Motorola 68000202881-A User guide

Supplemental Exhibit 36
Motorola Droid 2 User Guide
User Guide
Congratulations
DROIDZ by Motorola
_
_
_ _
_
DROIDZ
by
Motorola
gives
you
a
high
quality
imaging,
video, and multimedia experience. Your new phone
also syncs , feeds, messages, emails, photos, and
much more—from sources like Facebook, Twitter,
Myspace, Gmail, your email at work—and serves
them all up lust the Wav YOU Want them.
More
- A
:Touch G > Hel Center.
"“”°"
. your home
" screen left or right
. to
You
can also flick
see the ups & Tricks widgets‘
_
' Updates: Ph°"° "pdat°5- PC 5°fl_“'a'°- °"""° h°'P
""1 m°'° at
*
0 Accessories: Find accessories for your phone at
.
- Download BLOCKBUSTER videos, straight to your
handset.
- Stream and store multimedia on any DLNAT"
Certified device in your home network. No memory
cards to swap, no cables to attach.
0 DROID2 by Motorola syncs your favorite social
networking sites—all your messages, all the latest
updates—so you can stay connected, right from
you, home sc,een_
Caution: Before assembling, charging or using your
phone for the first time, please read the important
legal and safety information packaged with your
phone. Once your phone is up and running, touch
Menu E] > Settings > About phone > Safety
information to read the full information.
Notes.
'
_
_
_
_
- All screen shots in this guide are simulated.
Actual displays may vary.
0 Instructions to perform tasks in this guide may
diange depending on the software version on
your phone.
0 Unless specified otherwise, all instructions to
perform tasks in this guide assume that you are
starting from the home screen.
Your phone
the important keys & connectors
@ Power Kev
Press « sleep.
Had _ on/off
3~5'““‘
Headset Jack
Mlao USB
Connocmr
Charge 0!
connect
to PC.
When you open or tum your phone,
the screen adjusts for you.
Volume Keys
1buchscmIn
Home Kay [E]
[3] Bad: Kw
.'
[E] Shift
@ Altomato
Mlcrop hone
To
type theat the
chovacter
1
::::;;°*°*t
then the ey.
_
_
Emoamn
W8
saw
3 Space
Contents
Let's go . . . . . . . . . . . . . . . . . . . . .
Touchscreen & keys . . . . . . . . . . .
Home screen . . . . . . . . . . . . . . . .
Calls . . . . . . . . . . . . _ _ . _ _ . . . . . .
Contacts . . . . . . . . . . . . . . . . . . . .
Text entry . . . . . _ . . _ _ . _ _ . . _ . . _
Tips & tricks . . . . . . . . . . . . . . . . .
Digital living . . . _ . . _ _ . _ _ . . _ . . .
Photos & videos . . . . . . . . . . . . . .
Music . . . . . _ . . _ . . _ _ . _ . . . _ . . _
YouTube“’' . . . . i . . i . . i i . . i . . i .
Messaging . . . . . . . . . . . . . . . . . .
Social networking . . . . . . . . . . . . .
Web . . . . . . . . . . . . . . . . . . . . . . .
Personalize . . . . . . . . . . . . . . . . . .
Maps . . . . . . . . i . . i . . . . . . . . . . .
Latitude . . . . . . . . . . . . . . . . . . . . .
Apps for all . . . . . . . . . . . . . . . . i .
B|uetooth®wireless . . . . . . . . . . .
Wi-Fi® . . . . . . . . . . . . . . . . . i . . i .
Memory card & file management .
Tools . . . . . . . . . . . . . . . . . . . . . . .
Management . . . . . . . . . . . . . . . .
Security . . . . . . . . . . . . . . . . . . . . .
Troubleshooting . . . . . . . . . . . . . .
Safety, Regulatory & Legal . i . . i .
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
i
.
.
.
.
.
.
.
.
i
.
.
.
.
.
i
.
.
.
_
.
_
.
.
.
_
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
_
.
_
.
.
.
_
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
_
.
_
.
.
.
_
i
.
.
.
.
.
.
.
.
.
.
.
.
.
.
i
.
.
.
_
.
_
.
.
.
_
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
i
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
_
.
.
.
_
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
. .
. .
. .
. .
. .
. .
. .
. .
. .
. _
1 .
. .
. .
. .
. .
. .
1.
. .
1.
4.
. .
..
. .
. .
. .
. .
.
.
.
.
.
.
.
3
5
8
11
13
16
19
20
22
26
30
31
34
35
37
39
41
42
44
45
47
49
50
51
52
53
Let's go
lets get you up and running
Assemble & charge
1 MicroSD in (may
already be inserted)
2 Battery in
s°3@
4 Charge up
§ PI■■
Caution: Please read the battery use and safety text in
the important legal and safety information packaged
with your phone.
Tip: To save battery life, see "Battery tips" on page 19.
Contents
3
Set up & go
The first time you tum on your phone, a setup wizard
guides you through signing in to your Gmail"" account.
If you don't have one, don't worry, the wizard will help
you create one.
After you log into Gmail, you n set up social
networking, or you can do it later.
Note: This phone supports dataintensive apps and
services. It is strongly recommended that you
purchase a data plan that meets your needs. Contact
your service provider for details.
1 Press and hold Power
on
top of your phoneto him iton.
@
2 Select a language.
3 Follow the setup wizard to
create or log in to your Gmail account.
Note: If you have an existing Gmail account, your
contacts from that account are synced to your phone.
Whenever you choose to select all contacts for the one
you want, your phone shows every contact, in every
groups.
Wi-Fi connect
If you want to use a Wi-Fi computer network for even
faster lntemet access, toudn Menu @] > Settings
> Wireless & networks > Wi-Fi settings.
Cool content & more
Browse and download thousands of the coolest apps
on the planet from Android Market”.
Your phone comes with a microSD memory rd
instaIled—you can load it up with photos, videos, and
music from your computer using ‘Memory card" on
page 47.
Touchscreen & keys
a few essentials
Touch tips
Here are some tips on how to navigate around your
phone.
Touch
To choose an icon or
option, touch it.
Touch & hold
To open special options,
touch and hold an icon
or other item. Try it: In
the home screen, touch
&, Contacts, then
touch and hold a
contact to open
options.
Drag
To scroll through a list or
move slowly, drag across
the touchscreen. Try it:
In the home screen,
touch ,& Contacts, then
drag your Contacts list
up or down.
Tip: When you drag or
flick a list, a scroll bar
appears on the right.
Drag the scroll bar to
move the list to a letter
A - Z.
Flick
Conlxts All com
v Artrur Bar do
To scroll through a list or move quickly, flick across the
touchscreen (drag quickly and release).
Tip: When you flick a long list, touch the screen to stop
it from scrolling.
Zoom
Get a closer look at maps or web pages. To zoom in,
doubletoudt the screen. To zoom out, double touch
the screen again.
You can also zoom in or out by pinching your fingers
together or moving them apart on the screen.
hold Home [E] to show the last few apps you used,
then touch an app to open it.
Touch Search Q] for text search, or touch and hold for
voice search.
Touch Menu
to open menu options, or touch
Back
to go back.
Sleep & wake up
To save your battery, prevent
accidental touches, or when you
want to wipe smudges off your
touchscreen, put the touchscreen to
sleep by pressing Power To
wake u the touchscreen, just press
Power @ again, or open the phone.
To change how long your phone waits before the
screen goes to sleep automatically, touch Menu
> Settings > Display > Screen timeout.
Tip: To make the screen lock when it goes to sleep,
use "Screen lock'' on page 51. To unlock the screen,
press Power @or open the phone. Then, drag . to
the right.
Key tips
Menu Key
Home Key @ @ Bad: Key [gsonnh Key
Touch Home E] to close any menu or app and return
to the home screen. In the home screen, touch and
Power key menu
Press and hold Power
to open the power key
menu, where you can turn off the phone (Power off),
or turn Airplane mode or Silent mode on or off.
Adjust volume
Press the volume keys to
change the ring volume (in
the home screen). or the
earpiece vo|ume (during a
ca||)_
+
:l—_V0|IIIIIe KEYS
See item options—Open
an options menu (if
Touch & hold the
item.
available)
screen. for an item on the
Start again—Go back to
the home screen.
Toudt Home [E]
When you rotate the phone 90 degrees
counterclockwise, the touchscreen can rotate to stay
right-side up:
wake up your
phone—Tum on a sleeping
Press Power E] or
open the phone.
Find
it: Menu @]
> Settings > Display
>
Auto-rotate
screen
t°”d‘5°'9°"-
Rotate the screen
Quick tips
If ever you're not sure what to do next, try one of
these:
Get the details—Open a
text message, see details
for a contact, or open items
in other lists.
Touch the message,
contact, or item.
See screen menu—Open a
menu for the current
screen.
Touch Menu 38
Home screen
quick access to the things you need most
Quick start: Home screen
The home screen gives you all your latest information
in one place. It's what ou see when you turn on the
phone or touch Home
from a menu. lt's basically
like this:
Note: Your home screen might look a little different.
The home screen extends beyond what you see on
the screen to give you more room for adding
shortcuts, widgets, and more. Flick the home screen
left and right to see more panels or to add widgets or
shortcuts.
Notifications
F||d( this bar down to see
|
detalls.
153 3 Status Indicators
1 Flldt
left orscreens.
rlght to
see more
shortcuts
Touch to open.
Launcher Icon
Open the app menu.
8
Home screen
Widgets
A widget is small app on the home screen that
typically displays information such as weather, news,
and social networking updates. You can add a widget,
such as a clock, music player, or a calendar that shows
upcoming appointments. To open a widget, touch it.
To add a widget, touch an empty spot on the home
screen. (You can also touch Menu
> Add
> Widgets.) If your home screen is full, you won't see
the add option. You'll need to move or delete widgets
or shortcuts to make room.
You can change a widget's size. Just touch and hold
the widget. When the widget's outline turns white,
drag one of the comers to make it the size you want.
Note: If you install apps from Android Market that
have widgets, touch and hold the home screen, then
select a widget to add to the home screen.
Flick up and down to see all of your apps. Any new
apps that you download (see page "Android Market"’‘"
on page 42) are added to the app tray.
Shortcuts
To add shortcuts to the home screen, open the app
menu, then touch and hold the shortcut you want. It
will be added to the home screen. Or, touch Menu
> Add > Shortcuts.
App tray
Quick start: App tray
The App tray shows you all
of your applications. To open
it from the home screen,
touch Launcher icon Ðýã■
u
Ij Touch
return to
home to
SCYGHI.
To close the app tray, touch Q at the bottom of the
tray, or touch Home Q] or Back .
Recent apps
Touch and hold Home @] to see the last few apps you
used, then touch the app you want. Touch Home [Q]
to return to the home screen.
Home screen
9
Search
To
seardi, touch
the fronteout
of the phone,
ortou
r Search
ont[Qpononess
r .
"‘S°" °“
"° "
' '“
“°'‘’°‘“‘
Foratexlsearcntoum
so
N-«=3
ggngegggfgghwe
I we
.
I
kevboaM
* |"°°~“‘°
‘:94
y
I
sea a
u
rug
'
d
Search bvvoice.
Phone status & notifications
The status bar at the
top of the screen
contains icons that tell
,5 M,
.
Vmzm “ides
you about messages
and phone status. To
view your notifications,
touch the status bar
and drag it down.
Icons on the right tell
you about phone
status:
10
Home screen
~
33°»?$'."u.'."°'°°"'°'
Q
4...
ormesndeomxevboam.
3 ill! UHFWill‘!5 y-so-an
"""""""""""-
D
nemmk (fun signal)
.
.
Q
ewe nen~«««roam-us:
Bi semestaata»
n «moaning
.
.
IE
pc■
T
ba'1°'V ‘d‘a'9i"9’
E speakerphone active D battery (full charge)
Tip: To see today's date, toudt and hold the status bar
at the top of the screen.
In-call options
Calls
its good to talk
Connected
Quick start: Calls
f! d I mun:
_ca“~nmef
Kristine Ke|\ev'
Dialing options
From the home screen, touch go Phone.
Recent
calls List
Toudl to open,
then touch an
entry to call.
End call
Touch to hang up.
Dial Pad
1 Touch to enter
numbers during a call.
Toum to delete
digits you
entered.
— Speakerphone
call Vbleemall
call
Enter a phone
number &
touch here to
call it.
I
Touch"me
to mute or
unmute the all.
Touch to tum the
zrkerphone
on or
'
During a call:
- To use a Bluetooth® device, touch Bluetooth. (I119
device must be tumed on and previously
paired—see "Connect new devices" on page 44.)
0 To mute a call, touch Mute.
Calls
11
0 To use the speakerphone, touch Speaker.
Note: Using a mobile device or accessory while
driving may cause distraction and may be illegal.
Always obey the laws and drive safely.
Tip: You can touch Home [E] or Back
to leave the
active call display. To reopen it, touch Home [E
> K Phone > Return to call in progress.
Make & answer calls
To make a call, touch ‘. Phone, enter a number, then
touch 1.
Tip: If the screen is locked, drag . to the right.
To answer a call while the display is active, touch
. When the display is not active, answer by
dragging . to the right.
To end a call, touch I.
To ignore a ll, touch Ignore.
End calls
Touch -.
Note: Your phone
includes a proximity
sensor. When you hold
the phone to your ear,
the display goes dark to
prevent accidental
12 Calls
touches. When you move your phone away from your
ear, the display lights up again.
Recent calls
Find it: C Phone > Recent
- To call a number, touch it.
- To send a text message, create a contact, view a
contact, or other options, touch and hold an entry.
- To clear the list, toudi Menu [E] > Clear list.
Frequent calls
Find it: § Phone > Favorites
0 To call a number, touch it.
0 To send a text message, view a contact, or other
options, touch and hold an entry.
Conference calls
To start a conference call, call the first number. After
the II connects, touch Add Call. Dial the next
number, or select it from contacts or favorites. When
the next number answers, touch Merge calls.
Your phone number
Find it: Menu [E] > Settings > About phone
> Status > My phone number
Emergency calls
Note: Your service provider programs one or more
emergency phone numbers (such as 911 or 112) that
you can call under any circumstances, even when your
phone is locked. Emergency numbers vary by country.
Your pre-programmed emergency number(s) may not
work in all locations, and sometimes an emergency
call cannot be placed due to network, environmental,
or interference issues.
1 Touch Q3 Phone (if your phone is locked, touch
Emergency Call).
2 Enter the emergency number.
3 Toudw I to call the emergency number.
Note: Your mobile device can use GPS and AGPS
signals to help emergency services find you. See
"GPS & AGPS" in your legal and safety infonnation.
Co nta cts
contacts like you've never had before
Quick start: Contacts
Find it: ,2 Contacts
Co‘rrum.A.ll:orrutu
-- >‘4Fll'UVE1flL.d3
Group
f.
Touch Menu L33,‘ to
choose which group to
show (like All or Favorites).
Elarr, Smnh
I I Chrznznre Meam
§ Christine Frirmn
3Jtrm Simers
rat Blazer
Create Contacts
contacts Llst
Touch to view contact
information. Touch & hold
to call, send a text
message, & rnore_
FflSlll‘1:UHEl‘
Tip: To search the list, touch and hold Menu p■■ to
open a touchscreen keyboard, then type a name.
When you flick or drag the list, drag the scroll bar that
appears to move the list faster.
Contacts
13
Call or email contacts
Find it: g Contacts
For View contact, Call contact, Send text message,
Send email, or other options, touch and hold the
contact.
View & use contacts
When you set up a social networking account (see
"Social networking‘ on page 34), you'll know what
everybody's up to and when. Every time you pick up a
call, chedt a message, or look up a friend's contact
info, sure, you'll see their name and number, but you
can see their social network status and smiling face,
too.
Find it: g Contacts
- To find a contact, type the contact name.
Toudi a contact to open its details. While viewing
details, you n start a II or message by t3oud1ing a
phone number or other info. Flick the screen left or
right to see Social Networking updates or History.
Tip: To dtange which account provides the pictures
for your Contacts, from the home screen touch
launcher
icon Q > I MyAccounts > Menu [g]
> Picture source.
14
Contacts
- To change Whidt group of contacts is shown (All,
Facebook, and so on) toudt the filter name at the
top.
0 To change how you view the list of contacts, flick
left or right at the bottom of the screen to select
History (recently used), A-Z (list without status), or
Status (list with status).
Edit or delete contacts
Find it: & Contacts
Touch the contact, then touch Menu E] > Edit or
Delete.
Link contacts
You might have two Contacts for the same person,
sud: as a friend with two email addresses. To combine
these two contacts:
Find it: g Contacts
Toudt a contact to open it, then touch Menu [g]
> Link contact and toudt the second entry. Your
social networking account remembers this connection.
Create contacts
Find it: & Contacts > Menu
G ro u ps
> Add contact
Add contact
Find it: & Contacts > Menu @ > Display group
You can put your Contacts into groups that you create
(like ''friends',' ''family',' or "work"). Then, you can find
contacts faster by showing one group at a time.
Slide out the keyboard, or touch any entry area to open
the touchscreen keyboard.
When you're finished, touch Save.
Where are contacts saved? Your phone saves new
contacts in its memory and in the Google Sewer or the
subscription-only Backup Assistant, if you have a
subscription. It also updates your social networking
account.
Synchronize contacts
When you change one of your Contacts, your phone
automatically updates your other social networking
accounts. Also, your phone updates your Contacts
and social networking account whenever you change a
friend in your social networking accounts.
Contacts
15
Text entry
keys when you need them
Keyboards
You can slide your phone open to use its keyboard, or
you can open a keyboard on your screen by touching a
text field, or toudting and holding Menu . To close
the keyboard, touch Back [51
Different keyboards open for different text entry
screens. For example, this keyboard opens when you
create an email message:
loud: to open a keypad for
symbols or nulrbers.
Input methods
To select an input method, toudi and hold a text entry
area on the screen to open the Edit text menu. Toudi
Input method, then toudi the method you want:
Swype” text entry
Swype lets you enter words with one continuous
motion. To enter a word, just drag your finger over the
letters in the word.
a
2
U
r
SW.’
3
X
3
'3
i’n
h m■ 1 1
II
Tips:
To enter apostrophes in common words (like "|’l|"l.
drag through the n as though it was an apostrophe.
To enter several symbols, touch SYM.
To correct a word, double-tap it. Swype shows a
small menu of other word options. Swype might
also show a menu if it can't guess your word.
If Swype doesn't know a word, you can still touch
the letter keys to enter it. Swype remembers, so
next time you can just drag over the letters.
Multi—touch keyboard
Enter text a letter at a time. As you type, your phone
suggests words from your dictionary and chosen
language. Your phone also automatically enters
apostrophes in some words, like "dont." You can also
touch two keys at the same time, such as Shift [E]
with a letter
screen, touch Menu
keyboard.
Typing tips
Enter alternate characters
From the number
keyboard, toudm
Altemate ÀôJ■ Toudt
again to retum to
numbers.
Enter one capital letter
Toudl Shift .
Enter only capital letters,
until you touch Shift
again
Toudw Shift
twice. Toudi again to
revert to lowercase.
Cut or Copy selected text
Toudt and hold text,
then touch Cut or
Paste cut or copied text
Copy.
Toud'I and hold
location to paste
then toudt Paste.
Delete a character (hold to
delete more)
Toudl Delete .
To change your text entry settings and see the
dictionary of terms you've used, from the home
> Settings > Language &
Text input settings
Find it: Menu
> Settings > Language &
keyboard
- To edit your dictionary, touch User dictionary.
- To change the language and the style for your
touchscreen keyboard, touch Select language.
- To change input method and settings, touch Swype
or Multi-touch keyboard (see "Input methods" on
page 16).
Tips 8: tricks
a few handyhints
- To tum off automatic applications sync, touch
Menu
> Settings > Data manager > Data
Delivery.
General tips
If you can't to see the screen while wearing
sunglasses, take them off. Screen brightness
changes as your phone senses the current lighting
conditions.
- To tum off Bluetooth power, touch Menu
> Settings > Wireless & networks > Bluetooth.
0 To tum off Wi-FIT", touch Menu
> Wireless In networks > Wi-Fi.
> Settings
To retum to home screen, touch Home
To see recently dialed numbers, touch ‘. Phone
> Recent.
To sleep/wake your phone, press Power/|.ock .
To set screen timeout, touch Menu
> Settings
> Display > Screen timeout.
To search, touch Search [El
To show last few apps, touch and hold Home ■■
To tum sound on/off, press and hold PowerlLock
> Silent mode.
To turn airplane mode onloft press and hold
PowerlLock [E > Airplane mode.
Battery tips
Want to extend your battery life? Try these:
To select a battery profile that suits your phone use,
touch Menu @] > Settings > Battery Manager.
I9
Digital living
connectand enjoy
Note: Copyright—do you have the right? Always follow
the rules. See "Content Copyright" in your legal and
safety infomiation.
BLOCKBUSTER videos
Blockbuster On Demand is a service that allows you to
purchase or rent and download video assets from your
mobile phone. After purdiase or rental, you n play
bad( the content on your mobile phone or on PCs or
TVs that are connected to a 1'IVo® DVR, a BIu4ay
player, or 2Wire"‘ media platform.
Just clidt on the free Blodtbuster app:
Find it: launcher icon G > I Blockbuster
After the app completes an upgrade procedure, you
will be prompted to activate your device by signing up
(if you have no Blockbuster account) or signing in (if
you already have a Blockbuster account). You will be
prompted to add credit rd information for your
payment option. After that, you can browse a vast
array of Blockbuster video assets for purchase or rent.
There is no monthly fee for this service.
Media Share
Media Share gives you an easy way to share your
media content—photos, videos, and tunes—with
friends and family.
Share your media via DLNA devices: The Media
Share wird guides you through the easy setup
steps.
Swap photos & videos: Share any photos or videos
on your phone, even the ones you created.
More tunes: Enjoy favorites from your phone playlist
on your sound system at home. Or get music from
your portable music player and add it to your phone's
music library.
Connect
You must be connected to a Wi-Fi network or another
device:
- Connect to your computer with a USB ble (see
- Connect to a Wi-Fi network or use your own Wi-Fi
hotspot (see "Wi-Fi®" on page 45).
Media Share will lead you the rest of the way.
Your Media Share world
Note: If you're using a Wi-Fi connection, you must
allow access to other devices to download media from
your phone and to share your fi|es.lf you want to
access media files on other devices, they must allow
access.
To use Media Share, toud1 Launcher icon ©
> E Media Share. Then select the Media Share
feature you want to use.
- Sh are media—Al|ow other devices to access media
files on your phone. Without downloading any
media from your phone, other people can view your
pictures or videos, or play your songs, on their own
devices.
0 Sync media—Sync the media files on your phone
with other devices.
- Copy media—Copy a picture from one phone to
another.
0 Play media—Se|ect media for playback on another
device in a Wi-Fi network.
Make sure your
phone is connected to
an active Wi-Fi
network and has
access to a DLNA
Certified device.
1 Touch Launcher
icon© >3
DLNA
2 Touch Play media,
Copy media to
sewer, Copy
media to phone,
or Share media.
Then follow the
instructions you
see on your phone.
Share using DLNA
DLNA lets you expand the ways you can enjoy your
photos and videos on a DLNA Certified computer, TV,
or monitor, using your own Wi-Fi network.
21
Photos 8, Videos
1”rp: You can also touch Launcher icon G
see it, captureit, share it!
>
c"“°"‘-
Photos
Take & share photos
Take that family photo, and post it online for everyone
to see.
Note: To get the clearest photos, wipe the lens clean
with a soft, dry cloth before you take a photo.
Find it: Press the Camera Key (on the side of the
phone—see "Your phone" on page 2).
Adjust for geater
creative oontol.
Note: Photos are stored on your microSD memory
rd. Picture Resolution is Widescreen or 5MP,
unless you mange it.
To take the photo, press the Camera Key halfway to
|od( the focus, then press all the way to take the
photo.
22
Photos & videos
0 To set the photo as a wallpaper, contact photo, or
social network photo, touch Menu
> More
> Set as.
- To send the photo in a message or post it online,
touch Menu
> Share. For more info on sharing
your photos, see "Share photos & videos" on
page 25.
0 To delete the photo, touch Menu [E > Delete.
0 For more options, touch Menu E] > More."Share
photos & videos" on page 25.
Photo options
You can make adjustments to optimize your shot.
Toudi a button on the right side of the screen to make
changes (touch the screen to tum on the buttons if
necessary):
0 Scenes—Adjust for better image capture in different
environments: Auto, Portrait, Landscape, Sport,
and more. Toudt the screen when finished to return
to the viewfinder.
Camera settings
In the viewfinder, touch Menu
> Settings to open
the mera menu and adjust these settings:
Picture ResoIution—Adjust for optimal resolution
for widescreen TV, 8' by 10' prints, 5" x 7" prints,
"4 x "6" prints, or wallet photos.
Quick Upload A|bum—Automatically upload
photos to accounts you select, sud! as Facebook,
MySpace, Photobucket, and more.
Review Time—How long your phone displays a
new photo before returning to the viewfinder.
Face Detection— Detects a face in the viewfinder
and adjusts image quality accordingly.
Videos
Record & share videos
Find it: Launcher icon G > fl Camcorder
0 Effects—Change photo look: Normal, Negative,
Black and White, and more.
0 FIash4et Flash On, Flash Off, or Auto Flash.
0 Switch to—Toggle between photo and camcorder
modes.
Photos & videos
23
Note: To get the clearest videos, wipe the lens clean
with a soft, dry cloth before you record a video.
Video options
You can make adjustments to optimize your video.
TOUd'I one of the buttons on the right side of the
viewfinder to make changes (you may need to touch
the screen to make the buttons appear):
- Scenes—Adjust for better video capture in different
environments: Auto and Night. .
0 Effects—Change video look: Normal, Negative,
Black and White, and more.
- Light—Tum a light on or off to adjust for the lighting
where you are recording.
Tag videos with
your Iocation.
Video capture
Settings
Arjust for greater
creative contol.
To record the video, press the Camera Key. To stop
the video recording, press the Camera Key again.
0 To send the video in a message or post it online,
touch Menu [fl] > Share. For more info on sharing
your videos, see ‘Share photos & videos" on
page 25.
0 To play the video, touch 3
0 To delete the video, touch Menu [i] > Delete.
24
Photos & videos
0 mera.
Switch to—ToggIe between camcorder and
Camcorder settings
In the viewfinder, touch Menu [fij > Settings to open
the rncorder menu and adjust these settings: Video
Resolution, Review Time, Shutter Animation, and
more.
View photos & videos
Find it: launcher icon G >
Gallery
Note: To see the controls while the video is playing,
touch the display.
View photos & videos
Tip: Tum the phone sideways for a widescreen view.
The Gallery first displays photos and videos as
thumbnails. Scroll through the thumbnails by flidcing
them up or down. Touch a thumbnail to select it for
viewing or playbad(.
When you select a thumbnail, it is enlarged to normal
viewing size. \fideos are paused at the beginning.
Touch the play I, and pause ID buttons on the
screen to control video playback.
Note: To see the buttons while the video is playing,
touch the display.
Touch a folder to display all of its photos or videos.
option for the photos or videos you want to access.
- Camera roIl—All of the captured photos and videos
on your phone.
0 My Tags—Photos and videos grouped by tag.
0 FoIders—Photos and videos grouped by the folders
where they're saved.
0 All photos—All photos, no groupings.
0 All videos—All videos, no groupings.
Share photos & videos
Find it: Launcher icon 6 >
Gallery
To send your photo in a message or post it online:
1 Select an image.
2 Touch and hold a photo or video, then touch Share.
3 Choose how you want to share—like Bluetooth,
Email, Text Messaging, and more.
Photos & videos
25
Manage photos & videos
Find it: Launcher icon © >
1 Select an image.
Gallery
2 Toudi and hold a photo or video, then select Quick
upload, Share, Edit, Delete, or More (Set as,
Print).
Tip: To copy photos to/from a computer, go to "USB
connection" on page 47.
Music
when music is what you need...
Quick start: Music
Touch and p|ay—instant music. Just open your music
library, then select what you want to play.
Find it: Launcher icon © >
Music
MuKep|evAm1Amnlre
v.... .,.=.,.
nmv nnwmxx »
iu '(‘
categories
Touch a category, then
find & select the music
you want.
@k ■
.>' )1!
Music controls
Tip: \IVhen a song is playing, you can add it to a playlist
by touching Menu [E] > Add to playlist.
26
Music
Set up music
What music transfer tools do I need?
To put music on your oomputer and then load it on
your phone, you need:
- Microsoft"" VIfindows“" PC or Apple“
Macintosh“.
- USB data cable (included with your phone).
0 SD memory rd (16GB—incIuded with your
phone).
Your music is stored on your memory card. Your
phone supports removable microSD memory rds
up to 32GB capacity. To make sure your memory
card is installed, go to "Assemble & charge’ on
page 3.
Tip: To see the available memory on your memory
card, touoh Menu [E] > Settings > SD card &
Phone storage.
What headphones can I use?
Your phone has a 3.5mm headset jack for wired stereo
listening. You can go wireless with Bluetooth® stereo
headphones or speakers (see "Bluetooth® wireless”
on page 44).
Get music
You can transfer music from your computer to your
phone by using a USB connection.
For more information on transferring music, see "USB
connection‘ on page 47.
Play music
Music library
Open your music library, then select what you want to
play.
What audio file formats can I play?
Your phone can play many types of files: AAC, AMR,
MP3, WA\/, WMA, AAC+, and MIDI.
Note: Your phone does not support DRM-protected
files.
Music
27
Find it: Launcher icon © >
Music player
Music
Just touch a song or playlist to get going.
Touch to select
E as E ].°=-°-ies
music byartist,
,. Brook Fairfax
‘ a tn"
album, song_
or playlist.
‘ 5 cu"Kepp|ierAnd AnnaLee,,‘
6 Max
Open Playllst
‘:1 ‘ Illlinlllg loughshod
H‘ ’°"‘
3 .u_ Heaton/Sprinkliesky
Miller
j Last flayed
Touch to play
39am‘
Shullle 0nI0fl
-/3
Your music is stored by artists, albums, songs, and
playlists. Touch a category, then touch the song or
playlist you want to play. Touch Menu [T] > Party
shuffle to randomly play all your songs, or touch
Search to look for a song.
:3 j Repeat
IcunentOIIIAII
Max Kepler And AnnaLee...
F.-r '2 F:_:r~_ .‘
3:45 — Total songflme
m Progress Bar
Music player controls
- Play/pause—Touchj.1].
- Previous/next—Touch Q/E.
28
Musiic
Fast forward/rewind—Toud1 and hold .
View pIay|ist—Touch 75 .
ShuffIe—Touch X: .
Repeat—ToudI 2'3 .
VoIume—Press the side volume keys.
an existing playlist, or touch New to create a new
playlist.
To add a song to the playlist you're playing, toudi
Menu
> Add to playlist in the music player.
To edit, delete and rename playlists, touch and hold the
playlist in the music library.
View Iibrary—Touch Menu [E > Library.
Tum shuffle on/off—ToudI Menu
> Party
shuffle.
Add to pIaylist—Touch Menu E > Add to
playlist.
Use as ringtone—Toudi Menu
ringtone.
Delete—Toud1 Menu
Hide, wake, turn off
> Use as
> Delete.
Toudi Home [E to use another app. Your music
continues to play.
When you see ', in the status bar, a song is playing.
Flick down to see details. Touch the song to retum to
the music controls.
To tum off your music, mud: '3.
Playlists
To add a song from the music library to a playlist, toudi
and hold the song then touch Add to playlist. Choose
Music
29
YouTube“"
go and create your own classic
Note: If you don't have a YouTube account, visit
m¢y_w,y_omuhe,ggm to find out more. To create an
account or sign in, go to "Your account" on page 31.
Quick start: YouTube
Watch videos
Find it: Launcher icon © > YouTube
Voulubte
You Tubé ‘
Hes: Wrrti
Lester 011:" T categories
""
Touch a video to play.
See popular video categories, like Featured, Most
viewed, and Top rated. Touch a category, then touch
the video to start playingl To see more video
categories, touch Menu p■ > Cate ories. To see a
video in high quality, touch Menu
> Settings
> High quality video.
Search for videos
Find it: Lflmcher icon © > IE] YouTube
> Menu 4■ > Search
Enter text, then touchjearch.To clear your search
history, touch Menu [E] > Settings > Clear search
history.
Press
to show options.
Share videos
Send someone a link to a video that you are watching.
1 Touch the video to select it.
The YouTube usergenerated content Web site lets you
share videos with YouTube users everywhere. You
don't need a YouTube account to browse and view
videos.
30
YouTube""
2 Touch Menu @] > Share.
3 Address and complete your email, then touch Send.
Your account
Messaging
Log in or Create account
sometimes its best to text, orlM, oremail. . .
Find it: Launcher icon © > YouTube
Quick Start: Messaging
> Menu
> My account
1 To create your YouTube account, touch the "Don't
have a YouTube account? Touch here to create one"
link.
Find it: Launcher icon © > I] Messaging
> Universfl mg,”
Check Ibr Messages Now
If you already have a YouTube account, enter your
username, password and touch Sign in.
2 For a new account, enter a usemame, and complete
the fields, then touch I accept.
g’
Mary Morgan
o to create a new
creuihte
Messaoe
message, & see a list of you:
drafts (indicated by the
number).
Upload videos
— Mess:IIl¢WD¢
Find it: Launcher icon © > IE YouTube
M
> Menu @ > uPl°ad
Touch to open a message.
1 Touch the video you want to upload. You can change
the video title, description, set the access, and add
tags‘
2 Touch Upload.
..
._
US‘
£‘|g;&&“:':”';’ "‘°"°Messaoe
' SUNS
'
Icons indicate a message:
-!— urgent
Umead
I has attachments
Tip: To see more messages, f|id( or drag up.
Read & reply to messages
Find it: Launcher icon © > I] Messaging
> Universal Inbox
Note: Universal Inbox shows all of your messages
together—text, email, and social networking
messages. To show only one type of message, toudi a
message account type instead of Universal Inbox.
- To open a text message or social networking
message and all of its replies, touch it.
0 To respond to a message, just open it and enter
your response in the text box at the bottom.
To forward a text message, toudi and hold a
message in the conversation, then touch Forward
message.
For email, touch E to dioose
a reply or forward option.
0 To open options, touch and
hold a message.
Tip: Try the Messages widget in “Widgets” on
page 8.
Create messages
Find it: Launcher icon Q
> I] Messaging > I
Choose a message type, such as
Text Messaging or Facebook. Then, enter the
recipient and message. In text messages and emails,
touch Menu
for options like Insert... or Attach
Files.
Send & receive attachments
To send a file in a message, open a new message and
touch Menu
> Insert.
When you receive a message with an attachment,
open the message and touch the file name to
downld it. Then, touch the name again to open it.
Some file formats can be converted to HTML for faster
viewing, and your phone will show Get HTML
version.
While viewing the attachment, touch it to save it, share
it, and more.
Tip: To send and receive large attachments faster, use
a Wi-FI'"" connection, in "Wi-Fi®' on page 45.
Set up messaging
To add email accounts, touch Launcher icon Q
> I My Accounts > Add account.
0 Corporate Sync is for Exdiange sewer work email
accounts. Enter details from your IT administrator.
Tip: You might need to enter your domain name
with your user name (like domain/usemamel
- Email is for most personal email accounts. For
account details, contact the account provider.
Note: While you are using a Wi-Fi network, you
cannot access Yahoo Mail accounts. You can still
use your browser to see these accounts at
.
To change your settings, touch launcher icon 0
> I] Messaging > Menu
then touch:
0 Manage accounts to add or remove an account.
0 Edit Universal Inbox to choose whidi accounts
show messages in the Universal Inbox.
0 Messaging Settings to set the notification for eadi
account type (along with other preferences, for
email).
Tip: For social network accounts, see "Add accoums"
on page 34.
e-mail
The first time you tumed on your phone (see page 4),
you logged in to your Gmail"‘ account. You can add
any other email account that you set up.
To add other email accounts to your Messaging
widget and Universal Inbox: Toudi Launcher
icon 0 > 1] Messaging > Menu
then toudi
Manage accounts > Add account. On the Setup
accounts screen, touch Email and enter your email
account information.
Instant messages
To send and receive instant messages, you n use an
instant messaging app or your browser. Your device
comes preloaded with Google Talk”. You can also
downld an instant messaging app from the Android
Market
- To download and use an instant messaging app,
touch Launcher icon G > 3 Market > Apps
> Communication, then dioose an app for your
provider. Once you download the app, you'll see it in
"App tray" on page 9.
- If you don't see an app for your IM provider, you can
use your Web browser. Touch Home [E]
> . Browser > Menu [g] > Go, then enter your
provider's Web site. Once you're there, follow the
link to sign in.
Note: Your IM options will depend on your IM provider.
To browse instant messaging apps from your
Oomputer. 90 to
.
Voicemail
When you have a new Voicemail, °° shows at the top
of your screen. To hear the voicernail, touch '. Phone,
then touch .
If you need to diange your Voicemail number, in the
home screen touch Menu [E > Settings > Call
settings > Voicemail Settings.
Social networking
mylife, yourlife
Your social networking account
You can set up a social network account that
integrates and syncs all your contacts, emails, and
social networking sites, and serves them up just the
way you want them. No opening and closing apps and
menus. You can interact by using the Social
Networking and Social Status widgets on your home
screen. These widgets are your windows into the
social networking sites and other accounts you
entered into your social status.
Add accounts
You can add your more accounts to your social
networking account. If you don't have accounts on
these sites, visit their Web sites to set them up.
For email accounts, see ‘Set up messaging‘ on
page 32.
Find it: Launcher icon Q > I My Accounts > Add
account
Add an account by touching it. Then enter your user
name and password for that account.
When you sign into social networking accounts, you'll
see your friends and contacts in your Contacts list,
and your status and updates can appear in your Social
Networking and Social Status widgets on your home
screen.
Web
you don't need a PC, surf the web with your phone
Twitter and Myspace messages will always appear
as "read" on your phone, but your phone notifies you
when you receive a new message. Myspace marks
your messages as "read” online.
Tip: To download updates faster, use "Wi-Fi®" on
page 45.
Quick start: Browser
Find it: 0 Browser
OA 4- 394.153-u
Edit & delete accounts
Find it: Launcher icon 0 > I My Accounts
Touch and hold an account, then touch Open account
to edit it, or touch Delete account to remove it (along
with its contacts and messages).
Note: You can't delete the Google"’' account you used
or created when you set up your phone. That account
is locked when you set it up.
‘bmhflflflx
browser options.
Note: If you can't connect, contact your service
provider.
Connect
Your phone uses the mobile phone network (over the
air) or a Wi-Fi connection to automatically access the
Web.
Web 35
Note: Your service provider may charge to surf the
Web or download data.
options
To use a wireless network, touch Menu
> Settings
> Wireless & networks. Touch Wi-Fi to tum it on and
BacklForward
Navigate to previously viewed
pages-
toudn Wi-Fi settings to search for nearby wireless
networks. Toudi a network to connect.
More
See additional browser options.
Select links
When you toudm a
link, your phone
outlines it and goes to
that page. If you toud1
and hold the link, your phone shows options, like
Open in new window or Bookmark link.
See opti ons
Touch Menu [E to see browser options:
options
New Window
Open a new browser window.
Bookmarks
See your bookmarks.
Windows
Wow the browser windows that
are currently open.
Refresh
Reloads the current page.
36
Web
Personalize
add yourpersonal toudr
Widgets
Create widgets
1 Find an empty spot on your home screen where you
want to add a widget. You can flick left or right to
open other panels on your home screen.
2 Touch and hold the empty spot until you see the
Add to Home screen menu.
3 Touch Motorola widgets or Android widgets.
4 Touch the type of widget. If necessary, enter the
widget settings.
Set up widgets
You can customize some widgets. Touch a widget to
open it, then touch Menu ■2■
You may already have several useful widgets on your
home screen:
- Messages: Change the widget name or choose how
long it shows new messages. To add email
accounts, "Set up messaging” on page 32.
- Music: Set this widget to an artist, album, song,
playlist, or just touch Menu r0■ > Party shuffle.
There's more about "Music" on page 26.
- News: Change the widget name, choose how long
it shows new stories, or choose a news source. To
dioose a source, touch ., then choose preset
Bundles or Channels, or choose Custom to enter a
URL for a Webpage or an RSS feed.
0 Weather: Change temperature units or add
locations. To add locations, touch , enter a city,
and toudi Search. When you open the weather
widget, flick left to see other locations you added.
Ringtones
To personalize your ringtones:
Find it: Menu
> Settings > Sound > Phone
ringtone or Notification ringtone
To set your vibrate options:
Find it: Menu
vibrate
> Settings > Sound > Phone
Wallpaper
To apply a new wallpaper:
1 Touch and hold an empty spot on your home screen.
2 Touch Wallpapers.
3 Touch Live Wallpapers, Media gallery, or
Wallpapers, and choose a wallpaper.
Personalize
37
Sounds
0 To set volume for media and videos, touch
Menu
> Settings > Sound > Volume.
0 To play tones when using dial pad, toud1 Menu
> Settings > Sound > Audible touch tones.
- To play sound on a screen selection, touch
Menu
> Settings > Sound > Audible
selection, then adjust Media volume.
Display settings
- To set display brightness, touch Menu
> Settings > Display > Brightness.
- To set orientation, touch Menu
> Display > Orientation.
> Settings
- To set animation, touch Menu
> Settings
> Display > Auto-rotate screen.
Note: Some apps are designed so that your phone
can “animate” them by rotating, fading, moving,
and stretching one or more images.
Quick launch shortcuts
You can add shortcuts directly to the home screen by
touching and holding an empty spot on the home
screen, touching Shortcuts, and selecting a shortcut.
38
Personalize
Date & time
Set date, time, time zone, and formats:
Find it: Menu
> Settings > Date 8: time
Language & region
Set your menu language and region:
Find it: Menu
> Settings > language &
keyboard > Select language
power) or using the mobile network (less accurate, but
conserves battery power).
M a ps
where you are, where you're going
Quick start: Maps
Where am I? What's around here? Don't worry—let
Maps help you explore your surroundings and find
what you're looking for.
Find it: Launcher icon ® > Q Maps
To set your location, touch Menu [3 > Settings
> Location In security > Use GPS satellites andlor
Use wireless networks.
Find your location
Note: Don't forget to set your location sources.
From the main Map screen, toudt Menu E] > M
location. Your lomtion is shown on the map as O .
The bigger the circle, the less accurate the location.
Find any location
1 Touch Menu
> Search.
2 Enter text in the search box, like an address,
business, or city, then touch Q.
fip: If it's an address you have visited before. select
from the list shown.
Stanyan
Note: The map image you see may be a little different.
Set your location sources
Set your phone to determine your location using GPS
satellite signals (highly accurate, but uses battery
3 Touch the search box to view all the results, then
touch the one you want.
Get directions
Find your way with turn-by-tum directions. You n
even have them spoken so you can keep your eye on
the road.
1 Touch Menu
> Directions.
2 Enter a starting point address or touch [j and select
My current location, Contacts, or Points on map.
3 Enter an end point address or touch L1 and select
Contacts or Points on map.
4 Select your mode of transport (car, public transport
or walk), then touch Go. Your directions are shown
as a list. To view your directions on a map, touch
Show on map.
5 When you have finished, touch Menu
> More
> Clear map.
Select map mode
Touch Menu [E > Layers to select from Traffic,
Satellite, latitude or recent seardies, viewed
positions or directions.
Toudi Menu [E > Layers > More layers to select
from My Maps, Wikipedia, or Transit Lines.
Touch Clear Map to clear your selections.
Map view
Shows a map, complete with names of streets, rivers,
lakes, mountains, and borders. This is the default view.
Satellite View
Shows map on top of aerial photo.
Traffic view
If available in your area, real-time traffic conditions are
shown on the rds as color-coded lines.
Latitude
where are your friends & family?
joined Latitude, they'll receive an email request that
invites them to sign in to Latitude with their Google
account.
Join Latitude
To remove friends:
Keep track of where your friends and family are on
Maps. Plan to meet up, check that your parents got
home safely, or just stay in touch.
Don't worry, your location is not shared unless you
agree to it. You need to join Latitude, and then invite
your friends to view your location or accept their
invitations. When using Maps (in any mode except in
Street \fiewl, touch Menu
>]oin Latitude. Read
the privacy policy and if you agree with it, touch Agree
& Share.
1 Touch Menu
> Latitude to show your friend's
list, then touch a friend in your list.
2 Touch Remove this friend.
Add & remove friends
Find it: launcher icon G > Q Maps > Menu
> Latitude
To add friends:
1 Touch Menu ■F■ > Add friends.
2 Touch Select from Contacts, then touch a contact.
Or, touch Add via email address, then enter an
email address.
3 Touch Add friends.
If your friends already use Latitude, they'll receive an
email request and a notification. If they have not yet
Share location
When you receive a request to share location details
you can choose to:
- Accept and share back—See your friend's
location, and your friend can see yours.
- Accept, but hide my Iocation—See your friend's
location, but they can't see yours.
- Don't accept—Location information is not shared
between you and your friend.
Hide your location
To hide your ltion from a friend, touch Menu [g]
> Latitude to show your friend's list. Touch your
contact name, then toudi Menu @] > Edit privacy
settings > Hide your location.
Latitude
41
Turn off Latitude
Toudi Menu 38 > Latitude to show a friend's list.
Touch Menu 33 > Edit privacy settings > Turn off
Latitude.
Apps for all
getthewp you want
Android Market”
Note: You must set up a Gmail account (see ‘Set up &
go" on page 4) in order to buy and download apps
from the Android Market.
Find it: Launcher icon G > 3 Market
Get all the fun games and cool apps you wantl Android
Market provides access to applications developed by
developers woddwide, so you can find the app you
want. If you need help or have questions about
Android Market, toudi Menu E] > Help.
Browse & install apps
Scroll to and toudi the app you want to install. Then,
toudi Install (if app is free) or Buy.
Waming: If an app you are downloading requires
access to your data or control of functions on your
phone, you'll be asked to give your pennission. After
selecting Install, the app will download. After
selecting Buy, you may be asked to sign in to an
additional Google“" account. Sign in and select
Purchase now to proceed. Follow the on-screen
instructions. To see the download progress. open the
notifitions window.
After you download an app, the icon for that app
appears on the App tray (see "App tray" on page 9).
Manage & restore apps
Find it: Menu
> Settings > Applications
> Manage applications
Touch an app in the list, then touch Uninstall (for apps
you downloaded), Clear cache, or other options.
To reinstall any downloaded items, toudi launcher
icon G > "3 Market.
Important customer information
Please be advised that many services and applitions
offered through this unique device are provided by
Google and various application developers. If you use,
link to or download a Google service, or an appltion
such as a non-Verizon Wireless location based
GPS-type service, chat room, marketplace or social
network from this device, you should carefully review
the terms of such service or application. If you use any
of these non-Verizon Vlfireless services or applications,
personal infonnation you submit may be read,
collected, or used by the service or application
provider and/or other users of those forums.
Motorola, Inc. and Verizon Wireless are not
responsible for your use of those applications or
information you choose to submit or share with others.
Specific terms and conditions, terms of use, and
privacy polices apply to those applications and
services. Please review carefully any and all terms and
conditions applible to those applications and
services including those related to any locationbased
services for any particular privacy policies, risks or
waivers.
Your Verizon Wireless customer agreement terms and
conditions and certain other specifically identified
terms gcvem your use of any Verizon Wireless
products and services.
BIuetooth® wireless
lose the wires and go wireless
Quick start: Bluetooth wireless
Find it: Menu @] > Settings > Wireless & networks
> Bluetooth settings
Iueboxhsettlns
Bluetooth
—ToudI totum on
&off&toscan_
Device name
’9C‘l:.Z
Connect new devices
Note: This feature requires an optional accessory.
To connect with a new device, you need to pair with it.
You only need to do this once for each device—to
connect again, just turn on the device.
1 Make sure the device you are pairing with is in
discoverable mode.
Note: Refer to the guide that came with the device
for details.
Discoverable
‘Jan: 1!. .-1 _‘ -....-:l:‘.l:*
2 Touch Menu @] > Settings > Wireless &
networks > Bluetooth settings.
3 Touch Bluetooth to tum on and scan. If Bluetooth
Enhanced Stereo
[.
power is already on, toudw Scan for devices.
4 Touch a device to connect.
Scan for devices
llrerootnotvlces
DROI ■ež■
av».-7
Toudno rescan.
'—Touch to connect.
Turn Bluetooth power on or off
Find it: Menu @] > Settings > Wireless & networks
> Bluetooth
Note: To extend battery life, turn Bluetooth power
off when not in use.
44
B|uetooth® wireless
5 If necessary, touch OK, or enter the device passkey
(like 0000) to connect to the device. When the
device is connected, the Bluetooth indicator ®
appears in the status bar.
Note: Using a mobile device or accessory while
driving may cause distraction and may be illegal.
Always obey the laws and drive safely.
Note: The Bluetooth Enhanced Audio setting is not
recommended for older Bluetooth headsets as it may
not deliver acceptable sound quality.
Reconnect devices
To automatically reconnect your phone with a paired
device, simply tum on the device.
To manually reconnect your phone with a paired
device, touch the device name in the Bluetooth
devices list.
Disconnect devices
To automatically disconnect your phone from a paired
device, simply tum off the device.
To manually disconnect your phone from a paired
device, touchthe device name in the devices list, then
touch Menu @] > Disconnect.
Wi-Fi®
home, ofiice, orhotspot
Quick start: Wi-Fi
Find it: Menu [E] > Settings > Wireless & networks
> Wi-Fi settings
Note: Your phone's Wi-Fi features and power levels
are not allowed for outdoor operation in France. To
avoid unlawful interference with radio signals, do not
use the \M—Fi features in France unless you are
indoors.
Use a wireless network for fast lntemet access and to
download data.
Edit properties
Toudt Menu c > Settings > Wireless & networks
> Bluetooth settings > Device name. Enter a name
and touch OK.
w,_Fi
—Touchtotumon&swn.
Network notification
‘. . 'i:n’-:' : ...:'i -.-Inn‘! -_
WI R netvtonu
Your network
Touchtoconnect
Add Wi-Fi network
Wi-Fi®
45
Turn Wi-Fi on or off
Find it: Toudi Menu
networks > Wi-Fi
> Settings > Wireless &
Note: To extend battery life, tum off Wi-Fi power when
not in use.
Wi-Fi search & connect
To find networks in your range:
1 Touch Menu [E > Settings > Wireless &
networks > Wi-Fi settings.
2 Touch Wi-Fi to tum on and scan. If Wi-Fi is already
on. touch Menu
> Scan. Your phone lists the
networks it finds within range.
Tip: To see your phone's MAC address or other
WH-‘I details, touch Menu
> Advanced.
3 Touch a network to connect.
4 If necessary, enter Network SSID, Security, and
Wireless password, and touch Connect. When
your phone is connected to the network, the
wireless indicator fig‘ appears in the status bar.
Tip: When you are in range and Wi-Fi is on, you will
automatically reconnect to available networks you've
connected to before.
46
Wr—Fi®
Wi-Fi hotspot
Note: You need to subscribe to Wi-Fi hotspot service
to use this feature. Contact your service provider.
You can set up your phone as a Wi-Fi hotspot to
provide portable, convenient intemet access to other
Wi-Fi enabled devices.
Setup
Note: Risks can be associated with connecting to the
public intemet. Your phone allows you to create a 3G
Mobile Hotspot, which may be accessible by
unauthorized users. It is highly recommended that you
use a password other possible steps to protect your
computer from unauthorized access. To add security to
your Vlfi-Fi hotspot:
Find it: Launcher icon G >
36 Mobile Ilotspot
> @] > Advanced > WiFi AP mode Settings
Touch a setting to modify it:
- SSlD—Enter a unique name for your hotspot and
touch Next.
- Security—Select the type of security you want, and
touch Save: WEI’, WPA_ or WPA2. Enter a unique
password. Other users can access your Wi-Fi
hotspot only if they enter the correct password.
Note: WEP is the weakest option because it is
highly vulnerable to haddng. WPA2 is
recommended by IEEE.
- channel—Select a channel that minimizes potential
interference. You may need to try different channels
after your hotspot is active for a time.
Toudi Save when the settings are complete.
Activate hotspot
Find it: Launcher icon G >
3G Mobile Hotspot
> Tap to start Mobile Hotspot service
When your Wi—Fi hotspot is active, other Wi—Fi enabled
devices n connect by entering your hotspot's SSID,
selecting a Security type, and entering the correct
Wireless password,
Memory card 8: file management
oopyphotos, music, and more to yourphone
Memory card
Note: You need the memory card installed for some
features on your phone, like Camera.
Delete or share files on your phone
Find it: Launcher icon G > E Files > Phone files
Toudi a file or folder to open, then touch and hold a file
to Delete or Share.
Remove or format your memory card
Note: Do not remove your memory rd while your
phone is using it or writing files on it.
Before you remove or format your memory rd you
need to unmount it. Touch Menu
> Settings > SD
card & storage > Unmount SD card.
To fomiat your memory card, touch Format SD card.
Waming: All data on your memory card will be
deleted.
USB connection
You can connect your phone to a computer with a USB
ble.
Note: ‘lhe first time you use a USB connection, your
computer may indicate that drivers are being installed.
Follow any prompts you see to complete the
installation. This may take a few minutes.
1 Wth a memory card inserted, and your phone
showing the home screen, connect a Motorola
micro USB data ble from your phone's micro USB
port to a USB port on your computer. Your phone
should show
in the status bar.
Note: Make sure to connect the phone to a high
power USB port. Typilly, these are located directly
on your computer.
2 On your phone, flick down the status bar to see the
USB connection options.
3 Toudl an option: .
I Windows Media Sync- USB mass storage—Drag and drop files
between you computer and memory card
folders. When you're done, use ‘Safely
Remove Hardware‘ before disconnecting the
USB cable.
Note: You can't use the files on your
memory card with your phone while it is
connected to the computer.
- Charge 0nly—Use the connection only to
charge a device.
Tools
stay on top of things
Add calendar events
Alarm clock
You can even set a reminder so you don't forget about
the event. (When you set the reminder time to 0
minutes, it plays at the event start time.)
Tip: Reminders will play only if you've selected a
notification ringtone (see "Ringtones" on page 37).
When you finish entering event details, touch Save.
Find it: Launcher icon © > - AIarm& Timer
To turn on an alann, touch the
ched( box.
When an alarm sounds, slide
to Dismiss to tum it off or
Snooze to delay for five
minutes.
To add an alarm, touch
Menu @ > Add alarm, then
enter alarm details.
To enable or disable an alarm,
touch the check box.
From
view,
More
> New
event.any
Enter
thetouch
eventMenu
start ðjõ■
time>and
other
details.
Manage calendar events
To edit an event, touch and hold it, then touch Edit
event. When you're done, touch Save.
To delete an event, touch and hold it, then
touch Delete event.
To go to today, toudx Menu [E] > Today.
Calendar
Calculator
Find it: Launcher icon © > tr Calendar
Your calendar events can be
Find it: Launcher icon Q > E Calculator
Your calculator has basic and advanced views. To
viewed in different ways:
Touch Menu 0■ø■ > Agenda,
Day, or Week. When you
highlight an event, more
details appear.
change views, touch Menu @] > Advanced
panel/Basic panel. To clear history, touch Menu [E]
> Clear history.
Tools
49
Management
stayin control
Wireless manager
Find it: Menu
> Settings > Wireless & networks
Manage all your wireless connections: W-Fi"‘,
Bluetooth®, airplane mode, & mobile networks
l"Network" on page 50).
quite large (25MB or more) and may not be available
in all countries. If you don't have an unlimited data
plan, or mobile network updates are not available in
your country, you can update using a computer.
0 Using your computer:
On your computer, go to
m and check the
"Software" links. If an update is available, simply
follow the installation instructions.
Airplane mode
Use airplane mode to tum all your wireless
connections off—useful when flying. Press
Power/Lock @ > Airplane mode.
Update my phone
Stay up to date with the latest software updates for
your phone. You can check, download and install
updates using your phone, or using your computer:
0 Using your phone:
Ybu may get an automatic notification of an available
update on your phone. Simply follow the
instructions to download and install.
To manually check for updates, toud1 Menu [g]
> Settings > About phone > System updates.
Your phone downloads any updates over your
mobile network. Remember, these updates can be
Network
You should not need to change any network settings.
Contact your service provider for help.
Touch Menu
> Settings > Wireless & networks
> Mobile networks to show options for roaming
networks, network selection, operator selection, and
access point names.
Security
help keep your phone safe
Quick start: Security
Screen lock
Note: You can make emergency calls on a locked
phone (see "Emergency calls" on page 13). A locked
phone still rings, but you need to unlock it to
answer.
Find it: Menu @ > Settings > Location & security
Lod< the screen in the following ways:
Locnnan ti semmry mung
ktuirly
en IC
SPCUFIT" ioti V.liTi:F
- Press PowerILock .
- Let the screen time out (don't press anything).
- Slvitdi the power off.
0
M-up nxrhiul ltzl
Set up FESUICIIIJD iock
Pustuis
To un|od( the screen, press Power/Lock ■$■ Then,
drag . to the right.
Lock pattern
e p swords
Dunn Amlnmnomn
CE admini
To set the lod< pattem, touch Menu @ > Settings
> Location & security.
Follow the instructions to draw your look pattem.
When prompted, draw the pattern to unlock the
phone.
mama: map
Passcode lock
You can set a pattem, PIN, or password to prevent
unauthorized access to your device.
To set the passcode, touch Menu @] > Settings
> Location 8: security.
Enter password, then confirm it.
When prompted, enter the password to unlock the
phone.
Forgot your pattern or passcode?
If you forget your pattem or passcode, see your
service provider.
Troub|eshooting
we're here a) help
Crash recovery
In the unlikely event that your phone stops responding
to touches and key presses, try a quick reset. Remove
the back cover and battery ("Assemble & charge" on
page 3), then replace and SWiId1 your phone on as
usual.
Reset
To reset your phone to factory settings and erase all
the data on your phone. toudi Menu
> Settings
> Privacy > Factory data reset > Reset phone.
Waming: All data on your phone will be deleted.
(Nothing on your memory rd is deleted.)
Service & repairs
If you have questions or need assistance, go to
where You can
select from a number of customer care options. You
n also contact the Motorola Customer Support
Center at 1-800-734-5870 (United States),
1-888390-6456 (ITY/TDD United States for hearing
impaired). or 1-800-461-4575 (Canada).
Safely, Regulatory & Legal
Battery Use & Safety
pT]■
M1stI1d1eIvIaIseirunn|xIq)utaflIIl_]dhaflntIss,adpa‘huiaflyfimn
memlinnduseofthrqpdlniuies.
0 IIuI1Bnsdh.u|i,p-:h|.:I|l.udhIuiujh
“HHIHHEI
_
0 hfllilufllilnlulfilyu-le|II:lIIufll.'Vhtu
g9tiIoflI:nIIiatiaIi:3'scimits.|eafir|gmuxrusirLflItIenIii|edait:e
ilIVuhateryg_etwet.|nateflnndna|:h_adbyyulsetviz|:wiutamuxna1
Mmlda,aIaIIflfuyq)|)eumbewutIIg|!qn|1'
_
0 lI|I1IoIIh&|yh|I:IIndoIp|:L|fnminbp:1s,s1|inas
j9mhy,sIzyin|1uu|9aduula1wittIflnlnmxycmItz1poiIs.ltI!tnnuy
Izulldlmolrevuylu.
0 III'lflupIlflIllIi|:uIIfil1IIII|ia|Iu.'En2a‘ve
lndthruyflnlldiadmflnuflnmtmyl-lylmpumms
flnlnmxymsun!l,h&undfuI1imfl1eMum
0 h’ttyIIflIdq|flI1wIIqflm|II|fla|II:I,s1ma
wt.I|nidIyuIInicruanveuuaL
0 |IonI'l||lI'qyufliuniu'IyuI:I'I$:IfiIs.'
0 Ibn_IiIiIfi|I|IfiI1II@i|hIi|:|.'[)tq)pirgflnsei1eII|s,
espeI:d|yma|udal_la:e,pm!m2i|y§hInm'
_
0 llnuflclptaullupliluuflullllalynuuflnhaluu
&IyInhn1pliuiq'Qu#.fi|t&Is.
'lIh:NwaysIIdns1lettaflIe|msycu1|nnIIentdosuIar|1seuletn
miidrumqlnunledflnlnltuymarlyoflheseulnitius.
sfipulmbadwnnusnuthmfylgauflunmmmnhhatlulmtmn
mmijdumlmfiitlumilfiatnwmlmeaieqmenfelynumfiull
Mmlltapwiitaslnlngammitshannzqitgacntnllsstmhiulnfinnflatau
haflaytheypIldnse|asa'|hmula0r|yrd'In|ugan
_
Elrnhllezfiylldnplnfinnh-hfllllfilinfl
clupxmmuhnnmedavinsaredesiymmmtvimmmdalnuuies
lfymannssagamylldsphysqilasllwalid Bauetyur
Umblemdnrggtdtefluetdkumgnqx
- He|Imefl|ehmetyauiI1s|n1itmuIIfImItntitrasa'|Imrda(1iu_ind'
ml
0 Itfl'g:i'sFm|nhganLflnln1uyismaMmdalmax
0 flttII!eisatIlIl_|raI],rqia:eflIehalu;tya1dtIyI:!IIg'Igita|_pirt
0 |tttmI1essa_prs,uxIlaI:taMmnhaIIlnImdseIvI:eI:mlaL
hufl:M1nIuhk1nrarlyti1esrlxw4udarqpmfl|ennbi|ethvi:aInsed
tumnflmtohlnnuiesali/ordngxs.
&'g:lheofaImMlIrnla|nIIuynrdag!IIny|mulaIisldfIe,
enIosIII.leztaga,ordIIet|:«1m1
.
Hquflsfiflhgigndulrupphghqummydsumlsllp
GIyI|l[Il@fl_flflHV,flIK!lfi1f]iEell_flflnHI:CflflflI!tSflH_yfE$19_I1Hl
medhatIn|esnn'aIyta2iusuw:e|Ionch|u:1.MfItuul|IIklnmotIm
uqnudsmsdarlrwyuillgnnylnfinmmflnwalr
° ununmmzdammlmmlmn
- m@mm
_
Dilpntfimqliydqalnenflnulhatulesnanlthrmmmlufl
Q5
mghtmcummlmmuingwmumimmuim
Q;
again‘‘msfurnueirfannluxll’ mmwmtispaseofhalmrlea’
wuagumcrqnmmmmiesmafimmmmeynnyauum.
_
tetmazmm
expose
baIm_nsmtutpaaIlaslxa|w0°c(32°F)udme45°C(113“F|vdm
dtarm
- Newlnltuiesaelnidlyduged
0 Newhalteriestrbatteriesstuedfualulgtillalmytdrermmfinnmdlaga
53
0 Mnurdahatmiesaudngilgvplulslmtiuiuyflntumeusfinhatruy
inIn(hnagpftunmtdng'Iu
Driving Precautions
lhqlmghhaiisahfiviqisyutuhnyleqxunflnymmlnilnjfleued
of_qvaIII$ellsrgaIIIii_edeu;euax:e§sIyi_zraIuuietmIIzuIvaiIie
(IwlI]nayIi§tra1nLllsIIJaInII|e¢tmnuax:essngynnyIIa|1I!ilIed
uresltuedlnwtanamadmpmqmahmmimlmmsmmemd
Iheseuudlztx
Kati‘-glifl:
I Twecneallnnx
0 Btuonwiuuvniltuuhva.
0 Suflhevm
0 lrwtmvimtimhimluim
I Pahmamflufiltliasflmivmyuxalulliulfimltiiilq
“Him:
WWWNWW
.
.
Useahadsileedevlzelialliafleulugleibyhwllytllaln
Blndasfilnhihlunnfimimarmigaimdejmlfiluliving
llmninaiivatndiaanleslstdlasuiwtidladqaedingfedllnslsuilas
:uib|e¢iru1ims),ifan'|dIle.
0 tlxeyzlluzllamsallrlgihlilisixlllalilrnlieltavinesali
inlievdlide
0 EnIyulcd|nrmiIartaskifyu1t:aII1uII:amInm¢ivi1g
|hIuIiIumfd|uume'SuIutI’ta1ieesVJli|eI}iviIg'hflIisgidamia
fnwMM
SeizuresIB|ackouts
Summqlennybesnszqxiiemqflqxicseiallasaflazhnllsvtmeqmeim
fldimliyusmaflqlphyirgvihmugplmflesenwmnfla
W!lIiBSIHH’_ifl1a[.lP_lIlEl)l
_
_ _
flyuIlnemmnramIub|a$'n1[Is_,uflyIm|Ia4e_aia_n|yhstuydaI!I
mliulmplgsemnmumwlflrpnlmheflayimvqammgamu
udllgaflaslllg-ignshmlelifaaidielmyllxllduledelln
54
Disultiunaflomnltgugysiialiiaqdlllefllgnuilgsyliqrmmunr
mmpqmqmnhmmlgmmmuumlmmynwumuu
Iislrletlzllmltlsalwaysaguodmalnlnldlieslneuuamyfiunyuleyea
|ea|eIlIi|igjIsmi1flemmu:Ieal54IinInIIum1yInI,aIlsn1)if
ymaetiatl
Caution About High Volume Usage
fiqfimmlemluniqnausulwiumnmd
p|!nisofnnn_nay_affeI1_ytllIeeIIIgTIIe|u1_Ihfl1evIluI|;stllIi
|m|,IlI;|esshne|_sIeI;|rndI|tunyulI|euIguIldheafIaI:leI1
Iowniyulimllg
0 ljnitflnalumdfimyiunusaieatlsasaleaqiuesatlijnume
I Avlidnliilglpflnuiluremfluiulllisysnulnilgs
I Tunflevdunednmlifyllitinapengdeqlflilgreaylnl
ilymennngnqlnglgdannfutmlliigflnwsmmdpmsgreqmlmss
npleas.nIq|l|gnyoIlaas,anumeds|m!I,yIIIsIuIH§Im|Is1n|I'gmfle
mtmflruimylllnalsauleajluesadllanwllnullgdntnl
dnl|Inirg,ulWd)sima
Repetitive Motion
Vlimynurqltithnlypuilmaniussifllasulkssjlgkefiuuluig
fII_p4uinmduams,yI|m{eqnrnmumsIx|dd§I:xIiulhyurInans,
lll_S,SiflI(hI:,lI!:K,Gd|I!|flISOfIllhl}[:|!ylflulflmBh)IBEli§nlIWl
flagfiglmhsmummmmaflmum
Small Children
bqpuufluduhflhuuuuiuuniqiciiu
Iimapruinsaellltopaidnnyhallazatklsmsldldlitutfotlmlqicx
0 AdutiI1gIazadnnyui.~;fu||.deta:lnaIepa1x_
_ __
I h|lq)eIuIldIestlt_InImsulI1s,pussi1lyanslgieanII_1nmt
0 hmpulylndledhmmesuxldoauieaamahm.
Glass Parts
Sum|n|tsofyn|rnIIi|eni:vimra{heI1nleofgn.llisgassaIIlh|-zltif
Ihepu(i|1is(iw|:3duIa|iIdslmurwivesasIis1anidirpa1lfgass
heds,durntnuiIIlaIeII|xtnrurme.SlnprI_]yuInIii|edeIi:euIfi|flIe
gmisrqiatzeilryaqtflfiedsuubeoerln.
9.-unuiiiu
Dorncispmedyurlmayannlileuhvinwimyul
lnndm|dumeSea'|’eLy:lil_;'i:rnuainfuni1ix|.
Ftrilhnruseuiy
Operational Warnings
Iheydlpxtulstprsflmusirgnnfiledwinshpflicaeas
Potentially Explosive Atmospheres
NeasIiflIplemh|lymqInsiveanrns|iI!esaeoflerI,hnIxldways,mstedaIl
caIhduiefiIi1gaeas,suiIasheIuu(IadsmlI1ats,me|mdIaIi2|uastuu
stmaJefa:flifies,maInsvmeIln:ircul:irsduri:lsu;atiies,su$Ias
girldmunmlpmms
_
WherIyInaeInsI|dnmaea,nmoflynlnfl1iethv|12,addnIl1Iurne,
istdl,ordngabaterieahsrIiIaeas,sp:tlst:aIu:::ra1daIeqII1silI
«fie
Symbol Key
Yull)aI1ery_dngu,mnIi|edevi:ennyuxIaiIsyIIlis,thfirIedastlkuK
spur
niacin
Inmmsamyinrunniunullm
® Domttisgnseolylulmleryunntiledevizehafire
Q
Q)
Yulbatuylarrlnfllethvinllnyrupimruylilqh
aznthrlxawllhlmllauscorlatiyurloulreglfluy
aumnritiasiurnneiflumim
Ustuilagatfillughnemmsicumiaeflluqjlaleadststnny
|hM.l9W|l'l*l|||J
Radio Frequency (RF) Energy
Exposure to RF Energy
Yurlrmliledwimwlfisauaulimraflruzeimwmflisfllitrmdus
■
nwnnitléalllgylnrailmirdsflepuwulevelatvdidlynlnnhledevun
Yurmxflhdefuzeisdesipdmaurglyydmlmdreglauyrupirmuuntshyul
uumymmnmemmleofhnmlnlrgsmlungy
RF Energy Operational Precautions
Faqximlnnbiedzvizemrflrnarlzejndmhesuleflahlrnltmmlemlf
uI!g(dmsrIxmnwIflIegIihliInssethflIhflIere|e4u1tstaIiads,dvays
Illloulheseirsmnirsmdpeuzniuus
0 WlIe1plairgtxru:|i\irI_;a[IIl1eI,lnk1yuInIIi|edevi:ejst|FIeym
wnuldalallinemyn. _
_ _
0 flwuueaflnrlnhbdevunmyurbulydvaysflamflnnnhledwmnna
Mtuoh-su1|ieduawuseddip,Imla.'ln|ste,,uh:dyIIaI1essflyu:
dJI1pluse_almdy-yun axzessuyaplliedugqxmedlrymmldaleqafle
nnb1|edeu|:eq1d|IsmtuIaat||ast25oumnnIus|1|IuiI|lranyrxIhndy
M'I!ntr8|fiTIIIlu
• Using accessories not supplied or approved by Motorola may cause your mobile
device to exceed RF energy exposure guidelines. For a list of Motorola-supplied
or approved accessories, visit our Web site at: www.motorola.com.
Specific Absorption Rate (IEEE)
RF Energy Interference/Compatibility
Your mobile device is a radio transmitter and receiver. It is designed and
manufactured to not exceed limits for exposure to radio frequency (RF) energy set by
the Federal Communications Commission (FCC) of the U.S. Government and by the
Canadian regulatory authorities. These limits are part of comprehensive guidelines
and establish permitted levels of RF energy for the general population. The
guidelines are based on standards that were developed by independent scientific
organizations through periodic and thorough evaluation of scientific studies. The
standards include a substantial safety margin designed for the safety of all persons,
regardless of age or health, and to account for any variations in measurements.
The exposure standard for mobile devices employs a unit of measurement known as
the Specific Absorption Rate (SAR). The IEEE SAR limit set by the FCC and by the
Canadian regulatory authorities is 1.6 watts per kilogram (W/kg), averaged over one
gram of tissue. Tests for SAR are conducted using procedures accepted by the FCC
and by Industry Canada with the mobile device transmitting at its highest certified
power level in all tested frequencies. Although the SAR is determined at the highest
certified power level, the actual SAR level of the mobile device while operating can
be below the maximum value. This is because the mobile device is designed to
operate at multiple power levels so as to use only the power required to reach the
network. In general, the closer you are to a wireless base station, the lower the
power output.
Before a mobile device is available for sale to the public in the U.S. and Canada, it
must be tested and certified to the FCC and Industry Canada that it does not exceed
the limit established by each government for safe exposure. The tests are performed
in positions and locations (e.g., at the ear and worn on the body) submitted to the
FCC and available for review by Industry Canada. The highest SAR value for this
mobile device when tested for use at the ear is 1.49 W/kg, and when worn on the
body, as described in this guide, is 1.50 W/kg. Body-worn measurements can differ,
depending upon available accessories and regulatory requirements. The SAR
information includes the Motorola testing protocol, assessment procedure, and
measurement uncertainty range for this product.
Nearly every electronic device is subject to RF energy interference from external
sources if inadequately shielded, designed, or otherwise configured for RF energy
compatibility. In some circumstances, your mobile device may cause interference
with other devices.
Follow Instructions to Avoid Interference Problems
Turn off your mobile device in any location where posted notices instruct you to do
so.
In an aircraft, turn off your mobile device whenever instructed to do so by airline
staff. If your mobile device offers an airplane mode or similar feature, consult airline
staff about using it in flight.
Implantable Medical Devices
If you have an implantable medical device, such as a pacemaker or defibrillator,
consult your physician before using this mobile device.
Persons with implantable medical devices should observe the following precautions:
• ALWAYS keep the mobile device more than 20 centimeters (8 inches) from the
implantable medical device when the mobile device is turned ON.
• DO NOT carry the mobile device in the breast pocket.
• Use the ear opposite the implantable medical device to minimize the potential
for interference.
• Turn OFF the mobile device immediately if you have any reason to suspect that
interference is taking place.
Read and follow the directions from the manufacturer of your implantable medical
device. If you have any questions about using your mobile device with your
implantable medical device, consult your healthcare provider.
56
Your model wireless phone meets the governmental
requirements for exposure to radio waves.
While there may be differences between the SAR levels of various mobile devices
and at various positions, they meet the governmental requirements for safe
exposure. Please note that improvements to this product model could cause
differences in the SAR value for later products; in all cases, products are designed to
be within the guidelines.
Additional information on SAR can be found on the Cellular Telecommunications
& Internet Association (CTIA) Web site:
http://www.phonefacts.net
or the Canadian Wireless Telecommunications Association (CWTA) Web site:
http://www.cwta.ca
Information from the World Health
Organization
provide reasonable protection against harmful interference in a residential
installation. This equipment generates, uses and can radiate radio frequency energy
and, if not installed and used in accordance with the instructions, may cause
harmful interference to radio communications. However, there is no guarantee that
interference will not occur in a particular installation. If this equipment does cause
harmful interference to radio or television reception, which can be determined by
turning the equipment off and on, the user is encouraged to try to correct the
interference by one or more of the following measures:
• Reorient or relocate the receiving antenna.
• Increase the separation between the equipment and the receiver.
• Connect the equipment to an outlet on a circuit different from that to which the
receiver is connected.
• Consult the dealer or an experienced radio/TV technician for help.
“Present scientific information does not indicate the need for any special
precautions for the use of mobile phones. If you are concerned, you may want to
limit your own or your children’s RF exposure by limiting the length of calls or by
using handsfree devices to keep mobile phones away from your head and body.”
Source: WHO Fact Sheet 193
Further information: http://www.who.int/peh-emf
Industry Canada Notice to Users
FCC Notice to Users
GPS & AGPS
The following statement applies to all products that have received FCC
approval. Applicable products bear the FCC logo, and/or an FCC ID in the
format FCC ID:xxxxxx on the product label.
Motorola has not approved any changes or modifications to this device by the user.
Any changes or modifications could void the user’s authority to operate the
equipment. See 47 CFR Sec. 15.21.
This device complies with part 15 of the FCC Rules. Operation is subject to the
following two conditions: (1) This device may not cause harmful interference, and (2)
this device must accept any interference received, including interference that may
cause undesired operation. See 47 CFR Sec. 15.19(3).
This equipment has been tested and found to comply with the limits for a Class B
digital device, pursuant to part 15 of the FCC Rules. These limits are designed to
Operation is subject to the following two conditions: (1) This device may not cause
interference and (2) This device must accept any interference, including interference
that may cause undesired operation of the device. See RSS-GEN 7.1.5. This Class B
digital apparatus complies with Canadian ICES-003.
Your mobile device can use Global Positioning System (GPS) signals for
location-based applications. GPS uses satellites controlled by the U.S. government
that are subject to changes implemented in accordance with the Department of
Defense policy and the Federal Radio Navigation Plan. These changes may affect
the performance of location technology on your mobile device.
Your mobile device can also use Assisted Global Positioning System (AGPS), which
obtains information from the cellular network to improve GPS performance. AGPS
uses your wireless service provider's network and therefore airtime, data charges,
and/or additional charges may apply in accordance with your service plan. Contact
your wireless service provider for details.
57
Your Location
Location-based information includes information that can be used to determine the
approximate location of a mobile device. Mobile devices which are connected to a
wireless network transmit location-based information. Devices enabled with GPS or
AGPS technology also transmit location-based information. Additionally, if you use
applications that require location-based information (e.g. driving directions), such
applications transmit location-based information. This location-based information
may be shared with third parties, including your wireless service provider,
applications providers, Motorola, and other third parties providing services.
Emergency Calls
When you make an emergency call, the cellular network may activate the AGPS
technology in your mobile device to tell the emergency responders your approximate
location.
AGPS has limitations and might not work in your area. Therefore:
• Always tell the emergency responder your location to the best of your ability; and
• Remain on the phone for as long as the emergency responder instructs you.
Performance Tips
• Go outside and away from underground locations, covered vehicles, structures
with metal or concrete roofs, tall buildings, and foliage. Indoor performance
might improve if you move closer to windows, but some window sun shielding
films can block satellite signals.
• Move away from radios, entertainment equipment, and other electronic devices.
Navigation
When using navigation features, note that mapping information, directions and
other navigational data may contain inaccurate or incomplete data. In some
countries, complete information may not be available. Therefore, you should visually
confirm that the navigational instructions are consistent with what you see. All
drivers should pay attention to road conditions, closures, traffic, and all other factors
that may impact driving. Always obey posted road signs.
58
Smart Practices While Driving
Check the laws and regulations on the use of mobile devices and their accessories in the areas where you drive. Always obey them. The use of these
devices may be prohibited or restricted in certain areas—for example,
handsfree use only may be required. Go to www.motorola.com/callsmart (in English only) for more information.
Your mobile device lets you communicate by voice and data—almost anywhere,
anytime, wherever wireless service is available and safe conditions allow. When
driving a car, driving is your first responsibility. If you choose to use your mobile
device while driving, remember the following tips:
• Get to know your Motorola mobile device and its features such as speed
dial, redial and voice dial. If available, these features help you to place your
call without taking your attention off the road.
• When available, use a handsfree device. If possible, add an additional layer
of convenience to your mobile device with one of the many Motorola Original
handsfree accessories available today.
• Position your mobile device within easy reach. Be able to access your
mobile device without removing your eyes from the road. If you receive an
incoming call at an inconvenient time, if possible, let your voicemail answer it for
you.
• Let the person you are speaking with know you are driving; if necessary,
suspend the call in heavy traffic or hazardous weather conditions. Rain,
sleet, snow, ice, and even heavy traffic can be hazardous.
• Do not take notes or look up phone numbers while driving. Jotting down a
“to do” list or going through your address book takes attention away from your
primary responsibility—driving safely.
• Dial sensibly and assess the traffic; if possible, place calls when your
car is not moving or before pulling into traffic. If you must make a call while
moving, dial only a few numbers, check the road and your mirrors, then continue.
• Do not engage in stressful or emotional conversations that may be
distracting. Make people you are talking with aware you are driving and
suspend conversations that can divert your attention away from the road.
0 Ihnpulfiilhhclhhhflflmlumuhflmugxq
nnbahfleoffimuafitamismunafndmngptlimmnum
wildmmesuvineisaaildllel
I Ihpilflnlninhhhfinitpnislfpnsnamam
amixl,‘ ctinni1|1Iyess,ototlI!saI1us' aluwmdlatuflvasaeil
uhqx,||911uuiIerh:luIugpItynnI)alulnmmridess|I:m
isiHJ|e|,asyIl1wu||IiumtmhnrslndoIIIyIlL
0 cllifihluiucuaaplciu-Zplqiiulnu
Iui&uIjItIh||c|nIy.|fyu1alIIIuHitwa1uali:|e
|nsigmsuiIs|1azad,ahtinmaflicsi_;n|,aniIluafl'ca1iduIIlIn
mmeq1p|:Isin'plad,uav|tiieyu1hInumI1estnIeILI:llInai§|h
asistalzeulnllusmddmraluguywielasnnlzululnunrwidess
pllmsetviwisatilaiel
Pnvacy & Data Security
Mmluhulhlstzlllstauivawaddaasaulityaailwtaltnuuyun
hzpewmfmmdymnwhwflnnwafimwlmvqyuhn
_su:nty,_|iamafoIuulmsuIunnImhnusmuInI:epImnu1mIJfyul
0 I&uuu—KmpyuInI)h1edIvi:ewiflIymatdthII1lsa\eitvtlIun
oflusnnytanmmiuluianasslmiyxtnbvhekiegndmneflis
iameflia
I lIqIdfi|qI&—IfMlnthuasuliwuaImfI2tilIIu|il
te|eaysgpadguwmnefixhymndihmbalmIuhmh&dn's
smmty,ImllIt3som:s_pnssilI9.
_
0 S|uIPI||fl&I1I—YulnI1|1iledu|nI:ensnIapasIml
imunItil|i1vwimsluafiasiIiI|iI_"ulSlMI:xd,nIaInyIzd,arI1
fllmnmuyflegnmmomaplaxdlpasludflunaumhahaunn
ru.1de,IenmugueagaywmumYu1mdsoInchuyul|nwfldam
mnaslumalvadevm
Kcfuirlunuimmlwumlninpuvfinedialrunyurnliiledevin,
mm
0 &uoum—SaI|ennli|edwi:esm_wiiea|_lm|IIIauima1:un
|:x!IasMlT(ll1flL6nmyulamnfuIItunanmm|mmnan_;eIl|e
azunlrtalillrumsazlityluaulassuzllasrarllnwinealicbvine
Iuuzimlmleaddlel
I l|fieIi——lnsHflimpmymimilsfIunlIustaduly.
Iwinhsmvempliumillhnaillsunasdlmlalnnill
tililsarlrnmulrwuluss
0 Iflu-hd mmmimm
iflunuimflathelnulmdetuninflnmllninatehzfiultialniile
thvinmliluiunsflidlaaulluiulmawialmsrlnwuknaurit
lI:aiuHnsadiIIknnnilL|)rIi:osu1dIulvdflI6|’SuA(i’StodIIingydw
namihziurhmmhhnuimmifilnluflpllmqfliahsflfl
ra;lq|mmtg+|maiIrgfllnanqI|leg_ttMIJ_¢iIu1|Is),s|i|q_|I"I:lns
uaumlnnnrhundnhtnnlmmshmnuhhasedflunnnlnayln
wagdfimflimmmuimdgwlyiruagwvugwmgqfliflhs
|xmItaIs,IM|luh,:lIicIlIeIflIIrdpmJns|luv|flIgsuvI:_I5.
_
I ■_q■
te§irq;aIiulIItiagI1sficfII:ixiI;kwiuHmadliiunuim,aIicI|Is!
iflunnahimmmlohuuintflillnntyselvuflhis
iflunuimislsedtntdpirumulmxsandcifauilrfmmluh
flwllnnflflumnsliuslamdiglwfletsedpunnhhdevinenny
n|_nI:tyuIrpnvaLyIIdaasuunty,|ieaseIxIIa;tMm_daat
mnmflnmnmlamm uwmmmmuwdm
Use & Care
IofuyoIrMmIo|annh1edLi:e,|leaaadnuveflniJ||oAiI1g[
ifils
Dcl|'tapmeyIu|I_1IIi|e_tl!via;mIm!,Iain,a:tIu|Ia|nniIily, _
9qBl.ummrqnth|fntdnmgugvu,¢II'twmaxxluaeay_Ig
mmmofmoulammasmsnaymnmflnnmbmm
all-Iliucll
Aun'dtnIpuauashe|wu0°U32'FudlJM5‘CII13°F.
iulunu
DuI'tuymdIyyunIIuli|ed2vininani:omemuL
hludil
lJm'teipgmyI1rnph1ew4i:emdist,ufrLsa1d,fluid,aoIlIa
Iiqpqnatenneruls
x
dnégaeliuu
_
Tnchalwrnmledwmimmwaayafldmlllmineahdnl
orllladuiigslliliiris
auuuiniu
Don'tniq:yIunuliledevi:e
Tole|:;II1tectyIulnnli|edevi:e,dIaysIIidnsilellIMlnln1|:y
ulluamelilalialyixliiuxlrwlusaudosedanlseure
Recycling
Mobile Devices & Accessories
Heasedolxndisiliseolnflilenbvioesudeiiliallsiniiasdllgas,
lmls|as,ahanuies)wiIhyIulnnelIidunste,uhafire.lliesaituIsslnld
mdspmadofinwmdanquimflelryilflufllqiilladtwuiirgsdurm
upaamdb”llh|‘daruJnIdallgIny.Nmrrnbvdy,ytIinnyrehm}IvnlIled
iIII1idev_nesaIl_dechI2IeslnaI[IlmIohAqmNedSavu:eCerIII
g|yunogmDaakofMmxdaq|_IgvgalI1IIIflracyIirigsd|aIns,adhlflnr
Ilunmmwlkmohruyilgatmmsnhefumm
mnnu.nnmmla.I:om£mmI:|iIn
Packaging & Product Guides
Huniztpaiagirljadmfllligihsslmflmlybetisymadifhaxnihnneuim
Inilddhcfiuiafllumiiigrupirmulsllmemntwrrajml
amiiesfunuadetak
California Perchlorate Label
Sumnnhleplnnsmirlnldpmllmunbahphalnymflnpirled
druitlmdlllannyuminvuymldlammtsdpadlkxalnlnsunicasas,
(Hnhria Iawmiusltefdwimlihet
PadIk:ae|IhIaid—speddInidiignnyqplyvtiu1flnhanuyisrwpedu
¢i=Im.°d°*-5°".
.
llmis msmlzd lmiirg natured b/ctmllus
Hearing Aid Compafibility with Mobile
Phones
Sillelaimolaplniesaelleasledhlallmiililyuiflllnaimailsflfllehn
fuyul|gafiuIzIIui!las1htulfulhaiIq;Ails'|1iilndmiLllnlolkruiIg
WWNR
.
_
..
Vlimnnhleflulsaetselrnaslmlmnrgciavnesflealgalsafl
uuleailqhixlllaythlnahmiiuhnllirgafliiilgmimfilm
|'Blifld8BflIlBimflI!llfl|(IlI!Sfl)fl‘iSiflI!llUl!l!!lli$,flll|IllI3$
dsoiuyinlfnamnaliilmlaunelheygaunm
flnwimlsstdqinnilmsnyliasuhelcpedratiigsinlliectflnirinlile
|l_Il|9s,lI:asssllna_l|g¢t!vI:al|s:snfIIirg|lIflannyheouIpan}le
vnmflurlmuqdevlmflnallglunslmmmlatalflunsfluaomd
mmflnmfingmflleihnualdnlmflnbmlonimhflnptfislndlhaiq
AidCmqntii|fly|l|AC)rafiI'gfuIisnIiIle|iun,ineuiyflnaigim|eqjlrnn
lmuyinodd
Tlerafiligsaalngaattmlisiltxwfllvaydlmnitlgmflmusrslnaig
ttiizuaidleaigbssflyullaaignhflaeluqnsmlnuiemflem
ntuluerce,yu|nay_Inbe_dIemar:ted|iImsu:esslIllyiyiIqulflie
munhynullaaillgthvmlsflnwstunylnadintenfuryulpusuid
M-Ratings: Phones rated M3 or M4 meet FCC requirements and are likely to
generate less interference to hearing devices than phones that are not labeled. M4
is the better/higher of the two ratings.
T-Ratings: Phones rated T3 or T4 meet FCC requirements and are likely to be more
usable with a hearing device’s telecoil (“T Switch” or “Telephone Switch”) than
unrated phones. T4 is the better/higher of the two ratings. (Note that not all hearing
devices have telecoils in them.)
Hearing devices may also be measured for immunity to this type of interference.
Your hearing device manufacturer or hearing health professional may help you find
results for your hearing device. The more immune your hearing aid is, the less likely
you are to experience interference noise from mobile phones.
Software Copyright Notice
Motorola products may include copyrighted Motorola and third-party software
stored in semiconductor memories or other media. Laws in the United States and
other countries preserve for Motorola and third-party software providers certain
exclusive rights for copyrighted software, such as the exclusive rights to distribute
or reproduce the copyrighted software. Accordingly, any copyrighted software
contained in Motorola products may not be modified, reverse-engineered,
distributed, or reproduced in any manner to the extent allowed by law. Furthermore,
the purchase of Motorola products shall not be deemed to grant either directly or by
implication, estoppel, or otherwise, any license under the copyrights, patents, or
patent applications of Motorola or any third-party software provider, except for the
normal, non-exclusive, royalty-free license to use that arises by operation of law in
the sale of a product.
Content Copyright
The unauthorized copying of copyrighted materials is contrary to the provisions of
the Copyright Laws of the United States and other countries. This device is intended
solely for copying non-copyrighted materials, materials in which you own the
copyright, or materials which you are authorized or legally permitted to copy. If you
are uncertain about your right to copy any material, please contact your legal
advisor.
Open Source Software Information
For instructions on how to obtain a copy of any source code being made publicly
available by Motorola related to software used in this Motorola mobile device, you
may send your request in writing to the address below. Please make sure that the
request includes the model number and the software version number.
MOTOROLA MOBILITY, INC.
OSS Management
600 North US Hwy 45
Libertyville, IL 60048
USA
The Motorola website opensource.motorola.com also contains information
regarding Motorola's use of open source.
Motorola has created the opensource.motorola.com website to serve as a
portal for interaction with the software community-at-large.
To view additional information regarding licenses, acknowledgments and required
copyright notices for open source packages used in this Motorola mobile device,
please press Menu Key > Settings > About Phone > Legal & Safety
> Open source licenses. In addition, this Motorola device may include
self-contained applications that present supplemental notices for open source
packages used in those applications.
Export Law Assurances
This product is controlled under the export regulations of the United States of
America and Canada. The Governments of the United States of America and Canada
may restrict the exportation or re-exportation of this product to certain destinations.
For further information contact the U.S. Department of Commerce or the Canadian
Department of Foreign Affairs and International Trade.
Product Registration
Online Product Registration:
www.motorola.com/us/productregistration
Product registration is an important step toward enjoying your new Motorola
product. Registering permits us to contact you for product or software updates and
61
allows you to subscribe to updates on new products or special promotions.
Registration is not required for warranty coverage.
Please retain your original dated sales receipt for your records. For warranty service
of your Motorola Personal Communications Product you will need to provide a copy
of your dated sales receipt to confirm warranty status.
Thank you for choosing a Motorola product.
Products Covered
Length of Coverage
Monaural Headsets. Ear buds
and boom headsets that transmit
mono sound through a wired
connection.
Limited lifetime warranty for the
lifetime of ownership by the first consumer
purchaser of the product.
Motorola Limited Warranty for the United
States and Canada
Products and Accessories
that are Repaired or
Replaced.
The balance of the original warranty or
for ninety (90) days from the date
returned to the consumer, whichever is
longer.
What Does this Warranty Cover?
Subject to the exclusions contained below, Motorola Mobility, Inc. warrants its
mobile telephones (“Products”), Motorola-branded or certified accessories sold for
use with these Products (“Accessories”), and Motorola software contained on
CD-ROMs or other tangible media and sold for use with these Products (“Software”)
to be free from defects in materials and workmanship under normal consumer usage
for the period(s) outlined below. This limited warranty is a consumer's exclusive
remedy, and applies as follows to new Motorola Products, Accessories, and
Software purchased by consumers in the United States or Canada, which are
accompanied by this written warranty:
Products and Accessories
Products Covered
Length of Coverage
Products and Accessories as
defined above, unless otherwise
provided for below.
One (1) year from the date of purchase by
the first consumer purchaser of the product
unless otherwise provided for below.
Decorative Accessories and
Cases. Decorative covers,
bezels, PhoneWrap™ covers and
cases.
Limited lifetime warranty for the
lifetime of ownership by the first consumer
purchaser of the product.
62
Exclusions (Products and Accessories)
Normal Wear and Tear. Periodic maintenance, repair and replacement of parts
due to normal wear and tear are excluded from coverage.
Batteries. Only batteries whose fully charged capacity falls below 80% of their
rated capacity and batteries that leak are covered by this limited warranty.
Abuse & Misuse. Defects or damage that result from: (a) improper operation,
storage, misuse or abuse, accident or neglect, such as physical damage (cracks,
scratches, etc.) to the surface of the product resulting from misuse; (b) contact with
liquid, water, rain, extreme humidity or heavy perspiration, sand, dirt or the like,
extreme heat, or food; (c) use of the Products or Accessories for commercial
purposes or subjecting the Product or Accessory to abnormal usage or conditions; or
(d) other acts which are not the fault of Motorola, are excluded from coverage.
Use of Non-Motorola Products and Accessories. Defects or damage that result
from the use of non-Motorola branded or certified Products, Accessories, Software
or other peripheral equipment are excluded from coverage.
Unauthorized Service or Modification. Defects or damages resulting from
service, testing, adjustment, installation, maintenance, alteration, or modification in
any way by someone other than Motorola, or its authorized service centers, are
excluded from coverage.
Altered Products. Products or Accessories with (a) serial numbers or date tags
that have been removed, altered or obliterated; (b) broken seals or that show
evidence of tampering; (c) mismatched board serial numbers; or (d) nonconforming
or non-Motorola housings, or parts, are excluded from coverage.
Communication Services. Defects, damages, or the failure of Products,
Accessories or Software due to any communication service or signal you may
subscribe to or use with the Products Accessories or Software is excluded from
coverage.
Software
Products Covered
Length of Coverage
Software. Applies only to physical defects in the
media that embodies the copy of the software (e.g.
CD-ROM, or floppy disk).
Ninety (90) days from
the date of purchase.
Exclusions (Software)
Software Embodied in Physical Media. No warranty is made that the software
will meet your requirements or will work in combination with any hardware or
software applications provided by third parties, that the operation of the software
products will be uninterrupted or error free, or that all defects in the software
products will be corrected.
Software NOT Embodied in Physical Media. Software that is not embodied in
physical media (e.g. software that is downloaded from the Internet), is provided “as
is” and without warranty.
Who is Covered?
This warranty extends only to the first consumer purchaser, and is not transferable.
What Will Motorola Do?
Motorola, at its option, will at no charge repair, replace or refund the purchase price
of any Products, Accessories or Software that does not conform to this warranty. We
may use functionally equivalent reconditioned/refurbished/pre-owned or new
Products, Accessories or parts. No data, software or applications added to your
Product, Accessory or Software, including but not limited to personal contacts,
games and ringer tones, will be reinstalled. To avoid losing such data, software, and
applications, please create a back up prior to requesting service.
How to Obtain Warranty Service or Other
Information
USA
1-800-734-5870
Canada
1-800-461-4575
TTY
1-888-390-6456
You will receive instructions on how to ship the Products, Accessories or Software,
at your expense, to a Motorola Authorized Repair Center. To obtain service, you must
include: (a) a copy of your receipt, bill of sale or other comparable proof of purchase;
(b) a written description of the problem; (c) the name of your service provider, if
applicable; (d) the name and location of the installation facility (if applicable) and,
most importantly; (e) your address and telephone number.
What Other Limitations are There?
ANY IMPLIED WARRANTIES, INCLUDING WITHOUT LIMITATION THE IMPLIED
WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE,
SHALL BE LIMITED TO THE DURATION OF THIS LIMITED WARRANTY, OTHERWISE
THE REPAIR, REPLACEMENT, OR REFUND AS PROVIDED UNDER THIS EXPRESS
LIMITED WARRANTY IS THE EXCLUSIVE REMEDY OF THE CONSUMER, AND IS
PROVIDED IN LIEU OF ALL OTHER WARRANTIES, EXPRESS OR IMPLIED. IN NO
EVENT SHALL MOTOROLA BE LIABLE, WHETHER IN CONTRACT OR TORT
(INCLUDING NEGLIGENCE) FOR DAMAGES IN EXCESS OF THE PURCHASE PRICE OF
THE PRODUCT, ACCESSORY OR SOFTWARE, OR FOR ANY INDIRECT, INCIDENTAL,
SPECIAL OR CONSEQUENTIAL DAMAGES OF ANY KIND, OR LOSS OF REVENUE OR
PROFITS, LOSS OF BUSINESS, LOSS OF INFORMATION OR DATA, SOFTWARE OR
APPLICATIONS OR OTHER FINANCIAL LOSS ARISING OUT OF OR IN CONNECTION
WITH THE ABILITY OR INABILITY TO USE THE PRODUCTS, ACCESSORIES OR
SOFTWARE TO THE FULL EXTENT THESE DAMAGES MAY BE DISCLAIMED BY LAW.
63
Some states and jurisdictions do not allow the limitation or exclusion of
incidental or consequential damages, or limitation on the length of an
implied warranty, so the above limitations or exclusions may not apply to
you. This warranty gives you specific legal rights, and you may also have
other rights that vary from state to state or from one jurisdiction to another.
64
Copyright & Trademarks
Motorola Mobility, Inc.
Consumer Advocacy Office
600 N US Hwy 45
Libertyville, IL 60048
www.hellomoto.com
Note: Do not ship your product to the above address. If you need to return your
product for repairs, replacement, or warranty service, please contact the Motorola
Customer Support Center at:
1-800-734-5870 (United States)
1-888-390-6456 (TTY/TDD United States for hearing impaired)
1-800-461-4575 (Canada)
Certain features, services and applications are network dependent and may not be
available in all areas; additional terms, conditions and/or charges may apply.
Contact your service provider for details.
All features, functionality, and other product specifications, as well as the
information contained in this guide, are based upon the latest available information
and believed to be accurate at the time of printing. Motorola reserves the right to
change or modify any information or specifications without notice or obligation.
MOTOROLA, the Stylized M Logo, MOTOBLUR and the MOTOBLUR logo are
trademarks or registered trademarks of Motorola Trademark Holdings, LLC. The
Bluetooth trademarks are owned by their proprietor and used by Motorola Mobility,
Inc. under license.
is a Certification Mark of the Wireless Fidelity Alliance, Inc.
Java and all other Java-based marks are trademarks or registered trademarks of
Sun Microsystems, Inc. in the U.S. and other countries. Google, the Google logo,
Google Maps, Gmail, YouTube, Picasa, Android and Android Market are trademarks
of Google, Inc. Facebook is a registered trademark of Facebook, Inc. Microsoft,
Windows, Windows Me, and Windows Vista are registered trademarks of Microsoft
Corporation in the United States and other countries. Apple, Macintosh, Quicktime
and Quicktime logo are registered trademarks of Apple Computer, Inc. iTunes is a
trademark of Apple Computer, Inc., registered in the U.S. and other countries. All
rights reserved. America Online, AOL, the America Online & Design logo, the AOL &
Design logo, and the Triangle Logo, are registered trademarks of America Online,
Inc. in the United States and/or other countries. Instant Messenger and Buddy List
are trademarks of America Online, Inc. All other product or service names are the
property of their respective owners.
© 2010 Motorola Mobility, Inc. All rights reserved.
Caution: Changes or modifications made in the radio phone, not expressly approved
by Motorola, will void the user’s authority to operate the equipment.
Manual Number: 68000202881-B
65
66