Astria MontebelloDLX45TEP Specifications

INSTALLATION INSTRUCTIONS
Montebello DLX 40 and 45 in.
Direct Vent Gas Fireplaces
Intertek Report No.
100513650
P/N 506023-22 Rev. NC 12/2013
This manual is one of a set of two supporting this product.
Refer to P/N 506025-14 for Care and Operation Instructions.
Ce manuel est disponible en francais, simplement
en faire la demande. Numéro de la pièce 506023-23.
INSTALLER: Leave this manual with the appliance.
CONSUMER: Retain this manual for future reference.
INSTALLATEUR : Laissez cette notice avec l'appareil.
CONSOMMATEUR : Conservez cette notice pour
consultation ultérieure.
MODELS
MontebelloDLX40TEN
MontebelloDLX40TEP
MontebelloDLXCD40TEN
MontebelloDLXCD40TEP
MontebelloDLX45TEN
MontebelloDLX45TEP
MontebelloDLXCD45TEN
MontebelloDLXCD45TEP
Decorative Product: Not for use as a heating appliance.
NOTICE: Fireplace is not to be operated by a thermostat.
This appliance may be installed in an aftermarket permanently located, manufactured home (USA only) or mobile
home, where not prohibited by local codes. This appliance is only for use with the type of gas indicated on the rating
plate. This appliance is not convertible for use with other gases unless a certified kit is used.
WARNING / AVERTISSEMENT/ AVISO
HOT GLASS WILL
CAUSE BURNS.
DO NOT TOUCH GLASS
UNTIL COOLED
NEVER ALLOW CHILDREN
TO TOUCH GLASS.
UNE SURFACE VITRÉE CHAUDE
PEUT CAUSER DES BRÛLURES.
LAISSER REFROIDIR LA SURFACE
VITRÉE AVANT D'Y TOUCHER.
NE PERMETTEZ JAMAIS À UN ENFANT
DE TOUCHER LA SURFACE VITRÉE.
WARNING: If the information in these instructions
is not followed exactly, a fire or explosion may
result, causing property damage, personal injury,
or death.
- Do not store or use gasoline or other flammable
vapors and liquids in the vicinity of this or any other
appliance.
- WHAT TO DO IF YOU SMELL GAS:
s$ONOTTry to light any appliance.
s$ONOTTOUCHANYELECTRICALSWITCHDONOTUSEANY
phone in your building.
s)MMEDIATELYCALLYOURGASSUPPLIERFROMA
neighbor’s phone. Follow the gas supplier’s
instructions.
s)FYOUCANNOTREACHYOURGASSUPPLIERCALLTHEFIRE
department.
- Installation and service must be performed by a
qualified installer, service agency or the gas supplier.
EL VIDRIO CALIENTE
CAUSARÁ QUEMADURAS.
USTED DEBE NUNCA
TOCAR EL VIDRIO CALIENTE.
LOS NIÑOS DEBEN NUNCA
TOCAR EL VIDRIO.
AVERTISSEMENT : Assurez-vous de bien suivre les
instructions données dans cette notice pour réduire au
minimum le risque d’incindie ou d’explosion ou pour
éviter tout dommage matériel, toute blessure ou la mort.
- Ne pas entreposer ni utilizer d’essence ni d’autres vapeurs
ou liquides inflammables dans le voisinage de cet appareil
ou de tout autre appareil.
- QUE FAIRE SI VOUS SENTEZ UNE ODEUR DE GAZ :
s.EPASTENTERDALLUMERDAPPAREIL
s.ETOUCHEZÜAUCANINTERRUPTEUr. Ne pas vous servir des
téléphones se trouvant dans le bâtiment où vous trouvez.
s!PPELEZIMM£DIATEMENTVOTREFOURNISSEURDEGAZDEPUIS
un voisin. Suivez les instructions du fournisseur.
s3IVOUSNEPOUVEZREJOINDRELEFOURNISSEURDEGAZ
appelez le service des incindies.
- L’installation et l’entretien doivent être assurés par un
installateur ou un service d’entretien qualifié ou par le
fournisseur de gaz.
)../6!4)6%(%!24(02/$5#43s$)2%#46%.4'!3&)2%0,!#%3-ONTEBELLO$,8-ONTEBELLO$,8#$s).34!,,!4)/.).3425#4)/.3
TABLE OF CONTENTS
0ACKAGING . . . . . . . . . . . . . . . . . . . . . . . . . 2
Introduction . . . . . . . . . . . . . . . . . . . . . . . . 2
'ENERAL)NFORMATION . . . . . . . . . . . . . . . . . . -ASSACHUSETTS2EQUIREMENTS . . . . . . . . . . 4
Cold Climate Insulation . . . . . . . . . . . . . . . 5
-ANUFACTURED(OME2EQUIREMENTS . . . . . . 5
,OCATION. . . . . . . . . . . . . . . . . . . . . . . . . . . 5
Vent Termination Clearances . . . . . . . . . . . 6
-INIMUM#LEARANCESTO#OMBUSTIBLES . . . . . Detailed Installation Steps . . . . . . . . . . . . . 4YPICAL)NSTALLATION3EQUENCE . . . . . . . . . . 3TEP &RAMING . . . . . . . . . . . . . . . . . . . . &IREPLACEAND&RAMING3PECIlCATIONS . . . . . . 10
3TEP 2OUTING'AS,INE . . . . . . . . . . . . . 11
0ROPER3IZINGOF'AS,INE. . . . . . . . . . . . . . 11
3TEP )NSTALLTHE6ENT3YSTEM . . . . . . . . 12
Vertical Termination Systems . . . . . . . . . . .
6ENT3ECTION,ENGTH#HART . . . . . . . . . . . . .
6ERTICAL6ENT4ABLESAND&IGURES. . . . . . . . . 16
Horizontal Termination System . . . . . . . . .
(ORIZONTAL6ENT4ABLESAND&IGURES . . . . . .
3TEP &IELD7IRING . . . . . . . . . . . . . . . . . 21
3TEP 2EMOVING'LASS$OOR
&RAME!SSEMBLY . . . . . . . . . . . . . . . . . .
3TEP #ONNECTING'AS,INE . . . . . . . . . .
3TEP #HECKING!PPLIANCE
Operation . . . . . . . . . . . . . . . . . . . . . . . .
3TEP )NSTALLING,OGSAND0ANELS . . . . . . 24
3TEP )NSTALLING'LASS$OOR . . . . . . . . . . 26
3TEP "URNER!DJUSTMENTS . . . . . . . . . . . 26
&INISHING2EQUIREMENTS . . . . . . . . . . . . . . .
Step 11. Attaching Safety-in/PERATION7ARNINGS . . . . . . . . . . . . . . . .
Installation Accessories . . . . . . . . . . . . . . .
'AS#ONVERSION+ITS . . . . . . . . . . . . . . . . . .
Please read and understand these
instructions before beginning your
installation.
2
PACKAGING
INTRODUCTION
4HEASSEMBLEDlREPLACEISPACKAGEDWITHTHE
following:
The Signature Series direct-vent, sealedCOMBUSTIONGASlREPLACESOPERATEONNATURAL
or propane gas. These appliances feature a
remotely controlled electronic intermittent pilot
IGNITIONSYSTEMMANUALADJUSTMENTOFTHEGAS
VALVESETTINGSISNOTPOSSIBLE
s Literature Kit PLASTIC BAG SHIPPED INSIDE
lREBOX CONTAINING Care and Operation
Instructions, Installation Instructions THIS
MANUAL 3AFETYIN/PERATION 7ARNING ,ABELSAND7ARRANTY
s /NEBAGGlowing Embers
s /NEBAGPlatinum Embers
s /NEBAGVolcanic Stone
s Pull Screen Kit
s Remote Control and Wall Receiver
Switch Kit
s Door Modesty Shield
s Log Grate
NOTE: For use with fireplace as shipped from factory only. Not for use with Contemporary Burner/
Floor Kit.
REQUIRED ACCESSORIES
One of the following Firebox Liner Kits:
a. Ceramic Firebox Liner Kit–
Buff Rustic
B Ceramic Firebox Liner Kit–
Red Rustic
c. Porcelain Firebox Liner Kit–
Black
d. Ceramic Firebox Liner Kit–
Red Herringbone
e. Ceramic Firebox Liner Kit–
Buff Herringbone
NOTE: Porcelain kits include side and back panels.
Optional for use with log sets. Required when
using the contemporary burner/floor kit.
4HE3IGNATURE3ERIESISADECORATIVElREPLACE
ANDMAYNOTBEINSTALLEDANDOPERATEDASTHE
primary heat source in a dwelling.
%LECTRICALPOWER120 VACLINEVOLTAGEISRECOMMENDEDTOOPERATETHElREPLACEHOWEVER
FOUR!!BATTERIESCANBEUSEDFORFULLTIME
OPERATION OR AS A BACKUP IN CASE OF A POWER
outage.
Approved Vent Components
4HESE lREPLACES ARE DESIGNED TESTED AND
listed for operation and installation with Secure
Vent®DIRECTVENTSYSTEMCOMPONENTSINNER
OUTERMANUFACTUREDBY3ECURITY#HIMNEYS
International.
These approved vent system components
ARE LABELED FOR IDENTIlCATION USE ONLY APPROVED VENT COMPONENTS. Do NOT use
any other manufacturer’s vent components
with these appliances.
Codes and Standards
These appliances comply with National Safety
3TANDARDSANDARETESTEDANDLISTEDBY)NTERTEK
2EPORT.OTO:IN#ANADA
#3! AND #!.#'!- IN BOTH
53!AND#ANADAASVENTEDGASlREPLACES
These appliances are listed by Intertek for
installation in bedrooms and mobile homes.
Installation must conform to local codes. In
THEABSENCEOFLOCALCODESINSTALLATIONMUST
COMPLY WITH THE CURRENT .ATIONAL &UEL 'AS
#ODE !.3) : IN #ANADA THE CURRENT
#!.#'!"INSTALLATIONCODE
4HEAPPLIANCEWHENINSTALLEDMUSTBEELECTRIcally grounded in accordance with local codes
OR IN THE ABSENCE OF LOCAL CODES WITH THE
.ATIONAL%LECTRICAL#ODE!.3).&0!LATEST
EDITIONORTHE#ANADIAN%LECTRICAL#ODE#3!
#LATESTEDITION
)../6!4)6%(%!24(02/$5#43s$)2%#46%.4'!3&)2%0,!#%3-ONTEBELLO$,8-ONTEBELLO$,8#$s).34!,,!4)/.).3425#4)/.3
GENERAL INFORMATION
WARNING
Young children should be carefully supervised when they are
in the same room as the appliance. Toddlers, young children
and others may be susceptible
to accidental contact burns. A
physical barrier is recommended
if there are at risk individuals in
the house. To restrict access to
a fireplace or stove, install an
adjustable safety gate to keep
toddlers, young children and
other at risk individuals out of
the room and away from hot
surfaces.
AVERTISSEMENT
Les jeunes enfants devraient être
surveillés étroitement lorsqu’ils
se trouvent dans la même pièce
que l’appareil. Les tout petits,
les jeunes enfants ou les adultes
peuvent subir des brûlures s’ils
viennent en contact avec la surface chaude. Il est recommandé
d’installer une barrière physique
si des personnes à risques habitent la maison. Pour empêcher
l’accès à un foyer ou à un poêle,
installez une barrière de sécurité; cette mesure empêchera les
tout petits, les jeunes enfants et
toute autre personne à risque
d’avoir accès à la pièce et aux
surfaces chaudes.
Children and adults should be alerted to the
hazards of high surface temperature and
should stay away to avoid burns or clothing
ignition.
Les enfants et les adultes devraient être
infor-més des dangers que posent les
températures de surface élevées et se
tenir à distance afin d’éviter des brûlures
ou que leurs vêtements ne s’enflamment.
DO NOT ATTEMPT TO ALTER OR MODIFY
THE CONSTRUCTION OF THE APPLIANCE OR
ITS COMPONENTS. ANY MODIFICATION OR
ALTERATION MAY VOID THE WARRANTY,
CERTIFICATION AND LISTINGS OF THIS UNIT.
WARNING
Improper installation, adjustment, alteration, service or
maintenance can cause injury
or property damage. Refer to
this manual. For assistance or
additional information consult
a qualified installer, service
agency or the gas supplier.
WARNING
Failure to comply with these
installation instructions will result
in an improperly installed and
operating appliance, voiding its
warranty. Any change to this appliance and/or its operating controls
is dangerous.
WARNING
Clothing or other flammable
material should not be placed
on or near the appliance.
AVERTISSEMENT
On ne devrait pas placer de
vêtements ni d’autres matières
inflammables sur l’appareil ni à
proximité.
WARNING
Any safety screen or guard
removed for servicing the appliance must be replaced prior to
operating the appliance.
AVERTISSEMENT
Tout écran ou protecteur retiré
pour permettre l’entretien de
l’appareil doit être remis en
place avant de mettre l’appareil
en marche.
WARNING
Improper installation or use of
this appliance can cause serious
injury or death from fire, burns,
explosion or carbon monoxide
poisoning.
Installation and repair should be done by
a qualified service person. The appliance
should be inspected before use and at least
annually by a professional service person.
More frequent cleaning may be required due
to excessive lint from carpeting, bedding material, etcetera. It is imperative that control
compartments, burners and circulating air
passageways of the appliance be kept clean.
L’installation et la réparation devrait
être confiées à un technicien qualifié.
L’appareil devrait faire l’objet d’une inspection par un technicien professionnel
avant d’être utilisé et au moins une fois
l’an par la suite. Des nettoyages plus
fréquents peuvent être nécessaires si les
tapis, la literie, et cetera produisent une
quantité importante de pous-sière. Il est
essentiel que les compartiments abritant
les commandes, les brûleurs et les conduits de circulation d’air de l’appareil
soient tenus propres.
Do not use this appliance if any part has
been under water. Immediately call a
qualified service technician to inspect the
appliance and to replace any parts of the
control system and any gas control which
have been under water.
Ne pas se servir de cet appareil s'il a été
plongé dans l'eau, complètement ou en
partie. Appeler un technicien qualifié
pour inspecter l'appareil et remplacer
toute partie du système de contrôle et
toute commande qui ont été plongés
dans l'eau.
Only trim kit(s) supplied by the manufacturer
shall be used in the installation of this appliance.
Seules les trousses de garniture fournies
par le fabricant doivent être utilisées pour
l’installation de cet appareil.
0ROVIDEADEQUATECLEARANCESAROUNDAIROPENINGSANDADEQUATEACCESSIBILITYCLEARANCEFOR
SERVICEANDPROPEROPERATION.EVEROBSTRUCT
the front openings of the appliance.
These appliances are designed to operate on
natural or propane gas only. The use of other
fuels or combination of fuels will degrade
the performance of this system and may be
dangerous.
4HESEAPPLIANCESMUSTNOTBECONNECTEDTOA
chimney or flue serving a separate solid fuel
BURNINGAPPLIANCE
3
)../6!4)6%(%!24(02/$5#43s$)2%#46%.4'!3&)2%0,!#%3-ONTEBELLO$,8-ONTEBELLO$,8#$s).34!,,!4)/.).3425#4)/.3
These electronic appliances are remotely
controlled and feature an electronic intermittent pilot ignition system or standing pilot.
%XTERNALELECTRICALPOWERISREQUIREDTOOPERATE
these units.
These electronic models come standard with a
REMOTELYMODULATEDGASVALVEmAMEAPPEARANCEANDHEATOUTPUTCANNOTBECONTROLLEDAT
THEGASVALVE4HE"45)NPUTFORTHESEAPPLIances is shown in Table 1.
Input (BTU/HR)
Model
Input (BTU/Hr)
Natural Gas
40 in.
45 in.
32,000 to 50,000
38,500 to 60,000
Propane Gas
40 in.
45 in.
32,000 to 50,000
38,500 to 60,000
Table 1
Gas Pressure—All Models
Appliance inlet and manifold gas pressure
REQUIREMENTSARELISTEDINTables 2 and 3.
Inlet Gas Supply Pressure
Minimum
Maximum
5.5"
WC
10.5" WC
Natural
(1.37 kPa)
(2.61 kPa)
Gas
Fuel #
Propane
11.0" WC
(2.74 kPa)
13.0" WC
(3.23 kPa)
Table 2
Manifold Gas Supply Pressure
Fuel #
Low
High
Natural
1.6" WC
3.5" WC
Gas
(.4 kPa)
(.87 kPa)
6.3" WC
10.0" WC
Propane
(1.57 kPa)
(2.49 kPa)
Table 3
Orifice Sizes—Sea Level To High Altitude
(All Models)
These appliances are tested and approved
for installation at elevations of 0–4500 feet
n METERS ABOVE SEA LEVEL USING THE
STANDARDBURNERORIlCESIZESMARKEDWITHAN
ASTERISK
INTable 4)&ORELEVATIONSABOVE
FEETCONTACTYOURGASSUPPLIERORQUALIlED
service technician.
Deration—At higher elevations, the amount
OF"45FUELVALUEDELIVEREDMUSTBEREDUCED
BYEITHER
s USINGGASTHATHASBEENDERATEDBYTHEGAS
COMPANYOR
s CHANGINGTHEBURNERORIlCETOASMALLERSIZE
ASREGULATEDBYTHELOCALAUTHORITIESHAVING
JURISDICTIONANDBYTHE53!.ATIONAL&UEL
'AS #ODE .&0! !.3) :ˆLATEST
EDITIONORIN#ANADATHE#!.#'!"
CODESˆLATESTEDITION
Install the appliance according to the regulations
OFTHELOCALAUTHORITIESHAVINGJURISDICTIONAND
INTHE53!THE.ATIONAL&UEL'AS#ODE.&0!
!.3):ˆLATESTEDITIONORIN#ANADA
THE#!.#'!"LATESTEDITION
NOTE: Flame appearance will diminish 4% per
thousand feet of altitude.
Burner Orifice Sizes
Elevation 0–4500 ft ( 0–1372 m)
Model
Nat.Gas
drill size (inches)
40 in.
0.1405" (#28)*
0.086" (#44)*
45 in.
0.154" (#23)*
0.093" (#42)*
s(
s(
Table 4
The appliance and its appliance main gas
VALVE MUST BE DISCONNECTED FROM THE GAS
supply piping system during any pressure
testing of that system at test pressures in
excess ofPSIK0A
4HEAPPLIANCEMUSTBEISOLATEDFROMTHEGAS
SUPPLYPIPINGSYSTEMBYCLOSINGITSEQUIPMENT
shutoff valve during any pressure testing of
the gas supply piping system at test pressures
equal to or less thanPSIK0A
4
s(
s(
* Standard size installed at factory
s0ART#AT.UMBER
Gas Valve Diagram
The SIT Proflame gas valve is shown in Figure
1.
Test gauge connections are provided on the
FRONTOFTHEGASCONTROLVALVEIDENTIlED).FOR
THEINLETAND/54FORTHEMANIFOLDSIDE
0ROPANETANKSAREATPRESSURESTHATWILLCAUSE
damage to valve components. Verify that the
TANKSHAVESTEPDOWNREGULATORSTOREDUCETHE
pressure to safe levels.
Propane
drill size (inches)
Green Wire
(From DFC Wire
Harness)
Manifold (Out)
Test Port
Inlet (In) Test Port
Wire
(From DFC Wire
Harness)
Main Gas Inlet
3/8" NPT
Figure 1—SIT Proflame Valve
./4%$)!'2!-3),,5342!4)/.3!2%./44/3#!,%
REQUIREMENTS FOR THE COMMONWEALTH OF MASSACHUSETTS
4HESElREPLACESAREAPPROVEDFORINSTALLATIONIN
THE53STATEOF-ASSACHUSETTSIFTHEFOLLOWING
ADDITIONALREQUIREMENTSAREMET
s )NSTALL THIS APPLIANCE IN ACCORDANCE WITH
-ASSACHUSETTS2ULESAND2EGULATIONS
#-2
s )NSTALLATIONANDREPAIRMUSTBEDONEBYA
PLUMBERORGASlTTERLICENSEDINTHE#OMMONWEALTHOF-ASSACHUSETTS
s 4HE mEXIBLE GAS LINE CONNECTOR USED SHALL
NOT EXCEED INCHES CENTIMETERS IN
length.
s 4HE INDIVIDUAL MANUAL SHUTOFF MUST BE A
T-handle type valve.
Massachusetts Horizontal Vent Requirements
In the Commonwealth of Massachusetts, horizontal terminations installed less than seven
(7) feet above the finished grade must comply
with the following additional requirements:
s ! HARD WIRED CARBON MONOXIDE DETECTOR
WITHANALARMANDBATTERYBACKUPMUSTBE
installed on the floor level where the gas
lREPLACEISINSTALLED4HECARBONMONOXIDE
DETECTOR MUST COMPLY WITH .&0! BE
!.3)5,LISTEDANDBE)3!CERTIlED
s !METALORPLASTICIDENTIlCATIONPLATEMUST
BEPERMANENTLYMOUNTEDTOTHEEXTERIOROF
THEBUILDINGATAMINIMUMHEIGHTOFEIGHT
FEETABOVEGRADEANDBEDIRECTLYINLINEWITH
the horizontal termination. The sign must
READINPRINTSIZENOLESSTHANONEHALF
INCHINSIZE'!36%.4$)2%#4,9"%,/7
+%%0#,%!2/&!,,/"3425#4)/.3
Connect GTMS
Wire Harness
Pressure
Regulator
Tower
Yellow Ground Wire
(From DFC Wire
Harness)
)../6!4)6%(%!24(02/$5#43s$)2%#46%.4'!3&)2%0,!#%3-ONTEBELLO$,8-ONTEBELLO$,8#$s).34!,,!4)/.).3425#4)/.3
Cet appareil peut être installé cómme
du matéri-el d'origine dans une maison
PR£FABRIQU£E »5 SEULEMENT OU MOBILE
et doit être installé selon les instructions
DUFABRICANTETCONFORM£MENTÜLANORME
-ANUFACTURED (OME #ONSTRUCTIONS AND
3AFETY 4ITLE #&2 0ART AUX 5NIS
OU Ü LA NORME #AN#3!: 3£RIE --
-AISONSMOBILESAU#ANADA
This appliance is only for use with the type of
gas indicated on the rating plate. This appliance
ISNOTCONVERTIBLEFORUSEWITHOTHERGASESUNLESSACERTIlEDKITISUSED
#ET APPAREIL DOIT äTRE UTILIS£ UNIQUEMENT
AVEC LE TYPE DE GAZ INDIQU£ SUR LA PLAQUE
SIGNAL£TIQUE#ETAPPAREILNEPEUTäTRECONVERTIÜDgAUTRESGAZSAUFSIUNETROUSSEDE
conversion est utilisée.
CAUTION: Ensure that the cross members
are not cut or weakened during installation. The structural integrity of the manufactured home floor, wall, and ceiling / roof
must be maintained.
Flat on Wall
Application
Island
Application
FLAT
APPLICATION
Top Of Fireplace
Opening
HORIZONTA
Non-Combustible
When the unit is installed with one side flush with
a wall,
the DIVIDER
wall on the other side of the unit must
ROOM
APPLICATION
not extend
beyond the front edge of the unit.
RECESSED
Figure 2—Typical
Installation
APPLICATION
HORIZONTAL VENT
VERTICAL VENT
FLAT ON WALL
APPLICATION
4HISAPPLIANCEMAYBEINSTALLEDINANAFTERMARKET
permanently located, manufactured home and
MUSTBEINSTALLEDINACCORDANCEWITHTHEMANUFACTURERgS INSTRUCTIONS AND THE -ANUFACTURED
Home Construction and Safety Standard, Title
#&20ARTINTHE5NITED3TATESORTHE
3TANDARDFOR)NSTALLATIONIN-OBILE(OMES#!.
#3!:-(3ERIESIN#ANADA
Recessed
Application
Drywall
ISLAND
APPLICATION
MANUFACTURED HOME REQUIREMENTS
Room Divider
Application
CR
AP OS
PL S C
IC OR
AT N
IO ER
N
)FTHElREPLACEISBEINGINSTALLEDONACEMENT
SLAB IN COLD CLIMATES A SHEET OF PLYWOOD OR
OTHERRAISEDPLATFORMCANBEPLACEDUNDERNEATH
TO PREVENT COLD TRANSFER TO THE lREPLACE AND
INTOTHEROOM)TALSOHELPSTOSHEETROCKINSIDE
SURFACESANDTAPEFORMAXIMUMAIRTIGHTNESS
ANDCAULKlRESTOPS
Cr
Ap oss
pl Co
ic rn
at e
io r
n
&OR COLD CLIMATE INSTALLATIONS SEAL ALL CRACKS
AROUND YOUR APPLIANCE WITH NONCOMBUSTIBLE
material and wherever cold air could enter
the room. It is especially important to insulate
OUTSIDECHASECAVITYBETWEENSTUDSANDUNDER
mOORONWHICHAPPLIANCERESTSIFmOORISABOVE
GROUNDLEVEL'ASLINEHOLESANDOTHEROPENINGS
SHOULD BE CAULKED OR STUFFED WITH UNFACED
lBERGLASSINSULATION
Flat
Application
COLD CLIMATE INSULATION
LOCATION
In selecting the location, the aesthetic and
functional use of the appliance are primary
concerns. However, vent system routing to
THEEXTERIORANDACCESSTOTHEFUELSUPPLYARE
also important.
Due to high temperatures, the appliance
should be located out of traffic and away from
furniture and draperies (Figure 2).
En raison des températures élevées,
l’appareil devrait être installé dans un
endroit où il y a peu de circulation et loin
du mobilier et des tentures (Figure 2).
4HELOCATIONSHOULDALSOBEFREEOFELECTRICAL
PLUMBING OR OTHER HEATINGAIR CONDITIONING
ducting.
4HESE DIRECTVENT APPLIANCES ARE UNIQUELY
SUITEDFORINSTALLATIONSREQUIRINGAUTILITYSHELF
POSITIONEDDIRECTLYABOVETHElREPLACE5TILITY
SHELVES LIKE THESE ARE COMMONLY USED FOR
locating television sets and decorative plants.
Be aware that this is a heat producing appliance. Objects placed above the unit are
exposed to elevated temperatures.
Do not insulate the space between the
appliance and the area above itsee Figure
7 on Page 8).
4HE MINIMUM HEIGHT FROM THE BASE OF THE
APPLIANCE TO THE UNDERSIDE OF COMBUSTIBLE
materials used to construct a utility shelf in
this fashion is shown in Figure 7 on Page 8.
4HE APPLIANCE MUST BE MOUNTED ON A FULLY
SUPPORTED BASE EXTENDING THE FULL WIDTH
ANDDEPTHOFTHEUNIT4HEAPPLIANCEMAYBE
located on or near conventional construction
MATERIALS(OWEVERIFINSTALLEDONCOMBUSTIBLE
materials, such as carpeting, vinyl tile, or other
COMBUSTIBLEMATERIALOTHERTHANWOODmOORING
THEAPPLIANCESHALLBEINSTALLEDONAMETALOR
WOODPANELEXTENDINGTHEFULLWIDTHANDDEPTH
of the appliance.
CAUTION: This appliance must be grounded to the chassis of the manufactured
home in accordance with local codes or
in the absence of local codes, with the
National Electrical Code ANSI / NFPA 70—
latest edition or the Canadian Electrical
Code CSA C22.1—latest edition.
5
./4%$)!'2!-3),,5342!4)/.3!2%./44/3#!,%
)../6!4)6%(%!24(02/$5#43s$)2%#46%.4'!3&)2%0,!#%3-ONTEBELLO$,8-ONTEBELLO$,8#$s).34!,,!4)/.).3425#4)/.3
VENT TERMINATION CLEARANCES
These instructions should be used as a
guideline and do not supersede local codes
in any way. Install vent according to local
codes, these instructions, the current National
Fuel Gas Code (ANSI-Z223.1) in the USA or
the current standards of CAN/CGA-B149.1 in
Canada.
Vertical Vent Termination Clearances
Terminate multiple vent terminations according
TOTHEINSTALLATIONCODESLISTEDABOVE!LSOSEE
Figure 3.
Vertical Vent Termination Clearances
TERMINATION HEIGHTS FOR VENTS ABOVE
FLAT OR SLOPED ROOFS
Horizontal Overhang
2 FT
MIN.
2 FT MIN.
Lowest
Discharge
Opening
Vent
Termination
H*
Storm Collar
X
12
Flashing
Roof Pitch is X/12
4ERMINATESINGLEVENTCAPSRELATIVETOBUILDING
components according to Figures 3 and 4.
1” (25.4 mm) Minimum
Clearance to Combustibles
Concentric
Vent Pipe
12”
(305mm)
Minimum
Vertical
Wall
*H = MINIMUM HEIGHT FROM ROOF TO
LOWEST DISCHARGE OPENING OF VENT
4HEVENTAIRINTAKETERMINATIONCLEARANCES
ABOVETHEHIGHSIDEOFANANGLEDROOFISAS
shown in the following chart:
Termination Heights For Vents
Above Flat Or Sloped Roofs
Ref. NFPA 54 / ANSI Z223.1
Roof Pitch
* Feet
* Meters
&LATTO
1.0
TO
1.25
TO
1.5
0.46
TO
2.0
0.61
TO
2.5
10/12 to 11/12
11/12 to 12/12
4.0
1.22
12/12 to 14/12
5.0
1.52
14/12 to 16/12
6.0
TO
TO
20/12 to 21/12
2.44
Figure 4
Horizontal Vent Termination Clearances
Figure 3—Multiple Terminations
4HEHORIZONTALVENTTERMINATIONMUSTHAVEAMINIMUMOFMMCLEARANCETOANYOVERHEAD
COMBUSTIBLEPROJECTIONOFMMORLESSSEEFigure 5). &ORPROJECTIONSEXCEEDING
MMSEEFigure 5&ORADDITIONALVENTLOCATIONRESTRICTIONSREFERTOFigure 6 on Page 7.
Horizontal Vent Termination Clearances
Combustible Projection
2-1/2” or less in length
Combustible Projection
greater than 2-1/2” in length
Ventilated Or
Unventilated Soffit
3"
(76 mm)
24"
(610 mm)
Termination Kit
Figure 5—Side Elevation View
6
./4%$)!'2!-3),,5342!4)/.3!2%./44/3#!,%
See Figure 28 on Page 18 for the recess allowances, into
exterior walls, of the square horizontal terminations.
)../6!4)6%(%!24(02/$5#43s$)2%#46%.4'!3&)2%0,!#%3-ONTEBELLO$,8-ONTEBELLO$,8#$s).34!,,!4)/.).3425#4)/.3
NOTE: Local Codes Or Regulations May Require
Different Clearances.
* See Item D in the Text Below.
Center Line
Exterior Wall
of Termination
Inside
Corner Detail
*18”
24"
Horizontal
Termination
NOTE: Location Of The Vent Termination Must Not
Interfere With Access To The Electrical Service.
G
18”
36"
V
Ventilated Soffit
A
Inside Corner
= 9" in U.S.
!
A =12" in Canada
DETAIL D
H
3 ft.
B
L
V
C
V
F
V
C
C
!
A
Operable
Window
V
C
V
B
Fixed
Closed
Window
X
D
A
!
V
3 ft.
J
B
M
B
B
X
V
I
A
X = Air Supply Inlet
E
V = Vent Terminal
K
= Area where Terminal is NOT permitted
Minimum Clearances
Canadian Installation *
US Installation **
! #LEARANCE ABOVE GRADE VERANDA PORCH DECK CM
ORBALCONY
CM
"#LEARANCETOWINDOWORDOORTHATMAYBEOPENED
CMFORAPPLIANCES"45HRK7
CM FOR APPLIANCES "45HR K7 AND
"45HRK7CMFORAPPLIANCES
"45HRK7
CMFORAPPLIANCES"45HRK7
CMFORAPPLIANCES"45HRK7AND
"45HRK7CMFORAPPLIANCES
"45HRK7
C = Clearance to permanently closed window
MMRECOMMENDEDTOPREVENTWINDOWCONDENsation
MM RECOMMENDED TO PREVENT WINDOW CONdensation
$6ERTICAL CLEARANCE TO VENTILATED SOFlT LOCATED CM
ABOVETHETERMINALWITHINAHORIZONTALDISTANCEOF
CMFROMTHECENTERLINEOFTHETERMINAL
CM
%#LEARANCETOUNVENTILATEDSOFlT
CM
CM
&#LEARANCETOOUTSIDECORNER
CM
CM
'#LEARANCETOINSIDECORNER
CM
CM
(#LEARANCETOEACHINSIDEOFCENTERLINEEXTENDED FEETCMWITHINAHEIGHTOFFEETABOVETHEMETER FEETCMWITHINAHEIGHTOFFEETABOVETHEMETER
ABOVEMETERREGULATORASSEMBLY
REGULATORASSEMBLY
REGULATORASSEMBLY
I = Clearance to service regulator vent outlet
FEETCM
FEETCM
J = Clearance to non-mechanical air supply inlet CMFORAPPLIANCES"45HRK7 CMFORAPPLIANCES"45HRK7
TOBUILDINGORTHECOMBUSTIONAIRINLETTOANYOTHER CMFORAPPLIANCES"45HRK7AND CMFORAPPLIANCES"45HRK7AND
appliance
"45HRK7CMFORAPPLIANCES"45 "45HR K7 CM FOR APPLIANCES HRK7
"45HRK7
+#LEARANCETOMECHANICALAIRSUPPLYINLET
FEETMETERS
FEETCMABOVEIFWITHINFEETMHORIZONTALLY
, #LEARANCE ABOVE PAVED SIDEWALK OR PAVED FEETMp
DRIVEWAYLOCATEDONPUBLICPROPERTY
FEETMp
- #LEARANCE UNDER VERANDA PORCH DECK OR CM
p
BALCONY
CM
p
)NACCORDANCEWITHTHECURRENT#!.#'!".ATIONAL'ASAND"0ROPANE)NSTALLATION#ODEˆ,ATEST%DITIONS
)NACCORDANCEWITHTHECURRENT!.3):.&0!.ATIONAL&UEL#ODESˆ,ATEST%DITION
p!VENTSHALLNOTTERMINATEDIRECTLYABOVEASIDEWALKORPAVEDDRIVEWAYWHICHISLOCATEDBETWEENTWOSINGLEFAMILYDWELLINGSANDSERVESBOTHDWELLINGS
p/NLYPERMITTEDIFVERANDAPORCHDECKORBALCONYISFULLYOPENONAMINIMUMSIDESBENEATHTHEmOOR
Figure 6—Exterior Horizontal Vent Termination Clearance Requirements
7
./4%$)!'2!-3),,5342!4)/.3!2%./44/3#!,%
)../6!4)6%(%!24(02/$5#43s$)2%#46%.4'!3&)2%0,!#%3-ONTEBELLO$,8-ONTEBELLO$,8#$s).34!,,!4)/.).3425#4)/.3
MINIMUM CLEARANCES TO COMBUSTIBLES
4HEAPPLIANCEISAPPROVEDWITHZEROCLEARANCETOCOMBUSTIBLEMATERIALS
ONALLSIDESASDETAILEDINTable 5)WITHTHEFOLLOWINGEXCEPTIONWhen
the unit is installed with one side flush with a wall, the wall on the
other side of the unit must not extend beyond the front edge of the
unit. In addition, when the unit is recessed, the side walls surrounding
THEUNITMUSTNOTEXTENDBEYONDTHEFRONTEDGEOFTHEUNITSEEFigure 2).
Combustible Shelf Height—Inches (millimeters)
Top Vent—with 2 Feet Vertical Vent and One 90 Degree Elbow
Model
Secure Vent®
40 in.
*84-1/16 (2135)
45 in.
*89-1/16 (2252)
* Includes 3" clearance to combustibles (required above vent components)
APPLIANCE MINIMUM CLEARANCES*
Inches (millimeters)
Sides
1/2 (13), 0 (0) Spacers **
Top Spacers
0 (0)
Floor
0 (0)
Back
1/2 (13), 0 (0) Spacers
Bottom of Appliance To Ceiling
69 (1743)
Vent
3 (76) Top* / 1 (25.4) Sides & Bottom
Do not insulate the
space between the
appliance and the
area above it.
2-1/2 ft
(to centerline)
Vertical
Vent (minimum)
Shelf Height
(see table)
SERVICE CLEARANCES Feet (meters)
Front
3 feet (0.9 meters)
Table 5
Figure 7
Shelf Above Fireplace With Top Venting
*NOTE: 3" (75 mm) above any horizontal/inclined vent component.
**NOTE: See Page 9, Step 1 for clearance requirements to the nailing
flange located at each side of the unit and any screw heads adjacent
to it. See Page 28 for hearth extension requirements.
12 (305) MANTEL
10 (254) MANTEL
8 (203) MANTEL
Shelf Height
4OPROVIDEFORTHELOWESTPOSSIBLESHELFSURFACETHEVENTINGATTACHEDTO
THETOPVENTSHOULDBEROUTEDINAWAYTOMINIMIZEOBSTRUCTIONSTOTHE
SPACEABOVETHEAPPLIANCEDo not insulate the space between the appliance and the area above itSEEFigure 7). The minimum height from
THEBASEOFTHEAPPLIANCETOTHEUNDERSIDEOFCOMBUSTIBLEMATERIALSUSED
to construct a utility shelf in this fashion is shown in Figure 7.
17
(432)
6 (152) MANTEL
15
(381)
13
(330)
4 (102) MANTEL
11
(279)
2 (51)
9
(229)
NOTE: Combustible wall finish materials and/or surround materials must
not be allowed to encroach the area defined by the appliance front face
(black sheet metal). Never allow combustible materials to be positioned
in front of or overlapping the appliance face. See Figure 9 and Figure
51 on Page 28.
Top of Appliance
Combustible Materials
Allowed In Shaded Area
"Safe Zone"
Fireplace
(side view)
Top View of
Fireplace
12 in.
(305 mm)
.ONCOMBUSTIBLEMATERIALSSUCHASSURROUNDSANDOTHERAPPLIANCETRIM
MAYBEINSTALLEDONTHEAPPLIANCEFRONTFACEWITHTHESEEXCEPTIONSTHEY
MUSTNOTCOVERANYPORTIONOFTHEREMOVABLEGLASSPANEL
6ERTICALINSTALLATIONCLEARANCESTOCOMBUSTIBLEMANTELSVARYACCORDING
to the depth of the mantel. See Figure 8-ANTELSCONSTRUCTEDOFNON
COMBUSTIBLEMATERIALSMAYBEINSTALLEDATANYHEIGHTABOVETHEAPPLIANCE
OPENING-INIMUMCLEARANCEREQUIREMENTSINCLUDEANYPROJECTIONSSUCH
ASSHELVESWINDOWSILLSMANTELSETCABOVETHEAPPLIANCE
MANTEL
7
(178)
Figure 8
Wall Finishes / Surrounds / Mantels
MANTEL
CLEARANCES
Inches (mm)
45°
5 in.
(127 mm)
17 in.
(432 mm)
8-1/4 in.
(210 mm)
NOTE: We recommend the use of high temperature paint (rated 175° F
or higher) on the underside of the mantel.
Side
Wall
Minimum Distance to
Protected Side Wall
Side
Wall
14 in.
(356 mm)
Figure 9
8
./4%$)!'2!-3),,5342!4)/.3!2%./44/3#!,%
Minimum Distance to
Unprotected Side Wall
)../6!4)6%(%!24(02/$5#43s$)2%#46%.4'!3&)2%0,!#%3-ONTEBELLO$,8-ONTEBELLO$,8#$s).34!,,!4)/.).3425#4)/.3
WARNING
Failure to position the parts in
accordance with these diagrams
or failure to use only parts specifically approved with this appliance
may result in property damage or
personal injury.
AVERTISSEMENT
Risque de dommages ou de
blessures si les pièces ne sont
pas installées conformément à
ces schémas et ou si des pièces
autres que celles spécifiquement
approuvées avec cet appareil sont
utilisées.
DETAILED INSTALLATION STEPS
The appliance is shipped with all gas
controls and components installed and prewired.
2EMOVETHESHIPPINGCARTONEXPOSINGTHE
front glass door on the valve access side.
2. Using a Phillips screwdriver, unfasten two
SCREWSLOCATEDATTHETOPOFTHEGLASS
FRAMEsee Figure 46 on page 26). Tilt the
top of the glass frame away from the unit.
,IFTITCAREFULLYOFFTHEBOTTOMDOORTRACK
and set the door aside, protecting it from
inadvertent damage.
TYPICAL INSTALLATION SEQUENCE
Step 1. FRAMING
4HETYPICALSEQUENCEOFINSTALLATIONISOUTLINED
BELOW(OWEVEREACHINSTALLATIONISUNIQUEAND
MAYRESULTINVARIATIONSTOTHESTEPSDESCRIBED
&RAMETHESEAPPLIANCESASILLUSTRATEDINFigure
11 on Page 10, UNLESSTHEAPPLIANCEISTOBE
installed in a corner. See Figure 12 on Page
11 for corner framing installations. All framing
details must allow for a minimum clearance to
COMBUSTIBLE FRAMING MEMBERS AS SHOWN IN
Table 5 on Page 8.
3EETHE0AGENUMBERSREFERENCESINTHEFOLLOWing steps for detailed procedures.
Step 1. (Page 9) Construct the appliance
framing. Position the appliance within
the framing and secure with nailing
BRACKETS
Step 2. (Page 11) Route gas supply line to the
right side.
Step 3. (Page 12) Install the vent system and
EXTERIORTERMINATION
Step 4. (Page 21) Connect 120 VAC electrical
power to the appliance receptacle.
Step 5. (Page 23) Remove glass door assemBLY
Step 6. (Page 23) -AKE CONNECTION TO GAS
supply.
)FTHEAPPLIANCEISTOBEELEVATEDABOVEmOOR
LEVEL A SOLID CONTINUOUS PLATFORM MUST BE
CONSTRUCTEDBELOWTHEAPPLIANCE
(EADERS MAY BE IN DIRECT CONTACT WITH THE
APPLIANCE TOP SPACERS BUT MUST NOT BE SUPPORTEDBYTHEMORNOTCHEDTOlTAROUNDTHEM
!LLCONSTRUCTIONABOVETHEAPPLIANCEMUSTBE
self-supporting, DO NOT use the appliance for
structural support.
4HE lREPLACE SHOULD BE SECURED TO THE SIDE
FRAMING MEMBERS USING THE UNITgS NAILING
mANGESˆONETOPANDBOTTOMONEACHSIDEOF
THElREPLACEFRONTSEEFigure 10). 5SEDNAILS
ORTHEIREQUIVALENT
Step 7. (Page 23) Verifying appliance operation.
Use Top Flange For
1/2” Thick Drywall
Step 8. (Page 24))NSTALLlREBOXLINERPANELS
LOGSANDGLOWINGEMBERS
Front Of
Fireplace
OR
Use Center Flange
For Flush Mount
CONTEMPORARYBURNERmOORKITPORCElain panels, and media.
Use Bottom Flange For
5/8” Thick Drywall
Step 9. (Page 26))NSTALLGLASSDOORASSEMBLY
Step 10. (Page 26) !DJUST BURNER TO ENSURE
proper flame appearance.
Step 11. (Page 29) Attach safety in operation
warnings.
Left
LeftSide
SideFront
FrontCorner
CornerofofFireplace
Fireplace Shown
Shown
(Right Side Requirements the Same)
(Right Side Requirements the Same)
Unit Being Secured By Its Nailing Flanges
Unit Being Secured
By Its Nailing Flanges
To The Framing
To The Framing
Note: The nailing flanges, combustible members
NOTE:
Theheads
nailinglocated
flanges,incombustible
members
and
adjacent
areas directly
screw
and
heads flanges,
located are
in areas
directly
the 1/2” to
fromadjacent
EXEMPT
the nailing
toscrew
the nailingtoflanges,
are EXEMPT
from thefor
1/2”
theclearrequirements
combustible
clearance
ance to
combustible
for the may
firebox
be
Combustible framing
wrapper. requirements
outer
firebox
wrapper.
framing
may be
direct
andinmay
flanges
inouter
with the nailing
contactCombustible
direct
contact
the nailing
flanges
mayheads
be located
and
screw
from and
than 1/2”
closer
locatedwith
be
to the nailing
in areas
firebox
the
closer
thanwrapper
1/2” from
screwadjacent
heads and
firebox
dimensions
opening totothe
the adjacent
flanges.
wrapperFrame
in areas
theexact
nailing
flanges.
this manual.
details
the framing
in opening
specified
Frame the
to the
exactofdimensions
specified in the framing details of this manual.
Unit Being Secured by Its Nailing
UnitFlanges
Being Secured
by Its Nailing
to the Framing
Flanges to the Framing
Figure 10
9
./4%$)!'2!-3),,5342!4)/.3!2%./44/3#!,%
)../6!4)6%(%!24(02/$5#43s$)2%#46%.4'!3&)2%0,!#%3-ONTEBELLO$,8-ONTEBELLO$,8#$s).34!,,!4)/.).3425#4)/.3
Framing Dimensions
Model
40 in.
45 in.
A
B
C
in.
50-3/4
43
75-1/8
mm
1289
1092
1908
in.
56-7/8
48
80-1/16
mm
1445
1219
2034
Framing should be constructed
of 2x4 or larger lumber.
VENT FRAMING
TOP VENT WITH 2 FEET
VERTICAL VENT AND
ONE 90° ELBOWVENT FRAMING
TOP VENT WITH 2 FEET
VERTICAL VENT AND
ONE 90° ELBOW
PIPE CENTERLINE
13
(330)
13
(330)
PIPE CENTERLINE
Propane
Model
P4
P4
40 in.
35.8
TBD
45 in.
51.2
TBD
8-1/2
(216)
6-1/2
(165)
Thermal Efficiency (%)
Natural Gas
Framing should be constructed
of 2x4 or larger lumber.
15
6-1/2
(165)
8-1/2)
(381
(216)
15
(381)
C
B
C
B
25-1/4
(641)
1/2 A
E
25-1/4
A
D
(641)
1/2 A
Inches (mm)
A
Inches (mm)
5-1/4”
(133)
14-1/8
(359)
8-1/2”
(216)
26-15/32
(672)
25-29/32
(658)
Top View
25-1/2
(648)
J
8-3/8
(213)
5-3/32 (129)
2-1/2 (64)
Gas Inlet
(This
Side
Only)
7
(178)
G
B
H
Diagrams, illustrations and photographs are not to scale — consult
installation instructions. Product
designs, materials, dimensions,
specifications, colors and prices are
subject to change or discontinuance
without notice.
Electrical
Inlet
19-5/8
(498)
A
Notes
C
Right Side View
F
Vent Size
Coaxial DV
Vent Size
Front View
8" Inner
11" Outer
Fireplace Dimensions
Model
40 in.
45 in.
A
B
C
D
E
F
G
H
J
in.
50-5/8
37-1/4
42-7/8
25-5/16
34
37-5/8
33-3/32
29-9/32
34-3/4
mm
1286
946
1089
643
864
956
840
744
883
in.
56-11/16
42-1/4
47-7/8
28-3/8
40-1/8
43-5/8
38-3/32
34-1/2
40-59/64
mm
1440
1073
1216
721
1019
1108
968
876
1039
Figure 11—Fireplace and Framing Specifications
10
./4%$)!'2!-3),,5342!4)/.3!2%./44/3#!,%
)../6!4)6%(%!24(02/$5#43s$)2%#46%.4'!3&)2%0,!#%3-ONTEBELLO$,8-ONTEBELLO$,8#$s).34!,,!4)/.).3425#4)/.3
Model
40 in.
45 in.
A
B
C
D
in.
50-5/8
83-5/8
59-1/8
41-7/8
mm
1286
2124
1502
1064
in.
56-3/4
89-7/8
63-1/2
44-7/8
mm
1441
2283
1613
1140
C
D
A
B
Back wall of chase/enclosure
(including any finishing materials)
Figure 12—Corner Framing with Square Termination (SV8HTS)
Step 2. ROUTING GAS LINE
2OUTEAMMGASLINEALONGTHEINSIDE
of the right side framing as shown in Figure
13'ASLINESMUSTBEROUTEDCONSTRUCTEDAND
made of materials that are in strict accordance
with local codes and regulations.
!LL APPLIANCES ARE FACTORYEQUIPPED WITH A
mEXIBLE GAS LINE CONNECTOR AND SHUTOFF
valve. (See Step 6 on Page 22).
4HEINCOMINGGASLINESHOULDBEPIPEDINTOTHE
valve compartment and connected in one of the
two methods as shown in Figure 36 on Page 23.
Right Side
Front Corner
Of Fireplace
Framing
Never use galvanized or plastic pipe. Refer to
Table 6 for proper sizing of the gas supply
LINEIFBLACKIRONPIPEISBEINGUSED'ASLINES
MUST BE ROUTED CONSTRUCTED AND MADE OF
materials that are in strict accordance with
LOCAL CODESANDREGULATIONS7ERECOMMEND
THATAQUALIlEDINDIVIDUALSUCHASAPLUMBER
ORGASlTTERBEHIREDTOCORRECTLYSIZEANDROUTE
the gas supply line to the appliance. Installing
a gas supply line from the fuel supply to the
appliance involves numerous considerations of
materials, protection, sizing, locations, controls,
pressure, sediment, and more. Certainly no one
UNFAMILIARANDUNQUALIlEDSHOULDATTEMPTSIZING
or installing gas piping.
Schedule 40—Black Iron Pipe
Inside Diameter (Inches)
19-5/8”
(498 mm)
6-1/4”
(159 mm)
Figure 13
Schedule 40 Pipe
Length (feet)
Natural
Gas
Propane
Gas
0–10
10–40
40–100
100–150
150–200
Table 6
Proper Sizing of Gas Line
NOTES:
s !LLAPPLIANCESAREFACTORYEQUIPPEDWITHA
mEXIBLEGASLINECONNECTORANDSHUTOFF
VALVESEEFigure 36 on Page 23).
s 3EEMassachusetts Requirements on Page
4FORADDITIONALREQUIREMENTSFORINSTALLATIONS
INTHESTATEOF-ASSACHUSETTSINTHE53!
s 4HEGASSUPPLYLINESHOULD.OTBECONNECTED
to the appliance until Step 6Page 23).
s !PIPEJOINTCOMPOUNDRATEDFORGASSHOULDBE
USEDONTHETHREADEDJOINTS Ensure propane
resistant compounds are used in propane
applications"EVERYCAREFULTHATTHEPIPE
compound does not get inside the pipe.
s )TISRECOMMENDEDTOINSTALLASEDIMENTTRAP
INTHESUPPLYLINEASCLOSEASPOSSIBLETOTHE
APPLIANCESEEFigure 36 on Page 23).
s #HECK WITH LOCAL BUILDING OFlCIAL FOR LOCAL
CODEREQUIREMENTS
IMPORTANT: If propane is used, be aware that
if tank size is too small (i.e. under 100 lbs, if
this is the only gas appliance in the dwelling.
Ref. NPFA 58), there may be loss of pressure,
resulting in insufficient fuel delivery (which
can result in sooting, severe delayed ignition
or other malfunctions). Any damage resulting
from an improper installation, such as this,
is not covered under the limited warranty.
Properly size and route the gas supply
line from the supply regulator to the area
WHERE THE APPLIANCE IS TO BE INSTALLED PER
REQUIREMENTSOUTLINEDINTHE.ATIONAL&UEL'AS
#ODE.&0!ˆLATESTEDITION53!OR#!.
#'!"ˆLATESTEDITION#ANADA
11
./4%$)!'2!-3),,5342!4)/.3!2%./44/3#!,%
)../6!4)6%(%!24(02/$5#43s$)2%#46%.4'!3&)2%0,!#%3-ONTEBELLO$,8-ONTEBELLO$,8#$s).34!,,!4)/.).3425#4)/.3
Step 3. INSTALL THE VENT SYSTEM
Installation of Vent Restrictor
Select Venting System—Horizontal or Vertical
General Information
! VENT RESTRICTOR MAY BE NEEDED WITH THIS
appliance. The restrictor is installed in the
appliance top flue outlet as shown in Figure 14,
7ITH THE APPLIANCE SECURED IN FRAMING DETERMINEVENTROUTINGANDIDENTIFYTHEEXTERIOR
termination location. The following sections
DESCRIBEVERTICALROOFANDHORIZONTALEXTERIOR
WALL VENT APPLICATIONS 2EFER TO THE SECTION
relating to your installation. A list of approved
venting components is shown on Page 30.
These instructions should be used as a guideline and do not supersede local codes in any
way. Install vent according to local codes,
these instructions, the current National Fuel
Gas Code (ANSI-Z223.1) in the USA or the
current standards of CAN/CGA-B149.1 and
-B149.2 in Canada.
Ensure clearances are in accordance with
local installation codes and the requirements
of the gas supplier.
Dégagement conforme aux codes
d'installation locaux et aux exigences du
foumisseunde gaz.
Use only approved venting components.
See Approved Vent Components on
Page 2.
For vertical venting from 6 feet to 12 feet or
more, from the top of the fireplace to the top
of the termination, the installation of a vent
restrictor is required.
If necessary, install a vent restrictor in the
appliance flue outlet as shown in Figure 14. The
VENTRESTRICTORISHELDINPLACEBYFRICTIONONLY
NOTE: The restrictor is included within the
firebox.
When vertically terminating the vent system above
the roof, install a vent restrictor in the top vent of
the fireplace outlet. Install the restrictor as shown
from inside the unit, in the inner fireplace collar
These fireplaces must be vented directly
to the outside.
The vent system may not service multiple
APPLIANCESANDMUSTNEVERBECONNECTEDTOA
mUESERVINGASEPARATESOLIDFUELBURNINGAPPLIANCE4HEVENTPIPEISTESTEDTOBERUNINSIDE
ANENCLOSINGWALLSUCHASACHASE4HEREIS
NOREQUIREMENTFORINSPECTIONOPENINGSINTHE
ENCLOSINGWALLATANYOFTHEJOINTSINTHEVENTPIPE
RESTRICTOR
APPLIANCE VENT OUTLET
Figure 14—Vent Restrictor Installation
12
./4%$)!'2!-3),,5342!4)/.3!2%./44/3#!,%
)../6!4)6%(%!24(02/$5#43s$)2%#46%.4'!3&)2%0,!#%3-ONTEBELLO$,8-ONTEBELLO$,8#$s).34!,,!4)/.).3425#4)/.3
VERTICAL TERMINATION SYSTEMS (ROOF)
See Figure 15 and Figures 23 through 25 on
Page 16 and their associated Vertical Vent
4ABLESWHICHILLUSTRATETHEVARIOUSVERTICALVENTING
CONlGURATIONSTHATAREPOSSIBLEFORUSEWITHTHESE
appliances. Secure Vent® pipe applications
ARE SHOWN IN THESE lGURES A Vertical Vent
4ABLESUMMARIZESEACHSYSTEMSMINIMUMAND
MAXIMUMVERTICALANDHORIZONTALLENGTHVALUES
THATCANBEUSEDTODESIGNANDINSTALLTHEVENT
components in a variety of applications.
The vertical vent system terminates through
THEROOF4HEMINIMUMVENTHEIGHTABOVETHE
ROOFANDORADJACENTWALLSISSPECIlEDIN!.3)
:ˆLATESTEDITION)N#ANADATHECURRENT
#!.#'!"INSTALLATIONCODEBYMAJOR
BUILDING CODES !LWAYS CONSULT YOUR LOCAL
CODES FOR SPECIlC REQUIREMENTS ! GENERAL
GUIDETOFOLLOWISTHE'AS6ENT2ULEREFERTO
Figure 4 on Page 6).
Vertical (Straight) Installation
(Figure 15)
$ETERMINETHENUMBEROFSTRAIGHTVENTSECTIONS
REQUIREDMMMM
MM MM AND
MM NET SECTION LENGTHS ARE
AVAILABLESEETables on this page and Page
30—Vent Sections0LANTHEVENTLENGTHSSO
THATAJOINTDOESNOTOCCURATTHEINTERSECTIONOF
CEILINGORROOFJOISTS2EFERTOTHE6ENT3ECTION
,ENGTH#HART
Termination
Flashing And
Storm Collar
1" (25 mm)
Minimum
Clearance to
Combustibles
Firestop/Spacer
Nominal
Section Length
6
12
24
36
48
(inches)
Net Section 4-1/2 10-1/2 22-1/2 34-1/2 46-1/2
Length (inches)
Height of Vent
Number of Vent Sections
T
O
T
A
L
T
O
T
A
L
Nominal Section 6
12
24
36
48
Length (inches)
Net Section
4
1
/
2
1
0
1
/
2
2
2
1
/
2
3
4
1
/
2
4
6
-1/2
Length (inches)
inches
144
12
1
0
0
0
3
Q
T
Y
4
15 0
12.5
0
1
0
0
3
4
inches
ft
4.5
0.375
1
0
0
0
0
Q
T
Y
1
9
0.75
2
0
0
0
0
2
10.5
0.875
0
1
0
0
0
1
15
1.25
1
1
0
0
2
19.5
1.625
2
1
0
0
0
0
3
21
1 . 75
0
2
0
0
0
2
Height of Vent
Number of Vent Sections
ft
154.5
12.875
1
1
0
0
3
5
160.5
13.375
0
2
0
0
3
5
172.5
14.375
0
0
0
5
0
5
17 7
14.75
1
0
0
5
0
6
22.5
1.875
0
0
1
0
0
1
25.5
2.125
1
2
0
0
0
3
18 3
15.25
0
1
0
5
0
6
31.5
2.625
0
3
0
0
0
3
186
15.5
0
0
0
0
4
4
34.5
2.875
0
0
0
1
0
1
37.5
3.125
1
1
1
0
0
3
43.5
3.625
0
2
1
0
0
3
45
3.75
0
0
2
0
0
2
46.5
3.875
0
0
0
0
1
1
49.5
4.125
1
0
2
0
0
3
51
4.25
1
0
0
0
1
2
55.5
4.625
0
1
2
0
0
3
57
4 . 75
0
0
1
1
0
2
66
5.25
0
2
2
0
0
4
67.5
5.625
0
0
3
0
0
3
69
5.75
0
0
0
2
0
2
72
6
1
0
3
0
0
4
73.5
6.125
1
0
0
2
0
3
79.5
6.625
0
1
0
2
0
3
81
6.75
0
0
0
1
1
2
90
7.5
0
2
1
0
1
4
91.5
7.625
0
0
2
0
1
3
93
7.75
0
0
0
0
2
2
96
8
1
0
1
2
0
4
97.5
8.125
1
0
0
0
2
3
102
103.5
108
8.5
8.625
9
2
0
1
0
0
0
0
0
0
0
3
3
2
0
0
4
3
4
190.5
15.875
1
0
0
0
4
5
196.5
16.375
0
1
0
0
4
5
205.5
17.125
0
1
1
5
0
7
207
17.25
0
0
0
6
0
6
211.5
17.625
1
0
0
6
0
7
217.5
18.125
0
1
0
6
0
7
229.5
19.125
0
0
1
6
0
7
232.5
19.375
0
0
0
0
5
5
237
19.75
1
0
0
0
5
6
2 41. 5
20.125
0
0
0
7
0
7
246
20 . 5
1
0
0
7
0
8
252
21
0
1
0
7
0
8
26 4
22
0
0
1
7
0
8
27 6
23
0
0
0
8
0
8
279
23.25
0
0
0
0
6
6
280.5
23.375
1
0
0
8
0
9
283.5
23.625
1
0
0
0
6
7
289.5
24.125
0
1
0
0
6
7
301.5
25.125
0
0
1
0
6
7
310.5
25.875
0
0
0
9
0
9
10
315
26.5
1
0
0
9
0
325.5
27.125
0
0
0
0
7
7
330
27 . 5
1
0
0
0
7
8
114
9.5
0
2
0
0
2
4
336
28
0
1
0
0
7
8
117
9.75
1
0
5
0
0
6
345
28.75
0
0
0
10
0
10
118.5
9.875
1
1
0
3
0
5
349.5
29.125
1
0
0
10
0
11
126
10.5
0
0
1
3
0
4
372
31
0
0
0
0
8
8
1
0
1
3
0
5
376.5
31.375
1
0
0
0
8
9
11
130.5 10.875
135
11.25
0
0
6
0
0
6
379.5
31.625
0
0
0
11
0
138
11.5
0
0
0
4
0
4
4 18. 5
34.875
0
0
0
0
9
9
139.5 11.625
0
0
0
0
3
3
42 3
35.25
1
0
0
0
9
10
142.5 11.875
1
0
0
4
0
5
46 5
38.75
0
0
0
0
10
10
Table 7: Vent Section Length Chart
40' Max
(12.2 M)
6' Min
(1.8 M)
Model
SV8 6/12/24/36/48
Vent Sections
NOTE: Convert inches into metric equivalent
measurement, as follows:
Millimeters (mm) = Inches x 25.4
Centimeters (cm) = Inches x 2.54
Meters (M) = Inches x .0254
Effective Length
SV8L6
4-1/2"
SV8L12
10-1/2"
SV8L24
22-1/2"
SV8L36
34-1/2"
SV8L48
46-1/2"
Table 8—Effective Vent Length
Figure 15
13
./4%$)!'2!-3),,5342!4)/.3!2%./44/3#!,%
)../6!4)6%(%!24(02/$5#43s$)2%#46%.4'!3&)2%0,!#%3-ONTEBELLO$,8-ONTEBELLO$,8#$s).34!,,!4)/.).3425#4)/.3
Vertical (Offset) Installation
Analyze the vent routing and determine the
QUANTITIESOFVENTSECTIONSANDNUMBEROFELBOWS
REQUIRED2EFERTOVertical Vent Figures and
Tables on Page 16 to select the type of vertical
INSTALLATIONDESIRED6ENTSECTIONSAREAVAILABLE
INNETLENGTHSOFMM
MMMMMMAND
MM2EFERTOTHEVent Section
Length Chart on Page 13 for an aid in selectINGLENGTHCOMBINATIONS%LBOWSAREAVAILABLE
IN—AND—CONlGURATIONS2EFERTOFigure
20 on Page 15 FORTHE36%AND36%
ELBOWDIMENSIONALSPECIlCATIONS
7HERE REQUIRED A telescopic vent section
(SV8LA)MAYBEUSEDTOPROVIDETHEINSTALLER
WITHANOPTIONININSTALLINGINTIGHTANDCONlNED
SPACESORWHERETHEVENTRUNMADEUPOFlXED
LENGTHPIECESDEVELOPSAJOINTINAUNDESIRABLE
LOCATION OR WILL NOT BUILD UP TO THE REQUIRED
LENGTH4HE36,!4ELESCOPIC6ENT3ECTIONHAS
ANEFFECTIVELENGTHOFFROMMMTO
MM4HE36,!ISlTTEDWITHA
DIMPLEDENDIDENTICALTOANORMALVENTSECTION
COMPONENTANDAPLAINENDWITHPILOTHOLES
3LIPTHEDIMPLEDENDOVERTHELOCKINGCHANNEL
END OF A STANDARD 36 VENT COMPONENT THE
REQUIREDDISTANCEANDSECUREWITHTHREESCREWS
Maintain a minimum 1" (25 mm) clearance
to combustible materials for all vertical elements. Clearances for all horizontal elements
are 3" (76 mm) on top, 1" (25 mm) on sides
and 1" (25 mm) on the bottom.
A. Frame ceiling opening—5SEAPLUMBLINE
FROMTHECEILINGABOVETHEAPPLIANCETOLOCATE
center of the vertical run. Cut and/or frame an
OPENINGXMMXMMINSIDE
DIMENSIONSABOUTTHISCENTERMARK(Figure 16).
Minimum
13”
(330 mm)
Roof
Framing
Ceiling
Framing
Figure 16
Minimum
13”
(330 mm)
Plumb
Bob
B. Attach vent components to appliance—Secure Vent®36DIRECTVENTSYSTEMCOMPONENTS
are unitized concentric pipe components
FEATURINGPOSITIVETWISTLOCKCONNECTIONSsee
Figure 17).
All of the appliances covered in this document
ARElTTEDWITHCOLLARSHAVINGLOCKINGINCLINED
channels. The dimpled end of the vent compoNENTSlTOVERTHEAPPLIANCECOLLARTOCREATETHE
POSITIVETWISTLOCKCONNECTION
Arrow
Align the dimple (four places) of the
upper vent section with the opening
of the locking incline channel on the
lower vent section or appliance collar. Twist vent component clockwise
to engage and seal until arrow and
dimple align.
Dimple
Locking Incline
Channel
Connected Vent
Sections
Appliance Collar or
Vent Section
Arrow
Figure 17
To attach a vent component to the appliance
collar, align the dimpled end over the collar,
ADJUSTING THE RADIAL ALIGNMENT UNTIL THE FOUR
LOCKING DIMPLES ARE ALIGNED WITH THE INLET OF
THEFOURINCLINEDCHANNELSONTHECOLLARrefer
to Figure 17). Push the vent component against
the collar until it fully engages, then twist the
COMPONENT CLOCKWISE RUNNING THE DIMPLES
down and along the incline channels until they
seat at the end of the channels. The unitized
design of the Secure Vent components will
ENGAGEANDSEALBOTHTHEINNERANDOUTERPIPE
without the need for sealant or screws. If desired
AXSCREWMAYBEUSEDATTHEJOINTBUT
ITISNOTREQUIREDASTHEPIPEWILLSECURELYLOCK
when twisted.
C. Attach vent components to each other—
/THER VENT SECTIONS MAY BE ADDED TO THE
previously installed section in accordance with
THE REQUIREMENTS OF THE VERTICAL VENT lGURES
AND TABLES 4O ADD ANOTHER VENT COMPONENT
to a length of vent run, align the dimpled end
over the inclined channel end of the previously
INSTALLEDSECTIONADJUSTINGTHERADIALALIGNMENT
UNTILTHEFOURLOCKINGDIMPLESAREALIGNEDWITH
the inlets of the four incline channels of the
previous section.
14
./4%$)!'2!-3),,5342!4)/.3!2%./44/3#!,%
Push the vent component against the previous
section until it fully engages, then twist the
COMPONENTCLOCKWISERUNNINGTHEDIMPLESDOWN
and along the incline channels until they seat at
the end of the channels. This seating position
is indicated by the alignment of the arrow and
dimple as shown in Figure 17.
D. Install firestop/spacer at ceiling—7HEN
USING3ECURE6ENTUSE36"&lRESTOPSPACER
ATCEILINGJOISTS)FTHEREISLIVINGSPACEABOVE
THE CEILING LEVEL THE lRESTOPSPACER MUST BE
INSTALLEDONTHEBOTTOMSIDEOFTHECEILING)FATTIC
SPACEISABOVETHECEILINGTHElRESTOPSPACER
MUSTBEINSTALLEDONTHETOPSIDEOFTHEJOIST
Route the vent sections through the framed
OPENING AND SECURE THE lRESTOPSPACER WITH
DNAILSOROTHERAPPROPRIATEFASTENERSATEACH
corner. Remember to maintain 1" (25 mm)
clearance to combustibles, framing members,
and attic or ceiling insulation when running
vertical chimney sections. Attic insulation
shield (H3908) may be used to obtain the
required clearances indicated here. See
installation accessories on Page 30. The gap
BETWEENTHEVENTPIPEANDAVERTICALlRESTOP
CANBESEALEDWITHNONCOMBUSTIBLECAULKING
E. Support the vertical vent run sections—
NOTE: Proper venting support is very important.
The weight of the vent must not be supported
by the fireplace in any degree.
Support the vertical portion of the venting
SYSTEMEVERYFEETMABOVETHElREPLACE
vent outlet.
Blocking
Support Straps
(Plumber's tape)
8 feet (2.4 m)
Maximum
1" (25.4 mm)
minimum
clearance to
combustibles
Figure 18
)../6!4)6%(%!24(02/$5#43s$)2%#46%.4'!3&)2%0,!#%3-ONTEBELLO$,8-ONTEBELLO$,8#$s).34!,,!4)/.).3425#4)/.3
/NEMETHODOFSUPPORTISBYUTILIZINGlELDPROVIDEDSUPPORTSTRAPSCONVENTIONALPLUMBERgS
TAPE3ECURETHEPLUMBERgSTAPETOTHEFRAMING
MEMBERSWITHNAILSORSCREWS Strap the tape
around the vent, securing the ends of the tape
to the framing. If desired, sheet metal screws
X LENGTH MAY BE USED TO SECURE THE
support straps to the vent pipe. See Figure 18
on Page 14.
F. Change vent direction to horizontal/inclined
run—At transition from or to a horizontal/
INCLINEDRUNINSTALLTHE36%AND36%
ELBOWSINTHESAMEMANNERASTHESTRAIGHTVENT
SECTIONS4HEELBOWSFEATUREATWISTSECTIONTO
ALLOWTHEMTOBEROUTEDABOUTTHECENTERAXIS
of their initial collar section to align with the
REQUIREDDIRECTIONOFTHENEXTVENTRUNELEMENT
Twist elbow sections in a clockwise direction
only so as to avoid the possibility of unlocking
any of the previously connected vent sections.
See Figure 17 on Page 14 and Figure 19.
C
D
Framing Dimensions for Roof
Inches (millimeters)
Pitch
C
D
0/12
13"
(330 mm)
13"
(330 mm)
6/12
13"
(330 mm)
15-1/2"
(394 mm)
12/12
13"
(330 mm)
20-1/2"
(541 mm)
K. Install the vertical termination—4HElNAL
step involves installation of the Vertical TerminaTION%XTENDTHEVENTSECTIONSTOTHEHEIGHTAS
SHOWNINTHE6ERTICALVENTTERMINATIONSECTION
on Page 64HE366426ERTICAL4ERMINATION
Figure 22)CANBEINSTALLEDINTHEEXACTSAME
fashion as any other Secure Vent® section. Align
the termination over the end of the previously
INSTALLEDSECTIONADJUSTINGTHERADIALALIGNMENT
UNTILTHEFOURLOCKINGDIMPLESOFTHETERMINATION
are aligned with the inlets of the four incline
channels of the last vent section. Push the termination down until it fully engages, then twist
THETERMINATIONCLOCKWISERUNNINGTHEDIMPLES
down and along the incline channels until they
seat at the end of the channels.
Figure 20—Roof Framing
10"
(254mm)
6"
(153mm)
Swivel Joint
(360° swivel)
SV8E45
(45° Elbow)
Swivel Joint
(360° swivel)
SV8E90
(90° Elbow)
Figure 19
G. Continue installation of horizontal/inclined
sections—Continue with the installation of the
straight vent sections in horizontal/inclined run
ASDESCRIBEDINStep C. Install support straps
EVERYFTMMALONGHORIZONTALINCLINED
VENTRUNSUSINGCONVENTIONALPLUMBERSTAPE
See Page 17, Figure 26. It is very important
that the horizontal/inclined RUNBEMAINTAINEDIN
ASTRAIGHTNODIPSSLIGHTLYELEVATEDPLANE4HE
RECOMMENDEDINCLINEISAPPROXIMATELYPER
FOOTMMPERMETERHORIZONTALINADIRECTION
AWAYFROMTHElREPLACE4HERISEPERFOOTRUN
RATIOSTHATARESMALLERAREACCEPTABLEALLTHEWAY
DOWNTOATORNEARLEVEL5SEACARPENTERSLEVEL
TOMEASUREFROMACONSTANTSURFACEANDADJUST
the support straps as necessary.
I. Install the roof flashing—%XTEND THE VENT
sections through the roof structure. Install the
roof flashing over the vent section and position such that the vent column rises vertically
USECARPENTERSLEVEL(Figure 21). Nail along
PERIMETERTOSECUREmASHINGORADJUSTROOlNGTO
overlap the flashing edges at top and sides only
ANDTRIMWHERENECESSARY3EALTHETOPANDBOTH
SIDESOFTHEmASHINGWITHWATERPROOFCAULKING
J. Install the storm collar—Install the storm
collar, supplied with the flashing, over the vent/
mASHINGJOINTSEEFigure 21). ,OOSENTHESTORM
collar screw. Slide collar down until it meets
THETOPOFTHEmASHING4IGHTENTHEADJUSTING
SCREW !PPLY NONCOMBUSTIBLE CAULKING OR
MASTICAROUNDTHECIRCUMFERENCEOFTHEJOINT
to provide a water tight seal.
Flashing
Figure 22
)FTHEVENTSYSTEMEXTENDSMORETHANFEET
MABOVETHEROOFmASHINGSTABILIZERSMAYBE
NECESSARY!DDITIONALSCREWSMAYBEUSEDAT
SECTIONJOINTSFORADDEDSTABILITY'UIDEWIRES
MAYBEATTACHEDTOTHEJOINTFORADDITIONALSUPPORTONMULTIPLEJOINTCONlGURATIONS
Storm
Storm
Collar
Collar
It is important to maintain the required clearances to combustibles: 1" (25 mm) at all sides
for all vertical runs; and 3" (76 mm) at the
top, 1" (25 mm) at sides, and 1" (25 mm) at
the bottom for all horizontal/inclined runs.
H. Frame roof opening—Identify location for
vent at the roof. Cut and/or frame opening per
2OOF&RAMING#HART(Figure 20).
Figure 21
15
./4%$)!'2!-3),,5342!4)/.3!2%./44/3#!,%
)../6!4)6%(%!24(02/$5#43s$)2%#46%.4'!3&)2%0,!#%3-ONTEBELLO$,8-ONTEBELLO$,8#$s).34!,,!4)/.).3425#4)/.3
VERTICAL VENT FIGURES/TABLES
NOTES:
s 3ECURE6ENT® (rigid vent pipe) is shown in
the figures.
s )T IS VERY IMPORTANT THAT THE HORIZONTAL
inclined run be maintained in a straight
(no dips), slightly elevated plane. The
recommended incline is approximately
1/4" per foot (20 mm per meter) horizontal,
in a direction away from the fireplace. The
rise per foot run ratios that are smaller are
acceptable all the way down to at or near
level.
s SV8BF (Secure Vent) firestop/spacer must
be used anytime vent pipe passes through a
combustible floor or ceiling. SV8HF (Secure
Vent) firestop/spacer must be used anytime
vent pipe passes through a combustible wall.
s Two 45º elbows may be used in place of one
90º elbow. The same rise to run ratios, as
shown in the venting figures for 90º elbows,
must be followed if 45º elbows are used.
Table A
V Minimum
H Maximum
H
Ceiling
Firestop/Spacer
(SV8BF)
feet
(meter)
feet
(meter)
10
(3.1)
2.5
(0.762)
15
(4.65)
3.5
(1.07)
20
(6.2)
4.5
(1.37)
V + V1 + H = 40 feet (12.4 meters) Max.
V + V1 = 11 feet (3.3 meters) Minimum for 40 in. units
V + V1 = 10.5 feet (3.2 meters) Minimum for 45 in. units
V1
V
Example: If 20 feet of (H) horizontal
vent run is needed, then 4-1/2 feet
minimum of (V) vertical vent will be
required.
A Vent Restrictor, as shown in
Figure 14 on Page 12, must be used
in this application.
Figure 24—Top Vent—Two 90 Degree Elbows (Corner Framing with Square
Termination (SV8HTS))
Ceiling
Firestop/Spacer
(SV8BF)
40 feet (12.2 meters)
Maximum
6 feet (1.8 meters)
Minimum
Ceiling
Firestop/Spacer
(SV8BF)
V1
Wall
Firestop/Spacer
(SV8HF)
H
H1
V
A Vent Restrictor, as shown in Figure 15 on Page
12, may need to be used in this application
Figure 23—Top Vent—Straight
Table B
V Minimum
H + H1 Maximum
feet
(meter)
feet
(meter)
10
(3.1)
2.5
(0.762)
15
(4.65)
3.5
(1.06)
20
(6.2)
4.5
(1.37)
H + H1 = 20 feet (6.2 m) Max.
V + V1 + H + H1 = 40 ft. (12.4 m) Max.
V + V1 = 11 feet (3.3 meters) Min. for 40 in. units
V + V1 = 10.5 feet (3.2 meters) Min. for 45 in. units
Figure 25—Top Vent—Three Elbows
16
./4%$)!'2!-3),,5342!4)/.3!2%./44/3#!,%
A Vent Restrictor, as
shown in
Figure 14 on Page 12,
must be used in this
application.
Example: If 20 feet of (H+ H1) horizontal vent run is needed, then 4-1/2 feet
minimum of (V) vertical vent will be
required.
)../6!4)6%(%!24(02/$5#43s$)2%#46%.4'!3&)2%0,!#%3-ONTEBELLO$,8-ONTEBELLO$,8#$s).34!,,!4)/.).3425#4)/.3
HORIZONTAL (OUTSIDE WALL) TERMINATION
SYSTEM
See Figures 26–31 and their associated
(ORIZONTAL6ENTTABLESTHATILLUSTRATETHEVARIOUSHORIZONTALVENTINGCONlGURATIONSTHATARE
POSSIBLEFORUSEWITHTHESEAPPLIANCESSecure
Vent® pipe applications are shown in these
&IGURES ! (ORIZONTAL 6ENT TABLE SUMMARIZES
EACHSYSTEMSMINIMUMANDMAXIMUMVERTICAL
ANDHORIZONTALLENGTHVALUESTHATCANBEUSED
to design and install the vent components in a
variety of applications.
Support
Brackets
Building
Support
Framing
Horizontal / Inclined Run
SV8E90
Elbow
SV8 L6/12/24/36/48
Vent Sections
Ceiling
Vertical
Rise
Firestop/Spacer
Support Bracket Spacing
Every 3 ft (914 mm)
A. Plan the vent run.
Analyze the vent routing and determine the
TYPES AND QUANTITIES OF SECTIONS REQUIRED
MMMM
MMMMANDMMNET
SECTIONLENGTHSAREAVAILABLE)TISRECOMMENDED
THATYOUPLANTHEVENTINGSOTHATAJOINTDOESNOT
OCCURINTHECEILINGORROOFJOISTS!LLOWFORELBOWS
as indicated in Figure 20 on Page 15.
Maintain a minimum 1" (25 mm) clearance
to combustibles on the vertical sections.
Clearances for the horizontal runs are; 3"
(76 mm) on top, 1" (25 mm) on sides, and
1" (25 mm) at the bottom.
B. Frame exterior wall opening—,OCATETHE
CENTER OF THE VENT OUTLET ON THE EXTERIOR WALL
according to the dimensions shown in Figure
11 on Page 10. Cut and/or frame an opening,
XMMXMMINSIDEDIMENSIONSWITHABOVECENTERANDBELOWCENTER
C. Frame ceiling opening—If the vertical
ROUTEISTOPENETRATEACEILINGUSEPLUMBLINE
TOLOCATETHECENTERABOVETHEAPPLIANCE#UT
ANDORFRAMEANOPENINGXMMX
MMINSIDEDIMENSIONSABOUTTHISCENTER
REFERTOFigure 17 on Page 14).
D. Attach vent components to appliance—To
attach a vent component to the appliance collar,
ALIGNTHEDIMPLEDENDOVERTHECOLLARADJUSTINGTHERADIALALIGNMENTUNTILTHEFOURLOCKING
dimples are aligned with the inlets of the four
INCLINECHANNELSONTHECOLLARrefer to Figure
16 on Page 14).
Exterior
Wall
SV8HTS
Termination
Shown
2-1/2 Foot Vertical
Vent (min.)
The horizontal vent system terminates through
ANOUTSIDEWALL"UILDING#ODESLIMITORPROHIBIT
TERMINATINGINSPECIlCAREAS2EFERTOFigure 6
on Page 7 for location guidelines.
Secure Vent36DIRECTVENTSYSTEMCOMPOnents are unitized concentric pipe components
FEATURINGPOSITIVETWISTLOCKCONNECTIONrefer
to Figure 17 on Page 14). All of the appliANCESCOVEREDINTHISDOCUMENTARElTTEDWITH
COLLARSHAVINGLOCKINGINCLINEDCHANNELS4HE
DIMPLEDENDOFTHEVENTCOMPONENTSlTOVER
the appliance collar to create the positive twist
LOCKCONNECTION
SV8HTS
Termination
Shown
Fireplace
Exterior
Wall
Support the vertical portion of the venting system
every 8 feet (2.4m) above the fireplace vent outlet.
Figure 26—Typical Horizontal Vent Installation
Push the vent component against the collar
until it fully engages, then twist the component
CLOCKWISERUNNINGTHEDIMPLESDOWNANDALONG
the incline channels until they seat at the end of
the channels. The unitized design of the Secure
VentCOMPONENTSWILLENGAGEANDSEALBOTHTHE
inner and outer pipe elements with the same
procedure. Sealant and securing screws are
NOTREQUIRED
E. Attach vent components to each other—
/THERVENTSECTIONSMAYBEADDEDTOTHEPREVIously installed section in accordance with the
REQUIREMENTSOFTHEVENTTABLES4OADDANOTHER
vent component to a length of vent run, align
the dimpled end of the component over the
inclined channel end of the previously installed
SECTIONADJUSTINGTHERADIALALIGNMENTUNTILTHE
FOURLOCKINGDIMPLESAREALIGNEDWITHTHEINLETS
of the four incline channels of the previous
section. Push the vent component against the
previous section until it fully engages, then
TWIST THE COMPONENT CLOCKWISE RUNNING THE
dimples down and along the incline channels
until they seat at the end of the channels. This
seating position is indicated by the alignment
of the arrow and dimple as shown in Figure
17 on Page 14.
F. Install firestop/spacer at ceiling—7HEN
using Secure VentUSE36"&lRESTOPSPACER
ATCEILINGJOISTS)FTHEREISLIVINGSPACEABOVE
THECEILINGLEVELTHElRESTOPSPACERMUSTBE
INSTALLEDONTHEBOTTOMSIDEOFTHECEILING)F
ATTIC SPACE IS ABOVE THE CEILING THE lRESTOP
SPACER MUST BE INSTALLED ON THE TOP SIDE OF
THEJOIST2OUTETHEVENTSECTIONSTHROUGHTHE
FRAMEDOPENINGANDSECURETHElRESTOPSPACER
WITHDNAILSOROTHERAPPROPRIATEFASTENERSAT
each corner.
Remember to maintain 1" (25 mm) clearance
to combustibles, framing members, and attic
or ceiling insulation when running vertical
chimney sections.
./4%$)!'2!-3),,5342!4)/.3!2%./44/3#!,%
G. Support the vertical run sections—See
Step E on Page 14.
H. Change vent direction—At transition from or
TOAHORIZONTALINCLINEDRUNINSTALLTHE36%
AND36%ELBOWSINTHESAMEMANNERASTHE
STRAIGHTVENTSECTIONS4HEELBOWSFEATUREATWIST
SECTIONTOALLOWTHEMTOBEROUTEDABOUTTHE
CENTERAXISOFTHEIRINITIALCOLLARSECTIONTOALIGN
WITHTHEREQUIREDDIRECTIONOFTHENEXTVENTRUN
element. Twist elbow sections in a clockwise
direction only so as to avoid the possibility
of unlocking any of the previously connected
vent sections (see Figure 17 on Page 14).
I. Continue installation of horizontal/inclined
sections—Continue with the installation of the
straight vent sections in horizontal/inclined
RUNASDESCRIBEDINStep E on Page 14. Install
SUPPORTSTRAPSEVERYFEETMMALONG
horizontal/inclined vent runs using conventional
PLUMBERSTAPE
See Figure 26, It is very important that the
horizontal/inclined run be maintained in a
straight (no dips), slightly elevated plane. The
recommended incline is approximately 1/4"
per foot (20 mm per meter) horizontal, in a
direction away from the fireplace. The rise per
foot run ratios that are smaller are acceptable
all the way down to at or near level.
It is important to maintain the required clearances to combustibles: 1" (25 mm) at all sides
for all vertical runs; and 3" (76 mm) at the
top, 1" (25 mm) at sides, and 1" (25 mm) at
the bottom for all horizontal/inclined runs.
5SE A CARPENTERS LEVEL TO MEASURE FROM A
CONSTANTSURFACEANDADJUSTTHESUPPORTSTRAPS
as necessary.
17
)../6!4)6%(%!24(02/$5#43s$)2%#46%.4'!3&)2%0,!#%3-ONTEBELLO$,8-ONTEBELLO$,8#$s).34!,,!4)/.).3425#4)/.3
J. Assemble vent run to exterior wall—If not
previously measured, locate the center of the
VENTATTHEEXTERIORWALL0REPAREANOPENINGAS
DESCRIBEDINStep B on Page 17!SSEMBLETHE
vent system to point where the terminus of the
LASTSECTIONISWITHINMMTO
MMINBOARDOFTHEEXTERIORSURFACETOWHICH
THE36(43TERMINATIONISTOBEATTACHEDSEE
Figure 29 and Table 9 on Page 19.
If the terminus of the last section is not within
this distance, use the telescopic vent section
SV8LA, ASTHELASTVENTSECTION&ORWALLTHICKnesses greater than that shown in Figure 28,
refer to Table 9 on Page 19 4HIS TABLE LISTS
THEADDITIONALVENTINGCOMPONENTSNEEDEDIN
ADDITIONTOTHETERMINATIONANDADAPTORFORA
PARTICULARRANGEOFWALLTHICKNESSES
K. Attach termination adaptor—Attach the
ADAPTORADAPTORˆ362#(ˆPROVIDEDWITHTHE
TERMINATIONTOTHEVENTSECTIONORTELESCOPING
VENTSECTIONORELBOWASSHOWNINFigure 27
in the same manner as any SV vent component
REFERTOStep E on Page 17).
To help minimize water infiltration it
is recommended
theinfiltration
Firestop/
To help minimizethat
water
Spacer
be installed
on the
install(SV4.5HF)
the Firestop/Spacer
(SV4.5HF)
exterior
of the
on the side
exterior
sidewall.
of the wall.
15 in.
(381 mm)
3 in.
(76 mm)
1 in.
(25 mm)
Adaptor
SV8RCH
1 in.
(25 mm)
6–48 in. Vent Section,
Telescopic vent section.
NOTE: Centerline of Vent Piping is NOT
the Same as the Centerline of the
Framed Opening.
See Figure
12 on
Page
10 for Minimum
See other
side
for minimum
Distance
to Base
of Appliance
distance
to base
of appliance.
Base of Appliance
Figure 27—Installing the Square Horizontal Termination (SV8HTS)
Minimum wall thickness
5” (127 mm)
Maximum wall thickness
8-1/2” (216 mm)
Interior Surface of
Finished Wall
Siding
4HE&IRESTOP3PACERMAYALSOBEINSTALLEDOVER
THEOPENINGATTHEINTERIORSIDEOFTHEFRAMING
IMPORTANT: The vent termination is hot
while in operation and for a period of time
following the use of the fireplace. Young
children should be carefully supervised
when they are in the same area as a hot
termination.
13 in.
(330mm)
6-1/2 in.
(165 mm)
L. Install Firestop/Spacer at exterior wall
—7HENUSINGTHESQUARE termination, install
36(&&IRESTOP3PACEROVERTHEOPENINGATTHE
EXTERIORSIDEOFTHEFRAMINGLONGSIDEUPWITH
THESPACERCLEARANCEATTHETOPASSHOWNIN
Figure 27, and nail into place.
M. Install the square termination (SV8HTS)—
&OR THE LAST STEP FROM OUTSIDE THE EXTERIOR
wall, slide the collars of the termination onto
THEADAPTORTHEOUTEROVERTHEOUTERANDTHE
INNER INSIDE THE INNER UNTIL THE TERMINATION
SEATSAGAINSTTHEEXTERIORWALLSURFACETOWHICH
IT WILL BE ATTACHED /RIENT THE HOUSING OF THE
termination with the arrow pointed upwards.
3ECURETHETERMINATIONTOTHEEXTERIORWALLThe
horizontal termination must not be recessed
into the exterior wall or siding by more than
the 1-1/4" (32 mm) as shown in Figure 28.
8-1/2 in.
(216 mm)
SV8HTS
Termination
Shown.
Maximum Extent of Vent
Run Sections to Exterior
Surface of Framing
Last Vent Section. Use
Telescopic Vent Section
(SV8LA), If Necessary
SV8HTS
Square Termination
shown
Exterior Surface of Siding
Exterior Surface of
Framing
5” to 8-1/2”
(127 to 216 mm)
SV8HTS
Square Termination
Shown
Adaptor
SV8RCH
Stucco
For wall thicknesses greater than
8-1/2", see Table 9
1-1/4” Maximum Recess of
Square Termination into
Exterior Finishing Material
Venting Connection and Exterior Wall Recessing
of the Horizontal Square Termination (SV8HTS).
Figure 28—Wall Thickness and Horizontal Termination Requirements
Horizontal terminations have been designed to perform in a wide range of weather conditions. Our terminations meet or exceed industry standards.
When selecting the locations of your horizontal terminations, do not place the termination
where water from eaves and adjoining rooflines may create a heavy flow of cascading water
onto the termination cap. If the cap must be placed where the possibility of cascading water
exists, it is the responsibility of the builder to direct the water away from the termination cap
by using gutters or other means.
Take care to carefully follow the installation instructions for the termination, including the
use of silicone caulking where required.
18
./4%$)!'2!-3),,5342!4)/.3!2%./44/3#!,%
)../6!4)6%(%!24(02/$5#43s$)2%#46%.4'!3&)2%0,!#%3-ONTEBELLO$,8-ONTEBELLO$,8#$s).34!,,!4)/.).3425#4)/.3
See Table 9 as an aid in venting component selection for a particular
range of exterior wall thicknesses.
Venting Components Required for Various Exterior
Wall Thicknesses, when using Square Termination Kit
(SV8HTS—see Figure 28)
Vent Components Required Exterior Wall Thickness—inches (mm)
4ERMINATION+IT/NLY
TOTO
4ERMINATION +IT AND 6ENT
3ECTION36,
TOTO
4ERMINATION +IT AND 4ELESCOPIC3ECTION36,!
TOTO
4ERMINATION +IT AND 4ELESCOPIC3ECTION36,!AND
VENTSECTION36,
TOTO
Table 9
Table C
V Minimum
H Maximum
feet
(meter)
feet
(meter)
3.5
(1.07)
2.5
(0.762)
6.5
(1.98)
3.5
(1.07)
8.5
(2.6)
4.5
(1.37)
10.5
(3.2)
5.5
(1.68)
12.5
(3.8)
6.5
(1.98)
14.5
(4.4)
7.5
(2.3)
16.5
(5.0)
8.5
(2.6)
18.5
(5.6)
9.5
(2.9)
20
(6.0)
10
(3.0)
HORIZONTAL VENT FIGURES/TABLES
NOTES:
s 3ECURE6ENT® components (rigid vent pipe and terminal) are shown
in the figures.
s Two 45º elbows may be used in place of one 90º elbow. The same rise
to run ratios, as shown in the venting figures for 90º elbows, must be
followed if 45º elbows are used.
s SV8BF (Secure Vent) firestop/spacer must be used anytime vent pipe
passes through a combustible floor or ceiling. SV8HF (Secure Vent)
firestop/spacer must be used anytime vent pipe passes through a
combustible wall.
s )TISVERYIMPORTANTTHATTHEHORIZONTALINCLINEDRUNBEMAINTAINED
in a straight (no dips), slightly elevated plane. The recommended
incline is approximately 1/4" per foot (20 mm per meter) horizontal,
in a direction away from the fireplace. The rise per foot run ratios
that are smaller are acceptable all the way down to at or near level.
Example: If 20 feet of (H)
horizontal vent run is needed,
then 10 feet minimum of (V)
vertical vent will be required.
H
V
Wall Firestop/Spacer
(SV8HF)
V + H = 40 feet (12.4 m) Max.
H = 20 ft. (6.2 m) Max.
Ceiling
Firestop/Spacer
(SV8BF)
Square termination (SV8HTS) shown.
See Table 9 as an aid in venting component selection for
APARTICULARRANGEOFEXTERIORWALLTHICKNESSES
Figure 29—Top Vent—One 90 Degree Elbow (Elbow Connection Not Directly at Appliance)
19
./4%$)!'2!-3),,5342!4)/.3!2%./44/3#!,%
)../6!4)6%(%!24(02/$5#43s$)2%#46%.4'!3&)2%0,!#%3-ONTEBELLO$,8-ONTEBELLO$,8#$s).34!,,!4)/.).3425#4)/.3
HORIZONTAL VENT FIGURES/TABLES
(continued)
Wall Firestop/Spacer
(SV8HF)
Table D
H + H1 Maximum
H
H1
V
Wall Firestop/Spacer
(SV8HF)
Ceiling
Firestop/Spacer
(SV8BF)
V Minimum
feet
(meter)
feet
(meter)
3.5
(1.07)
2.5
(0.762)
6.5
(1.98)
3.5
(1.07)
8.5
(2.6)
4.5
(1.37)
10.5
(3.2)
5.5
(1.68)
12.5
(3.8)
6.5
(1.98)
14.5
(4.4)
7.5
(2.3)
16.5
(5.0)
8.5
(2.6)
18.5
(5.6)
9.5
(2.9)
20
(6.0)
10
(3.0)
V + H + H1 = 40 feet (12.4 m) Max.
H + H1 = 20 ft. (6.2 m) Max.
See Table 9 on Page 19 as an aid in venting component selection for a particular range of
EXTERIORWALLTHICKNESSES
Figure 30—Top Vent—Two 90 Degree Elbows
Table E
H + H1 = 20 feet (6.2 m) Max.
V + V1+ H + H1 = 40 ft. (12.4 m) Max.
H1
V = 2.5 feet Min. (0.762 m)
V + V1 = 11 feet (3.35 m) Min. for 40 in. units
V + V1 = 10.5 feet (3.2 m) Min. for 45 in. units
Ceiling
Firestop/Spacer
(SV8BF)
Wall Firestop/Spacer
(SV8HF)
H
V1
V
Wall
Firestop/Spacer
(SV8HF)
Ceiling
Firestop/Spacer
(SV8BF)
See Table 9 on Page 19ASANAIDINVENTINGCOMPONENTSELECTIONFORAPARTICULARRANGEOFEXTERIORWALLTHICKNESSES
Figure 31—Top Vent—Three 90 Degree Elbows
20
./4%$)!'2!-3),,5342!4)/.3!2%./44/3#!,%
)../6!4)6%(%!24(02/$5#43s$)2%#46%.4'!3&)2%0,!#%3-ONTEBELLO$,8-ONTEBELLO$,8#$s).34!,,!4)/.).3425#4)/.3
Step 4. FIELD WIRING
Verify proper operation after servicing.
S’assurer que l’appareil fonctionne
adéquatement une fois l’entretien
terminé.
CAUTION
Ground supply lead must be connected to the wire attached to the
green ground screw located on the
outlet box. Failure to do so will
result in a potential safety hazard.
The appliance must be electrically
grounded in accordance with local
codes or, in the absence of local
codes, the National Electrical Code,
ANSI/NFPA 70-latest edition. (In
Canada, the current CSA C22-1 Canadian Electrical Code).
6)NSTALLTHEWALLMOUNTED/./&&CONTROLAS
DESCRIBED IN )NSTALLING AND INITIALIZING THE
2EMOTE#ONTROL3YSTEMONPage 22, in a
CONVENIENTLOCATIONNEARTHElREPLACE
7. After the wiring is complete, replace the
cover plate.
Ground - Green
Neutral - White
120 VAC - Black
The gas valve is set in place and pre-wired at
the factory.
Electronic Wiring
NOTE: The electronic appliance must be
connected to the main power supply.
1 2OUTE A WIRE 6AC (Z PH POWER
SUPPLYTOTHEAPPLIANCEJUNCTIONBOX
Junction Box
2. Remove the electrical inlet cover plate from
THESIDEOFTHEUNITBYREMOVINGTHEPLATEgS
SECURINGSCREWSsee Figure 11 on Page 10).
Black
Tab
Intact
Hot
Side of
Receptacle
White
3 2EMOVETHECOVERPLATEgSKNOCKOUTANDTHEN
FEEDTHEPOWERSUPPLYWIRETHROUGHTHEKNOCKOUTOPENINGANDINTOTHEUNITJUNCTIONBOX
CAUTION: Label all wires prior to disconnection when servicing controls. Wiring errors
can cause improper and dangerous operation.
ATTENTION: Au moment de l’entretien des
commandes, étiquetez tous les fils avant
de les débrancher. Des erreurs de cáblage
peuvent entraîner un fonctionnement
inadéquat et dangereux.
Green
4 #ONNECTTHEBLACKPOWERSUPPLYWIRETOTHE
power outlet's red pigtail lead and the white
power supply wire to the common terminal of
the outlet as shown in Figures 32 and 33.
Neutral
Side of
Receptacle
Tab Intact
Green
Ground
Screw
Field Wired
5. Connect the ground supply wire to the pigtail lead attached to outlet's green ground
screw.
Factory Wired
Figure 33—J-BOX WIRING
ELECTRONIC WIRING DIAGRAM
Flame
Sensor
IPI Pilot
(Schematic representation only)
Spark
Electrode
A wiring diagram is provided here
for reference purposes only. This
information is also provided on
schematics attached directly to the
appliance on a pullout panel located
within the control compartment.
COLOR CODE:
B = Black
BB = Brown w/Black Stripe
BG = Brown w/Green Stripe
BL = Blue
BR = Brown
G = Green
GY = Gray
O = Orange
R = Red
W = White
Y = Yellow
J-BOX/RECEPTIACLE
WIRING
120V, 60HZ, 1PH
Pilot Tube
B
Optional
Split Flow
885 Valve
Main Wire
Harness
BR
Note: On models
without pressure
switch, these
connectors are
plugged together.
BatteryHolder
Holder with
Switch
Battery
w/Switch
ON/Remote/OFF
ON/ Remote
/OFF
Y
B
G
Y
B O
R
Battery Holder
Wire Harness
BL
G
Air Pressure Switch
Power Vent Only
O
Ground Y
G BL
W
R
R
B
Reset Switch
(See instructions.)
Control Module
B
GR
WH
B
B
W
G
Power Vent Blower
Power Vent
Models Only
G
B
W
Main Power Cord
580489-01
Figure 32
Fuse
./4%$)!'2!-3),,5342!4)/.3!2%./44/3#!,%
21
)../6!4)6%(%!24(02/$5#43s$)2%#46%.4'!3&)2%0,!#%3-ONTEBELLO$,8-ONTEBELLO$,8#$s).34!,,!4)/.).3425#4)/.3
Installing and initializing the Remote
Control System
REQUIRED ITEMS (not provided):
s3TANDARD*UNCTION"OX
s0APER#LIPORSIMILAROBJECTFORREMOTE
CONTROLSYSTEMINITIALIZATION
Installing and Wiring the Receiver
(Wall Switch)
The receiver for the Total Comfort Control™
Remote Control System connects directly to
the gas valve, stepper motor, and fan control
MODULEWITHANUMBILICALCORDWIRINGHARNESS
)NSTALL A JUNCTION BOX NOT PROVIDED ON
THEWALLADJACENTTOTHEAPPLIANCEWITHIN
REACHOFTHEREMOTESYSTEMUMBILICALCORD
wiring harness. Position the 6-pin termiNALWITHINTHEJUNCTIONBOXINPREPARATION
for attachment to the remote receiver.
7HENWALLlNISHISCOMPLETEINSTALLTHE
RECEIVERINTHEPREVIOUSLYINSTALLEDJUNCTIONBOXANDCONNECTTHEPINTERMINAL
TOTHEPINCONNECTORONTHEBACKOFTHE
receiver.
)NSTALLTHERECEIVERCOVERPLATETAKINGCARE
to ensure the receiver switch is properly
INDEXEDWITHTHESWITCHCOVERWHENALIGNing the components for attachments.
The remote control system provides remote
OPERATIONOFTHEFOLLOWINGlREPLACEFUNCTIONS
s0RIMARYBURNER/./&&
s&LAME HEIGHT AND HEAT OUTPUT ADJUSTMENT
SIXLEVELS
The receiver accepts commands via radio
FREQUENCYFROMTHETRANSMITTERANDDOESNOT
REQUIRELINEOFSIGHTOPERATION
4HESLIDERSWITCHONTHERECEIVERCANBESETTO
one of three positions:
s/.MANUALOVERRIDE
s/&&MANUALOVERRIDE
s2%-/4%REMOTECONTROL
3EETHElREPLACE#AREAND/PERATION)NSTRUCtions for detailed instructions on using the
REMOTECONTROLSYSTEMTOOPERATETHElREPLACE
Three-position slider switch
in REMOTE position
On
Remote
Off
PRG
Initializing the Remote Control System
!FTERCOMPLETINGlREPLACEINSTALLATIONINITIALIZE
THE REMOTE CONTROL SYSTEM BEFORE OPERATING
THElREPLACE
)NSERTTHETHREEPROVIDED!!!BATTERIES
INTOTHEBATTERYBAYINTHETRANSMITTERTAKINGCARETOCORRECTLYALIGNPOLARITY+
)NSERTTHEFOURPROVIDED!!BATTERIES
INTOTHERECEIVERBATTERYBAYBEHINDTHE
WALLSWITCHPLATETAKINGCARETOCORRECTLY
ALIGNPOLARITY+
6.
On the receiver, place the three-position
SLIDER SWITCH IN THE 2%-/4% POSITION
(Figure 34).
/NTHERECEIVERFRONTCOVERINSERTTHEEND
OFAPAPERCLIPOROTHERSIMILAROBJECTNOT
PROVIDEDINTOTHEHOLEMARKEDh02'v
4HE RECEIVER WILL hBEEPv THREE TIMES TO
indicate it is ready to synchronize with
the transmitter.
Figure 34—Receiver (Wall Switch)
LCD Display
ON/OFF Key
ING
WARN Cause
e Will
eplac
Hot Firre Burns
ren to
Seve
Child er Fireoth
r Allow
Neve Glass or
h
Touc Parts
place
ROOM
TEMP.
Key
UP/DOWN
Arrow Key
MODE Key
Figure 35—Transmitter (Remote Control)
/NTHETRANSMITTERPRESSTHE/.BUTTON
4HE RECEIVER WILL hBEEPv FOUR TIMES TO
INDICATE ACCEPTANCE OF THE TRANSMITTERS
COMMAND AND SET THE RECEIVER TO THE
TRANSMITTERSSPECIlCCODE4HESYSTEM
is now initialized.
22
./4%$)!'2!-3),,5342!4)/.3!2%./44/3#!,%
WARNING
Fire hazard. Can cause severe
injury or death. The receiver
causes ignition of the appliance.
The appliance can turn on
suddenly. Keep away from
the appliance burner when
operating the remote system or
activating manual bypass of the
remote system.
CAUTION
Property damage hazard. Excessive heat can cause property
damage. The appliance can stay
lit for many hours. Turn off the
appliance if it is not going to be
attended for any length of time.
Always place the transmitter
where children can not reach it.
)../6!4)6%(%!24(02/$5#43s$)2%#46%.4'!3&)2%0,!#%3-ONTEBELLO$,8-ONTEBELLO$,8#$s).34!,,!4)/.).3425#4)/.3
Step 5. REMOVE GLASS DOOR FRAME
2EMOVETHEGLASSDOORASSEMBLY3EEInstallation and Removal of Glass Door on Page 26.
Step 6. CONNECTING GAS LINE
A.,IGHT THE APPLIANCE REFER TO THE LIGHTING
INSTRUCTIONSLABELINTHECONTROLCOMPARTMENT
or in the Care and Operation Instructions
MANUAL
B. "RUSHALLJOINTSANDCONNECTIONSWITHTHEGAS
LEAKTESTSOLUTIONTOCHECKFORLEAKS)FBUBBLES
are formed, or gas odor is detected, turn the
RECEIVERORREMOTECONTROLTOTHEh/&&vPOSITION
%ITHERTIGHTENORREFASTENTHELEAKINGCONNECTION
THENRETESTASDESCRIBEDABOVE
C. 7HENTHEGASLINESARETESTEDANDLEAKFREE
BESURETORINSEOFFTHELEAKTESTINGSOLUTION
D. 2EINSTALLTHEACCESSPLATEMAKINGCERTAINTHE
GASKETHASNOTBEENDAMAGED
Right Side
Modesty Panel
Access Plate
!LLCODESREQUIREASHUTOFFVALVEMOUNTEDINTHE
supply line. The orientation of the shut-off valve
should face the front. Figure 36 illustrates two
methods for connecting the gas supply. A Sediment Trap is recommended to prevent moisture
ANDDEBRISINGASLINEFROMDAMAGINGTHEVALVE
4HEmEXLINEMETHODISACCEPTABLEINTHE53!
where local codes permit, however, Canadian
REQUIREMENTSVARYDEPENDINGONLOCALITY)NSTALLATIONMUSTBEINCOMPLIANCEWITHLOCALCODES
4HESEAPPLIANCESAREEQUIPPEDWITHAGASmEX
line for use in connecting the unit to the gas
line. See Figure 36 FORmEXLINEDESCRIPTION4HE
mEXLINEISRATEDFORBOTHNATURALANDPROPANE
gas. A manual shut off valve is also provided
WITHTHEmEXLINE
The gas control valve is located on the right
side of the unit.
7HENUSINGSOLIDGASLINECONNECTORACCESS
THEVALVEBYREMOVINGTHEFRONTDOORASSEMBLY
on the valve access side and the access plate
see Figure 37).
4HEELECTRONICCONTROLVALVEHASAMM
NPT thread gas supply inlet.
"RINGTHESHUTOFFVALVEONTHEENDOFTHEmEXLINE
over to the hard pipe and tighten with wrenches
FROMABOVETHROUGHTHElREBOXOPENING
Secure all joints tightly using appropriate
tools and sealing compounds (ensure propane
resistant compounds are used in propane applications). It is recommended to seal around
the gas line to prevent cold air leakage.
Gas Valve
Step 7. CHECKING APPLIANCE
OPERATION
Figure 37
TEST ALL CONNECTIONS FOR GAS LEAKS
(FACTORY AND FIELD):
WARNING
Never use an open flame to
check for leaks.
4URNONGASSUPPLYANDTESTFORGASLEAKSUSINGA
GASLEAKTESTSOLUTIONALSOREFERREDTOASBUBBLE
LEAKSOLUTION
NOTE: Using a soapy water solution is an
effective leak test solution but it is not recommended, because the soap residue that is left
on the pipes/fittings can result in corrosion
over time.
Gas Flex Line Connector
Gas
Valve
4URN ON BURNER THEN OBSERVE THE INDIVIDUAL
TONGUESOFmAMEONTHEBURNER-AKESUREALL
ports are open and producing flame evenly
ACROSSTHEBURNER)FANYPORTSAREBLOCKEDOR
PARTIALLYBLOCKEDCLEANOUTTHEPORTS
7ITHGASLINEINSTALLEDRUNINITIALSYSTEMCHECKOUTBEFORECLOSINGUPTHEFRONTOFTHEUNIT&OLLOW
the lighting instructions provided in the Care
and Operation Instructions manual.
NOTE: Lighting Instructions are also found on
the literature tag tied to the bracket above the
gas valve. To access the tag, reach into the
right side opening.
7HENlRSTLIGHTINGTHEAPPLIANCEITWILLTAKEAFEW
minutes for the line to purge itself of air. Once
PURGINGISCOMPLETETHEPILOTANDBURNERWILL
light and operate as indicated in the instruction
MANUAL3UBSEQUENTLIGHTINGOFTHEAPPLIANCEWILL
NOTREQUIRESUCHPURGING)NSPECTTHEPILOTmAME
REMOVELOGSIFNECESSARYHANDLINGCAREFULLY
Electronic Appliance Checkout
4OLIGHTTHEBURNERTURNh/.vTHEOPTIONALREMOTE
wall switch or turn the appliance mounted ON/
/&& SWITCH TO THE h/.v POSITION %NSURE THE
igniter lights the pilot. The pilot flame should
engulf the flame sensor as shown in Figure 38.
3/8" NPT x 1/2" x 3/8" Flare
Flare Fitting Shut-off Valve
3/8" Flex Tubing
1/2" x 3/8"
Reducer
3/8" Nipple
Gas
Stub
Igniter
NOTE: The gas supply line must
be installed in accordance
with building codes by a qualified installer approved and/or
licensed as required by the
locality. In the Commonwealth
of Massachusetts, installation
must be performed by a licensed
plumber or gas fitter.
3/8" Union
3/8" Close
Nipple
3/8" Shut-off Valve
Gas Solid Line Connector
Pilot
Hood
Flame Rod
(Sensor)
3"
Min
*Sediment
Trap
Figure 38
Figure 36—Gas Connection
23
./4%$)!'2!-3),,5342!4)/.3!2%./44/3#!,%
)../6!4)6%(%!24(02/$5#43s$)2%#46%.4'!3&)2%0,!#%3-ONTEBELLO$,8-ONTEBELLO$,8#$s).34!,,!4)/.).3425#4)/.3
Step 8. INSTALL VOLCANIC STONE, GLOWING EMBERS, AND
LOGS (Traditional Only), or
GLASS MEDIA (Contemporary Only)
NOTE: If installing the Contemporary Burner/Floor Kit, skip
this step and instead refer to the instructions provided with
the kit.
Step 4. Position the individual logs as shown in Figures 42 through 46.
,OGSSHOULDBEPLACEDINTHEORDERSHOWNPlace logs 2 and 3
against the pins on the grate, NOT over them.
Proper log and twig placement is critical to encourage outstandINGmAMEAPPEARANCEANDPREVENTSOOTING7HENPOSITIONED
PROPERLY AS SHOWN TWIGS WILL BE POSITIONED BETWEEN mAME
PEAKSANDWILLNOTIMPINGEANYmAMES
Cat. No.
WARNING
s$/./4OPERATETHISAPPLIANCEWITHOUTTHE
required accessories properly installed:
- floor (log set or contemporary kit), and
- firebox liner panels (ceramic or porcelain).
Model
Description
88L53
FGE
Bag of Glowing Embers
80L42
FDVS
Bag of Volcanic Stone
H8312
PGE
Bag of Platinum Embers
Table 10—Firebox Accessories / Parts
WARNING
s DO NOT attempt to install the logs until the
appliance installation has been completed, the
gas line connected and tested for leaks and the
initial burner operation has been checked out.
s The size and position of the log set was engineered
to give the appliance a safe, reliable and attractive
flame pattern. Any attempt to use a different log
set in the fireplace will void the warranty and will
result in incomplete combustion, sooting, and
poor flame quality.
s Logs get very hot and will remain hot up to one
hour after gas supply is turned off. Handle only
when logs are cool. Turn off all electricity to the
appliance before you install grate, volcanic stone,
embers and logs.
s This appliance is not designed to burn wood. Any
attempt to do so could cause irreparable damage to
the appliance and prove hazardous to your safety.
s If logs are not installed according to the log
installation instructions, flame impingement and
improper combustion could occur and result in soot
and/or excessive production of carbon monoxide
(CO), a colorless, odorless, toxic gas.
Figure 39
For Propane Gas Only: Do Not Place Embers On Main Ports.
Glowing Embers (Rockwool)
Figure 40
Step 1. )NSTALL THE CERAMIC OR PORCELAIN lREBOX LINER PANELS PER THE
INSTRUCTIONSPROVIDEDINKIT.
24
Step 2. 0LACEVOLCANICSTONEAROUNDTHEBURNERTHEENTIREBAGOFVOLCANIC
STONEWILL./4BEUSEDDO NOT PLACE VOLCANIC STONE ON
THE BURNER. See Figure 41.
Step 3.3EPARATETHEGLOWINGEMBERSROCKWOOLINTOPIECESABOUTTHE
SIZEOFAQUARTER(see Figure 39)+EEPTHEPIECESmUFFEDNOT
MATTED$ISTRIBUTETHESEPIECESOVERTHEBURNERASSHOWNINFigure
40$ONOTUSEMORETHANNECESSARY7HENPROPERLYPOSITIONED
THE'LOWING%MBERSWILLCOVERAPPROXIMATELYOFTHEBURNER
ONNATURALGAS&ORPROPANEGASDONOTPLACEEMBERSONMAIN
ports.
NOTE: Excessive use of embers may result in sooting or poor flame.
This appliance is provided with enough Glowing Embers for several applications, do not feel compelled to use all that is in a new bag. For best
glowing effect, replace the ember material annually. Replacement Glowing
Embers are available (Catalog Number 88L53).
Volcanic Stone
Figure 41
./4%$)!'2!-3),,5342!4)/.3!2%./44/3#!,%
)../6!4)6%(%!24(02/$5#43s$)2%#46%.4'!3&)2%0,!#%3-ONTEBELLO$,8-ONTEBELLO$,8#$s).34!,,!4)/.).3425#4)/.3
Traditional Only: Log Placement
3
5
6
2
4
1
7
Log Number
Description
1
,OG#ENTER
2
,OG2EAR
,OG#ENTER,EFT
4
,OG#ENTER2IGHT
5
,OG2EAR4OP
6
,OG&RONT,EFT
,OG&RONT#ENTER
4
3
Engage Logs (3 & 4) With The Grate Pins And Align Groves At
The Bottom Of The Logs Over The Grate.
Figure 44 - Placing Logs 3 and 4
6
5
Align Hole At Bottom Of Log (5)
Over The Pin On Log (2).
7
2
Table 6 - Log Set
1
Engage Log (6) With The Grate Pin
And Align Groove At The Bottom Of
The Log Over The Grate.
Engage Log (7) With
The Pin On Log (4).
4
Figure 45 - Placing Logs 5, 6, and 7
Contemporary Only: Glass Media Placement
Align Two Holes At Bottom Of Log (1)
Over The Pins On The Gas Burner.
Figure 42 - Placing Log 1
3PREADATHINLAYEROFTHEMEDIAEVENLYONTHEBURNERAND
media screen.
2
Align Groove At The Bottom Of Log (2) Over
The Grate And Push It Towards The Rear.
Figure 43 - Placing Log 2
Figure 46 - Glass media installed
2. On the corner of the right media screen, arrange the media to allow
THEPILOTmAMETOREACHTHEBURNERDURINGLIGHTING
./4%$)!'2!-3),,5342!4)/.3!2%./44/3#!,%
25
)../6!4)6%(%!24(02/$5#43s$)2%#46%.4'!3&)2%0,!#%3-ONTEBELLO$,8-ONTEBELLO$,8#$s).34!,,!4)/.).3425#4)/.3
Step 9. INSTALLATION AND REMOVAL
OF GLASS DOOR
WARNING
s When reinstalling the glass
door, the door latch screws
must be securely tightened
to prevent the glass door
from falling out, which could
potentially cause damage and
possible injury.
s Do not attempt to substitute the
materials used on this door,
or replace cracked or broken
glass.
s Handle this glass with extreme
care! Glass is susceptible to
damage — Do not scratch or
handle roughly while reinstalling the glass door frame.
s The glass door of this appliance must only be replaced
as a complete unit as provided
by the manufacturer. Do not
attempt to replace broken,
cracked or chipped glass separately.
s Do not attempt to touch the
front enclosure glass with your
hands while the fireplace is in
use.
Installing Glass Enclosure Panel
(see Figure 47)
Retrieve the glass door. Visually inspect the
GASKET ON THE BACKSIDE OF THE FRAME 'ASKET
SURFACE MUST BE CLEAN FREE OF IRREGULARITIES
ANDSEATEDlRMLY
0OSITIONTHEDOORINFRONTOFTHElREBOXOPENING
with the top of the door held away from the
lREPLACE(Figure 47),OWERTHEBOTTOMOFTHE
DOORASSEMBLYONTHEBOTTOMDOORTRACKAND
set on padded surface. Pivot the door up after
ENGAGINGANDCENTERINGINTHEBASECHANNEL
Using a Phillips screwdriver, fasten the door
FRAMETOTHEDOORLATCHWITHTHETWOSCREWS
The latch should pull forward to engage the
door frame.
Install the door modesty shield on top flange
GLASSDOORASFOLLOWSGRABTHEDOORMODESTY
SHIELD WITH BOTH HANDS WITH THE OPEN HEM
going down and engage it with the upper lip
OFTHEGLASSDOORFRAMEBYPUSHINGITALLTHE
WAY DOWN -AKE SURE THE INSTALLED SHIELD IS
lRMLYINPLACE
7ITHTHElRESCREENHANGINGONTHESCREENROD
INSERTTHERIGHTSIDEOFTHERODINTOTHEEXISTING
HOLEONTHERIGHTMODESTYPANEL"ENDDOWN
the rod at the center and drop the left end into
THESLOTONTHELEFTMODESTYPANELBEINGCAREFUL
not to scratch the paint.
Top Flange Glass door
assembly
Glass Door Latch (2)
WARNING
Do not operate appliance with
the glass front removed, cracked
or broken.
Screws
AVERTISSEMENT
Ne pas utiliser l'appareil si le
panneau frontal en verre n'est
pas en place, est craqué ou
brisé.
Firebox Floor
Step 10. BURNER ADJUSTMENTS
Flame Appearance and sooting
Proper flame appearance is a flame which is
BLUEATTHEBASEANDBECOMESYELLOWISHORANGE
INTHEBODYOFTHEmAME7HENTHEAPPLIANCEIS
lRSTLITTHEENTIREmAMEMAYBEBLUEANDWILL
GRADUALLYTURNYELLOWISHORANGEDURINGTHElRST
15 minutes of operation. After 15 minutes of
OPERATIONIFTHEmAMEISBLUEORIFTHEmAMEIS
ORANGEWITHEVIDENCEOFSOOTINGBLACKTIPTHE
AIRSHUTTEROPENINGMAYNEEDTOBEADJUSTED
If the air shutter opening is closed too far,
SOOTINGMAYDEVELOP3OOTINGISINDICATEDBY
BLACKPUFFSDEVELOPINGATthe tips of very long
ORANGEmAMES3OOTINGRESULTSINBLACKDEPOSITS
forming on the logs, appliance inside surfaces
ANDONEXTERIORSURFACESADJACENTTOTHEVENT
termination.
3OOTINGISCAUSEDBYINCOMPLETECOMBUSTION
INTHEmAMESANDLACKOFCOMBUSTIONAIRENTERing the air shutter opening. To achieve a warm
YELLOWISHORANGE mAME WITH AN ORANGE BODY
THATDOESNOTSOOTTHESHUTTEROPENINGMUSTBE
ADJUSTEDBETWEENTHESETWOEXTREMES
Air Shutter Adjustment Guidelines
s )FTHEREISSMOKEORSOOTPRESENTlRSTCHECK
the log set positioning to ensure that the
flames are not impinging on any of the logs.
If the log set is properly positioned and a
SOOTING CONDITION STILL EXISTS THEN THE AIR
SHUTTEROPENINGSHOULDBEINCREASED
s 4HEMOREOFFSETSINTHEVENTSYSTEMTHELARGER
THEAIRSHUTTEROPENINGWILLNEEDTOBE
s !NAPPLIANCEOPERATEDWITHTHEAIRSHUTTER
opened too far, may have flames that appear
BLUEANDTRANSPARENT4HESEWEAKBLUEAND
transparent flames are termed anemic.
s 0ROPANEMODELSMAYEXHIBITmAMESWHICH
candle or appear stringy. If this is present
ANDPERSISTSADJUSTTHEAIRSHUTTERTOAMORE
closed position, then operate the appliance
for a few more minutes to ensure that the
flame normalizes and the flames do not
appear sooty.
The following chart is provided to aid you in
ACHIEVING THE CORRECT AIR SHUTTER ADJUSTMENT
for your installation.
Glass Door Assembly
Figure 47—Installing the Glass Door
Only doors certified with the appliance
shall be used.
Seules des portes certifiées pour cet
appareil doivent être utilisées.
WARNING: DO NOT abuse glass door by
striking or slamming shut.
26
./4%$)!'2!-3),,5342!4)/.3!2%./44/3#!,%
Amount of
Primary Air
Flame
Color
Air Shutter
Adjustment
If air shutter is
closed too far
Flame will
be orange
Air shutter
gap should be
increased
If air shutter is
open too far
Flame will
be blue
Air shutter
gap should be
decreased
)../6!4)6%(%!24(02/$5#43s$)2%#46%.4'!3&)2%0,!#%3-ONTEBELLO$,8-ONTEBELLO$,8#$s).34!,,!4)/.).3425#4)/.3
Burner Air Shutter Adjustment Procedure
Air Shutter
Opening
WARNING
s Air shutter adjustment should
only be performed by a qualified professional service
technician.
s Ensure that the front glass
door assembly is in place and
sealed After adjustment.
Main Burner Factory Air Shutter
Opening Setting—Inches (millimeter)
Model
Nat.Gas
Propane Gas
40 in.
1/16 (1.59)
9/32 (7.14)
45 in.
1/16 (1.59)
9/32 (7.14)
Venturi
Orifice
Gas
Valve
Burner
CAUTION
Soot will be produced if the air
shutter is closed too much. Any
damage due to carboning resulting from improperly setting the
air shutter is not covered under
the warranty.
Venturi
Figure 48
Contemporary Media Shown
4OADJUSTTHEmAMEROTATETHEAIRSHUTTERTOWARD
THEBACKORTOWARDTHEFRONTOFTHElREPLACE
Position the air shutter to the factory setting as
SHOWNINTHETABLEINFigure 48!LLOWTHEBURNER
TOOPERATEFORATLEASTMINUTES/BSERVETHE
mAMECONTINUOUSLY)FITAPPEARSWEAKORSOOTY
ASPREVIOUSLYDESCRIBEDADJUSTTHEAIRSHUTTER
until the flame appearance is as desired.
Use the remote to adjust the flame height
as desired.
0ROPANE MODELS MAY EXHIBIT A mAME PATTERN
that may candle or appear stringy. If this is
PROBLEMATIC OR PERSISTS AS THE APPLIANCE IS
CONTINUALLY OPERATED ADJUST THE AIR SHUTTER
CLOSEDASDESCRIBEDINTHEPREVIOUSPARAGRAPHS
Operate the appliance for a period of time as the
effect diminishes, ensuring that the appliance
DOESNOTDEVELOPSOOTYmAMES7HENSATISlED
that the appliance operates properly, proceed
TOlNISHTHEINSTALLATION
Figure 49—Burner Flame Appearance
Oak Logs Shown
Figure 50—Burner Flame Appearance
27
./4%$)!'2!-3),,5342!4)/.3!2%./44/3#!,%
)../6!4)6%(%!24(02/$5#43s$)2%#46%.4'!3&)2%0,!#%3-ONTEBELLO$,8-ONTEBELLO$,8#$s).34!,,!4)/.).3425#4)/.3
FINISHING REQUIREMENTS
Wall Details
.ONCOMBUSTIBLEMATERIALSSUCHASSURROUNDSANDOTHERAPPLIANCETRIM
MAYBEINSTALLEDONTHEAPPLIANCEFRONTFACEWITHTHEEXCEPTIONS
#OMPLETElNISHEDINTERIORWALL4OINSTALLTHEAPPLIANCEFACINGmUSHWITH
THElNISHEDWALLPOSITIONFRAMEWORKTOACCOMMODATETHETHICKNESSOF
THElNISHEDWALL(Figure 51).
6ERTICALINSTALLATIONCLEARANCESTOCOMBUSTIBLEMANTELSVARYACCORDING
TOTHEDEPTHOFTHEMANTELSEEFigure 8)-ANTELSCONSTRUCTEDOFNON
COMBUSTIBLEMATERIALSMAYBEINSTALLEDATANYHEIGHTABOVETHEAPPLIANCE
opening.
#OMBUSTIBLEMATERIALSMAYPROJECTBEYONDTHESIDEOFTHElREPLACEOPENINGASLONGASITISKEPTWITHINTHESHADEDAREAILLUSTRATEDINFigure 9.
3" Min.
Combustible
Finished Wall
Materials
(76 mm)*
Header
(2x4’s)
Combustible
materials are
allowed above
this point on
the face of the
appliance.
2 Foot Vertical
Vent & 90° Elbow
1*
8-3/8" Min.
(213 mm)
Top of
Appliance
The gray shaded
area must be
non-combustible
or Dura Rock
Spacers
Top of Door Frame
Finish Combustible
Or Non-Combustible
Material
Fireplace (right side)
Front Face
Of Fireplace
Floor Panel
Figure 52
1Installations with horizontal terminations which have minimum
vertical vent height only will require 4”(102mm) minimum
side clearance as shown in shaded zone above. All other
installations require 1" (25mm) minimum side clearance as
specified in Figure 4 on Page 6.
Glass Door
Assembly
Fireplace
* Insulation is NOT ALLOWED in the clearance zones around vent
components. Keep this area free from combustible materials.
Figure 51
!HEARTHEXTENSIONISNOTREQUIREDWITHTHISAPPLIANCE)FAHEARTHEXTENSION
ISUSEDTHEREARETWOMETHODSOFINSTALLATION/NETHElNISHCOMBUSTIBLE
ORNONCOMBUSTIBLEMATERIALCOULDBEENDEDBYBUTTINGUPAGAINSTTHE
FRONTFACEOFTHElREPLACEANDTHEmOORPANELrefer to Figure 52).
28
4WOTHElNISHCOMBUSTIBLEORNONCOMBUSTIBLEMATERIALCOULDBEENDED
BELOWTHElREPLACE (refer to Figure 53). Remove the floor panel as shown
in Figure 52BYREMOVINGTHESCREWSONTHERIGHTSIDEOFTHEPANELAND
SLIDINGTHELEFTSIDEAWAYFROMTHETAB$ISCARDTHESCREWSANDmOORPANEL
It is critical that there is at least a 1/8" gap between the bottom of the
door track and the surface of the finish material.
1/8”
Minimum
Finish Combustible
Or Non-Combustible
Material
Figure 53
./4%$)!'2!-3),,5342!4)/.3!2%./44/3#!,%
Door Track
Bottom Of
Fireplace
)../6!4)6%(%!24(02/$5#43s$)2%#46%.4'!3&)2%0,!#%3-ONTEBELLO$,8-ONTEBELLO$,8#$s).34!,,!4)/.).3425#4)/.3
Step 11. INSTALLER INSTRUCTIONS—ATTACHING SAFETY-IN-OPERATION WARNINGS
It is the installers responsibility to ensure these warnings are properly affixed during installation. These warning labels are a
critical step in informing consumers of safe operation of this appliance.
ATTACHING SAFETY IN OPERATION WARNINGS
)TISREQUIREDTHATTHESETOFSAFETYINSTRUCTIONLABELS
THATHAVEBEENFURNISHEDWITHTHElREPLACEBEAFlXED
TOTHEOPERATIONANDCONTROLPOINTSOFTHElREPLACE!
SAFETYINSTRUCTIONLABELMUSTBEAFlXEDTOTHERECEIVER
WALLSWITCHPLATEWHERETHElREPLACEISTURNEDONAND
off (See Figure A) and on the remote control handheld
transmitter (See Figure B). To properly complete the
INSTALLATIONOFTHISlREPLACELOCATETHEMULTILINGUAL
ADHESIVELABELSPROVIDEDWITHTHE#AREAND/PERATION
Instructions and proceed as follows:
,OCATETHEWALLRECEIVERTHATCONTROLSTHElREPLACE
VERIFYTHESWITCHOPERATESTHElREPLACEBYTURNINGITONANDOFF#LEANTHEWALLRECEIVERPLATE
THOROUGHLYTOREMOVEANYDUSTANDOILS!FlXTHE
LABELTOTHESURFACEOFTHEPLATEOFTHEWALLRECEIVER
THATCONTROLSTHElREPLACE(Figure A). Choose
THELANGUAGEPRIMARILYSPOKENINTHEHOME)F
UNKNOWNAFlXTHE%NGLISHLANGUAGELABEL
,OCATETHEREMOTECONTROLTRANSMITTERANDCLEAN
ITTHOROUGHLYTOREMOVEANYDUSTANDOILS!FlX
THELABELTOTHESURFACEOFHANDHELDTRANSMITTER
(Figure B). Choose the language primarily spoKENINTHEHOME)FUNKNOWNAFlXTHE%NGLISH
LANGUAGELABEL
)F YOU ARE UNABLE TO LOCATE THE LABELS PLEASE
call Innovative Hearth Products or your nearest
Innovative Hearth Products dealer to receive adDITIONALSAFETYINSTRUCTIONLABELSFREEOFCHARGE
#AT.O(2EPLACEMENT,ABEL+IT
NOTE: English is red text on clear label. French
and Spanish are white text on black label.
SAFETY LABEL
DIAGRAMS
APPOSITION DES MISES EN GARDE RELATIVES
À LA SÉCURITÉ D’UTILISATION
)LESTIMP£RATIFQUELEJEUD£TIQUETTESDES£CURIT£QUI
ONT £T£ FOURNIES AVEC LE FOYER SOIENT COLL£ES Ü C¹T£
DESDISPOSITIFSDECONTR¹LEDUFOYER5NE£TIQUETTEDE
S£CURIT£DOITäTRECOLL£ESURLAPLAQUEDUR£CEPTEURMURAL
CONTR¹LANTLALLUMAGEDUFOYER(voir Figure A) et sur le
BO¦TIERDELAT£L£COMMANDE(Figure B). Pour achever
LINSTALLATIONCORRECTEDECEFOYERPROC£DEZCOMMESUIT
AVEC LES £TIQUETTES ADH£SIVES EN LANGUES £TRANGáRES
FOURNIESAVECLESINSTRUCTIONSDUTILISATIONETDENTRETIEN
2EP£REZ LE R£CEPTEUR MURAL QUI CONTR¹LE LE FOYER
V£RIlEZ QUE LINTERRUPTEUR CONTR¹LE LE FONCTION
NEMENTDUFOYERENLEFAISANTBASCULERDE-ARCHE
Ü !RRäT ET VICEVERSA .ETTOYEZ SOIGNEUSEMENT
LA PLAQUE DU R£CEPTEUR MURAL POUR £LIMINER LA
POUSSIáREETLESTRACESDEGRAISSEOUDHUILE#OLLEZ
L£TIQUETTESURLASURFACEDELAPLAQUEDUR£CEPTEUR
MURALQUICONTR¹LELEFOYER(Figure A). Choisissez
LA LANGUE QUI EST PRINCIPALEMENT PARL£E DANS LA
résidence du propriétaire. En cas de doute, collez
L£TIQUETTEENANGLAIS
2. Repérez la télécommande et nettoyez-la soigneuseMENT POUR £LIMINER LA POUSSIáRE ET LES TRACES
DEGRAISSEOUDHUILE#OLLEZL£TIQUETTESURLEBO¦TIER
de la télécommande (Figure B). Choisissez la
LANGUE QUI EST PRINCIPALEMENT PARL£E DANS LA
résidence du propriétaire. En cas de doute, collez
L£TIQUETTEENANGLAIS
3I VOUS NE TROUVEZ PAS LES £TIQUETTES VEUILLEZ
APPELER)NNOVATIVE(EARTH0RODUCTSOUVOTREDISTRIBU
teur Innovative Hearth Products local pour recevoir
GRATUITEMENTDES£TIQUETTESSUPPL£MENTAIRES
»TIQUETTESDEREMPLACEMENTN—CAT(
Remarque : Le texte anglais est rouge sur un support
transparent. Le texte français et espagnol est blanc
sur un support noir.
DIAGRAMMES DES ÉTIQUETTES
DE SÉCURITÉ
COLOCACIÓN DE ADVERTENCIAS DE SEGURIDAD
EN OPERACIÓN
3EREQUIEREQUEELJUEGODEETIQUETASDEINSTRUCCIONES
DESEGURIDADQUESEINCLUYERONCONLACHIMENEASE
COLOQUE EN LOS PUNTOS DE OPERACI˜N Y CONTROL DE LA
MISMA3EDEBECOLOCARUNAETIQUETADEINSTRUCCIONES
de seguridad en la placa del interruptor de pared
del receptor desde el cual se enciende y se apaga
la chimenea (ver la Figura A) y en el transmisor de
control remoto (ver la Figura B). Para completar
correctamente la instalación de esta chimenea,
ENCUENTRE LAS ETIQUETAS ADHESIVAS MULTILINGÓES
incluidas con las instrucciones de cuidado y operación
y haga lo siguiente:
)DENTIlQUE EL RECEPTOR DE PARED QUE CONTROLA LA
CHIMENEA VERIlQUE QUE EL INTERRUPTOR OPERA LA
CHIMENEA ENCENDI£NDOLA Y APAGÖNDOLA ,IMPIE
BIENLAPLACADELRECEPTORDEPAREDPARAQUITAREL
POLVOYACEITE0EGUELAETIQUETAENLASUPERlCIE
DELAPLACADELRECEPTORDEPAREDQUECONTROLALA
chimenea (Figura A). 3ELECCIONE EL IDIOMA QUE
MÖSSEHABLAENLACASA3INOSABECUÖLESUSELA
ETIQUETAENINGL£S
)DENTIlQUEELTRANSMISORDECONTROLREMOTOYL¤MPIELO
BIENPARAQUITARELPOLVOYACEITE0EGUELAETIQUETA
ENLASUPERlCIEDELTRANSMISOR(Figura B). Seleccione
ELIDIOMAQUEMÖSSEHABLAENLACASA3INOSABE
CUÖLESUSELAETIQUETAENINGL£S
3INOPUEDEENCONTRARLASETIQUETASS¤RVASELLAMAR
A)NNOVATIVE(EARTH0RODUCTSOALDISTRIBUIDORDE
Innovative Hearth Products más cercano para
RECIBIR ETIQUETAS DE INSTRUCCIONES DE SEGURIDAD
adicionales gratuitas.
*UEGODEETIQUETASDEREPUESTOˆ.ŽDECAT(
Nota: La etiqueta en inglés es transparente con texto
rojo. Las etiquetas en francés y español son negras
con texto blanco.
DIAGRAMAS DE ETIQUETAS
DE SEGURIDAD
Illustrations are for example only.
Your accessories may be different.
Les illustrations sont par exemple
uniquement. Vos accessoires
peuvent être différents.
Las ilustraciones son sólo ejemplos.
Tu accesorios pueden ser diferentes.
Figure A
On
Remote
Figure B
Off
PRG
Figure 54
29
./4%$)!'2!-3),,5342!4)/.3!2%./44/3#!,%
)../6!4)6%(%!24(02/$5#43s$)2%#46%.4'!3&)2%0,!#%3-ONTEBELLO$,8-ONTEBELLO$,8#$s).34!,,!4)/.).3425#4)/.3
INSTALLATION ACCESSORIES
Listed Secure Vent® Components
Cat.
No.
Model
No.
H2266
SV8HTS
H2265
SV8VTR
H2262
SV8SU
Support Strap
H2263
SV8SP
Support Plate
H3908
SV8ARSA
Description
Horizontal Square
Termination with
Firestop/Spacer
(H2260) and
Adaptor (H2267)
Attic Insulation
Shield (adjustable
12" to 22")
Vertical Termination
CTSO-46 Shroud
for double
terminations
CTSO-33/44 Shrouds
for Single terminations
1 typ.
C
1 typ.
2a
H2250
H2251
SV8L6
SV8L12
6" (152mm) Vent
Section
12" (305mm) Vent
Section
H2252
SV8L24
24" (610mm) Vent
Section
H2253
SV8L36
36" (914mm) Vent
Section
H2254
SV8L48
48" (1219mm) Vent
Section
H2255
SV8LA
Telescopic Section
H2256
SV8E45
45 Degree Elbow
H2257
SV8E90
2b
C
2b
D
2b
B
2a
A
B
A
Open Top Shroud Kits
Inches (millimeters)
Cat. No.
Model
A
B
C
D
*E
H1985
CTSO-33
37-5/8
(955)
37-5/8
(955)
7-1/2
(191)
24-1/2
(622)
3
(76)
H1987
CTSO-44
48-5/8
(1235)
48-5/8
(1235)
7-1/2
(191)
24-1/2
(622)
3
(76)
H1986
CTSO-46
48-5/8
(1235)
73 1/4
(1860)
7-1/2
(191)
24-1/2
(622)
3
(76)
90 Degree Elbow
H3236
SV8F
Flat Roof Flashing
H2258
SV8FA
1/12 to 7/12 Adjustable Flashing
H2259
SV8FB
7/12 to 12/12
Adjustable Flashing
H3237
SV8SC6
Storm Collars,
6 pack
H2260
SV8HF
Firestop/Spacer—
Horizontal
(3-1-1 spacing)
SV8BF
E
2a
The following flashings come packaged
with a storm collar
H2261
2 typ.
E D
2a
A
B
D
C
Closed Top Shroud Termination Kits
Inches (millimeters)
Cat. No.
Model
A
B
C
D
H1988
CTSA-33
34
(864)
5
(127)
34
(864)
34
(864)
Firestop/Spacer—
Vertical
(1-1-1 spacing)
30
./4%$)!'2!-3),,5342!4)/.3!2%./44/3#!,%
)../6!4)6%(%!24(02/$5#43s$)2%#46%.4'!3&)2%0,!#%3-ONTEBELLO$,8-ONTEBELLO$,8#$s).34!,,!4)/.).3425#4)/.3
GAS CONVERSION KITS
Step 1. TURN OFF THE GAS SUPPLY TO THE
APPLIANCE and disconnect power supply at
the circuit breaker. Ensure appliance is cold.
WARNING
This conversion kit shall be installed by a qualified service agency in
accordance with the manufacturer’s instructions and all applicable codes
and requirements of the authority having jurisdiction. If the information in
these instruction is not followed exactly, a fire, explosion or production of
carbon monoxide may result causing property damage, personal injury
or loss of life. The qualified service agency is responsible for the proper
installation of this kit. The installation is not proper and complete until the
operation of the converted appliance is checked as specified in the manufacturer’s instructions supplied with the kit. The qualified service agency
performing this installation assumes responsibility for this conversion.
AVERTISSEMENT
Cette trousse de conversion doit être installée par un technicien agréé,
selon les instructions du fabricant et selon toutes les exigences et tous les
codes pertinents de l’autorité compétente. Assurez-vous de bien suivre
les instructions dans cette notice pour réduire au minimum le risque
d’incendie, d’explosion ou la production de monoxyde de carbone pouvant
causer des dommages matériels, des blessures ou la mort. Le tecnicien
agréé est responsable de l’installation de cette trousse. L’installation n’est
pas adéquate ni complète tant que le bon fonctionnement de l’appareil
converti n’a pas été vérifié selon les instructions du fabricant fournies avec
la trousse. Le fournisseur de service qualifié ayant réalisé l'installation
assume les responsabilités liées à la conversion.
In Canada:
THE CONVERSION SHALL BE CARRIED OUT IN ACCORDANCE WITH THE
REQUIREMENTS OF THE PROVINCIAL
AUTHORITIES HAVING JURISDICTION
AND IN ACCORDANCE WITH THE REQUIREMENTS OF THE CAN/CGA-B149.1
INSTALLATION CODE.
LA CONVERSION DEVRA ÊTRE EFFECTUÉE CONFORMÉMENT AUX
RECOMMANDATIONS DES AUTORITÉS
PROVINCIALES AYANT JURIDICTION
ET CONFORMÉMENT AUX EXIGENCES
DU CODE D'INSTALLATION CAN/CGAB149.1.
'ASCONVERSIONKITSAREAVAILABLETOADAPTYOUR
appliance from the use of one type of gas to
THEUSEOFANOTHER4HESEKITSCONTAINALLTHE
necessary components needed to complete the
TASKINCLUDINGLABELINGTHATMUSTBEAFlXEDTO
ensure safe operation.
CAUTION: THE GAS SUPPLY SHALL BE
SHUT OFF PRIOR TO DISCONNECTING THE
ELECTRICAL POWER, BEFORE PROCEEDING
WITH THE CONVERSION.
ATTENTION. AVANT D’EFFECTUER
LA CONVERSION, COUPEZ D’ABORD
L’ALIMENTATION EN GAZ, ENSUITE,
COUPEZ L’ALIMENTATION ÉLECTRIQUE.
Step 2. Remove the front glass door/frame
and the access plate from the appliance. See
Figures 37 and 47.
Step 3. Carefully remove the logs and the grate
ASSEMBLYCONTEMPORARYMEDIAExercise care
so as not to break the logs / contemporary
media.
Step 4. Refer to Figure 55. Remove the two
SCREWSSECURINGTHEBURNERTOTHEBURNER
BRACKETS#AREFULLYSLIDETHEBURNERTOTHELEFT
TOCLEARTHEVENTURIFROMTHEORIlCE3ETASIDE
THE SCREWS AND BURNER ASSEMBLY IN A SECURE
location for later reinstallation.
Burner Assembly
+ITPARTNUMBERSARELISTEDBELOWANDTHEFOLlowing steps detail the conversion procedure.
Natural Gas to Propane Gas
Conversion Kits
Fireplace
Conversion Kit
Model No.
Cat. No.
40 in.
GCKMDLX40NP
H8668
45 in.
GCKMDLX45NP
H8669
Propane Gas to Natural Gas
Conversion Kits
Fireplace
Conversion Kit Conversion
Model No.
Kit Cat. No.
40 in.
GCK-MDLX40PN
H8670
45 in.
GCK-MDLX45PN
H8671
Gas Valve Assembly
Burner Orifice
Figure 55
Step 5. Remove the control compartment access
DOORANDGASKETBYREMOVINGTHETWELVE
screws securing it, and set it aside for later reinSTALLATION4HEGASVALVECANBEACCESSEDTHROUGH
THEOPENINGORTHECOMPLETEASSEMBLYCANBE
REMOVEDBYSLIDINGTHEASSEMBLYTOTHERIGHT
31
./4%$)!'2!-3),,5342!4)/.3!2%./44/3#!,%
)../6!4)6%(%!24(02/$5#43s$)2%#46%.4'!3&)2%0,!#%3-ONTEBELLO$,8-ONTEBELLO$,8#$s).34!,,!4)/.).3425#4)/.3
Step 6. Refer to the instructions provided
WITHTHE3)4REGULATORCONVERSIONKIT5SINGA
4ORX4WITHSHANKANDCENTERHOLEOR
slotted screwdriver, remove and discard the
two pressure regulator mounting screws, the
pressure regulator tower, and the diaphragm
ASSEMBLYIFAPPLICABLEProperly dispose of
all removed components-AKESURETHERUBBER
GASKETINSTALLEDONTHEBACKOFTHEREPLACEMENT
pressure regulator is properly positioned.
Step 7. Install the new stepper motor pressure
REGULATORASSEMBLYUSINGTHESUPPLIEDSCREWS
3ECURELYTIGHTENTHESCREWSINLBS
Step 8. !TTACHTHEENCLOSEDIDENTIlCATIONLABEL
TOTHEVALVEBODYWHEREITCANBEEASILYSEEN
Step 9. -AKE STEPPER MOTOR AND VALVE
electrical connections.
Step 10. 2EMOVETHEPILOTHOODASSEMBLYTO
ACCESSTHEHEXEDPILOTORIlCE5SINGAALLENWRENCHREMOVEANDREPLACETHEPILOTORIlCE
WITHTHEONEPROVIDEDWITHTHEKIT
NOTE: Use extreme care to avoid
damaging the igniter assembly.
Step 11. Refer to Figure 57 and remove the
PILOTHOODASSEMBLYTOACCESSTHEHEXEDPILOT
ORIlCE2EMOVEANDREPLACETHEORIlCEWITHTHE
ONEPROVIDEDWITHTHEKIT
Step 122EFERTOFigure 55 on Page 31 and
Figure 58)
VERIFY THE PROPER ORIFICE SIZE BEFORE INSTALLING IT.
Pilot
Hood
Burner Orifice Sizes
Elevation 0-4500 feet ( 0-1372 meters)
Natural Gas
Model
drill size (inches)
40 in.
0.1405" (#28)*
s(
0.086" (#44)*
s(
45 in.
0.161" (#20)*
s(
0.093" (#42)*
s(
* Standard size installed at factory
s0ART#AT.UMBER
Table 11
Pilot
Orifice
Figure 57
A.2EMOVETHEORIlCEFROMTHEMANIFOLDAND
REPLACEITWITHTHEONEPROVIDEDINTHEKIT3EE
THEFOLLOWINGTABLEFORORIlCESIZESFORNATURAL
and propane models. Figure 58 illustrates
THEORIlCE5SEPIPEJOINTCOMPOUNDOR4EFLONTAPEONALLPIPElTTINGSBEFOREINSTALLING
ENSUREPROPANERESISTANTCOMPOUNDSARE
used in propane applications, do not use pipe
JOINTCOMPOUNDSONmARElTTINGS
Step 16. 2ELIGHT THE MAIN BURNER AND VERIFY
PROPERBURNERIGNITIONANDOPERATION3EEBurner
Adjustments Pages 26 and 27.
B.2ETRIEVETHEBURNERANDSLIDETHEVENTURITUBE
OVERTHEORIlCE3ETTHEBURNERASSEMBLYINTO
its position and secure it.
Inspect the pilot system for proper flame. The
pilot flame should engulf the flame sensor as
shown in Figure 59.
C.2EINSTALLTHEGRATEASSEMBLY
4HELIGHTINGINSTRUCTIONSCANBEFOUNDONTHE
LIGHTINGLABELINTHECONTROLCOMPARTMENTORIN
THE#AREAND/PERATION-ANUALPROVIDEDWITH
the appliance.
Step 13. 2EASSEMBLE THE REMAINING COMPONENTSBYREVERSINGTHEPROCEDURESOUTLINEDIN
the preceding steps.
Step 14.!TTACHTHECONVERSIONLABELPROVIDED
INTHECONVERSIONKITTOTHERATINGPLATEONTHE
appliance.
Step 15. Apply gas to the system and relight
APPLIANCE7ITHTHEMAINBURNER/.TESTTHE
NEWPRESSUREREGULATORASSEMBLYANDALLGAS
LINEJOINTSFORLEAKSUSINGAGASLEAKTESTSOLUtion. See Test All Connections For Gas Leaks
on Page 23.
Figure 58
Step 17. Using a manometer, test the inlet and
manifold gas pressures. See Tables 2 and 3
on Page 4.
ALWAYS TEST PRESSURES WITH THE VALVE
REGULATOR CONTROL AT THE HIGHEST
SETTING.
SEE PAGE 26 FOR AIR SHUTTER ADJUSTMENT
GUIDELINES.
Igniter Rod
Green Wire
(from DFC Wire Harness)
Manifold (OUT) Test Port
Inlet (IN) Test Port
Connect GTMS
wire harness.
Flame
Sensor
Pressure Regulator
Tower
Wire
(from DFC Wire
Harness)
Figure 59
Main Gas Inlet
3/8" NPT
32
Propane
drill size (inches)
Yellow Ground Wire
(from DFC Wire Harness)
Figure 56
./4%$)!'2!-3),,5342!4)/.3!2%./44/3#!,%
Pilot Hood
Pilot
Nozzles
)../6!4)6%(%!24(02/$5#43s$)2%#46%.4'!3&)2%0,!#%3-ONTEBELLO$,8-ONTEBELLO$,8#$s).34!,,!4)/.).3425#4)/.3
NOTES
33
)../6!4)6%(%!24(02/$5#43s$)2%#46%.4'!3&)2%0,!#%3-ONTEBELLO$,8-ONTEBELLO$,8#$s).34!,,!4)/.).3425#4)/.3
)NNOVATIVE(EARTH0RODUCTSRESERVESTHERIGHTTOMAKECHANGESATANYTIMEWITHOUTNOTICE
IN DESIGN MATERIALS SPECIlCATIONS AND PRICES AND ALSO TO DISCONTINUE COLORS STYLES AND
PRODUCTS#ONSULTYOURLOCALDISTRIBUTORFORlREPLACECODEINFORMATION
0RINTEDIN53!Ú)NNOVATIVE(EARTH0RODUCTS,,#
34
P/N 506023-22 Rev. NC 12/2013
%LM(ILL0IKE3UITEs.ASHVILLE4.