Audiovox OARP05S Owner`s manual

Cable Replacement Remote
OARP05S Universal Remote Control
Owner’s Manual
Manual del Propietario (parte posterior)
Introduction
Features and Functions
The OARP05S Cable Replacement Remote by One For
All is our latest generation universal remote control. Its
sophisticated technology allows you to consolidate up to
five of your original home entertainment remote controls
into one easy-to-use product. Moreover, its packed with
advanced features such as:
Use the illustration below to locate features on the
OARP05S Cable Replacement Remote and then study the
key descriptions below to learn how they function.
s
$EDICATEDKEYSTOCONTROLPOPULARFUNCTIONSONYOUR
$62062$IGITAL0ERSONAL6IDEO2ECORDER
s
0ROGRAMMABLE-!34%20/7%2KEYFORMASTERONOFF
control of your home entertainment equipment with a
single keypress
s
0ROGRAMMABLE-ACRO+EYSTOCONSOLIDATEMULTISTEP
actions into a single keypress
s
#HANNEL,OCKTOLOCKCHANNELSELECTIONONLYTOTHECABLE
box or satellite receiver
s
6OLUME,OCKTOLOCKVOLUMECONTROLSTOONEMODEOR
individual modes
s
#ODE3EARCHTOHELPPROGRAMCONTROLOFOLDEROR
discontinued components
s
#OLORCODEDKEYSTOQUICKLYLOCATEPOPULARFUNCTIONSFOR
cable and satellite
s
#ODELIBRARYFORPOPULARVIDEOANDAUDIODEVICES
Before using the product, you will need to install batteries
and also perform some programming to operate the
specific home entertainment devices you wish to control.
To find out what type of devices can be controlled by each
DEVICEKEYAFTERPROGRAMMINGSEETHEh$EVICE4ABLEv
section.
TV, DVR/AUX, CBL/SAT,
DVD/VCR, and AUD select
a home entertainment
device to control. Also see
THEh$EVICE4ABLEvSECTION
%ACHDEVICEKEYHASAN
EMBEDDED,%$REDLIGHT
that blinks upon selection
and indicates the remote
CONTROLISWORKINGANDAFTER
PROGRAMMINGISSENDING
signals.
NOTE: If you have a digital
TV converter, you can
program it to the CBL/SAT or
DVR/AUX keys.
POWER/MASTER POWER
turns on or off a home
entertainment device. For
-!34%20/7%2CONTROLSEE
the “Using the Master Power
+EYvSECTION
SETUP is used in all
programming sequences.
Installing Batteries
1.
On the back of the remote control, push the tab and
lift off the battery cover.
)NSERTTWO!!BATTERIESNOTINCLUDED-ATCHTHE
and - marks with those in the battery case, then insert
them.
3.
Align the covers keys with the cases holes and press the
cover back into place. The tab should click when the
cover is locked.
4ESTTHEREMOTECONTROLBYPRESSINGANYMODEKEYEG
46)FTHEBATTERIESAREINSERTEDCORRECTLYTHE,%$RED
LIGHTWILLBLINKONCE
NOTE: When batteries need replacement, the remote
control will cease to operate. Replace the batteries
and the unit will be restored to its full functionality,
complete with your favorite settings.
Battery Precautions:
s$ONOTMIXOLDANDNEWBATTERIES
s$ONOTMIXALKALINESTANDARDCARBONZINCOR
RECHARGEABLENICKELCADMIUMBATTERIES
s!LWAYSREMOVEOLDWEAKORWORNOUTBATTERIESPROMPTLY
ANDRECYCLEORDISPOSEOFTHEMINACCORDANCEWITH,OCAL
and National Regulations.
LIVECOMMANDSYOUR062
$62TORETURNTOWATCHING
LIVE46
LIST displays a list of
RECORDEDSHOWSONYOUR062
$62
replay) commands your
062$62SETTOPBOXTO
instantly replay the last 7
seconds of a program you
are watching.
(skip
forward, reverse, play,
forward, stop, pause,
record) In all modes
EXCEPT#",3!4USETHESE
KEYSTOCONTROLA6#2$6$
PLAYERORA062AFTER
SELECTINGADESIREDDEVICE
4ORECORDIN$6$6#2
mode, press TWICE)N#",
SAT mode, use these keys
TOCONTROLTHE$62062
functions of the cable box or
satellite receiver.
MENU displays the active device’s menu system.
INFO displays the current channel and program
information.
Navigation keys move the cursor in the program guide
and menu screens and navigate within the interactive
service.
OKCHOOSESOPTIONS006EVENTSANDTUNESTOPROGRAMS
from the program guide.
Programming Device Control
GUIDE displays the program guide.
Before you can start using this remote, you must program it
to control your components.
NOTES:
The OARP05S Cable Replacement Remote is preprogrammed
to operate an RCA TV, a Toshiba DVD player, an RCA VCR, a
Pioneer audio receiver, and a Motorola cable box. If you own
these brands of these devices, test the remote with them.
If they work, you do not have to program the remote to
operate them.
For control of a Combo device (for example, a TV/VCR
combo), skip this section and perform the instructions in the
“Setting Up a Combo Unit” section. Also refer to the “Device
Table” to find out which devices can be programmed onto
each device key.
1. Turn on a device and, if applicable, insert video media,
EGCASSETTEORDISC
NOTE: Please read steps 2 through 5 completely before
proceeding. Highlight or write down the codes and
device you wish to program before moving on to step 2.
/NTHEREMOTECONTROLPRESSADEVICEKEYONCEIE$6$
6#2$62!58!5$46OR#",3!4ITWILLBLINKONCE
0RESSANDHOLD3%450UNTILTHESELECTEDMODEKEYBLINKS
TWICETHENRELEASE3%450
4. Use the codes in the accompanying code list to locate the
type of device and brand name and then enter the first
four-digit code for your device. If performed correctly,
the selected mode key will blink twice.
NOTE: If the selected mode key emits a long blink,
the entry is invalid. Repeat steps 2 through 4 and try
entering the same code again.
!IMTHEREMOTECONTROLATTHEDEVICEANDPRESS0/7%2
once. The device should turn off. If it does not, repeat
steps 2 through 4, trying each code for your brand until
you find one that works. If it still does not respond,
TRYSEARCHINGFORTHECODESEETHEh3EARCHINGFOR9OUR
#ODEvSECTION
NOTE: If the device does not have a POWER key (e.g.,
DVD and VCR), press the Play) key.
6. Once you’ve found a code that turns your device on and
OFFTESTOTHERREMOTECOMMANDSFORTHATDEVICEEG
VOLUMECHANNELMENUETC
NOTE: By default, the CH+/- keys change channels on the
CBL/SAT device regardless of what mode you’re in. So,
you should only use these keys to test for CBL/SAT device
codes at this point.
7. Repeat steps 1 through 6 for each device you want the
remote control to operate. For future reference, write
down each working device code in the boxes below.
EXITLEAVESORCLEARSYOURDEVICESMENUORGUIDE
DAY +/-MOVESADAYFORWARDORBACKONYOURDEVICES
program guide.
PAGE +/- moves up or down one screen at a time through
menu screens and the program guide.
A,B,C,D (red, green, yellow, blue) access additional
features on your cable box, satellite receiver, or Blu-ray disc
PLAYERSEEYOURDEVICEMANUALFORDETAILS
VOL +/-RAISESORLOWERSTHEAUDIOVOLUME
ON DEMANDACCESSESYOURPROGRAMPROVIDERS6IDEOON
$EMANDSERVICES4HE/.$%-!.$KEYMAYNOTWORKWITH
your program provider. Test the key, and if it doesn’t take
YOUTOYOURPROGRAMPROVIDERS/N$EMANDSERVICEYOUCAN
PROGRAMTHE/.$%-!.$KEYTOACCESSTHESERVICE3EETHE
h0ROGRAMMING-ACRO+EYSvSECTIONLATERINTHISMANUALFOR
more information.
CH+-SELECTSTHENEXTHIGHERORLOWERCHANNEL&OR$6$
PLAYERSUSETHESEKEYSTOSKIPFORWARDORREVERSETHROUGH
CHAPTERS&ORAMPLIlERSRECEIVERSUSETHESEKEYSTOSELECT
THENEXTHIGHERORLOWERPRESETSTATION
NOTE: By default, the CH+/- keys change channels on
the CBL/SAT device regardless of what mode you’re
in. To change the way the CH+/- keys work, see the
“Programming Channel Control Lock” section.
MUTE turns the sound off or on.
FAV cycles through your favorite channels on your cable
box or satellite receiver.
LAST recalls the last channel.
Number keys (1-9, and 0)TUNEDIRECTLYTOCHANNELSEG
&ORAMPLIlERSRECEIVERSUSETHEKEYPADNUMBERSTO
select inputs 1 through 10.
– ACCESSESDIGITALSUBCHANNELSFOREXAMPLEOR
ASPECT changes the aspect ratio of the show you are
WATCHING.OTAVAILABLEONALLDEVICES
PIPTURNSTHE0ICTURE)N0ICTUREFEATUREONOROFFIF
AVAILABLEONYOURDEVICE
SWAP switches PIP images and sound between the main
and window pictures.
MOVE moves the PIP window to different positions on your
46SCREEN
PIP CH +/- are used to select the next higher or lower
channel and is displayed on your PIP window.
INPUTIN#",3!4MODEISUSEDTOVIEWOTHERVIDEOSOURCES
!OR")NOTHERMODESUSE).054TOSWITCHBETWEENTHE
source inputs on the device you are controlling.
MACRO1 and MACRO2 are reserved for use as macro keys
SEETHEh0ROGRAMMING-ACRO+EYSvSECTIONLATERINTHIS
MANUAL
$6$6#2#ODE
$62!58#ODE
!5$#ODE
Device Table
#",3!4#ODE NOTE: Please refer to the table below when performing
the instructions in the “Programming Device Control” or
“Setting Up a Combo Unit” sections.
46#ODE
After programming, the OARP05S Cable Replacement
Remote will be able to control the following types of devices:
)FYOUOWNACOMBOUNITSUCHASA466#2#OMBOORA46$6$
Combo, you need to follow special steps to set it up. Perform
the following instructions to control combo device:
TV
Television
DVR/AUX
$62062ORAUXILIARY46$6$PLAYER6#2
ORDIGITAL46CONVERTER
CBL/SAT
#ABLEBOXSATELLITERECEIVERORDIGITAL46
converter
DVD/VCR
$6$PLAYER6#2466#2COMBOOR46$6$
combo
AUD
Audio amplifier, tuner, or receiver
Setting Up a Combo Unit
&ORA466#2#OMBOTURNONYOUR466#2#OMBOAND
INSERTAVIDEOCASSETTE&ORA46$6$#OMBOINSERTA
$6$
/NTHEREMOTECONTROLPRESS$6$6#2ONCEITWILLBLINK
ONCE4HENPRESSANDHOLD3%450UNTILTHE$6$6#2KEY
blinks twice.
3.
Use the codes in the accompanying code list to locate the
brand name and enter the first four-digit code for your
COMBODEVICEFOREXAMPLE466#2)FYOUPERFORMTHIS
PROCEDURECORRECTLYTHE$6$6#2KEYWILLBLINKTWICE
NOTE: If the DVD/VCR key did not blink twice after
entering the codes last digit, repeat steps 2 and 3 and
try entering the same code again. If you’ve located
a setup code that works for your combo device (for
example, a TV/VCR Combo) and a separate TV code
is also listed, you’ll need to program this code into
the remote control to access volume control (see the
“Programming Device Control” section).
!IMTHEREMOTECONTROLATYOURCOMBODEVICEFOR
EXAMPLE466#2#OMBOANDPRESS0/7%2ONCE
The device should turn off. If it does not respond,
repeat steps 2 and 3, trying each code listed for your
brand until you find one that works. If it still does not
RESPONDTRYSEARCHINGFORTHECODESEETHEh3EARCHING
FOR9OUR#ODEvSECTION
5. For future reference, write down each working device
code in the boxes below:
466#2OR46$6$#ODE
46#ODEIFUSED
4.
Repeat step 3 three more times for the remaining
digits. Use 2 for the second digit, 3 for the third digit,
and 4 for the fourth digit. Finish writing down the code
INTHE46#ODEBOXES
5.
To check for other device codes, repeat steps 1 through
BUTSUBSTITUTETHEAPPROPRIATEKEYEG$6$6#2
$62!58!5$OR#",3!4FORTHEDEVICEYOUARE
CHECKING7RITEDOWNTHECODESINTHEAPPROPRIATE
BOXESINTHEh0ROGRAMMING$EVICE#ONTROLvSECTION
Using Learning
The OARP05S Cable Replacement Remote includes a
,EARNINGFEATURESOYOUCANADDFUNCTIONSTHATAREUNIQUE
TOYOURHOMEENTERTAINMENTDEVICESEG6#2TRACKINGUP
ORDOWN
Learning Precautions
s
s
Searching For Your Code
If your home entertainment device does not respond to the
OARP05S Cable Replacement Remote after trying all of the
codes listed for your brand, or if your brand is not listed at
all, try searching for your code.
s
s
s
&OREXAMPLETOSEARCHFORACODEFORYOUR46
4URNONYOUR46
/NTHEREMOTECONTROLPRESS46ONCEITWILLBLINKONCE
4HENPRESSANDHOLD3%450UNTILTHE46KEYBLINKSTWICE
%NTER4HE46KEYWILLBLINKTWICE
!IMTHEREMOTECONTROLATTHE46ANDPRESS0/7%2ONCE
5.
Press and release the CH+ key continuously, then stop
WHENTHE46TURNSOFF
NOTE: In the search mode, the remote control will send
IR codes from its library to the selected device, starting
with the most popular code first.
0RESS0/7%24HE46SHOULDTURNONTHENPRESS3%450
ONCETOLOCKINTHECODE4HE,%$WILLBLINKTWICETO
indicate that the code is saved.
NOTE: If the TV does not turn on during step 6, then
slowly press and release CH- to go back through the
codes, then press SETUP when the TV turns on.
4ESTOTHERREMOTECOMMANDSFORTHE46EGVOLUME
MENUETC)FTHECOMMANDSYOUWANTTOUSEWITHYOUR
46WORKYOUVElNISHEDPROGRAMMINGFORYOUR46)F
they don’t, repeat steps 1-4 above. In step 5, don’t stop
WHENYOUR46TURNSOFFTHElRSTTIMEˆKEEPPRESSING
CH+ until it turns off again.
NOTE: By default, the CH+/- keys change channels on
the CBL/SAT device regardless of what mode you’re in.
So, you should only use these keys to test for CBL/SAT
device codes at this point.
8.
To search for the codes of your other devices, repeat
steps 1 through 6, but substitute the appropriate key
EG$6$6#2$62!58!5$OR#",3!4FORTHE
device you’re searching for.
Checking the Codes
If you have set up your remote control by searching for
your device code, you may need to find out which fourdigit code is operating your equipment.
&OREXAMPLETOlNDOUTWHICHCODEISOPERATINGYOUR46
/NTHEREMOTECONTROLPRESS46ONCEITWILLBLINKONCE
4HENPRESSANDHOLD3%450UNTILTHE46KEYBLINKSTWICE
%NTER4HE46KEYWILLBLINKTWICE
3.
To view the code for the first digit, press 1 once. Count
THENUMBEROFTIMESTHE46KEYBLINKSEGBLINKS
ANDWRITEDOWNTHENUMBERINTHELEFTMOST46#ODE
BOXINTHEh0ROGRAMMING$EVICE#ONTROLvSECTION
NOTE: If a code digit is 0, the selected mode key will not
blink.
s
9OURORIGINALREMOTECONTROLSMUSTBEINWORKINGORDER
for learning to work properly.
,EARNEDKEYSAREMODESPECIlCSOEACHONECANSTOREA
unique function for each mode.
$ONOTUSETHEFOLLOWINGKEYSFORLEARNINGDEVICEKEYS
3%450 2ECORD-ACROKEYS
,EARNINGCAPACITYISUPTOATOTALOFKEYSDEPENDING
on the code being learned.
#ERTAINDEVICEFUNCTIONSARENOTLEARNABLEINCLUDING
multi-frequency types, some high frequency ones, and
other unusual formats.
&OROPTIMUMLEARNINGAVOIDHIGHLEVELSOFAMBIENT
light such as natural sunlight or energy-efficient
fluorescent lights.
NOTE: Please have your original remote controls handy
before programming learning.
Programming a Learned Key
NOTE: If more than 15 seconds pass between key
presses, the remote exits programming.
0RESSANDHOLD3%450UNTILTHELASTSELECTEDMODEKEY
BLINKSTWICETHENPRESS
NOTE: If the LED displays one long flash instead,
either your batteries are low, or the OARP05S Cable
Replacement Remote has a memory fault.
0RESSAMODEKEYONCEIE$6$6#2$62!58!5$
46OR#",3!4TOASSIGNAMODEFORLEARNING
3.
Press the desired key on the OARP05S once to store the
feature to be learned.
0LACETHE/!2032EMOTE#ONTROLHEADTOHEADABOUT
vAPARTFROMYOURORIGINALREMOTECONTROL!LSOLOCATE
THEKEYONYOURORIGINALREMOTECONTROLTHATYOUWANT
the OARP05S Cable Replacement Remote to learn.
2"
5.
On the original remote, press and hold the key to be
LEARNED4HEDEVICEKEYS,%$WILLBLINKRAPIDLYTHEN
turn off. Continue holding the key on the original
REMOTEUNTILTHEDEVICEKEY,%$BLINKSTWICE
NOTE: If the LED displays one long blink, a learning
error has occurred. Try repeating this step again until
a successful capture occurs. If the function is still not
captured, press and hold SETUP to exit programming
and review the “Learning Precautions” earlier in this
section. If needed, also see “Troubleshooting” later in
this manual. After review, start programming again at
step 1.
2EPEATSTEPSTHROUGHFORANOTHERMODEANDORKEY
ORPRESSANDHOLD3%450UNTILTHEACTIVEMODEKEY,%$
blinks twice to exit programming.
Deleting a Single Learning Key
This process returns the key to its original programming
FORTHEMODEYOUSELECT9OUCANALSODELETELEARNED
programming by teaching a different function to the key
SEETHEh0ROGRAMMINGA,EARNED+EYvSECTION
NOTE: If more than 15 seconds pass between key
presses, the remote exits programming.
0RESSANDHOLD3%450UNTILTHELASTSELECTEDMODEKEY
BLINKSTWICETHENPRESS
0RESSAMODEKEYONCEIE$6$6#2$62!58!5$
46OR#",3!44HE,%$ONTHESELECTEDMODEKEYWILL
blink once.
3. Press the key containing the learned function to be
deleted twice. The active mode key will blink twice.
4. Repeat steps 2 through 3 for another key or press and
HOLD3%450TOEXITPROGRAMMING
Deleting All Learned Keys in a Specific Mode
Unlocking Volume Control for a Single
Device (Individual Volume Unlock)
!SSUMING'LOBAL6OLUME,OCKISACTIVESELECTAMODE
ONTHEREMOTECONTROLTHATYOUWANTTOUNLOCKEG
#",3!4ANDPRESSITONCE.EXTPRESSANDHOLD3%450
until the device key blinks twice.
%NTER4HELASTSELECTEDDEVICEKEYWILLBLINKTWICE
0RESS6/,ONCE4HELASTSELECTEDDEVICEKEYWILLBLINK
four times.
4. Repeat steps 1 through 3 for each device you want
volume to be unlocked.
Now, after you select a device that has volume unlocked
EG#",3!4PRESSING6/,6/,OR-54%WILLCONTROL
only that device’s volume.
Unlocking All Volume Control (Global
Volume Unlock)
NOTE: If more than 15 seconds pass between key
presses, the remote exits programming.
0RESSANDHOLD3%450UNTILTHELASTSELECTEDMODEKEY
BLINKSTWICETHENPRESS
0RESSAMODEKEYTWICEIE$6$6#2$62!58!5$
46OR#",3!4TOCLEARALLTHELEARNEDKEYSFORTHAT
MODE4HEMODEKEY,%$BLINKSTWICE
3. Repeat step 2 for another mode or press and hold
3%450TOEXITPROGRAMMING
NOTE: Performing these instructions will set independent
volume control for all programmed devices.
Programming Channel Control Lock
NOTE: The audio mode’s volume controls are active
regardless of Volume Lock settings. However, if you lock
the volume controls to the AUD mode, you will control the
audio device’s volume in all other modes (i.e., DVD/VCR,
DVR/AUX, TV, or CBL/SAT). This can be an advantage if, for
example, you always listen to home entertainment devices
through your receiver’s speakers.
"YDEFAULTIN46MODETHEREMOTECONTROLSCHANNELCONTROL
capabilities are locked to the cable box or satellite receiver.
4HEAFFECTEDKEYSARETHROUGH#(#(AND,!34
This will guarantee that you do not inadvertently change
ACHANNELONYOUR46(OWEVERYOUCANDEACTIVATETHIS
FEATURETOALLOWFULLACCESSTOTHESEKEYSIN46MODE
Unlocking Channel Control
/NTHEREMOTECONTROLPRESS#",3!4ONCEITWILLBLINK
ONCE0RESSANDHOLD3%450UNTILTHE#",3!4KEYBLINKS
twice.
%NTER4HE#",3!4KEYWILLBLINKTWICE
0RESS#(ONCE4HE#",3!4KEYWILLBLINKFOURTIMES
.OWTHEREMOTECONTROLWILLPROVIDE46AND6#2CHANNEL
CONTROLCAPABILITIESWHILEINTHE46OR6#2MODE
Locking Channel Control to CBL/SAT
/NTHEREMOTECONTROLPRESS#",3!4ONCEITWILLBLINK
ONCE0RESSANDHOLD3%450UNTILTHE#",3!4KEYBLINKS
twice.
%NTER4HE#",3!4KEYWILLBLINKTWICE
0RESS#(ONCE4HE#",3!4KEYWILLBLINKTWICE
.OWREGARDLESSOFWHATMODEYOUSELECTEXCEPT!5$THE
channel keys will only change channels on your set-top box.
Changing Volume Lock
6OLUME,OCKALLOWSYOUTOCONTROLTHEVOLUMETHROUGH
THEDEVICEIDENTIlEDASHAVINGYOURPRIMARYSPEAKERS
regardless of which mode you are using. On the OARP05S
2EMOTE#ONTROL'LOBAL6OLUME,OCKISSETTO46SOYOU
CANCONTROL46VOLUMEWHILEINTHE$6$6#2$62!58
46OR#",3!4MODE9OUCANPERFORM)NDIVIDUAL6OLUME
Unlock on a selected device to set its volume control for
independent operation.
NOTE: The audio mode’s (AUD) volume controls are active
regardless of Volume Lock settings. However, if you lock the
volume controls to the AUD mode, you will have control of
the audio device’s volume in all other modes (i.e., DVD/VCR,
DVR/AUX, TV, and CBL/SAT). This can be an advantage if, for
example, you always listen to home entertainment devices
through your receiver’s speakers.
/NTHEREMOTECONTROLPRESSANDHOLD3%450UNTILTHE
last-selected device key blinks twice.
%NTER4HELASTSELECTEDDEVICEKEYWILLBLINKTWICE
0RESS6/,ONCE4HELASTSELECTEDDEVICEKEYWILLBLINK
four times.
Locking Volume Control To One Mode
(Global Volume Lock)
/NTHEREMOTECONTROLPRESSANDHOLD3%450UNTILTHE
last-selected device key blinks twice.
%NTER4HELASTSELECTEDDEVICEKEYWILLBLINKTWICE
3ELECTAMODEEG46OR!5$WHICHYOUWANTTOUSE
to control the volume. The selected device key will blink
twice.
.OWWHENYOUPRESS6/,6/,OR-54%THEVOLUME
OFTHESELECTEDDEVICEEG46ISCONTROLLEDREGARDLESSOF
mode.
Programming Macro Keys
The OARP05S Cable Replacement Remote includes two
MACROKEYSLOCATEDDIRECTLYBELOWTHE37!0AND-/6%
KEYS-ACROKEYSALLOWYOUTOSETUPKEYMACROSTOACTIVATE
certain keys in a specific order. For example, you can set up
AKEYMACROTOCHANGETHECHANNELSONYOUR46RAISEOR
LOWERTHEVOLUMEANDSTARTRECORDINGONYOUR6#2ALLWITH
the touch of one key. If you want to change the macros
stored in a previously-programmed macro key, you’ll need
TOCLEARTHEKEYlRSTSEEh#LEARINGA-ACRO+EYvLATERIN
THISSECTION
Programming a Macro Key
/NTHEREMOTECONTROLPRESSANDHOLDTHE3%450KEY
until it blinks twice.
%NTER4HE3%450KEYBLINKSTWICE
3ELECTAMACROKEYFOREXAMPLE-!#2/ANDPRESSIT
once.
4.
Press the key sequence you want to program into
THEMACRO&OREXAMPLETOTURNONYOUR46ANDRAISE
ITSVOLUMEPRESSTHE46MODEKEYONCEFOLLOWEDBY
PRESSINGTHE6/,KEYONCE
NOTE: You can program up to 15 key presses into one
macro.
0RESSANDHOLD3%450UNTILITBLINKSTWICE
6.
To add another macro, repeat steps 1 through 5,
substituting the new key sequence to be added in step 4.
NOTE: Programming more than five macros on the
same macro key overwrites previous settings.
Clearing a Macro Key
/NTHEREMOTECONTROLPRESSANDHOLDTHE3%450KEY
until it blinks twice.
%NTER4HE3%450KEYBLINKSTWICE
3.
Press once on the macro key you want to clear.
0RESSANDHOLD3%450UNTILTHEACTIVEMODEKEYBLINKS
twice.
This macro key is now clear and ready for reprogramming
SEEh0ROGRAMMINGA-ACRO+EYvEARLIERINTHISSECTION)F
desired, repeat these to clear another Macro key.
NOTE: Performing the steps below will overwrite the
device you’ve programmed for the device key.
/NTHEREMOTECONTROLPRESS$6$6#2ONCEITWILL
BLINKONCE4HENPRESSANDHOLD3%450UNTILTHE$6$
6#2KEYBLINKSTWICE
%NTER4HE$6$6#2KEYWILLBLINKTWICE
0RESS!5$ONCETHENPRESS$6$6#2ONCE4HE$6$
6#2KEYWILLBLINKTWICE
4HE$6$6#2KEYISNOWREADYTOBEPROGRAMMEDFOR
YOURSECONDAUDIODEVICE3EETHEh0ROGRAMMING$EVICE
#ONTROLvSECTION4OREASSIGNOTHERDEVICEKEYSREPEAT
these and substitute the key sequence using the following
chart:
NOTE: Only one device can be assigned to an unused
device key at a time.
DVD/VCR as 2nd AUD key
$6$6#2ˆ3%450ˆˆˆˆ!5$ˆ$6$6#2
Using The Master Power Key
The OARP05S Remote Control has a unique feature that
allows you to sequentially turn on or off up to five of your
home entertainment devices with a single key press.
NOTE: MASTER POWER (POWER) only works in the CBL/
SAT mode. If it is not programmed, only the cable box or
satellite receiver will turn on or off. In any other mode,
pressing MASTER POWER (POWER) once will turn the
selected device on or off.
Programming the Master Power Key
/NTHEREMOTECONTROLPRESSANDHOLD3%450UNTILTHE
last-selected device key blinks twice.
%NTER4HELASTSELECTEDDEVICEKEYBLINKSTWICE
0RESS0/7%2ONCE
4.
k
5.
6.
For the first device you want in the power on sequence,
PRESSADEVICEKEYEG#",3!4ONCE4HENPRESS
0/7%2ONCE&ORTHESECONDDEVICEINTHEPOWER
SEQUENCEPRESSITSKEYONCEEG464HENPRESS
0/7%2
Repeat step 4 up to four more times to add the second,
third, fourth, and fifth device.
To save the settings and exit the program:
A0RESS#",3!4ONCE
B0RESSANDHOLD3%450UNTILTHE#",3!4KEYBLINKS
twice.
E
DVD/VCR as 2nd TV key
$6$6#2ˆ3%450ˆˆˆˆ46ˆ$6$6#2
DVD/VCR as 2nd CBL/SAT key
$6$6#2ˆ3%450ˆnnn#",3!4ˆ$6$6#2
DVD/VCR back to DVD/VCR
$6$6#2ˆ3%450nnnn$6$6#2ˆ$6$6#2
To re-assign another unused device key, substitute it for the
$6$6#2KEYABOVEANDTHENPERFORMTHESEQUENCE&OR
EXAMPLETOREASSIGNANUNUSED!5$KEYASASECOND$6$
key, perform:
!5$ˆ3%450ˆˆˆˆ$6$ˆ!5$
7HENAREASSIGNMENTISDONETHESELECTEDDEVICEKEY
EG!5$WILLBLINKTWICETOCONlRMYOURCHOICE!TTHAT
TIMEYOUWILLNEEDTOPROGRAMDEVICECONTROLSEETHE
h0ROGRAMMING$EVICE#ONTROLvSECTION
Clearing Custom Programming
The OARP05S Remote Control contains a Custom
0ROGRAMMING2ESETPROGRAM9OUCANUSEITTOREMOVE
all custom programming, except your setup codes and
reassigned device keys.
IMPORTANT: Executing this program will erase all custom
settings for Volume Lock, learned keys, Macro keys, and
Channel Lock. However, your device programming remains.
Using the Master Power Key
/NTHEREMOTECONTROLPRESSANDHOLD3%450UNTILTHE
last-selected device key blinks twice.
1.
%NTER4HELASTSELECTEDDEVICEKEYBLINKSTWICE
pauses, and blinks twice again to confirm that all
custom programming is cleared.
After programming, point the remote control at the
DEVICES0RESS#",3!4ONCE
0RESS0/7%2ONCETOSEQUENTIALLYTURNTHEPROGRAMMED
home entertainment devices on or off.
9OUWILLSEETHEDEVICESTURNONOROFFACCORDINGTOTHE
programmed sequence.
Clearing the Master Power Key
/NTHEREMOTECONTROLPRESSANDHOLD3%450UNTILTHE
last-selected device key blinks twice.
%NTER4HELASTSELECTEDDEVICEKEYBLINKSTWICE
0RESSANDRELEASE0/7%2
0RESSANDHOLD3%450UNTILTHE#",3!4KEYBLINKSTWICE
Re-Assigning Device Keys
The OARP05S Cable Replacement Remote can be set up to
control a second device of an already-assigned type.
&OREXAMPLETOHAVETHEUNITCONTROLA46ASETTOPBOX
ANDTWOAUDIODEVICESFOREXAMPLETWOAUDIORECEIVERS
REASSIGNTHEUNUSED$6$6#2KEYTOOPERATETHESECOND
audio device as follows:
Troubleshooting
FCC Notice
Device key does not blink when you press a key.
2EPLACETHEBATTERIESWITHTWONEW!!BATTERIESSEE
THEh)NSTALLING"ATTERIESvSECTION
This equipment has been tested and found to comply with the limits for a
class B digital device, pursuant to part 15 of the FCC Rules. These limits are
designed to provide reasonable protection against harmful interference in
a residential installation. This equipment generates, uses and can radiate
radio frequency energy and if not installed and used in accordance with the
instructions, may cause harmful interference to radio communications.
However, there is no guarantee that interference will not occur in a particular
installation. If this equipment does cause harmful interference to radio or
television reception, which can be determined by turning the equipment off
and on, the user is encouraged to try to correct the interference by one or
more of the following measures:
s2EORIENTORRELOCATETHERECEIVINGANTENNA
s)NCREASETHESEPARATIONBETWEENTHEEQUIPMENTANDRECEIVER
s#ONNECTTHEEQUIPMENTINTOANOUTLETONACIRCUITDIFFERENTFROMTHATTO
which the receiver is connected.
s#ONSULTTHEDEALERORANEXPERIENCEDRADIO46TECHNICIANFORHELP
This equipment has been verified to comply with the limits for a class B
computing device, pursuant to FCC Rules. In order to maintain compliance
with FCC regulations, shielded cables must be used with this equipment.
Operation with non-approved equipment or unshielded cables is likely to
RESULTININTERFERENCETORADIOAND46RECEPTION4HEUSERISCAUTIONEDTHAT
changes and modifications made to the equipment without the approval of
manufacturer could void the user’s authority to operate this equipment.
Device key blinks when you press a key, but home
entertainment device does not respond.
Make sure you are aiming the remote control at your home
entertainment device and that you are within 15 feet of the
device you are trying to control.
The remote control does not control devices or
commands are not performing properly.
Try all listed codes for the device brand being set up. Make
sure all devices can be operated with an infrared remote
control.
TV/VCR Combo does not respond properly.
5SETHE6#2CODESFORYOURBRAND3OMECOMBOUNITSMAY
REQUIREBOTHA46CODEANDA6#2CODEFORFULLOPERATION
SEETHEh3ETTING5PA#OMBO5NITvSECTION
No volume on a second TV.
&OLLOWINSTRUCTIONSINTHEh#HANGING6OLUME,OCKvSECTION
Play) and Stop) keys do not work on a Motorola
DCT-2000 cable converter.
2EPROGRAMTHE#",3!4KEYFORCABLECODESEETHE
h0ROGRAMMING$EVICE#ONTROLvSECTION
Tried Search Method and still could not find a
working code.
Try the Search Method again after clearing out the device
key as follows:
A 0RESSANDHOLD3%450UNTILDEVICEKEYBLINKSTWICE
B %NTER
c. Press and release the device key to be cleared twice.
Remote control does not turn on Sony or Sharp TV/
VCR Combo.
&ORPOWERONTHESEPRODUCTSREQUIREPROGRAMMING46
CODESONTHEREMOTECONTROL&OR3ONYUSE46CODE
AND6#2CODE&OR3HARPUSE46CODEAND6#2
code 0048.
Additional Information
This product does not have any user-serviceable parts.
Opening the case, except for the battery cover, may cause
permanent damage to your OARP05S Cable Replacement
Remote.
s
&ORHELPVIATHE)NTERNETVISITUSAT
www.oneforall.com
s
&ORHELPVIAOURCONSUMERHELPLINECALL
/.%&/2!,,šISTHEREGISTEREDTRADEMARKOF5NIVERSAL
%LECTRONICS)NC!UDIOVOX!CCESSORIES#ORPORATIONISTHE
,ICENSEEOFTHE/.%&/2!,,šBRANDFOR.ORTH!MERICA
¥5NIVERSAL%LECTRONICS)NC.OPARTOFTHISPUBLICATION
may be reproduced, transmitted, transcribed, stored in any
retrieval system, or translated to any language, in any form
or by any means, electronic, mechanical, magnetic, optical,
manual, or otherwise, without prior written permission of
5NIVERSAL%LECTRONICS)NC
This product is covered by one or more of the following U.S.
patents:
Care and Maintenance
s+EEPTHEREMOTEDRY)FITGETSWETWIPEITDRYIMMEDIATELY
s5SEANDSTORETHEREMOTEONLYINNORMALTEMPERATUREENVIRONMENTS
s(ANDLETHEREMOTEGENTLYANDCAREFULLY$ONTDROPIT
s+EEPTHEREMOTEAWAYFROMDUSTANDDIRT
s7IPETHEREMOTEWITHADAMPCLOTHOCCASIONALLYTOKEEPITLOOKINGNEW
s-ODIFYINGORTAMPERINGWITHTHEREMOTESINTERNALCOMPONENTSCAN
cause malfunction and invalidate its warranty.
Limited Lifetime Warranty
!UDIOVOX%LECTRONICS#ORPORATIONTHEh#OMPANYvWARRANTSTOYOUTHE
original retail purchaser of this product that should it, under normal use and
conditions, be proven defective in material or workmanship during its lifetime
WHILEYOUOWNITSUCHDEFECTSWILLBEREPAIREDORREPLACEDATTHE#OMPANYS
OPTIONWITHOUTCHARGEFORPARTSANDREPAIRLABOR4OOBTAINREPAIROR
REPLACEMENTWITHINTHETERMSOFTHIS7ARRANTYTHEPRODUCTISTOBEDELIVERED
WITHPROOFOFWARRANTYCOVERAGEEGDATEDBILLOFSALESPECIlCATIONOF
DEFECTSTRANSPORTATIONPREPAIDTOTHE#OMPANYATTHEADDRESSSHOWN
BELOW$ONOTRETURNTHISPRODUCTTOTHERETAILER
4HIS7ARRANTYDOESNOTCOVERPRODUCTPURCHASEDSERVICEDORUSEDOUTSIDE
THE5NITED3TATESOR#ANADA4HIS7ARRANTYISNOTTRANSFERABLEANDDOES
not extend to costs incurred for installation, removal or reinstallation of
THEPRODUCT4HIS7ARRANTYDOESNOTAPPLYIFINTHE#OMPANYSOPINION
the product has been damaged through alteration, improper installation,
mishandling, misuse, neglect, accident, or the simultaneous use of different
BATTERYTYPESEGALKALINESTANDARDORRECHARGEABLE
4(%%84%.4/&4(%#/-0!.93,)!"),)495.$%24()37!22!.49)3
,)-)4%$4/4(%2%0!)2/22%0,!#%-%.402/6)$%$!"/6%!.$)../
%6%.43(!,,4(%#/-0!.93,)!"),)49%8#%%$4(%052#(!3%02)#%0!)$
"9052#(!3%2&/24(%02/$5#4
4HIS7ARRANTYISINLIEUOFALLOTHEREXPRESSWARRANTIESORLIABILITIES
!.9)-0,)%$7!22!.4)%3).#,5$).'!.9)-0,)%$7!22!.49/&
-%2#(!.4!"),)49/2&)4.%33&/2!0!24)#5,!20520/3%3(!,,"%
,)-)4%$4/$52!4)/./&4()37!22!.49)../#!3%3(!,,4(%
#/-0!.9"%,)!",%&/2!.9#/.3%15%.4)!,/2).#)$%.4!,$!-!'%3
7(!43/%6%2.OPERSONORREPRESENTATIVEISAUTHORIZEDTOASSUMEFORTHE
Company any liability other than expressed herein in connection with the sale
of this product.
3OMESTATESPROVINCESDONOTALLOWLIMITATIONSONHOWLONGANIMPLIED
warranty lasts or the exclusion or limitation of incidental or consequential
damage so the above limitations or exclusions may not apply to you. This
7ARRANTYGIVESYOUSPECIlCLEGALRIGHTSANDYOUMAYALSOHAVEOTHERRIGHTS
WHICHVARYFROMSTATEPROVINCETOSTATEPROVINCE
U.S.A.:!UDIOVOX%LECTRONICS#ORPORATION-ARCUS"LVD(AUPPAUGE.EW
9ORK
CANADA:!UDIOVOX2ETURN#ENTERCO'ENCO+ENNEDY2OAD
5NIT$OOR-ISSISSAUGA/NTARIO,4!
4RADEMARKSš2EGISTERED
OARP05S US IB 02
Control Remoto Sustituto
para TV por Cable
Control Remoto Universal OARP05S
Manual del Propietario
Owner’s Manual (see reverse)
Introducción
Características y Funciones
%L#ONTROL2EMOTO3USTITUTOPARA46POR#ABLEMODELO
OARP05S de One For All es nuestro control remoto universal
DEÞLTIMAGENERACIØN3USOlSTICADATECNOLOGÓANOSPERMITE
INTEGRARENUNÞNICOPRODUCTOFÉCILDEUSARHASTACINCODELOS
CONTROLESREMOTOSORIGINALESQUEUSAPARAMANEJARLOSEQUIPOS
DEENTRETENIMIENTOENELHOGAR!UNMÉSESTÉDOTADODE
CARACTERÓSTICASAVANZADASPOREJEMPLO
6ÉLGASEDELASIGUIENTEILUSTRACIØNPARALOCALIZARLASFUNCIONES
DEL#ONTROL2EMOTO3USTITUTOPARA46POR#ABLEMODELO
OARP05S y estudie la descripción de las teclas para aprender a
usarlas.
s
4ECLASDEDICADASPARAMANEJARLASFUNCIONESMÉSUSADASDE
SU$62062GRABADORADEVIDEODIGITALPERSONAL
s
4ECLA-!34%20/7%2PROGRAMABLEPARAENCENDEROAPAGAR
DEUNASOLAVEZLOSEQUIPOSDEENTRETENIMIENTOENELHOGAR
s
4ECLA-ACROPROGRAMABLEQUELEPERMITEINTEGRARPASOSDE
un procedimiento compuesto en una sola tecla
s
"LOQUEODE#ANALESPARAPERMITIRLASELECCIØNDECANALES
SØLOATRAVÏSDELAPARATODECABLEODELRECEPTORDESATÏLITE
s
"LOQUEODE6OLUMENPARAPERMITIRREGULARELVOLUMENSØLO
en uno o en determinados modos
s
"ÞSQUEDADE#ØDIGOSPARAFACILITARLAPROGRAMACIØNDEL
MANEJODECOMPONENTESANTIGUOSODESCONTINUADOS
s
4ECLASCODIlCADASPORCOLORESPARALOCALIZARRÉPIDAMENTELAS
FUNCIONESMÉSUSADASEN46PORCABLEOSATÏLITE
s
"IBLIOTECADECØDIGOSDELOSEQUIPOSDEVIDEOYAUDIOMÉS
usados
!NTESDEUTILIZARELPRODUCTODEBEINSTALARLASBATERÓASY
programarlo para los equipos de entretenimiento en el hogar
ESPECÓlCOSQUELEINTERESEMANEJAR
Instalación de las Baterías
%NLAPARTEPOSTERIORDELCONTROLREMOTOOPRIMALALENGàETA
y retire la tapa del compartimiento de las baterías.
$ESPUÏSDEPROGRAMARELCONTROLREMOTOCONSULTELASECCIØN
h#UADRODE$ISPOSITIVOSvPARACONOCERLOSTIPOSDEDISPOSITIVO
QUEPUEDENMANEJARSEMEDIANTELASDIFERENTESTECLASDE
dispositivo.
TV, DVR/AUX, CBL/SAT,
DVD/VCR, y AUD permiten
seleccionar el equipo de
entretenimiento en el
HOGARQUEINTERESAMANEJAR
#ONSULTETAMBIÏNLASECCIØN
h#UADRODE$ISPOSITIVOSv
Cada tecla de dispositivo
TIENEUN,%$LUZROJAQUE
parpadea cuando se selecciona
e indica que el control remoto
ESTÉFUNCIONANDOYUNAVEZ
PROGRAMADOEMITESE×ALES
NOTA: Si tiene un convertidor
de TV digital, puede
programarlo para asignarlo a
las teclas CBL/SAT o DVR/AUX.
POWER/MASTER POWER
permite encender o apagar
un equipo de entretenimiento
en el hogar. Para la función
DECONTROLDELATECLA-!34%2
0/7%2CONSULTELASECCIØN
“Uso de la Tecla Master
0OWERv
SETUP se usa en todas las
secuencias de programación.
)NTRODUZCADOSBATERÓAS!!NOINCLUIDAS(AGA
CORRESPONDERLASMARCASYnCONLASDELCOMPARTIMIENTOE
INTRODUZCALASBATERÓAS
3.
Alinee las chavetas de la tapa con los orificios del
compartimiento y oprima la tapa para volver a instalarla. Si
LATAPAHAQUEDADOlJADEBEESCUCHARSEELCHASQUIDODELA
LENGàETA
4.
Pruebe el control remoto oprimiendo cualquier tecla de
MODOPEJ463ISEINSTALANCORRECTAMENTELASBATERÓAS
EL,%$LUZROJADEBERÉPARPADEARUNAVEZ
AVISO: Cuando sea necesario sustituir las baterías, el
control remoto dejará de funcionar. Sustituya las baterías
para restituir plenamente el funcionamiento del dispositivo;
finalice configurando sus preferencias.
Precauciones sobre las Baterías:
s.OCOMBINEBATERÓASNUEVASYVIEJAS
s.OCOMBINEDIFERENTESTIPOSDEBATERÓASALCALINASESTÉNDAR
CARBØNZINCORECARGABLESNÓQUELCADMIO
s3IEMPREREMUEVADEINMEDIATOBATERÓASVIEJASDÏBILESO
DESGASTADASYRECÓCLELASODESÏCHELASSEGÞNLODISPONENLAS
normas locales y nacionales.
LIVEPERMITEVOLVERALASE×AL
DETELEVISIØNENVIVOATRAVÏS
DESU062$62
LIST permite ver la lista de
los programas grabados en su
062$62
(repetir) hace que el
RECEPTORDESU062$62REPITA
INMEDIATAMENTELOSÞLTIMOS
segundos del programa que se
ESTÉVIENDO
(saltar
al siguiente, retroceder,
reproducir, avanzar, parar,
hacer pausa, grabar)%N
TODOSLOSMODOSEXCEPTO#",
SAT, use estas teclas para
MANEJARUNA6#2LECTORDE
$6$O062UNAVEZQUEHAYA
seleccionado el dispositivo que
LEINTERESA0ARAGRABARENEL
MODO$6$6#2OPRIMA dos
VECES%NELMODO#",3!4
USEESTASTECLASPARAMANEJARLASFUNCIONESDESU$62062DEL
APARATODECABLEODELRECEPTORDESATÏLITE
MENU PERMITEVERELSISTEMADEMENÞSDELDISPOSITIVOACTIVO
INFO permite ver información sobre el canal y el programa que
SEESTÉNVIENDO
Las teclas de navegación permiten mover el cursor por la
GUÓADEPROGRAMACIØNYPANTALLASDEMENÞSASÓCOMONAVEGAR
dentro del servicio interactivo.
OKPERMITEELEGIROPCIONESYEVENTOSDE006YSINTONIZARLOS
programas de la guía de programación.
Programación del Manejo de Dispositivos
GUIDE permite ver la guía de programación.
!NTESDEEMPEZARAUSARESTECONTROLREMOTODEBEPROGRAMARLO
PARAMANEJARSUSCOMPONENTES
EXITPERMITESALIROBORRARELMENÞOLAGUÓADELDISPOSITIVO
DAY +/-PERMITEAVANZAROREGRESARUNDÓAENLAGUÓADE
programación del dispositivo.
PAGE +/-PERMITESUBIROBAJARPANTALLAPORPANTALLAENELMENÞ
o la guía de programación.
A,B,C,D (rojo, verde, amarillo, azul) dan acceso a
características adicionales del aparato de cable, receptor de
SATÏLITEO,ECTORDEDISCOS"LURAYCONSULTELOSDETALLESENEL
MANUALDELDISPOSITIVO
VOL +/-PERMITESUBIROBAJARELVOLUMEN
ON DEMANDDAACCESOALOSSERVICIOS6IDEOON$EMAND
VIDEOAPETICIØNDELPROVEEDORDEPROGRAMACIØN,ATECLA
/.$%-!.$PUEDENOFUNCIONARCONALGUNOSPROVEEDORES
de programación. Pruebe la tecla y si no le conduce al servicio
de video a petición de su proveedor de programación, no
PODRÉPROGRAMARLAPARATENERACCESOALSERVICIO#ONSULTEMÉS
INFORMACIØNENLASECCIØNh0ROGRAMACIØNDELAS4ECLAS-ACROv
de este manual.
CH+-PERMITESELECCIONARELCANALINMEDIATOSUPERIORO
INFERIOR3ISETRATADELECTORESDE$6$USEESTASTECLAS
para saltar al siguiente capítulo o al anterior. Si se trata de
amplificadores o receptores, use estas teclas para seleccionar la
siguiente emisora preestablecida o la anterior.
AVISO: Por omisión, las teclas CH+/- cambian los canales en
el dispositivo CBL/SAT independientemente del modo en que
se encuentre. Para cambiar la manera en que las teclas CH+/funcionan, consulte la sección “Programación del Bloqueo del
Control de Canales”.
MUTE permite silenciar o activar el volumen.
FAV permite alternar entre los canales preferidos en el aparato
DECABLEOELRECEPTORDESATÏLITE
LASTPERMITEVOLVERALÞLTIMOCANALQUESEESTABAVIENDO
Las teclas numéricas (1-9 y 0)PERMITENSINTONIZAR
DIRECTAMENTELOSCANALESPEJ3ISETRATADEAMPLIlCADORES
ORECEPTORESUSEELTECLADONUMÏRICOPARASELECCIONARENTRADAS
entre 1 y 10.
– 0ERMITEACCEDERASUBCANALESDIGITALESPEJU
ASPECT permite modificar la relación de aspecto del programa
QUESEESTÉVIENDONOESTÉDISPONIBLEENTODOSLOSDISPOSITIVOS
PIPACTIVAYDESACTIVALAFUNCIØNDE)MAGENEN)MAGEN0)0SI
ESTÉDISPONIBLEENELDISPOSITIVO
SWAPPERMITECAMBIARENTRELASE×ALAUDIOVISUALDELAPANTALLA
principal y la de la ventana PIP.
MOVE permite cambiar de posición la ventana PIP en la
pantalla del televisor.
NOTAS:
El Control Remoto Sustituto para TV por Cable modelo OARP05S
se ha preprogramado para manejar televisores RCA, lectores
de DVD Toshiba, VCR RCA, receptores de sonido Pioneer y
aparatos de cable Motorola. Si usted tiene dispositivos de estas
marcas, pruebe el control remoto con ellos. Si funcionan, no es
necesario programar el control remoto para manejarlos.
Para manejar un dispositivo combinado (p. ej., una combinación
de TV/VCR), ignore esta sección y siga las instrucciones de la
sección “Configuración de Unidades de Combinación”. Además,
consulte el “Cuadro de Dispositivos” para conocer los dispositivos
que pueden programarse en cada tecla de dispositivo.
%NCIENDAELDISPOSITIVOYSICORRESPONDEINTRODUZCAEL
MEDIODEVIDEOPEJCASETEODISCO
AVISO: Lea completamente los pasos 2 al 5 antes de
continuar. Resalte o apunte los códigos y dispositivos que le
interesa programar antes de avanzar al segundo paso.
/PRIMAUNAVEZUNATECLADEDISPOSITIVODELCONTROLREMOTO
PEJ$6$6#2$62!58!5$46O#",3!4LACUAL
DEBERÉPARPADEARUNAVEZ
/PRIMAYSOSTENGA3%450HASTAQUELATECLADELMODO
seleccionado parpadee dos veces, y suelte la tecla.
6ÉLGASEDELOSCØDIGOSDELALISTADECØDIGOSQUESEINCLUYE
y localice el tipo de dispositivo y la marca y, seguidamente,
ingrese el código de cuatro dígitos que corresponde a su
dispositivo. Si se ha hecho correctamente, la tecla del modo
SELECCIONADODEBERÉPARPADEARDOSVECES
AVISO: Si la tecla del modo seleccionado muestra un
parpadeo continuo, el código ingresado no es válido. Repita
los pasos 2 al 4 e intente ingresar de nuevo el mismo código.
!PUNTEELCONTROLREMOTOALDISPOSITIVOYOPRIMA0/7%2
UNAVEZ%LDISPOSITIVODEBEAPAGARSE3INOESASÓREPITALOS
pasos 2 al 4 con cada código correspondiente a la marca de
su dispositivo hasta encontrar uno que funcione. Si aun así
NOFUNCIONATRATEDEBUSCARELCØDIGOCONSULTELASECCIØN
h"ÞSQUEDADE#ØDIGOSv
AVISO: Si el dispositivo no tiene tecla de encendido (p. ej.,
lectores de DVD y VCR), oprima la tecla ).
5NAVEZHAYAENCONTRADOUNCØDIGOQUEENCIENDEYAPAGAEL
dispositivo, intente otros comandos del control remoto para
ESEDISPOSITIVOPOREJEMPLOVOLUMENCANALMENÞETC
AVISO: Por omisión, las teclas CH+/- cambian los canales en
el dispositivo CBL/SAT independientemente del modo en
que se encuentre. Por lo tanto, debe utilizar únicamente
estas teclas para probar los códigos del dispositivo CBL/SAT
en estos momentos.
7.
Repita los pasos 1 al 6 con cada dispositivo que le interese
MANEJARCONELCONTROLREMOTO0ARAELFUTUROAPUNTELOS
códigos operativos de cada dispositivo en estos recuadros.
#ØDIGODE$6$6#2
#ØDIGODE$62!58
MACRO1 y MACRO2SERESERVANPARAMACROSCONSULTELA
SECCIØNh0ROGRAMACIØNDELAS4ECLAS-ACROvDEESTEMANUAL
#ØDIGODE!5$ #ØDIGODE#",3!4
Cuadro de Dispositivos
#ØDIGODE46
AVISO: Consulte este cuadro cuando siga las instrucciones de
las secciones “Programación del Manejo de Dispositivos” o
“Configuración de Unidades de Combinación”.
Configuración de Unidades de Combinación
PIP CH +/- se usan para seleccionar el canal siguiente o el
anterior en la ventana PIP.
INPUTENELMODO#",3!4SEUSAPARAVEROTRASFUENTESDE
VIDEO!O"%NOTROSMODOSUSE).054PARACAMBIARENTRELAS
ENTRADASFUENTEDELDISPOSITIVOQUESEESTÉMANEJANDO
$ESPUÏSDEPROGRAMADOEL#ONTROL2EMOTO3USTITUTOPARA46
POR#ABLEMODELO/!203PERMITEMANEJARESTOSTIPOSDE
dispositivo:
3ITIENEUSTEDUNAUNIDADDECOMBINACIØNCOMOPOREJEMPLO
UNACOMBINACIØNDE466#2OUNACOMBINACIØNDE46LECTORDE
$6$DEBESEGUIRUNPROCEDIMIENTOESPECIALPARACONlGURAR
ELCONTROLREMOTO3IGAESTASINSTRUCCIONESPARAMANEJARSU
dispositivo combinado:
TV
Televisor
DVR/AUX
$62062OUNTELEVISORCONVERTIDORDIGITAL
LECTORDE$6$O6#2ADICIONAL
3ISETRATADEUNACOMBINACIØNDE466#2APÉGUELAE
INTRODUZCAUNVIDEOCASETESISETRATADEUNACOMBINACIØN
DE46LECTORDE$6$INTRODUZCAUN$6$
CBL/SAT
Aparato de cable, convertidor digital o
RECEPTORDESATÏLITE
/PRIMAUNAVEZLATECLA$6$6#2DELCONTROLREMOTOLACUAL
DEBERÉPARPADEARUNAVEZ3EGUIDAMENTEOPRIMAYSOSTENGA
3%450HASTAQUELATECLA$6$6#2PARPADEEDOSVECES
DVD/VCR
,ECTORDE$6$6#2COMBINACIØNDE
466#2OCOMBINACIØNDE46LECTORDE$6$
AUD
!MPLIlCADORDESONIDOSINTONIZADORORECEPTOR
3.
Use los códigos de la lista de códigos que se incluye para
LOCALIZARLAMARCAEINGRESEELCØDIGODECUATRODÓGITOS
CORRESPONDIENTEASUDISPOSITIVOCOMBINADOPEJUNA
COMBINACIØNDE466#23IREALIZAESTEPROCEDIMIENTO
CORRECTAMENTELATECLA$6$6#2DEBERÉPARPADEARDOSVECES
AVISO: Si la tecla DVD/VCR no parpadea dos veces
luego de ingresar el último dígito del código, repita los
pasos 2 y 3 e ingrese de nuevo el mismo código. Si ha
encontrado un código de configuración que funcione
para su dispositivo combinado (p. ej., una combinación
de TV/VCR), pero la lista incluye además un código de TV
aparte, debe programar también este código en el control
remoto para poder regular el volumen (consulte la sección
“Programación del Manejo de Dispositivos”).
!PUNTEELCONTROLREMOTOASUDISPOSITIVOCOMBINADOP
EJUNACOMBINACIØNDE466#2YOPRIMA0/7%2UNA
VEZ%LDISPOSITIVODEBEAPAGARSE3INOFUNCIONAREPITALOS
pasos 2 y 3 con cada código correspondiente a la marca de
su dispositivo hasta encontrar uno que funcione. Si aun así
NOFUNCIONATRATEDEBUSCARELCØDIGOCONSULTELASECCIØN
h"ÞSQUEDADE#ØDIGOSv
5.
Para el futuro, apunte los códigos operativos de cada
dispositivo en estos recuadros:
#ØDIGODE466#2O46$6$
#ØDIGODE46SISEUSA
AVISO: Si uno de los dígitos del código es 0, la tecla del
modo seleccionado no parpadeará.
2EPITAELTERCERPASOTRESVECESMÉSPARACONOCERLOSDÓGITOS
restantes. Use la tecla 2 para el segundo dígito, 3 para el
tercer dígito y 4 para el cuarto dígito. Termine de apuntar
ELCØDIGOENLOSRECUADROSDE#ØDIGODE46
5.
Para verificar los códigos del resto de disposi-tivos, repita
los pasos 1 al 4 sustituyendo la tecla que corresponde al
DISPOSITIVOQUELEINTERESAPEJ$6$6#2$62!58
!5$O#",3!4!PUNTELOSCØDIGOSENLOSRECUADROS
CORRESPONDIENTESDELASECCIØNh0ROGRAMACIØNDEL-ANEJO
DE$ISPOSITIVOSv
Uso de la Función de Aprendizaje
%L#ONTROL2EMOTO3USTITUTOPARA46POR#ABLEMODELO/!203
INCLUYEUNAFUNCIØNDEAPRENDIZAJEQUELEPERMITEINCORPORAR
funciones exclusivas de sus equipos de entretenimiento en el
HOGARPEJPOSICIONAMIENTOASCENDENTEODESCENDENTEDEL
CABEZALDEUNA6#2
Búsqueda de Códigos
Precauciones Relativas a la Función de Aprendizaje
Si su equipo de entretenimiento en el hogar no responde al Control
2EMOTO3USTITUTOPARA46POR#ABLEMODELO/!203DESPUÏS
de intentar con todos los códigos enumerados para la marca
correspondiente, o si la lista no incluye su marca, intente buscar el
CØDIGO0OREJEMPLOPARABUSCARUNCØDIGOPARASUTELEVISOR
%NCIENDAELTELEVISOR
/PRIMAUNAVEZLATECLA46DELCONTROLREMOTOLACUAL
DEBERÉPARPADEARUNAVEZ3EGUIDAMENTEOPRIMAY
SOSTENGA3%450HASTAQUELATECLA46PARPADEEDOSVECES
)NGRESE,ATECLA46DEBERÉPARPADEARDOSVECES
!PUNTEELCONTROLREMOTOALTELEVISORYOPRIMA0/7%2UNAVEZ
/PRIMAYSUELTELATECLA#(CONTINUAMENTEYDETÏNGASE
cuando se encienda el televisor.
AVISO: En el modo de búsqueda, el control remoto le
transmitirá códigos IR de su biblioteca al dispositivo
seleccionado, empezando por los códigos de los dispositivos
más usados.
s
3USCONTROLESREMOTOSORIGINALESDEBENFUNCIONAR
perfectamente para que tenga efecto la función de
APRENDIZAJE
s
,ASTECLASCONFUNCIONESAPRENDIDASSONEXCLUSIVASDECADA
modo, por lo cual en cada una se puede grabar sólo una
función para ese modo.
s
.OUSEESTASTECLASCONLAFUNCIØNDEAPRENDIZAJETECLASDE
DISPOSITIVO3%450 'RABARTECLAS-ACRO
s
,ACAPACIDADDEAPRENDIZAJETIENEUNLÓMITEDETECLAS
SEGÞNCUÉLSEAELCØDIGOQUESEINTENTEAPRENDER
s
#IERTASFUNCIONESDELOSDISPOSITIVOSNOPUEDENAPRENDERSE
entre ellas, las de tipo multifrecuencia, algunas de alta
frecuencia y otras relacionadas con formatos poco usuales.
s
0ARAOPTIMIZARELAPRENDIZAJEEVITEAMBIENTESDELUZ
MUYINTENSACOMOPOREJEMPLOLUZNATURALOBOMBILLAS
fluorescentes de ahorro de energía.
/PRIMA0/7%2%LTELEVISORDEBEENCENDERSE
SEGUIDAMENTEOPRIMA3%450UNAVEZPARARETENEREL
CØDIGO%L,%$DEBERÉPARPADEARDOSVECESPARAINDICARQUE
se ha grabado el código.
AVISO: Si no se enciende el televisor en el sexto paso, oprima
y suelte lentamente la tecla CH- para repasar los códigos y,
entonces, oprima SETUP cuando se encienda el televisor.
7.
8.
AVISO: Tenga a mano sus controles remotos originales
antes de programar el aprendizaje.
Programación de Teclas con Funciones Aprendidas
AVISO: Si tarda más de 15 segundos en oprimir una
tecla después de la otra, el control remoto abandona el
procedimiento de programación.
Intente otros comandos del control remoto para el televisor
POREJEMPLOVOLUMENMENÞETC3ILOSCOMANDOSQUE
DESEAUTILIZARCONSUTELEVISORFUNCIONANHATERMINADODE
PROGRAMARELTELEVISOR$ELOCONTRARIOREPITALOSPASOSAL
EXPLICADOSARRIBA%NELPASONOSEDETENGALAPRIMERA
VEZQUEELTELEVISORSEAPAGUEˆCONTINÞEOPRIMIENDO#(
hasta que se vuelva a apagar.
AVISO: Por omisión, las teclas CH+/- cambian los canales en
el dispositivo CBL/SAT independientemente del modo en
que se encuentre. Por lo tanto, debe utilizar únicamente
estas teclas para probar los códigos del dispositivo CBL/SAT
en estos momentos.
/PRIMAYSOSTENGA3%450HASTAQUEPARPADEEDOSVECESLA
TECLADELÞLTIMOMODOSELECCIONADOYDESPUÏSOPRIMA
Para buscar los códigos del resto de sus dispositivos, repita
los pasos 1 al 6 sustituyendo la tecla que corresponde al
DISPOSITIVOQUELEINTERESAPEJ$6$6#2$62!58!5$
O#",3!4
4.
AVISO: Si en su lugar, el LED se enciende una sola vez y por
tiempo prolongado, o bien las baterías tienen poca carga o
bien el Control Remoto Sustituto para TV por Cable modelo
OARP05S tiene un fallo de memoria.
/PRIMAUNAVEZUNADELASTECLASDEMODOPEJ$6$6#2
$62!58!5$46O#",3!4PARAASIGNARLEELMODOQUE
se intenta aprender.
/PRIMAUNAVEZLATECLADELMODELO/!203QUEINTERESA
para grabar la característica que se intenta aprender.
Verificación de Códigos
Si ha configurado el control remoto buscando el código de su
DISPOSITIVOQUIZÉDEBAAVERIGUARCUÉLESELCØDIGODECUATRO
DÓGITOSQUEESTÉPERMITIÏNDOLEMANEJARELEQUIPO
0OREJEMPLOPARAAVERIGUARCUÉLESELCØDIGOQUEESTÉ
PERMITIÏNDOLEMANEJARELTELEVISOR
/PRIMAUNAVEZLATECLA46DELCONTROLREMOTOLACUAL
DEBERÉPARPADEARUNAVEZ3EGUIDAMENTEOPRIMAY
SOSTENGA3%450HASTAQUELATECLA46PARPADEEDOSVECES
)NGRESE,ATECLA46DEBERÉPARPADEARDOSVECES
3. Para conocer el primer dígito del código, oprima 1 una
VEZ#UENTELASVECESQUEPARPADEALATECLA46PEJ
PARPADEOSYAPUNTEELNÞMEROENELRECUADRODE
#ØDIGODE46DELAIZQUIERDAENLASECCIØNh0ROGRAMACIØN
DEL-ANEJODE$ISPOSITIVOSv
Coloque el Control Remoto modelo OARP05S frente a
su control remoto original de manera que sus extremos
SUPERIORESQUEDENAUNOSCMDESEPARACIØN,OCALICE
TAMBIÏNLATECLADESUCONTROLREMOTOORIGINALQUELE
INTERESAQUEAPRENDASU#ONTROL2EMOTO3USTITUTOPARA46
por Cable modelo OARP05S.
5cm
5.
Oprima y sostenga la tecla del control remoto original que
INTENTAGRABARENEL#ONTROL2EMOTOMODELO/!203%L
,%$DELATECLADEDISPOSITIVODEBEPARPADEARRÉPIDAMENTE
antes de volver a apagarse. Mantenga oprimida la tecla
DELCONTROLREMOTOORIGINALHASTAQUEEL,%$DELATECLADE
dispositivo parpadee dos veces.
AVISO: Si el LED muestra un parpadeo continuo, ha
ocurrido un error de aprendizaje. Repita este paso hasta
lograr grabar la función. Si aún no se graba la función,
oprima y sostenga SETUP para abandonar el procedimiento
de programación, y revise la sección “Precauciones Relativas
a la Función de Aprendizaje”. Si es necesario, consulte
también la sección “Resolución de Problemas” de este
manual. Después de revisarla, reinicie el procedimiento de
programación desde el paso 1.
6.
Repita los pasos 2 al 5 para otro modo o tecla, y oprima
YSOSTENGA3%450HASTAQUEEL,%$DELMODOACTIVO
parpadee dos veces para abandonar el procedimiento de
programación.
Eliminación de una Función Aprendida
%STEPROCESOPERMITERESTITUIRLAPROGRAMACIØNORIGINALDEUNA
TECLAPARAELMODOSELECCIONADO4AMBIÏNPUEDEELIMINARUNA
función aprendida programando otra función en esa tecla
CONSULTELASECCIØNh0ROGRAMACIØNDE4ECLASCON&UNCIONES
!PRENDIDASv
AVISO: Si tarda más de 15 segundos en oprimir una
tecla después de la otra, el control remoto abandona el
procedimiento de programación.
/PRIMAYSOSTENGA3%450HASTAQUEPARPADEEDOSVECESLA
TECLADELÞLTIMOMODOSELECCIONADOYDESPUÏSOPRIMA
/PRIMAUNAVEZUNADELASTECLASDEMODOPEJ$6$6#2
$62!58!5$46O#",3!4%L,%$CORRESPONDIENTEAL
MODOSELECCIONADODEBERÉPARPADEARUNAVEZ
3.
Para eliminar la función aprendida, oprima dos veces la
TECLACORRESPONDIENTE,ATECLACORRESPONDIENTEALMODO
ACTIVODEBERÉPARPADEARDOSVECES
4.
Repita los pasos 2 y 3 con otra tecla u oprima y sostenga
3%450PARAABANDONARELPROCEDIMIENTODEPROGRAMACIØN
Eliminación de Todas las Funciones
Aprendidas para un Modo Específico
Cambio de Canal sólo a través del Aparato de
Cable o del Receptor de Satélite
/PRIMAUNAVEZLATECLA#",3!4DELCONTROLREMOTOLACUAL
DEBERÉPARPADEARUNAVEZ/PRIMAYSOSTENGA3%450HASTA
QUELATECLA#",3!4PARPADEEDOSVECES
)NGRESE,ATECLA#",3!4DEBERÉPARPADEARDOSVECES
/PRIMA#(UNAVEZ,ATECLA#",3!4DEBERÉPARPADEAR
dos veces.
!HORASINIMPORTARENQUÏMODOSEENCUENTREEXCEPTO!5$
PODRÉUSARLASTECLASDECANALESPARACAMBIARSOLAMENTEELCANAL
del aparato.
Modificación del Bloqueo de Volumen
%LBLOQUEODEVOLUMENPERMITEREGULARELVOLUMENATRAVÏS
del dispositivo que se haya identificado como portador de los
ALTAVOCESPRINCIPALESSINIMPORTARELMODOQUEESTÏUSÉNDOSE
%NEL#ONTROL2EMOTOMODELO/!203EL"LOQUEO'ENERAL
DE6OLUMENSEHAPROGRAMADOPARAFUNCIONARCONELTELEVISOR
de manera que pueda regularse el volumen del televisor en los
MODOS$6$6#2$62!5846O#",3!43EPUEDEDESBLOQUEAR
el volumen de los dispositivos seleccionados si interesa regular
su volumen de forma independiente.
AVISO: Los controles de volumen del modo de audio (AUD)
están activos sin importar la configuración del bloqueo de
volumen. Sin embargo, si se programan los controles de
volumen para funcionar sólo en el modo AUD, se podrá regular
el volumen de los dispositivos de audio en todos los demás
modos (p. ej., DVD/VCR, DVR/AUX, TV y CBL/SAT). Esto puede
resultar ventajoso si, por ejemplo, uno siempre escucha sus
dispositivos de entretenimiento en el hogar a través de los
altavoces del receptor.
Desbloqueo del Control de Volumen de un
Dispositivo (Desbloqueo de Volumen Individual)
AVISO: Si tarda más de 15 segundos en oprimir una
tecla después de la otra, el control remoto abandona el
procedimiento de programación.
3UPONIENDOQUEESTÉACTIVOELBLOQUEOGENERALDEVOLUMEN
seleccione en el control remoto el modo que le interesa
DESBLOQUEARPEJ#",3!4YOPRÓMALOUNAVEZ3EGUIDA
MENTEOPRIMAYSOSTENGA3%450HASTAQUELATECLADE
dispositivo parpadee dos veces.
/PRIMAYSOSTENGA3%450HASTAQUEPARPADEEDOSVECESLA
TECLADELÞLTIMOMODOSELECCIONADOYDESPUÏSOPRIMA
)NGRESE,ATECLACORRESPONDIENTEALÞLTIMODISPOSITIVO
SELECCIONADODEBERÉPARPADEARDOSVECES
/PRIMADOSVECESUNADELASTECLASDEMODOPEJ$6$
6#2$62!58!5$46O#",3!4PARABORRARTODASLAS
FUNCIONESAPRENDIDASPARAESEMODO%L,%$DELATECLADE
modo parpadea dos veces.
/PRIMA6/,UNAVEZ,ATECLADELÞLTIMODISPOSITIVO
SELECCIONADODEBERÉPARPADEARCUATROVECES
2EPITAELPASOPARAOTROMODOUOPRIMAYSOSTENGA3%450
para abandonar el procedimiento de programación.
!HORAUNAVEZSELECCIONADOELDISPOSITIVOCONVOLUMEN
BLOQUEADOPEJ#",3!4CUANDOSEOPRIMA6/,6/,Y
-54%SØLOSEREGULARÉELVOLUMENDEESEDISPOSITIVO
Programación del Bloqueo
de Control de Canales
$EFORMAPREDETERMINADAPARAELMODO46ELCONTROLREMOTO
sólo permite cambiar el canal del aparato de cable o del
RECEPTORDESATÏLITE,ASTECLASRELACIONADASCONESTARESTRICCIØN
SONLASTECLASNUMÏRICASDELAL#(#(Y,!34#ONELLO
se impide cambiar accidentalmente el canal del televisor. No
obstante, puede desactivarse esta característica para dar acceso
PLENOAESTASTECLASENELMODO46
Desbloqueo del Control de Canales
/PRIMAUNAVEZLATECLA#",3!4DELCONTROLREMOTOLACUAL
DEBERÉPARPADEARUNAVEZ/PRIMAYSOSTENGA3%450HASTA
QUELATECLA#",3!4PARPADEEDOSVECES
)NGRESE,ATECLA#",3!4DEBERÉPARPADEARDOSVECES
/PRIMA#(UNAVEZ,ATECLA#",3!4DEBERÉPARPADEAR
cuatro veces.
!HORAELCONTROLREMOTOPERMITIRÉCAMBIARELCANALDELTELEVISOR
ODELA6#2ENLOSMODOS46Y6#2
4.
Repita los pasos 1 al 3 para cada dispositivo cuyo volumen
le interese desbloquear.
Desbloqueo del Control de Volumen de Todos los
Dispositivos (Bloqueo General de Volumen)
AVISO: Estas instrucciones permiten independizar el control de
volumen de todos los dispositivos programados.
/PRIMAYSOSTENGA3%450ENELCONTROLREMOTOHASTA
QUEPARPADEEDOSVECESLATECLADELÞLTIMODISPOSITIVO
seleccionado.
)NGRESE,ATECLACORRESPONDIENTEALÞLTIMODISPOSITIVO
SELECCIONADODEBERÉPARPADEARDOSVECES
/PRIMA6/,UNAVEZ,ATECLADELÞLTIMODISPOSITIVO
SELECCIONADODEBERÉPARPADEARCUATROVECES
Control del Volumen Sólo en un Modo (Bloqueo
General de Volumen)
AVISO: Los controles de volumen del modo de audio están
activos sin importar la configuración del bloqueo de volumen.
Sin embargo, si se programan los controles de volumen para
funcionar sólo en el modo AUD, se podrá regular el volumen
de los dispositivos de audio en todos los demás modos (p.
ej., DVD/VCR, DVR/AUX, TV o CBL/SAT). Esto puede resultar
ventajoso si, por ejemplo, uno siempre escucha sus dispositivos
de entretenimiento en el hogar a través de los altavoces del
receptor.
/PRIMAYSOSTENGA3%450ENELCONTROLREMOTOHASTA
QUEPARPADEEDOSVECESLATECLADELÞLTIMODISPOSITIVO
seleccionado.
2EPITAELCUARTOPASOHASTACUATROVECESMÉSPARA
incorporar el segundo, el tercero, el cuarto y el quinto
dispositivo.
)NGRESE,ATECLACORRESPONDIENTEALÞLTIMODISPOSITIVO
SELECCIONADODEBERÉPARPADEARDOSVECES
6.
3ELECCIONEELMODOPEJ46O!5$QUELEINTERESE
USARPARAREGULARELVOLUMEN,ATECLADELDISPOSITIVO
SELECCIONADODEBERÉPARPADEARDOSVECES
R
Para guardar la configuración y salir del programa:
A /PRIMA#",3!4UNAVEZ
B /PRIMAYSOSTENGA3%450HASTAQUELATECLA#",3!4
parpadee dos veces.
Ahora, puede regularse el volumen del dispositivo seleccionado
PEJELTELEVISORMEDIANTELASTECLAS6/,6/,O-54%SIN
importar el modo.
Uso de la Tecla Master Power
Programación de las Teclas Macro
/PRIMA0/7%2UNAVEZPARAENCENDEROAPAGAR
secuencialmente los dispositivos de entretenimiento en el
hogar programados.
%L#ONTROL2EMOTO3USTITUTOMODELO/!203CONTIENEDOS
TECLASMACROSITUADASDIRECTAMENTEDEBAJODELASTECLAS
37!0Y-/6%,ASTECLASMACROPERMITENPROGRAMARMACROS
para accionar ciertas teclas en una secuencia específica. Por
EJEMPLOPUEDEPROGRAMARSEUNAMACROPARACAMBIARELCANAL
DELTELEVISORSUBIROBAJARELVOLUMENYEMPEZARAGRABAREN
LA6#2TODOOPRIMIENDOUNASOLATECLA3ILEINTERESACAMBIAR
las macros grabadas anteriormente en una tecla macro, debe
BORRARANTESELPROGRAMADEESATECLACONSULTEh%LIMINACIØNDE
LA0ROGRAMACIØNDEUNA4ECLA-ACROvENESTASECCIØN
Programación de las Teclas Macro
/PRIMAYSOSTENGA3%450ENELCONTROLREMOTOHASTAQUE
parpadee dos veces.
)NGRESE,ATECLA3%450DEBERÉPARPADEARDOSVECES
3ELECCIONEUNATECLAMACROPEJ-!#2/YOPRÓMALAUNA
VEZ
4.
Oprima la secuencia de teclas que le interesa programar
ENLAMACRO0OREJEMPLOPARAENCENDERELTELEVISORY
SUBIRELVOLUMENOPRIMAUNAVEZLATECLADEMODO46Y
SEGUIDAMENTEOPRIMAUNAVEZLATECLA6/,
AVISO: En una macro se puede programar secuencias de
hasta 15 teclas.
/PRIMAYSOSTENGA3%450HASTAQUEPARPADEEDOSVECES
0ARAA×ADIROTRAMACROREPITALOSPASOSALUSANDOENEL
cuarto paso la nueva secuencia de teclas que interesa.
AVISO: Programar más de cinco macros en la misma tecla
macro anula la configuración anterior.
Eliminación de la Programación de una Tecla Macro
/PRIMAYSOSTENGA3%450ENELCONTROLREMOTOHASTAQUE
parpadee dos veces.
)NGRESE,ATECLA3%450DEBERÉPARPADEARDOSVECES
/PRIMAUNAVEZLATECLAMACROQUELEINTERESABORRAR
/PRIMAYSOSTENGA3%450HASTAQUELA
tecla del modo activo parpadee dos veces.
5NAVEZPROGRAMADOAPUNTEELCONTROLREMOTOALOS
DISPOSITIVOS/PRIMA#",3!4UNAVEZ
6ERÉENCENDERSEOAPAGARSELOSDISPOSITIVOSENLASECUENCIA
programada.
Eliminación de la Programación
de la Tecla Master Power
/PRIMAYSOSTENGA3%450ENELCONTROLREMOTOHASTA
QUEPARPADEEDOSVECESLATECLADELÞLTIMODISPOSITIVO
seleccionado.
)NGRESE,ATECLACORRESPONDIENTEALÞLTIMODISPOSITIVO
SELECCIONADODEBERÉPARPADEARDOSVECES
/PRIMAYSUELTE0/7%2
/PRIMAYSOSTENGA3%450HASTAQUELATECLA#",3!4
parpadee dos veces.
Reasignación de las Teclas de Dispositivo
#ONTROL2EMOTO3USTITUTOPARA46POR#ABLEMODELO/!203
PUEDECONlGURARSEPARAMANEJARUNSEGUNDODISPOSITIVODEUN
tipo ya asignado.
0OREJEMPLOPARAMANEJARCONLAUNIDADUNTELEVISORUN
APARATOYDOSDISPOSITIVOSDEAUDIOPEJDOSRECEPTORESDE
AUDIOREASIGNELATECLAOCIOSA$6$6#2ALSEGUNDODISPOSITIVO
de audio siguiendo este procedimiento:
AVISO: Este procedimiento anulará la programación que se
haya hecho de la tecla de dispositivo.
/PRIMAUNAVEZLATECLA$6$6#2DELCONTROLREMOTOLA
CUALDEBERÉPARPADEARUNAVEZ3EGUIDAMENTEOPRIMAY
SOSTENGA3%450HASTAQUELATECLA$6$6#2PARPADEEDOS
veces.
)NGRESE,ATECLA$6$6#2DEBERÉPARPADEARDOS
veces.
/PRIMA!5$UNAVEZYSEGUIDAMENTE$6$6#2UNAVEZ,A
TECLA$6$6#2DEBERÉPARPADEARDOSVECES
!HORAESTATECLAMACROESTÉVACÓAYPUEDEREPROGRAMARSE
CONSULTEh0ROGRAMACIØNDELAS4ECLAS-ACROvENESTASECCIØN
Si le interesa, repita este procedimiento para borrar la
programación de otra tecla macro.
!HORALATECLA$6$6#2SEPUEDEPROGRAMARPARAUNSEGUNDO
dispositivo de audio. Consulte la sección “Programación
DEL#ONTROLDE$ISPOSITIVOSv0ARAREASIGNAROTRASTECLAS
de dispositivo, repita este procedimiento usando la
correspondiente secuencia de teclas que se indica en este
diagrama:
Uso de la Tecla Master Power
AVISO: A cada tecla de dispositivo ociosa se le puede asignar
sólo un dispositivo a la vez.
%L#ONTROL2EMOTOMODELO/!203TIENEUNACARACTERÓSTICA
ÞNICAQUEPERMITEENCENDEROAPAGARSECUENCIALMENTEHASTA
cinco dispositivos de entretenimiento en el hogar oprimiendo
una sola tecla.
DVD/VCR como tecla de 2.º AUD
AVISO: MASTER POWER (POWER) funciona sólo en el modo
CBL/SAT. Si no se ha programado, sólo se encenderán o
apagarán el aparato de cable o el receptor de satélite. En
cualquier otro modo, al oprimir MASTER POWER (POWER) una
vez, se enciende o apaga el dispositivo seleccionado.
$6$6#2ˆ3%450ˆˆˆˆ46ˆ$6$6#2
Programación de la Tecla Master Power
/PRIMAYSOSTENGA3%450HASTAQUEPARPADEEDOSVECESLA
TECLADELÞLTIMODISPOSITIVOSELECCIONADO
)NGRESE,ATECLACORRESPONDIENTEALÞLTIMODISPOSITIVO
SELECCIONADODEBERÉPARPADEARDOSVECES
/PRIMA0/7%2UNAVEZ
4.
Para el primer dispositivo de la secuencia, oprima una tecla
DEDISPOSITIVOPEJ#",3!4UNAVEZ3EGUIDAMENTE
OPRIMA0/7%2UNAVEZ0ARAELSEGUNDODISPOSITIVODELA
SECUENCIAOPRIMASUTECLACORRESPONDIENTEUNAVEZPEJ
463EGUIDAMENTEOPRIMA0/7%2
$6$6#2ˆ3%450ˆˆˆˆ!5$ˆ$6$6#2
DVD/VCR como tecla de 2.º TV
DVD/VCR como tecla de 2.º CBL/SAT
$6$6#2ˆ3%450ˆnnn#",3!4ˆ$6$6#2
DVD/VCR de nuevo como DVD/VCR
$6$6#2ˆ3%450ˆnnn$6$6#2ˆ$6$6#2
0ARAREASIGNAROTRATECLADEDISPOSITIVOOCIOSAÞSELAENLUGARDE
LATECLA$6$6#2YREALICELASECUENCIADEPASOS0OREJEMPLO
PARAREASIGNARUNATECLA!5$OCIOSAAUNSEGUNDO$6$
!5$ˆ3%450ˆˆˆˆ$6$ˆ!5$
5NAVEZlNALIZADALAREASIGNACIØNLATECLADEDISPOSITIVO
SELECCIONADAPEJ!5$DEBEPARPADEARDOSVECESPARA
CONlRMARSUELECCIØN%NTONCESSERÉNECESARIOPROGRAMAREL
CONTROLDELDISPOSITIVOCONSULTELASECCIØNh0ROGRAMACIØNDEL
#ONTROLDE$ISPOSITIVOSv
Eliminación de Programas Personales
%L#ONTROL2EMOTOMODELO/!203CONTIENEUNPROGRAMA
de eliminación de programas personales. Puede usarlo para
eliminar todos sus programas personales, excepto sus códigos de
configuración y las teclas de dispositivo que haya reasignado.
IMPORTANTE: Este programa elimina todas las configuraciones
personales de bloqueo de volumen, teclas con funciones
aprendidas, teclas de macro y bloqueo de canales. Sin embargo,
permanece la programación de todos los dispositivos.
/PRIMAYSOSTENGA3%450ENELCONTROLREMOTOHASTA
QUEPARPADEEDOSVECESLATECLADELÞLTIMODISPOSITIVO
seleccionado.
)NGRESE,ATECLADELÞLTIMODISPOSITIVOSELECCIONADO
DEBERÉPARPADEARDOSVECESHACERUNAPAUSAYVOLVERA
parpadear dos veces para confirmar que se ha borrado toda
la programación personal.
Resolución de Problemas
A
La tecla de dispositivo no parpadea cuando usted oprime
una tecla.
3USTITUYALASBATERÓASPORDOSBATERÓAS!!NUEVASCONSULTELA
SECCIØNh)NSTALACIØNDE"ATERÓASv
La tecla de dispositivo parpadea cuando usted oprime
una tecla, pero el dispositivo de entretenimiento no
responde.
!SEGÞRESEDEAPUNTARELCONTROLREMOTOALDISPOSITIVODE
ENTRETENIMIENTOENELHOGARQUEPRETENDEMANEJARYCOMPRUEBE
QUENOHAYAMÉSDEMETROSDESEPARACIØNENTREELLOS
El control remoto no permite manejar los dispositivos o
los comandos no se cumplen correctamente.
Pruebe con todos los códigos de la lista que correspondan a la
MARCADELDISPOSITIVOQUESECONlGURA6ERIlQUEQUETODOSLOS
DISPOSITIVOSPUEDANMANEJARSEMEDIANTEUNCONTROLREMOTODE
INFRARROJOS
La combinación de TV/VCR no responde correctamente.
5SELOSCØDIGOSDE6#2CORRESPONDIENTESASUMARCA0ARAPODER
MANEJARPLENAMENTEALGUNASUNIDADESDECOMBINACIØNESNECESARIO
USARTANTOELCØDIGODE46COMOELCØDIGODE6#2CONSULTELA
SECCIØNh#ONlGURACIØNDE5NIDADESDE#OMBINACIØNv
El segundo televisor no tiene volumen.
Siga las instrucciones de la sección “Modificación del Bloqueo
DE6OLUMENv
y no funcionan con
Las teclas
un aparato de cable Motorola DCT-2000.
6UELVAAPROGRAMARLATECLA#",3!4CONELCØDIGODECABLE
CONSULTELASECCIØNh0ROGRAMACIØNDEL#ONTROLDE$ISPOSITIVOSv
He seguido el procedimiento de búsqueda pero sigo sin
encontrar un código que funcione.
6UELVAAINTENTARELPROCEDIMIENTODEBÞSQUEDADESPUÏSDEBORRAR
la programación de las teclas de dispositivo como se indica:
A /PRIMAYSOSTENGA3%450HASTAQUELATECLADEDISPOSITIVO
parpadee dos veces.
B )NGRESE
c. Oprima y suelte dos veces la tecla de dispositivo cuya
programación interesa borrar.
El control remoto no hace encender una combinación de
TV/VCR marca Sony o Sharp.
Para encender estos productos, es necesario programar el
CØDIGODE46ENELCONTROLREMOTO0ARAPRODUCTOS3ONYUSE
ELCØDIGODE46YELCØDIGODE6#20ARAPRODUCTOS
3HARPUSEELCØDIGODE46YELCØDIGODE6#2
Información Adicional
%STEPRODUCTONOCONTIENEPIEZASALASQUEELUSUARIO
PUEDADARMANTENIMIENTO!BRIRLACAJAEXCEPTOPORLA
tapa del compartimiento de las baterías, puede averiar
PERMANENTEMENTEEL#ONTROL2EMOTO3USTITUTOPARA46POR
Cable modelo OARP05S.
s
s
0ARAASISTENCIAATRAVÏSDE)NTERNETVISÓTENOSEN
www.oneforall.com
0ARAASISTENCIAATRAVÏSDENUESTRALÓNEA
DEAYUDAALCLIENTELLAMEPOREL
/.%&/2!,,šESLAMARCACOMERCIALREGISTRADADE5NIVERSAL
%LECTRONICS)NC!UDIOVOX!CCESSORIES#ORPORATIONESLA
CONCESIONARIADELAMARCA/.%&/2!,,šPARA%%55Y#ANADÉ
¥DE5NIVERSAL%LECTRONICS)NC.INGUNAPARTEDEESTA
publicación puede reproducirse, transmitirse, transcribirse,
ALMACENARSEENNINGÞNTIPODESISTEMADERECUPERACIØNDE
INFORMACIØNNITRADUCIRSEANINGÞNIDIOMADENINGUNAFORMA
NIPORNINGÞNMEDIOYASEAELECTRØNICOMECÉNICOMAGNÏTICO
ØPTICOMANUALUOTROSINLAAUTORIZACIØNPREVIAPORESCRITODE
5NIVERSAL%LECTRONICS)NC
%STEPRODUCTOESTÉCUBIERTOPORUNAOMÉSDELASSIGUIENTES
PATENTES
Aviso de la FCC
%STEEQUIPOHASIDOPROBADOYSECONSIDERØQUECUMPLECONLOSLÓMITES
de los aparatos digitales de clase B, de acuerdo con las especificaciones
DELAPARTEDELAS2EGLASDELA&##%LOBJETIVODEESTOSLÓMITESES
OFRECERUNAPROTECCIØNRAZONABLECONTRAINTERFERENCIASNOCIVASENUNA
INSTALACIØNRESIDENCIAL%STEEQUIPOGENERAUTILIZAYPUEDERADIARENERGÓADE
RADIOFRECUENCIAYSINOSEINSTALAYUTILIZADEACUERDOCONESTASINSTRUCCIONES
PUEDEGENERARINTERFERENCIAPERJUDICIALPARALASRADIOCOMUNICACIONES
3INEMBARGONOSEGARANTIZAQUENOSEPRODUCIRÉINTERFERENCIAENUNA
INSTALACIØNENPARTICULAR3ISUEQUIPOCAUSAINTERFERENCIAPERJUDICIAL
para la recepción de radio o televisión, que puede averiguar apagando y
encendiendo el equipo, intente corregirla mediante uno o varios de los
siguientes procedimientos:
s6UELVAAORIENTAROCAMBIEDELUGARLAANTENARECEPTORA
s!UMENTELASEPARACIØNENTREELEQUIPOYELRECEPTOR
s#ONECTEESTEEQUIPOAUNTOMACORRIENTEENUNCIRCUITODIFERENTEALQUEESTÏ
conectado el receptor.
s#ONSULTEALDISTRIBUIDOROAUNTÏCNICOEXPERIMENTADODERADIOYTELEVISIØN
para solicitar asistencia.
%STEEQUIPOHASIDOVERIlCADOYSESABEQUECUMPLECONLOSLÓMITESPARAUN
dispositivo de computación de clase B, de acuerdo con las especificaciones
DELAS2EGLASDELA&##0ARAGARANTIZARELCUMPLIMIENTOCONLASREGLASDELA
&##SEDEBENUTILIZARCABLESBLINDADOSCONESTEEQUIPO%LFUNCIONAMIENTO
con equipo no aprobado o cables no blindados podría ocasionar interferencia
ENLARECEPCIØNDERADIOY463ELEADVIERTEALUSUARIOQUELOSCAMBIOSY
MODIlCACIONESREALIZADOSALEQUIPOSINLAAPROBACIØNDELFABRICANTEPODRÓAN
ANULARLAAUTORIDADDELUSUARIOCONFERIDAPARAUTILIZARESTEEQUIPO
Cuidado y Mantenimiento
s-ANTENGAELCONTROLREMOTOSECO3ISEMOJASÏQUELOINMEDIATAMENTE
s5TILICEYALMACENEELCONTROLREMOTOÞNICAMENTEENENTORNOSDE
temperatura normal.
s-ANEJEELCONTROLREMOTODEFORMACUIDADOSA.OLODEJECAER
s-ANTENGAELCONTROLREMOTORESGUARDADODELPOLVOYLASUCIEDAD
s,IMPIEELCONTROLREMOTOCONUNPA×OHÞMEDODEVEZENCUANDOPARA
mantenerlo en buenas condiciones de operación.
s-ODIlCAROSABOTEARLOSCOMPONENTESINTERNOSDELCONTROLREMOTO
podría ocasionar desperfectos y anular la garantía.
Garantía Limitada Durante
la Vida Útil del Producto
!UDIOVOX%LECTRONICS#ORPORATIONLAh#OMPA×ÓAvLEGARANTIZAAUSTED
ELCOMPRADORORIGINALDEESTEPRODUCTOQUESIBAJOCONDICIONESYUSO
normales, se encontrara que presenta defectos materiales o de mano de
OBRADURANTESUVIDAÞTILMIENTRASSEADESUPROPIEDADTALESDEFECTOS
SERÉNREPARADOSOREEMPLAZADOSAOPCIØNDELA#OMPA×ÓASINCARGO
ALGUNOPORLASPIEZASYLABORESDEREPARACIØN0ARAOBTENERLOSSERVICIOS
DEREPARACIØNOREEMPLAZODENTRODELOSTÏRMINOSDEESTA'ARANTÓAEL
PRODUCTOSEENTREGARÉCONPRUEBADECUBIERTADEGARANTÓAPOREJEMPLO
FACTURAFECHADADEVENTAESPECIlCACIØNDELOSDEFECTOSTRANSPORTE
PREPAGADOALA#OMPA×ÓAALADIRECCIØNINDICADAABAJO.ODEVUELVAESTE
producto al distribuidor.
%STA'ARANTÓANOCUBREUNPRODUCTOADQUIRIDOMANTENIDOOUTILIZADO
FUERADELOS%STADOS5NIDOSO#ANADÉ%STA'ARANTÓANOESTRANSFERIBLEY
no incluye los costos incurridos en la instalación, remoción o reinstalación
DEESTEPRODUCTO%STA'ARANTÓANOAPLICASIESOPINIØNDELA#OMPA×ÓA
QUEESTEPRODUCTOHASUFRIDODA×OSDEBIDOAALTERACIONESINSTALACIØN
inadecuada, abuso, uso indebido, negligencia, accidente o el uso
SIMULTÉNEODEDIFERENTESTIPOSDEBATERÓASPOREJEMPLOALCALINAS
TÓPICASORECARGABLES%,!,#!.#%$%,!2%30/.3!"),)$!$$%,!
#/-0!»·!"!*/%34!'!2!.4·!%34­,)-)4!$/!,!2%0!2!#)¼.
/%,2%%-0,!:/02/6)34/!22)"!9%..).'Â.#!3/$%"%2­,!
2%30/.3!"),)$!$$%,!#/-0!»·!%8#%$%2%,02%#)/$%#/-02!
0!'!$/0/2%,#/-02!$/2$%%34%02/$5#4/
%STA'ARANTÓAREEMPLAZACUALESQUIERAOTRASRESPONSABILIDADES
OGARANTÓASEXPRESAS#5!,%315)%2!'!2!.4·!3)-0,·#)4!3
).#,59%.$/#5!,15)%2'!2!.4·!)-0,·#)4!$%#/-%2#)!"),)$!$
/!$!04!"),)$!$0!2!5.02/0¼3)4/%.0!24)#5,!2%34!2­.
,)-)4!$!3!,!$52!#)¼.$%%34!'!2!.4·!%..).'Â.#!3/
,!#/-0!»·!3%2­2%30/.3!",%0/2$!»/3%-%2'%.4%3/
).#)$%.4!,%3.INGUNAPERSONANIREPRESENTANTEESTÉAUTORIZADOA
ASUMIRANOMBREDELA#OMPA×ÓANINGUNARESPONSABILIDADSALVOLA
expresada aquí en conexión con la venta de este producto. Algunos
ESTADOSPROVINCIASNOPERMITENLIMITACIONESSOBRELADURACIØNDEUNA
GARANTÓAIMPLÓCITAOLAEXCLUSIØNOLALIMITACIØNDEDA×OSINCIDENTALESO
emergentes, de modo que es posible que las limitaciones o exclusiones
ANTERIORESNOAPLIQUENENSUCASO%STA'ARANTÓALECONlEREDERECHOS
LEGALESESPECÓlCOSSEGÞNELESTADOPROVINCIAPUEDEDISFRUTARADEMÉSDE
otros derechos.
EE.UU.: !UDIOVOX%LECTRONICS#ORPORATION-ARCUS"LVD(AUPPAUGE
.EW9ORK
CANADÁ: !UDIOVOX2ETURN#ENTERCO'ENCO+ENNEDY2OAD5NIT
$OOR-ISSISSAUGA/NTARIO,4!
Audio
Amplifier / Amplificateur / Amplificador
Durabrand ...................................................................................1561
Harman/Kardon ...........................................................................0892
JVC................................................................................................0331
Left Coast .....................................................................................0892
Lenoxx ..........................................................................................1561
Marantz .......................................................................................0892
Optimus .......................................................................................0823
Philips ...........................................................................................0892
Pioneer .........................................................................................0823
Polk Audio ...................................................................................0892
RCA...............................................................................................0823
Sony..............................................................................................0815
Victor............................................................................................0331
Yamaha ........................................................................................0354
Receiver / Récepteur / Receptor
Accurian .......................................................................................2098
Aiwa .....................................................1405, 0189, 0121, 1243, 1641
Akai ..............................................................................................1512
Alco ..............................................................................................1390
Anam..................................................................................1609, 1074
Apex Digital .............................................................1257, 1430, 1774
Audiotronic..................................................................................1189
Audiovox......................................................................................1390
B & K ..................................................................... 0701, 0820, 0840
Bose ............................................1229, 0639, 1253, 1629, 1841, 1933
Cambridge Soundworks....................................................1370, 2297
Carver .................................................................................1189, 0189
Daewoo........................................................................................1250
Denon ............................................................1360, 1142, 2279, 2857
Fisher ............................................................................................1801
Gateway .......................................................................................1517
Go Video ......................................................................................1532
Harman/Kardon ...................................0189, 0891, 1304, 1306, 2241
Hitachi ..........................................................................................1801
Insignia.................................................1030, 1077, 1893, 2169, 2175
Integra ...........................................................0135, 1298, 1320, 1805
JBL ................................................................................................1306
JVC........................................................1374, 1676, 1871, 2239, 2331
Kenwood .......................................................1313, 1570, 1569, 0186
KLH ...........................................................................1390, 1412, 1428
Koss ..............................................................................................1366
LG .......................................................................................1293, 2197
Linn ..............................................................................................0189
Magnavox ............................................1189, 1269, 0189, 0391, 1514
Marantz .........................................................1189, 1269, 0189, 1289
Mitsubishi ....................................................................................1393
Onkyo.........................................0135, 0842, 1298, 1320, 1531, 1805
Optimus ...................................................................1023, 0186, 1074
Oritron ........................................................................................ 1366
Panasonic .....1308, 0367, 1288, 1316, 1548, 1633, 1763, 1764, 2967
Philips ...............................1189, 1269, 0189, 0391, 1266, 1831, 2311
Pioneer .......................................1023, 0244, 0630, 1123, 1384, 1935
Polaroid........................................................................................1508
Polk Audio .........................................................................0189, 1289
Proscan .........................................................................................1254
RCA.........................1023, 1609, 1254, 1074, 1123, 1390, 1511, 2041
Rio ................................................................................................1869
Samsung...................................................................................... 1295, 1500, 1868
Sansui .............................................................................................................. 0189
Sanyo........................................................................................... 1251, 1469, 1801
Sharp ..................................................................................................... 0186, 1286
Sherwood................................................................ 1077, 1517, 1653, 1905, 2169
Sherwood Newcastle...................................................................................... 2169
Sonic Blue ............................................................................................. 1532, 1869
Sony............. 1759, 1058, 1441, 1258, 1622, 1558, 1658, 1758, 1822, 1858, 2172
Stereophonics ................................................................................................. 1023
Sunfire............................................................................................................. 1313
Teac ............................................................................................. 1074, 1390, 1528
Technics ........................................................................................................... 1308
Thorens ........................................................................................................... 1189
Toshiba ............................................................................................................ 1788
Venturer .......................................................................................................... 1390
Vizio ................................................................................................................ 1517
Wards .............................................................................................................. 0189
Yamaha ....... 0176, 0186, 0376, 1176, 1276, 1331, 1375, 1376, 1476, 1815, 2061
Zenith .................................................................................................... 0857, 1293
Audio Accessories / Accessoires de audio / Accessorios de audio
Accurian .......................................................................................................... 1106
Altec Lansing .................................................................................................. 0607
Apple..................................................................................................... 1115, 1644
D-Link .............................................................................................................. 1522
DLO ................................................................................................................. 1155
GPX.................................................................................................................. 2113
Griffin.............................................................................................................. 1891
iDeck ............................................................................................................... 1106
iLive ................................................................................................................. 2113
Monitor Audio................................................................................................ 1106
NaviPod ........................................................................................................... 1644
Netgear ........................................................................................................... 1785
Roku ................................................................................................................ 1828
SSI .................................................................................................................... 1522
Yamaha ................................................................................................. 1809, 1810
Cable / Câble
Code Lists / Liste des codes /
Lista de Códigos
Amino ................................................................................1602, 1822
Bright House ......................................................................1376, 1877
Cable One ..........................................................................1376, 1877
Cablevision.........................................................................1376, 1877
Charter .....................................................................1376, 1877, 2187
Cisco .........................................................................1877, 0877, 1982
Comcast..........................................................1376, 1877, 1982, 2576
Cox .....................................................................................1376, 1877
Digeo..................................................................................1187, 2187
Director ........................................................................................0476
General Instrument .....................................................................0476
Homecast .....................................................................................2301
i3 Micro ........................................................................................1602
Insight ................................................................................1376, 1877
Jerrold ..........................................................................................0476
Mediacom ..........................................................................1376, 1877
Motorola ..................................................................1376, 0476, 1187
Myrio ..................................................................................1602, 1822
Pace ..............................................................................................1877
Panasonic .....................................................................................1982
Pioneer ...............................................................................1877, 0877
Scientific Atlanta ...............................................................1877, 0877
Sejin..............................................................................................1602
Suddenlink .........................................................................1376, 1877
Time Warner ............................................................1376, 1877, 2187
Tivo ...............................................................................................2576
Satellite / Satélite
Amino ................................................................................................................ 1822
Bright House ............................................................................................ 1376, 1877
Cable One ................................................................................................ 1376, 1877
Cablevision............................................................................................... 1376, 1877
Charter ........................................................................................... 1376, 1877, 2187
Cisco ......................................................................................................... 1877, 1982
Comcast................................................................................ 1376, 1877, 1982, 2576
Cox ........................................................................................................... 1376, 1877
Digeo........................................................................................................ 1187, 2187
Homecast ........................................................................................................... 2301
Insight ...................................................................................................... 1376, 1877
Mediacom ................................................................................................ 1376, 1877
Motorola .................................................................................................. 1376, 1187
Myrio .................................................................................................................. 1822
Pace .................................................................................................................... 1877
Panasonic ........................................................................................................... 1982
Pioneer ............................................................................................................... 1877
Scientific Atlanta ............................................................................................... 1877
Suddenlink ............................................................................................... 1376, 1877
Time Warner .................................................................................. 1376, 1877, 2187
Tivo ..................................................................................................................... 2576
Cable-DVR Combos / Combinés Câble - DVR /
Combos de Cable-DVR
Bell ExpressVu ....................................................................... 0775, 1170
Chaparral ........................................................................................ 0216
Coolsat ............................................................................................ 1806
Crossdigital ..................................................................................... 1109
DirecTV ............. 1377, 0392, 0566, 0639, 1639, 1142, 0247, 0749, 1749,
1856, 1076, 1109, 1189, 1414, 1442, 1443, 1609, 1708
Dish Network System ...................................... 0775, 1505, 1170, 1775
Dishpro........................................................................ 0775, 1505, 1775
Echostar ............................................................ 0775, 1505, 1170, 1775
Expressvu .............................................................................. 0775, 1775
GE .................................................................................................... 0566
General Instrument ........................................................................ 0869
GOI ........................................................................................ 0775, 1775
Hitachi ............................................................................................. 1250
HTS ........................................................................................ 0775, 1775
Hughes Network Systems ...................... 1142, 0749, 1749, 1442, 1443
Humax ............................................................................................. 1790
JVC............................................................................... 0775, 1170, 1775
LG .................................................................................................... 1414
Mitsubishi ....................................................................................... 0749
Motorola ......................................................................................... 0869
Next Level ....................................................................................... 0869
Panasonic .................................................................... 0247, 0701, 1189
Pansat.............................................................................................. 1807
Philips ...................................................... 1142, 0749, 1749, 1076, 1442
Proscan .................................................................................. 0392, 0566
RadioShack ..................................................................................... 0869
RCA........................................................................................ 0566, 0143
Samsung........................................ 1377, 1276, 1109, 1442, 1609, 1708
Sony....................................................................................... 0639, 1639
Star Choice ...................................................................................... 0869
Tivo .............................................................................. 1142, 1442, 1443
Accurian .............................................................................0675, 1416
Advent .........................................................................................1016
Aiwa .............................................................................................0641
Akai ................................................................0695, 0770, 0899, 1089
Alco ..............................................................................................0790
Allegro .........................................................................................0869
Amphion Media Works .....................................................0872, 1245
AMW ..................................................................................0872, 1245
Apex Digital ....................0672, 0717, 0755, 0794, 0796, 0797, 0830,
1004, 1056, 1061, 1100, 1480
Arrgo ............................................................................................1023
Aspire Digital .....................................................................1168, 1407
Astar ...................................................................................1489, 1678
Audiovox..................................................................0790, 1121, 1122
B & K ............................................................................................0662
BBK ...............................................................................................1224
Bel Canto Design .........................................................................1571
Blaupunkt ....................................................................................0717
Blue Parade..................................................................................0571
Bose ..............................................................................................2023
Broksonic .................................................................0695, 0868, 1419
Buffalo .........................................................................................1882
Centrios ........................................................................................1577
Cinea ............................................................................................0831
CineVision ................................................................0876, 0833, 0869
Citizen ................................................................................0695, 1277
Coby .................................0778, 0852, 1086, 1107, 1165, 1177, 1351
Craig .............................................................................................0831
Curtis Mathes...............................................................................1087
CyberHome ............0816, 0874, 1023, 1024, 1117, 1129, 1502, 1537
D-Link ...........................................................................................1881
D-Vision........................................................................................1173
Bell ExpressVu .......................................................................................... 0775, 1170
DirecTV................................................... 1377, 0392, 0639, 1142, 1076, 1442, 1443
Dish Network System .............................................................................. 0775, 1505
Dishpro..................................................................................................... 0775, 1505
Echostar ......................................................................................... 0775, 1505, 1170
Expressvu ........................................................................................................... 0775
Hughes Network Systems ............................................................. 1142, 1442, 1443
JVC...................................................................................................................... 1170
Motorola ............................................................................................................ 0869
Philips ....................................................................................................... 1142, 1442
Proscan ............................................................................................................... 0392
Samsung............................................................................................................. 1442
Sony.................................................................................................................... 0639
Star Choice ......................................................................................................... 0869
Tivo ................................................................................................. 1142, 1442, 1443
Satellite-DVR Combos / Combinés Satellite - DVR /
Combos de Satélite-DVR
Toshiba ........................................................................................... 0749, 1749, 0790
Ultrasat .............................................................................................................. 1806
Voom .................................................................................................................. 0869
Zenith ................................................................................................................. 1856
DVD / Lecteurs DVD
Daewoo................0784, 0705, 0833, 0869, 1169, 1172, 1234, 1242, 1441, 1443
Denon ........................................................................................0490, 0634, 2258
Desay ..............................................................................................................1407
Diamond Vision .........................................................................1316, 1609, 1610
DigitalMax .....................................................................................................1738
Disney...................................................................................................0675, 1270
Dual ......................................................................................................1068, 1085
Durabrand ...........................................................................................1127, 2164
DVD2000 ........................................................................................................0521
Emerson ...........................................................................0591, 0675, 0821, 1268
Enterprise.......................................................................................................0591
ESA .............................................................................................0821, 1268, 1443
Fisher ....................................................................................................0670, 1919
Funai ..........................................................................................0675, 1268, 1334
Gateway .....................................................................................1073, 1077, 1158
GE ...............................................................................................0522, 0815, 0717
GFM ......................................................................................................0675, 1268
Go Video .................................0744, 0715, 0741, 0783, 0833, 0869, 1044, 1075,
1099, 1144, 1158, 1304, 1443, 1730
GoldStar .........................................................................................................0741
GPX.......................................................................................................0699, 0769
Greenhill ........................................................................................................0717
Harman/Kardon .........................................................................0582, 0702, 1229
Helios .............................................................................................................2192
Hello Kitty ......................................................................................................0831
Hitachi ..............................................................................0573, 0664, 1247, 1919
Hiteker ...........................................................................................................0672
Humax ............................................................................................................1588
iLo.........................................................................................................1348, 1472
Initial ....................................................................................................0717, 1472
Insignia.............................................................................0675, 1268, 2095, 2428
Integra .......................................................................................0627, 1769, 2147
JBL ..................................................................................................................0702
Jensen ............................................................................................................1016
JSI ...................................................................................................................1423
JVC............................................0558, 0623, 0867, 1164, 1275, 1550, 1602, 1863
jWin ................................................................................................................1049
Kawasaki ........................................................................................................0790
Kenwood ...................................................................................0490, 0534, 0682
KLH ...................................................................................0717, 0790, 1149, 1261
Konka .........................................................................................0711, 0719, 0720
Koss ............................................................................................0651, 0896, 1423
Lasonic .................................................................................................0798, 1173
Lenoxx ............................................................................................................1127
LG .....................................................................................0591, 0741, 0869, 1526
LiteOn ..........................................................1058, 1158, 1416, 1440, 1656, 1738
Loewe.............................................................................................................0511
Magnavox ......................0503, 0539, 0646, 0675, 0821, 1268, 1354, 1472, 1506
Malata ............................................................................................................0782
Marantz ...............................................................................................0539, 2414
McIntosh ........................................................................................................1273
Memorex..........................................................................0695, 0831, 1270, 2213
Microsoft..............................................................................................0522, 2083
Mintek........................................................................................0839, 0717, 1472
Mitsubishi ............................................................................................1521, 0521
NAD ................................................................................................................0741
NEC .................................................................................................................0785
Nesa................................................................................................................0717
NexxTech ........................................................................................................1402
Norcent ..................................................................1003, 0872, 1107, 1265, 1457
Olevia .............................................................................................................2331
Onkyo...................................................................... 0503, 0627, 1769, 2120, 2147
Oppo ........................................................................................... 0575, 1224, 2185
OptoMedia Electronics................................................................................... 0896
Oritron ............................................................................................................ 0651
Panasonic .................................. 0490, 0632, 0703, 1362, 1462, 1490, 1641, 1762
Philco............................................................................................................... 0675
Philips ....................................... 0503, 0539, 2056, 0646, 0675, 0854, 1260, 1267,
1340, 1354, 2084, 2334, 2434
Pioneer ...................................... 0525, 0571, 0142, 0631, 0632, 1460, 1571, 2442
Polaroid........................... 1061, 1086, 1245, 1261, 1316, 1478, 1480, 1482, 2313
Polk Audio ...................................................................................................... 0539
Portland .......................................................................................................... 0770
Presidian ............................................................................................... 0675, 1738
Prima ............................................................................................................... 1016
Primare............................................................................................................ 1467
Princeton......................................................................................................... 0674
Proscan ............................................................................................................ 0522
ProVision ......................................................................................................... 0778
Qwestar........................................................................................................... 0651
RCA.................................. 0522, 0571, 0717, 0790, 0822, 1022, 1132, 1193, 1769
Rio ................................................................................................................... 0869
RJTech ............................................................................................................. 1360
Rotel ................................................................................................................ 0623
Sampo ......................................................................................... 0698, 0752, 1501
Samsung.............................................. 0490, 0573, 0199, 0899, 1044, 1075, 2329
Sansui .............................................................................................................. 0695
Sanyo................................................................................. 0670, 0695, 0873, 1919
Schmartz ......................................................................................................... 2367
Sensory Science............................................................................................... 1158
Sharp ....................................................................... 0630, 0675, 0752, 1256, 2250
Sharper Image ................................................................................................ 1117
Sherwood................................................................ 0633, 0770, 1043, 1077, 1889
Sherwood Newcastle...................................................................................... 1077
Shinsonic ............................................................................................... 0533, 0839
Sigma Designs................................................................................................. 0674
Sonic Blue ............................................................................................. 0869, 1099
Sony.................................................... 0533, 1533, 0864, 0772, 1033, 1070, 1431,
1432, 1433, 1516, 1548, 1892, 2043
Sova ................................................................................................................. 1122
Sungale ........................................................................................................... 1074
Superscan ........................................................................................................ 0821
SVA ........................................................................................................ 0860, 1105
Sylvania ............................................................................. 0675, 0821, 1268, 2194
Symphonic ............................................................................................ 0675, 0821
Teac ................................................................................................................. 0790
Technics ................................................................................................. 0490, 0703
Terapin ............................................................................................................ 1031
Theta Digital ................................................................................................... 0571
Tivo .................................................................................................................. 1503
Toshiba .................. 0503, 0695, 1045, 1154, 1503, 1510, 1588, 1769, 1854, 2277
Tredex ................................................................................................... 0800, 0803
Urban Concepts .............................................................................................. 0503
US Logic .......................................................................................................... 0839
Venturer .......................................................................................................... 0790
Vizio ...................................................................................................... 1064, 1226
Vocopro........................................................................................................... 1360
Xbox ...................................................................................................... 0522, 2083
Yamaha ....................................................................................... 0490, 0539, 0545
Zenith ................................................................................ 0503, 0591, 0741, 0869
Zoece ............................................................................................................... 1265
TV-VCR-DVD Combos /
Combinés téléviseur -magnétoscope - lecteur DVD /
Combos de TV-VCR-DVD
Sharp ......................................................................................... 0807
Controlled by VCR / Contrôlé par VCR / Controlado por VCR
Akai ............................................................................................ 0899
Broksonic ................................................................................... 0868
Diamond Vision ......................................................................... 1609
Emerson ..................................................................................... 0821
ESA ............................................................................................. 0821
Funai .......................................................................................... 1334
Magnavox .................................................................................. 0821
Panasonic ......................................................................... 1362, 1462
Polaroid...................................................................................... 1482
RCA............................................................................................. 1132
Sharp .......................................................................................... 0630
Superscan ................................................................................... 0821
Sylvania ...................................................................................... 0821
Symphonic ................................................................................. 0821
Toshiba ....................................................................................... 1045
Controlled by DVD / Contrôlé par DVD / Controlado por DVD
Akai ............................................................................................ 1903
Broksonic ................................................................................... 1938
Diamond Vision ......................................................................... 1996
Emerson ..................................................................................... 1944
ESA ............................................................................................. 1944
Insignia....................................................................................... 2088
Magnavox .................................................................................. 1944
Panasonic ......................................................................... 1946, 1947
Polaroid...................................................................................... 1992
RCA............................................................................................. 1953
Sylvania ...................................................................................... 1944
Symphonic ................................................................................. 1944
Toshiba ....................................................................................... 1945
Controlled by TV / Contrôlé par TV / Controlado por TV
Accurian ................................................................................................ 0675, 1416
Apex Digital .................................................................................................... 1056
Aspire Digital .................................................................................................. 1168
Astar ................................................................................................................ 1489
Broksonic ........................................................................................................ 1419
Coby ................................................................................................................ 1086
CyberHome ........................................................................................... 1129, 1502
DigitalMax ...................................................................................................... 1738
Funai ..................................................................................................... 0675, 1334
Gateway ................................................................................................ 1073, 1158
Go Video ........................................................................... 0741, 1158, 1304, 1730
Humax ............................................................................................................. 1588
iLo.................................................................................................................... 1348
JVC......................................................................................................... 1164, 1275
LG .................................................................................................................... 0741
LiteOn ............................................................................... 1158, 1416, 1440, 1738
Magnavox ................................................................................... 0646, 0675, 1506
Panasonic ........................................................................................................ 0490
Philips .................................................................................................... 0646, 1340
Pioneer .................................................................................................. 0631, 1460
Polaroid........................................................................................................... 1086
Presidian ......................................................................................................... 1738
RCA.................................................................................................................. 0522
Samsung.......................................................................................................... 0490
Sanyo............................................................................................................... 0670
Sensory Science............................................................................................... 1158
Sharp ............................................................................................................... 0675
Sony......................................................................... 1033, 1070, 1431, 1432, 1433
Sylvania ........................................................................................................... 0675
Toshiba ........................................................................................ 1510, 1588, 2277
Zenith .............................................................................................................. 0741
DVD-R
TV/DVD Combos / Combinés téléviseur - lecteur DVD /
Combos de TV-DVD
Advent ......................................................................................... 1016
Akai .............................................................................................. 0695
Apex Digital ....................................................................... 0830, 1480
Audiovox............................................................................ 1121, 1122
Broksonic ..................................................................................... 0695
Citizen .......................................................................................... 0695
Diamond Vision ........................................................................... 1610
Emerson ............................................................................. 0675, 1268
ESA ............................................................................................... 1268
Funai ............................................................................................ 1268
GFM .............................................................................................. 1268
Hitachi .......................................................................................... 1247
iLo................................................................................................. 1472
Initial ............................................................................................ 1472
Insignia......................................................................................... 1268
Jensen .......................................................................................... 1016
KLH ............................................................................................... 1261
Konka ................................................................................. 0719, 0720
LG ................................................................................................. 1526
Magnavox .......................................................................... 1268, 1472
Mintek.......................................................................................... 1472
Panasonic ..................................................................................... 1490
Philips ................................................................................. 0854, 1260
Polaroid.............................................................................. 1261, 1480
Prima ............................................................................................ 1016
RCA..................................................................................... 1022, 1193
Samsung....................................................................................... 0899
Sansui ........................................................................................... 0695
Sova .............................................................................................. 1122
Sylvania .................................................................... 0675, 1268, 2194
Toshiba ......................................................................................... 0695
Controlled by DVD / Contrôlé par DVD / Controlado por DVD
Accurian ....................................................................................... 1803
Advent ......................................................................................... 1933
Akai .......................................................................... 1675, 1935, 2232
Apex Digital ....................................................................... 1943, 1991
Audiovox.................................................................. 1937, 1951, 1952
Axion ............................................................................................ 1937
Broksonic ..................................................................................... 1935
Cinego .......................................................................................... 1986
Citizen .......................................................................................... 1935
Diamond Vision ........................................................................... 1997
Dynex ................................................................................. 2049, 2184
Emerson ................................................................... 1864, 1394, 1963
ESA ............................................................................................... 1963
Funai ............................................................................................ 1963
GFM .............................................................................................. 1963
Hitachi .......................................................................................... 1960
iLo................................................................................................. 1990
Initial ............................................................................................ 1990
Insignia..................................................................... 1963, 2002, 2049
Jensen .......................................................................................... 1933
KLH ............................................................................................... 1962
LG ....................................................................................... 1423, 1993
Magnavox ................................................................ 1866, 1963, 1990
Mintek.......................................................................................... 1990
Panasonic ..................................................................................... 1941
Polaroid...................................... 1523, 1766, 1769, 1962, 1991, 2002
Prima ............................................................................................ 1933
Proscan ......................................................................................... 2256
RCA................................................................. 1948, 1958, 2002, 2187
Samsung....................................................................................... 1903
Sansui ........................................................................................... 1935
Sharp ............................................................................................ 0818
Sova .............................................................................................. 1952
Sylvania .......................................................... 1864, 1394, 1886, 1963
Toshiba ..................................................................... 1524, 1635, 1935
TruTech ......................................................................................... 2066
Controlled by TV / Contrôlé par TV / Controlado por TV
VCRs / Magnétoscopes
ABS ................................................................................................... 1972
Accurian ........................................................................................... 0000
Admiral ............................................................................................ 0209
Adventura ........................................................................................ 0000
Aiwa ................................................................................................. 0000
Alienware ........................................................................................ 1972
Asha ................................................................................................. 0240
Beaumark......................................................................................... 0240
Bell & Howell ................................................................................... 0104
Bell ExpressVu .................................................................................. 1944
Broksonic ....................................... 0184, 0121, 0209, 0002, 1479, 1815
CCE ................................................................................................... 0072
Citizen .............................................................................................. 1278
Colt ................................................................................................... 0072
Craig ............................................................................. 0047, 0240, 0072
Curtis Mathes............................................................... 0060, 0162, 1035
Cybernex .......................................................................................... 0240
CyberPower ..................................................................................... 1972
Daewoo............................................................................................ 1278
Dell ................................................................................................... 1972
Denon .............................................................................................. 0042
DirecTV................................................................................... 0739, 0740
Dish Network System ...................................................................... 1944
Dishpro............................................................................................. 1944
Durabrand ............................................................................. 0039, 0038
Dynatech .......................................................................................... 0000
Echostar ........................................................................................... 1944
Emerson .........0184, 0000, 0121, 0043, 0209, 0002, 0593, 1278, 1479, 1593
Expressvu ......................................................................................... 1944
Fisher ...................................................................................... 0047, 0104
Fuji.................................................................................................... 0033
Funai ............................................................................ 0000, 0593, 1593
Garrard............................................................................................. 0000
Gateway ........................................................................................... 1972
GE ............................................................. 0060, 0240, 0807, 1035, 1060
GFM .................................................................................................. 1593
Go Video ................................................................................ 0432, 0614
GOI ................................................................................................... 1944
GoldStar ................................................................................. 0038, 1237
Gradiente ......................................................................................... 0000
Harley Davidson .............................................................................. 0000
Harman/Kardon ............................................................................... 0038
Harwood .......................................................................................... 0072
Hewlett Packard .............................................................................. 1972
HI-Q .................................................................................................. 0047
Hitachi .......................................................................... 0000, 0042, 0089
Howard Computers ......................................................................... 1972
HP ..................................................................................................... 1972
HTS ................................................................................................... 1944
Hughes Network Systems ........................................... 0739, 0042, 0740
Humax .............................................................................................. 0739
Hush ................................................................................................. 1972
iBUYPOWER ..................................................................................... 1972
JVC................................................................................ 0067, 1707, 1944
Kenwood ............................................................................... 0067, 0038
KLH ................................................................................................... 0072
LG ..................................................................................................... 1037
Linksys .............................................................................................. 1972
Lloyd’s .............................................................................................. 0000
Logik ................................................................................................ 0072
Magnasonic ........................................................................... 0593, 1278
Magnavox ...................................... 0039, 0000, 0563, 0593, 1593, 1781
Magnin............................................................................................. 0240
Matsushita ............................................................................. 0162, 1162
Media Center PC.............................................................................. 1972
Memorex...........0162, 0039, 0047, 0240, 0000, 0104, 0209, 1037, 1162, 1237, 1262
MGA ....................................................................................... 0240, 0043
MGN Technology ............................................................................. 0240
Microsoft......................................................................................................... 1972
Mind ................................................................................................................ 1972
Minolta ........................................................................................................... 0042
Mitsubishi ................................................................................... 0067, 0043, 0807
MTC ....................................................................................................... 0240, 0000
Multitech .............................................................................................. 0000, 0072
NEC .............................................................................................. 0104, 0067, 0038
Niveus Media .................................................................................................. 1972
Noblex ............................................................................................................. 0240
Northgate ....................................................................................................... 1972
Optimus .................................... 1062, 0162, 0104, 0432, 0593, 1048, 1162, 1262
Orion ................................................................................. 0184, 0209, 0002, 1479
Panasonic .................................. 1062, 0162, 0225, 0614, 0616, 1035, 1162, 1262
Penney .................................................................... 0240, 0042, 0038, 1035, 1237
Pentax ............................................................................................................. 0042
Philips ................................................................................ 0739, 0618, 1081, 1181
Pioneer ............................................................................................................ 0067
Presidian ......................................................................................................... 1593
Profitronic ....................................................................................................... 0240
Proscan .................................................................................................. 0060, 1060
Protec .............................................................................................................. 0072
Pulsar............................................................................................................... 0039
Quasar ......................................................................................... 0162, 1035, 1162
RadioShack ........................................................................................... 0000, 1037
RCA...................................................... 0060, 0240, 0042, 0807, 0880, 1035, 1060
Realistic ....................................................................................... 0047, 0000, 0104
ReplayTV ............................................................................................... 0614, 0616
Ricavision ........................................................................................................ 1972
Runco .............................................................................................................. 0039
Samsung...................................................................................... 0739, 0240, 1014
Sanky ............................................................................................................... 0039
Sansui ................................................................................ 0000, 0067, 0209, 1479
Sanyo........................................................................................... 0047, 0240, 0104
Scott ............................................................................................ 0184, 0121, 0043
Sears ........................................................................ 0047, 0000, 0042, 0104, 1237
Sharp ..................................................................................................... 0807, 0848
Shintom........................................................................................................... 0072
Shogun ............................................................................................................ 0240
Singer .............................................................................................................. 0072
Sonic Blue ............................................................................................. 0614, 0616
Sony............................................................... 1232, 0033, 0000, 0636, 1032, 1972
Stack 9 ............................................................................................................. 1972
STS ................................................................................................................... 0042
Sylvania ................................................................... 0000, 0043, 0593, 1593, 1781
Symphonic .................................................................................. 0000, 0593, 1593
Systemax ......................................................................................................... 1972
Tagar Systems ................................................................................................. 1972
Teac ................................................................................................................. 0000
Technics ........................................................................................................... 0162
Teknika............................................................................................................ 0000
Thomas............................................................................................................ 0000
Tivo .......................................................................... 0739, 0618, 0636, 0740, 1996
TMK ................................................................................................................. 0240
Toshiba .......................................................... 0043, 0845, 1008, 1145, 1972, 1996
Totevision........................................................................................................ 0240
Touch............................................................................................................... 1972
Unitech............................................................................................................ 0240
Vector Research .............................................................................................. 0038
Videosonic ...................................................................................................... 0240
Viewsonic ........................................................................................................ 1972
Villain .............................................................................................................. 0000
Voodoo ........................................................................................................... 1972
Wards ............................................................ 0060, 0047, 0240, 0000, 0042, 0072
White Westinghouse ............................................................................ 0209, 0072
XR-1000 ................................................................................................. 0000, 0072
Yamaha ........................................................................................................... 0038
Zenith ............................................................ 0039, 0033, 0000, 0209, 1139, 1479
ZT Group ......................................................................................................... 1972
Broksonic ............................................................................ 0002, 1479
Citizen ........................................................................................... 1278
Colt ................................................................................................ 0072
Curtis Mathes................................................................................ 1035
Daewoo......................................................................................... 1278
Emerson .......................................................... 0002, 0593, 1278, 1479
Funai ............................................................................................. 0000
GE .................................................................... 0240, 0807, 1035, 1060
GoldStar ........................................................................................ 1237
Harley Davidson ........................................................................... 0000
Hitachi ........................................................................................... 0000
LG .................................................................................................. 1037
Lloyd’s ........................................................................................... 0000
Magnasonic ........................................................................ 0593, 1278
Magnavox ................................................................. 0000, 0593, 1781
Magnin.......................................................................................... 0240
Memorex............................................... 0162, 1037, 1162, 1237, 1262
MGA .............................................................................................. 0240
Mitsubishi ..................................................................................... 0807
Optimus .......................................................... 0162, 0593, 1162, 1262
Orion ................................................................................... 0002, 1479
Panasonic ........................................................ 0162, 1035, 1162, 1262
Penney ...................................................................... 0240, 1035, 1237
Quasar ....................................................................... 0162, 1035, 1162
RadioShack ......................................................................... 0000, 1037
RCA.................................................................. 0240, 0807, 1035, 1060
Samsung........................................................................................ 1014
Sansui .................................................................................. 0000, 1479
Sanyo............................................................................................. 0240
Sears .................................................................................... 0000, 1237
Sony..................................................................................... 1232, 0000
Sylvania ......................................................................................... 1781
Symphonic .......................................................................... 0000, 0593
Thomas.......................................................................................... 0000
Toshiba ................................................................................ 0845, 1145
Zenith .................................................................................. 0000, 1479
ABS ................................................................................................ 1972
Alienware ..................................................................................... 1972
Bell ExpressVu ............................................................................... 1944
CyberPower .................................................................................. 1972
Dell ................................................................................................ 1972
DirecTV................................................................................ 0739, 0740
Dish Network System ................................................................... 1944
Dishpro.......................................................................................... 1944
Echostar ........................................................................................ 1944
Expressvu ...................................................................................... 1944
Gateway ........................................................................................ 1972
Go Video ....................................................................................... 0614
GOI ................................................................................................ 1944
Hewlett Packard ........................................................................... 1972
Howard Computers ...................................................................... 1972
HP .................................................................................................. 1972
HTS ................................................................................................ 1944
Hughes Network Systems .................................................. 0739, 0740
Humax ........................................................................................... 0739
Hush .............................................................................................. 1972
iBUYPOWER .................................................................................. 1972
JVC................................................................................................. 1944
Linksys ........................................................................................... 1972
Media Center PC........................................................................... 1972
Microsoft....................................................................................... 1972
Mind .............................................................................................. 1972
Niveus Media ................................................................................ 1972
Northgate ..................................................................................... 1972
Panasonic ............................................................................ 0614, 0616
Philips .................................................................................. 0739, 0618
RCA................................................................................................ 0880
ReplayTV ............................................................................. 0614, 0616
Samsung........................................................................................ 0739
Sonic Blue ........................................................................... 0614, 0616
Sony..................................................................................... 0636, 1972
Stack 9 ........................................................................................... 1972
Systemax ....................................................................................... 1972
Tagar Systems ............................................................................... 1972
Tivo .................................................................. 0739, 0618, 0636, 0740
Toshiba ...................................................................... 1008, 1972, 1996
Touch............................................................................................. 1972
Viewsonic ...................................................................................... 1972
Voodoo ......................................................................................... 1972
ZT Group ....................................................................................... 1972
Access HD ...................................................................................... 2185
Airlink 101 .................................................................................... 2491
Alpha Digital ................................................................................ 2185
AMTC ............................................................................................ 2185
Apex Digital .................................................................................. 2478
Artec.............................................................................................. 2490
CASTi ............................................................................................. 2305
Channel Master ............................................................................ 2365
Coship ........................................................................................... 2487
Daewoo......................................................................................... 2338
Daytek ........................................................................................... 2305
Digital Stream............................................................................... 2303
Dish Network System ................................................................... 2470
Echostar ........................................................................................ 2470
Evolution....................................................................................... 2479
GE ........................................................................................ 2360, 2450
Goodmind ..................................................................................... 2450
Gridlink .............................................................................................................. 2348
Insignia............................................................................................................... 1415
Lasonic ............................................................................................................... 2348
Magnavox .......................................................................................................... 1563
Memorex............................................................................................................ 2486
MicroGEM .......................................................................................................... 2489
Philco.................................................................................................................. 1563
RCA........................................................................................................... 2325, 2454
Sansonic ............................................................................................................. 2348
Sylvania .............................................................................................................. 1563
Tivax ................................................................................................................... 2185
Ventura .............................................................................................................. 2454
Venturer ............................................................................................................. 2454
Winegard ........................................................................................................... 2454
Zenith ................................................................................................................. 1415
Zentech .............................................................................................................. 2491
Zinwell ............................................................................................................... 2488
America Action ............................................................................. 0180
Audiovox....................................................................................... 0180
Emerson ........................................................................................ 0236
Controlled by VCR / Contrôlé par VCR /
Controlado por VCR
DVRs
TV/VCR Combos / Combinés téléviseur
-magnétoscope / Combos de TV-VCR
DTV Converters /
Récepteurs TV numériques /
Convertidores Digitales
Controlled by TV / Contrôlé par TV /
Controlado por TV
ABS ................................................................................................ 1272
Access HD ...................................................................................... 2185
ADB ..................................................................................... 2254, 2586
Airlink 101 .................................................................................... 2491
Alienware ..................................................................................... 1272
Alpha Digital ................................................................................ 2185
Amino ................................................................................. 1481, 2482
AMTC ........................................................................................... 2185
Apex Digital .................................................................................. 2478
Artec.............................................................................................. 2490
AT&T.............................................................................................. 0858
CASTi ............................................................................................. 2305
Channel Master ............................................................................ 2365
Cisco .............................................................................................. 2345
Coship ........................................................................................... 2487
CyberPower .................................................................................. 1272
Daewoo......................................................................................... 2338
Daytek ........................................................................................... 2305
Digital Stream............................................................................... 2303
Dish Network System ................................................................... 2470
Echostar ........................................................................................ 2470
Entone........................................................................................... 2302
Epson............................................................................................. 1563
Evolution....................................................................................... 2479
Gateway ........................................................................................ 1272
GE ........................................................................................ 2360, 2450
Goodmind ..................................................................................... 2450
Gridlink ......................................................................................... 2348
Hewlett Packard ........................................................................... 1272
Howard Computers ...................................................................... 1272
HP .................................................................................................. 1272
Hush .............................................................................................. 1272
iBUYPOWER .................................................................................. 1272
Insignia.......................................................................................... 1415
KoolConnect ................................................................................. 1481
Lasonic .......................................................................................... 2348
LG .................................................................................................. 1415
Linksys ........................................................................................... 1272
Magnavox ..................................................................................... 1563
Media Center PC........................................................................... 1272
Memorex....................................................................................... 2486
MicroGEM ..................................................................................... 2489
Microsoft....................................................................................... 1272
Mind .............................................................................................. 1272
Motorola .................................................................. 1998, 0858, ,2378
Niveus Media ................................................................................ 1272
Northgate ..................................................................................... 1272
Philco............................................................................................. 1563
RCA...................................................................................... 2325, 2454
Ricavision ..................................................................................... 1272
Roku .............................................................................................. 2371
Sansonic ........................................................................................ 2348
Scientific Atlanta ................................................................ 0858, 2345
Sony..................................................................................... 1272, 1324
Stack 9 ........................................................................................... 1272
SureWest ....................................................................................... 1481
Sylvania ......................................................................................... 1563
Systemax ....................................................................................... 1272
Tagar Systems .............................................................................. 1272
Tivax .............................................................................................. 2185
Toshiba .......................................................................................... 1272
Touch............................................................................................. 1272
Accurian .......................................................................................1803
Action...........................................................................................0873
Admiral ..............................................................................0093, 0463
Advent .......................................0761, 0783, 0815, 0817, 0842, 1933
Aiko ..............................................................................................0092
Akai ....0812, 1675, 0702, 0030, 0672, 1207, 1676, 1903, 1935, 2078, 2232
Albatron.............................................................................0700, 0843
America Action ............................................................................0180
Ampro ..........................................................................................0751
Anam............................................................................................0180
AOC ................................................................0030, 1365, 1590, 2014
Aomni ..........................................................................................1623
Apex Digital ...........0748, 0879, 0765, 0767, 0890, 1217, 1943, 1991
Astar .............................................................................................1548
Audiovox...............0451, 0180, 0092, 0623, 0710, 0802, 0846, 0875,
........................................................................1284, 1937, 1951, 1952
Aventura ......................................................................................0171
Axion ............................................................................................1937
Bell & Howell ...............................................................................0154
BenQ ..................................................................................1032, 1315
Bradford.......................................................................................0180
Broksonic .......................................................0236, 0463, 1935, 1938
Byd:sign..............................................................................1309, 1311
Cadia ............................................................................................1283
Candle ..........................................................................................0030
Carnivale ......................................................................................0030
Carver ...........................................................................................0054
Celebrity.......................................................................................0000
Celera ...........................................................................................0765
Changhong ..................................................................................0765
Cinego ..........................................................................................1986
Citizen ............................................................0060, 0030, 0092, 1935
Clarion..........................................................................................0180
Coby .............................................................................................2017
Commercial Solutions .......................................................1447, 0047
Contec ..........................................................................................0180
Craig .............................................................................................0180
Crosley..........................................................................................0054
Crown...........................................................................................0180
Curtis Mathes........0047, 0054, 0154, 0451, 0093, 0060, 0702, 0030,
..............................................................0145, 0166, 0466, 1147, 1347
CXC ...............................................................................................0180
CyberHome ..................................................................................0794
Cytron ..........................................................................................1326
Ventura .........................................................................................................2454
Venturer ........................................................................................................2454
Verizon ..........................................................................................................2378
Viewsonic ......................................................................................................1272
Voodoo .........................................................................................................1272
Vudu ..............................................................................................................2298
Winegard ......................................................................................................2454
Zenith ............................................................................................................1415
Zentech .........................................................................................................2491
Zinwell ..........................................................................................................2488
ZT Group .......................................................................................................1272
TVs / Téléviseurs
Video Accessories / Accessoires de vidéo / Accessorios de vídeo
Daewoo........................................................... 0451, 0092, 1661, 0623, 0661, 0672
Dell ............................................................................ 1264, 1080, 1178, 1403, 1863
Denon ............................................................................................................... 0145
Diamond Vision ...................................................................................... 1996, 1997
Digital Lifestyles ............................................................................................... 1765
Dumont ............................................................................................................. 0017
Durabrand ................................................................ 0463, 0180, 0178, 0171, 1034
Dwin .................................................................................................................. 0720
Dynex ............................................................................................ 1463, 2049, 2184
Electroband ...................................................................................................... 0000
Electrograph ........................................................................................... 1755, 1623
Electrohome ..................................................................................................... 0463
Element ............................................................................................................. 1687
Emerson ........................... 1864, 0154, 0236, 0463, 0180, 0178, 0171, 0623, 1394,
....................................................................................................... 1665, 1944, 1963
Emprex .......................................................................................... 1422, 1546, 1765
Envision ............................................................................... 0030, 0813, 1365, 2014
Epson............................................................................................. 0833, 0840, 1290
ESA ...................................................................................... 0812, 0171, 1944, 1963
Fisher ................................................................................................................. 0154
FlexVision .......................................................................................................... 0710
Fujitsu.................................................................................. 0809, 0683, 0853, 2008
Funai ................................................................................... 0180, 0171, 1271, 1963
Futuretech ........................................................................................................ 0180
Gateway .................................................................... 1755, 1001, 1002, 1003, 1756
GE .................................................................... 1447, 0047, 0051, 0451, 0178, 1347
GFM ..................................................................................... 0171, 1665, 1963, 2167
Gibralter.................................................................................................. 0017, 0030
Go Video ........................................................................................................... 0886
GoldStar .................................................................................................. 0178, 0030
Grunpy .............................................................................................................. 0180
Haier.............................................................................................. 1034, 1748, 1749
Hallmark ........................................................................................................... 0178
Hannspree..................................................................................... 1348, 1351, 1352
Harman/Kardon ................................................................................................ 0054
Harsper.............................................................................................................. 1206
Harvard ............................................................................................................. 0180
Havermy ............................................................................................................ 0093
Helios ................................................................................................................ 0865
Hello Kitty ......................................................................................................... 0451
Hewlett Packard ....................................................... 1494, 1088, 1089, 1101, 1502
Hisense .............................................................................................................. 0748
Hitachi ....................................................................... 1643, 1145, 0145, 0797, 1960
HP .............................................................................. 1494, 1088, 1089, 1101, 1502
Hyundai......................................................................................... 0849, 1219, 1294
iLo.............................................................................. 1286, 1603, 1665, 1684, 1990
Infinity............................................................................................................... 0054
Initial ....................................................................................................... 1603, 1990
Insignia.............................. 1564, 0171, 1204, 1326, 1517, 1963, 2002, 2049, 2088
Inteq .................................................................................................................. 0017
iRIS..................................................................................................................... 2189
JBL ..................................................................................................................... 0054
JCB ..................................................................................................................... 0000
Jensen ....................................................................... 0761, 0815, 0817, 1299, 1933
JVC............................................................................. 0053, 0731, 1253, 1601, 1774
KDS .......................................................................................................... 1498, 1687
KEC .................................................................................................................... 0180
Kenwood .......................................................................................................... 0030
KLH ................................................................................................ 0765, 0767, 1962
Kost ......................................................................................................... 1262, 1483
KTV .......................................................................................................... 0180, 0030
LG ................................................ 1423, 0178, 0700, 0856, 1178, 1325, 1768, 1993
LXI ..................................................................................0047, 0054, 0154, 0156, 0178
MAG .............................................................................................................1498, 1687
Magnavox .......................................1454, 1866, 0054, 0030, 0706, 0802, 1198, 1254,
........................................................................................1365, 1525, 1944, 1963, 1990
Marantz .....................................................0054, 0030, 0704, 0854, 0855, 1154, 1398
Matsushita ...................................................................................................0250, 0650
Maxent .....................................................................................1755, 0762, 1211, 1757
Megapower ...........................................................................................................0700
Megatron .....................................................................................................0178, 0145
Memorex..................................................................................0154, 0463, 0150, 0178
MGA ...................................................................................................0150, 0178, 0030
Midland..............................................................................................0047, 0017, 0051
Mintek..........................................................................................................1603, 1990
Mitsubishi ..................................................1250, 0093, 0150, 0178, 0836, 0868, 1550
Monivision ...................................................................................................0700, 0843
Motorola ......................................................................................................0093, 0835
Moxell ....................................................................................................................0835
MTC ..............................................................................................................0060, 0030
Multitech ...............................................................................................................0180
NAD ..........................................................................................0156, 0178, 0866, 1156
NEC .................................................................................0030, 0497, 0882, 1398, 1704
NetTV ...........................................................................................................1755, 0762
Nexus Electronics ...................................................................................................2183
Nikko ..................................................................................................0178, 0030, 0092
Norcent ......................................................0748, 0824, 1089, 1365, 1589, 1590, 1591
Norwood Micro .................................................................................1286, 1296, 1303
NTC .........................................................................................................................0092
NuVision.......................................................................................................1657, 2158
Olevia .......................................................................................1610, 1144, 1240, 1331
Olympus .................................................................................................................1342
Onwa......................................................................................................................0180
Optimus ...................................................................................0250, 0154, 0166, 0650
Optoma ..................................................................................................................0887
Optonica ................................................................................................................0093
Orion ..................................................................................................0236, 0463, 1463
Panasonic .........................................0250, 1480, 0051, 0650, 1291, 1941, 1946, 1947
PARK.............................................................................................................2194, 2202
Penney .......................................................0047, 0156, 0051, 0060, 0178, 0030, 1347
Petters ....................................................................................................................1523
Philco............................................................................................................0054, 0030
Philips .........................................................1454, 0054, 0690, 1154, 1483, 1744, 1867
Pilot ........................................................................................................................0030
Pioneer .................................................................1457, 0166, 0679, 0866, 1260, 1398
Planar .....................................................................................................................1496
Polaroid...1523, 0765, 2121, 2120, 2119, 2002, 1992, 1991, 1962, 1769, 1767, 1766,
1687, 1498, 1341, 1328, 1327, 1326, 1316, 1314, 1286, 1276, 1262, 0865
Portland .................................................................................................................0092
Prima ..............................................................................0761, 0783, 0815, 0817, 1933
Princeton................................................................................................................0700
Prism.......................................................................................................................0051
Proscan ...........................................................................1447, 0047, 1347, 2147, 2256
Proton ..........................................................................................................0178, 0466
Protron .........................................................................................................1320, 1323
Proview ..............................................................................................0835, 1498, 1687
Pulsar......................................................................................................................0017
Puneet ....................................................................................................................1546
Quasar ................................................................................................0250, 0051, 0650
RadioShack ....................................................................0047, 0154, 0180, 0178, 0030
RCA ..................................1547, 1447, 0047, 0090, 0679, 1047, 1147, 1247, 1347, 1781, 1948,
........................................................................................1953, 1958, 2002, 2187, 2247
Realistic ....................................................................................0154, 0180, 0178, 0030
RevolutionHD ........................................................................................................1623
Runco ...................................................................0017, 0030, 0497, 0603, 1398, 1629
Sampo ................................................................................................1755, 0030, 0762
Samsung .....................................0812, 0060, 0702, 0178, 0030, 0766, 0814, 1060, 1575, 1903
Sansui .................................................................................................0463, 1409, 1935
Sanyo..............................................................................0154, 0088, 0799, 0893, 1142
Sceptre .....................................................................................0878, 1217, 1360, 1599
Scotch .....................................................................................................................0178
Scott .........................................................................................0236, 0180, 0178, 1711
Sears .....................................................................0047, 0054, 0154, 0156, 0178, 0171
Sharp ..........................................................0818, 0093, 0491, 0688, 0689, 0851, 1602
Sheng Chia .............................................................................................................0093
Sherwood...............................................................................................................1399
Signet .....................................................................................................................1262
SIM2 Multimedia ...................................................................................................1297
Sole...............................................................................................................1483, 1623
Sony................................................................................0000, 0810, 0834, 1317, 1685
Soundesign ..................................................................................................0180, 0178
Sova ..............................................................................................................1320, 1952
Soyo..............................................................................................................1546, 1826
Spectroniq....................................................................................................1498, 1687
Squareview ............................................................................................................0171
SSS ..........................................................................................................................0180
Starlite....................................................................................................................0180
Studio Experience..................................................................................................0843
Superscan .....................................................................................................0093, 0864
Supreme .................................................................................................................0000
SVA ...........................................................................................0748, 0865, 0870, 0872
Sylvania ..............1864, 0054, 0030, 0171, 1271, 1314, 1394, 1665, 1886, 1944, 1963
Symphonic .........................................................................................0180, 0171, 1944
Syntax.......................................................................................1610, 1144, 1240, 1331
Tandy......................................................................................................................0093
Tatung ........................................................1101, 1285, 1286, 1287, 1288, 1361, 1756
Technics ........................................................................................................0250, 0051
Techview ................................................................................................................0847
Techwood ..............................................................................................................0051
Teknika...........................................................................0054, 0180, 0150, 0060, 0092
Telefunken .............................................................................................................0702
TMK ........................................................................................................................0178
TNCi ........................................................................................................................0017
Toshiba ....1524, 0154, 0156, 1256, 0060, 1945, 1935, 1704, 1656, 1635, 1356, 1343,
1325, 1306, 1156, 0845, 0832, 0650
TruTech .........................................................................................................1723, 2066
TVS .........................................................................................................................0463
Ultra .......................................................................................................................1323
US Logic .......................................................................................................1286, 1303
Vector Research .....................................................................................................0030
Victor......................................................................................................................0053
Vidikron .............................................................................................0054, 1398, 1629
Vidtech ...................................................................................................................0178
Viewsonic ..................................................1755, 0797, 0857, 0864, 0885, 1330, 1342,
........................................................................................1578, 1627, 1742, 2014, 2087
Viore.............................................................................................................1207, 1684
Visart ......................................................................................................................1336
Vizio ...............................................................................1758, 0864, 0885, 1499, 1756
Wards .............................................................................0054, 0178, 0030, 0866, 1156
Waycon ..................................................................................................................0156
Westinghouse ......................................................1712, 0885, 0889, 0890, 1282, 1577
White Westinghouse ...................................................................................0463, 0623
Wyse .......................................................................................................................1365
Yamaha ..........................................................................0030, 0769, 0797, 0833, 0839
Zenith .......................................................................................0017, 0463, 0178, 0092
Accurian .......................................................................................................... 1803
Action.............................................................................................................. 0873
Akai ................................................................................... 1675, 1676, 1935, 2232
AOC ....................................................................................................... 1365, 2014
Aomni ............................................................................................................. 1623
Apex Digital .......................................................................................... 0890, 1217
Astar ................................................................................................................ 1548
Audiovox......................... 0180, 0710, 0802, 0846, 0875, 1284, 1937, 1951, 1952
BenQ ............................................................................................................... 1315
Byd:sign................................................................................................. 1309, 1311
Cadia ............................................................................................................... 1283
Citizen ............................................................................................................. 1935
Coby ................................................................................................................ 2017
CyberHome ..................................................................................................... 0794
Dell .................................................................................... 1264, 1080, 1178, 1863
Digital Lifestyles ............................................................................................. 1765
Dynex .................................................................................................... 2049, 2184
Element ........................................................................................................... 1687
Emerson ...................................................................................... 1864, 1394, 1963
Emprex ........................................................................................ 1422, 1546, 1765
Envision ....................................................................................... 0813, 1365, 2014
FlexVision ........................................................................................................ 0710
Funai ............................................................................................................... 0171
GFM ................................................................................................................. 2167
Go Video ......................................................................................................... 0886
Haier...................................................................................................... 1748, 1749
Hannspree............................................................................................. 1348, 1351
Harsper............................................................................................................ 1206
Hewlett Packard ............................................................................................. 1088
Hitachi ............................................................................................................. 1643
HP .................................................................................................................... 1088
Hyundai....................................................................................... 0849, 1219, 1294
iLo...................................................................................... 1286, 1603, 1684, 1990
Initial ..................................................................................................... 1603, 1990
LCD / ACL
Advent ............................................................................................................ 0842
Hitachi ............................................................................................................. 1960
Marantz .......................................................................................................... 0854
Mitsubishi ....................................................................................................... 0150
Olevia .............................................................................................................. 1610
Panasonic .................................................................................... 0250, 0650, 1291
Pioneer ............................................................................................................ 0679
RCA.................................................................................................................. 1447
Samsung................................................................................................ 0812, 0702
Sharp ..................................................................................................... 0688, 0689
Toshiba ............................................................................................................ 1256
HDTV
Hewlett Packard ............................................................................................. 1494
HP .................................................................................................................... 1494
Magnavox ....................................................................................................... 1525
Mitsubishi ....................................................................................................... 1250
Optoma ........................................................................................................... 0887
Panasonic ........................................................................................................ 1291
RCA.................................................................................................................. 1447
Samsung................................................................................................ 0812, 1060
SIM2 Multimedia ............................................................................................ 1297
SVA .................................................................................................................. 0872
Toshiba .................................................................................................. 1524, 1306
Vizio ................................................................................................................ 1499
DLP
Insignia.................................................................... 1564, 1204, 1517, 2002, 2049
iRIS................................................................................................................... 2189
Jensen ............................................................................................................. 1299
JVC......................................................................................................... 1601, 1774
Kost ................................................................................................................. 1262
LG ............................................................................ 1423, 0856, 1178, 1768, 1993
Magnavox ............................................................... 1866, 0802, 1198, 1365, 1990
Marantz .......................................................................................................... 0855
Maxent .............................................................................. 1755, 0762, 1211, 1757
Mintek................................................................................................... 1603, 1990
Mitsubishi ....................................................................................................... 1250
NetTV .............................................................................................................. 0762
Nexus Electronics ............................................................................................ 2183
Norcent ....................................................................................... 1365, 1589, 1591
Norwood Micro .................................................................................... 1286, 1296
NuVision................................................................................................ 1657, 2158
Olevia ................................................................................ 1610, 1144, 1240, 1331
Panasonic .................................................................................... 1480, 0650, 1941
PARK...................................................................................................... 2194, 2202
Petters ............................................................................................................. 1523
Philips ................................................................................ 1454, 1483, 1744, 1867
Pioneer ............................................................................................................ 1260
Planar .............................................................................................................. 1496
Polaroid.......................... 1523, 1262, 1276, 1316, 1341, 1498, 1687, 1766, 1767,
........................................................................................... 1769, 2119, 2120, 2121
Proscan .................................................................................................. 2147, 2256
Protron .................................................................................................. 1320, 1323
Puneet ............................................................................................................. 1546
RCA.......................................................................... 0047, 1781, 1958, 2187, 2247
RevolutionHD ................................................................................................. 1623
Runco .............................................................................................................. 1629
Sampo ................................................................................................... 1755, 0762
Samsung............................................................................ 0812, 0766, 0814, 1575
Sansui .............................................................................................................. 1409
Sanyo............................................................................................................... 1142
Sceptre .............................................................................. 0878, 1217, 1360, 1599
Scott ................................................................................................................ 1711
Sharp ........................................................................................... 0818, 0093, 1602
Sherwood........................................................................................................ 1399
Signet .............................................................................................................. 1262
Sole........................................................................................................ 1483, 1623
Sony....................................................................................................... 0810, 1685
Sova ................................................................................................................. 1320
Soyo....................................................................................................... 1546, 1826
Superscan ........................................................................................................ 0864
SVA .................................................................................................................. 0870
Sylvania ......................................................... 1864, 0171, 1271, 1314, 1394, 1886
Symphonic ...................................................................................................... 0171
Syntax................................................................................ 1610, 1144, 1240, 1331
Tatung ............................................................................................................. 1286
Techview ......................................................................................................... 0847
Toshiba .................................................................... 1524, 0845, 1343, 1635, 1656
TruTech ............................................................................................................ 1723
Ultra ................................................................................................................ 1323
US Logic .......................................................................................................... 1286
Vidikron ................................................................................................ 1398, 1629
Viewsonic ........................ 0857, 0864, 0885, 1330, 1578, 1627, 1742, 2014, 2087
Viore................................................................................................................ 1684
Visart ............................................................................................................... 1336
Vizio .................................................................................. 1758, 0864, 0885, 1756
Westinghouse ............................................... 1712, 0885, 0889, 0890, 1282, 1577
Wyse ................................................................................................................ 1365
Trademark(s) ® Registered
Marque(s) de commerce déposée(s)® Marca(s) Registrada(s)
SuperAtlas Codes 00
Akai ................................................................................... 0812, 1675, 1207, 2078
Albatron.......................................................................................................... 0843
AOC ................................................................................................................. 1590
Aomni ............................................................................................................. 1623
BenQ ............................................................................................................... 1032
Byd:sign........................................................................................................... 1311
Daewoo........................................................................................................... 0661
Dell ........................................................................................................ 1264, 1863
Electrograph ......................................................................................... 1755, 1623
ESA .................................................................................................................. 0812
Fujitsu................................................................................ 0809, 0683, 0853, 2008
Funai ............................................................................................................... 1271
Gateway .................................................................. 1755, 1001, 1002, 1003, 1756
Haier................................................................................................................ 1748
Harsper............................................................................................................ 1206
Helios .............................................................................................................. 0865
Hewlett Packard ................................................................................... 1089, 1502
Hitachi ................................................................................................... 1643, 0797
HP .......................................................................................................... 1089, 1502
iLo.................................................................................................................... 1684
Insignia............................................................................................................ 1564
JVC................................................................................................................... 0731
LG ................................................................................................ 1423, 0178, 0856
Magnavox ....................................................................................................... 1866
Marantz ................................................................................................ 0704, 1398
Maxent .................................................................................................. 1755, 1757
Mitsubishi ....................................................................................................... 0836
Monivision ...................................................................................................... 0843
Motorola ......................................................................................................... 0835
Moxell ............................................................................................................. 0835
NEC ........................................................................................................ 1398, 1704
NetTV .............................................................................................................. 1755
Nexus Electronics ............................................................................................ 2183
Norcent ....................................................................................... 0824, 1089, 1590
Norwood Micro .............................................................................................. 1303
Panasonic .................................................................................... 0250, 1480, 0650
Philips .................................................................................................... 0690, 1744
Pioneer .............................................................................. 1457, 0679, 1260, 1398
Polaroid............................................................................. 0865, 1276, 1327, 1328
Proview ........................................................................................................... 0835
Puneet ............................................................................................................. 1546
RevolutionHD ................................................................................................. 1623
Runco .............................................................................................................. 1398
Sampo ............................................................................................................. 1755
Samsung.......................................................................................................... 0812
Sanyo............................................................................................................... 1142
Sole.................................................................................................................. 1623
Sony............................................................................................. 0000, 0810, 1317
Studio Experience........................................................................................... 0843
SVA .................................................................................................................. 0865
Sylvania ................................................................................................. 1271, 1394
Tatung ..................................................................... 1101, 1285, 1287, 1288, 1756
Toshiba .................................................................................................. 0650, 1704
US Logic .......................................................................................................... 1303
Viewsonic .............................................................................................. 1755, 0797
Viore...................................................................................................... 1207, 1684
Vizio ...................................................................................................... 1758, 1756
Yamaha ........................................................................................................... 0797
Zenith .............................................................................................................. 0178
Plasma