USER MANUAL
Downloaded From Microwave-Manual.com Manuals
EMM20017
Downloaded From Microwave-Manual.com Manuals
t
EMM2015
Contents
Before using your microwave oven
4
Technical data
4
Safety instructions
– Testing suitability of cookware
– Food safety
5
5
6
Safety Instructions when cooking by Grill
7
Installation
– Connecting to the mains
8
8
Oven utensils and accessories guide
9
– Unpacking
9
How to operate your microwave oven
– Name and function of parts
– Turntable Installation
– Control panel
– Microwave Cooking
– Microwave Power Setting Guide
– Cooking with Grill
– Cooking with Microwave and Grill
– Recommendations for Cooking with Grill
– Recommendations for Cooking with Microwave and Grill
– Microwave and Grill Power Levels
(180W)
– Defrosting instructions using
– Microwave Hints
– Care and cleaning
– Cleaning the accessories (turntable and support)
– Cleaning the interior
– Cleaning the exterior
– Care and Cleaning (Grill)
10
10
10
11
12
12
13
13
14
14
14
15
16
17
17
17
17
17
Guarantee conditions
18
3
Downloaded From Microwave-Manual.com Manuals
English
t
EMM2015
English
Congratulations on the purchase of your new Microwave Oven
Thank you for having chosen a Electrolux product. We are convinced that you will find your new microwave
oven very useful and that it will be of great help to you. As with all new kitchen appliances, it will take some
time to learn all the new functions and features, but with time, this oven will become indispensable to you.
Before using your Microwave Oven
Read through the instruction manual carefully and ensure that you follow the recommendations given, these
instructions have been prepared so that you get the best from your new Electrolux Microwave Oven.
It is important that this instruction book is retained with the appliance for future reference. Should the appliance
be sold or transferred to another owner, or if you move house and leave the appliance, always ensure that the
book is supplied with the appliance so that the new owner can be acquainted with the functioning of the
appliance and the relevant warnings.
Technical data
Overall dimension
Width 484 mm
Depth 376 mm
Height 285 mm
Cavity dimension
Width 300 mm
Depth 292 mm
Height 195 mm
Weight 13.5 kg
Volume 20 Litre
Power source 230V, 50 Hz
Power consumption
Microwave 1300W
Grill 1000W
Power output
Microwave 800W
Grill 1000W
4
Downloaded From Microwave-Manual.com Manuals
t
EMM2015
English
Important Safety instructions.
READ CAREFULLY AND KEEP FOR FUTURE REFERENCE
•
The built-in safety interlock switches prevent the
microwave oven from operating when the door is
open.
•
Do not tamper with them, or attempt to operate
the oven with the door open as open door
operation can result in exposure to microwave
energy.
•
•
Do not allow food spills or cleaner residue to
accumulate on door sealing surfaces. See the
Cleaning and Care section for cleaning
instructions.
It is particularly important that the oven door
closes properly and that there is no damage to
the: (1) door (warped), (2) hinges and latches
(broken or insecure), (3) door seals and sealing
surface.
 WARNING : If the door,
•
Do not store this appliance outdoors. Do not use
this product near water.
•
Do not attempt to dry clothing or newspapers in
the microwave oven. These items can ignite.
•
Do not use the cavity for storage purposes. Do
not leave paper products, cooking utensils, or
food in the cavity when not in use.
•
The temperature of accessible surfaces may be
high when the appliance is operating.
 WARNING : If smoke is observed,
switch off or unplug the appliance and
keep the door closed in order to stifle any
flames. Never use water.
 WARNING : Only allow children or
infirm persons to use the microwave,
without supervision, when adequate
instructions have been given so that the
child or infirm person is able to use the
microwave in a safe way and understand
the hazards of improper use.
hinges/latches or door seals are damaged,
the microwave must not be operated until
it has been repaired by a authorized
service person.
 WARNING : It is hazardous for
anyone except factory trained service
personnel to service or make adjustments
to this oven. Contact your nearest
authorised service agent if service should
be required.
•
Do not remove the outer case, door or control
panel at any time. Doing so may cause exposure
to extremely high voltage.
•
Install or locate this oven only in accordance with
‘installation instructions’ found in this manual.
•
•
Use the appliance for its intended use as
described in this manual. Do not use corrosive
chemicals in this appliance. This type of oven is
specifically designed to heat, cook, or defrost
food. It is not designed for industrial or laboratory
use neither for commercial use as this will
invalidate the guarantee.
Utensil safety
•
Only use utensils that are suitable for use in a
microwave oven.
•
Most glass, glass ceramic and heat-resistant
glass-ware utensils are excellent for use in the
micro-wave oven. Although microwave energy will
not heat most glass and ceramic items, these
utensils can become hot as heat transfers from
the food to the container. The use of oven gloves
to remove dishes is recommended.
Testing suitability of cookware
•
Utensils should be checked to ensure they are
suitable for use in Microwave Ovens.
•
Place the cookware in the microwave along with a
glass half full of water. Heat on (900W) (100%) for
one minute. If the cookware feels hot, you should
not use it. If it is just slightly warm, you can use it
for reheating but not for cooking. If the dish is
room temperature, it is suitable for microwave
cooking.
Do not operate the oven empty. If food or water is
not present to absorb the microwave energy, the
magnetron tube can be damaged.
5
Downloaded From Microwave-Manual.com Manuals
t
EMM2015
•
•
•
•
Paper napkins, wax paper, paper towels, plates,
cups, cartons, freezer wrap and cardboard are
great convenience utensils. Always be sure
containers are filled with food to absorb energy
and thus avoid the possibility of overheating or
ignition.
Many plastic dishes, cups, freezer containers and
plastic wraps may be used in the microwave
oven. Follow manufacturer’s instructions when
using plastics in the oven. Avoid using plastic
utensils with foods that have high fat or sugar
content since these foods reach high
temperatures and could melt some plastics.
Do not leave oven unattended, and look at it from
time to time when heating or cooking food in
plastic, paper or other combustible containers.
Metal utensils and utensils with metallic trim
should not be used in the microwave oven, unless
specifically recommended for microwave use.
•
Containers with restricted openings, such as
bottles, should not be used for microwave
cooking.
•
Use caution when removing a lid or cover from a
dish to avoid steam burns.
7. The container and turntable may become hot
during use, take great care when removing either
from the oven. It is advisable to use an oven cloth
or glove when doing so.
8. Remember when using an aluminium foil
container that the reheating or cooking times may
be longer than you are used to, always ensure
that the food is piping hot before serving.
Food safety
•
Do not heat food in a can in the microwave oven.
Always remove the food to a suitable container.
•
Deep fat frying should not be done in the
microwave oven, because the fat temperature
cannot be controlled, hazardous situations can
result.
•
Popcorn may be prepared in the microwave oven,
but only in special packages or utensils designed
specifically for this purpose. This cooking
operation should never be unattended.
•
Pierce foods with non-porous skins or
membranes to prevent steam build-up and
bursting. Apples, potatoes, chicken livers, and
egg yolks are examples of items that should be
pierced.
•
The contents of feeding bottles and baby food jars
are to be stirred or shaken and the temperature is
to be checked before consumption, in order to
avoid burns.
Foil containers
Shallow foil containers may safely be used to reheat
foods in your microwave oven providing the following
rules are observed:
1. Foil containers should not be more than 3 cms
(1 1/4”) deep.
 WARNING : Liquids or other foods
must not be heated in sealed containers
since they are liable to explode.
2. Foil lids must not be used.
3. The foil containers must be at least two-thirds full
of food. Empty containers must never be used.
4. Foil containers should be used singly in the
microwave oven and should not be allowed to
touch the sides. If your oven has a metal turntable
or cooking rack, the foil container should be
placed on an upturned oven-proof plate.
English
 WARNING : Microwave heating of
beverages can result in delayed eruptive
boiling, therefore care must be taken when
handling the container.
 WARNING : When heating liquids,
5. Foil containers should never be re-used in the
microwave oven.
6. If the microwave oven has been in use for 15
minutes or more, allow it to cool before using it
again.
6
Downloaded From Microwave-Manual.com Manuals
e.g. soups, sauces and beverages in your
microwave oven, overheating the liquid
beyond boiling point can occur without
evidence of bubbling. This could result in a
sudden boil over of the hot liquid. To
prevent this possibility the following steps
should be taken:
t
EMM2015
1. Avoid using straight-sided containers with narrow
necks.
2. Do not overheat.
3. Stir the liquid before placing the container in the
oven and again halfway through the heating time.
4. After heating, allow to stand in the oven for a
short time, stirring again before carefully removing
the container.
 WARNING : Some products such as
whole eggs and sealed containers – for
example, closed glass jars – may explode
and should not be heated in this oven.
Occasionally, poached eggs may explode
during cooking. Always pierce the yolk,
then cover and allow the standing time of
one minute before removing cover.

It is quite normal for steam to be emitted
around the door, or for misting to occur on the
door, or even for water droplets to appear
below the door during the cooking cycle. This
is merely condensation from the heat of the
food and does not affect the safety of your
oven. The door is not intended to seal
the oven cavity completely.
•
Do not force the turntable to rotate by hand. This
may cause malfunctioning.
•
Arcing in the oven during microwave operation
usually occurs from use of metallic utensils.
Continuous arcing, however, can damage the
unit. Stop the programme and check the utensil.
•
Care should be taken not to obstruct any air vents
located on the top, rear, side and bottom of the
oven.
English
Safety instructions when
cooking with grill, combination modes.
1. The glass viewing window may break if water is
spilled on it during grill cooking.
2. Be sure to use an oven glove when loading and
unloading the oven. Containers get very hot in the
oven, so be careful not to burn yourself. The turntable and metal rack also get very hot so be sure
to use an oven glove when handling them.
3. Do not touch the inner or outer viewing window
with metal components when loading or unloading
the oven. The inside of the door and oven get
very hot so take care when attending food in the
oven.
4. Do not put the turntable or containers in cold
water or try to cool them quickly after use.
5. Do not place items on top of the cabinet. The top
of the cabinet gets very hot, so anything placed
on it may be damaged by the heat.
6. Preheat your oven only when using the Grill,
never when using microwave or combination
modes (Microwave and Grill)

Warning : When the appliance is
used in combination mode, Children
should only use the oven under adult
supervision due to the temperature
generated.
Keep these instructions!
m WARNING : Do not use this oven for
commercial purposes.This oven is made
for domestic use only.
7
Downloaded From Microwave-Manual.com Manuals
t
EMM2015
English
Installation.
1. Remove any promotion label from the door.
Connecting to the mains
2. The oven should be installed on a flat, level
surface. The surface must be strong enough to
safely bear the weight (17 kg) of the oven, and
the contents. To avoid the possibility of causing
vibration or noise the oven must be in a stable
position.
The oven is delivered with the power cord and a plug
for 230V, 50Hz, earthed socket outlet.
Earth protection minimises the risks should a short
circuit occur. Check to ensure the voltage of the oven
matches the supply.
N.B. If the oven is connected to the socket via an
extension cord, make sure the cord is earthed.
3. Keep the oven away from heat and water.
Exposure to heat and water can lower oven
efficiency and lead to malfunctioning, so be sure to
install the oven away from heat and water sources.

4. Do not block air vents on the top and the sides of
the cabinet and also do not place any articles on
the top of the oven. If air vents are blocked during
operation, the oven may overheat, and this may
lead to malfunctioning. Hot air escapes from the
vents, so be sure not to obstruct it or let curtains
come between the oven and the rear wall.

5. Place the oven as far away from radios and TV’s
as possible. This oven does conform to EEC
requirements of radio interference suppression, but
some interference may occur if it is placed too
close to a radio or TV, so keep them as far apart
as possible.

6. If positioned in a corner, leave a gap of at least
15 cm from the walls and 15 cm above the
microwave.
IMPORTANT! The oven can be placed almost
anywhere in the kitchen. Make sure the oven is
placed on a flat, level surface and that vents as
well as the surface underneath the oven are not
blocked (for sufficient ventilation).
8
Downloaded From Microwave-Manual.com Manuals
This appliance must not be used on a nonearth protected power supply. Contact an
electrician if you are uncertain regarding
electrical connection of the oven or
provision of earth protection of the
supply.
This appliance must be earthed. If this
appliance is fitted with a non-rewireable
plug for which your socket is unsuitable, it
must be replaced by the manufacturer, its
service agent or similarly qualified persons
in order to avoid a hazard.
If the supply cord is damaged, it must be
replaced by the manufacturer, its service
agent or similarly qualified persons in
order to avoid a hazard.
t
EMM2015
English
Oven utensils and accessories guide
A variety of Utensils and Materials may be used for cooking in your microwave oven. For your safety and to
prevent damaging utensils and your oven choose appropriate utensils and materials for each cooking method.
The list below is a general guide.
Material
Ceramic &
Glass
China
Utensils
Corning ware
Heat resistant glass
ware
Glass ware with metal
decoration
Lead crystal glass
Without metal
decoration
Microwave
YES
Mode of operation
Grill
YES
Combination
YES
YES*1
YES
YES*1
NO
NO
NO
Pottery*2
Plastic
Metal
Paper
Microwave oven
heat-proof wear
Plastic wrap
Baking pan
Aluminium foil*3
Cups, plates, towels
Waxed paper
Wood
Accessories
Grill rack
Turntable
Turntable support
YES: Utensils and accessories to use
NO
NO
NO
YES
YES
NO
YES
YES
YES
YES
NO
NO
YES
NO
YES
YES
YES
NO
NO
YES
YES
NO
YES
YES
NO
NO
NO
YES
YES
YES
NO
NO
YES
NO
NO
NO
YES
YES
YES
NO: Utensils and accessories to avoid
*1 Only if there is no metal trim.
*2 Only if it does not have a glaze containing metal.
*3 NOTE: Use aluminium foil only for shielding purposes, over use may cause arcing.
Unpacking
N.B. When you unpack the oven, check that the product is free from damage. Damage or any missing parts must be
reported immediately to the retailer. The oven, parts of the oven or the accessories may be wrapped by a protection foil. If
so, you must remove this foil before using the oven. Do not leave packing material so that small children can play with it.
This can be hazardous.
9
Downloaded From Microwave-Manual.com Manuals
t
EMM2015
English
How to operate your microwave oven
1
2
3
9
5
8
6
4
4
7
10
Name and function of parts
1. Cooking compartment. Wipe the compartment
clean after using the oven.
2. Viewing window. Food can be checked while the
microwave oven is in operation.
3. Oven door. The door must always be firmly
closed while cooking.
4. Latch hook and safety interlock system.
5. Control panel.
6. Drive shaft for turntable
7. Turntable. Made of special heat-resistant glass.
Food in a suitable container is placed on this tray
for cooking. Do not use the oven without the
turntable.
8. Turntable support. Place the support on the floor
of the cooking chamber to support the turntable.
9. Grill.
10. Grill Rack.
Turntable Installation
1. Place the turntable support on the cavity Bottom.
2. Place the turntable on top of the turntable support
as shown in the diagram. Make sure that turntable
hub is securely locked in the turntable shaft. Never
place the turntable upside down.
• Both turntable and turntable support must always
be used during cooking.
• All food and containers of food are always placed
on this turntable for cooking.
• This turntable rotates clockwise and
anticlockwise; this is normal.
Turntable
Roller rest
Turntable Shaft
10
Downloaded From Microwave-Manual.com Manuals
EMM2015
t
English
CONTROL PANEL
1. Power Selector
Adjust this knob to select the correct power
level for your food.
2. Timer
Set for desired cooking time. Cooking
will start. All clockwork timers will operate
more accurately if wound past the desired
time first, and then back.
11
Downloaded From Microwave-Manual.com Manuals
t
EMM2015
English
MICROWAVE COOKING
1. Open the door, place the food on the turntable.
Close the door.
2. Set the Power Selector to the desired power
level.(See table below.)
3. Set the Timer to the desired time.
The oven begins cooking.
When cooking for less than 2 minutes, turn the timer
for a longer period and than return to the desired
time.
To turn off the oven during cooking, simply turn the
Timer to 0.
Note: After use, be sure to return the Timer to 0,
or the oven will continue to operate.
Example: To cook at 450W for 20 minutes
1. Turn the power selector to 450W.
2. Turn the timer to 20
3. The Oven will automatically start cooking for 15 minutes at 450W
Re-heating cook-chilled foods
•
•
•
The food manufacturer’s cooking time should be used as a guide only. If, when stated cooking time has
expired, the food isn’t piping hot, return it to the oven and cook it until it is. In much the same manner as
you would when cooking with a conventional oven.
Always stir food regularly, particularly sauces and casseroles.
Standing time is very important, it is part of the cooking process and also allows an even temperature
throughout the food.
Microwave Power setting Guide
Power Setting
100W
(180W)
300W
450W
600W
800W
Suggested use
Keeping warm; Keeping foods warm
Defrost; Thawing frozen foods.
Simmer; Completing the cooking cycle of some pot roasts.
Casseroles and stews.
Baked custards or cheesecakes.
Medium; Faster defrosting and reheating for casseroles and
stews.
Medium; Baking cakes and sponge puddings
Reheat; Reheating pre-cooked foods.
Roasting joints of meat and poultry.
Boiling or reheating liquids.
Cooking vegetables.
Preheating a browning dish.
12
Downloaded From Microwave-Manual.com Manuals
t
EMM2015
English
Cooking with Grill
Place the turntable on top of the roller rest on
the base of the cavity and position food on the
metal rack. This method is ideal for grilling
meat such as steak, chops etc. Remember the
oven will be hot.
1. Set the Power Selector to the Grill setting.
2. Set cooking time by turning the Timer to the
desired time. The microwave starts automatically.
Note: After use, be sure to return the Timer
to 0, or the oven will continue to operate.
Note: You may detect smoke or a burning smell
when using your grill for the first time, this is
normal and not a sign that the oven is out order.
To avoid this problem, when using your grill for
the first time, heat the oven without any food for
10 minutes on grill.
Example: To cook using Grill for 40 minutes
1. Turn the power selector to
(Grill).
2. Turn the timer to 40
3. The Oven will automatically start cooking for 15 minutes at
(Grill).
Cooking with Microwave and Grill
Place the turntable on top of the roller rest on
the base of the cavity and position food on the
metal rack. This method is ideal for grilling
meat such as steak, chops etc. Remember the
oven will be hot.
1. Set the Power Selector to the desired Microwave
Power and Grill level.
2. Set cooking time by turning the Timer to the
desired time. The microwave starts automatically.
Note: After use, be sure to return the Timer
to 0, or the oven will continue to operate.
Example: To cook at 450W and Grill for 30 minutes
1. Turn the power selector to
(Combi 2).
2. Turn the timer to 30
3. The Oven will automatically start cooking for 15 minutes at
(Combi 2).
NOTE:
If you open the door during cooking, the oven switches off. To resume cooking, close the door.
At the end of the cooking cycle the grill and microwave switches off and a bell sounds.
In microwave and grill mode, power selection and cooking time can be changed whilst the microwave is
operating.
13
Downloaded From Microwave-Manual.com Manuals
t
EMM2015
English
Recommendations for cooking with Grill
All foods should be placed on the grilling rack with a dish placed underneath to catch any food spillage or
juices to minimise cleaning. Turn all food halfway through the cooking time.
Food
Toast
Cheese on Toast
QTY. (Weight)
2 Slices
4 Slices
Cooking time
4 – 5 min
6 – 7 min
Special notes
4 – 5 min. to toast. 2 min. with topping
Recommendations for cooking with Microwave and Grill
Use roasting rack on turntable for roast beef and pork, shield thin parts and edges. Place a dish on the turntables under the grill rack to catch food spillage and juices. Turn food, as appropriate during the cooking time.
Food
Bacon
QTY (Weight)
4 (100 g)
Roast Beef (Boned) 600 g
Roast Pork (Loin)
600 g
Pork Chops
Power Selector
position
Combi 3
Microwave only 800W
Cooking
time
7- 9 min
14-16 min
Combi 2
5 - 6 min
2 - 3(450 g)
Combi 2
14 - 16 min
Chicken, Halved
lengthways
Legs
Frozen Hamburger
Sausages
450 g
Combi1
15 - 20 min
800 g
4 (200 g)
450 g Only
Combi 1
Combi 2
Combi 1
16 - 22 min
12 - 15 min
10 - 15 min
Fish Steak
2 (350 g)
Combi 3
22 – 24 min
Frozen Potato,
Hash Brown
2 (150 g)
Combi 2
16 – 18 min.
Special notes
Brush with oil. Season
with salt and pepper. Allow
15 – 20 minutes standing
time after cooking.
Brush with oil. Season
with salt, pepper and
paprika.
Brush with oil. Season
with salt, pepper and
paprika.
Brush with oil, Season
with salt and pepper.
Microwave and Grill Power Levels
Symbol
Setting
Microwave Power
Grill Power
Grill
0W
1000W
Combi 1
300W
1000W
Combi 2
450W
1000W
Combi 3
600W
1000W
14
Downloaded From Microwave-Manual.com Manuals
t
EMM2015
Recommendations for Defrosting using
English
(180W)
Some foods such as bread and fruit, can successfully be thawed manually by using the power setting.
FOOD
STANDING
TIME
PREPARATION
Bread
Small loaf
Sliced large loaf
2 slices
1 bread roll
2 bread rolls
Cakes and Pastry
Gateau 450g/1 lb
Cheesecake
450g/1 lb
Pie (cooked)
450g/1 lb
Pastry 450g/1 lb
Butter
250g/8.8 oz
(1 packet)
Fruit
225g/8 oz
Soft berry fruits
450g/1 lb
Soft berry fruits
Plated meal
400g/14 oz
Place on microwave-proof rack or kitchen paper.
Turn over halfway through defrosting time.
Place on microwave-proof rack or kitchen paper.
Turn over halfway through defrosting time.
Place on kitchen paper.
Place on kitchen paper.
Place on kitchen paper.
8–10 min.
10–15 min.
10–13 min.
10 min
45–60 sec.
45–60 sec.
1–11/2 min.
5 min.
5 min.
5 min.
Remove from packaging, place on plate.
9–11 min.
15–30 min.
Remove from packaging, place on plate.
9–11 min.
15–30 min.
Remove from packaging, place on plate.
7– 9 min.
15–30 min.
Remove from packaging, place on plate.
7– 9 min.
15–30 min.
If foil wrapped, remove from wrapper and place on a
plate
3– 4 min.
5–10 min.
Place in a single layer in a shallow dish.
5– 6 min.
5–10 min.
7– 8 min.
5–10 min.
7– 8 min
5–10 min.
Place in a single layer in a shallow dish.
Cover with a plate or non P.V.C. cling film.
To reheat, microwave on 100% (800W)for 3–4 minutes.
Vegetables
It is not necessary to defrost vegetables before cooking.
All vegetables can be thawed and cooked on
100% (800W)
15
Downloaded From Microwave-Manual.com Manuals
t
EMM2015
Microwave Hints
•
•
•
•
•
•
•
•
•
•
•
•
•
•
•
•
•
Always keep the oven clean – avoid spill-overs
and do not forget to clean under the glass tray
and the inside of the door.
Preferably use round or oval casseroles with a lid
when cooking in your microwave oven.
Do not use metal or metal decorated casseroles.
Certain plastic materials can melt and be warped
by hot food.
Cover the food when cooking. Use a glass lid, a
plate or grease proof paper.
Pastry, bread and the like can be defrosted
directly in a bread basket or on a paper towel.
If frozen food is heated in its packaging, the
packaging should be opened. Packaging
containing metal or metal decoration must not be
used unless specifically recommended for use in
the microwave. Remove metal clips and wire ties.
Smaller pieces of aluminium foil can be used to
cover parts that easily over cook such as chicken
legs.
Food with peel or skin should be pierced with a
fork – e.g. potatoes and sausages. Do not boil
eggs in the microwave oven as they can explode.
Put large, thick pieces close to the edge of the
casserole and try to cut the food in to even sized
pieces. Always place the food in the centre of the
oven.
The food will be evenly cooked if you stir or turn it
a few times.
Always set a shorter cooking time than indicated
in your recipe to avoid over cooking. The larger
the amount of food the longer it takes.
Use little or no water for vegetables.
Use less salt and spices than for ‘normal’ cooking.
Season afterwards.
Allow a few minutes ‘standing’ time after the oven
has switched off to ensure complete and even
cooking results.
Always ensure food is piping hot throughout
before serving.
Use pot holders or gloves when taking dishes and
food from the oven.
English
Microwave Tips
•
Softening Honey
If you have a jar of honey which has
crystallised, remove lid and place the jar in the
oven, microwave on medium power for 2
minutes.
•
Melting Chocolate
Break 100g of chocolate into squares, place in
a bowl and heat on high power for 1-2
minutes and stir well.
•
Softening or Melting Butter
Melting takes a few seconds on high power.
Softening is best done more gently on low
power.
•
Freshen or Warm Bread
Use medium power for few seconds.
•
Peeling Garlic easily
Heat 3 or 4 cloves of garlic on high power for
15 seconds. Squeeze at one end until the
clove pops out.
•
Fruit Juice
Citrus fruits will yield more juice if they are
heated on high power for 15 seconds before
squeezing.
•
Cooking Porridge
Porridge is easily cooked in the serving dish
with no sticky pan to wash. Follow food
manufacturers’ recommendations.
16
Downloaded From Microwave-Manual.com Manuals
EMM2015
t
English
Care and cleaning
The oven must always be clean. Residue of food from spillovers or spatters will attract microwave energy
causing it to burn on. This could reduce the efficiency of the oven and may cause bad odours. Do not attempt
to tamper with or make any adjustments or repairs to any part of the oven. Repairs should only be done by a
qualified service technician.
Be sure the oven is disconnected from the electricity supply before cleaning.
Cleaning the accessories (turntable and support)
Clean them with mild detergent after removing them from the cavity. The turntable support should be carefully
handled.
CAUTION: The inside of the oven and turntable get very hot, so do not touch them immediately after use.
Cleaning the interior
Always keep the inside of the oven clean. Wipe up spill-overs and food spatters immediately. Deposits that are
allowed to remain on the oven walls, door seal and door surface will absorb microwave energy, reduce the
efficiency of the oven, and possibly damage the oven interior. Use mild, liquid detergent, warm water and a
soft, clean cloth to remove deposits.
NEVER USE ABRASIVE CLEANERS, COMMERCIAL OVEN CLEANERS OR STEEL WOOL PADS ON
ANY PART OF THE MICROWAVE OVEN.
To loosen difficult deposits, boil a cup of water in the microwave oven for 2 or 3 minutes.
NEVER USE A KNIFE OR ANY UTENSIL TO REMOVE DEPOSITS FROM OVEN SURFACES.
To remove odours from the oven interior, boil a cup of water plus 2 tablespoons of lemon juice for 5 minutes.
Cleaning the exterior
Open the oven door when cleaning the control panel. This will prevent the oven from being turned on
accidentally. You should clean outside surfaces of the oven with mild liquid detergent and water followed by a
wiping with clear water to remove any excess detergent. Dry with a soft cloth.
Spray-on window cleaners or all purpose spray-on kitchen cleaners can also be used. Never use abrasive
cleaners, scouring pads or harsh chemicals on outside surfaces of your oven. To prevent damage to the
working parts, do not allow water to seep into ventilation openings.
Care and cleaning (grill)
The element may be stained with spattered fat or oil while the oven is in use. Wait until the cavity cools down
and wipe off the spattered oil before next using of the oven. Stains grill may cause unpleasant odours and
smoke.
17
Downloaded From Microwave-Manual.com Manuals
t
EMM2015
English
GUARANTEE CONDITIONS
Electrolux offer the following guarantee to the first purchaser of this appliance:
1. The guarantee is valid for 24 months commencing when the appliance is handed over to the first retail
purchaser, which must be verified by purchase invoice or similar documentation. The guarantee does not
cover commercial use.
2. The guarantee covers all parts or components which fail due to faulty workmanship or faulty material. The
guarantee does not cover appliances where defects or poor performance are due to misuse, accidental
damage, neglect, faulty installation, unauthorised modification or attempted repair, commercial use or
failure to observe requirements and recommendations set out in the instruction book. This guarantee does
not cover such parts as light bulbs, removable glassware, or plastic.
3. Should guarantee repairs be necessary the purchaser must inform the nearest customer service office
(ELECTROLUX’s service or authorised agent). ELECTROLUX reserves the right to stipulate the place of
repair (i.e. the customer’s home, place of installation or ELECTROLUX workshop).
4. The guarantee or free replacement includes both labour and materials.
5. Repairs carried out under guarantee do not extend the guarantee period for the appliance. Parts removed
during guarantee repairs become the property of ELECTROLUX.
6. The Purchaser’s statutory rights are not affected by this guarantee.
European Guarantee
If you should move to another country within Europe then your guarantee moves with you to your new home
subject to the following qualifications:
•
The guarantee starts from the date you first purchased your product
•
The guarantee is for the same period and to the same extent for labour and parts as exists in the new
country of use for this brand or range of products
•
This guarantee relates to you and cannot be transferred to another user
•
Your new home is within the European Community (EC) or European Free Trade Area
•
The product is installed and used in accordance with our instructions and is only used domestically, i.e. a
normal household
•
The product is installed taking into account regulations in your new country
Before you move please contact your nearest Customer Care centre, listed below, to give them details of your
new home. They will then ensure that the local Service Organisation is aware of your move and able to look
after you and your appliances.
France
Germany
Italy
Sweden
UK
Senlis
Nürnberg
Pordenone
Stockholm
Slough
+33 (0) 3 44 62 20 13
+49 (0) 800 234 7378
+39 (0) 800117511
+46 (0) 20 78 77 50
+44 (0) 1753 219898
18
Downloaded From Microwave-Manual.com Manuals
EMM2015
Sivu Sisällysluettelo
4
5
Turvallisuusmääräyksiä
– Asennuksen ja huollon yhteydessä
– Mikroaaltouunia käytettäessä
– Mikroaaltouunin romutuksessa
– Tärkeää tietoa
5
Pakkauksen purkaminen ja varusteluettelo
– Pakkauksen purkaminen
– Varusteluettelo
6
Tekniset tiedot
Asennus
– Sijoittaminen
– Kalusteisiin sijoittaminen
– Sähköliitäntä
7
Mikroaaltouunin käyttö
– Uuni
– Varusteet
– Pyörivän kuumennusalustan asettaminen paikalleen
– Ohjaustaulu
– Pyörivä kuumennusalusta
– Ruoanvalmistuksen keskeyttäminen
– Ruoan valmistaminen
– Ohjeita tehon valitsemiseen
8
9
10
11
Grillin Käyttö
– Käyttö : Mikro / Grillaus
– Mikro / Grillaustehot
12
– Taulukot
13
– Muista
13
Käytännön neuvoja ja vihjeitä
– Yleisiä vihjeitä
– Valmistaminen ja kuumentaminen
– Pakasteiden sulattaminen
– Keittoastiat
– Mikroaaltouunikäyttöön sopivien astioiden kokeileminen
– Tätä ei voi tehdä mikroaaltouunissa
14
15
Puhdistaminen ja hoito
15
Mikäli mikroaaltouuni ei toimi
Takuu
Huolto ja varaosat
Downloaded From Microwave-Manual.com Manuals
3
EMM2015
Turvallisuusmääräyksiä
Asennuksen ja huollon yhteydessä
• Uuni on tarkoitettu kotitalouden normaaliin
ruoanlaittoon. Mikäli sitä käytetään muuhun
tarkoitukseen, saattaa syntyä vahingonvaara
henkilölle ja/tai omaisuudelle.
• Rikkinäistä uunia ei saa koskaan käyttää. Uuni
tehdään jännitteettömäksi irrottamalla
pistotulppa pistorasiasta (vetämällä
pistotulpasta, ei koskaan johdosta).
• Mikäli uunissa on vikaa tai se toimii huonosti,
ota yhteys valtuutettuun huoltoliikkeeseen
uunin korjaamiseksi. Varmista, että
alkuperäisiä varaosia käytetään.
• Rikkoutunutta uunia ei koskaan saa itse
muuttaa tai korjata. Asennustyöt, liitosjohdon
pidentäminen j n e., on annettava
ammattitaitoisen henkilön tehtäväksi.
• Riittämättömällä ammattitaidolla suoritettu työ
saattaa heikentää uunin toimintaa ja johtaa
henkilö- ja/tai aineellisiin vahinkoihin.
Mikroaaltouunia käytettäessä
• Uuni on tarkoitettu aikuisten käytettäväksi.
Lasten ei anneta leikkiä uunin kanssa eikä
pieniä lapsia jätetä ilman valvontaa toimivan
uunin läheisyyteen.
• Mikroaaltouunia ei missään olosuhteissa saa
käyttää uunin luukku avattuna tai luukun
turvakytkimien ollessa pois toiminnasta.
Turvakytkimien ja lukitusmekanismin toimintaa
ei saa muuttaa.
• Uunia ei saa koskaan käynnistää, mikäli
luukku ei sulkeudu kunnolla. Puhdista luukun
sisäpinta ja tiivisteet säännöllisesti.
• Mikroaaltouunia ei saa käyttää, mikäli uunin
luukku tai luukun tiiviste ovat vaurioituneet.
Käyttö on sallittua vasta kun valtuutettu
huoltoliike on korjannut uunin.
• Uunia ei saa käyttää tyhjänä, koska se saattaa
vaurioitua, aseta kupillinen vettä uuniin
käyttökokeilun ajaksi.
• Toiminnassa oleva uunia ei saa koskaan jättää
ilman valvontaa. Uunin luukku on ehdottomasti
pidettävä suljettuna, mikäli uunissa jokin syttyy
palamaan. Lisäksi uunista katkaistaan virta
välittömästi. Tällöin mahdollisesti syttynyt tuli
tukahtuu, älä koskaan käytä vettä.
• Ruokaöljyä tai rasvaa ei saa kuumentaa uunissa,
koska niiden lämpötilaa on vaikea valvoa.
Popcornien kanssa on oltava varovainen.
Ne saattavat ylikuumentua ja syttyä palamaan.
Mikroaaltouunin romutuksessa
• Mikroaaltouunin romutuksen yhteydessä
vältytään vahingoilta, mikäli menetellään
seuraavasti. Irrota uunin liitosjohdon
pistotulppa pistorasiasta. Katkaise tämän
jälkeen liitosjohto uunin puoleisesta päästä.
Ota tarvittaessa yhteys kuntasi
jätehuoltoasioita hoitavaan viranomaiseen.
Downloaded From Microwave-Manual.com Manuals
4
EMM2015
Tärkeää tietoa
• Uunin lasisen kuumennusalustan on aina oltava
paikallaan uunissa.
• Veden tai muiden nesteiden kuumentamisessa
lämpötila saattaa nousta yli 100°C ilman, että neste
alkaa kiehua. Tämä ylikuumennus saattaa aiheuttaa,
että neste äkkiä kiehahtaa astiaa kosketeltaessa.
• Tämän estämiseksi nestettä voi sekoittaa tai
astiassa voi pitää lusikkaa kuumennuksen aikana
(metallilusikkaa voi käyttää nesteessä, kunhan se
sijoitetaan siten, ettei lusikka kosketa uunin seinämiä,
jolloin saattaa syntyä kipinöintiä). Nesteen voi myös
antaa seistä 20 sekuntia lämpötilan tasoittumiseksi,
ennen kuin astia otetaan uunista. Käytä patalappuja!
• Metallisia ruokailuvälineitä tai astioita tai astioita,
joissa on metallikoriste, ei saa käyttää. Kipinöinti
vaurioittaa uunia ja/tai astiaa.
• Metalliset sulkimet tai sulkimet, jotka sisältävät
metallia, saattavat aiheuttaa kipinöintiä ja sulkijat on
sen vuoksi poistettava pakkauksista, ennen kuin
pakkaus pannaan uuniin.
• Varmista, etteivät tölkit tai pakkaukset ole liian
tiiviisti suljettuja. Näin estetään ylipaineen
muodostuminen kuumennuksen aikana.
Vauvanruoan kuumentamisessa on oltava
varovainen. Poista tölkin kansi ja tuttipullon tutti
ennen kuumentamista. Ruoan tai nesteen
lämpötila on aina tarkoin tarkistettava, ennen kuin
niitä annetaan lapsille.
Pakkauksen purkaminen ja varusteluettelo
Pakkauksen purkaminen
Varusteluettelo
Tarkista, ettei pakkauksessa eikä uunissa ole
kuljetusvaurioita.
1 Pyörivä lasinen kuumennusalusta
1 Lasisen kuumennusalustan pyöritin
1 Käyttöohje
Mahdollisista kuljetusvaurioista on välittömästi
ilmoitettava myyjäliikkeeseen.
Uunin ulkovaippa on peitetty suojakelmulla.
Kelmu on poistettava ennen kuin uunia
käytetään ensimmäistä kertaa.
Tarkista pakkauksen purkamisen yhteydessä, että
tuote on virheetön. Vahingoista, virheellisyyksistä
ja mahdollisesti puuttuvista osista on välittömästi
ilmoitettava myyjäliikkeeseen.
Pakkausmateriaalia ei saa jättää siten, että lapset
voivat leikkiä sillä.
Downloaded From Microwave-Manual.com Manuals
5
EMM2015
Tekniset tiedot
Ulkomitat:
Korkeus
Leveys
Syvyys
Uunitilan mitat:
Korkeus
Leveys
Syvyys
285 mm
484 mm
376 mm
Paino
Jännite
Sulake
Liitäntäteho
Mikroaaltoteho
Tilavuus
Grilli
195 mm
300 mm
292 mm
13.5 kg
230 V, 1-vaihe, 50 Hz
10 A
2300 W
800 W
20 l
1000W
Asennus
Sijoittaminen
myös, että uunin jalat ovat paikallaan ja että uunin
ilmanvaihto on riittävä.
1 Sijoita uuni suoralle ja tukevalle alustalle. Uunin
ilmanvaihdon on oltava riittävä joka puolelta. Uunia
ei saa sijoittaa lähelle muita lämpölähteitä, esim.
lieden tai lämpöpatterin viereen.
Sähköliitäntä
2 Uunin ilmanvaihtoaukkoja ei saa peittää. Tällöin
uuni saattaa ylikuumentua ja terminen
ylikuumenemissuoja saattaa toimia. Uunin sivuilla,
takana ja yläpuolella on oltava vähintään 10 cm
vapaata tilaa riittävän ilmankierron
varmistamiseksi. Uunin jalkoja ei saa poistaa.
3 Poista kaikki pakkausmateriaali uunin sisältä ja
aseta uunin lasinen kuumennusalusta uunin
pohjalle. Uunia ei saa käyttää ilman paikallaan
olevaa lasialustaa.
Uunissa on pistotulpallinen liitosjohto. Uuni liitetään
230 V jännitteiseen 50 Hz sähköverkkoon
pistotulpalla pistorasiaan, jota suojaa 10 A sulake.
Tarkista, että uunin arvokilpeen merkitty ja
sähköverkon jännite on sama.
Mikroaaltouunissa on erikoisliitosjohto, joka on
vaihdettava samantyyppiseen, mikäli se vaurioituu.
Liitosjohto on saatavissa valtuutetuilta
huoltoliikkeiltä, joiden myös pitää suorittaa sen
asennus.
4 Ennen kuin käytät uunia, pyyhi se sisältä, luukun
sisäpinnalta ja tiivistepinnoilta kostealla liinalla.
Uunin pienten ulkomittojen ansiosta sen voi sijoittaa melkein mihin tahansa työtasolle, pöydälle
tai viedä kesämökille. Tarkista aina, että uuni
sijoitetaan suoraan ja vankalle alustalle. Tarkista
Downloaded From Microwave-Manual.com Manuals
6
EMM2015
Mikroaaltouunin käyttö
Electrolux-mikroaaltouuni on helppokäyttöinen.
Se käynnistyy, kun haluttu teho ja aika on valittu.
1
2
3
9
5
8
6
4
4
7
10
Uuni
1.
2.
3.
4.
5.
6.
7.
8.
9.
10.
Uunitila
Luukun ikkuna
Luukku
Luukun lukitussalvat
Ohjauspaneeli
Pyörittimen tuki
Pyörivä lasinen kuumennusalusta
Lasisen kuumennusalustan pyöritin
Grilli
Grillausritilä
Downloaded From Microwave-Manual.com Manuals
7
EMM2015
Varusteet
Pyörivä kuumennusalusta
Pyörivän kuumennusalustan
asettaminen paikalleen
On tärkeää, että lasinen kuumennusalusta on aina
paikallaan kuumennuksen aikana, koska tällöin
lopputulos on paras mahdollinen.
Lasinen alusta pyörii joko vasta- tai myötäpäivään.
Alustan voi pestä tiskikoneessa.
Kuumennusalustan pyöritin
1. Aseta alustan pyöritin uunin pohjalle.
2. Aseta alusta pyörittimelle. Tarkista, että alustan
keskellä oleva syvennys asettuu uunin pohjassa
olevaan tukeen.
Alustaa ei koskaan saa asettaa ylösalaisin
paikalleen.
Paina
Pyöritin asetetaan alustan alle, jotta alusta pyörii.
Pyörittimen ja alustan on aina oltava paikallaan
uunissa uunia käytettäessä.
Pyörittimelle ei koskaan saa asettaa mitään
muuta astiaa tai alustaa.
Pyöritin on konepesun kestävä.
Ylös
Pyörivä kuumennusalusta irrotetaan painamalla
reunasta kuvan osoittamalla tavalla.
Downloaded From Microwave-Manual.com Manuals
8
EMM2015
Ohjauspaneeli
Uunia ei saa käyttää tyhjänä. Kun kokeilet
toimintaa, aseta kupillinen vettä uuniin.
Tehonvalitsin
Ajanvalitsin
Downloaded From Microwave-Manual.com Manuals
9
EMM2015
Pyörivä kuumennusalusta
Ruoan valmistaminen
On tärkeää, että kuumennusalusta on paikallaan
uunissa, koska pyörivä alusta edesauttaa tasaisen
lopputuloksen saavuttamista.
1. Aseta ruoka sopivaan astiaan. Ks. sivulta 14,
mitkä astiat sopivat. Sulje luukku.
2. Valitse haluttu mikroaaltoteho kääntämällä
tehonvalitsinta sen lukeman kohdalle, mikä vastaa
haluttua tehoa, ks. allaolevaa taulukkoa.
Ruoanvalmistuksen
keskeyttäminen
Uunin luukun voi avata ruoanvalmistuksen aikana
painamalla luukun aukaisinta. Tällöin uuni lakkaa
toimimasta. Kun luukku suljetaan uudelleen, uuni
jatkaa toimimista jäljellä olevan ajan. Mikäli uunin
toiminta halutaan lopettaa, ennen kuin valittu aika
on kulunut, ajanvalitsin käännetään 0-asentoon.
3. Valitse aika kääntämällä ajanvalitsinta halutun
aikalukeman kohdalle. Uuni alkaa välittömästi
toimia. Vääntimen merkinnät merkitsevät
minuutteja. Mikäli valitset lyhyen ajan, 2 min tai
lyhyemmän, käännä ajanvalitsinta ensin
suuremman lukeman, esim. 4- tai 5- lukeman
kohdalle, ja sen jälkeen haluamaasi pienempään
aikalukemaan.
4. Kun valittu aika on kulunut, kuuluu merkkiääni ja
uuni lakkaa toimimasta.
Ohjeita tehon valitsemiseen
100W
180W
Pakastetun lihan, kalan ja valmiin ruoan sulattaminen.
Pakastetun lihan, kalan ja valmiin ruoan sulattaminen.
300W
Pakastettujen leivonnaisten sulattaminen ja kuumentaminen.
Kastikkeiden kiehauttaminen.
450W
Suurempien ruokamäärien sekä ruokien, joita ei voi sekoittaa,
esimerkiksi laatikkoruoat, kuumentaminen ja kypsentäminen.
600W
Ruoan nopea kuumentaminen ja kypsentäminen, esim. kala sekä
vihannekset.
700W
Ruoan nopea kuumentaminen ja kypsentäminen, esim. kala sekä
vihannekset.
800W
Juomien ja valmiin ruoan nopea kuumentaminen.
Downloaded From Microwave-Manual.com Manuals
10
EMM2015
Grillin käyttö
Voit lisätä tai vähentää valmistusaikaa kääntämällä
väännintä oikealle tai vasemmalle. Halutessasi voit
myös lisätä tehoa valmistuksen aikana. Jokainen
Start-painikkeen painallus lisää valmistusaikaa 30
sekunnilla.
Grilliä voi käyttää erityisen hyvin esimerkiksi leivän
paahtamiseen. Muista, että uuni on kuuma. Aseta
grillattava grillausritilälle.
Esim. Ohjelmointi Grilli -toiminnolle, ruoanvalmistusaika 15 minuuttia.
Toimi näin: Uunin/näytön tila:
1. Aseta tehoksi
kääntämällä tehonvalitsinta.
2. Aseta aika 15 min. kääntämällä ajanvalitsinta.
3. Uuni on toiminnassa 15 min.
(Grillitoiminto).
Grilli täytyy esilämmittää ennen käyttöä.
Grilliä tulee esilämmittää kuten yllä on neuvottu 3 - 4 minuuttia.
Käyttö: Mikro/Grillaus
Esim. Ohjelmointi Grilli ja Mikro -toiminnoille, teho 450 W, ruoanvalmistusaika 30 minuuttia.
Toimi näin: Uunin/näytön tila:
1. Aseta tehoksi
kääntämällä tehonvalitsinta.
2. Aseta aika 30 min. kääntämällä ajanvalitsinta.
3. Uuni on toiminnassa 30 min.
(Combi 2).
Grilliä ei tarvitse esilämmittää kun käytetään yhdistettyä mikroaalto- ja grillikypsennystä
Mikro/Grillaustehot
Symboli
Toiminto
Mikroteho
Grilliteho
Grill
0W
1000W
Combi 1
300W
1000W
Combi 2
450W
1000W
Combi 3
600W
1000W
11
Downloaded From Microwave-Manual.com Manuals
EMM2015
Taulukot
Grillaustaulukko (suosituksia)
Ruokalaji
Paahtoleipä
Lämmin juustoleipä
Määrä/paino
2 viipaletta
4 viipaletta
Valmistusaika
5 – 6 min
7 – 8 min
Huomioi
(5 -6 min) pelkkä paahtoleipä (2 min)
päällisen kanssa.
Mikro/Grillaustaulukko (suosituksia)
Ruokalaji
Pekoni
Naudanpaisti
(luun kanssa)
Porsaanpaisti
(selkä)
Porsaankyljykset
Broileri, puolikas
Koivet
Hampurilainen,
pakastettu
Makkarat
Kalapihvi
Peruna, paistettu
sipuliperuna,
pakastettu
Määrä/paino
4 (100 g)
900 g
Valmistusaika
8- 10 min
25 min
900 g
Toiminto
Grill+300W
Ainoastaan
kypsennys
600W
Grill+300W
2 - 3 (450 g)
Grill+300W
22 - 27 min
450 g
800 g
4 (200 g)
Grill+300W
Grill+300W
Grill+300W
17 - 22 min
27 - 32 min
14 - 17 min
450 g
2 (350 g)
Grill+300W
Grill+300W
12 - 17 min
24 – 26 min
2 (150 g)
Grill+300W
18 – 20 min
Huomioitavaa
Sivele öljyllä. Mausta suolalla,
pippurilla Anna seistä 15 – 20
minuuttia kypsennyksen jälkeen.
7 - 8 min
Downloaded From Microwave-Manual.com Manuals
12
Sivele öljyllä. Mausta suolalla,
pippurilla, ja paprikalla.
Sivele öljyllä. Mausta suolalla,
pippurilla ja paprikalla.
Sivele öljyllä. Mausta suolalla,
pippurilla
EMM2015
Muista
• Mitä isompi määrä, sitä pidempi
kuumennus/kypsennysaika.
• Suolaa lisätään vasta kypsennyksen jälkeen.
Suola kuivattaa ja esim. lihasta tulee sitkeää.
• Kylmät elintarvikkeet kuumenevat/kypsyvät
hitaammin kuin huoneenlämpöiset.
• Ruoan annetaan seistä vähintään 5 minuutin ajan
lämpötilan tasoittumiseksi. Tasoittumisaika riippuu
ruoan määrästä ja koostumuksesta. Suuri määrä
kiinteää ruokaa vaatii pidemmän ajan kuin pieni
määrä huokoista ruokaa.
• Huokoiset elintarvikkeet tarvitsevat lyhyemmän
kuumennus-/kypsennysajan kuin kiinteät.
• Paljon vettä sisältävät ruoat kypsyvät hitaammin.
• On hyvä valita ohjeessa mainittu lyhin aika ja
tarvittaessa lisätä aikaa. Tällöin ruokaa ei
kuumenneta/kypsennetä liikaa yhtä helposti.
Käytännön neuvoja ja vihjeitä
Yleisiä vihjeitä
Valmistaminen ja kuumentaminen
Erilaisissa mikroaaltouunin keittokirjoissa on monta
hyvää ohjetta ja vihjettä erilaisten ruoanvalmistusja leivontavaiheiden helpottamiseksi. Aloita aina
valitsemalla ohjeissa ja taulukoissa oleva lyhin
aika.
• Tarkista, että pakaste on sulanut kunnolla ennen
kuin aloitat ruoan valmistaminen.
• Omia ohjeita voi myös käyttää. Suolan,
mausteiden ja nesteen määrää on syytä vähentää,
mitkään ei kiehu pois.
• Suurin osa ruoista kypsyy omassa liemessään.
Kuivat ainekset, kuten riisi ja pavut tarvitsevat
tietysti nestettä.
• Ruoka peitetään kuumennuksen/kypsennyksen
ajaksi, jolloin ruoan kosteuspitoisuus säilyy.
Uunikaan ei tällöin likaannu.
• Pakastettuja leivonnaisia voi sulattaa ja
kuumentaa esim. leipäkorissa (tarkistettava, ettei
korissa ole metalliniittejä ym.) tai talouspaperilla.
Hillotäyte kuumenee aina enemmän kuin muu osa
leivonnaisesta.
• Pekonia ei saa valmistaa suoraan lasialustalla.
Pekonin ja lasialustan lämpötilan erot ovat
liian suuret ja alusta saattaa vaurioitua.
• Makkaran, omenan ja perunan kuori sekä
maksan ja kananmunan keltuaisen kalvo on
pisteltävä esim. haarukalla ennen kypsennystä,
muutoin kuori ja kalvo halkeaa.
• Poista lihasta mahdollinen rasva.
• Aseta kypsennettävien ainesten ohuimmat osat
astian keskustaa kohti.
• Kypsennysaikaa on muunneltava riippuen
kypsennettävien ainesten lämpötilasta
(huoneenlämpöinen tai jääkaappikylmä) sekä
oman maun ja tottumuksen mukaan.
• Sekoita pataruokia, kastikkeita yms. ruokia
kypsennyksen aikana, tasaisemman lopputuloksen
saavuttamiseksi.
Pakasteiden sulattaminen
• Liha voidaan sulattaa pakkauksessaan. Kaikki
metallia sisältävät osat on poistettava
pakkauksesta.
• Sulatettavan ohuimmat osat asetetaan astian
keskustaa kohti.
• Pakasteen sulattamisen jälkeen saattaa
pakasteen keskiosassa vielä olla jäisiä kohtia.
Tämän vuoksi sulatetun pakasteen annetaan vielä
hetken seistä, ns. lämpötilan tasoitusjakson ajan,
ennen kuin siitä valmistetaan ruokaa.
Downloaded From Microwave-Manual.com Manuals
13
EMM2015
Keittoastiat
Astioiden sopivuus mikroaaltouunikäyttöön riippuu
astioiden raaka-aineesta.
Eräät muovit tulevat veltoiksi. Toiset muovit ja
keramiikka saattavat haljeta, varsinkin pieniä
ruokamääriä kuumennettaessa. Metalliastioita ei
saa käyttää.
POSLIINI – Useimmat posliiniastiat sopivat,
poikkeuksena astiat, joissa on metallikoriste. Kultatai hopeakoriste vaurioituu. Eräät posliinilasitteet
sisältävät myös metallia. Varmuuden saamiseksi,
kokeile astioiden sopivuus alla annetun ohjeen
mukaan.
SAVIASTIAT – Kivitavara- ja saviastioita voi
käyttää. Paljon käytössä oleva ruskea savipata
liotetaan ensin vedessä, kuten normaalisti
tavallisessa uunissa käytettäessä.
METALLI – Metalliastiat eivät sovi
ruoanvalmistusastioiksi mikroaaltouunissa.
Mikroaallot eivät läpäise metallia, joten mikroaallot
pääsevät kuumentamaan/kypsentämään vain
päältä eikä hyvää tulosta saavuteta.
Mikäli metalliastia tai alumiinifoliota
asetetaan mikroaaltouuniin liian lähelle
uunin seinämiä, saattaa syntyä
kipinöintiä, mikä aiheuttaa polttojälkiä
sisävaippaan. Muista myös aina poistaa
teepussien ja leipäpakkauksien
metalliosat.
LASI – Lasi sopii yleensä hyvin. Ei kuitenkaan
kristalli- eikä värilliset lasit.
MUOVI – Muovimukeja tai tölkkejä voi käyttää
varovaiseen kuumentamiseen, muttei ruoan
kypsentämiseen.
Useimmat talousmuovit eivät kestä 90°C
korkeampaa lämpötilaa. Muoviastioiden
lämmönkestävyys on syytä tarkistaa.
Mikroaaltouunikäyttöön sopivien
astioiden kokeileminen
Astian sopivuus kokeillaan asettamalla astia uunin
sisään keskelle. Aseta kahvikupillinen vettä astian
viereen. Valitse täysteho ja yhden minuutin
toiminta-aika. Valitun ajan kuluttua astian ei pidä
mistään kohtaa olla kädenlämpöä kuumempi.
Tällöin sitä voi käyttää mikroaaltouunissa.
Tätä ei voi tehdä mikroaaltouunissa
• Paistaa hiivataikinoita – leivonnaiset eivät saa
väriä.
• Kypsentää kananmunaa kokonaisena eikä
kuumentaa jo keitettyä kananmunaa.
• Valmistaa kohokkaita.
• Käyttää tavallista paistomittaria.
Mikroaaltouunikäyttöön soveltuvia erikoismittareita
on saatavissa liikkeistä.
Downloaded From Microwave-Manual.com Manuals
14
EMM2015
Puhdistaminen ja hoito
• Uunin puhdistamiseen ei saa käyttää
uuninpuhdistusaineita eikä muita syövyttäviä
tai naarmuttavia aineita. Uunin ulko- ja
sisävaippa pyyhitään
kostealla liinalla, joka on kasteltu lämpimään
veteen, missä on käsitiskiainetta.
• Uunista pyyhitään sisätilaan mahdollisesti
tiivistynyt kosteus, pehmeällä liinalla tai
talouspaperilla.
Mikäli mikroaaltouuni ei toimi
Ellei uuni seuraavista tarkistuksista huolimatta toimi
oikealla tavalla, ota yhteys valtuutettuun
huoltoliikkeeseen.
Ennen kuin otat yhteyttä huoltoon:
tarkista, että pistotulppa on pistorasiassa ja että
sulake on ehjä. Älä tee uunille mitään toimenpiteitä,
jotka voivat aiheuttaa vaurioita henkilölle tai
tuotteelle.
• Onko uuni kytketty sähköverkkoon?
• Onko pistorasiaa suojaava sulake ehjä?
• Onko luukku kunnolla suljettu?
• Onko kuumennus/kypsennysaika valittu?
Takuu
Tuotteen takuuaika voidaan ilmoittaa erikseen.
Ellei takuuaikaa ole erikseen määritelty, noudatetaan
vallitsevaa lainsäädäntöä ja kansallisia määräyksiä.
Takuuehdot noudattavat vallitsevan lainsäädännön
mukaisia yleisiä ehtoja. Ostokuitti säilytetään, koska
takuun alkaminen määritetään ostopäivän mukaan.
Korvaus huollosta voidaan periä myös takuuaikana:
• aiheettomasta huoltokäynnistä
• ellei valmistajan laitteen asennuksesta, käytöstä
ja hoidosta antamia ohjeita ole noudatettu.
(Model)...................................
Huolto ja varaosat
Malli
Huollot, varaosatilaukset ja mahdolliset
korjaukset on annettava valtuutetun
huoltoliikkeen tehtäväksi. Lähimmän valtuutetun
huoltoliikkeen numeron löydät soittamalla
numeroon
0200-2662 (0,1597 €
€ /min) + pvm),* tai
katsomalla puhelinluettelon keltaisilta sivuilta
kohdasta “kodinkoneiden huoltoa”.
Tuotenumero(Prod.nr.).........................................
Varmistaaksesi laitteesi moitteettoman
toiminnan, vaadi aina käytettäväksi sopivinta, siis
alkuperäistä varaosaa.
* Mainitse soittaessasi tuotteen merkki. Kopioi
arvokilvestä tuotteen tiedot alla olevaan kohtaan,
niin ne löytyvät helposti, jos sinun pitää ottaa
yhteys huoltoliikkeeseen.
Sarjanumero(Serial
nr.)................................................
Kuluttajaneuvonta
Tuotettasi tai sen käyttöä koskeviin kysymyksiin
saat vastauksen kuluttajaneuvonnastamme
soittamalla numeroon 0200-2662 (0,1597
€
€ /min+pvm)
Voit olla myös yhteydessä kuluttajaneuvontaan
sähköpostitse osoitteessa:
Carelux.fsh@electrolux.fi
Downloaded From Microwave-Manual.com Manuals
15
S
EMM2015
Innehållsförteckning
4
Säkerhetsinformation
– Vid installation och service
– Vid användning av mikrovågsugnen
– Vid skrotning av mikrovågsugnen
5
5
Viktigt att veta
Uppackning och Tillbehörslista
– Uppackning
– Tillbehör
5
– Tekniska data
6
Installation
– Placering
– Elanslutning
7
Beskrivning av mikrovågsugnen och dess
tillbehör
– Ugnen
– Montering av den roterande glastallriken
8
Kontrollpanelen
9
Den roterande tallriken
– Tillagning
– Vägledning för val av effekt
9
Vägledning för val av upptiningstid
12
Tillagning med grill
– Tillagning med mikro och grill
12
Tabeller
– Val av mikro – och grilleffekt
12
12
Kom ihåg
Praktiska råd och tips
– Allmänna
– Tillagning och uppvärmning
– Upptining
– Kokkärl
13
Så här testar du om ett kärl är lämpligt att använda
i mikrovågsugnen
13
Det här kan du inte göra i mikrovågsugnen
13
Rengöring och skötsel
13
Om mikrovågsugnen inte fungerar
– Innan du kontaktar serviceman
14
Service och reservdelar (i Finland)
3
Downloaded From Microwave-Manual.com Manuals
S
EMM2015
Gratulerar till Din nya mikrovågsugn
Innan Du använder mikrovågsugnen rekommenderar vi att Du läser igenom hela bruksanvisningen, som ger en direkt
beskrivning av ugnen och dess funktioner. För att undvika de risker, som trots allt alltid finns när Du använder en produkt
som drivs med el, är det viktigt att ugnen installeras på rätt sätt och att Du läser igenom säkerhetsinformationen noga för
att undvika felanvändning och onödiga olycksrisker. Spara bruksanvisningen och se till att den finns tillgänglig vid
användning av ugnen.
Hur fungerar mikrovågsugnen?
Ekonomiskt!
Den s.k. magnetronen i mikrovågsugnen sänder ut
elektromagnetisk energi i form av radiovågor. Dessa
radiovågor, av en speciell våglängd, har förmåga att sätta
fart på matens egna vattenmolekyler. Då molekylerna
gnids mot varandra uppstår friktionsvärme och maten blir
varm. Att laga mat med mikrovågor ger därför många
fördelar:
Mikrovågorna värmer endast maten. Beroende på vad du
lagar och hur mycket, så kan du spara upp till 75%
elenergi jämfört med en vanlig spis/ugn! Dessutom kan du
spara dina matrester, frysa in och sedan snabbt värma upp
dem igen när det passar. Det blir raskt många insparade
matslantar!
Smakämnen, vitaminer och näringsämnen blir kvar i maten
och den blir godare och fräschare. Till och med uppvärmda
matrester smakar nylagat! Inget extra fett behövs. Därför
blir mikrolagad mat kalorisnål.
Säkerhetsinformation
•
Vid installation och service.
•
•
•
•
•
•
Ugnen är avsedd för i hushåll normalt förekommande
matlagning. Används den för andra ändamål kan det
uppstå risk för skada på person och/eller egendom.
En trasig ugn skall aldrig användas. Gör ugnen strömlös. Är den stickproppsansluten, lossas stickproppen
från vägguttaget (drag i stickproppen, aldrig i kabeln). I
annat fall tas säkringen (proppen) till ugnen ur elskåpet.
Vid fel eller dålig funktion kontakta auktoriserad service för reparation. Se till att originalreservdelar
används.
Försök aldrig att förändra eller laga en trasig ugn själv.
Installationsarbeten, förlängning av kabel osv, skall
utföras av behörig fackman.
Arbete utfört av person utan tillräcklig kunskap
kan försämra ugnen och leda till skada på person
och/eller egendom. Sådan skada omfattas inte av
garantin.
Installationsarbeten, förlängning av kabel osv, skall
utföras av behörig fackman.
•
•
•
•
Vid skrotning av mikrovågsugnen
•
Vid användning av mikrovågsugnen
•
•
Starta aldrig ugnen om något kommit i kläm vid ugnsluckan. Låt inte mat eller smuts samlas på luckans
insida eller på luckans tätningsytor på ugnen.
Mikrovågsugnen får inte användas med skadad ugnslucka eller lucktätning innan den repareras av auktoriserad service.
Ugnen får inte köras tom, då den kan skadas. Vid prov
ställ in en kopp vatten för att absorbera mikrovågsenergin.
Lämna aldrig ugnen utan tillsyn vid bakning av potatis,
smältning av stearin, kokande av knäck, värmning av
mat i papper eller annat brännbart material eftersom
dessa varor vid mycket för lång uppvärmningstid blir så
varma att de kan ta eld. Behåll då luckan stängd och
stäng av ugnen helt, så kvävs eventuell uppkommen
eld, använd aldrig vatten.
Värm inte matolja eller fett då temperaturen inte går att
kontrollera. Var försiktig med popcorn. Använd inte
ugnen för att torka några som helst föremål. De kan
överhettas och ta eld.
Ugnen är avsedd att användas av vuxna. Låt inte barn
leka med ugnen och lämna inte småbarn utan
övervakning i närheten av en mikrovågsugn som är
igång.
Under inga omständigheter får mikrovågsugnen
användas med ugnsluckan öppen eller med luckans
säkerhetsbrytare ur funktion. Manipulera aldrig med
säkerhetsbrytarna eller låsmekanismen.
4
Downloaded From Microwave-Manual.com Manuals
Hjälp till att undvika skador även när mikrovågsugnen
skall skrotas. Lossa den från vägguttaget, kapa kabeln
vid utgången från ugnen. Kontakta eventuellt Din
kommun för information om var Du kan lämna Din ugn
eller kontakta AB Elektroservice.
S
EMM2015
Viktigt att veta
•
•
•
Använd alltid glastallriken på plats i ugnens botten.
Vid upphettning av vatten eller vissa drycker kan det hända att temperaturen går över 100°C utan att vätskan börjar koka. Denna överhettning kan leda till att vätskan plötsligt kokar över när kärlet vidrörs.
För att motverka detta kan man röra om vätskan eller låt vätskan stå minst 20 sekunder för att
temperaturen skall utjämnas innan du tar ut den. Använd grytvantar.
Var försiktig vid värmning av barnmat. Tag bort locket eller nappar på burkar och flaskor innan de
värms. Rör om maten ordentligt och kontrollera temperaturen noga innan maten ges till små barn.
•
•
•
Använd inte bestick eller kärl av metall eller med metalldekor. Gnistbildning kan uppstå och förstöra ugnen
och/eller kärlet.
Metallklämmor eller förslutningar som innehåller metalltrådar kan ge gnistbildning i ugnen och skall därför
avlägsnas.
Se till att burkar eller förpackningar inte är tätt tillslutna när de värms i ugnen, då övertryck annars kan
uppstå.
Uppackning och Tillbehörslista
Uppackning
Tillbehör
Kontrollera att förpackningen och därmed ugnen ej är
transportskadad.
1 Roterande glastallrik
1 Tallriksstöd, för den roterande glastallriken
1 Bruksanvisning
Eventuella transportskador skall omedelbart
anmälas till den som ansvarat för transporten.
Om ugnen är täckt med en skyddande plastfilm
måste denna tas bort innan ugnen används första
gången.
Efter uppackningen kontrollera att varan är felfri.
Skador, felaktigheter och eventuella saknade delar
skall omedelbart anmälas till säljaren. Lämna inte
förpackningsmaterial så att små barn kan leka med
det.
Tekniska data
Utvändiga mått:
Vikt
Spänning
Säkring
Anslutningseffekt
Mikrovågseffekt
Volym
Höjd 285 mm
Bredd 484 mm
Djup 376 mm
Ugnsutrymme:
Höjd 195 mm
Bredd 300 mm
Djup 292 mm
Vi reserverar oss för ändringar.
5
Downloaded From Microwave-Manual.com Manuals
13.5 kg
230 V, 1-fas 50 Hz
10 A trög
2300 W
800 W
20 l
Grill 1300 W
S
EMM2015
Installation
Placering
Elanslutning
1. Ugnen skall placeras på en plan och stabil yta
med god ventilation runt ugnen. Placera inte
ugnen nära andra värmekällor, t ex spis eller
värmeelement.
2. Blockera inte ugnens ventilationsöppningar. Då
kan ugnen överhettas och automatiskt stängas av
genom ett termiskt överhettningsskydd. Ugnen
bör ha minst 10 cm fritt utrymme till närmaste
vägg för att få tillräcklig ventilation. Fötterna får ej
tas bort.
3. Tag bort eventuell förpackningsmaterial inifrån
ugnen. Obs! avlägsna inte den skyddande
plastfil-men på ugnsluckans insida. Den finns
där för att skydda mot stänk och värme. Läs mer
om hur du installerar den roterande glastall-riken
och fästet för denna längre fram i
instruktionsboken.
4. Torka ur ugnen invändigt och på luckans insida
och tätningsytor med en fuktad trasa innan ugnen
används.
Ugnen levereras med sladd och stickpropp för
anslutning till ett separat 230 V 50 Hz, 10 A trög
säkring och jordat vägguttag.
Genom ugnens kompakta mått kan den placeras
nästan var som helst på köksbänken, ett bord eller
flyttas med till sommarhuset. Var alltid noga med att
ugnen skall stå plant och på ett stabilt underlag. Se
också till att ugnens fötter finns på plats för att ugnen
skall få tillräcklig ventilation.
Om ugnen ansluts till vägguttaget med
skarvsladd måste också denna sladd vara av
jordat utförande.
Kontrollera att ugnens spänning överensstämmer
med vägguttagets spänning.
Mikrovågsugnar drar en mycket stor startström och
måste därför anslutas till ett separat avsäkrat, jordat
vägguttag. Andra större apparater som kyl, frys, spis,
diskmaskin och dylikt får alltså inte anslutas på
samma säkring.
Om din bostad är utrustad med automatsäkringar,
måste dessa klara motsvarande krav.
Mikrovågsugnen är försedd med sladd av specialutförande, som om den skadas, måste utbytas
mot sladd av samma typ. Sådan sladd kan
erhållas från AB Elektroservice som även bör
montera denna.
Ansluts ugnen till ett icke jordat vägguttag finns
risk för elektrisk chock, vilket kan leda till skada
på person och/eller egendom.
Kontakta en fackman vid tveksamhet om ugnens
elektriska anslutning.
6
Downloaded From Microwave-Manual.com Manuals
S
EMM2015
Beskrivning av mikrovågsugnen och dess tillbehör
1
2
3
9
5
8
6
4
4
7
10
Montering av den roterande
glastallriken
Ugnen
1. Ugnsutrymme
2. Fönster.
3. Lucka
4. Lucklås.
5. Kontrollpanel.
6. Fäste för den roterande tallriken.
7. Glastallriken
8. Stödet för glastallriken
9. Grillelement
10. Grillgaller
1. Placera stödet för glastallriken på ugnens
botten.
2. Placera glastallriken på stödet. Se till att
uttaget i tallrikens centrum låses i fästet på
ugnens botten.
Placera aldrig tallriken upp och ned.
7
Downloaded From Microwave-Manual.com Manuals
S
EMM2015
Kontrollpanelen
Ugnen får ej köras tom. Om du vill träna, sätt in en
kopp vatten.
Effektväljare.
Tidsinställning.
8
Downloaded From Microwave-Manual.com Manuals
S
EMM2015
Den roterande tallriken
Tillagning
Det är viktigt att tallriken alltid är på plats i ugnen
eftersom den fördelar mikrovågorna jämnt i maten då
den roterar. Den kan rotera både åt höger och
vänster.
1. Placera maten i en lämplig form.
(Se sidan 14 om vilka kärl som går att använda.)
2. Välj önskat effektläge genom att vrida på effektväljaren, beroende på det du tänker tilllaga i
ugnen. Se tabell nedan.
3. Ställ in tiden genom att vrida vredet för tidsinställningen till önskad tid. Markeringarna på vredet
representerar minuter. Önskar du en kort
tillagningstid, 2 minuter eller mindre, skall du vrida
vredet upp till 10-minutersläget, och sedan tillbaks
till önskad tid.
4. Om luckan är stängd eller stängs, startar ugnen
automatiskt
5. När vredet återställs, hörs en signal och ugnen
stängs automatiskt av.
Vägledning för val av Effekt
100W
180W
300W
450W
600W
700W
800W
För mjukgöring av smör, ost och glass. Upptining av skaldjur, kött och fisk.
För mjukgöring av smör, ost och glass. Upptining av skaldjur, kött och fisk.
För upptining av färdiglagade maträtter. Sjudning av såser.
Tining och uppvärmning av bakverk.
För tillagning av rätter som innehåller ägg och ost, samt grytor och försiktig
uppvärmning.
Tining och uppvärmning av bakverk.
För tillagning och uppvärmning av större mängder samt
rätter som du inte kan röra i, t.ex. Janssons frestelse.
För snabb uppvärmning och tillagning av t.ex. fisk och grönsaker.
För snabb uppvärmning av drycker och redan tillagad mat.
Vägledning för val av upptiningstid med 180W
Typ av mat
Kött
Vikt
Effekt
Tid/min
stek
kotletter
stuvning
hamburgare
korv
1 kg
200 g
500 g
200 g
300 g
180W
180W
180W
180W
180W
27-32
8-12
16-20
9-13
11-15
hel kyckling
kycklingdelar
kycklingbröst
1,5 kg
500 g
300 g
180W
180W
180W
38-43
15-20
16-21
fiskblock
fiskfiléer
hel fisk
400 g
300 g
500 g
250 g
180W
180W
180W
180W
16-20
11-16
15-20
7-10
Fågel
Anmärkning
Efter upptining, skölj bort ev. isiga delar
under varmt vatten.
Fisk
Bröd
OBS! Låt alltid maten stå 5-10 minuter, s.k.
Placera brödet direkt på den roterande
tallriken.
utjämningstid, innan du fortsätter tillagningen.
9
Downloaded From Microwave-Manual.com Manuals
S
EMM2015
Tillagning med Grill
Du kan öka eller minska tillagningstiden under
pågående tillagning genom att vrida vredet åt höger
eller vänster.
Om du önskar kan du också lägga till mikrovågseffekt
under pågående tillagning. Vid varje tryckning på
Start adderas ytterligare 30 sekunder till
tillagningstiden.
Ex: Programmera ugnen för Grill i 15 minuter
Gör så här: Detta händer:
1. Ställ in effekt
genom att vrida effektväljaren.
2. Turn the timer to 15
3. The Oven will automatically start cooking for 15 minutes at
(Grill).
Du bör förvärma grillen innan användande.
För att förvärma grillen bör du ställa in den enligt beskrivningen i 3 - 4 minuter.
Tillagning med Mikro och Grill
Du kan öka eller minska tillagningstiden under
pågående tillagning genom att vrida vredet åt höger
eller vänster.
Om du önskar kan du också lägga till mikrovågseffekt
under pågående tillagning. Vid varje tryckning på
Start adderas ytterligare 30 sekunder till
tillagningstiden.
Ex: Programmera ugnen för Grill och Mikro, 450W, i 30 minuter
Gör så här: Detta händer:
1. Ställ in effekt
genom att vrida effektväljaren.
2. Ställ in tiden 30 genom att vrida tidinställning vredet.
3. Ugnen startar och fungerar för 30 minuter med
(Combi 2).
Du behöver ej förvärma grillen för kombinerad mikro- och grilltillagning.
10
Downloaded From Microwave-Manual.com Manuals
S
EMM2015
Tabeller
Rekommendationer för tillagning med Grill
Typ av mat
Varma smörgåsar
Grillkorv
Kvantitet/vikt
2 st
4 st
Tillagningstid
5 – 6 min.
7 – 8 min.
Gör så här:
Vänd efter halva tiden.
Rekommendationer för tillagning med Mikro och Grill
Typ av mat
Bacon
Rostbiff (benfri)
Fläskkotletter
Kvantitet/vikt
4(100 g)
900 g
Funktion
Grill+300W
1.Mikroeffekt
Endast 600W
2. Grill+300W
Tillagningstid
8- 10 min
1. 25 min
2. 7-8 min
2 - 3(450 g)
Grill+300W
22 - 27 min
450 g
800 g
Grill+300W
Grill+300W
17 - 22 min
27 - 32 min
Hamburgare
djupfryst
Korv
Fiskkotlett
4 (200 g)
Grill+300W
14 - 17 min
450 g
2 (350 g)
Grill+300W
Grill+300W
12 - 17 min
24 – 26 min
Pyttipanna/
potatisklyftor,
fryst
2 (150 g)
Grill+300W
18 – 20 min
Kyckling, halv /
klubba
Gör så här:
Pensla med olja. Salta, och
peppra. Låt stå i 15 – 20
minuter efter tillredningen.
Pensla med olja. Salta och
peppra. Och smaksatt med
paprika.
Pensla med olja. Salta och
peppra. Och smaksatt med
paprika.
Pensla med olja. Salta och
peppra.
Val av mikro- och grilleffekt
Symbol
Funktion
Mikroeffekt
Grilleffekt
Grill
0W
1000W
Combi 1
300W
1000W
Combi 2
450W
1000W
Combi 3
600W
1000W
11
Downloaded From Microwave-Manual.com Manuals
S
EMM2015
Kom ihåg
•
•
•
•
•
•
Ju större mängd, desto längre tid.
Kalla matvaror tar längre tid än rumstempererade.
Porösa matvaror kräver kortare tid än kompakta.
Maträtter som innehåller mycket vatten tilllagas
fortare.
Salta först när köttet är klart. Salt gör lätt köttet
segt och torrt.
•
Låt alltid rätten få stå minst fem minuter för temperaturutjämning.Utjämningstiden ökar i
förhållande till rättens storlek och konsistens.
Det är bättre att välja den kortast angivna tiden i
ett recept och sedan öka än att överkoka maten.
Praktiska råd och tips
Allmänna
Upptining
I handeln finns många bra kokböcker med tips och
recept för att underlätta olika moment vid matlagning
och bakning. Börja alltid med den kortaste
tillagningstiden i recept och tabeller.
•
•
•
•
•
•
•
•
•
Du kan också lätt använda dina vanliga recept.
Minska på salt, kryddor och vatten. Inget kokar ju
bort.
Den mesta maten kokas i sitt eget spad. Torra
varor som ris och bönor behöver naturligtvis
vätska.
Täck maten vid tillagning och uppvärmning för att
bibehålla fuktigheten och för att undvika onödig
nedsmutsning.
Bakverk kan tinas direkt i brödkorg eller på
hushållspapper. Fyllning av sylt blir alltid mycket
varmare än bakverket.
Stek inte bacon direkt på glastallriken. För stora
temperaturskillnader kan orsaka skada eller
sprickor på brickan.
Korv, äpple, potatis, lever och äggula är exempel
på matvaror som bör prickas för att skalet eller
hinnan spricker.
Kokkärl
Kontrollera att materialet i kärl som används är lämpligt. Vissa plaster kan bli ”sladdriga” och förlora formen. Andra plaster och vissa typer av keramik kan
spricka, speciellt om små matmängder värms.
Använd inte metallkärl.
PORSLIN – De flesta typer av porslin med undantag
av porslin med metalldekor. Guld- eller silverdekor
förstörs. Det finns också porslinsglasyrer som
innehål-ler metall. Om du är osäker, testa enligt
metoden som
anges nedan.
GLAS – Allt glas passar bra utom kristall och visst
färgat glas.
PLAST – Plastmuggar eller burkar kan du använda
för att värma i men inte koka i. De flesta
hushållsplaster tål inte mer än 90°C. Kontrollera
vilken temperatur de tål.
LERGODS – Stengods och lergods går att använda.
Den bruna lergrytan skall blötläggas som vanligt.
METALL – Metallkärl högre än 3 cm passar inte för
matlagning i mikrovågsugnen. Mikrovågorna kan inte
assera genom metall, så man får bara påverkan
ovanifrån och resultatet blir därför inte bra.
Tillagning och uppvärmning
•
•
•
•
Du kan tina köttet i sin förpackning. Se till att
avlägsna eventuella delar av förpackningen som
innehåller metall av olika slag.
Placera de tunnare delarna av det som skall tinas
mot mitten av kärlet.
Efter upptiningstidens slut kan det fortfarande
finnas is i matens centrum. För att få bästa
resultat skall maten därför stå en stund, s. k.
utjämningstid.
Innan du börjar tillaga maten, se till att den är
ordent-ligt tinad.
Placera de tunnare delarna av det som skall
tillagas mot mitten av kärlet.
Tillagningstiden kan variera beroende på matens
temperatur, rumsvarm eller kylskåpskall, samt
efter eget tycke och smak.
Rör om i grytor, såser och dyligt för att få en
jämnare tillagning.
Om metallkärl eller aluminiumfolie placeras för
nära ugnens väggar kan detta ge upphov till
gnist- bildningar och brännmärken kan uppstå.
Tänk på att ta bort metallclips på tepåsar och
brödförpackningar.
12
Downloaded From Microwave-Manual.com Manuals
S
EMM2015
Så här testar du om ett kärl är lämpligt att använda i mikrovågsugnen
Kärl kan testas genom att man ställer det tomt mitt I ugnen. Placera en kaffekopp med vatten bredvid och
värm sedan på full effekt i en minut. Efteråt bör kärlet inte på något ställe ha blivit mer än handvarmt.
Det här kan du inte göra i mikrovågsugnen
•
•
•
• Använda vanlig stektermometer.
Specialtermometer för mikrovågsugnar finns i
handeln.
Baka jäsdegsbröd – det får ingen färg.
Grädda suffléer.
Koka hela ägg med skal eller återuppvärma.
Rengöring och skötsel.
•
•
Använd inte ugnsrengöringsmedel eller andra frätande eller slipande rengöringsmedel. Torka ugnens utsida och insida med en mjuk och fuktad trasa, använd handdiskmedel om så behövs.
Torka upp eventuell kondens som bildas i ugnen, vid tillagning, med en mjuk trasa eller t. ex.
hushållspapper.
Om mikrovågsugnen inte fungerar
•
•
•
•
•
Är ugnen ansluten till vägguttaget?
Är säkringen (proppen) hel?
Är luckan stängd?
13
Downloaded From Microwave-Manual.com Manuals
Har du valt tillagningstid?
Har du tryckt på start?
S
EMM2015
Service och reservdelar (i Finland)
Innan du kontaktar service, skriv upp följande
enligt dataskylten:
Alla servicearbeten, reservdelsbeställningar och
Eventuella reparationer får utföras endast av ett
auktoriserat serviceföretag. Information om det
närmaste auktoriserade serviceföretaget får du från
numret 0200-2662 (0,1597 €
€ /min+lna), *eller
telefonkatalogens gula sidor
“hushållsapparatservice”.
Mod:
SER. No:
Innan du beställer service, enligt EHL
åtagandet, kontrollera först om du kan
avhjälpa felet själv.
Inköpsdatum:
Läs igenom bruksanvisningen och följ de råd och
anvisningar som ges i avsnittet “Om mikrovågsugnen inte fungerar” för att försäkra dig om att
du inte kan åtgärda felet på egen hand.
Observera, elektriska fel skall alltid åtgärdas av
certifierad elektriker.
Konsumentrådgivning i Finland
Vid eventuella tekniska problem eller om du
har frågor angående maskinens funktion eller
användning, ber vi dig ringa vår
konsumentrådgivare, tel. 0200-2662 (0,1597 €
€
/min+lna). Konsumentrådgivaren kan också
kontaktas via elektronisk post, address
carelux.fsh@electrolux.fi.
För att säkra maskinens klanderfria funktion skall
man vid reparationer använda endast original
reservdelar.
Garanti i Finland
Produktens garantitid kan definieras separat.
Finns det ingen definierad garantitid, har
produkten garanti enligt den gällande
lagstiftningen och de lokala bestämmelserna.
Garantivillkoren uppfyller branchens allmänna
villkor enligt den gällande lagstiftningen. Spara
inköpskvittot, som avgör garantitidens början.
Kostnaderna kan debiteras även under den tid
som omfattas av kostnadsfri service
- vid onödigt servicebesök.
- Om tillverkarens anvisningarna för
installation, användning och skötsel inte
följts.
14
Downloaded From Microwave-Manual.com Manuals
B
EMM2015
6DGUåDM
3ULMHXSRUDEHYDãHPLNURYDOQHSHüQLFH
...................................... 4
Sigurnosne upute ......................................................................... 4
.......... 4
D ........................................................ 5
- Sigurnost namirnica ...................................................................... 5
9RGLþNUR]SULERULRSUHPXSHüQLFH .............................................. 6
6LJXUQRVQHQDSRPHQH]DSULSUHPXKUDQHSRPRüXURãWLOMD
3URYMHUDSULNODGQRVWLSRVX
7HKQLþNLSRGDFL
............................................................................. 6
............................ 7
....................................................................... 7
3ULSUHPD]DXNOMXþLYDQMHPLNURYDOQHSHüQLFH
6NLGDQMHDPEDODåH
Postavljanje ................................................................................... 7
.................................................... 7
(OHNWULþNLSULNOMXþDN ....................................................................... 7
3ULNOMXþDNQDPUHåQRQDSDMDQMH
................................... 8
- Naziv i funkcija dijelova................................................................. 8
- Postavljanje okretnog tanjura ....................................................... 8
8SUDYOMDþNDSORþD ......................................................................... 9
- Kuhanje s mikrovalovima............................................................ 10
9RGLþ]DSRGHãDYDQMHVQDJHPLNURYDORYD .................................. 10
- Kuhanje sa roštiljem ................................................................... 11
- Kuhanje sa mikrovalovima i roštiljem.......................................... 11
3UHSRUXNH]DSULSUHPXKUDQHSRPRüXURãWLOMD ............................ 12
3UHSRUXNH]DNXKDQMHSRPRüXPLNURYDORYDLURãWLOMD ................. 12
- Razine snage mikrovalova i roštilja ............................................ 12
- Upute za odmrzavanje................................................................ 13
1DWXNQLFHRPLNURYDOQRMSHüQLFL ................................................. 14
2GUåDYDQMHLþLãüHQMH.................................................................. 15
ýLãüHQMHRSUHPHRNUHWQLWDQMXULSRGXSLUDþ .............................. 15
ýLãüHQMHXQXWUDãQMRVWL................................................................. 15
ýLãüHQMHYDQMVNRJGLMHODSHüQLFH ................................................ 15
.DNRVHNRULVWLYDãDPLNURYDOQDSHüQLFD
Servis i nadomjesni dijelovi....................................................... 16
3
Downloaded From Microwave-Manual.com Manuals
B
EMM2015
ýHVWLWDPRQDNXSRYLQLYDãHQRYHPLNURYDOQHSHüQLFH
+YDODYDPQDRGDELUX(OHFWUROX[SURL]YRGD6LJXUQLVPRGDüHYDPQRYDPLNURYDOQDSHüQLFDELWLYUORNRULVQDLRGYHOLNH
SRPRüL.DRãWRMHVOXþDMLVRVWDOLPQRYLPNXKLQMVNLPXUH
DMLPDSRWUHEQRMHRGUH
HQRYULMHPHGDQDXþLWHVYHQRYHIXQNFLMHL
PRJXüQRVWLDOLVYUHPHQRPRYDSHüQLFDüHYDPSRVWDWLQH]DPMHQMLYD
3ULMHXSRUDEHYDãHPLNURYDOQHSHüQLFH
3DåOMLYRSURþLWDMWHXSXWH]DXSRUDEX8SXWHNRMHVOLMHGHSULSUHPOMHQHVXNDNRELYDPRPRJXüLOHRSWLPDOQRNRULãWHQMHYDãHQRYH
PLNURYDOQHSHüQLFH
0ROLPRYDVGDLKSURþLWDWHSDåOMLYR9UORMHYDåQRGDRYHXSXWHVDþXYDWHX]XUH
SRVXGLWHGUXJRMRVRELLOLDNRVHSUHVHOLWHLRVWDYLWHXUH
DM]DGDOMQMHNRULãWHQMH$NRXUH
DMXYLMHNSURYMHULWHGDOLVXXSXWHSRKUDQMHQHX]XUH
YODVQLNPRJDRXSR]QDWLVQDþLQRPUDGDLRGJRYDUDMXüLPXSR]RUHQMLPD0ROLPRYDVGDSULMHNRULãWHQMDXUH
DMSURGDWHLOL
DMNDNRELVHQRYL
DMDSURþLWDWHRYH
upute u potpunosti i potom slijedite dane preporuke.
Sigurnosne upute
•
•
8JUD
HQLVLJXUQRVQLSUHNLGDþ]DEORNDGX
•
1HNRULVWLWHXQXWUDãQMRVWSHüQLFHNDRVSUHPQLN
RQHPRJXüDYDNRULãWHQMHPLNURYDOQHSHüQLFHGRN
Ne ostavljajte papirnate proizvode, pribor za
su otvorena vrata.
NXKDQMHLOLKUDQXXXQXWUDãQMRVWLSHüQLFHNDGDMX
1H³SUþNDMWH´RNRYUDWDLQHSRNXãDYDMWHXNOMXþLWL
ne koristite.
SHüQLFXDNRVXYUDWDRWYRUHQDMHUVHQDWDMQDþLQ
•
Sigurnosne napomene za pripremu
PRåHWHL]ORåLWLHQHUJLMLPLNURYDORYD
Ne dopustite prosipanje hrane ili nakupljanje
KUDQHSRPRüXURãWLOMD
RVWDWDNDVUHGVWYD]DþLãüHQMHQDSRYUãLQLEUWYH
YUDWD3RJOHGDMWHSRJODYOMHýLãüHQMHLRGUåDYDQMH
•
•
]DXSXWHXYH]LþLãüHQMD
1HNRULVWLWHRãWHüHQXUH
DMGRNJDQHSRSUDYL
VWUXþQDLRYODãWHQDVHUYLVQDRVRED
1.
6WDNORSUR]RUDPRåHSXNQXWLDNRMHSRQMHPX
2.
prolivena voda za vrijeme korištenja roštilja.
Koristite zaštitne termo-rukavice pri punjenju i
SUDåQMHQMXSHüQLFH3RVXGHXSHüQLFLPRJX
3RVHEQRMHYDåQRGDYUDWDSHüQLFHEXGXSUDYLOQR
SRVWDWLMDNRYUXüH]DWRSD]LWHGDVHQHRSHþHWH
]DWYRUHQDLGDQHPDRãWHüHQMDQDYUDWLPD
•
(svinuta), (2) šarkama i zasunima (slomljeni ili
nesigurni), (3) brtve na vratima i površini brtve
vrata.
2NUHWQLWDQMXULUHãHWNDWDNR
PHWDOQLPSUHWPHWLPD8QXWUDãQMRVWYUDWDLSHüQLFH
QHVWUXþQLSRSUDYFLPRJXX]URNRYDWLR]OMHGHL
SRVWDMXMDNRYUXüLSD]LWHSULOLNRP
XJUR]LWLIXQNFLRQLUDQMHSHüQLFH$NRWUHEDWH
•
ovlaštenom servisu.
•
VWDYOMDQMDSRVOXåLYDQMDKUDQH
4.
Ne stavljajte okretni tanjur ili posude u hladnu
vodu, ne pokušavajte ih brzo ohladiti nakon
uporabe.
5.
1HVWDYOMDMWHSUHGPHWHQDSHüQLFX*RUQMLGLR
1LNDGDQHVNLGDMWHYDQMVNRNXüLãWHYUDWDLOL
XSUDYOMDþNXSORþX$NRWRXþLQLWHSRVWRMLRSDVQRVW
od izlaganja iznimno visokom naponu.
XUH
3RVWDYOMDQMHLVPMHãWDQMHRYHSHüQLFHL]YUãLWH
2YDMXUH
XRELþDMHQRMHGDVHRNRYUDWDVWYDUDSDUDLOLGDVH
YUDWD]DPDJOHLOLþDNGDVHLVSRGYUDWDSRMDYH
DMNRULVWLWHVDPRXVYUKH]DNRMHMH
kapljice vode. To je tek rezultat kondenzacije od
proizveden, kao što je opisano u ovom uputstvu.
Ne koristite korozivna kemijska sredstva u
XUH
DMDSRVWDMHMDNRYUXüVYHãWRVWDYLWHQDQMHJD
moglo bi se oštetiti. Za vrijeme kuhanja
samo u skladu s poglavljem “UPUTE ZA
POSTAVLJANJE” ovih uputa.
•
3ULOLNRPSXQMHQMDLOLSUDåQMHQMDSHüQLFHQH
dodirujte vanjsku ili unutrašnju stranu prozora
1LNDGQHSRNXãDYDMWHVDPLSRSUDYOMDWLSHüQLFX
VHUYLVQXXVOXJXSRWUDåLWHMHXQDMEOLåHP
HUSRVWDMXMDNRYUXüL
koristite rukavice i kada njima baratate.
3.
WRSOLQHKUDQHLQHXWLþHQDVLJXUQRVWSHüQLFH
Vrata nisu namijenjena potpunom brtvljenju
DMX2YDMWLSSHüQLFHSRVHEQRMHGL]DMQLUDQ]D
SHüQLFH
zagrijavanje, kuhanje ili odmrzavanje hrane.
8UH
DMQLMHQDPLMHQMHQ]DLQGXVWULMVNX
laboratorijsku ili komercijalnu uporabu i u tom
•
1HNRULVWLWHSHüQLFXDNRMHSUD]QD$NRQHPD
hrane ili vode za apsorpciju mikrovalne energije,
•
•
•
•
1HRNUHüLWHUXNRPRNUHWQLWDQMXU7RPRåHGRYHVWL
do kvara.
VOXþDMXJXELWHSUDYRQDMDPVWYR
•
,VNUHQMHXSHüQLFL]DYULMHPHNRULãWHQMD
PLNURYDORYDQDMþHãüHMHSRVOMHGLFDNRULãWHQMD
PRåHGRüLGRRãWHüHQMDFLMHYLPDJQHWURQD
PHWDOQRJSULERUD.RQWLQXLUDQRLVNUHQMHPRåH
'MHFDVPLMXNRULVWLWLSHüQLFXVDPRX]VWURJL
RãWHWLWLXUH
nadzor.
pribor.
1HVSUHPDMWHXUH
DM=DXVWDYLWHSURJUDPLSURYMHULWH
DML]YDQNXüH1HNRULVWLWHRYDM
proizvod u blizini vode.
•
3D]LWHGDQH]DþHSLWHELORNRMLRGRWYRUD]D
1HSRNXãDYDMWHVXãLWLRGMHüXLOLQRYLQHX
SURYMHWUDYDQMHVPMHãWHQLKQDJRUQMRMVWUDåQMRM
PLNURYDOQRMSHüQLFL0RåHGRüLGRSRåDUD
ERþQRMLGRQMRMVWUDQLFLSHüQLFH
4
Downloaded From Microwave-Manual.com Manuals
B
EMM2015
3URYMHUDSULNODGQRVWLSRVX D
•
3RVWDYLWHSRVXGXXPLNURYDOQXSHüQLFX]DMHGQR
Sigurnost namirnica
•
VDþDãRPQDSXQMHQRPGRSRORYLFHYRGRP
Zagrijavajte je na 800 W (100%) jednu minutu.
$NRMHQDNRQWRJDSRVXGDYUXüDQHELMHWUHEDOL
•
•
spremnik.
3UåHQMHXXOMXIULWLUDQMHQHPRåHWHYUãLWLX
NRULVWLWL$NRMHODJDQR]DJULMDQDPRåHWHMH
PLNURYDOQRMSHüQLFLMHUVHWHPSHUDWXUDPDVWLQH
koristiti za prigrijavanje ali ne i za kuhanje. Ako je
posuda sobne temperature, prikladna je za
mikrovalno kuhanje.
PRåHNRQWUROLUDWLãWRPRåHGRYHVWLGRRSDVQLK
•
3DSLUQDWLXEUXVLYRãWDQLSDSLUSDSLUQDWLUXþQLFL
WDQMXULþDãHRPRWL]D]DPU]LYDþLNDUWRQLVX
pribor velike prikladnosti. Uvijek budite sigurni da
MHVSUHPQLNQDSXQMHQKUDQRPNRMDüHDSVRUELUDWL
•
Ne zagrijavajte hranu u konzervama u mikrovalnoj
SHüQLFL8YLMHNSUHEDFLWHKUDQXXSULNODGDQ
•
HQHUJLMXLXNORQLWLPRJXüQRVWSUHJULMDYDQMD
5D]QRSODVWLþQRSRVX
ali samo u posebnim pakiranjima ili priboru
dizajniranom posebno za ovu namjenu. Ova
operacija kuhanja se nikada ne bi trebala izvoditi
bez nadzora.
1DPLUQLFHVQHSRUR]QRPNRåLFRPLOLOMXVNRP
probušite kako bi izbjegli stvaranje pare i
HþDãHVSUHPQLFL]D
]DPU]LYDþLSODVWLþQLRPRWLPRJXVHNRULVWLWLX
PLNURYDOQRMSHüQLFL6OLMHGLWHXSXWHSURL]YR
situacija.
.RNLFHPRåHWHSULSUHPDWLXPLNURYDOQRMSHüQLFL
UDVSUVNDYDQMH-DEXNHNUXPSLULSLOHüDMHWUDL
DþD
åXPDQMFLVXSULPMHUQDPLUQLFDNRMHWUHEDSUREXãLWL
NDGDNRULVWLWHSODVWLNXXSHüQLFL,]EMHJDYDMWH
•
NRULãWHQMHSODVWLþQRJSULERUDVKUDQRPNRMDVDGUåL
UPOZORENJE:.DGD]DJULMDYDWHWHNXüLQHNDRãWRVX
YLVRNLSRVWRWDNPDVQRüDLOLãHüHUDWDKUDQD
QSUMXKHXPDFLLQDSLWFLXYDãRMPLNURYDOQRMSHüQLFL
SRVWLåHYLVRNHWHPSHUDWXUHLPRåHUDVWRSLWLQHNH
PRåHVHGRJRGLWLSUHJULMDYDQMHWHNXüLQHL]QDGWRþNH
plastike.
YUHQMDEH]YLGOMLYLKPMHKXULüD7RPRåHUH]XOWLUDWL
1HRVWDYOMDMWHSHüQLFXEH]QDG]RUDSRJOHGDMWHMH
L]QHQDGQLPNOMXþDQMHPYUXüHWHNXüLQH.DNREL
s vremena na vrijeme kada podgrijavate ili kuhate
VSULMHþLOLRYXPRJXüQRVWXþLQLWHVOMHGHüH
KUDQXXSODVWLþQLPSDSLUQDWLPLOLRVWDOLP
zapaljivim spremnicima. Ako ste zapazili dim,
1.
Izbjegavajte korištenje spremnika s pravilnim
stranicama i uskim grlima.
2.
3.
1HSUHJULMDYDMWHWHNXüLQX
]DGUåLWHYUDWD]DWYRUHQLPDLVNOMXþLWHSHüQLFXLOL
•
L]YXFLWHPUHåQLXWLNDþGRNGLPQHQHVWDQH
Metalni pribor i pribor s metalnim ukrasima ne bi
zagrijavanja.
SRVHEQRSUHSRUXþHQ]DXSRUDEXXPLNURYDOQRM
•
SHüQLFL
Spremnici sa malim otvorima, kao što su boce, ne
bi trebali biti korišteni za mikrovalno kuhanje.
Budite oprezni pri skidanju poklopaca ili pokrova s
SRVX
DNDNRELL]EMHJOLRSHNOLQHSDURP
3URPLMHãDMWHWHNXüLQXSULMHVWDYOMDQMDVSUHPQLNDX
SHüQLFXLSRQRYLWHWRQDSRODSXWDNUR]YULMHPH
WUHEDOLNRULVWLWLXPLNURYDOQRMSHüQLFLRVLPDNRQLMH
4.
1DNRQ]DJULMDYDQMDRVWDYLWHVSUHPQLNXSHüQLFL
kratko vrijeme, promiješajte ponovno prije
SDåOMLYRJXNODQMDQMDVSUHPQLND
•
Neki proizvodi kao što su cijela jaja i zabrtvljeni
spremnici - kao što su npr. zatvorene staklenke mogu eksplodirati i ne smiju se zagrijavati u ovoj
SHüQLFL3RYUHPHQRMDMDPRJXHNVSORGLUDWLL]D
vrijeme dok se peku. Zato uvijek probušite
åXPDQMDN]DWLPSRNULMWHLSXVWLWHGDRGVWRMLMHGQX
minutu prije skidanja pokrova.
NAPOMENA:
•
1HRNUHüLWHUXNRPRNUHWQLWDQMXU7RPRåHGRYHVWL
do kvara.
•
,VNUHQMHXSHüQLFL]DYULMHPHNRULãWHQMD
PLNURYDORYDQDMþHãüHMHSRVOMHGLFDNRULãWHQMD
PHWDOQRJSULERUD.RQWLQXLUDQRLVNUHQMHPRåH
RãWHWLWLXUH
•
DM=DXVWDYLWHSURJUDPLSURYMHULWH
pribor.
3D]LWHGDQH]DþHSLWHELORNRMLRGRWYRUD]D
SURYMHWUDYDQMHVPMHãWHQLKQDJRUQMRMVWUDåQMRM
ERþQRMLGRQMRMVWUDQLFLSHüQLFH
1HNRULVWLWHRYXSHüQLFXXNRPHUFLMDOQHVYUKH
2YDSHüQLFDQDþLQMHQDMHVDPR]DNRULãWHQMHX
GRPDüLQVWYLPD
ýXYDMWHRYHXSXWH
5
Downloaded From Microwave-Manual.com Manuals
B
EMM2015
9RGLþNUR]SULERULRSUHPXSHüQLFH
5D]QLSULERULPDWHULMDOLPRJXVHNRULVWLWL]DNXKDQMHXYDãRMPLNURYDOQRMSHüQLFL=DYDãXVLJXUQRVWNDNREL
VSULMHþLOLRãWHüHQMDSULERUDLYDãHSHüQLFHRGDEHULWHRGJRYDUDMXüLSULERULPDWHULMDOH]DVYDNXYUVWXNXKDQMD
7DEHODLVSRGWHNVWDMHRSüHQLWLYRGLþ
Materijal
Pribor
Keramika i staklo
-HGQRVWDYQRSRVX
1DþLQNRULãWHQMD
H
9DWURVWDOQRVWDNOHQRSRVX
6WDNOHQRSRVX
Porculan
ukrasima
Olovo-kristal staklo
Bez metalnih ukrasa
/RQþDUVNL
proizvodi*2
Plastika
3RVX
H
HVPHWDOQLP
H]DPLNURYDOQX
Mikrovalovi
DA
DA*1
NE
Roštilj
DA
DA
NE
Kombinacija
DA
DA*1
NE
NE
DA
DA
NE
DA
DA
NE
NE
DA
DA
NE
NE
DA
NE
DA
DA
DA
NE
NE
DA
DA
DA
DA
NE
NE
NE
DA
DA
DA
NE
DA
NE
NE
NE
DA
DA
DA
SHüQLFXRWSRUQRQDWRSOLQX
3ODVWLþQLRPRW
Metal
3RVXGH]DSHþHQMH
Aluminijska folija*3
Papir
ýDãHWDQMXULUXþQLFL
Voštani papir
Drvo
Oprema
Rešetka roštilja
Okretni tanjur
3RGXSLUDþRNUHWQRJWDQMXUD
DA: Pribor i oprema za uporabu
NE: Pribor i oprema koju treba izbjegavati
*1: Samo ako nema metalnih ukrasa.
6DPRDNRQHPDJOD]XUXNRMDVDGUåLPHWDOH
$OXPLQLMVNXIROLMXNRULVWLWHVDPRNDR]DãWLWXSUHWMHUDQRNRULãWHQMHPRåHX]URNRYDWLLVNUHQMH
7HKQLþNLSRGDFL
13.5 kg
Ukupne dimenzije
7HåLQD
Širina 484 mm
Dubina 376 mm
Visina 285 mm
Volumen 20 litara
3ULNOMXþDN
230V, 50 Hz
Dimenzije unutrašnjosti
Širina 300 mm
Dubina 292 mm
Visina 195 mm
Potrošnja energije 1300W
Roštilj 1000W
Snaga
Mikrovalovi 800W
Roštilj 1000 W
6
Downloaded From Microwave-Manual.com Manuals
B
EMM2015
3ULSUHPD]DXNOMXþLYDQMHPLNURYDOQHSHüQLFH
8NODQMDQMHDPEDODåH
3ULNOMXþDNQDPUHåQRQDSDMDQMH
.DGDRWSDNLUDWHSHüQLFXSURYMHULWHGDOLMHSURL]YRG
3HüQLFDVHLVSRUXþXMHVPUHåQLPNDEHORPLXWLNDþHP
EH]RãWHüHQMD(YHQWXDOQDRãWHüHQMDLOLDNRQHGRVWDMH
QHNLGLRRGPDKPRUDWHMDYLWLLVSRUXþLWHOMX3HüQLFD
za 230 V, 50 Hz sa zaštitnim uzemljenjem. Uzemljenje
umanjuje rizik kod pojave kratkog spoja. Provjerite
GLMHORYLSHüQLFHLOLRSUHPDPRJXELWLRPRWDQL]DãWLWQRP
RGJRYDUDOLQDSRQSHüQLFHQDSRQXQDSDMDQMD
folijom. Ako je to tako, morate ukloniti foliju prije
NRULãWHQMDSHüQLFH1HRVWDYOMDMWHXNORQMHQLPDWHULMDO]D
$NRMHSHüQLFDSULNOMXþHQDQDPUHåQLQDSRQSXWHP
SDNLUDQMHQDGRKYDWXPDORMGMHFL7RPRåHELWLYUOR
SURGXåQRJNDEHODRQLVWRWDNRPRUDELWLX]HPOMHQ
opasna igra.
Upozorenje!2YDMXUH DMQHVPLMHELWLVSRMHQQDL]YRU
napajanja bez uzemljenja.
Postavljanje
1.
2.
Uklonite sve reklamne naljepnice s vrata.
3RVWDYLWHSHüQLFXQDUDYQXXUDYQRWHåHQX
SRGORJX3RYUãLQDPRUDELWLGRYROMQRMDNDGDL]GUåL
WHåLQXNJSHüQLFHLVDGUåDMD.DNREL
L]EMHJOLPRJXüQRVWVWYDUDQMDYLEUDFLMDLOLEXNH
SHüQLFDPRUDELWLXVWDELOQRPSRORåDMX
3.
'UåLWHSHüQLFXSRGDOMHRGL]YRUDWRSOLQHLYRGH
,]ODJDQMHWRSOLQLLYRGLPRåHVPDQMLWLHILNDVQRVW
SHüQLFHLGRYHVWLGRNYDURYDWDNRGDREYH]QR
SURYMHULWHGDMHSHüQLFDSRVWDYOMHQDGDOMHRG
4.
izvora topline i vode.
Ne pokrivajte otvore za provjetravanje na gornjoj i
ERþQLPVWUDQLFDPDNXüLãWDWHLVWRWDNRQH
.RQWDNWLUDMWHRYODãWHQRJHOHNWULþDUDDNRLPDWH
QHGRXPLFDYH]DQRX]HOHNWULþNLSULNOMXþDNSHüQLFHLOL
osiguranja zaštitnog uzemljenja.
2YDMXUH
DMPRUDELWLX]HPOMHQ$NRMHRYDMXUH
DM
RSVNUEOMHQPUHåQLPXWLNDþHPNRMLQHRGJRYDUDYDãRM
XWLþQLFLXWLNDþWUHEDRGUH]DWLLSRVWDYLWLRGJRYDUDMXüL
$NRMHQXåQDL]PMHQDRVLJXUDþDXXWLNDþXSRNORSDF
RVLJXUDþDPRUDVHYUDWLWLQDPMHVWR$NRMHSRNORSDF
L]JXEOMHQLOLRãWHüHQXWLNDþVHQHVPLMHNRULVWLWLGRNVH
ne izvrši zamjena.
(OHNWULþNLSULNOMXþDN
stavljajte nikakve predmete na gornju stranicu
SHüQLFH$NRVXRWYRUL]DSURYMHWUDYDQMHSRNULYHQL
832=25(1-(29$-85(
]DYULMHPHUDGDSHüQLFDVHPRåHSUHJULMDWLãWR
UZEMLJEN.
$-025$%,7,
PRåHGRYHVWLGRNYDUD9UXüL]UDNL]OD]LNUR]
RWYRUH]DWREXGLWHVLJXUQLGDQLVX]DþHSOMHQLLOLGD
QLMHSDOD]DYMHVDL]PH
5.
XSHüQLFHLVWUDåQMHJ]LGD
3RVWDYLWHSHüQLFXãWRMHGDOMHPRJXüHRGUDGLRL
79SULMHPQLND2YDSHüQLFDRGJRYDUD((&
3URL]YR
•
zahtjevima* u vezi potiskivanja radio-smetnji, ali
neke smetnje se ipak mogu pojaviti ako je
smještena preblizu radio ili TV prijemniku, tako da
MHGUåLWHãWRMHGDOMHPRJXüH
6.
Ako je smještena u kutu, ostavite razmak od
najmanje 10 cm od zidova, kako bi se osiguralo
pravilno provjetravanje.
9DåQR3HüQLFDPRåHELWLVPMHãWHQDJRWRYRQDELOR
NRMHPPMHVWXXNXKLQML3URYMHULWHGDOLMHSHüQLFD
smještena na glatku, vodoravnu površinu i da otvori za
SURYMHWUDYDQMHNDRLSRYUãLQDLVSRGSHüQLFHQLVX
blokirani (za efikasno provjetravanje).
2YDMXUH
DþRGELMDVYDNXRGJRYRUQRVWDNRVHQH
SULGUåDYDWHRYLKVLJXUQRVQLKPMHUD
DMRGJRYDUD]DKWMHYLPDGDQLPX((&
odredbi o radio-smetnjama 87/308/EEC.
7
Downloaded From Microwave-Manual.com Manuals
$NRXWLNDþQDYDãHPXUH
DMXQHRGJRYDUDXWLþQLFL
WUHEDJDRGUH]DWLL]DPLMHQLWLRGJRYDUDMXüLP
XWLNDþHP
B
EMM2015
.DNRVHNRULVWLYDãDPLNURYDOQDSHüQLFD
1
2
3
9
5
8
6
4
4
7
10
Naziv i funkcija dijelova
Postavljanje okretnog tanjura
1.
Odjeljak za kuhanje. Obrišite odjeljak nakon
uporabe.
3RVWDYLWHSRGXSLUDþRNUHWQRJWDQMXUDQDGQR
2.
3UR]RU+UDQXPRåHWHNRQWUROLUDWL]DYULMHPH
3RVWDYLWHRNUHWQLWDQMXUQDYUKSRGXSLUDþD
UDGDPLNURYDOQHSHüQLFH
okretnog tanjura kao što je prikazano na slici.
Provjerite da li je središte okretnog tanjura sigurno
uglavljeno u pogonsku osovinu okretnog tanjura.
Nikada ne postavljajte okretni tanjur naopako.
• Za vrijeme kuhanja obavezno morate koristiti i
3.
4.
5.
6.
7.
9UDWDSHüQLFH=DYULMHPHSULSUHPHKUDQHYUDWD
moraju uvijek biti dobro zatvorena.
Kuke zasuna i sigurnosni sistem zabravljivanja.
8SUDYOMDþNDSORþD
Pogonska osovina okretnog tanjura.
Okretni tanjur. Napravljen je od posebnog
vatrostalnog stakla. Hranu za kuhanje postavite
na njega u prikladnom spremniku. Ne koristite
SHüQLFXEH]RNUHWQRJWDQMXUD
8.
3RGXSLUDþRNUHWQRJWDQMXUD3RVWDYLWH
XQXWUDãQMRVWLSHüQLFH
RNUHWQLWDQMXULSRGXSLUDþRNUHWQRJWDQMXUD
• Sva hrana i spremnici hrane moraju se uvijek
postaviti na ovaj tanjur za vrijeme kuhanja.
• Ovaj tanjur se vrti u smjeru kazaljki na satu i u
smjeru suprotnom od kazaljki na satu; to je
normalno.
SRGXSLUDþQDGQRRGMHOMND]DNXKDQMHNDNREL
poduprli okretni tanjur.
9. Roštilj.
10. Rešetka roštilja.
Okretni tanjur
3RGXSLUDþVYDOMþLüLPD
Pogonska osovina
okretnog tanjura
8
Downloaded From Microwave-Manual.com Manuals
B
EMM2015
8SUDYOMDþNDSORþD
1.
Kontrola za odabir snage
Namjestite kontrolu tako da odredite ispravnu
snagu za vašu hranu.
2.
Vremenski sklop
1DPMHVWLWHåHOMHQRYULMHPHNXKDQMD
.XKDQMHüH]DSRþHWL
Svi satni vremenski
VNORSRYLUDGLWüHWRþQLMHDNRSULQDPMHãWDQMX
PDORSUHNRUDþLWHåHOMHQRYULMHPHLSRWRPLK
vratite.
9
Downloaded From Microwave-Manual.com Manuals
B
EMM2015
Kuhanje s mikrovalovima
1.
Otvorite vrata, smjestite hranu na okretni tanjur.
Zatvorite vrata.
Kad kuhate manje od 2 minute, okrenite kontrolu
vremenskog sklopa na dulje trajanje i potom je vratite
2.
1DPMHVWLWHNRQWUROX]DRGDELUVQDJHGRåHOMHQH
QDåHOMHQRYULMHPH
razine snage (vidi tablicu).
$NRåHOLWHLVNOMXþLWLSHüQLFXWLMHNRPNXKDQMD
3.
1DPMHVWLWHYUHPHQVNLVNORSGRåHOMHQRJYUHPHQD
jednostavno okrenite kontrolu vremenskog sklopa na
0.
3HüQLFD]DSRþQHVNXKDQMHP
Napomena: Nakon uporabe, provjerite da je
NRQWURODYUHPHQVNRJVNORSDYUDüHQDQDX
VXSURWQRPüHSHüQLFDQDVWDYLWLVUDGRP
Primjer: Kuhanje na 450 W u trajanju 20 minuta
1.
Okrenite kontrolu za odabir snage na 450 W.
2.
Okrenite vremenski sklop na 20.
3.
3HüQLFDüHDXWRPDWVNL]DSRþHWLNXKDWLPLQXWDQD:
• 3UHSRUXNHSURL]YR
DþDKUDQHRYUHPHQXSRWUHEQRP]DSULSUHPXMHODVOXåHVDPRNDRYRGLþ$NRSRLVWHNX
QD]QDþHQRJYUHPHQDKUDQDQLMHQDGRGLUYUXüDYUDWLWHMXXSHüQLFXLNXKDMWHVYHGRNQHEXGHYUXüD7RMH
JRWRYRLVWRNDRLSULNXKDQMXXWUDGLFLRQDOQRMSHüQLFL
• 8YLMHNUHGRYLWRSURPLMHãDMWHKUDQXSRVHEQRVORåHQFHLSDSULNDãH
• +UDQXSXVWLWHGDRGVWRMLWRMHGLRSRVWXSNDNXKDQMDLRPRJXüDYDMHGQROLNXWHPSHUDWXUXKUDQH
9RGLþ]DSRGHãDYDQMHVQDJHPLNURYDORYD
Podešena snaga
100W
(180W)
300W
450W
Preporuka za korištenje
2GUåDYDQMHWRSOLQH2GUåDYDKUDQXWRSORP
2GOH LYDQMH2WDSDQMH]DPU]QXWHKUDQH
.OMXþDQMH'RYUãHQMHFLNOXVDNXKDQMDQHNLKSHþHQNL6ORåHQFLLSDSULNDã
=DSHþHQDNUHPDRGMDMDLNRODþRGVLUD
6UHGQMH%UåHRGOH
LYDQMHLSRGJULMDYDQMHVORåHQDFDLSDSULNDãD
6UHGQMH3HþHQMHNRODþD
600W
3RGJULMDYDQMH3RGJULMDYDQMHYHüVSUDYOMHQHKUDQH
3HþHQMHYHüLKNRPDGDPHVDLSHUDGL
800W
.OMXþDQMHLOLSRGJULMDYDQMHWHNXüLQD
.XKDQMHSRYUüD
10
Downloaded From Microwave-Manual.com Manuals
B
EMM2015
Kuhanje sa roštiljem
1.
2.
6WDYLWHRNUHWQLWDQMXUQDYDOMþLüHQDGQXXXQXWUDãQMRVWL
SHüQLFHLSRVWDYLWHKUDQXQDPHWDOQXUHãHWNX2YD
Namjestite kontrolu za odabir snage na roštilj.
1DPMHVWLWHYUHPHQVNLVNORSGRåHOMHQRJ
metoda je idealna za roštiljanje mesa kao što su
YUHPHQD3HüQLFDDXWRPDWVNL]DSRþQHV
RGUHVFLLVO,PDMWHQDXPXGDüHSHüQLFDELWLYUXüD
kuhanjem.
Napomena: Nakon uporabe, provjerite da je
NRQWURODYUHPHQVNRJVNORSDYUDüHQDQDX
VXSURWQRPüHSHüQLFDQDVWDYLWLVUDGRP
Primjer: Kuhanje korištenjem roštilja u trajanju 40 minuta
1.
Okrenite kontrolu za odabir snage na roštilj
2.
Okrenite vremenski sklop na 40.
3.
3HüQLFDüHDXWRPDWVNL]DSRþHWLNXKDWLPLQXWDQDSRGHãHQMXURãWLOM
.
.
Kuhanje sa mikrovalovima i roštiljem
1.
6WDYLWHRNUHWQLWDQMXUQDYDOMþLüHQDGQXXXQXWUDãQMRVWL
Namjestite kontrolu za odabir snage do
åHOMHQHUD]LQHVQDJHLUD]LQHURãWLOMD
SHüQLFHLSRVWDYLWHKUDQXQDPHWDOQXUHãHWNX2YD
2.
metoda je idealna za roštiljanje mesa kao što su
1DPMHVWLWHYUHPHQVNLVNORSGRåHOMHQRJ
YUHPHQD3HüQLFDDXWRPDWVNL]DSRþQHV
RGUHVFLLVO,PDMWHQDXPXGDüHSHüQLFDELWLYUXüD
kuhanjem.
Napomena: Nakon uporabe, provjerite da je
NRQWURODYUHPHQVNRJVNORSDYUDüHQDQDX
VXSURWQRPüHSHüQLFDQDVWDYLWLVUDGRP
Primjer: Kuhanje na 450 W i korištenje roštilja u trajanju 15 minuta
1.
Okrenite kontrolu za odabir snage na kombinaciju 2
2.
Okrenite vremenski sklop na 15.
3.
3HüQLFDüHDXWRPDWVNL]DSRþHWLNXKDWLPLQXWDQDSRGHãHQMXNRPELQDFLMD
.
.
NAPOMENA:
$NR]DYULMHPHNXKDQMDRWYRULWHYUDWDSHüQLFDüHVHLVNOMXþLWL.DNREL]DYUãLOLNXKDQMH]DWYRULWHYUDWD
1DNUDMXFLNOXVDNXKDQMDURãWLOMLPLNURYDORYLVHLVNOMXþHLRJODVLVH]YXþQLVLJQDO
Na podešenju za kuhanje sa mikrovalovima i roštiljem, razina snage i vrijeme kuhanja mogu se promijeniti
WLMHNRPUDGDPLNURYDOQHSHüQLFH
11
Downloaded From Microwave-Manual.com Manuals
B
EMM2015
3UHSRUXNH]DSULSUHPXKUDQHSRPRüXURãWLOMD
,VSRGUHãHWNHURãWLOMDQDNRMXVWHSRVWDYLOLKUDQXWUHEDVWDYLWLSRVXGXXNRMXüHVHVNXSOMDWLSUROLYHQDKUDQDL
VRNRYLRGSHþHQMD7LPHüHWHVPDQMLWLþLãüHQMH6YXKUDQXRNUHQLWHQDSRODYUHPHQDSULSUHPH
Hrana
.ROLþLQDWHåLQD
3UHSHþHQDF
2 kriške
4 kriške
3UHSHþHQDFVDVLURP
Vrijeme pripreme
4 – 5 min
6 – 7 min
Posebne napomene
±PLQ]DSUHSHþHQDF
min sa sirom.
3UHSRUXNH]DNXKDQMHSRPRüXPLNURYDORYDLURãWLOMD
5HãHWNX]DSHþHQMHQDRNUHWQRPWDQMXUXNRULVWLWH]DSHþHQMHJRYHGLQHLVYLQMHWLQH]DãWLWLWHWDQNHGLMHORYHL
rubove. Na okretni tanjur, ispod rešetke roštilja, postavite posudu za skupljanje prolivene hrane i soka od
SHþHQMD+UDQXRNUHQLWHNDNRMHSULPMHUHQR]DYULMHPHNXKDQMD
Hrana
.ROLþLQDWHåLQD
Vrijeme pripreme
3RORåDMNRQWUROH
Posebne napomene
snage
Slanina
4 (100 g)
kombinacija 3
7 – 9 min
3HþHQD
900 g
Samo mikrovalovi 800
W
25 min
900 g
kombinacija 2
5 – 6 min
paprom. Neka stoji 15
– 20 min nakon
kuhanja.
2 – 3 (450 g)
kombinacija 2
20 – 25 min
1DPDåLWHXOMHP
govedina (s
kosti)
3HþHQD
1DPDåLWHXOMHP
=DþLQLWHVROMXL
svinjetina
EXEUHåQMDN
Svinjski odresci
=DþLQLWHVROMX
paprom i paprikom.
Pile, polovljeno
po duljini, bataci
450 g
800 g
kombinacija 1
kombinacija 1
15 – 20 min
25 – 30 min
Zamrznuti
hamburger
Kobasice
4 (200 g)
kombinacija 2
12 – 15 min
Samo 450 g
kombinacija 1
10 – 15 min
Riblji odrezak
2 (350 g)
kombinacija 3
22 – 24 min
1DPDåLWHXOMHP
=DþLQLWHVROMX
paprom i paprikom.
1DPDåLWHXOMHP
=DþLQLWHVROMXL
paprom.
Zamrznuti
krumpir, umak
od sjeckanog
mesa
2 (150 g)
kombinacija 2
16 – 18 min
Razine snage mikrovalova i roštilja
Simbol
Podešenje
Snaga
mikrovalova
Snaga roštilja
Roštilj
0W
1000 W
Kombinacija 1
300 W
1000 W
Kombinacija 2
450 W
1000 W
Kombinacija 3
600 W
1000 W
12
Downloaded From Microwave-Manual.com Manuals
B
EMM2015
Upute za odmrzavanje korištenjem snage
(180W)
1HNDKUDQDNDRãWRVXNUXKLYRüHPRåHVHXVSMHãQRUXþQRRGPU]QXWLNRULVWHüLRYXVQDJX
HRANA
VRIJEME
STAJANJA
PRIPREMA
Kruh
2 kriške
1 kruh
Postavite ga na rešetku otpornu na mikrovalove ili na
kuhinjski papir.
Okrenite na polovici vremena odmrzavanja.
Postavite ga na rešetku otpornu na mikrovalove ili na
kuhinjski papir.
Okrenite na polovici vremena odmrzavanja.
Postavite na kuhinjski papir.
Postavite na kuhinjski papir.
2 kruha
Postavite na kuhinjski papir.
Mali kruh
8–10 min.
10–15 min.
10–13 min.
10 min
45–60 sek.
45–60 sek.
1–11/2
min.
5 min.
5 min.
Izvadite iz omota, stavite na tanjur.
9–11 min.
15–30 min.
Izvadite iz omota, stavite na tanjur.
9–11 min.
15–30 min.
Izvadite iz omota, stavite na tanjur.
7– 9 min.
15–30 min.
.RODþLJ
Izvadite iz omota, stavite na tanjur.
7– 9 min.
15–30 min.
Maslac
250g
(1 pakiranje)
Ako je omotan folijom, uklonite ju i postavite ga na
tanjur.
3– 4 min.
5–10 min.
Postaviti u jednom sloju u plitku posudu.
5– 6 min.
5–10 min.
7– 8 min.
5–10 min.
7– 8 min
5–10 min.
Narezan
veliki kruh
5 min.
.HNVLLNRODþL
Gateau 450g
.RODþRGVLUD
450g
Pita
(spravljena)
450g
9RüH
225g
9RüHVPHNLP
bobicama
450g
9RüHVPHNLP
Postaviti u jednom sloju u plitku posudu.
bobicama
Obrok
3RNULWLWDQMXURPLOLSULDQMDMXüRPIROLMRPEH]39&D=D
400g
podgrijavanje, mikrovalovi na 100% (800 W) u trajanju
3-4 minute.
3RYUüH
2GPU]DYDQMHSRYUüDSULMHNXKDQMD
QLMHQXåQR6YRSRYUüHPRåHVH
odmrzavati i kuhati na 100% (800 W).
13
Downloaded From Microwave-Manual.com Manuals
B
EMM2015
1DWXNQLFHRPLNURYDOQRMSHüQLFL
•
•
Omekšavanje meda
Ako imate teglu kristaliziranog meda, otklopite ju i
3HüQLFXXYLMHNGUåLWHþLVWRP±L]EMHJDYDMWH
SUROMHYDQMHQDPLUQLFDLQH]DERUDYLWHSRþLVWLWL
•
ispod staklene plitice i unutrašnju stranu vrata.
3RPRJXüQRVWLNRULVWLWHRNUXJORLOLRYDOQRSRVX
VWDYLWHXSHüQLFXXNOMXþLWHPLNURYDORYHVUHGQMHVQDJH
H
s poklopcem kada kuhate u svojoj mikrovalnoj
•
SHüQLFL
1HNRULVWLWHPHWDOQRSRVX
GHNRUDFLMDPD2GUH
•
•
•
HLOLSRVX
HVPHWDOQLP
HQLSODVWLþQLPDWHULMDOLVH
PRJXUDVWRSLWLLLVNULYLWLRGYUXüHKUDQH
Pokrijte hranu kada kuhate. Koristite staklene
SRNORSFHWDQMXUHLOLSDSLURWSRUDQQDPDVRüX
.RODþLNUXKLVOLþQRPRJXVHRGPU]DYDWLGLUHNWQR
•
ih u posudu i zagrijavajte na velikoj snazi 1-2 minute.
Dobro miješajte.
•
Omekšavanje ili otapanje maslaca
Na velikoj snazi za otapanje je potrebno nekoliko
niskoj snazi.
SHüQLFL8NORQLWHPHWDOQHNRSþHLåLþDQHYH]LFH
6LWQHNRPDGLüHDOXPLQLMVNHIROLMHPRåHWHNRULVWLWL
•
2VYMHåDYDQMHLOL]DJULMDYDQMHNUXKD
Nekoliko sekundi koristite srednju snagu.
•
=DJULMWHGRþHQDþHãQMDNDQDMDNRMVQD]L
ãWRVXSLOHüLEDWDFL
VHNXQGL6WLVQLWHVMHGQHVWUDQHGRNþHQRYLQH
+UDQXVDOMXVNDPDLOLNRåRPWUHEDWHSUREXãLWL
ispadnu.
PLNURYDOQRMSHüQLFLMHUPRJXHNVSORGLUDWL
Velike, debele komade postavite blizu ruba
posude i pokušajte narezati hranu na nekoliko
jednakih komada. Hranu uvijek postavite u
•
VUHGLQXSHüQLFH
•
+UDQDüHELWLXMHGQDþHQRNXKDQDDNRMH
.DãXüHWHODNRVNXKDWLXWDQMXULPDSRVX
promiješate ili okrenete nekoliko puta.
SRVOXåLYDQMHEH]OMHSOMLYLKSRVXGD]DSUDQMH'UåLWHVH
8YLMHNSRGHVLWHNUDüHYULMHPHNXKDQMDQHJRãWRMH
XSXWDSURL]YR
vrijeme.
.RULVWLWHPDORLOLQLãWDYRGH]DSRYUüH
.RULVWLWHPDQMHVROLL]DþLQDQHJR]DQRUPDOQR
kuhanje.
=DþLQHGRGDMWHQDNUDMX
Dopustite nekoliko minuta "stajanja" nakon što se
SHüQLFDLVNOMXþLODNDNRELRVLJXUDOLSRWSXQHL
•
•
HQMD
sekundi zagrijete na jakoj snazi.
SUHNXKD9HüDNROLþLQDKUDQH]DKWLMHYDGXåH
•
•
9RüQLVRN
$JUXPLüHGDWLYLãHVRNDDNRLKSULMHFLMH
dano u vašem receptu kako bi izbjegli da se hrana
•
•
/DJDQRJXOMHQMHþHãQMDND
za pokrivanje dijelova koji se lako prekuhaju kao
vilicom - npr. krumpiri i kobasice. Ne kuhajte jaja u
•
2WDSDQMHþRNRODGH
,]ORPLWHJþRNRODGHQDþHWYUWDVWHNRPDGHVWDYLWH
VHNXQGL0DVODFüHWHQDMEROMHRPHNãDWLQMHåQLMHQD
metalne dekoracije ne smijete koristiti osim ako
•
•
Ako se smrznuta hrana zagrijava u svom omotu,
QLVXSUHSRUXþHQL]DXSRUDEXXPLNURYDOQRM
•
na 2 minute.
XNRãDUL]DNUXKLOLQDSDSLUQDWRPUXþQLNX
SRWUHEQRJDMHRWYRULWL2PRWHNRMLVDGUåHPHWDOLOL
•
6DYMHWLRPLNURYDOQRMSHüQLFL
XMHGQDþHQHUH]XOWDWHNXKDQMD
8YLMHNVHUYLUDMWHYUXüXKUDQX
.RULVWLWHGUåDþHSRVXGDLOLUXNDYLFHNDGDYDGLWH
SRVX
HLKUDQXL]SHüQLFH
14
Downloaded From Microwave-Manual.com Manuals
Kuhanje kaše
DþDKUDQH
X]D
B
EMM2015
2GUåDYDQMHLþLãüHQMH
3HüQLFDXYLMHNPRUDELWLþLVWD2VWDFLSUROLYHQHKUDQHLOLSUVNDQMDüHSULYODþLWLHQHUJLMXPLNURYDORYDãWRüHGRYHVWL
GR]DJDUDQMD7RPRåHVPDQMLWLHILNDVQRVWSHüQLFHLVWYRULWLORãPLULV1HGLUDMWHLQHSRNXãDYDMWHL]PLMHQLWLLOL
SRSUDYLWLELORNRMLGLRSHüQLFH3RSUDYDNPRUDREDYLWLVWUXþQDLRYODãWHQDRVRED
3URYMHULWHGDOLMHSHüQLFDLVNOMXþHQDLPUHåQLXWLNDþL]YXþHQL]XWLþQLFHSULMHþLãüHQMD
ýLãüHQMHRSUHPHRNUHWQLWDQMXULSRGXSLUDþ
2þLVWLWHLKEODJLPVUHGVWYRP]DþLãüHQMHQDNRQYD
HQMDL]XQXWUDãQMRVWLSHüQLFH
3DåOMLYRUXNXMWHVSRGXSLUDþHP
3$ä1-$8QXWUDãQMRVWSHüQLFHLRNUHWQLWDQMXUSRVWDMXYUORYUXüLSDLKQHPRMWHGRGLULYDWLRGPDKSRXSRUDEL
ýLãüHQMHXQXWUDãQMRVWL
8YLMHNGUåLWHXQXWUDãQMRVWSHüQLFHþLVWRP2GPDKSRþLVWLWHSHüQLFXDNRGR
HGRSUROLMHYDQMDLOLSUVNDQMDKUDQH
2VWDFLQDVWMHQNDPDSHüQLFHEUWYLYUDWDLSRYUãLQLYUDWDDSVRUELUDWüHHQHUJLMXPLNURYDORYDVPDQMLWLHILNDVQRVW
SHüQLFHLPRJXGRYHVWLGRRãWHüHQMDXQXWUDãQMRVWLSHüQLFH=DXNODQMDQMHRVWDWDNDNRULVWLWHEODJDWHNXüD
VUHGVWYD]DþLãüHQMHWRSOXYRGXLPHNXþLVWXNUSX
1,.$'$1(.25,67,7($%5$=,91$65('679$=$ý,âû(1-(65('679$=$ý,âû(1-(./$6,ý1,+
3(û1,&$,/,-$678ý,û(2'ý(/,ý1(981(=$ý,âû(1-(%,/2.2-(*',-(/$0,.529$/1(
3(û1,&(
=DRPHNãDYDQMHWHåLKPUOMD]DJULMWHþDãXYRGHXPLNURYDOQRMSHüQLFLXWUDMDQMXPLQXWH
1,.$'$1(.25,67,7(12ä,/,.$.$9'58*,$/$7=$8./$1-$1-(05/-$63295â,1(3(û1,&(
=DXNODQMDQMHPLULVDL]XQXWUDãQMRVWLSHüQLFH]DJULMWHþDãXYRGHVDGYLMHåOLFHOLPXQRYRJVRNDXWUDMDQMXRG
minuta.
ýLãüHQMHYDQMVNRJGLMHODSHüQLFH
2WYRULWHYUDWDSHüQLFHNDGDþLVWLWHXSUDYOMDþNXSORþX1DWDMQDþLQQHPRåHGRüLGRVOXþDMQRJQHåHOMHQRJ
XNOMXþLYDQMDSHüQLFH9DQMVNXSRYUãLQXSHüQLFHþLVWLWHEODJLPWHNXüLPVUHGVWYRP]DþLãüHQMHLYRGRPQDNRQ
þHJDREULãLWHþLVWRPYRGRPRVWDWNHGHWHUGåHQWD2VXãLWHPHNRPNUSRP
6UHGVWYD]DþLãüHQMHSUR]RUDXVSUHMXLOLYLãHQDPMHQVNDNXKLQMVNDVUHGVWYD]DþLãüHQMHXVSUHMXPRJXVHLVWR
WDNRNRULVWLWL1LNDGDQHNRULVWLWHDEUD]LYQDVUHGVWYD]DþLãüHQMHåLþDQHMDVWXþLüH]DULEDQMHLOLMDNHNHPLNDOLMHQD
YDQMVNLPSRYUãLQDPDYDãHSHüQLFH.DNRELVHL]EMHJODRãWHüHQMDUDGQLKGLMHORYDQHGRSXVWLWHXOLMHYDQMHYRGHX
ventilacione otvore.
2GUåDYDQMHLþLãüHQMHURãWLOMD
(OHPHQWPRåHELWLSRSUVNDQPDVQRüRPLOLXOMHPWLMHNRPUDGDSHüQLFH3ULþHNDMWHGDVHXQXWUDãQMRVWSHüQLFH
RKODGLLREULãLWHSRSUVNDQHGLMHORYHSULMHVOLMHGHüHXSRUDEHSHüQLFH=DPUOMDQURãWLOMPRåHX]URNRYDWLVWYDUDQMH
neugodnih mirisa i dim.
15
Downloaded From Microwave-Manual.com Manuals
B
EMM2015
Servis i nadomjesni dijelovi
$NRPLNURYDOQDSHüQLFDQHUDGLPROLPRGDSURYMHULWHVOMHGHüHSULMHQHJRSR]RYHWHRYODãWHQLVHUYLV
$NRPLNURYDOQDSHüQLFDQH]DSRþLQMHVUDGRP
•
•
•
•
•
Provjerite da je aparat pravilno spojen.
3URYMHULWHGDMHXWLNDþSUDYLOQRXNOMXþHQXXWLþQLFX
$NRMHSRWUHEQR]DPLMHQLWHRVLJXUDþXNDEHOXVDQRYLPLVWRYMHWQLPSRVQD]L
3URYMHULWHGDXXWLþQLFLLPDQDSRQDWDNRGDXNOMXþLWHQHNLGUXJLXUH
DM
3URYMHULWHLVSUDYQRVWRVLJXUDþDXGRPDüLQVWYX
Ako mikrovalovi ne rade:
•
0RåGDMHQDPMHãWHQDVLJXUQRVQD]DãWLWDGRVWXSQDQDQHNLPPRGHOLPD
•
Provjerite da su kontrole pravilno podešene.
•
3URYMHULWHSRGHãHQMHSRVWXSDNNRULVWHüLXSXWX]DXSRUDEX
•
Provjerite da su vrata pravilno zatvorena. (Ako su dijelovi hrane ili nešto drugo ostali zaglavljeni u otvoru
YUDWDYUDWDVHQHüHSUDYLOQR]DWYRULWLLPLNURYDOQDSHüQLFDQHüHUDGLWL
$NRQDNRQRYLKSURYMHUDPLNURYDOQDSHüQLFDLGDOMHQHUDGLSUDYLOQRVWXSLWHXNRQWDNWVDQDMEOLåLPRYODãWHQLP
servisnim centrom.
9$ä12$NRSR]RYHWHVHUYLVHUDUDGLMHGQHRGRYGMHQDYHGHQLKVPHWQMLLOL]ERJSRJUHãQRJUXNRYDQMDLOL
SRVWDYOMDQMDPLNURYDOQHSHüQLFHGROD]DNQHüHELWLEHVSODWDQþDNLXQXWDUMDPVWYHQRJURND
Servisne usluge i nadomjesne dijelove nude ovlašeni Electrolux servisi.
.DGDQDUXþXMHWHVHUYLVQXXVOXJXLOLGLMHORYHPROLPRYDVGDSULSUHPLWHWRþDQQD]LYLPRGHOPLNURYDOQHSHüQLFH
7HSRGDWNHüHWHQDüLQDQDWSLVQRMSORþLFL
Zapišite ih tako da su vam uvijek pri ruci kada ih trebate.
Model: EMM 20017
Serijski broj: ............................................
Datum kupnje: .........................................
1DSRPHQD3RVSUHPLWHYDãHXSXWHLMDPþHYQLOLVW
16
Downloaded From Microwave-Manual.com Manuals
W
EMM2015
Obsah
3UHGSUYêPSRXåLWtP
3
Technické údaje
3
%H]SHþQRVWQpSRN\Q\
4
4
4
5
5
–
–
–
–
Vhodný kuchynský riad
%H]SHþQRV SULJULORYDQt
Testovanie kuchynského riadu
Príprava pokrmov
7DEX NDYDUQêFKQiGREDSUtVOXãHQVWYD
6
Inštalácia
–
Vybalenie
–
Inštalácia
– Zapojenie do elektrickej siete
7
7
7
7
3RXåtYDQLHPLNURYOQQHMU~U\
8
8
8
9
10
10
11
11
–
–
–
–
–
–
–
2]QDþHQLDDIXQNFLDMHGQRWOLYêFKþDVWt
,QãWDOiFLDURWDþQpKRWDQLHUD
Ovládací panel
Mikrovlnná prevádzka
7DEX NDYêNRQRYêFKVWXS
RY
Grilovanie
Kombinovaná prevádzka (mikrovlny a gril)
7DEX N\
–
–
–
–
–
Grilovanie
Kombinovaná prevádzka
Výkon pri grilovaní a kombinovanej prevádzke
Rozmrazovanie
Tipy pre mikrovlnnú prevádzku
2ãHWURYDQLHDþLVWHQLH
–
–
–
–
ýLVWHQLHSUtVOXãHQVWYD
ýLVWHQLHVSRWUHELþD]YQ~WUD
ýLVWHQLHVSRWUHELþD]YRQND
ýLVWHQLHJULOX
Servis a náhradné diely
–
Náhradné diely
–
Záruka
3
Downloaded From Microwave-Manual.com Manuals
12
12
12
12
13
14
15
15
15
15
15
16
16
16
W
EMM2015
%ODKRåHOiPHYiPNXN~SHQRYHMPLNURYOQQHMU~U\
DNXMHPH YiP åH VWH VL Y\EUDOL YêURERN ]QDþN\ (OHFWUROX[ 6PH SUHVYHGþHQt åH VD YDãD QRYi PLNURYOQQi U~UD VWDQH
XåLWRþQêP SRPRFQtNRP YR YDãHM GRPiFQRVWL 7DN DNR SUL LQêFK GRPiFLFK HOHNWURVSRWUHELþRFK DM SUL WRPWR YêURENX EXGHWH
SRWUHERYD XUþLWê þDV DE\ VWH VD QDXþLOL Y\XåtYD YãHWN\ MHKR IXQNFLH D SUHGQRVWL 9HUtPH åH VD SUH YiV VWDQH YDãD QRYi
PLNURYOQQiU~UDQHSRVWUiGDWH QRX
3UHGSUYêPSRXåLWtP
7HQWR QiYRG QD SRXåtYDQLH VL G{NODGQH SUHþtWDMWH $N KR SUHãWXGXMHWH SR]RUQH D EXGHWH VD ULDGL XYHGHQêPL SRN\QPL
GRVLDKQHWHRSWLPiOQHY\XåLWLHYDãHMPLNURYOQQHMU~U\(OHFWUROX[
1iYRG QD SRXåtYDQLH MH G{OHåLWRX V~þDV RX PLNURYOQQHM U~U\ $N VSRWUHELþ SUHGiWH GDUXMHWH DOHER KR QHFKiWH Y VWDURP E\WH
SRVWDUDMWH VD R WR DE\ VD QiYRG QD SRåtYDQLH GRVWDO GR U~N QRYpKR PDMLWH D
DOãt XåtYDWH VD WDN EXGH P{F RER]QiPL V
REVOXKRXVSRWUHELþDDEH]SHþQRVWQêPLSRN\QPL
3UHGSUYêPSRXåLWtPVSRWUHELþDVLSR]RUQHSUHþtWDMWHWHQWRQiYRGDULD
WHVDXYHGHQêPLSRN\QPL
%H]SHþQRVWQpSRN\Q\
Œ
9
DND ]DEXGRYDQpPX EH]SHþQRVWQpPX VStQDþX VD
PLNURYOQQi U~UD QHGi VSXVWL NH
Œ
=D åLDGQ\FK RNROQRVWt VD QHVQDåWH XYLHV PLNURYOQQ~
Œ
rúru do prevádzky pri otvorených dvierkach, aby ste
sa nevystavili vplyvu mikURY Q
Dbajte na to, aby sa na tesnení dvierok neusadzovali
]Y\ãN\MHGiODOHERþLVWLDFHKRSURVWULHGNX3UHþtWDMWHVL
Œ
NDSLWROXRþLVWHQtDošetrovaní mikrovlnnej rúry.
V prípade poruchy alebo poškodenia mikrovlnnú rúru
våLDGQRP SUtSDGH QHSRXåtYDMWH 2SUDYX VSRWUHELþD
prenechajte kvalifikovaným servisným technikom.
-H G{OHåLWp DE\ VD GYLHUND PLNURYOQQHM U~U\ ]DWYiUDOL
EH]
LQDN
SUREOpPRY
SRãNRGHQp
åLDGQ\FK
'YLHUND
QHVP~
E\ D
WHVQHQLH
RNROQRVWt
VD
GYLHURN
RKQXWp
QHVPLH
QHSRN~ãDMWH
RSU
DOHER
prípade
VD
servisné
REUi WH
QD
stredisko.
QDMEOLåãLH
Zoznam
DXWRUL]RYDQp
autorizovaných
VHUYLVQêFKVWUHGtVNMHSULORåHQê
Œ
1LNG\ QHRGVWUD
XMWH YRQNDMãt SOiã GYLHUND DOHER
RYOiGDFt SDQHO VSRWUHELþD +UR]t Q
Œ
Œ
eEH]SHþHQVWYR
Œ
QHSRXåtYDMWHNRUR]tYQHFKHPLNiOLH
0LNURYOQQi U~UD MH XUþHQi SU
zohrievanie
0LNURYOQQi
laboratórne
U~UD
a
QLH
a
MH
koPHUþQp
QD
~þHO\
SULHP\VHOQp
3UL
SRXåtYDQt
SODWQRV Œ
Nikdy nezapínajte prázdnu mikrovlnnú rúru.
VRSDþQRm príSDGH P{åH G{MV N poškodeniu
vnútorného magnetrónového zariadenia.
0LNURYOQQ~ U~UX QLNG\ QHXPLHVW XMWH Y exteriéroch.
Rovnako mikrovlnnú rúru nepoXåtYDMWH Y EOt]NRVWL
vody.
]
PLNURYOQQHM
U~U\
SRXåLWH
RFKUDQQp
%H]SHþQRV SULJULORYDQt
1.
$NVDQDVNOHQpRNQRNWRUpMHV~þDV RX GYHUt SRþDV
2.
.H
JULORYDQLDGRVWDQHYRGDP{åH DKNRSUDVNQ~ nej vyberáte
eciálne rukavice.
GRPLNURYOQQHMU~U\YNODGiWHDOHER]
NXFK\QVN~ QiGREX SRXåtYDMWH ãS
2FKUDQQp
UXNDYLFH
SRXåLWH
WLHå
SUL
PDQLSXOiFLL
sURWDþQêP WDQLHURP D NRYRYêP SRGVWDYFRP NW oré
VD SUL þLQQRVWL PLNURYOQQHM U~U\ ]RKULHYDM~ QD Y\VRN~
3.
edovšetkým na tepelnú
rozmrazovanie jedál.
XUþHQi
mikrovlnnej rúre je vhodné najmä
sklo, sklokeramika a predovšetkým tepluvzdorný
sklenený riad. Mikrovlnná energia nepôsobí na
YlþãLQX VNOHQHQêFK D SRUFHO ánových nádob, riad sa
však zohreje vplyvom tepla z pokrmov. Pri vyberaní
rukavice, aby ste predišli popáleninám.
teplotu.
Dvierok mikrovlnnej rúry sa zásadne nedotýkajte
kovovými
predmetmi.
Pri
manipulovaní
sNXFK\QVNêPL QiGREDPL EX WH RSDWUQt ± GYLHrka a
YQ~WURU~U\VDSRþDVSUHYiG]N\]QDþQH]RKUHM~
4.
5RWDþQê
WDQLHU
DOHER
NXFK\QVN~
QiGREX
VD
QHSRN~ãDMWH RFKODGL SRQRUHQtP GR VWXGHQHM YRG\ D
PLNURYOQQHM U~U\ QD QHYKRGQp ~þHO\ ]iUXND VWUiFD
Œ
VD
1D SRXåtYDQLH Y
SRNUPRY
0LNURYOQQ~ U~UX SRXåtYDMWH OHQ QD ãSHFLILFNp ~þHO\
úpravu,
GRVWDOL
0{åX
Vhodný kuchynský riad
zásahu elektrickým prúdom.
Pri inštalácii a zapájaní mikrovlnnej rúry do elektrickej
VLHWHVDULD WHSRN\QPLY kapitole Inštalácia.
SRStVDQpYWRPWRQiYRGH 3UL þLVWHQt PLNURYOQQHM U~U\
Œ
U~U\
WH[WtOLH
Œ
E\
oYD
SRUXFK\
PLNURYOQQHM
VXFKp
dospelých, len ak sú oboznámeQp V EH]SHþQRX
prevádzkou a sú si vedoPp QHEH]SHþHQVWYD NWRUp
súvisí s neVSUiYQ\PSRXåtYDQtP
0LNURYOQQ~
U~UX
QHSRXåtYDMWH
QD
VNODGRY anie
potravín. Ak je mikrovlnná rúra mimo prevádzky,
nenechávajte v nej zvyšky papierov, obalov a
kuchynské náradie.
aYL
RYD VSRWUHELþ D MHKR YODVWQRVWL 9
VSRWUHELþ VDPL -H QHEH]SHþQp XSUDY
SR]PH
GR
DOHER
'HWL VP~ REVOXKRYD PLNURYOQQ~ U~UX EH] GRK DGX
narušené.
=D
VD
Œ
VSRMRYDFLH N E\ D þDS\ QHVP~ E\ ]ORPHQp DOHER
Œ
DE\
SDSLHU
Y]QLHWL Œ
Œ
1HGRYR WH
QRYLQRYê
V~ MHM GYLHUND
otvorené.
podobne.
5.
1D PLNURYOQQ~ U~UX QHRGNODGDMWH åLDGQH SUH
SUHWRåHE\VDPRKOLYSO\YRPWHSODSRãN
-H QRUPiOQH NH
GYLHUND
]DKPOLD
oGL
dmety,
VD RNROR GYLHURN Y\WYRUt SDUD NH
DOHER
NH
VD
QD
VSRGNX
VD
GYLHURN
Y\]UiåDM~ NYDSN\ YRG\ ,GH R NRQGHQ]iFLX YRGQHM SDU\
ktorá sa uYR
QHRYSO\Y
XMH SUL WHSHOQHM SUtSUDYH MHGiO D QLM
4
Downloaded From Microwave-Manual.com Manuals
ako
XMH EH]SHþQRV U~U\ 'YLHUND QHPDM~ WHVQL
dutinu rúry úplne.
W
EMM2015
Œ
Testovanie kuchynského riadu
Œ
å WND YåG\ SUHSLFKQLWH DE\ VWH ]DEU ánili
tak
utajenému varu vo vnútri pokrmov a ich následnej
explózii.
pohárom plným vody a výkon nastavte na 800 W
ýDVRKULHYDQLDQDVWDYWHQDMHGQXPLQ~WX$N
MHULDGKRU~FLQHPDOLE\VWHKRSRXåtYD $NMHPLHUQH
WHSOê P{åHWH KR SRXåtYD QD ]RKULHYDQLH MHGiO $N
Œ
má riad izbovú tepORWX P{åHWH KR SRXåtYD DM QD
tepelnú úpravu pokrmov.
Obaly z materiálov, ako sú napr. servítky, voskový
papier, papierové utierky, papierové šálky, kartónové
ãNDWXOH D OHSHQNRYp REDO\ V~ YKRGQp SUH SRXåLWLH
vPLNURYOQQHM U~UH 3UHG SRXåLWtP VD YåG\ XEH]SHþWH
åHQLHV~SUi]GQHDE\VWH]DEUiQLOLSUHKUL atiu.
Œ
9 PLNURYOQQHM U~UH P{åHWH SRXåtYD YH D GUXKRY
XPHORKPRWQêFK ULDGRY ãiORN D REDORY 9åG\ VD
ULD
WHSRN\QPLYêUREFX3ODVWRYp REDO\ QHSRXåtYDMWH
ak obsahujú príliš mastné jedlá alebo jedlá s vysokým
REVDKRP
Œ
FXNUX
3UL
LFK
]RKULDWt
P{åH
G{MV N
poškodeniu obalu.
V mikrovlnnej rúre nikdy nepripravujte bez dozoru
jedlá v plastových, papierových aOHER KRU DYêFK
obaloch. Ak sa objaví dym, nechajte dvierka
zatvorené, rúru vypnite, odpojte ju od elektrickej siete
Œ
Œ
Œ
Upozornenie:
WH RSDWUQt D SRXåLWH UXNDYLFH DE\ VWH SUHGLãOL
1.
2.
3.
4.
Œ
SRKiURFK
1LNG\ VD QHSRN~ãDMWH QiVLOtP RWRþL URWDþQê WDQLHU
P{åH GRMV N QHEH]SHþ
SRXåLW~QiGREXVNRQWURO
Œ
proces treba neustále sledoYD
'EDMWH
QD
WR
DE\
oYD
YHQWLODþQp
RWYRU\
YR
vrchnej,
]DGQHM ERþQHM D VSRGQHM þDVWL VSRWUHELþD ]RVWDOL
YR Qp
ným
ãSHFLiOQ\FK REDORFK XUþHQêFK QD WHQWR ~þHO 7HQWR
3UtþLQRX LVNUHQLD Y PLNURYOQQHM U~UH EêYD NRYRYi
SRãNRGL SUHWR WUHED SURJUDP RNDPåLWH ]DVWDYL D
SUtOLã PDVWQp MHGOi 9]K DGRP QD WR åH VD WHSORWD
3XNDQFH P{åHWHY PLNURYOQQHM U~UH SULSUDYRYD OHQ Y
]RKULHYDQt
NXFK\QVNi QiGRED ,VNUHQLH P{åH VSRWUHELþ YiåQH
V mikrovlnnej rúre nikdy nezohrievajte potraviny v
ádoby, ktorú je
SOHFKRYLFLDFK1DMSUYLFKSUHORåWHGRQ
V mikrovlnnej rúre nikdy nefritujte a nepripravujte
SUL
Upozornenia:
mohli by ste ho poãNRGL
YKRGQpSRXåtYD YPLNURYOQQHMU~UH
P{åX
vajcia zakryte. Pred odoNU\WtPSRNULHYN\SRþNDMWHFFD
jednu minútu.
Príprava pokrmov
tuNX QHGi NRQWURORYD
situáciám.
X]DWYRUHQêFK
SULSUDYL YDMtþND å WRN YåG\ SUHSLFKQLWH D SRWRP
Œ
Œ
Niektoré potraviny ako napr. celé vajcia alebo pokrmy
aPH SULSUDYRYD Y
mikrovlnnej rúre. Ak chcete v mikrovlnnej rúre
Œ
Œ
1HSRXåtYDMWHQiGRE\V~]N\PKU dlom.
Pokrmy neprehrievajte.
Pokrmy pred ich zohrievaním v mikrovlnnej rúre, ako
aj v polovici procesu zohrievania premiešajte.
3R]RKULDWtQHFKDMWHSRNUP\HãWHFKYt XY mikrovlnnej
rúre, a potom ich zamiešajte.
H[SORGRYD SUHWR LFK QHRGSRU~þ
popáleninám.
Œ
3UL ]RKULHYDQt SROLHYRN QiSRMRY D RPiþRN
YPLNURYOQQHMU~UHVDP{åHVWD åHSRNUPY\N\StEH]WRKR
aby ste spozorovali bod varu. Aby ste sa vyhli uvedenému
javu, odporúþDPH
Y
Kovový riad alebo riad s kovovým lemovaním, resp.
ornamentom by ste v mikrovlnnej rúre nemali
SRXåtYD DNWRYêUREFDY\VOoYHQHQHRGSRU~þD
V mikrovlnnej rúre nezohrievajte pokrmy v obaloch
s úzkym otYRURPDNRV~QDSUI DãH
Pri snímaní pokrievok a uzáverov kuchynských nádob
EX
'HWVN~ YêåLYX SR ]RKULDWt GREUH SUHPLHãDMWH DOHER
pretrepte, aby sa teplo rovnomerne rozORåLOR 6N{U
DNR
YêåLYX
GLH D X
SRGiWH
EHzSRGPLHQHþQH
skontrolujte jej teplotu.
DSRþNDMWHNêPSRNUPSUHVWDQHG\PL Œ
3RWUDYLQ\ V SHYQRX ãXSRX UHVS QHSyURYLWRX NRåRX
QDSU MDEONi ]HPLDN\ NXUDFLH SHþLHQN\ YDMHþQp
'RPLNURYOQQHMU~U\YORåWHNXFK\QVN~QiGREXVSROXV
6SRWUHELþQHSRXåtYDMWHQDNRPHUþQp~þHO\
0LNURYOQQiU~UDMHXUþHQiQDSRXåtYDQLHY
'RGUåLDYDMWHY\ããLHXYHGHQpSRN\Q\
5
Downloaded From Microwave-Manual.com Manuals
domácnosti.
W
EMM2015
7DEX NDYDUQêFKQiGREDSUtVOXãHQVWYD
1D WHSHOQ~ ~SUDYX SRNUPRY Y PLNURYOQQHM U~UH P{åHWH SRXåtYD PQRåVWYR GUXKRY ULDGRY D SUtVOXãHQVWYD 9 záujme
bezproblémovej preYiG]N\YODVWQHMEH]SHþQRVWLDPD[LPiOQHM~þLQQRVWLVLY\EHUWHWRQDMYKRGQHMãLHSUHGDQêGUXK
WHSHOQHM~SUDY\SRNUPX3RQ~NDPH9iPVWUXþQêSUHK DGYãHREHFQHSRXåtYDQêFKQiGRE
MATERIÁL
Riad
keramika a sklo
porcelán bez kovovej dekorácie
tepluvzdorné sklenené nádoby
sklenené nádoby s kovovými
ornamentami
þtQVN\SR
rcelán
porcelán *
plast
bez kovových ozdôb
bez kovových ozdôb
tepluvzdorné plastové obaly
plastové obaly
kov
SOHFK\QDSHþHQLH
papier
alobal**
šálky, tanieriky
QiGRE\]RORYQDWpKRNULãWi X
Mikrovlnná
tepelná
úprava
ÁNO
ÁNO*
NIE
Grilovanie
Kombinovaná
tepelná úprava
ÁNO
ÁNO
NIE
ÁNO
ÁNO*
NIE
NIE
ÁNO
ÁNO
ÁNO
ÁNO
NIE
ÁNO
ÁNO
NIE
ÁNO
ÁNO
NIE
NIE
ÁNO
ÁNO
NIE
NIE
NIE
ÁNO
NIE
NIE
NIE
ÁNO
NIE
voskový papier
ÁNO
NIE
NIE
drevo
NIE
NIE
NIE
NIE
ÁNO
ÁNO
ÁNO
ÁNO
ÁNO
ÁNO
ÁNO
ÁNO
príslušenstvo
JULORYDFLHSRGORåND
URWDþQêWDQLHU
SRGORåNDSRGWDQLHU
È12YKRGQpSRXåtYD Y
mikrovlnnej rúre
1,(QHYKRGQpSRXåtYD YPLNURYOQQHMU~UH
* Ak glazúra neobsahuje kov, alebo ak nádoby nemajú kovovú dekoráciu.
** POZNÁMKA: Alobal sa SRXåtYDQD]DNU\WLHDRFKUDQXSRWUDYtQP{åHVS{VRERYD
Technické údaje
Vonkajšie rozmery
šírka 484 mm
K ENDPP
Vnútorné rozmery dutiny
výška 285 mm
šírka 300 mm
K ENDPP
Objem
+PRWQRV
Zapojenie
Spotreba energie mikrovlnnej rúry
Spotreba energie grilu
Výkon mikrovlnnej rúry
Výkon grilu
výška 195 mm
20 litrov
13.5 kg
230 V, 50 Hz
1300 W
1000 W
800 W
1000 W
6
Downloaded From Microwave-Manual.com Manuals
LVNUHQLH
W
EMM2015
Inštalácia
Vybalenie
Zapojenie do elektrickej siete
3R Y\EDOHQt VNRQWUROXMWH þL VSRWUHELþ SRþDV SUHSUDY\
QHXWUSHO ãNRG\ $ ]LVWtWH åH MH U~UD SRãNRGHQi DOHER
QHMDNi MHM þDV FKêED EH]RGNODGQH VD REUi WH QD YiãKR
GRGiYDWH D 5~UD D MHM SUtVOXãHQVWYR P{åH E\ ]DEDOHQp
GR RFKUDQQHM IyOLH 3UHG SUYêP SRXåLWtP VSRWUHELþD WUHED
IyOLXEH]SRGPLHQHþQHRGVWUiQL 2EDORYêPDWHULiORGVWUi
6SRWUHELþ MH GRGiYDQê V SUtSRMQêP NiEORP D ãWDQGDUGQRX
WH]GRVDKXGHWt
HXUR]iVWUþNRX
1.
=
2.
nálepky.
SpotreELþ
GYLHURN
VSRWUHELþD
RGVWUi
WH
YãHWN\
UHNODPQp
SHYQp DE\ XGUåDOR KPRWQRV VSRWUHELþD NJ D
jeho obsah, a stabilné, aby nedošlo k vzniku vibrácií.
0LNURYOQQ~ U~UX XPLHVWQLWH Y GRVWDWRþQHM Y]GLDOHQRVWL
od vody a zdrojov tepla, ako sú napr. radiátor a boiler,
DE\ VWH VD Y\KOL ]QtåHQLX YêNRQX D SRãNRGHQLX
spotUHELþD
9HQWLODþQp
VSRWUHELþD
VSRWUHELþD
8]HPQHQLH
GR
HOHNWULFNHM
VLHWH
PLQLPDOL]XMH
QHEH]SHþHQVWYR
VNUDWX
prípojnému napätiu na mieste inštalácie.
$NKRGOiWHU~UX]DSRML GRHOHNWULFNHMVLHWHSURVWUHGQtFWYRP
SUHGOåRYDFLHKRNiEODVNR
9
SUtSDGH
nWUROXMWHþLMHNiEHOX]HPQený.
SUREOpPRY
DOHER
RWYRU\
Y
GROQHM
QHFKDMWH
YR Qp
QHGiYDMWH
D
ERþQêFK
1D
åLDGQH
KRUQ~
þDVWLDFK
VWUDQX
SUHGPHW\
3UL
WR DE\ EROL RWYRU\ YåG\ YR Qp D DE\ VD PHG]L U~UX D
zadnú stenu nedostali napr. záclony.
0LNURYOQQ~U~UX XPLHVWQLWH þR QDM
DOHM RG UiGLD DOHER
SRFK\EQRVWt
RK DGQH
]DSRMHQLD VSRWUHELþD GR HOHNWULFNHM VLHWH D X]HPQHQLD VD
REUi WHQDNYDOLILNRY
6SRWUHELþ
PXVt
aného elektrikára.
E\ X]Hmnený.
Ak
ibilná so zásuvkou na
EH]SRGPLHQHþQH
]iVWUþND VSRWUHELþD QLH MH NRPSDW
zablokoYDQtYHQWLODþQêFKRWYRURYSRþDVSUHYiGzky sa
P{åH
U~UD
SUHKULD D
QiVOHGQH
SoãNRGL ZYHQWLODþQêFKRWYRURYSU~GLKRUúci vzduch. Dbajte na
5.
]DSRMHQLH
6NRQWUROXMWH þL QRPLQiOQH QDSlWLH VSRWUHELþD ]RGSRYHGi
XPLHVWQLWH QD URYQê D KODGNê SRYUFK
0LHVWR XPLHVWQHQLD VSRWUHELþD PXVt E\ GRVWDWRþQH
4.
SUH
s parametrami 230 V, 50 Hz prostredníctvom uzemnenej
elektrickej zásuvky.
Inštalácia
3.
086Ë
%< %(=32D0,(1(ý1(
UZEMNENÝ!
Výrobca
nezodpovedá
za
škody
spôsobené
nerešpektovaním tohto bezSHþQRVtného pokynu.
63275(%,ý
PLHVWHXPLHVWQHQLDP{åHWH]iVWUþNXRGVWULKQ~ DQDKUDGL
MX
QRYRX
=
RGGHOHQHM
]iVWUþN\
RGVWUi
WH
SRLVWNX
D
]iVWUþNX ]OLNYLGXMWH DE\ QHGRãOR N MHM ]DSRMHQLX Y LQHM
]iVXYNH þR E\ PRKOR PD ]D QiVOHGRN ~UD] HOHNWULFNêP
QDSlWtP $N WUHED Y GRGiYDQHM ]iVXYNH Y\PHQL SRLVWNX
PXVtWH
QDKUDGL DM
NU\W
SRLVWN\
$N
MH
NU\W
SRLVWN\
SRãNRGHQê DOHER VD VWUDWLO QHVPLHWH ]iVWUþNX SRXåtYD
dovtedy, kým vám autorizovaný
nenainštaluje nový kryt poistky.
servisný
technik
WHOHYt]LH 7HQWR VSRWUHELþ ]RGSRYHGi SRåLDGDYNiP
SUH SRWODþHQLH UXãHQLD SUtMPX DN KR YãDN SRORåtWH
SUtOLã EOt]NR UiGLD DOHER WHOHYt]LH P{åH VD SUtMHP
naruãL
6.
3ULYêPHQH]iVWUþN\VSRWUHELþDSRVWXSXMWHWDNWR
=RGVWULKQXWHM]iVWUþN\RGVWUi
YHQWLOiFLH]DFKRYDMWHRGVWXSRGVWLHQDVSR
FP
niektorej zásuvky elektrickej inštalácie.
7HQWR VSRWUHELþ ]RGSRYHGi VPHUQLFL (:* NWRUi
'{OHåLWpXSR]RUQHQLH
5~UXP{åHWHXPLHVWQL NGHNR YHNY NXFK\QL 3RORåWH MX QD
i
URYQ~ D SHYQ~ SRGORåNX 9HQW ODþQp RWYRU\ D GROQi þDV
PXVLD
]RVWD EH]SRGPLHQHþQH
WH DE\ VWH SUHGLãOL
QHEH]SHþHQVWYX NWRUp KUR]t SUL ]DSRMHQt ]iVWUþN\ GR
sa týka opatrení proti rušeniu príjmu.
VSRWUHELþD
WHSRLVWNX
2GVWULKQXW~ ]iVWUþNX SRWRP RGVWUi
$N U~UX XPLHVWQLWH GR URKX Y ]iXMPH GRVWDWRþQHM
YR Qp
GRVWDWRþQiYHQWLOiFLD
7
Downloaded From Microwave-Manual.com Manuals
W
EMM2015
3RXåtYDQLHPLNURYOQQHMU~U\
1
2
3
9
5
8
6
4
4
7
10
2]QDþHQLHDIXQNFLDMHGQRWOLYêFKþDVWt
1.
,QãWDOiFLDURWDþQpKRWDQLHUD
Pracovný priestor na tepelnú úpravu
3R
NDåGRP
SRXåLWt
GXWLQX
U~U\
1.
Y\WULWH
2.
3.
2.
1DSRGORåNXXPLHVWQLWH URWDþQê WDQLHU SRG D SRN\QRY
3ULHK DGQpRNLHQNRGYHUt
QD REUi]NX 'EDMWH QD WR DE\ ERO URWDþQê WDQLHU
$NMHU~UDYSUHYiG]NH P{åHWH FH] RNLHQNR VOHGRYD
pevne prichytený v hriadeli.
nedávajte obrátene.
prípravu pokrmu.
Dvierka mikrovlnnej rúry
3RþDV SUHYiG]N\ VSRWUHELþD PXVLD E\ GYLHUND U~U\
-
3UtFK\WN\GYLHURNDEH]SHþQRVWQêEORNRYDFtV\
stém
5~UX QLNG\ QHSRXåtYDMWH EH] SRGORåN\ D URWDþQpKR
-
3UL WHSHOQHM ~SUDYH PXVt E\ SRNUP YR YKRGQHM
-
5RWDþQê WDQLHU VD RWiþD Y VPHUH DM SURWL VPHUX
Ovládací panel
+ULDGH URWDþQpKRWDQLHUD
QiGREHSRORåHQêQDURWDþQRPWDQLHUL
5RWDþQêWDQLHU
KRGLQRYêFKUXþLþLHN
Je vyrobený zo špeciálneho tepluvzdorného skla.
3RNUP YR YKRGQHM QiGREH WUHED SRORåL QD URWDþQê
WDQLHU5~UXQHSRXåtYDMWHEH]URWDþQpKRWDQLHUD
8.
3RGORåNDSRGURWDþQêWDQLHU
3RGORåNX XPLHVWQLWH QD GQR GXWLQ\ U~U\ SRG URWDþQê
tanier.
9. Grilovacie teleso
10. Grilovací rošt
5RWDþQê WDQLHU QLNG\
taniera.
YåG\~SOQH]DWYRUHQp
4.
5.
6.
7.
3RGORåNX URWDþQpKR WDQLHUD SRORåWH QD GQR GXWLQ\
rúry.
YOKNRX
KDQGULþNRX
URWDþQêWDQLHU
SRGORåND
KULDGH
8
Downloaded From Microwave-Manual.com Manuals
W
EMM2015
Ovládací panel
1.
2YOiGDþYêNRQX
6O~åLQDQDVWDYHQLHSRåDGRYDQpKRYêNRQXYãNiOHRGGR:
2.
2YOiGDþþDVX
6O~åL QD QDVWDYHQLH SRåDGRYDQpKR þDVX 3R QDVWDYHQt þDVX VD U~UD
VSXVWt 2YOiGDþ þDVX EXGH SUDFRYD SUHVQHMãLH DN QDMSUY QDVWDYtWH
Y\ããLXKRGQRWXDSRWRPKQH
9
Downloaded From Microwave-Manual.com Manuals
YUiWLWHRYOiGDþQDSRåDGRYDQ~KRGQRWX
W
EMM2015
Mikrovlnná prevádzka
1.
2.
3.
2WYRUWH GYLHUND SRNUP YR KRGQHM QiGREH SRORåWH QD
$NVLåHOiWHDE\ WHSHOQi ~SUDYD SRNUPX WUYDOD NUDWãLH DNR
URWDþQêWDQLHUDGYLHUND]DWYRUWH
2 minúty,
2YOiGDþRP
YêNRQX
QDVWDYWH
]YR WH
SRåDGRYDQê
QDVWDYWH QDMSUY Y\ããLX KRGQRWX D SRWRP KQH
YUi WHRYOiGDþQDSRåDGRYDQ~KRGQRWX
YêNRQSR]ULQDVOHGXM~FXWDEX NX
$N FKFHWH WHSHOQ~ ~SUDYX SRNUPX VNRQþL RWRþWH RYOiGDþ
2WRþHQtP RYOiGDþD þDVX QDVWDYWH SRåDGRYDQê þDV
þDVXGRSRORK\
tepelnej úpravy pokrmu.
4.
8SR]RUQHQLH3RNDåGRPSRXåLWtU~U\QDVWDYWHRYOiGDþ
5~UD]DþQHSUDFRYD þDVX
GR
SRORK\
LQDN
EXGH
U~UD
SRNUDþRYD
v prevádzke.
Príklad: 20- minútová tepelná úprava pri výkone 450 W
1.
2.
3.
2WRþQêRYOiGDþYêNRQXQDVWDYWHQDKRGQRWX:
2WRþQêRYOiGDþþDVXQDVWDYWHQDKRGQRWX
5~UDEXGHDXWRPDWLFN\SUDFRYD PLQ~WSULYêNRQH:
Zohrievanie hotových chladených pokrmov
•
3RN\Q\YêUREFRYKRWRYêFKSRNUPRYRK DGQHþDVX]RKULHYDQLDXYHGHQpQDREDOHYêURENXVO~åLDOHQSUHRULHQWiFLX$NSR
XSO\QXWtRGSRUXþHQpKRþDVX]RKULHYDQLHSRNUPQLHMHWHSOêYUi WHKRGRPLNURYOQQHMU~U\D]RKULHYDMWHKRGOKãLH
3RVWXSXMWHSRGREQHDNRSUL]RKULHYDQtYEHåQHMU~UHQDSHþHQLH
•
•
3RNUP\SUDYLGHOQHSUHPLHãDYDMWHSUHGRYãHWNêPRPiþN\DSROLHYN\
9H PLG{OHåLWêMHDMþDVRGVWDYHQLDSRNUPXNWRUêMHV~þDV RXSURFHVXWHSHOQHM~SUDY\SRNUPXD]DEH]SHþXMHURYQRPHUQp
rozdelenie teploty v celom pokrme.
7DEX NDYêNRQRYêFKVWXS RY
Výkon
100 W
9\XåLWLH
300 W
pokrmov.
Rozmrazovanie mrazených pokrmov
8GUåLDYDQLHWHSORW\
180 W
Mierny výkon
GRNRQþRYDQLHQLHNWRUêFKSRNUPRYKXVWêFKSROLHYRNDJXOiãRYSHþHQLHSXGLQJRY
DV\URYêFKNROiþRY
450 W
Stredný výkon
UêFKOHMãLHUR]PUD]RYDQLHD]RKULHYDQLHKXVWêFKSROLHYRNDJXOiãRYSHþHQLH
NROiþRY
600 W
Zohrievanie
]RKULHYDQLHKRWRYêFKSRNUPRYSHþHQLHPlVDDK\GLQ\NROiþRYDSXGLQJRY
800 W
Max. výkon
zohrievanie vody alebo tekutín, tepelná úprava zeleniny, prehrievanie a
zapekanie pokrmov
10
Downloaded From Microwave-Manual.com Manuals
W
EMM2015
Grilovanie
Otvorte dvierka rúry, nD SRGORåNX XPLHVWQLWH URWDþQê
tanier, SRNUP SRORåWH QD JULORYDFt URãW D YORåWH KR GR U~U\
2.
3.
2YOiGDþRPþDVXQDVWDYWHSRåDGRYDQêþDVJULORYDQLD
Rúra sa automaticky spustí.
7iWRPHWyGDWHSHOQHM~SUDY\SRNUPXMHYKRGQiQDSHþHQLH
PlVD
DNR
V~
QDSU
VWHDN\
NRWOHW\
IDãtUN\
DW
1H]DEXGQLWHåHU~UDVDSULJULORYDQt]RKUHMH
1.
8SR]RUQHQLH3RNDåGRPSRXåLWtU~U\QDVWDYWHRYOiGDþ
þDVX GR SRORK\ LQDN EXGH U~UD SRNUDþRYD Y
prevádzke.
2YOiGDþYêNRQXQDVWDYWHGRSRORK\SUHJULORYDQLH
Príklad: 40-minútové grilovanie
1.
2.
3.
(gril).
2YOiGDþYêNRQXRWRþWHGRSRORK\
2YOiGDþþDVXQDVWDYWHGRSRORK\
5~UD]DþQHDXWRPDWLFN\SUDFRYD Kombinovaná prevádzka
Otvorte dvierka rúry, nD SRGORåNX XPLHVWQLWH URWDþQê
tanier, SRNUP SRORåWH QD JULORYDFt URãW D YORåWH KR GR U~U\
2.
2YOiGDþRP
7iWRPHWyGDWHSHOQHM~SUDY\SRNUPXMHYKRGQiQDSHþHQLH
3.
kombinovanej prevádzky.
Rúra sa automaticky spustí.
PlVD
DNR
V~
QDSU
VWHDN\
NRWOHW\
IDãtUN\
DW
QDVWDYWH
SRåDGRYDQê
8SR]RUQHQLH3RNDåGRPSRXåLWtU~U\QDVWDYWHRYOiGDþ
2YOiGDþYêNRQXQDVWDYWHGRSRORK\SUHNRPELQRYDQ~
prevádzku.
þDVX GR SRORK\ LQDN EXGH U~UD SRNUDþRYD Y
prevádzke.
Príklad: 30-minútová kombinovaná prevádzka
1.
2.
3.
2YOiGDþYêNRQXRWRþWHGRSRORK\
þDV
1H]DEXGQLWHåHU~UDVDSULJULORYDQt]RKUHMH
1.
þDVX
(kombinovaná prevádzka 2).
2YOiGDþþDVXQDVWDYWHGRSRORK\
5~UD]DþQHDXWRPDWLFN\SUDFRYD Upozornenie:
$NSRþDVSUHYiG]N\RWYRUtWHGYLHUNDU~U\U~UDVDDXWRPDWLFN\Y\SQH3R]DWYRUHQtGYLHURNEXGHWHSHOQi~SUDYDSRNUPX
SRNUDþRYD 3RVNRQþHQtWHSHOQHM~SUDY\SRNUPXVDU~UDY\SQHD]D]QLH]YXNRYêVLJQiO
3ULNRPELQRYDQHMSUHYiG]NHP{åHWHXSUDYRYD SRåDGRYDQêYêNRQDMþDVSRþDVSUHYiG]N\U~U\
11
Downloaded From Microwave-Manual.com Manuals
W
EMM2015
7DEX N\
Grilovanie
3RNUPWUHEDSRORåL QDJULORYDFtURãWDSRGURãWWUHEDXPLHVWQL YKRGQ~QiGREXQD]DFK\WiYDQLHã DY\Y
záujme zjednodušenia
þLVWHQLD9SRORYLFLWHSHOQHM~SUDY\SRNUPREUi WH
Pokrm
Toast
Syrový toast
0QRåVWYR
ýDV
Poznámky
2 kusy
4 kusy
4 - 5 min
6 - 7 min
4-5 min. pre toast, 2 min. pre oblohu
Kombinovaná prevádzka
3ULSHþHQtPlVDSRORåWHSRNUPQDJULORYDFtURãWDSRGURãWQDURWDþQêWDQLHUXPLHVWQLWH YKRGQ~ QiGREX QD ]DFK\WiYDQLH ã DY\
v]iXMPH]MHGQRGXãHQLDþLVWHQLD3RNUPREUDFDMWHSRG
Pokrm
0QRåVWYR
Slanina
4 (100 g)
900 g
+RYlG]LHPlVRVNRV RX
%UDYþRYpPlVR
%UDYþRYpN~VN\
900 g
2-3 (450 g)
DSRWUHE\
Program /
výkon
Kombi 3
Mikrovlnná
prevádzka
800 W
Kombi 2
Kombi 2
Poznámky
ýDV
7-9 min
25 min
3RWULWHROHMRP2FKX WHVR RXD
NRUHQtP3RGRSHþHQtQHFKDMWH
5-6 min
20-25 min
RGVWi PLQ~W
3RWULWHROHMRP2FKX WHVR RX
korením a paprikou.
stehná
Mrazený hamburger
Klobásky
Rybí steak
450 g
800 g
4 (200 g)
len 450 g
2 (350 g)
Kombi 2
Kombi 1
Kombi 3
15-20 min
25-30 min
12-15 min
10-15 min
22-24 min
Mrazenie zemiaky a fašírka
2 (150 g)
Kombi 2
16-18 min
.XUþDSR]G åQHUR]SROHQp
Kombi 1
3RWULWHROHMRP2FKX WHVR RX
korením a paprikou.
3RWULWHROHMRP2FKX WHVR RXD
korením.
Výkon pri grilovaní a kombinovanej prevádzke
Symbol
Nastavenie
Mikrovlnný výkon
Výkon grilu
Gril
0W
1000 W
Kombi 1
300 W
1000 W
Kombi 2
450 W
1000 W
Kombi 3
800 W
1000 W
12
Downloaded From Microwave-Manual.com Manuals
W
EMM2015
Rozmrazovanie
1LHNWRUpSRNUP\DNRV~QDSURYRFLHDFKOLHEP{åHWH~þLQQHUR]PUD]RYD SULYêNRQRYRPVWXSQL:
Pokrm
Chlieb
Menší bochník
Príprava
3RORåWH QD YKRGQê SRGVWDYHF DOHER ãSHFLiOQ\
ýDV
Odstátie
8-10 min
10-15 min
10-13 min
10 min
45-60 s
45-60 s
1-1,5 min
5 min
5 min
5 min
15-30 min
15-30 min
15-30 min
15-30 min
kuchynský papier. V polovici rozmrazovania
REUi WH
.UiMDQêYlþãtERFKQtN
3RORåWH QD YKRGQê SRGVWDYHF DOHER ãSHFLiOQ\
kuchynský papier. V polovici rozmrazovania
REUi WH
2 krajce
3RORåWHQDãSHFLiOQ\NXFK\QVNêSDSLHU
åHP D
3RORåWHQDãSHFLiOQ\NXFK\QVNêSDSLHU
åHPOH
3RORåWHQDãSHFLiOQ\NXFK\QVNêSDSLHU
.ROiþHDFHVWRYLQ\
Torta 450 g
2GED WHDSRORåWHQDWDQLHU
6\URYêNROiþJ
2GED WHDSRORåWHQDWDQLHU
.ROiþJ
2GED WHDSRORåWHQDWDQLHU
0~þQHMHGORJ
2GED WHDSRORåWHQDWDQLHU
9-11 min
9-11 min
7-9 min
7-9 min
Maslo
250 g (1 balenie)
Ovocie
2GED WHDSRORåWHQDWDQLHU
3-4 min
5-10 min
0lNNp
EREX RYLWp
3RORåWHYMHGQHMYUVWYHQDSO\WNêWDQLHU
5-6 min
5-10 min
EREX RYLWp
3RORåWHYMHGQHMYUVWYHQDSO\WNêWDQLHU
7-8 min
5-10 min
Prikryte tanierom alebo vhodnou fóliou (nie
7-8 min
5-10 min
ovocie 225 g
0lNNp
ovocie 450 g
Krájaný pokrm
400 g
39&$NFKFHWHSRNUPDM]RKULD ]YR WH
YêNRQ:DQDVWDYWHþDVPLQ~W\
Zelenina
Zeleninu pred tepelnou úpravou nemusíte
UR]PUD]RYD $N FKFHWH ]HOHQLQX UR]PUD]L DM
]RKULD ]YR WHPD[LPiOQ\YêNRQ
13
Downloaded From Microwave-Manual.com Manuals
W
EMM2015
Tipy pre mikrovlnnú prevádzku
Œ
5~UX XGUåXMWH YåG\ þLVW~ 'EDMWH QD WR DE\ SRNUP\
QHY\N\SHOL
D
QH]DEXGQLWH
Y\þLVWL SORFKX
VNOHQHQêP URWDþQêP WDQLHURP D YQ~WRUQ~ VWU
Œ
Œ
Œ
3UL WHSHOQHM ~SUDYH Y PLNURYOQQHM U~UH SRXåtYDMWH
1HSRXåtYDMWH
NRYRYê
ULDG
DOHER
ULDG
V
kovovou
•
JþRNROiG\ UR]OiPWH QD N~VN\ YORåWH GR YKRGQHM
tepla z pokrPXUR]WRSL
nádoby, zohrievajte 1-2 minúty pri najvyššom výkone
a potom dobre premiešajte.
D]GHIRUPRYD -HGOR SULSUDYXMWH YåG\ ]DNU\Wp 3RXåLWH VNOHQHQ~
3HþLYR FKOLHE D LQp P~þQLN\ P{åHWH UR]PUD]RYD
priamo v košíku alebo na kuchynskom papieri.
Ak rozmrazujete jedlo v pôvodnom obale, otvorte ho.
2GVWUi WH NRYRYp VSRMH D VSLnky. Obaly s obsahom
kovu nikdy nedávajte do mikrovlnnej rúry, iba ak to
•
-HGOi Y ãXSNH DOHER SRWLDKQXWp NRåRX ]HPLDN\
YêNRQH
VWXSH
•
Œ
•
YLDFWêPGOKãtþDVMHSRWUH
Zohrievanie chleba
Jednoduché šúpanie cesnaku
2YRFQiã DYD
&LWUXVRYp SORG\ GDM~ YLDF ã DY\ DN LFK QDMSUY QD sekúnd zohrejete pri vysokom výkone.
•
]HOHQLQ\
bný na jeho prípravu.
SRXåtYDMWH
OHQ
PLQLPi
lne
3RXåtYDMWH PHQHM GRFKXFRYDGLHO DNR SUL QRUPiOQHM
WHSHOQHM ~SUDYH 3RNUP RNRUH
WH Då SR VNRQþHQt
Œ
tepelnej úpravy.
V záujme rovnomernej tepelnej úpravy nechajte jedlo
YPLNURYOQQHMU~UHYåG\SiUPLQ~WR dVWi Œ
3UHG VHUYtURYDQtP VNRQWUROXMWH þL MH MHGOR GRVWDWRþQH
teplé.
Œ
YêNRQRYê
DKNR]EDYtãXS\
•
PQRåVWYRYRG\
Œ
QLåãt
ešate.
3UL SUtSUDYH SRNUPX ]YR WH QDMVN{U NUDWãLX GREX
SUtSUDYH
SRVWDþt
Y\VRNRPYêNRQH1DNRQFLVWU~þLNVWODþWHDFHVQDNVD
-HGOR VD SULSUDYt URYQRPHUQH DN KR SRþDV WHSHOQHM
3UL
]PlNþHQLH
DOHER VWU~þLN\ FHVQDNX ]RKULHYDMWH VHN~QG SUL
SUtSUDY\ DE\ VWH VD Y\KOL SUHYDUHQLX ýtP MH MHGOD
Œ
1D
1DQLHNR NRVHN~QG]YR WHVWUHGQêYêNRQRYêVWXSH
3UL WHSHOQHM ~SUDYH YlþãtFK NXVRY GEDMWH QD WR DE\
~SUDY\REþDVSUHPL
=PlNþHQLHDOHERUR]WRSHQLHPDVOD
0DVORVDUR]WRSt]DQLHNR NR VHN~QG SUL PD[LPiOQRP
Na ochranu tenkých a chúlostivých kúskov (nohy
boli najhrubšie kusy na okrajoch nádoby. Pokrm sa
VQDåWH UR]SRUFLRYD URYQRPHUQH 3RNUP umiestnite
YåG\GRVWUHGXQádoby.
Œ
5R]WRSHQLHþRNROiG\
GHNRUiFLRX 1LHNWRUp GUXK\ SODVWX VD P{åX YSO\YRP
klobásy) pred tepelnou prípravou prepichnite. V rúre
nepripraYXMWHYDMFLDSUHWRåHP{åXH[SORGRYD Œ
GR
QHFKDMWHSUDFRYD PLQ~W\
NXUþD DSRXåLWHDOREDO
Œ
YORåWH
mikrovlnnej rúry, nastavte stredný výkon a rúru
YêUREFDYêVORYQHRGSRU~þD
Œ
VWDYX RGQtPWH YHNR QiGRE\ QiGREX
dvierok.
pokrievku, tanier alebo špeciálny papier.
Œ
Zjemnenie medu
$N FKFHWH YUiWL VNU\ãWDOL]RYDQê PHG RG S{YRGQpKR
anu
okrúhle a oválne nádoby.
Œ
•
SRG
3ULY\EHUDQtSRNUPX]U~U\SRXåtYDMWHUXNDY
ice.
14
Downloaded From Microwave-Manual.com Manuals
Príprava obilnej kaše
.DãX P{åHWH SULSUDYL MHGQRGXFKR Y mikrovlnnej rúre
priamo v servírovacom tanieri bez ulepených hrncov.
5LD
WHVDSRN\QPLYêUREFXSRNUPX
W
EMM2015
2ãHWURYDQLHDþLVWHQLH
ahujú energiu
2GROQêFK QHþLVW{W VD ]EDYtWH MHGQRGXFKêP VS{VRERP Y
PLNURY Q D SULSD XM~ VD 7R P{åH PD ]D QiVOHGRN QLåãLX
PLNURYOQQHM U~UH QHFKDMWH ]RYULH SRKiU YRG\ SR GREX FFD
YêNRQQRV VSRWUHELþDDY]QLNQHSUtMHPQpKR]iSDFKX
2-3 minúty.
1LNG\ VD QHSRN~ãDMWH VSRWUHELþ RSUDYRYD VDPL 2SUDY\
1$
6SRWUHELþXGUåXMWHYþLVWRWH=Y\ãN\MHGiOSUL
2'675È1(1,(
1(ý,67Ð7
=
VNÚTORNÉHO
VSRWUHELþD VPLH Y\NRQiYD YêOXþQH NYDOLILNRYDQê VHUYLVQê
3295&+80,.529/11(-5Ò5<1(328äË9$-7(1Ðä
technik.
A INÉ PREDMETY.
3UHGþLVWHQtPVSRWUHELþRGSRMWHRGHOHNWULFNHMVLHWH
Nepríjemný zápach po jedle odstránite týmto spôsobom: v
mikrovlnnej rúre nechajte zoYULH SR GREX PLQ~W SRKiU V
UR]WRNRP YODåQHM YRG\ D SROLHYNRYêFK O\åtF FLWUyQ ovej
ýLVWHQLHSUtVOXãHQVWYD
ã DY\
URWDþQpKRWDQLHUDDSRGORåN\
3R RGPRQWRYDQt XP\WH SUtVOXãHQVWYR ãHWUQêP þLVWLDFLP
ýLVWHQLHVSRWUHELþD]YRQND
prostriedkom. S príslušenstvom manipulujte opatrne.
3UL
Pozor: 9Q~WUR U~U\ D URWDþQê WDQLHU VD SRþDV SUHYiG]N\
U~U\]QDþQH]RKUHM~SUHWRVDLFKEH]SURVWUHGQHSRSRXåLWt
nedotýkajte.
þLVWHQt
9RQNDMãt SOiã SURVWULHGNX
XGUåXMWH
þLVWp
Y\þLVWLWH
SRWRP
=Y\ãN\
MHGiO
D
SUVND
nce
RNDPåLWHXWULWH1HþLVWRW\QDVWHQiFKU~U\SRYUFKXGYLHURN
a tesnení pohlcujú mikrovlnnú energiu, redukujú výkon
rúry a vNUDMQRPSUtSDGHP{åXSRãNRGL MHMYQ~WUR
1D þLVWHQLH SRXåtYDMWH ãHWUQê WHNXWê þLVWLDFL SUR striedok,
SDQHOX
Zabránite
VSRWUHELþD
tým
UR]WRNRP
þLVWRX
þLVWLDFHKR SURVWULHGNX D Q
ýLVWHQLHVSRWUHELþD]YQ~WUD
9Q~WUR U~U\
RYOiGDFLHKR
pootvorené dvierka.
spusteniu spotrebiþD
ãHWUQpKR
YRGRX
QHFKDMWH
neúmyselnému
RGVWUi
þLVWLDFHKR
WH
]Y\ãN\
ásledne vytrite dosucha mäkkou
handriþkou.
1DþLVWHQLHRNQDGYLHURNP{åHWH SRXåL EHåQê XQLYHU]iOQ\
SURVWULHGRN V UR]SUDãRYDþRP 1D þLVWHQLH YRQNDMãHM þDVWL
VSRWUHELþD QHSRXåtYDMWH DEUD]tYQH D DJUHVtYQH þLVWLDFH
SURVWULHGN\ D GU{WHQN\ 'EDMWH QD WR DE\ VD SUL þLVWHQt GR
YHQWLODþQêFKRWYRURYQHGRVWDODYRGD
WHSO~YRGXDPlNN~þLVW~KDQGULþNX
=È6$'1( 1(328äË9$-7( $%5$=Ë91( $*5(6Ë91(
ýLVWHQLHJULOX
$
*ULORYDFLH WHOHVR VD SRþDV SUHYiG]N\ VSRWUHELþD P{åH
.20(5ý1e
DRÔTENKY.
ý,67,$&(
352675,('.<
$
]QHþLVWL SUVNDM~FLP WXNRP DOHER ã DYRX ] SRNUPX 3R
VNRQþHQt SUHYiG]N\
SRþNDMWH
NêP
U~UD
Y\FKODGQH
D
]Y\ãN\ WXNXRþLVWLWH9G{VOHGNX]QHþLVWHQpKRJULORYDFLHKR
WHOHVD VD P{åH Y U~UH WYRUL SUL
nepríjemný zápach.
15
Downloaded From Microwave-Manual.com Manuals
DOãRP ]RKULHYDQt
W
EMM2015
Servis a náhradné diely
$NVSRWUHELþQHSUDFXMHWDNDNRE\PDOSUHþtWDMWHVLQDVOHGXM~FXNDSLWROXDULD
WHVDXYHGHQêPLSRN\QPL
6SRWUHELþY{EHFQHIXQJXMH"
6NRQWUROXMWHþL
-
MHVSRWUHELþ]DSRMHQêGRHOHNWULFNHMVLHWH
MH]iVWUþND]DVXQXWiY]iVXYNH
YSUtSDGHSRWUHE\Y\PH
WHSRLVWNXY]iVWUþNH]DQRY~VURYQDNêPLSDUDPHWUDPLDVNRQWUROXMWHþLMH]iVWUþNDVSUiYQH
pripojená ku káblu;
-
MH]DSQXWêVStQDþ]iVXYN\DOHERHOHNWULFNpKRREYRGX
sú v poriadku poistky domácej elektrickej inštalácie;
neide o prerušenie dodávky elektrického prúdu;
$NVDSRLVWN\Y\SiOLDYLDFNUiW]DVHERXREUi WHVDQDNYDOLILNRYDQpKRHOHNWURLQãWDODWpUD
Mikrovlnná rúra nepracuje?
6NRQWUROXMWHþL
-
sú dvierka dobre zatvorené;
na dvierkach nie sú zachytené zvyšky pokrmov alebo iné predmety;
V~WHVQHQLDGYLHURNGRNRQDOHþLVWp
VWHVSUiYQHQDVWDYLOLYãHWN\RYOiGDþH
$N YiP XYHGHQp SRN\Q\ QHSRP{åX D SRUXFKD SUHWUYiYD DM QD
DOHM REUi WH VD QD DXWRUL]RYDQp VHUYLVQp VWUHGLVNR =R]QDP
DXWRUL]RYDQêFKVHUYLVQêFKVWUHGtVNMHSULORåHQê
.RPSHWHQWQêVHUYLVQêFKWHFKQLNEXGHRGYiVSRåDGRYD QDVOHGXM~FH~GDMH
1.
2.
3.
4.
5.
0HQRDGUHVXD36ý
7HOHIyQQHþtVOR
6WUXþQêSRSLVSRUXFK\
0RGHODVpULRYpþtVOR
Dátum kúpy
7LHWR ~GDMH XPRåQLD SUDFRYQtNRP VHUYLVX SULSUDYL VSUiYQH QiKUDGQp GLHO\ 9\KQHWH VD WDN RSDNRYDQHM QiYãWHYH VHUYLVQêFK
technikov a ušetríte.
0RGHODYêUREQpþtVORQiMGHWHQD W\SRYRP ãWtWNX VSRWUHELþD 'RSRUXþXMHPH ]DStVD VL LFK GR QDVOHGXM~FHKR ]R]QDPX DE\ VWH
LFKPDOLYåG\SRU
uke:
Model:
EMM20017
9êUREQpþtVORBBBBBBBBBBBBBBBBBBBBBB
Dátum kúpy: ._______________________
i
$NVD]iYDGDY\VN\WODSRþDV]iUXþQHMGRE\WUHEDVLSULFK\VWD DMGRNODGRN~SHVSRWUHE þD
6OXåE\VHUYLVQpKRVWUHGLVNDSRþDV]iUXþQHMGRE\QHEXG~EH]SODWQpDNVDMHGQiRQHRSR
VS{VREHQ~QHVSUiYQ\PSRXåLWtPVSRWUHELþD3UHWRVDG{VOHGQHULD
dstatnenú reklamáciu alebo poruchu,
WHSRN\QPLYWHMWRSUtUXþNH
Náhradné diely
1iKUDGQp GLHO\ PDM~ N GLVSR]tFLL YêOXþQH DXW
orizované servisné strediská a zákaznícke centrum. V prípade poruchy sa preto
YåG\REUi WHQDDXWRUL]RYDQpVHUYLVQpVWUHGLVNR3UtVOXãQê]R]QDPMHSULORåHQê
Záruka
Electrolux Slovakia, divízia Domáce spotUHELþH SRVN\WXMH QD YêUREN\ URþQ~ ]iUXNX 9LDF LQIRUPiFLt R ]iUXNH QiMGHWH QD
SULORåHQRP]iUXþQRPOLVWH
16
Downloaded From Microwave-Manual.com Manuals
Q
EMM2015
&RQ LQXW
Inainte de a util iza cuptorul cu microu nde
6LJXUDQ DvQXWLOL]DUH,QVWUXF LXQL
±*KLGXOXVWHQVLOHORUúLDFFHVRULLORUFXSWRUXOXL
4
5
5
6
Date tehnice
6
3XQHUHDvQIXQF LXQH
7
7
±6LJXUDQ
vQXWLOL]DUHDJU WDUXOXL,QVWUXF LXQL
±7HVWDUHDFRPSDWLELOLW
±6LJXUDQ DPkQF
LLYDVHORU
ULL
– Despachetarea
Instalare
7
7
7
±&RQHFWDUHDODUH HD
– Conexiuni electrice
&XPV
XWLOL]H]LFXSWRUXOW XFXPLFURXQGH
±1XPHOHúLUROXOS U LORUFRPSRQHQWH
– Instalarea platanului
±7DEORXOGHFRPDQG
±*
WLWXOFXPLFURXQGH
±*KLGXOVHW ULLHQHUJLHLHOHFWULFHSHQWUXFXSWRUXOFXPLFURXQGH
±*
WLWXOSHJU
±*
WLWXOFXPLFURXQGHúLJU WDU
WDU
±5HFRPDQG ULSHQWUXJ WLWXOSHJU WDU
±5HFRPDQG ULSHQWUXJ WLWXOFXPLFURXQGHúLJU WDU
±1LYHOHGHFXUHQWSHQWUXPLFURXQGHúLJU WDU
±,QVWUXF LXQLGHGHFRQJHODUHXWLOL]kQG:
– Sugestii pentru utilizarea cuptorului cu microunde
±,QJULMLUHúLFXU
DUH
±&XU
DUHDDFFHVRULLORUSODWDQúLVXSRUW
±&XU
LUHDLQWHULRUXOXL
±&XU
LUHDH[WHULRUXOXL
±,QJULMLUHúLFXU
LUHJU
WDU
8
8
8
9
10
10
11
11
12
12
12
13
14
15
15
15
15
15
6HUYLFHúLSLHVHGHUH]HUY 16
&RQGL LLGHJDUDQ LH
17
3
Downloaded From Microwave-Manual.com Manuals
Q
EMM2015
6WLPD L&OLHQ L
9 PXO XPLPF D LDOHVXQSURGXV(OHFWUROX[6XQWHPFRQYLQúLF YH LDMXQJHODFRQFOX]LDF QRXOGYRDVWU FXSWRU
FXPLFURXQGHY HVWHH[WUHPGHXWLOúLGHPDUHDMXWRU&DúLvQFD]XODOWRUDSDUDWHGHEXF W ULHYH LDYHDQHYRLHGH
WLPSSHQWUXDY IDPLOLDUL]DFXWRDWHIXQF LXQLOHúLFDUDFWHULVWLFLOHOXLGDUWUHSWDWFXSWRUXOYDGHYHQLXQDFFHVRULX
LQGLVSHQVDELOSHQWUXEXF W ULDGYRDVWU Înainte de a utiliza Cuptorul cu Microunde
&LWL LFXDWHQ LHLQVWUXF LXQLOHúLXUPD LWRDWHUHFRPDQG ULOHGDWHHOHDXIRVWFRQFHSXWHSHQWUXDY GDSRVLELOLWDWHD
V RE LQH LXQUDQGDPHQWPD[LPGHODFXSWRUXOFXPLFURXQGH(OHFWUROX[UHFHQWDFKL]L LRQDW(VWHLPSRUWDQWV
S VWUD LPDQXDOXOFXLQVWUXF LXQLSHQWUXDSXWHDILFRQVXOWDWúLvQYLLWRU'DF YLQGH LVDXvQVWU LQD LDSDUDWXOVDX
GDF Y PXWD LODVkQGXOODYHFKHDORFXLQ
DVLJXUD LY F QRXOSURSULHWDUSULPHúWHPDQXDOXORGDW FXFXSWRUXO
DYkQGDVWIHOSRVLELOLWDWHDV FXQRDVF PRGXOOXLGHIXQF LRQDUHúLSULQFLSDOHOHSUHFDX LLFDUHWUHEXLHXUPDWHSH
SHULRDGDXWLOL] ULLVDOH
I6LJXUDQ DXWLOL] ULLLQVWUXF LXQL
•
,QWUHUXS WRDUHOHGHVLJXUDQ
energia microundelor, tubul magnetronului se poate
deteriora.
FXSODWHúLvQFRUSRUDWH
vPSLHGLF FXSWRUXOFXPLFURXQGHV IXQF LRQH]H
•
FkQGXúDHVWHGHVFKLV •
•
SXQH LvQIXQF LXQHFXSWRUXOFkQGXúDHVWHGHVFKLV
•
expune energiei microundelor.
•
VFDPHOHO VDWHGHODYHW V VHDFXPXOH]HSH
VXSUDIH HOHL]RODWRDUHDOHXúLL9H]LVHF LXQHD
•
LUHúL,QJULMLUHSHQWUXLQVWUXF LXQLOHGHFXU
1XvQFHUFD LV XVFD LKDLQHVDX]LDUHvQFXSWRU
Aceste articole se pot aprinde.
1XO VD LFDVWURSLLGHPkQFDUHLPSU úWLD LVDX
&XU
1XS VWUD LDFHVWDSDUDWvQH[WHULRU1XOIRORVL LvQ
apropierea apei.
vQWUXFkWRSHUDUHDOXLFXXúDGHVFKLV Y SRDWH
•
(VWHQHYRLHGHRVXSUDYHJKHUHDWHQW DFXSWRUXOXL
când este utilizat de copii.
1XY DWLQJH LGHvQWUHUXS WRDUHVDXQXvQFHUFD LV
1XXWLOL]D LVSD LXOJROGLQLQWHULRUXOFXSWRUXOXLSHQWUX
DVWRFDSURGXVH1XO VD LEXF
LUH
LGHKkUWLHXVWHQVLOH
GHEXF W ULHVDXDOLPHQWHvQLQWHULRUXOFXSWRUXOXL
când acesta nu este utilizat.
1XSXQH LvQIXQF LXQHFXSWRUXOGDF HVWHGHIHFW
SkQ FkQGQXHVWHUHSDUDWGHXQSHUVRQDOFDOLILFDW
•
(VWHGHRVHELWGHLPSRUWDQWFDXúDFXSWRUXOXLV VH
,QVWUXF LXQLGHVLJXUDQ
vQFKLG FRPSOHWúLFDXúDRQGXO UL
vQXWLOL]DUHDJU WDUXOXL
EDODPDOHOHúL] YRDUHOHVWULFDWHVDXQHVLJXUH
HWDQú ULOHXúLORUúLVXSUDIH HOHGHHWDQúDUHVXV QX
1.
SUH]LQWHGHIHF LXQL
•
vPSU úWLHDS SHVXSUDID DHLvQWLPSXOXWLOL] ULL
FXSWRUXOSULQIRU HSURSULL5HSDUD LLOHHIHFWXDWHGH
JU WDUXOXL
SHUVRDQHI U H[SHULHQ
•
•
2.
SRWSURYRFDDFFLGHQWHVDX
VDXVFRDWH LSURGXVHGLQFXSWRU$FHVWHDGHYLQ
&RQWDFWD L$WHOLHUXOGH6HUYLFHGLQORFDOLWDWH
IRDUWHILHUELQ LvQFXSWRUDúDF DYH LJULM V QX
1XGLVORFD LFDUFDVDH[WHULRDU XúDVDXWDEORXOGH
Y DUGH LùLSODWDQXOVDXVXSRUWXOGHPHWDOVH
FRPDQG vQWUXFkWY H[SXQH LXQXLYROWDMH[WUHPGH
vQILHUELQW SHSDUFXUVXOXWLOL] ULLvQFRQVHFLQ
înalt.
IRORVL LRP QXú FkQGOHPDQLSXOD L
3.
,QVWDOD LVDXSR]L LRQD LDFHVWFXSWRUvQFRQIRUPLWDWH
1XDWLQJH LIHUHDVWUDH[WHULRDU VDXLQWHULRDU
FXFRPSRQHQWHPHWDOLFHFkQGLQWURGXFH LVDX
VFRDWH LSURGXVHGLQFXSWRU,QWHULRUXOXúLLúLDO
J VL LvQPDQXDO
FXSWRUXOXLVHvQILHUEkQW IRDUWHPXOWDúDF DYH L
8WLOL]D LDSDUDWXOSHQWUXGHVWLQD LDOXLDúDFXPHVWH
JULM FkQGPDQLSXOD LPkQFDUHDGLQFXSWRU
HDGHVFULV vQPDQXDO1XXWLOL]D LFKLPLFDOHFRUR]LYH
4.
1XSXQH LSODWDQXOVDXUHFLSLHQWHOHvQDS UHFH
QXvQFHUFD LV OHU FL LUHSHGHGXS XWLOL]DUH
vQDFHVWFXSWRUFRQFHSXWSHQWUXDvQF O]LJ WLVDX
decongela preparatele culinare. El nu a fost proiectat
pentru utilizare
LQGXVWULDO VDXvQODERUDWRUúLQLFLSHQWUXXQD
FRPHUFLDO vQWUXFkWDFHVWOXFUXDULQYDOLGDJDUDQ LD
•
)RORVL LRP QXú GHSURWHF LHFkQGLQWURGXFH L
IXQF LRQDUHDQHFRUHVSXQ] WRDUHDDSDUDWXOXL
cu
“INSTRUCTIUNILE DE INSTALARE” pe care le
•
)HUHDVWUDGHVWLFO VHSRDWHVSDUJHGDF VH
6XEQLFLXQSUHWH[WVDQXvQFHUFD LV UHSDUD L
1XSXQH LFXSWRUXOvQIXQF LXQHFkQGHVWHJRO'DF
HOQXFRQ LQHDOLPHQWHVDXDS FDUHV DEVRDUE
4
Downloaded From Microwave-Manual.com Manuals
Q
EMM2015
5.
1XSXQH LQLPLFGHDVXSUDSHFXSWRU3DUWHDGH
VXVDFDELQHWXOXLVHvQILHUEkQW IRDUWHWDUHDúD
6LJXUDQ DDOLPHQWHORU
F RULFHSURGXVDúH]DWDFRORSRDWHILGHWHULRUDW
•
GHF OGXU (VWHQRUPDOFDDEXUXOV LDV SULQ
1XSU ML LFDUQHIRDUWHJUDV vQFXSWRUXOFX
PLFURXQGHvQWUXFkWWHPSHUDWXUDJU VLPLORUQX
FU WXULPLQXVFXOHV DSDU RSkFO XúRDU SH
Xú VDXFKLDUvQMXUXOXúLLúLFDvQWLPSXO
SRDWHILFRQWURODW H[LVWkQGULVFXODSDUL LHLXQRU
SURFHVXOXLGHSUHSDUDUHDDOLPHQWHORUV DSDU
VLWXD LLQHSUHYD]XWH
•
VWURSLGHDS VXEXú $FHVWHIHQRPHQHVXQW
3XWH LSUHJ WLSRSFRUQvQFXSWRUXOFXPLFURXQGH
GRDURVLPSO FRQGHQVDUHGDWRUDW F OGXULL
vQV GRDUvQSDFKHWHVDXXVWHQVLOHVSHFLDO
HPDQDWHGHPkQFDUHúLQXDIHFWHD] VLJXUDQ D
GHVHPQDWHvQDFHVWVFRS$FHDVW RSHUD LHGH
FXSWRUXOXL8úDQXDUHUROXOGHDHWDQúDFRPSOHW
SUHSDUDWHQXWUHEXLHO VDW QHVXSUDYHJKHDW •
LQWHULRUXOFXSWRUXOXL1XSXQH LRELHFWHSHFXSWRU
•
vQWUXFkWSDUWHDOXLVXSHULRDU GHYLQHIRDUWH
neporoase pentru a împiedica acumularea de
ILHUELQWHúLRULFHRELHFWSXVDFRORYDDYHDGH
DEXUúLFU SDUHDORU0HUHOHFDUWRILLILF
suferit.
SXLúLJ OEHQXúXULOHGHRXVXQWH[HPSOHGH
ATENTIE: &kQGvQF
aparatului.
Formarea unui arc electric în cuptor atunci când
FRQWLQX SRDWHGHWHULRUDDSDUDWXOúLvQDFHVWFD]
RSUL LSURJUDPXOúLYHULILFD LXVWHQVLOD
•
GHSXQFWXOGHILHUEHUHSRDWHDYHDORFI U EDUERWDUH
ceea ce poate duce la darea în clocot a lichidului
ILHUELQWH3HQWUXDvPSLHGLFDDFHDVW SRVLELOLWDWHHVWH
ELQHV XUPD LSDúLLXUP WRUL
1.
JkWXOVXE LUH
GHVXVGLQVSDWHúLODWHUDOHDOHFXSWRUXOXL
2.
3.
1XVXSUDvQF O]L L
$JLWD LOLFKLGXOvQDLQWHGHDLQWURGXFHUHFLSLHQWXO
LLYHVHOHLXWLOL]DWH
vQFXSWRUúLvQF RGDW ODMXP WDWHDWLPSXOXL
DIHFWDWvQF O]LULL
ODJ WLW
•
(YLWD LIRORVLUHDUHFLSLHQWHORUFXSHUH LLGUHS LúL
1XDFRSHUL LRULILFLLOHGHYHQWLOD LHORFDOL]DWHvQS U LOH
7HVWDUHDFRPSDWLELOLW
O]L LOLFKLGHH[VXSHVDXE XWXULvQ
FXSWRUXOFXPLFURXQGHVXSUDvQF O]LUHDOLFKLGXOXLGLQFROR
PLFURXQGHOHVXQWvQIXQF LXQHVHGDWRUHD] GHRELFHL
XWLOL] ULLXVWHQVLOHORUPHWDOLFH7RWXúLIRUPDUHDOXL
HLLGH
SURGXVHFDUHWUHEXLHvQ HSDWH
1XIRU D LURWLUHDPDQXDO DSODWDQXOXL$FHVWOXFUX
SRDWHGXFHODRIXQF LRQDUHQHFRUHVSXQ] WRDUHD
•
,Q HSD LDOLPHQWHOHFXVXSUDIH HVDXPHPEUDQH
4.
'XS vQF O]LUHO VD LOLFKLGXOvQFXSWRUR
SHULRDGDVFXUW GHWLPSDPHVWHFkQGXOFXJULM
3XQH LXQYDVGHJ WLWvQFDYLWDWHvPSUHXQ FXXQ
înainte de a scoate recipientul.
SDKDUSHMXP WDWHSOLQFXDS $F LRQD LFXSWRUXOOD
•
:WLPSGHXQPLQXW'DF YDVXOVD
vQILHUEkQWDWQXWUHEXLHIRORVLW'DF VDvQF O]LWXúRU
8QHOHSURGXVHFXPDUILRX OHvQWUHJLVDX
recipientele sigilate – de exemplu borcanele de
SRDWHILXWLOL]DWODUHvQF O]LUHDPkQF ULLGDUQXúLOD
VWLFO FXFDSDF±SRWH[SORGDúLQXDUWUHEXL
J WLW'DF DU PDVODWHPSHUDWXUDvQF SHULLSRDWHIL
vQF O]LWHvQFXSWRUXOFXPLFURXQGH2FD]LRQDO
IRORVLWODJ WLWXOFXPLFURXQGH
•
RFKLXULOHSRWH[SORGDvQWLPSXOJ WLULL,Q HSD L
6HUYH HOHOHGHKkUWLHK UWLDGHSDUDILQ IDUIXULLOH
vQWRWGHDXQDJ OEHQXúXODSRLDFRSHUL LOHúL
FHúWLOHFDUWRDQHOHDPEDODMHOHGHSURGXVHFRQJHODWH
O VD LOHDúDXQPLQXWvQDLQWHGHDvQGHS UWD
VXQWXVWHQVLOHH[WUHPGHXWLOH$VLJXUD LY
vQWRWGHDXQDF UHFLSLHQWHOHVXQWSOLQHFXDOLPHQWH
capacul.
127
•
FDUHV DEVRDUE HQHUJLDHYLWkQGDVWIHOSRVLELOLWDWHD
VXSUDvQF O]LULL
QHFRUHVSXQ] WRDUHDDSDUDWXOXL
SHQWUXSURGXVHFRQJHODWHúLDPEDODMHGLQSODVWLFSRW
•
fi utilizate în cuptorul cu microunde.
GDWRUHD] XWLOL] ULLXVWHQVLOHORUPHWDOLFH
7RWXúLIRUPDUHDFRQWLQX DDFHVWRUDUFXULSRDWH
mâncare în plastic, hârtie sau alte recipiente
GHWHULRUDDSDUDWXO2SUL LSURJUDPXOúLYHULILFD L
FRPEXVWLELOH'DF REVHUYD LIXP LQH LXúDvQFKLV
ustensila.
úLRSUL LVDXGHFRQHFWD LFXSWRUXOSkQ ODRSULUHD
•
fumului.
jos ale cuptorului.
metalice nu ar trebui introduse în cuptorul cu
•
7UHEXLHV HYLWD LREWXUDUHDRULILFLLORUGHDHULVLUH
SODVDWHvQS U LOHGHVXVGLQVSDWHODWHUDOHúLGH
8VWHQVLOHOHPHWDOLFHúLXVWHQVLOHOHFXPDUJLQL
PLFURXQGHGDF QXVXQWUHFRPDQGDWHVSHFLDOvQ
Formarea unui arc electric în cuptor atunci când
PLFURXQGHOHVXQWvQVWDUHGHIXQF LXQHVH
1XO VD LFXSWRUXOQHVXSUDYHJKLDWúLXLWD LY ODHO
GLQWLPSvQWLPSDWXQFLFkQGvQF O]L LVDXJ WL L
•
1XIRU D LURWLUHDPDQXDO DSODWDQXOXL$FHVW
OXFUXSRDWHGXFHODIXQF LRQDUHD
0XOWHWLSXULGHIDUIXULLGHSODVWLFFHúWLUHFLSLHQWH
•
1XIRORVL LDFHVWFXSWRUvQVFRSXULFRPHUFLDOH
acest sens.
Recipientele cu deschideri mici, de exemplu sticlele, Acest cuptor a fost proiectat doar pentru uz casnic.
QXWUHEXLHXWLOL]DWHODJ WLWXOFXPLFURXQGH)L L
SUHFDX LFkQGvQGHS UWD LFDSDFXOXQHLIDUIXULLSHQWUX
a evita arsurile provocate de aburi.
•
3 VWUD LDFHVWHLQVWUXF LXQL
1XvQF O]L LPkQFDUHvQF QL7UDQVIHUD L
întotdeauna alimentele în recipiente potrivite.
5
Downloaded From Microwave-Manual.com Manuals
Q
EMM2015
*KLGXOXVWHQVLOHORUúLDFFHVRULLORUFXSWRUXOXL
3HQWUXDJ WLvQFXSWRUXOFXPLFURXQGHSRWILXWLOL]DWHPDLPXOWHWLSXULGHXVWHQVLOHúLPDWHULDOH3HQWUXVLJXUDQ DG
YRDVWU úLSHQWUXDSUHYHQLGHWHULRUDUHDXVWHQVLOHORUúLDFXSWRUXOXLDOHJH LXVWHQVLOHúLPDWHULDOHSRWULYLWHSHQWUX
ILHFDUHPHWRG GHJ WLW
Lista de mai jos este un ghid general.
Materiale
Mod de operare
Ustensile
Microunde
DA
DA*1
*U WDU
&RPELQD LH
DA
DA
DA
DA*1
9DVHGHVWLFO FXGHFRUD LLGHPHWDO
NU
NU
NU
Sticla de cristal plumbuit
NU
NU
NU
3RU HODQXULI U GHFRUD LLGHPHWDO
DA
DA
NU
DA
NU
DA
NU
Corning ware
6WLFO UH]LVWHQW ODF OGXU
&HUDPLF 6WLFO
Portelan
Materiale
plastice
Cuptorul de microunde
DA
DA
Ambalaje din materiale plastice
DA
Metal
7LJDLHPHWDOLF SHQWUXFRSW
NU
DA
NU
Folie de alumuniu*3
DA
DA
DA
NU
NU
DA
DA
DA
NU
NU
DA
DA
DA
DA
DA
NU
NU
DA
DA
DA
DA
&HUDPLF Hârtie
&HúWLIDUIXULLúHUYHWH
+ UWLHFHUXLW
Lemn
*ULODMJU WDU
Platan
Suport platan
Accesorii
'$8VWHQVLOHúLDFFHVRULLXWLOL]DELOH
188VWHQVLOHúLDFFHVVRULLGHHYLWDW
'RDUGDF QXDXPDUJLQHPHWDOLF 'RDUGDF QXDUHHPDLOFDUHFRQ LQHPHWDO
127$8WLOL]D LIROLHGHDOXPLQLXGRDUvQVFRSXULGHSURWHF LHVXSUDXWLOL]DUHDSRDWHFUHDDUFXULHOHFWULFH
Date tehnice
Dimensiuni generale
Greutate 13.5 kg
Volum 20 Litri
/ WLPHPP
6XUV GHHQHUJLH9+]
Adâncime 376 mm
,Q O LPHPP
'LPHQVLXQHD&DYLW
Consum energie
Microunde 1300W
LL
*U WDU:
LPHPP
(QHUJLHIXUQL]DW
Adâncime 292 mm
Microunde 800W
,Q O LPHPP
*U WDU:
/
6
Downloaded From Microwave-Manual.com Manuals
Q
EMM2015
3XQHUHDvQIXQF LXQH
Despachetare
&RQHFWDUHDODUH HD
1%& QGGHVSDFKHWD LFXSWRUXOYHULILFD LGDF
DSDUDWXOQXHVWHGHWHULRUDW'HWHULRU ULOHVDXRULFH
&XSWRUXOHVWHOLYUDWvPSUHXQ FXXQFDEOXHOHFWULFúLR
S U LOLSV WUHEXLHLPHGLDWUDSRUWDWHGHWDLOLVWXOXL
fisa de contact pentru o priza cu impamantare de
&XSWRUXOS U LFRPSRQHQWHDOHFXSWRUXOXLVDX
9+]3URWHF LDRIHULW GHvPS PkQWDUH
accesoriile ar putea fi protejate de o folie ce trebuie
PLQLPDOL]HD] ULVFXULOHvQFD]XOXQXLVFXUWFLUFXLW
vQGHS UWDW vQDLQWHGHDXWLOL]DFXSWRUXO1X
9HULILFD LGDF YROWDMXOFRUHVSXQGHDOLPHQW ULL
DEDQGRQD LDPEDODMHOHFDUHDUSXWHDF GHDvQPkQD
1%'DF FXSWRUXOHVWHFRQHFWDWODSUL] SULQWUXQ
copiilor. Acest lucru poate provoca accidente.
SUHOXQJLWRUYHULILFD LGDF FDEOXOGHSUHOXQJLUHHVWH
vPS PkQWDW
Instalare
ATENTIE! Acest aparat nu trebuie alimentat de la o
,QGHS UWD LRULFHHWLFKHW SURPR LRQDO GHSHXú ,QVWDOD LFXSWRUXOSHRVXSUDID
VXUV GHHQHUJLHQHvPS PkQWDW $SHOD LODXQ
HOHFWULFLDQSHQWUXRULFHSUREOHP UHIHULWRDUHOD
SODW 6XSUDID
WUHEXLHV ILHVXILFLHQWGHUH]LVWHQW SHQWUXDVXSRUWD
FRQHFWDUHDHOHFWULF DFXSWRUXOXLVDXODDVLJXUDUHD
I U SUREOHPHJUHXWDWHDFXSWRUXOXLNJúL
SURWHF LHLSULQvPS PkQWDUHDIXUQL] ULLGHFXUHQW
FRQ LQXWXOXOWHULRUDODFHVWXLD3HQWUXDHYLWD
SRVLELOLWDWHDSURGXFHULLGHYLEUD LLVDX]JRPRWH
$FHVWDSDUDWWUHEXLHvPS PkQWDW'DF HOHVWH
FXSWRUXOWUHEXLHV ILHvQWURSR]L LHVWDELO SUHY ]XWFXRILVDGHFRQWDFWQHUHFDEODELO SHQWUX
$úH]D LFXSWRUXOGHSDUWHGHVXUVHGHF OGXU úL
FDUHSUL]DGYRDVWU HVWHQHSRWULYLW ILVDWUHEXLH
DS ([SXQHUHDODF OGXU úLXPH]HDO SRDWHUHGXFH
W LDW úLFXSWRUXOSUHY ]XWFXRILVDFRUHVSXQ] WRDUH
HILFLHQ DúLUDQGDPHQWXODúDF LQVWDOD LFXSWRUXO
'DF VLJXUDQ DGLQWURILVDQHUHFDEODELO WUHEXLH
GHSDUWHGHVXUVHOHPHQ LRQDWH
VFKLPEDW vQYHOLúXOVLJXUDQ HLWUHEXLHUHDMXVWDW'DF
1XEORFD LRULILFLLOHGHYHQWLOD LHGLQS U LOHGHVXVúL
vQYHOLúXOHVWHSLHUGXWVDXGHWHULRUDWILVDQXWUHEXLH
ODWHUDOHDOHFXSWRUXOXLúLQXSXQH LRELHFWHSHFXSWRU
XWLOL]DW SkQ FkQGDFHVWLQYHOLúQXHVWHvQORFXLW
'DF RULILFLLOHGHDHULVLUHVXQWEORFDWHvQWLPSXO
Conexiuni electrice
IXQF LRQ ULLFXSWRUXOVHSRDWHVXSUDvQF O]LFHHDFH
SRDWHGXFHODXQUDQGDPHQWQHFRUHVSXQ] WRUDO
DSDUDWXOXL$HUXOILHUELQWHLHVHSULQDFHVWHRULILFLLúLLQ
Acest aparat este livrat echipat cu o fisa euro
FRQVHFLQWDDVLJXUD LY F QXOHREWXUD LVDXF QX
VWDQGDUGFXúWLIWXUL
H[LVW HFUDQ ULvQWUHFXSWRUúLSHUHWHOHGLQVSDWH
$úH]D LFXSWRUXOF WPDLGHSDUWHSRVLELOGHDSDUDWH
ATENTIE! ACEST APARAT TREBUIE
GHUDGLRúLWHOHYL]RDUH$FHVWDSDUDWVHFRQIRUPHD]
Ì03
0Æ17$7
FHULQ HORU&((UHIHULWRDUHODVXSULPDUHD
3URGXF WRUXOvúLGHFOLQ RULFHUHVSRQVDELOLWDWH
LQWHUIHUHQ HORUUDGLRGDUXQHOHLQWHUIHUHQ HSRWDSDUH
GDF DFHDVW P VXU GHVLJXUDQ
GDF DSDUDWXOHVWHSODVDWSUHDDSURDSHGHUDGLRVDX
QXHVWHOXDW
în considerare.
televizor.
'DF DúH]D LFXSWRUXOvQWUXQFRO O VD LXQVSD LX
•
GHFHOSX LQFPÌQWUHDSDUDWúLSHUHWHGLQPRWLYH
·'DF
ILVDFXFDUHHVWHHFKLSDWDSDUDWXOQX
GHYHQWLOD LH
HVWHSRWULYLW SHQWUXSUL]DGHFDUHGLVSXQH L
Important! Cuptorul poate fi plasat aproape oriunde în
HDWUHEXLHW LDW VLvQORFXLW FXXQDSRWULYLW EXF W ULH$VLJXUD LY F HVWHDúH]DWSHRVXSUDID
SODW úLF RULILFLLOHGHYHQWLOD LHúLVXSUDID DGHVXE
,QGHS UWD LVLJXUDQ DGLQILVDvQORFXLW )LVDvQORFXLW
FXSWRUQXVXQWEORFDWHSHQWUXDVHRE LQHRYHQWLOD LH
WUHEXLHDUXQFDW SHQWUXDSUHYHQLFXUHQW ULOHFDUHV
VXILFLHQW DUSURGXFHGDF GLQvQWkPSODUHDUILLQWURGXV vQWUR
$FHVWDSDUDWVHFRQIRUPHD] FHULQ HORU'LUHFWLYHL
SUL]DvQDOW SDUWHDFDVHL
&((UHIHULWRDUHOD,QWHUIHUHQ HOH5DGLR
7
Downloaded From Microwave-Manual.com Manuals
Q
EMM2015
* WLWXOODPLFURXQGH
1
2
3
9
5
8
6
4
4
7
10
1XPHOHúLIXQF LDS
U LORUFRPSRQHQWHDOH
&XPV
XWLOL]D LFXSWRUXOFXPLFURXQGH
platanului
1&RPSDUWLPHQWXOSHQWUXJ
WLW&XU
1.3XQH LVXSRUWXOSODWDQXOXLvQFDYLWDWH
D LFRPSDUWLPHQWXO
FXRFkUS GXS XWLOL]DUHDFXSWRUXOXL
2.3XQH LSODWDQXOSHVXSRUWDúDFXPHVWHDU
WDWvQ
2.)HUHDVWUDVSUHLQWHULRU0kQFDUHDSRDWHILREVHUYDW
GLDJUDP $VLJXUD LY F EXWXFXOHVWHELQHIL[DWvQD[XO
vQWLPSFHFXSWRUXOHVWHvQIXQF LXQH
platanului. 1XDúH]D
jos.
3.8úDFXSWRUXOXL8úDWUHEXLHvQWRWGHDXQDvQFKLV
ELQH
vQWLPSXOJ WLWXOXL
4.&kUOLJXO]
$WkWSODWDQXOFkWúLVXSRUWXOWUHEXLHIRORVLWHvQ
YRUXOXLúLVLVWHPXOGHEORFDUHGHVLJXUDQ
5.7DEORXOGHFRPDQG
SHUPDQHQ
7.3ODWDQXO5HDOL]DWGLQWURVWLFO
vQWLPSXOJ WLWXOXL
$WkWPkQFDUHDFkWúLUHFLSLHQWHOHYRUILSXVHSHSODWDQ
vQWLPSXOJ WLWXOXL
6. Axul de transmisie pentru platan
3ODWDQXOVHURWHúWHDWkWvQVHQVXODFHORUGHFHDVRUQLF
VSHFLDO UH]LVWHQW OD
FkWúLLQYHUV$FHVWOXFUXHVWHQRUPDO
F OGXU 0kQFDUHDDIODW vQWUXQUHFLSLHQWHVWHSXV SHDFHDVW
Platan
WDY SHQWUXDILJ WLW 1XIRORVL LFXSWRUXOI U SODWDQ
8.6XSRUWSODWDQ3XQH LVXSRUWXOvQFDPHUDGHJ
WLWúL
Suport rotativ
DúH]D LSODWDQXOSHHO
9.*U
WDU
10.6WDWLYXOJU
LQLFLRGDW SODWDQXOFXID DvQ
Axul platanului
WDUXOXL
8
Downloaded From Microwave-Manual.com Manuals
Q
EMM2015
7DEORXOGHFRPDQG
1. Selectorul de putere
$F LRQD LDFHVWEXWRQSHQWUXDDOHJHQLYHOXOGHSXWHUHFRUHFW
SHQWUXPkQFDUHDGRULW 2. Cronometror
)L[D LOODWLPSXOGRULWSHQWUXJ WLW2SHUD LDGHJ WLWvQFHSH
7RDWHFURQRPHWURDUHOHFXPHFDQLVPGHFHDVRUQLFDF LRQHD]
PDLSUHFLVGDF VXQWIL[DWHODPDLPXOWGHFkWWLPSXOGRULWúL
DSRLUHYHQL LODFHOLQL LDOVWDELOLW
9
Downloaded From Microwave-Manual.com Manuals
Q
EMM2015
* WLWXOODPLFURXQGH
1.
2.
3.
'HVFKLGH LXúDSXQH LPkQFDUHDSHSODWDQ
&XSWRUXOvQFHSHV J WHDVF ,QFKLGH LXúD
&DQGSHULRDGDGHJ WLWHVWHIL[DW ODPDLSX LQGH
)L[D LVHOHFWRUXOGHSXWHUHODSXWHUHDGRULW 9H]L
PLQXWHIL[D LFURQRPHWURUXOODPDLPXOWGHPLQXWHúL
tabelul de mai jos)
DSRLUHYHQL LODWLPSXOGRULW
)L[D LFURQRPHWURUXOODWLPSXOGRULW
3HQWUXDRSULFXSWRUXOvQWLPSXOJ WLWXOXLSXUúLVLPSOX
vQWRDUFH LFURQRPHWURUXOODSR]LWLD
1RW 'XS XWLOL]DUHYHULILFD LGDF D LvQWRUV
FURQRPHWURUXOODSHQWUXF vQFD]FRQWUDU
FXSWRUXOYDFRQWLQXDV IXQF LRQH]H
([DPSOX3HQWUXDJ WLOD:WLPSGHGHPLQXWH
1.
)L[D LVHOHFWRUXOGHSXWHUHOD:
2.
)L[D LFURQRPHWURUXOOD¶
3.
&XSWRUXOYDvQFHSHDXWRPDWV J WHDVF WLPSGHPLQXWHOD:
5HvQF O]LUHDPkQF UXULORUJ WLWHLQVXILFLHQWGHILHUELQ L
•
7LPSXOSURSXVGHSURGXF WRUSHQWUXJ WLUHDXQXLIHOGHPkQFDUHHVWHGRDURULHQWDWLY'DF GXS H[SLUDUHD
WLPSXOXLSURSXVPkQFDUHDQXHVWHH[WUHPGHILHUELQWHLQWURGXFH LRvQDSRLvQFXSWRUúLO VD LRDFRORSkQ YD
DMXQJHODWHPSHUDWXUDFRUHVSXQ] WRDUH$FHVWPRGGHDSURFHGDQXGLIHU GHJ WLWXOvQFXSWRDUHOHFODVLFH
•
•
$PHVWHFD LPkQFDUHDvQPRGUHJXODWPDLDOHVVRVXULOH
7LPSXOGHVWD LRQDUHFkQGPkQFDUHDHVWHO VDW vQFXSWRUvQF RSHULRDG GXS RSULUHDDFHVWXLDHVWHIRDUWH
LPSRUWDQWHVWHSDUWHLQWHJUDQW DJ WLWXOXLúLSHUPLWHDWLQJHUHDXQHLWHPSHUDWXULHJDOHvQvQWUHDJDPkQFDUH
Ghid pentru setarea puterii microundelor
Fixarea Puterii
5HFRPDQG ULGHXWLOL]DUH
100W
,QF O]LUH,QF O]LUHDPkQF ULL
(180W)
'HFRQJHODUH'H]JKH DUHDPkQF UXULORUFRQJHODWH
300W
450W
600W
800W
$WLQJHUHDSXQFWXOXLGHILHUEHUH&RPSOHWDUHDFLFOXOXLGHJ WLWDXQRUPkQF UXULSU MLWH
0XVDFDOHúLJKLYHFLXUL&UqPHGHRX FRDSWHVDXSU MLWXULFXEUkQ] 0HGLX'HFRQJHODUHPDLUDSLG úLUHvQF O]LUHSHQWUXPXVDFDOHúLJKLYHFLXUL
0HGLX/DZVHFRFSU MLWXULúLSXGGLQJULELVFXLWVHUHvQF O]HVFDOLPHQWHJ WLWHvQ
SUHDODELOVHSU MHúWHFDUQHDGHSRUFYLW úLSXL
6HILHUEVDXVHUHvQF O]HVFOLFKLGH6H3UHSDU OHJXPH6HSUHvQF O]HVFPkQF UXULOH
rumenite.
10
Downloaded From Microwave-Manual.com Manuals
Q
EMM2015
* WLWXOSHJU WDU
1.
)L[D LSODWDQXOSHVXSRUWXOFXUROHDIODWODED]D
FDYLW
)L[D LVHOHFWRUXOGHSXWHUHSHVHWDUHD*ULOO
*U WDU
LLúLSXQH LPkQFDUHDSHJULODGHPHWDO
2.
$FHDVW PHWRG HVWHLGHDO SHQWUXSU MLUHDF UQLLSH
$OHJH LWLPSXOGHJ WLWSULQIL[DUHD
cronometrorului pe timpul dorit. Cuptorul va
porni automat.
JU WDUFRWOHWHVWHDNXULHWF1XXLWD LF GXS
utilizare cuptorul va fi fierbinte.
1RW 'XS XWLOL]DUHYHULILFD LGDF D LvQWRUV
cronometrorul la 0; în caz contrar cuptorul va
FRQWLQXDV IXQF LRQH]H
([DPSOX3HQWUXDXWLOL]DJU WDUXOWLPSGHGHPLQXWH
1.
)L[D LVHOHFWRUXOGHSXWHUHSHJU WDU
2.
)L[D LFURQRPHWURUXOSHFLIUD
3.
&XSWRUXOYDvQFHSHDXWRPDWV J WHDVF WLPSGHPLQXWHvQPRGXO*ULOOJU WDU
* WLWXOFXPLFURXQGHúLJU WDU
1.
)L[D LSODWDQXOSHVXSRUWXOFXUROHDIODWODED]D
FDYLW
LLúLSXQH LPkQFDUHDSHJULODGHPHWDO
)L[D LVHOHFWRUXOGHSXWHUHODSXWHUHDGRULW
SHQWUXPLFURXQGHúLQLYHOXOSHQWUXJU WDU
2.
$FHDVW PHWRG HVWHLGHDO SHQWUXSU MLUHDF UQLLSH
$OHJH LWLPSXOGHJ WLWSULQIL[DUHD
JU WDUFRWOHWHVWHDNXULHWF1XXLWD LF GXS
FURQRPHWURUXOXLSHGXUDWDGHWLPSGRULW utilizare cuptorul va fi fierbinte.
&XSWRUXOSRUQHúWHDXWRPDW
1RW 'XS XWLOL]DUHYHULILFD LGDF D LvQWRUV
cronometrorul la 0; în caz contrar cuptorul va
FRQWLQXDV IXQF LRQH]H
([DPSOX3HQWUXDJ
LOD:úLDXWLOL]DJU WDUXOGHPLQXWH
1.
)L[D LVHOHFWRUXOGHSXWHUHSH&RPEL
2.
)L[D LFURQRPHWURUXOSHFLIUD
3.
&XSWRUXOYDvQFHSHV J WHDVF DXWRPDWWLPSGHPLQXWHOD&RPEL
NOTA:
'DF GHVFKLGH LXúDvQWLPSXOJ WLWXOXLFXSWRUXOvQFHWHD] V IXQF LRQH]H3HQWUXDUHOXDJ WLWXOvQFKLGH LXúD
/DVI UúLWXOFLFOXOXLGHJ WLWJU WDUXOúLPLFURXQGHOHvúLvQFHWHD] DFWLYLWDWHDúLVHDXGHVXQHWXOXQXLFORSR HO
,QPRGXOPLFURXQGHúLJU WDUVHOHFWDUHDSXWHULLúLDWLPSXOXLGHJ WLWSRWILVFKLPEDWHvQWLPSFHFXSWRUXOHVWHvQ
IXQF LXQH
11
Downloaded From Microwave-Manual.com Manuals
Q
EMM2015
5HFRPDQG ULSHQWUXJ WLWXOSHJU WDU
7RDWHDOLPHQWHOHWUHEXLHSXVHSHJU WDUFXRIDUIXULHGHGHVXSWXODFHVWXLDSHQWUXDUHFXSHUDJU VLPHDVDX
SLHUGHULOHSULQVFXUJHUHIDFLOLWkQGDVWIHOFXU
DUHDXOWHULRDU DFDYLW
LL,QWRDUFH LDOLPHQWHOHSHSDUWHDFHDODOW OD
MXP WDWHDWLPSXOXLDIHFWDWJ WLWXOXL
Cantitate
mâncare.
Timp afectat
(Greutate)
3kLQHSU MLW
%UkQ] SHSkLQH
SU MLW
J WLWXOXL
2 felii
4-5 min.
4 felii
6-7 min
Note speciale
PLQSHQWUXDSU MLSkLQHDPLQSHQWUXvQWLQGHUHD
garniturii pe pâine
5HFRPDQG ULSHQWUXJ WLWXOFXPLFURXQGHúLJU WDU
3XQH LRJULO SHSODWDQSHQWUXDSU MLFDUQHDGHSRUFVDXGHYLW 6XEJULO SHSODWDQSXQH LRIDUIXULHSHQWUXD
UHFXSHUDJU VLPHDVDXSLHUGHULOHSULQVFXUJHUH,QWRDUFH LEXF WLOHGHFDUQHSHSDUWHDFHDODOW
atunci când e cazul.
ùXQF
4 (100 g)
Combi 3
7- 9 min
)ULSWXU GHYLW FXRV
900 g
)ULSWXU GHSRUFILOH
900 g
Cotlet de porc
2 - 3(450 g)
Combi 2
20 - 25 min
Microunde doar 800W
Combi 2
25 min
5 - 6 min
450 g
Combi 1
15 - 20 min
Picioare
800 g
Combi 1
25 - 30 min
Hamburger congelat
&kUQD L
4 (200 g)
doar 450 g
Combi 2
Combi 1
12 - 15 min
10 - 15 min
6WHDNGHSHúWH
2 (350 g)
Combi 3
22 – 24 min
2 (150 g)
Combi 2
16 – 18 min.
3XLvQMXP W
L LORQJLWXGLQDO
&DUWRILvQJKH DWL+DVK
Brown
1LYHOHSXWHUHPLFURXQGH3XWHUHJU WDU
Simbol
Setare
Putere microunde
3XWHUHJU WDU
Grill
0W
1000W
Combi 1
300W
1000W
Combi 2
450W
1000W
Combi 3
600W
1000W
12
Downloaded From Microwave-Manual.com Manuals
Q
EMM2015
5HFRPDQG ULSHQWUXXWLOL]DUHDGHFRQJHO ULL
(180W)
8QHOHDOLPHQWHGHH[HPSOXSkLQHDúLIUXFWHOHSRWILGHFRQJHODWHPDQXDOXWLOL]kQGVHW ULOHGHSXWHUH
ALIMENTE
TIMP de
STATIONARE
PREPARARE
Pâine
3XQH LIUDQ]HODSHVXSRUWXOGHVLJXUDQ
)UDQ]HO PLF
DO
FXSWRUXOXLVDXSHXQúHUYH HOGHEXF W ULH
,QWRDUFH LIUDQ]HODODMXP WDWHDWLPSXOXLGH
8-10 min.
10-15 min.
10-13 min.
10 min.
decongelare
3XQH LIUDQ]HODSHVXSRUWXOGHVLJXUDQ
)UDQ]HO PDUHIHOLDW
VDXSHXQ
úHUYH HOGHEXF W ULH,QWRDUFH LIUDQ]HODOD
MXP WDWHDWLPSXOXLGHGHFRQJHODUH
2 felii
3XQH LOHSHXQúHUYH HOGHEXF W ULH
45–60 sec.
5 min.
FKLIO GHSkLQH
3XQH LFKLIODSHXQúHUYH HOGHEXF W ULH
45–60 sec.
5 min.
2 chifle de pâine
3XQH LFKLIOHOHSHúHUYH HOHGHEXF W ULH
1–11/2 min.
5 min.
6FRDWH LSU MLWXUDGLQDPEDODMúLSXQH LRSHIDUIXULH
9-11 min.
15–30 min.
6FRDWH LSU MLWXUDGLQDPEDODMúLSXQH LRSHIDUIXULH
9–11 min.
15–30 min.
7– 9 min.
15–30 min.
7– 9 min.
15–30 min.
3– 4 min.
5–10 min.
3U MLWXULúLSURGXVHGHSDWLVHULH
3U MLWXU JOE
3U MLWXU FXEUkQ]
450g/1 lb
3O FLQW JDWD
SUHSDUDW JOE
Produse de patiserie
450g/1 lb
Unt
250g/8.8 oz (1 pachet)
6FRDWH LSO FLQWDGLQDPEDODMúLSXQH LRSH
farfurie.
6FRDWH LSURGXVHOHGLQDPEDODMúLSXQH LOHSH
farfurie.
'DF HVWHDPEDODWVFRDWH LXQWXOGLQDPEDODMúL
SXQH LOSHRIDUIXULH
Fructe
225g/8 oz Fructe boabe
moi.
3XQH LOHSHXQVLQJXUVWUDWvQWURIDUIXULHvQWLQV 5– 6 min.
5–10 min.
450g/1 lb Fructe boabe
moi
3XQH LOHSHXQVLQJXUVWUDWvQWURIDUIXULHvQWLQV 7– 8 min.
5–10 min.
7– 8 min
5–10 min.
0 QFDUHDFRSHULW
$FRSHUL LPkQFDUHDFXRIDUIXULHVDXFXRSHOLFXO
400g/14 oz
DGH]LY QRQ&393HQWUXDRUHvQF O]LIRORVL L
microundele 100% (800W) timp de 3–4 minute
Legume
1XHVWHQHFHVDUV GH]JKH D LOHJXPHOHvQDLQWHGH
DILJ WLWH7RDWHOHJXPHOHSRWILGH]JKH DWHúLJ WLWH
100% la (800W)
13
Downloaded From Microwave-Manual.com Manuals
Q
EMM2015
Sfaturi pentru utilizarea microundelor
Sugestii pentru utilizarea microundelor
Fluidizarea mierii
Â
Â3 VWUD LvQWRWGHDXQDFXSWRUXOFXUDW±HYLWD L
vPSU úWLHUHDVWURSLORUGHPkQFDUHúLQXXLWD LV
FXU
D LVXEWDYDGHVWLFO úLLQWHULRUXOXúLL
'DF DYH LXQERUFDQGHPLHUHFDUHVDFULVWDOL]DW
Â(VWHGHSUHIHUDWV IRORVL LFDVHUROHURWXQGHVDX
VFRDWH LFDSDFXOvQWURGXFH LERUFDQXOvQFXSWRUúL
RYDOHFXFDSDFF QGJ WL LvQFXSWRUXOFXPLFURXQGH
DF LRQD LPLFURXQGHOHODSXWHUHPHGLHWLPSGH
minute.
Â1XIRORVL LFDVHUROHGHPHWDOVDXFXGHFRUD LLGH
PHWDO$QXPLWHPDWHULDOHGHSODVWLFVHSRWWRSLúL
Topirea ciocolatei
GHIRUPDGLQFDX]DPkQF UXULORUILHUELQ L
Â
Â$FRSHUL LPkQFDUHDFkQGJ WL L)RORVL LXQFDSDF
GHVWLFO RIDUIXULHVDXXQFDUWRQUH]LVWHQWODJU VLPH
5XSH LXQEDWRQGHFLRFRODW GHJvQEXF
Â3URGXVHOHGHSDWLVHULHSkLQHDúLDOWHSURGXVH
L
S WUDWHSXQH LOHvQWURFXS úLvQF O]L LOHODSXWHUH
mare 1-2 minute amestecând bine.
DVHP Q WRDUHSRWILGHFRQJHODWHGLUHFWvQWUXQFRúGH
S LQHVDXSHXQúHUYHWGHKkUWLH
Â'DF DOLPHQWHOHvQJKH DWHVXQWvQF O]LWHvQSURSULXO
Fluidizarea sau topirea untului
Â
DPEDODMDPEDODMXOWUHEXLHGHVI FXW$PEDODMHOH
FRQ LQkQGPHWDOVDXGHFRUD LLPHWDOLFHQXWUHEXLH
Topirea ia doar câteva secunde la putere mare.
XWLOL]DWHGDF QXH[LVW UHFRPDQG ULVSHFLDOHvQDFHVW
sens.. ,QGHS
3HQWUXIOXLGL]DUHHVWHPDLELQHV IRORVLPRSXWHUH
UWD LDJUDIHOHPHWDOLFHúLOHJ WXULOHGH
PLF DPLFURXQGHORU
VkUP Â)ROLLOHGHDOXPLQLXGHGLPHQVLXQLPDLPLFLSRWIL
Â,PSURVS WDUHDVDXvQF O]LUHDSkLQLL
utilizate pentru a acoperi tipuri de carne care se pot
DUGHXúRUFXPDUILSLFLRUXúHOHGHSXL
Â$OLPHQWHOHFXFRDM VDXSLHOL
)RORVL LRSXWHUHPHGLHWLPSGHFkWHYDVHFXQGH
HJFDUWRILLVDX
FkUQD LLWUHEXLHvQ HSDWHFXRIXUFXOL
1XILHUEH LRX
Â'HFRMLUHDIDFLO DXVWXURLXOXL
în cuptorul cu microunde deoarece pot exploda.
Â3XQH LEXF
LOHPDULúLJURDVHDSURDSHGH
,QF O]L LVDXF
PDUJLQHDFDVHUROHLúLvQFHUFD LV W LD LPkQFDUHDvQ
EXF
HLGHXVWXURLODSXWHUHPDUHWLPS
GHVHFXQGH6WUkQJH LF S
LHJDOH3XQH LDOLPHQWHOHvQWRWGHDXQDvQ
kQDODXQFDS WSkQ
LHVHGLQWHDF centrul cuptorului.
Â0 QFDUHDYDILJ WLW HJDOGDF RDPHVWHFD LVDX
Sucul de fructe
Â
RvQWRDUFH LGHFkWHYDRUL
Â)L[D LvQWRWGHDXQDXQWLPSGHJ WLWPDLVFXUWGHFkW
Fructele citrice vor da mai mult suc dacâ sunt
FHOLQGLFDWvQUH HWDGYRDVWU SHQWUXDHYLWDDUGHUHD
vQF O]LWHVHFXQGHODSXWHUHPDUHvQDLQWHGHDOH
PkQF ULL&XFkWFDQWLWDWHDGHPkQFDUHHVWHPDL
stoarce.
PDUHFXDWkWHVWHQHYRLHGHPDLPXOWWLPSGHJ WLW
Â)RORVL LDS SX LQ VDXFKLDUGHORFSHQWUXOHJXPH
Â&XPVHJ WHúWHSRUULGJH
Â)RORVL LPDLSX LQHFRQGLPHQWHúLVDUHGHFkWSHQWUX
XQJ WLW³QRUPDO´
3RUULGJHXOSRDWHILJ WLWXúRUvQIDUIXULDvQFDUHHVWH
Â$VH]RQD LXOWHULRU
VHUYLWI U DPDLILQHYRLHV VS OD LWLJ LXQVXURDVH
Â$FRUGD LPkQF ULLFkWHYDPLQXWHFDWLPSGH
8UPD LUHFRPDQG ULOHSURGXF WRULORUGHDOLPHQWH
³VWD LRQDUH´GXS FHFXSWRUXODIRVWRSULWSHQWUXD
DVLJXUDXQJ WLWFRPSOHWúLHJDO
Â9HULILFD LvQWRWGHDXQDGDF WRDW PkQFDUHDHVWH
IRDUWHILHUELQWHvQDLQWHGHDILVHUYLW Â)RORVL LVXSRUWXULGHYDVHVDXP QXúLSHQWUXD
scoate mâncarea din cuptor.
14
Downloaded From Microwave-Manual.com Manuals
Q
EMM2015
,QJULMLUHúL&XU LUH
&XSWRUXOWUHEXLHPHQ LQXWvQWRWGHDXQDFXUDW5HVWXULOHGHPkQFDUHY UVDWHVDXvPSURúFDWHDWUDJHQHUJLD
PLFURXQGHORUFDUHOHYRUDUGH$FHVWOXFUXUHGXFHHILFLHQ DFXSWRUXOXLúLSRDWHSURGXFHPLURVXULQHSO FXWH1X
vQFHUFD LV UHSDUD LVDXV DGXFH LDMXVW ULXQRUS U LFRPSRQHQWHDOH5HSDUD LLOHWUHEXLHI FXWHGRDUGHXQ
tehnician calificat.
$VLJXUD LY F DSDUDWXOHVWHGHFRQHFWDWGHODVXUVDGHHOHFWULFLWDWH
vQDLQWHGHFXU
LUH
&XU LUHDDFFHVRULLORUSODWDQúLVXSRUW
&XU
L LOHFXXQGHWHUJHQWVODEGXS FHOHD LVFRVGLQFDYLWDWH6XSRUWXOSODWDQXOXLWUHEXLHPDQLSXODWFX
JULM ATENTIE: ,QWHULRUXOFXSWRUXOXLúLSODWDQXOGHYLQIRDUWHILHUELQ LDúDF
QXOHDWLQJH LLPHGLDWGXS XWLOL]DUH
&XU LUHDLQWHULRUXOXL
0HQ LQH LLQWHULRUXOFXSWRUXOXLvQWRWGHDXQDFXUDW6WHUJH LGHSXQHULOHGHPkQFDUHY UVDWHVDXvPSURúFDWHLPHGLDW
5HVWXULOHO VDWHSHSHUH LLFXSWRUXOXLSHL]ROD LDXúLLúLSHVXSUDIH HOHGHHWDQúDUHLYRUDEVRUELHQHUJLD
PLFURXQGHORUUHGXFHHILFLHQ DFXSWRUXOXLúLSRVLELOGHWHULRUDLQWHULRUXOFXSWRUXOXL)RORVL LXQGHWHUJHQWVODEOLFKLG
DS FDOG úLRFkUS PRDOHúLXVFDW SHQWUXDvQGHS UWDGHSXQHULOH
18)2/26,7,1,&,2'$7
3(51,
&85
,72$5($%5$=,9(&85
(',19$7$'(67,&/$3(1758$&85
,72$5('(&83725',1&20(5
6$8
,25,&(3$57($&837258/8,&80,&5281'(
3HQWUXDIDFLOLWDvQGHS UWDUHDGHSXQHULORUGLILFLOHILHUEH LRFHDúF GHDS vQFXSWRUWLPSGHPLQXWH
1887,/,=$7,1,&,2'$7
3(6835$)$
&8
,7(6$825,&($/7(867(16,/(3(1758$,1'(3
57$'(381(5,/('(
$&837258/8,
3HQWUXDvQGHS UWDPLURVXULOHQHSO FXWHGLQLQWHULRUXOFXSWRUXOXLILHUEH LRFHDúF GHDS FXOLQJXULGHVXFGH
O PkLHWLPSGHPLQXWH
&XU LUHDH[WHULRUXOXL
'HVFKLGH LXúDFXSWRUXOXLFkQGFRQWUROD LWDEORXOGHFRPDQG $FHVWOXFUXYDvPSLHGLFDvQWRDUFHUHDDFFLGHQWDO D
FXSWRUXOXL6XSUDIH HOHH[WHULRDUHDOHFXSWRUXOXLDUWUHEXLFXU
DWHFXXQGHWHUJHQWOLFKLGXúRUúLFXDS úLDSRL
FO WLWHFXDS FXUDW SHQWUXDvQGHS UWDH[FHVXOGHGHWHUJHQW8VFDUHDWUHEXLHI FXW FXRFkUS PRDOH6SUD\XULOH
SHQWUXFXU
LUHDIHUHVWUHORUVDXDEXF W ULLORUSRWILGHDVHPHQHDXWLOL]DWH1XIRORVL LQLFLRGDW FXU
DEUD]LYHVDXFKLPLFDOHGXUHSHQWUXDFXU
LWRDUH
DVXSUDIH HOHH[WHULRDUHDOHFXSWRUXOXL3HQWUXDSUHYHQLGHWHULRUDUHD
S U LORUOXFU WRDUHQXO VD LV LQWUHDS vQRULILFLLOHGHYHQWLOD LH
ÌQJULMLUHúLFXU LUHJU WDU
*U WDUXOSRDWHILS WDWFXXOHLúLJU VLPLvPSU úWLDWHvQWLPSXOIXQF LRQ ULLFXSWRUXOXL$úWHSWD LSkQ FkQGFDYLWDWHD
VHU FHúWHúLúWHUJH LXOHLXOvQDLQWHGHDXWLOL]DGLQQRXFXSWRUXO3HWHOHGHSHJU WDUSRWSURGXFHPLURVXULQHSO FXWH
úLIXP
15
Downloaded From Microwave-Manual.com Manuals
Q
EMM2015
6HUYLFHúLSLHVHGHUH]HUY
'DF DSDUDWXOQXIXQF LRQHD] FRUHFWHIHFWXD LXUP WRDUHOHYHULILF ULvQDLQWHGHDFRQWDFWD6HUYLFHXOORFDO
'DF FXSWRUXOQXSRUQHúWH
Â9HULILFD LGDF DSDUDWXOHVWHFRQHFWDWODUH HD
Â9HULILFD LGDF ILúDGHFRQWDFWHVWHLQWURGXV FRPSOHW
Â'DF HFD]XOvQORFXL LUH]LVWHQ DGLQILú FXRDOWDGHDFHODúLWLSúLYHULILFD LGDF ILúDHVWHFRQHFWDW FRUHFW
Â9HULILFD LGDF RULFHFRPXWDWRUODSUL]DGLQSHUHWHVDXvQDOW SDUWHvQFLUFXLWHVWH'(6&+,6
Â9HULILFD LGDF SUL]DGLQSHUHWHIXQF LRQHD] SXQkQGvQSUL] XQDSDUDWFDUHúWL LF IXQF LRQHD] Â9HULILFD LUH]LVWHQ DGLQFXWLDGHUH]LVWHQ H
'DF PLFURXQGHOHQXIXQF LRQHD] Â6DUSXWHDFD'LVSR]LWLYXOSHQWUXVHFXULWDWHDFRSLOXOXLFXFDUHHVWHSUHY ]XWDSDUDWXOV ILIRVWVHWDWOXFUXSRVLELO
la unele modele).
Â9HULILFD LGDF FRPHQ]LOHDXIRVWVHWDWHFRUHFW
Â9HULILFD LDMXVW ULOHSURFHGXULOHFRQVXOWkQGPDQXDOXOFXLQVWUXF LXQL
Â9HULILFD LGDF XúDHVWHvQFKLV FRUHFW'DF SDUWLFXOHOHGHPkQFDUHVDXDOWHOXFUXULU PkQvQFDGUXOXúLLXúDQX
VHYDvQFKLGHFRUHFWúLFXSWRUXOQXYDIXQF LRQD
Â9HULILFD LGDF EXWRQXO67$57HVWHDFWLYDW
'DF FXSWRUXOWRWXúLQXIXQF LRQHD] FRUHFWGXS YHULILF ULOHGHPDLVXVFRQWDFWD L6HUYLFHXO(OHFWUROX[ORFDO
$GUHVHOHSRWILJ VLWHvQXUP WRDUHOHSDJLQLDOHDFHVWXLJKLG
IMPORTANT :
'DF FKHPD LXQWHKQLFLDQSHQWUXXQDGLQGHIHF LXQLOHGHPDLVXVVDXVDXSHQWUXDUHSDUDRGHIHF LXQH
FDX]DW GHRLQVWDODUHLQFRUHFW YH LILREOLJD LV SO WL LUHSDUD LDFKLDUGDF DSDUDWXOPDLHDWHvQJDUDQ LH
&kQGDSHOD L6HUYLFHXOYLVHYRUFHUHXUP WRDUHOHLQIRUPD LL
1XPHOHDGUHVDúLFRGXOSRúWDO
1XP UXOGHWHOHIRQ
'HWDOLLFODUHúLFRQFLVHGHVSUHGHIHF LXQH
1XP UXOPRGHOXOXL
1XP UXOVHULHL
'DWDGHFXPS UDUH
9 VI WXLPV Y QRWD LLQIRUPD LLOHGHPDLMRVSHQWUXDDYHDODvQGHPkQ LQIRUPD LLOH
1XP UXOPRGHOXOXL(00
1XP UXOVHULHL
'DWDFXPS U ULL
'DF DSDUDWXOHVWHvQF vQJDUDQ LHWUHEXLHV IL LVLJXULF YHULILF ULOHQHFHVDUHDXIRVWHIHFWXDWHSHQWUXF
FKHPDUHDXQXLWHKQLFLDQY FRVW GDF SUREOHPDQXHVWHGHQDWXU PHFDQLF VDXHOHFWULF 9 UXJ PV QRWD LF WUHEXLHV SUH]HQWD LGRYDGDFXPS U ULLDSDUDWXOXLFkQGFKHPD LXQWHKQLFLDQvQ
SHULRDGDGHJDUDQ LH
3LHVHGHUH]HUY
3LHVHOHGHUH]HUY SRWILFXPS UDWHSULQ6HUYLFHXO(OHFWUROX[GLQORFDOLWDWHDGYRDVWU 6HUYLFLXO&OLHQ L
3HQWUXWRDWHvQWUHE ULOHJHQHUDOHOHJDWHGHDSDUDWXO(OHFWUROX[DFKL]L LRQDWVDXSHQWUXDOWHLQIRUPD LLGHVVSUHDOWH
SURGXVH(OHFWUROX[FRQWDFWD L6HUYLFLXOQRVWUX&OLHQ LSULQHPDLOVDXWHOHIRQ
16
Downloaded From Microwave-Manual.com Manuals
Q
EMM2015
&RQGL LLGHJDUDQ LH
1*DUDQ LDHVWHYDODELO
GHOXQLvQFHSkQGGLQPRPHQWXOvQFDUHDSDUDWXOHVWHvQPkQDWSULPXOXLFXPS U WRU
GHWDLOLVWOXFUXFDUHWUHEXLHYHULILFDWSULQIDFWXUDGHFXPS UDUHVDXSULQWUXQGRFXPHQWVLPLODU*DUDQ LDQXDFRSHU
XWLOL]DUHDFRPHUFLDO 2.*DUDQ LDDFRSHU
WRDWHS U LOHVDXFRPSRQHQWHOHFDUHVHGHIHFWHD] GDWRULW H[HFX LHLGHIHFWXRDVHVDX
PDWHULDOXOXLGHSURDVW FDOLWDWH*DUDQ LDQXDFRSHU DSDUDWHOHDOHF URUSHUIRUPDQ HQHFRUHVSXQ] WRDUHVH
GDWRUHD] XWLOL] ULLJUHúLWHQHJOLMHQ HLLQVWDO ULLGHIHFWXRDVHPRGLILF ULORUVDXvQFHUF ULORUGHUHSDUD LLQHDXWRUL]DWH
DYDULLORUDFFLGHQWDOHXWLOL] ULLFRPHUFLDOHVDXQHREVHUY ULLUHFRPDQG ULORUVDXFHULQ HORUVWLSXODWHvQPDQXDOXOGH
LQVWUXF LXQL$FHDVW JDUDQ LHQXDFRSHU S U LFRPSRQHQWHSUHFXOEHFXULDUWLFROHGLQVWLFO VDXGLQPDWHULDOH
plastice.
3'DF
DSDUDWXOQHFHVLW UHSDUD LLDFRSHULWHGHJDUDQ LHFXPS U WRUXOWUHEXLHV LQIRUPH]HFHOPDLDSURSLDWELURX
ELETROLUX sau un agent autorizat). ELECTROLUX vúLUH]HUY
ELECTROLUX.
GHVHUYLFLXFOLHQ L6HUYLFLX
GUHSWXOGHDVWLSXOD
ORFXOUHSDUD LHLLHORFXLQ DFOLHQWXOXLORFXOGHLQVWDODUHVDXXQDWHOLHU
4*DUDQ LDVDXvQORFXLUHDJUDWXLW
LQFOXGHDWkWPDQRSHUDFkWúLPDWHULDOHOH
55HSDUD LLOHHIHFWXDWHvQSHULRDGDGHJDUDQ LHQXH[WLQGDFHDVW
JDUDQ LHGHYLQSURSULHWDWHDELECTROLUX-ului.
6. 'UHSWXULOHVWDWXWDUHDOHFXPS
SHULRDG 3 U LOHvQORFXLWHvQSHULRDGDGH
U WRUXOXLQXVXQWDIHFWDWHGHDFHDVW JDUDQ LH
17
Downloaded From Microwave-Manual.com Manuals
P
EMM2015
6SLVWUH FL
3U]HGUR]SRF] FLHPNRU]\VWDQLD]NXFKQLPLNURIDORZHM
4
:VND]yZNLEH]SLHF]H
4
4
5
5
7
7
VWZD
±:VND]yZNLEH]SLHF]H VWZDSRGF]DVX \ZDQLDJULOOD
±6SUDZG]HQLHSU]\GDWQR FLQDF]\
±
\ZQR ü
±7DEHODQDF]\ Dane techniczne
8
8
8
8
8
3U]HGZá F]HQLHP
– Rozpakowanie
Instalacja
±3RGá
F]HQLHGR]DVLODQLD
±3RGá
F]HQLHHOHNWU\F]QH
– Konserwacja i czyszczenie (grill)
9
9
9
10
11
11
12
12
13
13
13
14
15
16
16
16
15
15
6HUZLVLF]
17
2EVáXJDNXFKQLPLNURIDORZHM
– Elementy
– Podstawa obrotowa / talerz
±3DQHOVWHUXM F\
– Gotowanie mikrofalowe
±7DEHODXVWDZLH – Pieczenie na grillu
– Gotowanie “Mikrofale + Grill”
±:VND]yZNLGRW\F] FHSLHF]HQLDQDJULOOX
±:VND]yZNLGRW\F] FHIXQNFML³0LNURIDOH*ULOO´
±7DEHODXVWDZLH ³0LNURIDOH*ULOO´
±:VND]yZNLGRW\F] FHUR]PUD DQLD
(180W)
– Praktyczne wskazówki
– Konserwacja i czyszczenie
– Czyszczenie akcesoriów (talerz / podstawa)
±&]\V]F]HQLHZQ WU]DNXFKQL
±&]\V]F]HQLHHOHPHQWyZ]HZQ WU]Q\FK
FL]DPLHQQH
Gwarancja
18
3
Downloaded From Microwave-Manual.com Manuals
P
EMM2015
Gratulujemy zakupu nowej kuchni mikrofalowej
*UDWXOXMHP\3D VWZXWUDIQHJRZ\ERUXLG]L NXMHP\]D]DNXSSURGXNWXILUP\(OHFWUROX[-HVWH P\SU]HNRQDQL
HQRZDNXFKQLDPLNURIDORZDE G]LH3D
VWZXEDUG]RSU]\GDWQDLXáDWZLSU]\JRWRZ\ZDQLHSRWUDZ
3U]HGUR]SRF] FLHPNRU]\VWDQLD]NXFKQLPLNURIDORZHM
wnego wykorzystania
nnych wskazówek i porad.
3URVLP\RGRNáDGQH]DSR]QDQLHVL ]QLQLHMV] LQVWUXNFM REVáXJL:FHOXHIHNW\
3D VWZDQRZHMNXFKQLPLNURIDORZHMZLQVWUXNFMLREVáXJL]DZDUWRZLHOHFH
=DOHFDP\ GRNáDGQH SU]HF]\WDQLH QLQLHMV]HM LQVWUXNFML REVáXJL SU]HG UR]SRF] FLHP X \ZDQLD NXFKQL
,QVWUXNFM QDOH \]DFKRZDüDE\SRGF]DVX \WNRZDQLDPyFZND GHMFKZLOL]QLHMVNRU]\VWDü
:SU]\SDGNXVSU]HGD \XU] G]HQLDSURVLP\RSU]HND]DQLHLQVWUXNFMLQRZHPXX \WNRZQLNRZL
:VND]yZNLEH]SLHF]H VWZD
•
:EXGRZDQ\
SU]Há F]QLN
NXFKQL ]DEH]SLHF]D
EORNXM
PLNURIDORZ
•
F\
SU]HG
uruchomieniem przy otwartych drzwiach.
•
•
1LH QDOH \ PDQLSXORZDü SU]\ GU]ZLDFK DQL
XPLH FLü
w
.XFKQL QDOH \
X \WNRZDü
]JRGQLH
]
LQVWUXNFML
VWRVRZDü FKHPLNDOLyZ NRUR]\MQ\FK 7HQ W\S
1LH
QDOH \
GRSXV]F]Dü
DE\
XV]F]HOQLDM F\FK
UHV]WNL
\ZQR FLRZ\FK OXE
JRWRZDQLD
XVXQL FLD
GR
URGNyZ F]\V]F] F\FK
LFK
SU]H]
]ZUDFDü
SUDZLGáRZH
VL XZDJ
GU]ZL
RUD]
•
QD
awodnie, (3)
•
VL ]
FL
JG\ WR
RUD]
OXE
NXFKQL
Z
ZRG\
HQHUJL PLNURIDORZHM
QLHM
SURGXNWyZ
NWyUH
PRJá\E\
PLNURIDORZ PR H
.XFKQLD PLNURIDORZD PR H E\ü REVáXJLZDQD
•
1LH VXV]\ü Z NXFKQL PRNU\FK SU]HGPLRWyZ
•
.XFKQLD
OXEJD]HWJG\ PR HGRM üGRLFK]DSDOHQLD
QLH
VáX \
przedPLRWyZ 1LH QDOH
SU]HGPLRWyZ
goWRZDQLD
SDQHOX
GR
SU]HFKRZ\ZDQLD
\ZQR FLRZ\FK
SURGXNWyZ
DXWRU\]RZDQ\FK
GU]ZL
PR H
PD
.XFKQLQLHQDOH \SU]HFKRZ\ZDüQD]HZQ WU]
]DNáDGyZVHUZLVRZ\FK
REXGRZ\
SXVWHM
QLH
•
: DGQ\PSU]\SDGNXQLH ZROQR GHPRQWRZDü
VWHUXM FHJR
Zá F]Dü
SRPLHV]F]H RUD]ZSREOL XZRG\
ORNDOQ\P
]DNáDGHP
VHUZLVowym.
Wszelkie prace o charakterze naprawczym i
E\ü
Zykonywane
UHJXODF\MQ\P
PXV] ]HZQ WU]QHM
1LH
o
DXWRU\]RZDQ\P
Z\á F]QLH SU]H] SHUVRQHO
NRPHUF\MQ\FK
Z\á F]QLHSU]H]RVRE\GRU VáH
: SU]\SDGNX Z\VW SLHQLD XVWHUNL RSLVDQHM
VNRQWDNWRZDü
FHODFK
Z\VW SLüXV]NRG]HQLHPDJQHWURQX
E\üXV]NRG]RQH
QDOH \
F]\
MDN UyZQLH QLH PR H E\ü
Z
SRFKáRQ ü
WH L SRZLQQ\ G]LDáDü QLH]
SRZ\ HM E G NRQLHF]QR FL Z\PLDQ\ F]
SURGXNWyZ
SU]HP\VáRZ\FK
\ZQR FLRZ\FK
XV]F]HONL RUD] SRZLHU]FKQLH XV]F]HOQLDM FH QLH
PRJ
XU] G]HQLX
anie niezgodne z przeznaczeniem
powoduje anulowanie gwarancji.
-H HOL
QD
]ZLFKURZDQH ]DZLDV\ L ]DWU]DVNL QLH PRJ
NQL
FHOyZ
X \ZDQD
HZHQWXDOQH XVWHUNL WM GU]ZL QLH PRJ E\ü
E\ü S
W\P
8 \WNRZ
owany
DXWRU\]
V]F]HJyOQ ]DP\NDQLH
Z
UR]PUD DQLD
L
laboraWRU\MQ\FK
]DNáDGVHUZLVRZ\
3URVLP\
QDOH \
\ZQR FLRZ\FK 1LH MHVW RQD SU]H]QDF]RQD
SURGXNWyZ
: SU]\SDGNX XVWHUHN QLH X \ZDü NXFKQL GR
F]DVX
1LH
NXFKQL VáX \ Z\á F]QLH GR SRGJU]HZDQLD
QD
GU]ZL
SDWU]UR]G]LDáÄ&]\V]F]HQLHLNRQVHUZDFMD´
•
L
zawartymi
energii mikrofalowej.
pozostaZDá\
•
]DLQVWDORZDü
wskazówkami
WR QDUD]Lü REVáXJXM FHJR QD RGG]LDá\ZDQLH
SRZLHU]FKQLDFK
•
ze
przeznaczeniem - jak podano w niniejszej
r
•
QDOH \
zgodnie
LQVWUXNFMLREVáXJL
Zá F]DüNXFKQLNLHG\GU]ZLV RWZD WH0R H
•
.XFKQL OXE
SDSLHURZ\FK
SURGXNWyZ
JG\NXFKQLDQLHMHVWX \ZDQD
VSRZRGRZDü
znym o
]DJUR HQLHSRUD HQLDSU GHPHOHNWU\F
Z\VRNLPQDSL FLX
4
Downloaded From Microwave-Manual.com Manuals
L
LQQ\FK
\ SR]RVWDZLDü Z QLHM
VSU] WX
GR
\ZQR FLRZ\FK
P
EMM2015
WR
:VND]yZNLEH]SLHF]H VWZDSRGF]DV
X \ZDQLDJULOOD
•
mikrofalowej.
Papierowe serwetki,
U
1.
6]\ED Z GU]ZLF]NDFK NXFKQL PR H S
GRVWDQ
VL
QDQL
NQ
ü MH HOL
NURSOHZRG\SRGF]DVX \ZDQLD
U
NDZLF
QDJU]HZDM VL
WDN H
RFKURQQ\FK
:HZQ
SRFKáDQLDá
VL
L
QDOH \
PR QD
i ruszt
L
]HZQ WU]QHM
QLH
QDOH \
VWURQ\
GRW\NDü
dnak
VL NWyU\
PLNURIDORZ E G]LH
aczynia).
oducenta
SU]HJU]DQLD
Q
ZVND]yZHN
SU
GR
E G]LH
L
\ZQR FL
V]\E\
•
Z
:LHOH QDF]\ ] WZRU]\Z V]WXF]Q\FK NXENL
WDOHU]H RSDNRZDQLD PUR RQHN L LQQH QDGDMH
PHWDORZ\PL
VL potraw z kuchni.
PLNURIDORZ\FK -H HOL FKFHFLH 3D VWZR ]
VL
:Q WU]H NXFKQL RUD] GU]ZLF]NL
Z
F]DVLH
SUDF\
=DFKRZDü
w zimnej wodzie bezpo
kuchni mikrofalowej.
SUDF\
XOHF
ZL F
SR]RVWDZLRQH
o
XV]N G]HQLX
=
G]L
NXFKQL
SRG
GU]ZLDPL
•
WDN H
VL NURSOH ZRG\ -HVW WR QRrmalne
zjawisko fizyczne spowodowane oddawaniem
XU] G]HQLD
'U]ZL
praF
QLH
XV]F]HOQLDM FDáNRZLFLHNXFKQLPLNURIDORZHM
SR]RVWDZLDü
Zá F]RQHM
NXFKQL
SRGF]DV SRGJU]HZDQLD L JRWRZDQLD ]
SRMHPQLNyZ
Z\NRQDQ\FK
G áDWZRSDOQ\FK
PDWHULDáyZ -H HOL ]DXZD
3D VWZR G\P
Z\á F]\ü
X \FLHP VLá\ JG\ PR H WR VSRZRGRZDü MHM
NXFKQL RGá F]\ü
RG
]DVLODQLD
HOHNWU\F]QHJR L RGF]HNDü D G\P SU]HVWDQLH
uszkodzenie.
VL Z\GRE\ZDü]ZQ WU]DXU] G]HQLD
.LHG\ X \ZDP\ Z NXFKQLH PLNURIDORZHM QDF]\
PR H
Z\VW
SLü
LVNU]HQLH
•
&L JáH
6SU] W PHWDORZ\ OXE ] HOHPHQWDPL PHWDORZ\PL
LVNU]HQLH PR H XV]NRG]Lü XU] G]HQLH : WDNLP
QLH
SU]\SDGNX QDOH \ SU]HUZDü SURJUDP L VSUDZG]Lü
PLNURIDORZHM
naczynie, z którego korzystamy.
Z\UD QLH RNUH OL L ]DOHFL PR OLZR ü X \Z
2WZRU\
]DVáRQL
]H
V]WXF]Q\FK SDSLHURZ\FK E
SURVLP\ QLH RWZLHUDü GU]ZL OHF] QDW\FKPLDVW
3RVWDZ\ REURWRZHM QLH ZROQR REUDFDü U F]QLH ]
PHWDORZ\FK
gatunków tworzyw sztucznych.
1LH
X \FLHP
\ZQR ü L QLH ZSá\ZD XMHPQLH QD
IXQNFMRQRZDQLH
JDM Z
WHPSHUDWXU FR
PLNURIDORZHM EH] QDG]RUX NRQWURORZDü MHM
SRMDZLü
FLHSáD SU]H]
]
XQLNDü
PR H VSRZRGRZDü WRSLHQLH VL QLHNWyU\FK
PR H
PRJ 1DOH \
kuchnie miNURIDORZHMZ\VRN
Z\GRE\ZDü VL SDUD RVLDGDM F QD GU]ZLDFK 1D
NUDZ
VL ]DSR]QDü
SURGXFHQWD
FXNUX OXE WáXV]F]X 3URGXNW\ WH RVL
SU]HGPLRW\
NXFKQL
UDG]LP\
NXFKQLDFK
ZUD] ] SURGXNWDPL ]DZLHUDM F\PL GX H LOR FL
DGQ\FK SU]HGPLRWyZ 8OHJD RQ UR]JU]DQLX Z
Z
VWRVRZDQLD RSDNRZD ] WZRU]\Z V]WXF]Q\FK
UHGQLR SR Z\M FLX ]
1D ZLHU]FKX NXFKQL QLH QDOH \ SU]HFKRZ\ZDü
F]DVLH
VWRVRZDQLD
NRU]\VWDü
inIRUPDFM
3RGVWDZ\ REURWRZHM L QDF]\ QLH ZROQR ]DQXU]Dü
PRJ
GR
QLFK
V]F]HJyOQ RVWUR QR ü
•
NDUWRQ\
HOHPHQWDPL SRGF]DV ZNáDGDQLD L Z\MPRZDQLD
QDJU]HZDM •
HQHUJL XQLNQ ü
6WRVRZDü
]DFKRZDü
RVWUR QR üSU]\LFKGRW\NDQLX
WU]QHM
GU]ZLF]NDFK
•
woskowany,
NXENL
\ZQR FLRZ\P
SURGXNWHP
1DF]\QLD
Z F]DVLH SUDF\ NXFKQL L PR H
UR]JU]HZDM szczególQ
5.
papier
WDFNL
Z\JRGQH Z X \FLX =DZV]H QDOH \ MH
3RGF]DV ZNáDGDQLD L Z\MPRZDQLD SRWUDZ QDOH \
GRM ü GR RSDU]HQLD 3RGVWDZD REURWRZD
4.
SDSLHURZH
XSHZQLü VL F]\ SRMHPQLN Z\SHáQLRQ\ MHVW
X \ZDü
3.
F]QLNL
RSDNRZDQLD PUR RQHN L WHNWXUD V EDUG]R
grilla.
2.
H QDGDMH VL GR JRWRZDQLD Z NXFKQLH
ZHQW\ODF\MQH
NXFKQL
SRZLQLHQ
E\ü
VWRVRZDQ\
Z\M WNLHP
]
Z
MH HOL
NXFKQLH
SURGXFHQW
ania w
QLH
PRJ kuchniach mikrofalowych.
E\ü
•
WHJyUQHERF]QHRUD]GROQH
6SUDZG]HQLHSU]\GDWQR FLQDF]\
3RMHPQLNL
]
RJUDQLF]RQ\PL
RWZLHUDQLD
QS
X \ZDQH
GR
EXWHONL
PR OLZR FLDPL
QLH
SRZLQQ\
SU]\U] G]DQLD
E\ü
SRWUDZ
Z
kuchniach mikrofalowych.
•
•
8PLH FLü Z NXFKQLH PLNURIDORZHM QDF]\QLH
naF]\
ZRG 3RGJU]Dü SU]\ XVWDZLHQLX QD :
SU]H] MHGQ PLQXW -
e
3URVLP\
V]F]HJyOQ XZDJ SU]\
DE\QLHSRSDU]\üVL
SDU \ZQR ü
HOL QDF]\QLH
MHVW JRU FH QLH QDOH \ VWRVRZDü JR Z NXFKQL
PLNURIDORZHM -H HOL MHVW RQR OHNNR FLHSáH •
PR HE\ü X \ZDQH GR SRGJU]HZDQLD DOH QLH
do gotowaQLD
R
]GHMPRZDQLX SRNU\ZHN E G SU]\NU\ZHN ]
o
ZUD] ]H V]NODQN Z\SHáQLRQ GR S áRZ\
1LH
SRGJU]HZDü
Z
NXFKQL
SRWUDZ
Z
SXV]NDFK 3URGXNW QDOH \ Z\M ü ] SXV]NL L
-H HOL QDF]\QLH XWU]\PDáR
XPLH FLüZRGSRZLHGQLPQDF]\QLX
QRUPDOQ WHPSHUDWXU RWRF]HQLD R]QDF]D
•
1LH QDOH \ VPD \ü SRWUDZ QD WáXV]F]X -HJR
WHPSHUDWXUD QLH MHVW NRQWURORZDQD FR PR H
5
Downloaded From Microwave-Manual.com Manuals
P
EMM2015
GRSURZDG]Lü
]DJUR
•
GR
V\WXDFML
VWZDU]DM
FHM
]DPLHV]Dü D QDVW SQLH Z\M ü SRMHPQLN SU]\
enie.
]DFKRZDQLXV]F]HJyOQHMRVWUR QR FL
3UD RQD NXNXU\G]D PR H E\ü SU]\U]
tylko
w
specjalnych
•
G]DQD
opakowaniach
lub
]DPNQL
SRVLDGDM FH
QLHSRURZDW SU]HNáXZDü
mniaki,
GURELRZH
ZF]H QLHMV]HJR
yáWND
MDM
]DNR
Z\PDJDM
eZQ
QDNáXFLD
]
ZDUVWZ\DE\]DSRELHFWZRU]HQLXVL
PR H
=$3$0,
•
QDVW
SLü
•
EH]
oWRZDQLD RGF]HNDü MHV]F]H PLQXW
7$-
3RVWDZ\REURWRZHMQLHZROQRREUDFDüU F]QLH
o
HWRVSRZRGRZDü MHM
.LHG\
X \ZDP\
Z
NXFKQLH
PLNURIDORZHM
y
QDF]\ PHWDORZ\FK PR H Z VW SLü LVNU]HQLH
FKDUDNWHU\VW\F
&L JáH LVNU]HQLH PR H XV]NRG]Lü XU]
G]HQLH
:WDNLP SU]\SDGNX QDOH \ SU]HUZDü SURJUDP
azówki:
SRQL V]HZVN
amy.
LVSUDZG]LüQDF]\QLH]NWyUHJRNRU]\VW
1.
XQLNDü
2.
QLH
3.
SU]HG XPLHV]F]HQLHP Sá\QX Z NXFKQL QDOH \
SRMHPQLNyZ
FLDQNDFK]Z VNLPLV]\
GRSURZDG]Dü
R
SURVW\FK
•
jkami;
GR
2WZRU\ ZHQW\ODF\MQH NXFKQL QLH PRJ E\ü
]DVáRQL WHJyUQHERF]QHRUD]GROQH
QDGPLHUQHJR
przegrzewania;
1LHX \ZDüNXFKQLGRFHOyZNRPHUF\MQ\FK
JRXSU]HGQLR]DPLHV]DüF]\QQR üSRZWyU]\ü
.XFKQLD
owie cyklu podgrzewania);
MHVW
SU]H]QDF]RQD
GR
warunkach gospodarstwa domowego.
ZSRá
4.
yáWND SU]\NU\ü MH SRNU\ZN L SR
uszkodzenie.
S FKHU]\NyZ $E\ WHJR XQLNQ ü QDOH \ SU]\M ü
X \ZDQLD
XOHF
F]HQLX J
]X \FLHPVLá\JG\ P
znych
VL SRMDZLHQLD
szczelnie
WU]QHM
SDU\ OXE
UWAGA: 3RGF]DVSRGJU]HZDQLDSá\QyZWM]XS
sosów, napojów) doprowadzenie ich do
ZU]HQLD
oraz
o
SU]HGMHM]GM FLHP
ewentualnemu poparzeniu.
WHPSHUDWXU\
jaja
HNVSORGRZDü SRGF]DV JRWRZDQLD =DZV]H QDOH \
VNyU
E G SRZáRN WDNLH MDN MDEáND ]LH
Z WUyENL
np.
G]LDáDQLXHQHUJLLPLNURIDORZHM&]DVDPLMDMDPRJ
Z\PDJDQDG]RUXREVáXJXM FHJR
3URGXNW\
produkty,
WH SRMHPQLNL V]NODQH Vá LNL PRJ
HNVSOR]ML L GODWHJR QLH SRZLQQ\ E\ü SRGGDZDQH
SU]\VWRVRZDQ\FK QDF]\QLDFK F]\QQR ü WD
•
Niektóre
SRSRGJU]DQLXQDF]\QLH]Sá\QHP SR]RVWDZLü
=DFKRZDMLQVWUXNFM REVáXJL
onownie
MHV]F]H SU]H] FKZLO Z NXFKQL S
6
Downloaded From Microwave-Manual.com Manuals
X \WNX
Z
P
EMM2015
7DEHODQDF]\
Do gotowania w kuchni
PLNURIDORZHM PR HFLH 3D
ynia. Dla Waszego
VWZR VWRVRZDü Uy QRURGQH QDF]
hQL QDOH
EH]SLHF]H VWZD RUD] GOD ]DSRELHJDQLD ]QLV]F]HQLX QDF]\ L NXF
\ Z\EUDü RGSRZLHGQLH SRMHPQLNL L
materiaá\
3RQL V]D OLVWD SR]ZROL 3D VWZX ]DSR]QDü VL ] RJyOQ\PL ]DVDGDPL GRERUX QDF]\ GR VWRVRZDQLD Z NXFKQL
mikrofalowej.
Tryb pracy
0DWHULDá
Rodzaj naczynia
1DF]\QLD]HV]NáD
rnego
DURRGSR
&HUDPLNDLV]NáR
6]NáR]PHWDORZ\PL
dekoracjami
6]NáRRáRZLDQH
Porcelana
Wyroby
2
garncarskie*
Bez dekoracji metalowych
Gotowanie
mikrofalowe
Grill
Mikrofale & Grill
TAK*1
TAK
TAK *1
NIE
NIE
NIE
NIE
TAK
NIE
TAK
NIE
NIE
TAK
TAK
TAK
TAK
NIE
NIE
Wyroby z tworzyw
odpornych na
Tworzywa
sztuczne
Naczynia
metalowe
Naczynia
papierowe
Drewno
RGG]LDá\ZDQLHPLNURIDO
opakowania z tworzyw
sztucznych
Plastikowe opakowania
Metalowe rondle do
pieczenia
Folia aluminiowa*3
.XENLWDFNLU F]Qiki
Papier woskowany
Ruszt grilla
Talerz obrotowy
Podstawa talerza
obrotowego
Akcesoria
TAK
NIE
TAK
NIE
TAK
TAK
TAK
NIE
NIE
TAK
TAK
NIE
NIE
NIE
TAK
TAK
TAK
NIE
NIE
NIE
TAK
TAK
TAK
TAK
TAK
7$.PR QDX \ZDü
1,(QLHZROQRX \ZDü
*1 tylko wtedy, gdy nie ma elementów metalowych
*2 W\ONRZWHG\JG\QLHMHVWSRZOHF]RQHVXEVWDQFM ]DZLHUDM F PHWDO
*3 UWAGA: IROLLDOXPLQLRZHMX \ZDüW\ONRGRSU]\NU\ZDQLDQSNR FLXGHNNXUF]DNDVNU]\GeáHNIROLDPo
Dane techniczne
Waga 13.5 kg
3RMHPQR ü 20 litrów
Zasilanie elektryczne 230V, 50 Hz
:\PLDU\]HZQ WU]QH
484 mm
376 mm
ü 285 mm
6]HURNR ü
*á
ERNR ü
:\VRNR
Pobór mocy
Mikrofale 1300W
Grill 1000W
Wymiary komory
300mm
292 mm
ü 195 mm
6]HURNR ü
0RFX \WHF]QD
*á
Mikrofale 800W
Grill 1000W
ERNR ü
:\VRNR
7
Downloaded From Microwave-Manual.com Manuals
HLVNU]\ü
P
EMM2015
35=(':à &=(1,(0
Rozpakowanie
8:$*$ .XFKQLD PR H E\ü XVWDZLRQD Z SUDZLH
ND G\P PLHMVFX NXFKQL 0XVL RQD
]DSHZQLRQ 3RGF]DV UR]SDNRZ\ZDQLD NXFKQL QDOH \ VSUDZG]Lü
Z\SRVD HQLX
QDOH \
jednostce hanGORZHM
QDW\FKPLDVW
]JáRVLü
JG]LH GRNRQDOL FLH 3D
VL
Z
PRJ
E\ü RSDNRZDQH Z IROL ]DEH]SLHF]DM F
NXFKQL
ü M
*
-H OL
1LH
QDOH \
WHWDN HZF]
XU]
G]HQLH
QLH
UR]SRU]
SR]RVWDZLDü
elementów opakoZDQLD Z PLHMVFDFK GRVW
7R
RGQR
SU]HG SLHUZV]\P X \FLHP
PLNURIDORZHM
PLHü
MHGQDN
SRZLHU]FKQL L
HRWZRU\ZHQW\ODF\MQHQLHV ]DEORNRZDQHE G
przyVáRQL
VWZR
]DNXSX .XFKQLD MHM Z\SRVD HQLH OXE DNFHVRULD
WDN QDOH \ XVXQ
UyZQ
RGSRZLHGQL ZHQW\ODFM : W\P FHOX QDOH \ XSHZQLü
czy nie jest ona uszkodzona. Uszkodzenia lub braki
Z
SáDVN FLVSRGQLHM
RGSRZLDGD
HOLPLQDFML
]DNáyFH
QRUPRP
(:*
owych
-
UDGL
G]HQLH((&
SQ\FK GOD
G]LHFL 0DWHULDá ] NWyUHJR Z\NRQDQH V HOHPHQW\
3RGá F]HQLHGR]DVLODQLD
eci.
RSDNRZDQLDPR HE\ü]DJUR HQLHPGODG]L
.XFKQLD MHVW Z\SRVD RQD Z SU]HZyG ]DVLODM F\ ]
ZW\F]N
Instalacja
1.
2.
8VXQ
ü
czy
]
]QDMGXM
VL
.XFKQL
GU]ZL
QDXU]
QDOH \
QDNOHMNL
UHNODPRZH
L
]DLQVWDORZDü
G]LH Z VWDQLH XWU]\PDü FL
NJ ZUD] ] MHM ]DZDUWR FL
GOD
NWyUHJR
RGSRZLDGD
XU] G]HQLH
QDSL FLX
UWAGA! .XFKQLD PXVL E\ü SRGá
z uziemieniem.
$E\ XQLNQ ü ZLEUDFML
Z
MHVW
VLHFL
F]RQD GR JQLD]GND
lnej.
G]HQLDZSR]\FMLVWDEL
-H HOL
.XFKQLDQLHSRZLQQDVWDüZSREOL X UyGHáFLHSáDL
ZRG\ -H HOL XU]
G]HQLH E
jego efektywQR
aZHWVSRZRGRZDüDZDUL
üDQ
PDM
SRGá F]HQLD
G]LH QDUD RQH QD
3D
VWZR
NXFKQL
GR
Z
WSOLZR FL
VLHFL
GRW\F]
HOHNWU\F]QHM
FH
E G
]DEH]SLHF]HQLD X]LHPLDM FHJR SURV] VNRQWDNWRZDü
RGG]LDá\ZDQLH FLHSáD OXE ZRG\ PR H WR REQL \ü
4.
FLH
1LHX \ZDüSU]HGáX DF]\GRSRGá F]HQLDNXFKQL
DU NXFKHQNL OXE KDáDVX SRGF]DV SUDF\ ]DOHFDP\ XVWDZLHQLH
XU]
F]\ü
QD
owierzchni, która
3.
SRGá
elektrycznej.
dzeniu.
XPLH FLü
naSL
]DSURMHNWRZDQH
MH HOL
SáDVNLHM Z\SR]LRPRZDQHM S
E
a
GOD 9 +] 1 OH \ M
GR JQLD]GND ]H VW\NLHP X]LHPLDM F\P L VSUDZG]Lü
VL
ktrykiem.
]XSUDZQLRQ\PHOH
3URVLP\ ]ZUyFLü XZDJ QD VZRERGQ\ SU]HSá\Z
ylacyjnych. Nie
SRZLHWU]D ZRNyá RWZRUyZ ZHQW
VWDZLDü
XU]
3RGá F]HQLHHOHNWU\F]QH
DGQ\FK SU]HGPLRWyZ QD JyUQ\P EODFLH
ablokowanie
G]HQLD
otworów
=
ZHQW\ODF\MQ\FK PR H SURZDG]Lü GR SU]HJU]DQLD
8U]
NXFKQL
ZW\F]N
D
WR
]
NROHL
GR
QLHZáD FLZHJR
G]HQLH
MHVW
Z\SRVD RQH
Z
VWDQGDUGRZ
SU]HZRGX]DVLODM FHJR
IXQNFMRQRZDQLD E G XV]NRG]HQLD XU] G]HQLD
2WZRU\
ZHQW\ODF\MQH
SRZLHWU]H
GODWHJR
RGSURZDG]DM QDOH \
JRU
XPR OLZLü
FH
8:$*$85=
MHJR
'=(1,(086,%<û8=,(0,21(
VZRERGQ\SU]HSá\ZQSPL G]\NXFKQL D FLDQ
j
SRPLHV]F]HQLD QLH PRJ ]QD GRZDü VL
aVáRQ\
3URGXFHQW
]
przypadku
itp.).
5.
.XFKQL
i
telewizyjnych.
Urz dzenie
UDGLRZ\FK OHF] PRJ RQH VL
8U]
SRMDZLü
MH HOL XVWDZLFLH 3D VWZR NXFKHQN ]E\W EOLVNR
radioodbiornika lub telewizora.
6.
-H HOL
NXFKQLD
E G]LH
XV\WXRZDQD
Z
URJX
SRPLHV]F]HQLD QDOH \ SR]RVWDZLü V]F]HOLQ R
V]HURNR FL SU]\QDMPQLHM FP SU]\
RGSRZLHG]LDOQR FL
FLDQLH ]
prawej strony.
8
Downloaded From Microwave-Manual.com Manuals
Z
spowodowanych
to
RGSRZLDGD QRUPRP 8( GRW\F] F\P HOLPLQDFML
]DNáyFH
SRQRVL
usterek
QLHSU]HVWU]HJDQLHPSU]HSLVyZEH]SLHF]H VWZD
QDOH \ XPLH FLü ] GDOD RG RGELRUQLNyZ
radiowych
QLH
G]HQLHSRGá F]\üGRJQLD]GND]X]LHPLHQLHP
P
EMM2015
2EVáXJDNXFKQLPLNURIDORZHM
1
2
3
9
5
8
6
4
4
7
10
Elementy
1.
Podstawa obrotowa / talerz
.RPRUD NXFKQL PLNURIDORZHM:\F]\ FLü L Z\WU]Hü
1.
SRND G\PX \FLX
2.
2NQR
SU]H]
NWyUH
PR QD
VSUDZG]Dü
2.
przygotowania potrawy.
3. 'U]ZL1DOH \MHGRNáDGQLH]DP\NDü
4. Zaczepy zatrzaskowe i blokada drzwi.
5. 3DQHOVWHUXM F\
6. Zaczep dla talerza obrotowego
7. 7DOHU] REURWRZ\ Z\NRQDQ\ ]H VSHFMDOQHJR V]NáD
DURRGSRUQHJR
1D
WDOHU]
QDOH \
3RGVWDZ
REURWRZ
XPLH FLüZGROQHMF]
FL
kuchni.
VWDQ
7DOHU]REURWRZ\SRáR \üQDSRGVWDZLHZ
VSRVyESRND]DQ\QDU\VXQNX1DOH \XSHZQLü
VL
HWDOHU]]RVWDáRGSRZLHGQLR]DPRFRZDQ\
w wypustce. 1LHZROQRNáD
üWDOHU]DZ
SRáR HQLXRGZURWQ\P
-
SRVWDZLü
=DUyZQR WDOHU] MDN L MHJR
SRGVWDZD
PXV]
]QDMGRZDüVL ZNXFKQLHSRGF]DVMHMSUDF\
-
RGSRZLHGQLH QDF]\QLH ] SRWUDZ 1LH X \ZDü
kuchni bez talerza obrotowego.
8. Podstawa obrotowa talerza; umieszczana w
GROQHMF]
FLNXFhni pod talerzem.
9. Grill.
10. Ruszt grilla.
-
Produkty oraz pojemniki umieszczamy zawsze na
talerzu obrotowym.
7DOHU]REUDFDVL ZSUDZ
LZOHZ
VWURQ
MHVWWR
]MDZLVNRQRUPDOQH1LHREUDFDüWDOHU]DU F]QLH
brotowy.
JG\ PR QDXV]NRG]LüPHFKDQL]PR
Talerz obrotowy
Podstawa obrotowa
Zaczep dla talerza
9
Downloaded From Microwave-Manual.com Manuals
P
EMM2015
3$1(/67(58- &<
1.
3RNU
WáRZ\ERUXPRF\
6áX \GRZ\ERUXSR]LRPXPRF\NXFKQL
2.
3RNU
WáR]HJDUD
6áX \GRXVWDZLHQLDF]DVXJRWRZDQLD
1DMSLHUZQDOH \XVWDZLüQLHFRGáX V]\F]DV
SRF]\PSRZUyFLüGRSUDZLGáRZHMZDUWR FL
10
Downloaded From Microwave-Manual.com Manuals
P
EMM2015
GOTOWANIE MIKROFALOWE
1.
2.
3.
2WZRU]\ü GU]ZL QD WDOHU]X REURWRZ\P SRáR \ü
$E\ Z\á
SRWUDZ
REUyFLüSRNU WáR]HJDUDGRSRáR HQLD
3RNU
ZQDF]\QLX=DPNQ üGU]ZL
WáHP
Z\ERUX
PRF\
XVWDZLü
F]\ü XU]
G]HQLH Z WUDNFLH SUDF\ QDOH \
Z\PDJDQ\
SR]LRPQDJU]HZDQLDSDWU]SRQL V]DWDEHOD
8ZDJD
3RNU
XSHZQLü VL WáHP]HJDUDXVWDZLüF]DVJRWRZDQLD
3R
]DNR
F]HQLX
H SRNU
JRWRZDQLD
QDOH \
WáR ]HJDUD ]QDMGXMH VL Z
SRáR HQLX : SU]HFLZQ\P UD]LH NXFKQLD E G]LH
5R]SRF]QLHVL JRWRZDQLH
QDGDOSUDFRZDáD
-H HOL F]DV JRWRZDQLD MHVW NUyWV]\ QL PLQXW\
QDOH \XVWDZLüGáX V]\F]DVDQDVW SQLHSRZUyFLüGR
SUDZLGáRZHMZDUWR FL
3U]\NáDG*RWRZDQLH:SU]H]PLQXW
1.
3RNU
WáRZ\ERUXPRF\XVWDZLüQD:
2.
3RNU
WáHP]HJDUDXVWDZLüPLQXW
3.
.XFKQLDE G]LHSUDFRZDáDSU]H]PLQXW]PRF QDSR]LRPLH:
3RGJU]HZDQLHJRWRZ\FKVFKáRG]RQ\FKGD
•
&]DV SU]\JRWRZDQLD ZVND]DQ\ SU]H] SURGXFHQWD
\ZQR FL QDOH \ WUDNWRZDü RULHQWDF\MQLH -H HOL SR
XSá\ZLH ]DOHFDQHJR F]DVX SRGJU]HZDQLD SRWUDZD QLH MHVW UyZQRPLHUQLH SRGJU]DQD QDOH \ SRQRZQLH
ZáR \üM
•
•
GRNXFKQLLSRGJU]Dü
3RWUDZ\QDOH \PLHV]Dü]ZáDV]F]DVRV\
&]DV ³RGF]HNDQLD´ MHVW LVWRWQ\P HWDSHP SRGJU]HZDQLD L SR]ZDOD QD Z\UyZQDQLH WHPSHUDWXU\ FDáHM
potrawy/.
7DEHODXVWDZLH
Poziom mocy
100W
(180W)
3URSRQRZDQHX \FLH
Utrzymywanie w cieple
5R]PUD DQLH
300W
gotowanie i podgrzewanie delikatnych potraw, zapiekanek
pieczenie ciast z serem
450W
V]\EV]HUR]PUD DQLHLSRGJU]HZDQLHSURGXNWyZ
3LHF]HQLHFLDVWSU]\U] G]DQLHEXG\QLX
600W
2GJU]HZDQLHJRWRZ\FKGD 3LHF]HQLHPL VD,GURELX
800W
*RWRZDQLHOXESRGJU]HZDQLHSá\QyZ
Gotowanie warzyw.
11
Downloaded From Microwave-Manual.com Manuals
P
EMM2015
Pieczenie na grillu
1D SRGVWDZ REURWRZ
SRWUDZ
2.
] WDOHU]HP SRVWDZLü UXV]W ]
=DFKRZDü
RVWUR QR ü
JG\ NXFKQLD
8VWDZLü
8ZDJD3R]DNR
SRNU
WáR
LQDF]HM
3RNU
SLHF]HQLD
SRNU WáHP
]HJDUD
E G]LH
rozgrzana.
1.
F]DV
.XFKQLDUR]SRF]QLHSUDF 1DJULOOXPR QDSLHFPL VRVWHNLNRWOHW\LWS
F]HQLXSLHF]HQLDXSHZQLüVL H
]HJDUD
]QDMGXMH
NXFKQLD
E
VL G]LH
Z
ZFL
SRáR HQLX
SUDFRZDáD
WáRPRF\XVWDZLüZSR]\FML*ULOO
3U]\NáDG3LHF]HQLHQDJULOOXSU]H]PLQXW
1.
8VWDZLüSRNU WáRPRF\ZSRáR HQLX
(Grill).
2.
3RNU
3.
.XFKQLDE G]LHSUDFRZDáDSU]H]PLQXW
WáHP]HJDUDXVWDZLüF]DV±PLQXW
(Grill).
Gotowanie “Mikrofale + Grill”
1D SRGVWDZ REURWRZ
SRWUDZ
2.
] WDOHU]HP SRVWDZLü UXV]W ]
=DFKRZDü
RVWUR QR ü
JG\ NXFKQLD
8VWDZLü
8U]
1DJULOOXPR QDSLHFPL VRVWHNLNRWOHW\LWS
JRWRZDQLD
SRNU WáHP
]HJDUD
E G]LH
rozgrzana
8ZDJD3R]DNR
SRNU
1.
F]DV
G]HQLHUR]SRF]QLHSUDF 8VWDZLü SRNU WáR PRF\ QD RGSRZLHGQL PRF
WáR
LQDF]HM
F]HQLXSLHF]HQLDXSHZQLüVL H
]HJDUD
]QDMGXMH
NXFKQLD
E
G]LH
VL Z
ZFL
SRáR HQLX
SUDFRZDáD
mikrofal i grilla.
3U]\NáDG*RWRZDQLH]PRF PLNURIDO:LJULOORZDQLHSU]H]PLQXW
1.
3RNU
WáRPRF\XVWDZLüZSRáR HQLX
2.
3RNU
WáR]HJDUDXVWDZLüZSR]\FML
3.
3U]H]PLQXWE G]LHZá
(Combi 2).
F]RQDIXQNFMD
(Combi 2).
UWAGA:
2WZDUFLH GU]ZL NXFKQL SRGF]DV MHM SUDF\ SRZRGXMH Z\á F]HQLH XU] G]HQLD $E\ Z]QRZLü SURFHV QDOH \
]DPNQ
üGU]ZL
3RGNRQLHFJRWRZDQLDNXFKQLDZ\á F]DVL
DXWRPDW\F]QLHLUR]OHJDVL V\JQDáDNXVW\F]Q\
:WU\ELHÄ0LNURIDOH*ULOO´PR QD]PLHQLDüSR]LRPPRF\LF]DVJRWRZDQLDJG\NXFKQLDMHVWZá F]RQD
12
Downloaded From Microwave-Manual.com Manuals
P
EMM2015
:VND]yZNLGRW\F] FHSLHF]HQLDQDJULOOX
3URGXNW\ SU]H]QDF]RQH GR SLHF]HQLD QD JULOOX QDOH \ XáR \ü QD UXV]FLH SRG UXV]W SRGVWDZLü QDF]\QLH Z
NWyU\PE
G
e
]ELHUDá\VL VRNL]PL VDRUD]WáXV]F]:SRáRZLHF]DVXSL F]HQLDQDOH \REUyFLüSURGXNW\
Produkt
Tost
Tost z serem
,OR
Czas pieczenia
4-5 min.
6-7 min.
üZDJD
2 kromki
4 kromki
Uwagi
4-5 min same tosty; 2 minuty z serem
:VND]yZNLGRW\F] FHIXQNFML³0LNURIDOH*ULOO´
8 \ZDü UXV]WX Z SU]\SDGNX SLHF]HQLD ZLHSU]RZLQ\ L ZRáRZLQ\ GHOLNDWQH NDZDáNL SU]\NU\ü IROL 1D WDOHU]X
REURWRZ\P SRG UXV]WHP SRVWDZLü QDF]\QLH GR ]ELHUDQLD WáXV]F]X L VRNyZ -H HOL WR NRQLHF]QH REUyFLü
produkty w czasie pieczenia.
Produkt
Bekon
,OR
üZDJD
:RáRZLQD
4
(100 g)
900 g
Wieprzowina
900 g
3RáR HQLHSRNU WáD
Combi 3
Tylko mikrofale 800W
Czas
przygotowa
nia
7- 9 min
25 min
Uwagi
3RVPDURZDüWáXV]F]HP
3U]\SUDZLüVRO L
pieprzem. Po pieczeniu
Combi 2
5 - 6 min
RGF]HNDüPLQXW
3RVPDURZDüWáXV]F]HP
Kotlety wieprzowe
2 - 3(450 g)
Combi 2
20 - 25 min
Kurczak:
PoáRZD
Udka
450 g
Combi1
15 - 20 min
800 g
4 (200 g)
Combi 1
Combi 2
25 - 30 min
12 - 15 min
450 g
Combi 1
10 - 15 min
2 (350 g)
Combi 3
22 – 24 min
2 (150 g)
Combi 2
16 – 18 min.
3U]\SUDZLüVRO SLHSU]HP
LSDSU\N
3RVPDURZDüWáXV]F]HP
3U]\SUDZLüVRO SLHSU]HP
0UR RQH
LSDSU\N
hamburgery
.LHáEDVNL
Kotlety rybne
3RVPDURZDüWáXV]F]HP
3U]\SUDZLüVRO L
pieprzem.
0UR RQH]LHPQLDNL
7DEHODXVWDZLH ³0LNURIDOH*ULOO´
Symbol
Ustawienie
Moc mikrofal
Moc grilla
Grill
0W
1000W
Combi 1
300W
1000W
Combi 2
450W
1000W
Combi 3
600W
1000W
13
Downloaded From Microwave-Manual.com Manuals
P
EMM2015
:VND]yZNLGRW\F] FHUR]PUD DQLD
1LHNWyUHSURGXNW\SLHF]\ZRLRZRFHPR QDUR]PUD DüSU]\U
PRODUKT
(180W)
F]Q\PXVWDZLHQLXPRF\
CZAS
“ODCZEKA
NIA”
PRZYGOTOWANIE
Pieczywo
aczyniu do
mikrofaOyZNLREUyFLüZSRáRZLHF]DVXRGPUa DQLD
'X \ERFKHQHN
3RáR \üQDSDSLHU]HNXFKHQQ\POXEQaczyniu do
(krojony) mikrofaOyZNLREUyFLüZSRáRZLHF]DVXRGPUa DQLD
2 kromki
3RáR \üQDSDSLHU]HNXFKHQQ\P
0Dá\ERFKHQHN
3RáR \üQDSDSLHU]HNXFKHQQ\POXEQ
EXáND
3RáR \üQDSDSLHU]HNXFKHQQ\P
EXáNL
3RáR \üQDSDSLHU]HNXFKHQQ\P
Ciasta i wyroby cukiernicze
Sernik (450 g)
=GM üRSDNRZDQLHXáR
Ciasto
=GM üRSDNRZDQLHXáR
(upieczone) (450
g)
Placek (450 g)
=GM üRSDNRZDQLHXáR
\üQDWDOHU]X
8–10 min.
10–15 min.
10–13 min.
10 min
45–60 sek.
45–60 sek.
1–11/2 min.
5 min.
5 min.
5 min.
9–11 min.
15–30 min.
7– 9 min.
15–30 min.
7– 9 min.
15–30 min.
7– 8 min.
5–10 min.
7– 8 min
5–10 min.
\üQDWDOHU]X
\üQDWDOHU]X
0DVáR
250 g (1 kostka)
Owoce
Drobne owoce
(225 g)
Drobne owoce
(450 g)
Dania gotowe
400 g
8áR \üMHGQ
ZDUVWZ
alerzu
QDSá\WNLPW
3U]\NU\üWDOHU]HPOXEVSHFMDOQ IROL GRPLNURIDOyZHN
DE\SRGJU]Dü±Zá F]\üPLNURIDOHQD:QD
4 minuty
Warzywa
Nie ma konieczno FLRGPUD DQLDZarzyw przed
gotowaQLHP:V]\VWNLHZDU]\ZDPR QDXJRWRZDüSU]\
ustawieniu 100% (800W)
14
Downloaded From Microwave-Manual.com Manuals
P
EMM2015
Praktyczne wskazówki
•
.XFKQL
QDOH \
XWU]\P\ZDü
Z
Porady
F]\VWR FL
±
•
Z\FLHUDü SR ND G\P X \FLX WDN H SRGVWDZ
eZQ
REURWRZ
•
LZ
WU]Q
GU]ZL
1LHX \ZDüQDF]\
]SRNU\
HOHPHQWDPL
RSDNRZD
SRNU\ZN
Já\FK
wkami.
1LHNWyUH
PLNURIDORZ\PL
URG]DMH
QDF]\ OXE
•
VWRSLü SRGF]DV
gotowania w kuchni mikrofalowej.
•
erza.
V
SRGJU]HZDQH
Z
Topienie czekolady
•
VZRLFK
7RSLHQLHOXE]PL NF]DQLHPDVáD
2SDNRZDQLD]HOHPHQWDPLPHWDORZ\PL PRJ E\ü
]PL
•
\ZQR FL WR ]DOHFLá =GM ü
metalowe klipsy.
'HOLNDWQH
QS
QDOH \
DOXPLQLRZHM
DE\
VNU]\GHáND
RNU\ü
2G
XQLNQ ü
OXE
Qy NL
IROLL
•
SU]HJU]DQLD
OXE
OXE ]
3URGXNW\ SRVLDGDM FH QLHSRURZDW VNyU
mQLDNL
WDNLH MDN MDEáND ]LH
yáWND
MDM
NLHáEDVNL
E G
Z
•
WUyENL
DE\
Z\FL QL
]DSRELHF
WZRU]HQLX
VL SDU\
OXE
1LHJRWRZDüMDMJG\ PRJ
:L NV]H
NDZDáNL
s
HN SORGRZDü
\ZQR FL
XPLHV]F]Dü
SR
WU]QHM VWURQLH QDF]\QLD 6WDUDü VL JRWRZDü
SRUFMRZDQ Z
PQLHMV]H
NDZDáNL
\ZQR üXNáDGDüQD URGNXWDOHU]DREURWRZHJR
•
\ZQR ü E
E
G]LH
G]LH XJRWRZDQD UyZQRPLHUQLH MH HOL
REUDFDQD
OXE
PLHV]DQD
SRGF]DV
gotowania.
1DOH \
QLHFR
VNUDFDü
F]DV
SU]\JRWRZDQLD
SRWUDZ\ZVND]DQ\SU]H]SURGXFHQWDDE\XQLNQ ü
UR]JRWRZDQLD ,P ZL NV]H NDZDáNL
\ZQR FL W\P
GáX V]\F]DVMHVWF]DVLFKJRWRZDQLD
'R
JRWRZDQLD
ZDU]\Z
QDOH \
GRGDZDü
MDN
QDMPQLHMV]HLOR FLZRG\OXEJRWRZDüEH]ZRG\
8 \ZDü PQLHM VROL L LQQ\FK SU]\SUDZ QL Z
przypadku gotowania tradycyjnego.
\ZQR ü
SU]\SUDZLDü
SR
Z\M FLX
]
NXFKQL
mikrofalowej.
•
3R
]DNR
ÄF]DV
F]HQLX
JRWRZDQLD
RGF]HNDQLD´
DE\
QDOH \
]DFKRZDü
SRWUDZ\
E\á\
równomiernie ugotowane.
•
3R Z\M
MX FLX ] NXFKQL SRWUDZ\ VSUDZG]Lü F]\ MHVW
Z\VWDUF]DM FR
JRU
FD
XJRWRZDQD
równomiernie).
•
EDUG]LHM VRF]\VWH SR SRGJU]DQLX QD
QDMZ\ V]\P SR]LRPLH PRF\ SU]H] VHNXQG SU]HG
\ZQR ü
•
Sok owocowy
ZF]H QLHMV]HJR QDNáXFLD ]HZQ WU]QHM ZDUVWZ\
]HZQ
•
ENL F]RVQNX RJU]HZDü QD QDMZ\ V]\P
2ZRFH E G
Z\PDJDM
ewentualnemu poparzeniu.
•
Obieranie czosnku
poziomie mocy przez 15 sekund.
GURELRZH
•
ZLH DQLHOXESRGJU]HZDQLHSLHF]\ZD
NDZDáNDPL
spalenia.
SRZáRN
NF]HQLH±SU]\QDMQL V]\PSR]LRPLHPRF\
UHGQLSR]LRPPRF\SU]H]NLONDVHNXQG
NDZDáNL
NXUF]DND
•
•
6WRSLHQLH PDVáD QD QDMZ\ V]\P SR]LRPLH PRF\
JG\ LFK SURGXFHQW
•
SU]H]
RU\JLQDOQ\FK RSDNRZDQLDFK QDOH \ MH RWZRU]\ü
umieszczane w kuchni mikrofalowej tylko wtedy,
•
XVWDZLHQLX
PLHV]Dü
&KOHEPR QDUR]PUD DüQDSDSLHURZ\PU F]QLNX
PUR RQNL
UHGQLP
SRGJU]HZDü QD QDMZ\ V]HM PRF\ SU]H] PLQXW\
3URGXNW\ QDOH \ SU]\NU\ü SRGF]DV JRWRZDQLD
-H HOL
SU]\
3RG]LHOLü WDEOLF]N J QD NRVWNL ZáR \ü GR PLVNL L
8 \üV]NODQHMSRNU\ZNLOXEWDO
•
•
ü
LZáR \üVáRLNGRNXFKQLSRGJU]HZDüIDODPL
minuty.
PHWDORZ\FKOXE]PHWDORZ\PL
SODVWLNRZ\FK PRJ VL
Miód
-H HOL PLyG Z VáRLNX XOHJá NU\VWDOL]DFML QDOH \ ]GM
'R JRWRZDQLD PLNURIDORZHJR X \ZDü RNU
OXERZDOQ\FKQDF]\
•
VWURQ
3U]\Z\MPRZDQLXQDF]\ LSRWUDZ]NXFKQLQDOH \
]DZV]HX \ZDüU
NDZLFRFKURQQ\FK
15
Downloaded From Microwave-Manual.com Manuals
.
FLHP
P
EMM2015
Konserwacja i czyszczenie
oduktów niepotrzebnie
.XFKQLD PLNURIDORZD PXVL E\ü XWU]\P\ZDQD Z F]\VWR FL 1LHXVXQL WH UHV]WNL SU
ypaleniu.
SRFKáDQLDM HQHUJL PLNURIDORZ RUD]XOHJDM SU]
7RSU]\F]\QLDVL
yjemnych zapachów.
asnym zakresie. Naprawy
GR]PQLHMV]HQLDZ\GDMQR FLXU]
G]HQLDRUD]SRZVWDZDQLDQLHSU]
DGQH F]\QQR FL QDSUDZF]H F]\ UHJXODF\MQH QLH SRZLQQ\ E\ü GRNRQ\ZDQH ZH Zá
PRJ
utoryzowanych zaNáDGyZVHUZLVRZ\FK
E\üSU]HSURZDG]DQHZ\á F]QLHSU]H]WHFKQLNyZD
3U]HG SU]\VW SLHQLHP GR F]\V]F]HQLD QDOH \ XSHZQLü VL F]\ NXFKQLD MHVW Z\á F]RQD LOXE RGá
czona
od zasilania.
Czyszczenie akcesoriów (talerz i podstawa)
&]\ FLü GHOLNDWQ\PL
URGNDPL SR Z\M FLX ] NXFKQL QDOH \ RVWUR QLH REFKRG]Lü VL ] SRGVWDZ WDOHU]D
obrotowego.
UWAGA:
]DNR
:Q
WU]H NXFKQL RUD] WDOHU] V EDUG]R JRU FH ZL
F QLH QDOH \ LFK GRW\NDü EH]SR UHGQLR SR
F]HQLXF\NOXJRWRZDQLD
&]\V]F]HQLHZQ WU]DNXFKQL
.XFKQL
k
QDOH \ XWU]\P\ZDü Z F]\VWR FL 1DW\FKPLDVW XVXZDü SR]RVWDáR FL SURGX WyZ
oZRGXM
FLDQHN XV]F]HOHN SRZLHU]FKQL XV]F]HOQLDM F\FK JG\ S
PLNURIDORZHMSU]\F]\QLDM
FVL
jszenia jej efekW\ZQR
GR]PQLH
< 8
<:$û
52'.Ï:
HQHUJLL
FLDQDZHWSRZVWDQLDSRZD QHMXVWHUNL
'RF]\V]F]HQLDVWRVRZDüGHOLNDWQHGHWHUJHQW\Sá\QQHFLHSá ZRG
1,( 1$/(
\ZQR FLRZ\FK ]H
RQH QDGPLHUQ DEVRUSFM
RUD]PL
NNLHLF]\VWH FLHUHF]NL
&,(51<&+ 35=(0<6à2:<&+ 67$/
OWYCH ZMYWAKÓW DO
OWEJ.
$'1(*2=(/(0(17Ï:.8&+1,0,.52)$/
:FHOXXVXQL FLDPRFQ\FK]DEUXG]H PR QDJRWRZDüZNXFKQLV]NODQN ZRG\SU]H]PLQXW\
'2868:$1,$=$1,(&=<6=&=(
1,(8
<:$û12
<,,11<&+2675<&+1$5=
'=,
ytryny
:FHOXXVXQL FLDQLHSU]\MHPQHJR]DSDFKXQDOH \JRWRZDüZNXFKQLV]NODQN ZRG\]á\ NDPLVRNX]F
przez 5 minut.
&]\V]F]HQLHHOHPHQWyZ]HZQ WU]Q\FK
3RGF]DV F]\V]F]HQLD HOHPHQWyZ SDQHOX VWHUXM FHJR QDOH \ RWZRU]\ü GU]ZL FR ]DSRELHJQLH SU]\SDGNRZHPX
Zá
F]HQLXNXFKQL(OHPHQW\ ]HZQ WU]QHQDOH \F]\ FLüáDJRGQ\PL URGNDPLWDN HXQLZHUVDOQ\PL URGNDPL Z
VSUD\XFLHSá ZRG
LRVXV]DüPL NN
1LH ZROQR VWRVRZDü
URGNyZ
V]PDWN
FLHUQ\FK V]RUVWNLFK ]P\ZDNyZ GR QDF]\ F]\ WH V]RUVWNLFK
URGNyZ
FKHPLF]Q\FK 3RGF]DV F]\V]F]HQLD SURVLP\ ]ZUyFLü XZDJ DE\ GR RWZRUyZ ZHQW\ODF\MQ\FK QLH GRVWDáD VL
woda.
Konserwacja i czyszczenie (grill)
*U]DáND JULOOD PR H ]RVWDü ]DQLHF]\V]F]RQD SU\VNDM F\P WáXV]F]HP 2GF]HNDü D NXFKQLD E G]LH FKáRGQD L
Z\WU]Hü ]DEUXG]HQLD SU]HG QDVW SQ\P Zá
F]HQLHP NXFKQL 3R]RVWDZLRQH UHV]WNL WáXV]F]X PRJ SRZRGRZDü
dymienie i powstawanie nieprzyjemnych zapachów.
16
Downloaded From Microwave-Manual.com Manuals
P
EMM2015
SHUZLVLF]
FL]DPLHQQH
-H HOL NXFKQLD QLH G]LDáD SUDZLGáRZR SU]HG ZH]ZDQLHP VHUZLVX SURV] VSUDZG]Lü F]\ XVWHUNL QLH
uQ
PR QDXV
üVDPRG]LHOQLH
1LHPR QDXUXFKRPLüNXFKQL
•
•
•
•
6SUDZG]LüF]\XU]
-H OLWRNRQLHF]QHZ\PLHQLüEH]SLHF]QLNQDVSUDZQ\RW\FKVDP\FKSDUDPHWUDFK
6SUDZG]Lü F]\ SU]Há
Zá
•
•
ego.
G]HQLHMHVWSUDZLGáRZRSRGá F]RQHGR]DVLODQLDHOHNWU\F]Q
6SUDZG]LüF]\ZW\F]NDMHVWSUDZLGáRZRZáR RQDGRJQLD]GND
F]QLN JQLD]GNR
FLHQQH OXE LQQ\ SXQNW REZRGX ]QDMGXMH VL Z SR]\FML 21
F]RQ\
6SUDZG]LüF]\ZJQLD]GNXMHVWQDSL FLHSRSU]H]SRGá F]HQLHLQQHJRVSUDZQHJRXU] G]HQLD
6SUDZG]LüEH]SLHF]QLNZVNU]\QFH
Kuchnia nie podejmuje pracy:
• 6SUDZG]Lü F]\ Zá F]RQR ]DEH]SLHF]HQLH SU]HG SU]\SDGNRZ\P XUXFKRPLHQLHP SU]H] G]LHFL GRVW SQH Z
niektórych modelach).
• 6SUDZG]LüZ\NRQDQHXVWDZLenia.
• 6SUDZG]LüF]\XVWDZLHQLD]RVWDá\GRNRQDQH]JRGQLH]RSLVHPZLQVWUXNFMLREVáXJL
• 6SUDZG]LüF]\SUDZLGáRZR]DPNQL WRGU]ZLRUD]F]\]DPNQL FLXQLHSU]HV]NaG]DM UHV]WNLSURGXktów).
• 6SUDZG]LüF]\SU]\FLVN6WDUW]RVWDáZFL QL W\
-H HOL Z\NRQDQLH SRZ\ V]\FK F]\QQR FL QLH SU]\QLRVáR HIHNWX L NXFKQLD QDGDO QLH IXQNFMRQXMH QDOH \
isowym Electrolux.
VNRQWDNWRZDüVL ]QDMEOL V]\PDXWRU\]RZDQ\P]DNáDGHPVHUZ
8:$*$.RV]WZH]ZDQLHWHFKQLND]SRZRGXXVWHUNLZ\PLHQLRQHMSRZ\ HMOXEQLHSUDZLGáRZHMREVáXJL
LQVWDODFMLXU] G]HQLDSRNU\ZDNOLHQWQDZHWZF]DVLHWUZDQLDJZDUDQFML
-H HOL E
G
3D
VWZR ]DPDZLDOL XVáXJL VHUZLVRZH OXE F]
FL ]DPLHQQH SURVLP\ R SRGDQLH QDVW SXM
F\FK
informacji:
1. objawy usterki
2. oznaczenie modelu
3. numer seryjny/produktu
4. data zakupu
=DOHFDP\]DSLVDQLHW\FKLQIRUPDFMLSRQL HM
Model :
EMM20017
Numer seryjny:
Data zakupu:
-H HOL XU]
G]HQLH SRGOHJD JZDUDQFML SU]HG ZH]ZDQLHP VHUZLVX QDOH \ VSUDZG]Lü F]\ XVWHUNL QLH
PR QD XVXQ
ü VDPRG]LHOQLH :L]\WD E G]LH RGSáDWQD JG\ XVWHUND QLH E G]LH PLDáD FKDUDNWHUX
mechanicznego lub elektrycznego.
:UD]LHQDSUDZ\ZF]DVLHJZDUDQFMLQDOH \XGRVW
SQLüGRZyG]DNXSXXU] G]HQLD
&]
FL]DPLHQQH
&]
FL]DPLHQQHPR QDQDE\üZDXWRU\]RZDQ\FK]DNáDGDFKVHUZLVRZ\FK
Serwis
,QIRUPDFMLRSURGXNWDFKXG]LHODSURGXFHQW:SU]\SDGNXZ WSOLZR FLGRW\F]
]ZUyFLüVL GRDXWRU\]RZDQHJRVHUZLVX
17
Downloaded From Microwave-Manual.com Manuals
F\FKG]LDáDQLDXU] G]HQLDQDOH \
P
EMM2015
WARUNKI GWARANCJI
:DUXQNL XG]LHORQHM JZDUDQFML ]QDMGXM VL
XU]
Z NDUFLH JZDUDQF\MQHM NWyU RWU]\PDOL 3D VWZR SU]\ ]DNXSLH
G]HQLD
18
Downloaded From Microwave-Manual.com Manuals
A
EMM2015
Tartalomjegyzék
$PLNURKXOOiP~VW
KDV]QiODWDHO
4
WW
Biztonsági tudnivalók
6W HGpQ\HNpVWDUWR]pNRN
4
5
5
6
0
V]DNLDGDWRN
6
(O
NpV]OHWHND]]HPEHKHO\H]pVKH]
Kicsomagolás
7
7
Elhelyezés
Csatlakoztatás a hálózatra
7
7
$I ] HGpQ\HNDONDOPDVViJiQDNYL]VJiODWD
Az ételek biztonsága
+RJ\DQP
N|GLNDPLNURKXOOiP~VW
"
) UpV]HNPHJQHYH]pVHpVIXQNFLyL
Forgótányér behelyezése
.H]HO SDQHO
0LNURKXOOiP~I ]pV
9Mikrohullámú teljesítmény táblázat
) ]pVJULOOHO
Sütés mikrohullám és grill kombinálásával
-DYDVODWRNJULOOHOYDOyI ]pVKH]
Javaslatok mikrohullámmal és grillel való sütéshez
Mikrohullám- és grillteljesítmény táblázat
Felolvasztási tudnivalók 180 W beállításnál
Mikrózási tanácsok
Tisztítás és ápolás
Tartozékok tisztítása (forgótányér és támasz)
8
8
8
9
10
10
11
11
12
12
12
13
14
.OV WLV]WtWiV
15
15
15
14
Üzemzavarok - pótalkatrészek
16
Jótállás
16
%HOV WLV]WtWiV
Downloaded From Microwave-Manual.com Manuals
3
A
EMM2015
*UDWXOiOXQND]~MPLNURKXOOiP~VW PHJYiViUOiViKR]
.|V]|QMNKRJ\(OHFWUROX[WHUPpNHWYiODV]WRWW0HJJ\ ] GpVQNKRJ\QDJ\RQKDV]QRVQDNWDOiOMD PDMG D]
~M PLNURKXOOiP~ VW W DPHO\ QDJ\V]HU VHJtW WiUVD OHV] 0LQW PLQGHQ NRQ\KDL NpV]OpN H] LV PHJN|YHWHOL
KRJ\ PHJLVPHUMH D I UpV]HNHW pV D]RN IXQNFLyLW PLYHO D NpV]OpN QpONO|]KHWHWOHQ OHV] PDMG D] gQ
számára.
$PLNURKXOOiP~VW KDV]QiODWDHO WW
0LHO WW D NpV]OpNpW KDV]QiODWED YHQQp IHOWpWOHQO ROYDVVD HO H]W D +DV]QiODWL ~WPXWDWyW $] (OHFWUROX[
PLNURKXOOiP~VW KDV]QiODWDNRUDOHJMREEHUHGPpQ\HOpUpVHpUGHNpEHQWDUWVDEHD+DV]QiODWL~WPXWDWyEDQ
leírtakat. Figyelmesen olvassa el a tudnivalókat. Ügyeljen arra, hogy a Használati útmutató mindig a
rendelkezésére álljon.
Ha a készüléket eladja, vagy elajándékozza, akkor ezt a Használati útmutatót is adja át az új tulajdonosnak,
KRJ\
LVWLV]WiEDQOHJ\HQDNpV]OpNP N|GpVpYHOpVPHJLVPHUMHDYRQDWNR]yEL]WRQViJL~WPXWDWiVRNDWLV
$ KDV]QiODWED YpWHO HO WW MyO LVPHUMH PHJ D NH]HO HOHPHNHW D NO|QE|] IXQNFLyNDW pV N|YHVVH D]
ajánlásokban leírtakat is.
Biztonsági tudnivalók
• A
beépített
megakadályozza,
biztonsági
kapcsoló
hogy
nyitott
ajtónál
P N|GM|QDPLNURKXOOiP~VW • Ne próbálja meg "bütykölni" a kapcsolót és ne
SUyEiONR]]RQ D VW Q\LWRWW DMWyYDO W|UWpQ
P N|GWHWpVpYHO VHP PHUW D] D PLNURKXOOiP~
energia veszélyes kijutását eredményezheti.
• Ne hagyja a kifröccsent étel- és tisztítószer
PDUDGYiQ\RNDW
UiUDNyGQL
D]
DMWyW
W|PtW
felületekre. Vegye figyelembe a tisztításra
YRQDWNR]yIHMH]HWHO tUiVDLW
•
.O|Q|VHQ IRQWRV KRJ\ D VW DMWy W|NpOHWHVHQ
zárjon, ne legyen sérült, vagy deformálódott
(1). A zsanéroknak (2) és a zárszerkezetnek
biztonságosnak, az ajtó tömítésének (3) és a
•
nincs étel, vagy víz, amelyek képesek a
mikrohullámú energia elnyelésére, akkor
károsodhat a magnetron.
• Ha gyerekek tartózkodnak a készülék
közelében, akkor az csak felügyelet mellett
]HPHOWHWKHW • Ne tárolja a készüléket a szabadban. Ne
használja víz közelében sem.
• 1H SUyEiOMRQ UXKDQHP W YDJ\ ~MViJSDStUW
szárítani
a
mikróban,
mert
azok
meggyulladhatnak.
• 1H KDV]QiOMD D VW WHUHW WiUROiVL FpOUD 1H
hagyjon
benne
papírtermékeket,
W|PtW IHOOHWHNQHNNLIRJiVWDODQ iOODSRWEDQ NHOO
lenni.
• Soha ne próbálkozzon saját maga a készülék
javításával.
A
meghibásodott
készülék
javítását, beleértve a csatlakozó vezeték
cseréjét is, csak a jótállási jegyben megjelölt
szerviz végezheti. Hiba esetén forduljon a
kijelölt szervizhez.
• 6RKD QH WiYROtWVD HO D NpV]OpN NOV
EXUNRODWiW D] DMWyW YDJ\ D NH]HO SDQHOW $
nagyfeszültség rendkívül veszélyes.
• A készülék elhelyezésénél vegye figyelembe
az „Elhelyezési tudnivalók´ FtP IHMH]HW
HO tUiVDLW
• A készüléket kizárólag az Útmutatóban leírtak
figyelembe vételével használja. Ne használjon
maró vegyi anyagokat a készülékben. Ezt a
WtSXV~
VW W
PHOHJtWpVpUH
NLIHMH]HWWHQ
I ]pVpUH
Ki]WDUWiVL
pV
pWHOHN
IHOROYDV]WiViUD
tervezték. Nem alkalmas ipari, laboratóriumi,
vagy
kereskedelmi
használatra,
amely
1HP N|GWHVVHDVW WDIRUJyWiQ\pUpVpWHOHN
EHKHO\H]pVH QpONO $PHQQ\LEHQ D VW EHQ
I ] HGpQ\HNHW YDJ\ pWHOHNHW DPLNRU QHP
használja.
%L]WRQViJLWXGQLYDOyNJULOOHOYDOyI ]pVNRU
1. Az ajtó üvegablaka eltörhet, ha grillezéskor
víz fröccsen a forró felületre.
2. +DV]QiOMRQPLQGLJYpG NHV]W\ WDVW EHYDOy
bepakoláshoz, illetve az edények kivételéhez.
Az edények nagyon felforrósodnak, ezért
legyen nagyon óvatos. A forgótányér és a fém
rács szintén nagyon felforrósodik, ezért azok
NLYpWHOpKH]LVKDV]QiOMRQNHV]W\ W
3. Sem bepakoláskor, sem pedig kipakoláskor
ne érintse meg fém eszközzel az ajtó
YHJDEODNiW VHP EHOOU O VHP SHGLJ NtYOU O
$] DMWy EHOVHMH LV pV D VW EHOVHMH LV QDJ\RQ
forró, ezért legyen óvatos az étel keverésekor,
vagy forgatásakor.
4. Sem a forgótányért, sem pedig az edényeket
ne helyezze forró vízbe és ne próbálja meg
UHQGHOWHWpVHOOHQHV KDV]QiODWQDN PLQ VO pV
nem vonatkozik rá a jótállás.
Downloaded From Microwave-Manual.com Manuals
4
D]RNDWJ\RUVDQOHK WHQL
A
EMM2015
5.
1H WHJ\HQ VHPPLO\HQ WiUJ\DW D VW WHWHMpUH
$ WHW D KDV]QiODW VRUiQ IHOIRUUyVRGLN pV D
UiKHO\H]HWW WiUJ\ NiURVRGKDW D K W O $] DMWy
N|UO NLiUDPOy J
] WHOMHVHQ QRUPiOLV MHOHQVpJ
ugyanúgy, mint az ajtó alatti vízcseppek
megjelenése. Ezek a jelenségek nincsenek
NLKDWiVVDO D PLNURKXOOiP~ VW P N|GpVpUH
és biztonságára.
6.
1H
HU OWHVVH
Np]]HO
HOIRUJDWiViW
PHUW
D
IRUJyWiQ\pU
KLEiV
Az ételek biztonsága
• Az ételeket mindig alkalmas tárolóedényben
melegítse.
• 1H KDV]QiOMD D NpV]OpNHW IULW ]pVUH PHUW D]
RODM]VtU
YpJH]KHW P N|GpVW
$PHQQ\LEHQ
D
PLNUy
P N|GpVH
N|]EHQ
V]LNUi]iV IRUGXO HO DNNRU D]W IpP YDJ\
DPHO\HW
NLIHMH]HWWHQ
pV
PLNUyEDQ
$ QHP SRUy]XVRV KpMDV pWHOHN E UpW V]XUNiOMD
PHJ KRJ\ D NHOHWNH] J
]|N NLMXWKDVVDQDN
1pKiQ\pOHOPLV]HUQpOJRQGRVNRGQLNHOODNOV
EXURN NLV]~UiViUyO DOPD EXUJRQ\D FVLUNHE U
D]RQQDONDSFVROMDNLpVHOOHQ UL]]HD]HGpQ\W
V]HOO ] Q\tOiVDLW
V]DEiO\R]KDWy
tilos felügyelet nélkül végezni.
•
fémtartalmú edény okozza. A folyamatos
szikrázás károsíthatja a készüléket. Ilyenkor
• Ha az edény deformálódik, akkor hagyja abba
a sütést és válasszon másik edényt.
• hJ\HOMHQ DUUD KRJ\ VHPPL QH ]iUMD HO D VW
QHP
W|UWpQ HONpV]tWpVUHJ\iUWRWWDN(]WDP YHOHWHW
eredményezhet.
•
K IRND
könnyen meggyulladhat.
• A mikróban csak olyan kukorica pattogtatása
WRMiVKpM
KRJ\
D
NHOHWNH] J
]|NW O
D]
élelmiszer ne "robbanjon" szét.
Vigyázat! Amikor folyadékot melegít, pl. levest,
V]yV]WLWDOWDNNRUDIRUUiVSRQWIHOHWWLW~OI WpVPLDWW
a folyadék kifuthat. Hogy ezt elkerülhesse, tartsa
EHDN|YHWNH] NHW
$ I ] HGpQ\HN DONDOPDVViJiQDN
vizsgálata
1.
•
2.
3.
+HO\H]]HDI ] HGpQ\WDPLNUyEDHJ\IpOSRKiU
vízzel együtt. Melegítse egy percig 800 W-os
WHOMHVtWPpQ\HQ
+D
D
I ] HGpQ\
felforrósodik, akkor az nem alkalmas
mikrózásra. Ha csak éppen meleg, akkor
PHOHJtWpVUH KDV]QiOKDWy GH I ]pVUH QHP +D
D] HGpQ\ V]REDK PpUVpNOHW PDUDGW DNNRU
DONDOPDVDPLNUyEDQW|UWpQ I ]pVUH
•
$
SDStUWiOFiN
]VtUSDStURN
SDStUW|U|ON|] N
tányérok, csészék, fagyasztó tálcák és
kartonpapírok nagyon kényelmes edények.
0LQGLJW|OWVH NHWWHOHpWHOOHOKRJ\HOQ\HOMpND]
energiát, mert így elkerülheti az edények
túlmelegedését.
•
6RNIDMWD P DQ\DJ HGpQ\ SO WiOFD WiQ\pU
GRER] VWE DONDOPDV D PLNURKXOOiP~ VW EHQ
W|UWpQ KDV]QiODWUD 0LQGLJ N|YHVVH D J\iUWy
ajánlását. A túl zsíros, vagy magas
cukortartalmú ételek esetében azonban kerülje
el ezeknek az edényeknek a használatát, mivel
D PDJDV K
•
1H KDJ\MD D VW W IHOJ\HOHW QpONO DPLNRU
P DQ\DJ SDStU YDJ\ PiV N|QQ\HQ pJKHW
SHUFLJiOOQLPLHO WWHOWiYROtWMDDWHW W
FIGYELEM:
• 1H HU OWHVVH D IRUJyWiQ\pU IRUJiViW Np]]HO
Meghibásodást okozhat.
• $PHQQ\LEHQ D PLNUy P N|GpVH N|]EHQ
V]LNUi]iV IRUGXO HO DNNRU D]W IpP YDJ\
fémtartalmú edény okozza. A folyamatos
szikrázás károsíthatja a készüléket. Ilyenkor
D]RQQDONDSFVROMDNLpVHOOHQ UL]]HD]HGpQ\W
• Ha az edény deformálódik, akkor hagyja abba
a sütést és válasszon másik edényt.
• hJ\HOMHQ DUUD KRJ\ VHPPL QH ]iUMD HO D VW
HGpQ\EHQ PHOHJtW YDJ\ I ] +D IVW|W pV]OHO
KDJ\MDD]DMWyW]iUYDDPtJDIVWPHJV] QLN
)pP
pV
IpPGtV]tWpV HGpQ\HN
V]HOO ] Q\tOiVDLW
6] N
Q\tOiV~
HGpQ\HN
YHJHN
1HKDV]QiOMDDVW
WNHUHVNHGHOPLFpOUD
QHP
használhatók a mikróban, kivéve a speciálisan
erre a célra tervezett edényeket.
•
.DYDUMD IHO D IRO\DGpNRW PLHO WW EHWHV]L D
• Néhány élelmiszer, mint pl. egész tojás,
valamint néhány edény, pl. zárt lekvárosüveg
szétrobbanhatnak. Rántotta sütésénél szúrja ki
a tojás sárgáját, majd takarja le és hagyja 1
kapcsolja ki a készüléket, húzza ki a dugót és
•
.HUOMHHODW~OI WpVW
készülékbe, majd a melegítés félidejében a
kavarást ismételje meg.
4. A melegítés után rövid ideig hagyja a
folyadékot állni a készülékben, majd keverje
meg és óvatosan vegye ki az edényt.
PpUVpNOHW PLDWW H]HN N|QQ\HQ
megolvadhatnak.
1H KDV]QiOMRQ HJ\HQHV ROGDO~ V] N V]iM~
edényt.
(] D VW
NL]iUyODJ Ki]WDUWiVL KDV]QiODWUD
készült.
QHP
KDV]QiOKDWyNDPLNURKXOOiP~I ]pVUH
0LQGLJWDUWVDEHD]HO
• Az égési sérülések elkerülése érdekében
yYDWRVDQYHJ\HOHD IHG W YDJ\ WiYROtWVD HO D]
edényt.
Downloaded From Microwave-Manual.com Manuals
5
]
HNEHQOHtUWDNDW
A
EMM2015
6W HGpQ\HNpVWDUWR]pNRN
$ PLNUy]iVKR] V]iPRV HV]N|] pV DQ\DJ KDV]QiOKDWy (J\ DGRWW I ]pVL VWpVL PyGKR] EL]WRQViJL RNRN
miatt mindig a legalkalmasabb eszközöket és anyagokat válassza ki. Vegye figyelembe az alábbi táblázatot.
Anyag
Edény
Mikrohullámú
I
Kerámia és üveg
) ] HGpQ\
+ iOOyYHJiUX
Porcelán
Agyagedény*2
0 DQ\DJ
Üvegáru
fémdíszítéssel
Ólomkristály
Fémdíszítés nélkül
+ iOOyPLNURKXOOiP~
Grillezés
]pV
Mikrohullámú
I
]pVpVJULOOH]pV
IGEN
IGEN*1
NEM
IGEN
IGEN
NEM
IGEN
IGEN*1
NEM
NEM
IGEN
IGEN
IGEN
NEM
IGEN
IGEN
NEM
NEM
NEM
IGEN
NEM
NEM
IGEN
IGEN
IGEN
IGEN
NEM
NEM
IGEN
NEM
IGEN
NEM
IGEN
IGEN
NEM
NEM
NEM
IGEN
IGEN
IGEN
NEM
NEM
IGEN
IGEN
IGEN
VW EH
IGEN
0 DQ\DJ
csomagoló anyag
Fém
)pPVW VHUSHQ\
Papír
Alumínium fólia*3
Csésze, tányér,
SDStUW|U|ON|]
Zsírpapír
Fa
Tartozékok
Forgótányér
Forgótányér támasz
Grillrács
IGEN: Használható edények és tartozékok NEM: Az edények és tartozékok használatát kerülni kell.
*1 Csak ha nem tartalmaz fémdíszítést.
*2 Csak ha nem tartalmaz fémet.
*3 MEGJEGYZÉS: Az alumínium fóliát csak árnyékolási célra (pl. csirkeláb) használja, mert különben
szikrázást okozhat.
0 V]DNLDGDWRN
.OV PpUHWHN
6W WpULPpUHWHN
Szélesség
Mélység
Magasság
Szélesség
Mélység
Magasság
UWDUWDORP
Teljesítmény-felvétel
Mikrohullámú teljesítmény
Grill teljesítmény
Tömeg
Feszültség
Zajkibocsátás
484 mm
376 mm
285 mm
300 mm
292 mm
195 mm
20 liter
1300 W
800 W
1000 W
13.5 kg
230V/50Hz
60 dB(A)
Ez a készülék megfelel az alábbi irányelveknek:
−
−
(:*NLVIHV]OWVpJ LUiQ\HOYDYiOWR]iVRNNDOEH]iUyODJ
89/336/EWG - 1989.05.03. (EMC-irányelv a 92/31/EWG változásokkal bezárólag)
Downloaded From Microwave-Manual.com Manuals
6
A
EMM2015
(O NpV]OHWHND]]HPEHKHO\H]pVKH]
Kicsomagolás
Csatlakoztatás a hálózatra
Figyelem:$PLNRUNLFVRPDJROWDDVW
WIHOWpWOHQO
HOOHQ UL]]H KRJ\ D V]iOOtWiV N|]EHQ QHP pUWHH
valamilyen sérülés a készüléket. A sérült, vagy
KLiQ\]y UpV]HNNHO UHQGHONH] VW W WLORV ]HPEH
helyezni, azt azonnal vissza kell vinni az eladás
KHO\pUH $ VW W LV pV D WDUWR]pNRNDW LV YpG IyOLD
ERUtWKDWMD $ VW KDV]QiODWD HO WW H]W D YpG IyOLiW
(amennyiben van) el kell távolítani. Ne engedje,
hogy a gyermekek játsszanak a csomagoló
anyagokkal. A csomagoló anyagok veszélyesek
lehetnek a gyerekek számára.
Elhelyezés
1.
0LQGHQ UHNOiPFtPNpW WiYROtWVRQ HO D VW
ajtajáról.
2.
$ VW W VWDELO VLPD IHOOHWUH KHO\H]]H $
IHOOHWQHN RO\DQ HU VQHN NHOO OHQQLH KRJ\ D
készüléket is (13.5 kg) és a tartalmát is
biztonsággal megtartsa. A vízszintes felületre
a rendellenes zaj és vibráció elkerülése
érdekében van szükség.
3.
$ VW W WDUWVD WiYRO K W O pV Yt]W O 0LQGNHWW
FV|NNHQWL
D
VW KDWiVIRNiW
V W
meghibásodáshoz vezethet. Az elhelyezésnél
H]pUW J\HOMHQ DUUD KRJ\ K IRUUiVWyO pV Yt]W O
$VW WDJ\iUWyEHN|W|WWFVDWODNR]yYH]HWpNNHOpV
dugóval szállítja, amelyet 230 V 50 Hz-es földelt
konnektorba kell csatlakoztatni. A földelés
minimálisra csökkenti a rövidzárlat kockázatát.
&VDWODNR]WDWiV HO WW HOOHQ UL]]H KRJ\ D ODNiV
elektromos hálózatának adatai megegyeznek-e a
fent leírtakkal.
0HJMHJ\]pV +D D VW W KRVV]DEEtWyQ NHUHV]WO
csatlakoztatja a hálózatra, akkor annak is földelt
NLYLWHO QHNNHOOOHQQLH
FIGYELEM! Tilos a készüléket
konnektorból üzemeltetni.
földeletlen
+D D PHJIHOHO I|OGHOW NRQQHNWRU QHP iOO D
rendelkezésére, akkor arra illetékes szakemberrel
NHOODPHJIHOHO NLpStWWHWpVU OJRQGRVNRGQLD
Elektromos csatlakoztatás
Ez a készülék egy az európai szabványnak
PHJIHOHO NpWFVDSRV
FVDWODNR]y
GXJyYDO
YDQ
felszerelve.
PHJIHOHO WiYROViJEDQOHJ\HQDVW 4.
1H]iUMDHODEXUNRODWIHOV pVROGDOVyV]HOO ]
Q\tOiVDLW pV VHPPLYHO QH WDNDUMD OH
NHW 1H
FIGYELEM! A KÉSZÜLÉKET FÖLDELNI KELL.
WHJ\HQ VHPPLO\HQ WiUJ\DW D VW WHWHMpUH +D
D V]HOO ] Q\tOiVRN D P N|GpV VRUiQ WDNDUYD
YDQQDN
DNNRU
D
IHOOpS meghibásodáshoz vezet.
KRJ\
D
V]HOO ] W~OPHOHJHGpV
Arra is ügyeljen,
Q\tOiVRNRQ
WiYR]y
IRUUy
OHYHJ HOWiYR]iViW VHP IJJ|Q\ VHP PiV
tárgy ne
hátoldalán.
5.
akadályozhassa
a
készülék
$ J\iUWy PLQGHQ IHOHO
HO
−
OHJWiYRODEE KHO\H]]H HO $ VW PHJIHOHO D]
EMC
(elektromágneses
kompatibilitásra
vonatkozó) irányelveknek, azonban ha túl
közel üzemel a rádióhoz, vagy a TV-hez,
akkor zavarokat okozhat.
6. Ha a készüléket sarokban helyezi el, akkor
hagyjon legalább 10 cm-es távolságot a faltól,
D
PHJIHOHO tUiVRNEHQHPWDUWiVDPLDWWN|YHWNH]LNEH
Ha a készülék csatlakozó dugója nem
alkalmas a konnektorba való csatlakoztatásra,
DNNRU OH NHOO YiJQL pV HJ\ PHJIHOHO W NHOO D
$ NpV]OpNHW UiGLyWyO pV 79W O D OHKHW
KRJ\
VVpJHW HOKiUtW PDJiWyO
ha a meghibásodás, illetve kár a biztonsági
V]HOO ]pV
szervizzel, felszereltetni.
.
EL]WRVtWKDWy
legyen.
)RQWRV $ VW D NRQ\KiEDQ EiUKRO HOKHO\H]KHW Ügyeljen azonban arra, hogy sík felületre állítsa a
NpV]OpNHW pV D V]HOO ] Q\tOiVRN QH OHJ\HQHN
HOWDNDUYD pV D V]HOO ]pV DOXOUyO LV EL]WRVtWYD
legyen.
Downloaded From Microwave-Manual.com Manuals
7
A
EMM2015
+RJ\DQP N|GLNDPLNURKXOOiP~VW "
1
2
3
9
5
8
6
4
4
7
10
)
1.
Forgótányér behelyezése
UpV]HNPHJQHYH]pVHpVIXQNFLyL
6W WpU ± D KDV]QiODW XWiQ
W|U|OMH
NL
D
VW WHUHW
2.
ÈWOiWV]y DEODN ± D VW P N|GpVH N|]EHQ
1. +HO\H]]HDIRUJyWiQ\pUWiPDV]WDVW DOMiUD
2. Helyezze a forgótányért a meghajtó tengelyre
a képen látható módon. Ügyeljen arra, hogy a
ILJ\HOHPPHONtVpUKHWLDNpV]O pWHOW
3.
IRUJyWiQ\pU
PHJIHOHO HQ
záródnia kell.
4. Kampós zárnyelv – ez a biztonsági ajtózár
rendszer része.
5. .H]HO SDQHO
6. Forgótányért meghajtó tengely
7. )RUJyWiQ\pU ± VSHFLiOLV K iOOy YHJE O
NpV]OW 6WpVI ]pVNRU HUUH D WiQ\pUUD NHOO D
tartóba elhelyezett ételt rakni. Ne használja a
VW WIRUJyWiQ\pUQpONO
8.
)RUJyWiQ\pUWiPDV]±~J\KHO\H]]H EHDVW
aljára, hogy jól megtartsa a forgótányért.
9. Grill
10. Grillrács
LOOHV]NHGMHQ
D
meghajtó tengelyre. Soha ne tegye be a
forgótányért lefelé fordítva.
− 6WpVI ]pVNRU D IRUJyWiQ\pU WiPDV]W pV
a forgótányért is használni kell.
− Az edénybe helyezett ételt mindig a
forgótányérra kell betenni.
− A forgótányér az óramutató járásával
azonos és ellentétes irányba is foroghat.
Ez teljesen
normális.
6W DMWy ± VWpV N|]EHQ D] DMWyQDN V]LOiUGDQ
Forgótányér
Forgótányér támasz
Meghajtó tengely
Downloaded From Microwave-Manual.com Manuals
8
A
EMM2015
.H]HO SDQHO
1. Teljesítménybeállító gomb
A gomb segítségével lehet az étel elkészítéséhez szükséges
teljesítményt beállítani.
2.
,G
ÈOOtWVD
EHiOOtWyJRPE
EH
D
NtYiQW
I ]pVL
LG W
$
I ]pV
DXWRPDWLNXVDQ
PHJNH]G GLN 0LQGHQ LG NDSFVROy SRQWRVDEEDQ P N|GLN KD D
V]NVpJHV I ]pVL LG Q W~O HOIRUJDWMD D JRPERW PDMG YLVV]DIHOp
IRUJDWYDiOOtWMDEHDSRQWRVLG WDPHGGLJDI ]pVWYpJH]QLDNDUMD
Downloaded From Microwave-Manual.com Manuals
9
A
EMM2015
0LNURKXOOiP~I ]pV
1. Nyissa ki az ajtót, helyezze be az ételt a
forgótányérra és zárja be az ajtót.
2. ÈOOtWVD EH D V]NVpJHV I ]pVL WHOMHVtWPpQ\W
Vegye figyelembe az alábbi táblázatot.
3. A beállító gomb óramutató járásával
PHJHJ\H] LUiQ\ED
W|UWpQ +D D I ]pVL LG SHUFQpO NHYHVHEE DNNRU
PLQGHQNpSSHQ IRUJDVVD HO D] LG EHiOOtWy JRPERW
egy a 2-nél nagyobb számra, majd vissza a kívánt
LG UH
$ VW NLNDSFVROiViKR] HJ\V]HU HQ IRUJDVVD HO
HOIRUJDWiViYDO
iOOtWVDEHDV]NVpJHVI ]pVLLG W
$NpV]OpNP
N|GpVHPHJNH]G
D]LG EHiOOtWyJRPERWDÄ´SR]tFLyED
GLN
9LJ\i]DW 0LQGHQ KDV]QiODW XWiQ HOOHQ
KRJ\ D] LG
UL]]H
EHiOOtWy D Ä´ SR]tFLyEDQ YDQH
vagy ha folytatni akarja a sütést, akkor állítson
EHHJ\~MLG
W
Példa: Sütés 450 W teljesítményen, 15 percig
1. Forgassa el a teljesítménybeállító gombot a 450 W-os beállításba.
2. )RUJDVVDHOD]LG EHiOOtWyJRPERWD|VV]iPKR]
3. $VW P N|GpVHPHJNH]G GLNpVSHUFLJDXWRPDWLNXVDQ:RVWHOMHVtWPpQ\HQ]HPHO
0pO\K W|WWNpV]pWHOHNIHOPHOHJtWpVH
−
A felmelegítés során az élelmiszer gyártójának az ajánlását kell figyelembe venni. Ha saját maga már
NLWDSDV]WDOWD D] HONpV]tWpVL LG W GH D J\iUWyL DMiQOiV DODSMiQ PpJ QHP HOpJ IRUUy D] pWHO DNNRU WHJ\H
YLVV]D D VW EH pV PHOHJtWVH WRYiEE $ PLNURKXOOiP~ VW QpO XJ\DQ~J\ WDSDV]WDODWRNDW NHOO V]HUH]QL
PLQWDKDJ\RPiQ\RVVW QpO
−
−
Rendszeresen keverje az ételt, különösen a szószokat és a casserole-kat.
1DJ\RQ IRQWRV D] iOOiVLG DPHO\ UpV]H D I ]pVQHN (UUH D]pUW YDQ V]NVpJ KRJ\ D] pWHO WHOMHV
W|PHJpEHQHJ\HQOHWHVK IRN~OHJ\HQ
Mikrohullámú teljesítmény táblázat
Teljesítmény beállítás
Felhasználási javaslat
100 W
Melegentartó funkció: Ételek melegen tartásához
180 W
Felolvasztó funkció: Fagyasztott élelmiszerek felolvasztásához
300 W
*\HQJHIRNR]DW1pKiQ\IDMWDVOWEHIHMH] I ]pVpKH]WHMVRGyYDJ\VDMWRV
keksz sütéséhez
450 W
Közepes fokozat:
felmelegítéséhez
Gyorsabb
felolvasztáshoz,
600 W
Közepes fokozat: Kekszek sütéséhez, puddingok készítéséhez,
készételek felmelegítéséhez, hús és szárnyas pecsenye készítéséhez.
800 W
/HYHVHN IHOPHOHJtWpVpKH] I ]pVpKH] ]|OGVpJHN I ]pVpKH]
tálban készült ételek felmelegítéséhez
Downloaded From Microwave-Manual.com Manuals
10
casserole
és
ragu
EDUQtWy
A
EMM2015
) ]pVJULOOHO
Helyezze a forgótányért a forgótányér tartóra, az
ételt pedig a grillrácsra. Zárja be az ajtót. Ez a
funkció húsok és vagdaltak grillezésére ideális.
1. A teljesítménybeállító gombbal válassza ki a
grill funkciót.
2. $] LG EHiOOtWy JRPE yUDPXWDWy MiUiViYDO
1HIHOHMWVHHOKRJ\DVW QDJ\RQIHOIRUUyVRGLN
PHJHJ\H] LUiQ\ED
W|UWpQ HOIRUJDWiViYDO
iOOtWVD EH D V]NVpJHV VWpVL LG W $ NpV]OpN
P N|GpVHDXWRPDWLNXVDQPHJNH]G GLN
9LJ\i]DW +DV]QiODW XWiQ PLQGLJ HOOHQ
KRJ\D] LG
UL]]H
EHiOOtWyJRPE D Ä´SR]tFLyEDQ iOO
HPHUWKDQHPDNNRUDVW
WRYiEE]HPHO
Példa: Grillezés 15 percig
1. Forgassa el a teljesítménybeállító gombot a
grill szimbólumra.
2. $]LG EHiOOtWyJRPEEDOiOOtWVRQEHSHUFVWpVLLG W
3. $VW P N|GpVHDXWRPDWLNXVDQPHJNH]G GLNpVDJULOOH]pV
15 percig tart.
Sütés mikrohullám és grill kombinálásával
Helyezze a forgótányért a forgótányér tartóra, az
ételt pedig a grillrácsra. Zárja be az ajtót. Ez a
funkció húsok és vagdaltak grillezésére ideális.
1. A teljesítménybeállító gombbal válassza ki a
mikrohullám és grill funkciót.
2. $] LG EHiOOtWy JRPE yUDPXWDWy MiUiViYDO
1HIHOHMWVHHOKRJ\DVW QDJ\RQIHOIRUUyVRGLN
PHJHJ\H] LUiQ\ED
W|UWpQ HOIRUJDWiViYDO
iOOtWVD EH D V]NVpJHV VWpVL LG W $ NpV]OpN
P N|GpVHDXWRPDWLNXVDQPHJNH]G GLN
9LJ\i]DW +DV]QiODW XWiQ PLQGLJ HOOHQ
KRJ\D] LG
HPHUWKDQHPDNNRUDVW
3pOGD)
UL]]H
EHiOOtWyJRPE D Ä´SR]tFLyEDQ iOO
WRYiEE]HPHO
]pV:PLNURKXOOiP~WHOMHVtWPpQ\HQpVJULOOH]pVSHUFLJ
1. Forgassa el a teljesítménybeállító gombot a
grill szimbólumra (Combi 2).
2. $]LG EHiOOtWyJRPEEDOiOOtWVRQEHSHUFVWpVLLG W
3. $VW P N|GpVHDXWRPDWLNXVDQPHJNH]G GLNpVDVWpV 15 percig tart (Combi 2).
MEGJEGYZÉS:
+DDVWpVLIRO\DPDWDODWWNLQ\LWMDD]DMWyWDNNRUD VW NLNDSFVRO $ VWpV IRO\WDWiViKR] ]iUMD EH D] DMWyW $
VWpVLLG OHWHOWHNRUDPLNURKXOOiPpVDJULOONLNDSFVROpVH]WHJ\FVHQJ KDQJMHO]L
$PLNURKXOOiPpVJULOONRPELQiFLyV]HPPyGEDQDWHOMHVtWPpQ\EHiOOtWiVDpVDVWpVLLG DGGLJYiOWR]WDWKDWy
PHJDPHGGLJDVW PLNURKXOOiP~]HPPyGEDQGROJR]LN
Downloaded From Microwave-Manual.com Manuals
11
A
EMM2015
-DYDVODWRNJULOOHOW|UWpQ VWpVKH]
0LQGHQ pOHOPLV]HUW D JULOOUiFVUD NHOO KHO\H]QL DPHO\ DOi HJ\ HGpQ\W NHOO KHO\H]QL KRJ\ D NLFVHSHJ V]DIWRW
IHOIRJMDpVPLQLPiOLVUDFV|NNHQWVHDV]HQQ\H] GpVW0LQGHQpWHOWDI ]pVIpOLGHMpEHQPHJNHOOIRUGtWDQL
Étel
Mennyiség
Pirítós
Sajtos pirítós
2 szelet
4 szelet
,G
V]NVpJOHW
Megjegyzés
4-5 perc
6-7 perc
4-5
perc
a
pirításhoz,
2
perc
a
sajt
HOV]tQH] GpVpKH]
Javaslatok mikrohullámmal és grillel való sütéshez
Étel
Bacon
Marhasült
(csontos)
Sertéssült
(vesepecsenye)
Sertés szelet
(aprított)
Mennyiség
Teljesítmény
beállítás
100 g
900 g
Combi 3
Mikrózás csak 800 W
7-9 perc
25 perc
900 g
Combi 2
5-6 perc
2-3 (450 g)
Combi 2
20-25 perc
450 g
Combi 1
15-20 perc
Olajjal kenje meg. Sóval,
borssal,
paprikával
800 g
4 (200 g)
Combi 1
Combi 2
25-30 perc
12-15 perc
I V]HUH]]H
csak 450 g
2 (350 g)
Combi 1
Combi 3
10-15 perc
22-24 perc
6WpVLLG
Megjegyzés
Olajjal kenje meg. Sóval,
ERUVVDO
I V]HUH]]H
6WpV
után 15-20 percig hagyja
állni.
Olajjal kenje meg. Sóval,
borssal,
paprikával
I V]HUH]]H
Csirke, hosszában
félbevágott
Lábszár, combok
Fagyasztott
hamburger
Kolbászok
Halszelet
Olajjal kenje meg. Sóval,
ERUVVDOI V]HUH]]H
Fagyasztott
burgonya,
Hasé lebarnítva
2 (150 g)
Combi 2
16-18 perc
Mikrohullám- és grillteljesítmény fokozatok
Szimbólum
Beállítás
Mikrohullámú teljesítmény
Grill teljesítmény
Grill
0W
1000 W
Combi 1
300 W
1000 W
Combi 2
450 W
1000 W
Combi 3
600 W
1000 W
Downloaded From Microwave-Manual.com Manuals
12
A
EMM2015
Felolvasztási tudnivalók 180 W beállításnál
Néhány ételfajta (kenyér, gyümölcs) felolvasztása jobb eredményt ad ezen a 180 W teljesítményen való
felolvasztáskor.
Étel
(O
NpV]tWpV
,G
V]NVpJOHW
ÈOOiVLG
180 W-on
Kenyér
.LVPpUHW HJpV]NHQ\pU
Mikrohullámálló rácsra vagy
8-10 perc
10-15 perc
10-13 perc
10 perc
45-60 mp
45-60 mp
1-1,5 perc
5 perc
5 perc
5 perc
Távolítsa el a csomagolást és tegye
tányérra.
Távolítsa el a csomagolást és tegye
tányérra.
Távolítsa el a csomagolást és tegye
tányérra.
Távolítsa el a csomagolást és tegye
tányérra.
9-11 perc
15-30 perc
9-11 perc
15-30 perc
7-9 perc
15-30 perc
7-9 perc
15-30 perc
Távolítsa el róla a fóliát és tegye tányérra.
3-4 perc
5-10 perc
Egy rétegben helyezze lapos tányérra.
5-6 perc
5-10 perc
Egy rétegben helyezze lapos tányérra.
7-8 perc
5-10 perc
7DNDUMDOHWiQ\pUUDO0HOHJtWVHHO 7-8 perc
5-10 perc
SDStUW|U|ON|] UHWHJ\H$IHOROYDV]WiV
1DJ\PpUHW V]HOHWHOW
félidejében fordítsa meg.
Mikrohullámálló rácsra vagy
kenyér
SDStUW|U|ON|] UHWHJ\H$IHOROYDV]WiV
félidejében fordítsa meg.
2 szelet
1 zsemlye
2 zsemlye
7HJ\HSDStUW|U|ON|] UH
7HJ\HSDStUW|U|ON|] UH
7HJ\HSDStUW|U|ON|] UH
Sütemények és tészták
Torta (450 g)
Sajtos sütemény (450 g)
Pite (450 g)
Tészta (450 g)
Vaj
250 g (1 csomag)
Gyümölcs
Puha bogyós gyümölcs
(225 g)
Puha bogyós gyümölcs
(450 g)
Tányéros készétel
450 g
os (800 W) mikrohullámú teljesítményen
3-4 percig.
Zöldségek
) ]pVHO WWQHPV]NVpJHVD]|OGVpJHNHW
felolvasztani. Indokolt esetben minden
zöldség felolvasztható 100 %-on (800 Won).
Downloaded From Microwave-Manual.com Manuals
13
A
EMM2015
Mikrózási tanácsok
•
Méz felolvasztása±+DD]YHJEHQOpY Pp]
kikristályosodott, akkor vegye le az üveg
tetejét, majd az üveget helyezze a mikróba 2
percre, közepes teljesítmény beállításával.
•
Csokoládé felolvasztása – 100 g csokoládét
darabolja fel, helyezze egy mély tálba és
magas teljesítménnyel 1-2 percig olvassza,
majd jól keverje meg.
•
Vaj puhítása, vagy felolvasztása – Az
olvasztást néhány másodpercig magas
teljesítménnyel végezze. Ha csak meg akarja
puhítani, akkor alacsonyabb teljesítményt
állítson be.
• Tésztát, kenyeret és hasonlókat közvetlenül a
kenyértartó kosárban is, vagy szalvétán is
felolvaszthat.
•
Kenyér frissítése, melegítése – Néhány
másodpercig végezze, közepes teljesítmény
beállításával.
• Ha a fagyasztott ételt a csomagolásában
•
•
0LQGLJWDUWVDD PLNUyW WLV]WiQ OHKHW OHJ NHUOMH
el az ételek kifröccsenését és ne felejtkezzen
HO PHJWLV]WtWDQL D IRUJyWiQ\pUW YDODPLQW D VW
belsejét.
•
0LNUy]iVQiO UpV]HVtWVH HO Q\EHQ D IHG YHO
UHQGHONH] NHUHNYDJ\RYiOLVHGpQ\HNHW
•
1H
KDV]QiOMRQ
IpP
YDJ\
IpPGtV]tWpV
HGpQ\HNHW %L]RQ\RV P DQ\DJ HGpQ\HN D]
étel forróságától megolvadhatnak.
•
) ]pVNRU WDNDUMD OH D] pWHOHNHW +DV]QiOMRQ
HUUH D FpOUD YHJIHG W WiQ\pUW YDJ\ ]VtUiOOy
papírt.
PHOHJtWLIHODNNRUDFVRPDJROiVWHO V]|UNLNHOO
nyitni. Ha a csomagolás fémet, vagy
fémdekorációt is tartalmaz, akkor azt csak
akkor nem kell eltávolítani, ha a gyártó
kifejezetten erre a célra ajánlja. Távolítsa el a
fém zárókapcsot is.
• Kisebb darab alumínium fólia használható a
mikróban olyan részek burkolására, ahol a
W~OI ]pVHONHUOpVHDFpOSOFVLUNHOiE
•
•
PpUHW HNUH
IHOYiJQL
$]
edényt mindig a készülék közepére helyezze.
• Az étel
egyenletesen
fog
elkészülni,
ha
LG QNpQWPHJNHYHULYDJ\PHJIRUJDWMD
•
0LQGLJ U|YLGHEE I ]pVL LG W iOOtWVRQ EH PLQW
amennyit a receptkönyvek írnak, hogy a
W~OI ]pVW HONHUOMH $ QDJ\REE PHQQ\LVpJHN
KRVV]DEEI ]pVLLG WLJpQ\HOQHN
• Zöldségek párolásánál ne használjon vizet,
vagy ha kell, akkor csak kis mennyiséget.
• .HYHVHEE VyW pV I V]HUW KDV]QiOMRQ PLQW
DPHQQ\LWDKDJ\RPiQ\RVI ]pVQpOV]RNRWW
•
•
•
•
D
N|QQ\
Gyümölcslé – A citrusfélék több levet adnak,
teljesítménnyel melegítik.
•
szélére tegye és ha lehet, próbálja a nagyobb
NLVHEE
KpMiQDN
KD IDFVDUiV HO WW PiVRGSHUFLJ PDJDV
$ QDJ\REE VRYiQ\ GDUDERNDW D K iOOy HGpQ\
GDUDERNDW
)RNKDJ\PD
eltávolításához – 3-4 gerezd fokhagymát 15
másodpercig
melegítsen
magas
teljesítményen. Préselje össze az egyik végét,
amíg a fokhagyma gerezd kipattan a héjából.
) V]HUH]]HQNpV EE
$ I ]pV EHIHMH]pVH XWiQ KDJ\MD iOOQL D] pWHOW
hogy jobb eredményt kapjon.
0LQGLJW ]IRUUyOHJ\HQD]pWHOPLHO WWWiODOMD
0LQGLJ KDV]QiOMRQ HGpQ\IRJyW YDJ\ NHV]W\ W
DPLNRUD]HGpQ\WNLYHV]LDNpV]OpNE O
Downloaded From Microwave-Manual.com Manuals
14
=DENiVD I
]pVH
– A zabkása a szervírozó
WiQ\pUEDQ LV HONpV]tWKHW pV QHP UDJDG OH D
lábos aljára. Kövesse a gyártó útmutatásait.
A
EMM2015
Tisztítás és ápolás
$VW QHNPLQGLJWLV]WiQDNNHOOOHQQLH$]pWHOPDUDGYiQ\RNHOQ\HOLNDPLNURKXOOiP~HQHUJLiWpVHOpJKHWQHN
(]FV|NNHQWLDVW KDWpNRQ\ViJiWpVNHOOHPHWOHQV]DJRNDWHUHGPpQ\H]KHW 1H SUyEiOMD PHJ VDMiW PDJD D
VW MDYtWiViWYDJ\EHiOOtWiViW$PHJKLEiVRGRWWNpV]OpNMDYtWiViWEHOHpUWYHDFVDWODNR]yYH]HWpNFVHUpMpW
is, csak a jótállási jegyben megjelölt szerviz végezheti.
hJ\HOMHQ DUUD KRJ\ EiUPLO\HQ WLV]WtWiVL PXQND HO
WW D PLNURKXOOiP~ VW
OH OHJ\HQ YiODV]WYD D]
elektromos hálózatról!
Tartozékok tisztítása (forgótányér és támasz)
$ VW WpUE O W|UWpQ HOWiYROtWiVXN XWiQ PRVRJDWyV]HUHV Yt]EHQ WLV]WtWVD PHJ D WDUWR]pNRNDW $ IRUJyWiQ\pU
támaszát óvatosan kell tisztítani.
$VW WpUpVDIRUJyWiQ\pUQDJ\RQIHOIRUUyVRGKDWH]pUWDKDV]QiODWXWiQQHpULQWVHPHJD]RQQDO
%HOV WLV]WtWiV
$ VW ROGDOIDODLQ D] DMWy W|PtWpVpQ pV D] DMWy IHOOHWpQ YLVV]DPDUDGy V]HQQ\H] GpVHN HOQ\HOLN D
PLNURKXOOiP~HQHUJLiWH]iOWDOFV|NNHQWLNDVW KDWpNRQ\ViJiWV WNiURVtWKDWMiNDVW EHOVHMpWLV
$V]HQQ\H] GpVHOWiYROtWiViKR]KDV]QiOMRQNHYpVIRO\pNRQ\PRVyV]HUWPHOHJYL]HWpVSXKDUXKiW
62+$
1(
+$6=1È/-21
)e06=È/$6
7,6=7Ë7Ï
0$5Ï
3È51È7
7,6=7Ë7Ï6=(57
$
.(5(6.('(/0,
0,.52+8//È0Ò
6h7
6h7
7,6=7Ë7Ï7
(*<(7/(1
9$*<
5e6=e1(.
$
TISZTÍTÁSÁHOZ SEM.
$PDNDFVV]HQQ\H] GpVHNHOWiYROtWiViKR]SHUFLJIRUUDOMRQHJ\FVpV]HYL]HWDPLNUyEDQ
62+$
6h7
1(
+$6=1È/-21
)(/h/(75
.e67
/7g57e1
9$*<
%È50,/<(1
0È6
(6=.g=7
$
6=(11<(=
'e6
(/7È92/Ë7È6È+2=
$ VW EHQ OpY NHOOHPHWOHQ V]DJRN HOWiYROtWiViKR] D N|YHWNH] W DMiQOMXN WHJ\HQ HJ\ FVpV]H Yt]EH HY NDQiOFLWURPOHYHWpVD]WSHUFLJIRUUDOMDDPLNUyEDQ
.OV WLV]WtWiV
$ NH]HO SDQHO WLV]WtWiVDNRU Q\LVVD NL D] DMWyW (]]HO HONHUOKHWL D YpOHWOHQV]HU EHNDSFVROiVW $ NOV
felületeket enyhe mosogatószeres meleg vízzel tisztítsa meg egy puha ruha segítségével. A
mosogatószeres ruhával való letörlés után tiszta vizes ruhával, majd száraz ruhával törölje át a felületeket.
Ablaktisztító, vagy hasonló konyhai tisztító-spray is használható az ajtó ablakához. Soha ne használjon
maró, karcoló vegyszert, mert károsíthatja a felületet. A károsodás elkerülése érdekében fokozottan ügyelni
NHOODUUDKRJ\DV]HOO ] Q\tOiVRNEDYt]VHPPLO\HQN|UOPpQ\HNN|]|WWQHMXWKDVVRQEH
Tisztítás és ápolás (grill)
$ VW KDV]QiODWD VRUiQ D JULOO I W EHWpWUH ]VtU pV PiV V]HQQ\H] DQ\DJ VSULFFHOKHW Ui 9iUMD PHJ DPtJ D
NpV]OpN EHOVHMH NLK O PDMG D N|YHWNH] KDV]QiODWRW PHJHO ] HQ W|U|OMH OH D I W EHWpWUH IU|FFVHQW
V]HQQ\H] GpVHNHW $ I W EHWpWUH UiUDNyGy V]HQQ\H] GpVHN D KDV]QiODW VRUiQ NHOOHPHWOHQ V]DJRNDW pV
füstöt okozhatnak.
Downloaded From Microwave-Manual.com Manuals
15
A
EMM2015
ÜZEMZAVAROK - PÓTALKATRÉSZEK
+D D NpV]OpN P
N|GpVpEHQ KLEiW pV]OHO DNNRU HOOHQ
UL]]H D] DOiEELDNEDQ OHtUWDNDW PLHO
WW D
szervizhez fordul.
+DDVW
•
•
•
•
•
QHPLQGXOHO
(OOHQ UL]]HKRJ\DNpV]OpNHWFVDWODNR]WDWWDHD]HOHNWURPRVKiOy]DWUD
(OOHQ UL]]HKRJ\PHJIHOHO HQEHQ\RPWDHDFVDWODNR]yGXJyWDNRQQHNWRUED
+DDFVDWODNR]yGXJyEDQOpY EL]WRVtWpNNDOYDQSUREOpPDFVHUpOWHVVHNLHJ\~MUD
(OOHQ UL]]HKRJ\YDQHiUDPDIDOLFVDWODNR]yDOM]DWEDQYDJ\QHPROGRWWHOHDODNiVI EL]WRVtWpND
(OOHQ UL]]H KRJ\ XJ\DQDEEDQ D W|EE IpU KHO\HV FVDWODNR]y DOM]DWEDQ QHP ]HPHOH PiV NpV]OpN
DPHO\QDJ\WHOMHVtWPpQ\ •
(OOHQ UL]]HDODNiVI EL]WRVtWpNiW
+DDPLNURKXOOiPQHPP
•
•
•
N|GLN
(OOHQ UL]]HDEHiOOtWyJRPERNDWKRJ\KHO\HVHD]RNEHiOOtWiVD
(OOHQ UL]]HKRJ\DEHiOOtWiVWDKDV]QiODWL~WPXWDWyOHtUiVDV]HULQWYpJH]WHH
(OOHQ UL]]H KRJ\ PHJIHOHO HQ EH]iUWDH D] DMWyW KD pWHOPDUDGYiQ\RN UDJDGQDN D] DMWyVW WpU ]iUyGy
IHOOHWpUH DNNRU D] LV DNDGiO\R]KDWMD D PHJIHOHO ]iUyGiVW DPL D PLNUy P N|GpVNpSWHOHQVpJpW
eredményezheti.)
+DDIHQWLHOOHQ U]pVHNXWiQVHPPHJIHOHO DNpV]OpNP N|GpVHDNNRUIRUGXOMRQDMyWiOOiVLMHJ\EHQNLMHO|OW
szervizhez.
Fontos! Ha hívja a szervizt, akkor a bejelentkezéskor az alábbi adatokat adja meg a szerviznek:
1.
2.
3.
4.
5.
6.
Az Ön nevét, címét, postai irányítószámát:
Az Ön telefonszámát:
A hiba pontos leírását:
A készülék modellszámát:
A készülék sorozatszámát:
A készülék vásárlásának dátumát:
Azért, hogy az azonosító adatok mindig kéznél legyenek, javasoljuk, hogy írja be azokat az alábbi sorokba:
Modellszám:
EMM20017
Sorozatszám:
………………………
Vásárlási dátum:
………………………
+D D NpV]OpN PpJ MyWiOOiVL LG
PLHO
Q EHOO YDQ D IHQWLHNEHQ UpV]OHWH]HWW HOOHQ
U]pVHNHW HO NHOO YpJH]QL
WW KtYMD D V]HUYL] V]DNHPEHUpW +D D V]DNHPEHU NLKtYiViUD QHP D NpV]OpN PHFKDQLNXV YDJ\
elektromos hibája miatt kerül sor, akkor annak költsége a vásárlót terheli.
Pótalkatrészek
3yWDONDWUpV]D]$ONDWUpV]HOOiWiVWyOV]HUH]KHW EH
Jótállás
A jótállási feltételeket és kötelezettségeket a készülékhez mellékelt jótállási jegy tartalmazza.
9HY
V]ROJiODW%XGDSHVW(U]VpEHWNLUiO\Qp~W
Forgalmazó: Electrolux Lehel Kft. Háztartási Készülékek
1142 Budapest, Erzsébet királyné út 87.
Downloaded From Microwave-Manual.com Manuals
16
j
EMM2015
Obsah
' tYHQHå]DþQHWHPLNURYOQQRXWURXEXSRXåtYDW
4
%H]SHþQRVWQtSRN\Q\
4
4
5
5
6
6
%H]SHþQRVWQtSRN\Q\S LSRXåLWtJULOX
=NRXãHQtYKRGQRVWLNXFK\ VNpKRQiGREt
%H]SHþQRVWSRWUDYLQ
1iYRGQDSRXåLWtQiGREtDS tVOXãHQVWYtWURXE\
Technické údaje
3 tSUDYDSURXåtYiQt
- Vybalení
Instalace
3 LSRMHQtQDHOHNWULFNêUR]YRG
(OHNWULFNpS LSRMHQt
7
7
7
7
7
Jak provozovat vaší mikrovlnnou troubu
8
8
,QVWDODFHRWRþQpKRWDOt H
8
- Ovládací panel
9
3 tSUDYDSRNUP YPLNURYOQQpWURXE
10
3U YRGFHQDVWDYRYiQtYêNRQXPLNURYOQQpWURXE\ 10
3 tSUDYDSRNUP QDJULOX
11
3RSLVDIXQNFHMHGQRWOLYêFKGtO
3 tSUDYDSRNUP PLNURYOQQêPRK HYHPV
grilem (kombinace)
'RSRUXþHQtSURSRXåLWtJULOX
11
12
'RSRUXþHQtSURSRXåLWtPLNURYOQQpKR
ÒGUåEDDþLãW QtJULOX
12
12
13
14
15
15
15
15
15
Servis a náhradní díly
16
=iUXþQtSRGPtQN\
17
Záruka, servis a náhradní díly
18
RK HYXVJULOHP
6WXSQ
YêNRQXPLNURYOQQpKRRK HYXDJULOX
1iYRGQDUR]PUD]RYiQtS LYêNRQX:
5DG\SURSRXåLWtPLNURYOQQpWURXE\
3pþHDþLãW QtWURXE\
ýLãW
QtS tVOXãHQVWYtRWRþQêWDOt DYR]tN
ýLãW
QtLQWHULpUX
ýLãW
QtH[WHULpUX
3
Downloaded From Microwave-Manual.com Manuals
j
EMM2015
%ODKRS HMHPHYiPNQiNXSXYDãtQRYpPLNURYOQQp
b
' NXMHPHYiPåHMVWHVLY\EUDOLSURGXNWILUP\(OHFWUROX[-VPHS HVY GþHQLåHVKOHGiWHWXWRQRYRX
PLNURYOQRXWURXEXXåLWHþQRXDåHYiPEXGHYêWHþQêPSRPRFQtNHP%XGHWRY\åDGRYDWQ MDNêþDVVH
QDXþLWYãHFKQ\IXQNFHDPRåQRVWLYDãHKRQRYpKRNXFK\ VNpKRSRPRFQtNDVWHMQ MDNRMVWHQDWR]Y\NOtX
NDåGpKRQRYpKRNXFK\ VNpKRVSRW HELþH
' tYHQHå]DþQHWHPLNURYOQQRXWURXEXSRXåtYDWWURXE\
3 HþW WH VL SHþOLY FHOê QiYRG N REVOX]H D XMLVW WH VH åH S L SRXåtYiQt YDãt QRYp PLNURYOQQp WURXE\
(OHFWUROX[SRVWXSXMHWHSRGOHQ MDGRViKOLMVWHWDNFRQHMOHSãtFKYêVOHGN -HG OHåLWpDE\WDWRS tUXþNDE\ODXFKRYiYiQDSURQiVOHGXMtFtSRXåLWtVSROXVHVSRW HELþHP9S tSDG
SURGHMHWURXE\MLQpPXYODVWQtNRYLQHERNG\E\MVWHVHQ NG\VW KRYDOLYåG\VHSURVtPXMLVW WHåHWDWR
S tUXþNDMHYEOt]NRVWLVSRW HELþHLQDQRYpPPtVW DDE\LMHMtQRYêYODVWQtNVHPRKOVVH]QiPLWVMHMtP
obsahem.
%H]SHþQRVWQtSRN\Q\
•
9HVWDY QpVStQDþHEH]SHþQRVWQtKREORNRYiQt ]DEUD XMt SURYR]RYiQt PLNURYOQQp WURXE\ NG\å MVRX GYt ND
VSRW HELþHRWHY HQD
•
1HPDQLSXOXMWH V QLPL D DQL VH QHSRNRXãHMWH SURYR]RYDW WURXEX V RWHY HQêPL GYt N\ 3URYR] V RWHY HQêPL
GYt N\P åHPtW]DQiVOHGHNY\VWDYHQtVH]i HQtPLNURYOQQpHQHUJLH
•
1HGRYROWH DE\ VH QD SRYUFKX W VQ Qt GYH t QDVKURPiåGLO\ ]E\WN\ SRNUP QHER þLVWtFtKR SURVW HGNX 9L]
þiVW3pþHDþLãW QtNGHMVRXSRN\Q\SUR~GUåEXXYHGHQ\
•
•
1HGRYROWHSRXåtYDWSRãNR]HQRXWURXEXGRGRE\QHåMHRSUDYHQDNYDOLILNRYDQêPVHUYLVQtPWHFKQLNHP
-H RE]YOiãW G OHåLWp DE\ VH GYt ND WURXE\ GRE H ]DYtUDOD D QHGRãOR N SRãNR]HQt GYt HN
SRNURXFHQt ]iY V D ]iPN SRãNR]HQt QHER QHVSROHKOLYRVW W VQ Qt GYH t QHER SRYUFKX
YODVWQtKRW VQ Qt
•
9 åiGQpP S tSDG VH QHSRNRXãHMWH WURXEX RSUDYLW VYpSRPRFt 3RNXV\ R RSUDYX QH]NXãHQêPL RVREDPL
PRKRXYpVWNH]UDQ QtRVREQHERNYiåQpPXSRãNR]HQtWURXE\9åG\NRQWDNWXMWHYiãPtVWQtDXWRUL]RYDQê
servis.
•
1LNG\ QHVQtPHMWH YQ Mãt NU\W GYt ND QHER RYOiGDFt SDQHO 7DNRYp MHGQiQt YiV P åH Y\VWDYLW QHEH]SHþt
GRW\NXY\VRNpKRQDS Wt
•
•
,QVWDOXMWHUHVSXPtVW WHWXWRWURXEXSRX]HYVRXODGXVSRN\Q\SURLQVWDODFLXYHGHQêPLYWpWRS tUXþFH
7HQWR VSRW HELþ SRXåtYHMWH SRX]H N ~þHO P NH NWHUêP MH XUþHQ D MDN MH SRSViQR Y WpWR S tUXþFH 9
PLNURYOQQp WURXE QHSRXåtYHMWH S tSUDYN\ ]S VREXMtFt NRUR]L 7HQWR W\S WURXE\ MH VSHFLiOQ XUþHQ SUR
RK HY YD HQt D UR]PUD]RYiQt SRWUDYLQ 1HQt XUþHQ SUR SU P\VORYp ODERUDWRUQt QHER NRPHUþQt SRXåLWt
.DåGpWDNRYpSRXåLWtE\P OR]DQiVOHGHN]WUiWX]iUXN\QDWHQWRVSRW HELþ
•
1HSRXåtYHMWH WURXEX SUi]GQRX -HVWOLåH QHQt Y WURXE SRWUDYLQD QHER YRGD NWHUi DEVRUEXMH Y\]D RYDQp
•
•
•
9S tSDG åHWURXEDMHSRXåtYiQDG WPLMHQXWQp]DMLVWLWGRKOHGGRVS OêFK
PLNURYOQQp]i HQtP åHVHSRãNRGLWPLNURYOQQê]i LþPDJQHWURQ
1HVNODGXMWHVSRW HELþYHYHQNRYQtPSURVW HGt1HSRXåtYHMWHKRYEOt]NRVWLYRG\
1HSRNRXãHMWHVHVXãLWYWURXE SUiGORQHERSDStU7\WRPDWHULiO\VHPRKRXY]QtWLW
1HSRXåtYHMWH YQLW Qt SURVWRU WURXE\ SUR VNODGRYiQt 1HQHFKiYHMWH YêUREN\ ] SDStUX NXFK\ VNp SRW HE\
QHERSRWUDYLQ\YWURXE NG\åMLQHSRXåtYiWH
%H]SHþQRVWQtSRN\Q\S LSRXåLWtJULOX
1.
3U KOHGRYp VNOR GYH t VH P åH UR]EtW MHVWOLåH
E KHPJULORYiQtQDQ MY\VW tNQHYRGD
2.
3 L
YNOiGiQt
D
Y\MtPiQt
SRWUDYLQ
3.
1LNG\
VH
QHGRWêNHMWH
NRYRYêPL
þiVWPL
SU KOHGRYpKR RNQD GYH t D WR MDN ] YQLW Qt WDN L ]
]
WURXE\
YQ MãtVWUDQ\S LYNOiGiQtQHERY\QGiYiQt SRNUP
SRXåtYHMWH YåG\ UXNDYLFH 1iGREt VH S L JULORYiQt
] WURXE\ 9QLW Qt VWUDQD GYH t D WURXE\ MVRX RK iWp
RK tYi QD Y\VRNRX WHSORWX D PRKOR E\ GRMtW N
na
SRSiOHQt 3UR PDQLSXODFL V RWRþQêP WDOt HP þL
SR]RUQRVWL S L PDQLSXODFL V JULORYDQRX SRWUDYLQRX
YR]tNHP SRXåtYHMWH WDNp UXNDYLFH QHER VH WDNp
YWURXE RK HMtQDY\VRNRXWHSORWX
4
Downloaded From Microwave-Manual.com Manuals
vysokou
teplotu,
proto
dbejte
zvýšené
j
EMM2015
4.
YDãtPLNURYOQQpWURXE\'Yt NDQHPDMt]D~þHOKHUPHWLFN\
1LNG\QHYNOiGHMWHUR]SiOHQêRWRþQêWDOt
QHERQiGREtGRVWXGHQpYRG\DQHVQDåWHVHMH
prudce ochlazovat.
5.
troubu uzavírat.
•
1HSRNRXãHMWH VH VLORX RWiþHW RWRþQêP WDOt HP XYQLW
WURXE\0
1HGiYHMWHåiGQpS HGP W\QDYUãHNWURXE\3 LJULORYiQtVH
•
SRYUFKRK HMHQDY\VRNRXWHSORWXDSRORåHQpS HGP W\E\VH
åHWHWtP]S
S L
-HVWOLåH
VRELWMHMtYiåQpSRãNR]HQt
PLNURYOQQpP
RK HYX
SRXåLMHWH
NRYRYp
QiGREt WDN VH EXGH XYQLW WURXE\ REY\NOH MLVN LW
PRKO\WHSOHP]QLþLW-H]FHODQRUPiOQtåHNROHPGYt HN
=DWDYWHSUREtKDMtFtRK HYD]NRQWUROXMWHQiGREt%XGHWH
WURXE\]DSURYR]XXQLNiSiUDQHERåHGRFKi]tN]DPOåHQt
OLSRNUDþRYDWYS tSUDY
GYt HNQHERGRNRQFHNWYRUE YRGQtFKNDSHNSRGGYt N\
Jedná se pouze o kondenzaci vody, která je teplem vypuzená
]SRWUDYLQDQLMDNWtPQHRYOLY XMHIXQNþQRVWDEH]SHþQRVW
WURXEXYiåQ
•
SRNUPXE
KHPMLVN HQtP
åHWH
SRãNRGLW
9 QXMWH]YOiãWQtSR]RUQRVWWRPXDE\MVWHYåiGQpP
S tSDG
QHEORNRYDOLY
WUDFtRWYRU\XPtVW
QpQDKR H
vzadu, dole a po stranách trouby.
=NRXãHQtYKRGQRVWLNXFK\ VNpKRQiGREt
•
8PtVW WHQiGREtGRPLNURYOQQpWURXE\VSROXVHVNOHQLFt
plastikové nádobí pro potraviny s vysokým obsahem
GR SRORYLQ\ QDSOQ
QRX YRGRX 2K tYHMWH ML SR GREX WXNX QHER FXNUX 7HQWR W\S SRWUDYLQ VH RK HMH QD
PLQXW\ S L YêNRQX : -HVWOLåH VH YiP
Y\VRNRX WHSORWX D SODVWRYp REDO\ E\ VH PRKO\ ]DþtW
QiGREt ]Gi KRUNp QHP
SRXåtYDW -HVWOLåH VH YiP
1LNG\ QHQHFKiYHMWH WURXEX EH] GR]RUX NG\å Y Qt
WRYQêRK HYDOH
RK tYiWH QHER YD tWH SRNUP\ XORåHQp Y SDStURYêFK
SODVWRYêFK QHER MLQêFK KR ODYêFK PDWHULiOHFK .G\å
åHWHMHSRXåtYDWSURRS
SRXåLWtYPLNURYOQQpWURXE
]SR]RUXMHWHNRX XQLNDMtFt]WURXE\WDNMLQHRWYtUHMWHDOH
9HOLFH YKRGQp SUR SRXåLWt MVRX SDStURYp XEURXVN\
YRVNRYêSDStUSDStURYpXW
UN\NHOtPN\NUDELþN\WiFN\
D NDUWyQ\ ]PUD]HQêFK SRWUDYLQ 9åG\ VH S HVY
•
•
QH SUR YD HQt 0iOL SRNRMRYRX WHSORWX MH YKRGQp SUR
]GiYODåQpP
•
deformovat nebo tavit.
OL E\ MVWH MH SUR S tSUDYX
SRNUP Y PLNURYOQQp WURXE
GþHWH
WURXEX Y\SQ
WH D SRþNHMWH GR GRE\ QHå WYRUED NRX H
ustane.
• Kovové nádobí nebo nádobí s kovovými díly a
zda jsou plné potravin, aby mohly absorbovat energii a
R]GREDPL QHVPt EêW Y PLNURYOQQp WURXE
QHGRFKi]HORWDNNS HK tYiQt
QHQtOLYêVORYQ
7DNp PQRKR W\S
SODVWRYêFK WDOt N WiFN
ãiON D
•
krabic, spolu s plastovými obaly zmrazených potravin
O]H Y PLNURYOQQp WURXE
MtEêWYWURXE
U\QDS ODKYH
)
SRXåtYiQ\SURYD HQtPLNURYOQQêP
RK HYHP
SRXåtYDW 9åG\ GEHMWH QiYRGX
YêUREFHEXGHWHOLSODVWSRXåtYDWYWURXE
2EDO\QHER]iVREQtN\VSHYQêPLX]iY
QHVP
SRXåtYiQR
XUþHQRSURWRWRSRXåLWt
1HSRXåtYHMWH
%H]SHþQRVWSRWUDYLQ
•
•
1LNG\ QHRK tYHMWH Y WURXE
SRWUDYLQ\ Y SOHFKRYNiFK
4.
3R RK iWt SRQHFKHMW
9åG\S HQGHMWHSRWUDYLQXGRYKRGQpQiGRE\
WURXE
0LNURYOQQi WURXED QHQt YKRGQi SUR VPDåHQt QD WXNX
WURXE\RS
e nádobu s kapalinou chvíli
v
RGSRþLQRXW SRWp ML S HG RSDWUQêP Y\QGiQtP ]
W]DPtFKHMWH
SURWRåH QHO]H GRE H NRQWURORYDW WHSORWX ROHMH D WtP E\
•
PRKORGRFKi]HWNQHEH]SHþQêPVLWXDFtP
•
3RSFRUQ O]H S LSUDYRYDW SRX]H
Y
QiGREt
N
XUþHQpPX QHER Y RULJLQiOQtP EDOHQt NWHUp MH YêVORYQ
XUþHQRSURPLNURYOQQêRK HY3 tSUDYXSRSFRUQXP
NWHUp
WURXE
MWH
WURXE
• Potraviny s pevnou sOXSNRXN
SURStFKHMWH
DE\
MVWH
]S
QDKURPDG
QRX
]DEUiQLO\
SiURX
SRG
UR]WUåHQt
W\SLFNpS tNODG\SRWUDYLQNWHUpPXVtEêWSURStFKDQp
E
KHP
FHOi
YHMFH
S tSUDY\
H[SORGRYDW
YH
QHRK tYHMWH
3URWR
YåG\
WH åORXWHN S LNORSWH YtNR D SR S tSUDY
QHFKHMWHMHãW
MHM
PLQXWXS LNORSHQp
Poznámka:
• 1HSRNRXãHMWH VH VLORX RWiþHW RWRþQêP
WURXE\0
Qt 2K tYiWHOL Y WURXE
QDS tNODG
SRYUFKHP
-DEOND EUDPERU\ NX HFt MiWUD D YDMHþQp åORXWN\ MVRX
8SR]RUQ
MDNR
H[SORGRYDW SURWR MH QLNG\ Y WURXE
SURStFKQ
åtQHERSRGPHPEUiQRX
WDN
SRWUDYLQ\
1 NG\L]WUDFHQiYHMFHYDMtþNDEH]VNR iSN\PRKRXY
YåG\SRGGRKOHGHP
VREHQêP
1
VNR iSFH QHER X]DY HQp ]DYD RYDFt VNOHQLFH PRKRX Y
WRPX
NDSDOLQ\ MDNR QDS •
-HVWOLåH
åHWHWtP]S
S L
WDOt HP XYQLW
VRELWMHMtYiåQpSRãNR]HQt
PLNURYOQQpP
RK HYX
SRXåLMHWH
NRYRYp
QiGREt WDN VH EXGH XYQLW WURXE\ REY\NOH MLVN LW
SROpYN\ RPiþN\ D QiSRMH D NWHUp VH PRKRX RK iW QDG
teplotu varu bez typického projevu varu (bubláním). Jedná
=DWDYWHSUREtKDMtFtRK HYD]NRQWUROXMWHQiGREt%XGHWH
VH R W]Y XWDMHQê YDU D WHQ VH SURMHYXMH RNDPåLWêP
OLSRNUDþRYDWYS tSUDY
prudkým varem.
Aby se zabránili tomuto efektu,
postupujte dle tohoto návodu:
1. 1HSRXåtYHMWH QiGRE\ V RVWUêPL YQLW QtPL KUDQDPL D
úzkými hrdly.
2. 3RNUP\QHS HK tYHMWH
3. =DPtFKHMWHNDSDOLQXY QiGRE S HG MHMtP YORåHQtP GR
WURXEXYiåQ
WURXE\
2S
WRYQ
ML
SOiQRYDQpGRE\RK HYX
]DPtFKHMWH
Y
SRORYLQ
GRE\
•
SRNUPXE
KHPMLVN HQtP
åHWH
SRãNRGLW
'EHMWH DE\ QHGRFKi]HOR N XFSiQt YHQWLODþQtFK RWYRU
XPtVW
QêFK QD KRUQt VSRGQt ]DGQt D RERX ERþQtFK
stranách trouby.
1HSRXåtYHMWHWXWRWURXEXSURNRPHUþQt~þHO\
7DWR PLNURYOQQi WURXED MH Y\UREHQD D XUþHQD SRX]H
SURSRXåLWtYGRPiFQRVWHFK
'RGUåXMWHWHQWRQiYRGNSRXåLWt
5
Downloaded From Microwave-Manual.com Manuals
j
EMM2015
1iYRGQDSRXåLWtQiGREtDS tVOXãHQVWYtWURXE\
9HYDãtPLNURYOQQpWURXE P åHEêWSRXåtYiQDSRP UQ ãLURNiãNiODGUXK QiGREt
Y\UREHQêFK]U ]QêFKPDWHULiO $E\VWH]DEUiQLOLMDNSRãNR]HQtSRXåLWêFKSRP FHND
QiGREtWDNLYODVWQtWURXE\SRXåtYHMWHSRX]HW\GUXK\NWHUpMVRXSURNRQNUpWQt]S VRE
S tSUDY\GRSRUXþHQp6H]QDPYWDEXOFHE\OS LSUDYHQSURYDãtRULHQWDFL
9\EUDQêRK HY
Materiál
Nádobí
Mikrovlnný
RK HY
Keramika
a sklo
Porcelán
Kovy
RK HY
tvrzené sklo
ANO
ANO
a grilování
ANO
åiURY]GRUQpVNOR
ANO*1
ANO
ANO*1
sklo s kovovým
dekorem
NE
NE
NE
RORYQDWêN Lã iO
NE
NE
NE
bez kovového
dekoru
ANO
ANO
NE
ANO
ANO
ANO
ANO
NE
NE
NE
Pálená hlína*2
Plasty
Mikrovlnný
Grilování
teplovzdorné pro
mikrovlnné trouby
plastové obaly
ANO
NE
SHþtFtSiQYH
NE
ANO
NE
hliníkové fólie*3
ANO
ANO
ANO
ubrousky
ANO
NE
NE
voskový papír
ANO
NE
NE
NE
NE
NE
NE
ANO
ANO
RWRþQêWDOt
ANO
ANO
ANO
YR]tNWDOt H
ANO
ANO
ANO
ãiON\WDOt N\
Papír
' HYR
grilovací rošt
3 tVOXãHQVWYt
$121iGREtDS tVOXãHQVWYtYKRGQpSURSRXåLWt1(1iGREtDS tVOXãHQVWYtQHYKRGQpSURSRXåLWt
*1
*2
*3
3RX]HEH]NRYRYêFKVRXþiVWHN
3RX]HYS tSDG NG\JOD]XUDQHREVDKXMHNRY\
3R]QiPND+OLQtNRYRXIyOLLSRXåtYHMWHSRX]H]D~þHOHPVWtQ QtPLNURYOQQpKR]i HQtQDGE\WHþQp
PQRåVWYtP åH]S VRELWY]QLNHOHNWULFNpKRREORXNX
Technické údaje
&HONRYpUR]P U\
ãt NDPP
Hmotnost: 13.5kg
Objem:OLWU
Napájení: 230V, 50Hz
hloubka 376 mm
výška 285 mm
6SRW HEDHOHNWULFNpHQHUJLH
5R]P U\YQLW QtKRSURVWRUX
300W
3 tNRQPLNURYOQQpþiVWL
3 tNRQJULOX:
ãt NDPP
Výkon trouby
hloubka 292 mm
výška 195 mm
Výkon grilu 1000W
800W
9êNRQPLNURYOQQpþiVWL
6
Downloaded From Microwave-Manual.com Manuals
j
EMM2015
3 tSUDYDSURSRXåtYiQt
Vybalení
' OHåLWp
3R]QiPND .G\å WURXEX Y\EDOtWH ]NRQWUROXMWH åH
NGHNROLY Y NXFK\QL 8MLVW WH VH DOH åH MH WURXED
QHQtSRãNR]HQi=MLãW QpYDG\QHERFK\E MtFtGtO\MH
LQVWDORYiQDQDSORFKpPDYRGRURYQpPSRYUFKXDåH
W HEDFRQHMU\FKOHMLQDKOiVLWYDãHPXSURGHMFL9ODVWQt
Y WUDFt RWYRU\ WURXE\ D SURVWRU SRG WURXERX MH
PLNURYOQQi WURXED VRXþiVWL WURXE\ D S tVOXãHQVWYt
7XWR
WURXEX
P åHWH
XPtVWLW
SUDNWLFN\
GRVWDWHþQêDYROQêSURGREUpRGY WUiYiQt
mohou být zabaleny do ochranné fólie. Je-li tomu
WDN MH QXWQp ML S HG SRXåLWtP WURXE\ RGVWUDQLW
QRUP\((&3 HGSLVRUiGLRYpPUXãHQt((&
7HQWR
VSRW HELþ
VSO XMH
SRåDGDYN\
HYURSVNp
1HSRQHFKiYHMWH REDORYp PDWHULiO\ YROQ GRVWXSQp
PDOêPG WHPDE\VL V QLPL PRKOL KUiW 0RKOR E\ WR
EêWYHOLFHQHEH]SHþQp
3 LSRMHQtQDKODYQtHOHNWULFNêUR]YRG
0LNURYOQQi WURXED MH GRGiQD V NDEHOHP D ]iVWUþNRX
Instalace
1. 2GVWUD WH]GYt HNYãHFKQ\UHNODPQtVDPROHSN\
2. Troubu instalujte na plochou vodorovnou plochu.
pro 230V, 50Hz pro zásuvku se zemnícím kolíkem.
2FKUDQD ]HPQ QtP PLQLPDOL]XMH QHEH]SHþt Y]QLNX
]NUDWX 3 HG S LSRMHQtP VH S HVY GþHWH åH QDS Wt Y
VtWLRGSRYtGiKRGQRW XYHGHQpSURWHQWRVSRW HELþ
1RVQRVW SORFK\ PXVt EêW GRVWDWHþQi DE\ PRKOD
unést celou hmotnost trouby (13.5kg) a i její
8SR]RUQ Qt
REVDK $E\ QHGRFKi]HOR N UXãLYpPX FKY Qt QHER
SURGOXåRYDFtã
QHåiGRXFtPX KOXNX PXVt EêW WURXED SRORåHQD YH
NDEHOMHY\EDYHQ]HPQtFtPYRGLþHP
stabilní poloze.
3.
-HOL
QXWQp
SRXåtW
SUR
]DSRMHQt
UXS HVY GþHWHVHåHSURGOXåRYDFt
7URXEX LQVWDOXMWH Y GRVWDWHþQp Y]GiOHQRVWL RG
Pozor!
WHSOD D YRG\9\VWDYHQt WURXE\ ~þLQN P YRG\ D
HOHNWULFNpVtWLEH]MLãW Qt]HPQ QtP
7HQWR VSRW HELþ QHVPt EêW SRXåtYiQ Y
WHSODVHP åHVQtåLWMHMt~þLQQRVWDQHER]DS tþLQLW
Y]QLN SRUXFK\ 3URWR VH XMLVW WH åH WURXED MH
4.
.RQWDNWXMWHHOHNWULNi HYS tSDG åHVL QHMVWH MLVWL VH
instalována mimo zdroje vody a tepla.
zapojením nebo nevíte-li zda váš elektrický obvod je
1HEORNXMWH Y WUDFt RWYRU\ QDKR H D SR VWUDQiFK
MLãW Q]HPQ QtP
WURXE\ D DQL QD Qt QHSRNOiGHMWH åiGQp S HGP W\
1HEXGRXOL Y WUDFt RWYRU\ E KHP SURYR]X YROQp
7HQWR VSRW HELþ PXVt EêW X]HPQ Q MHVWOLåH ]iVWUþND
WURXED VH P åH S HK iW D WR P åH YpVW Då NH
vaší
Y]QLNX ]iYDG\ % KHP SURYR]X
HOHNWULFNpKRUR]YRGXMH W HED ML RG t]QRXW D QDKUDGLW
WURXE\
EXGH
XQLNDW ] Y WUDFtFK RWYRU KRUNê Y]GXFK SURWR
trouby
neodpovídá
zásuvce
vašeho
MLYKRGQRXQiKUDGQt]iVWUþNRX
GEHMWHQDWRDE\Y WUDFtRWYRU\E\O\YROQpDDE\VH
QDS tNODG ]iFORQD QHGRVWDOD PH]L ]H
D ]DGQt
þiVWWURXE\
5.
(OHNWULFNpS LSRMHQt
7URXEX XPtVW WH FR QHMGiOH RG WHOHYL]QtFK D
UiGLRYêFK
S LMtPDþ 3 HVWRåH
WDWR
WURXED
Y\KRYXMH SRåDGDYN P HYURSVNp QRUP\ ((& R
7HQWR VSRW HELþ MH VWDQGDUGQ GRGiYiQ V GYRX
NROtNRYRX(852]iVWUþNRX
~URYQLUiGLRYpKRUXãHQtWDNE\S HVWRYS tSDGHFK
XPtVW Qt
WURXE\
S LMtPDþ P
S tOLã
PRKOR
EOt]NR
N
GRFKi]HW
MPHQRYDQêP
N
UXãLYêP
interferencím ( rušení televizního nebo rádiového
VLJQiOX 3URWR WURXEX XPtVW WH FR QHMGiOH RG
nich.
6. Umístíte-li troubu do rohu, ponechejte mezi
VW QRXWURXE\D]GtPLQLPiOQ FPSUR]DUXþHQt
dobré ventilace.
3R]RU7HQWRVSRW HELþPXVtEêWX]HPQ Q
9êUREFH
RGPtWi
MDNRXNROLY
RGSRY GQRVW
]D
QHGRGUåHQtWRKRWREH]SHþQRVWQtKRS HGSLVX
•
-HOL]iVWUþNDNWHUiE\ODGRGiQDVHVSRW HELþHP
QHY\KRYXMtFtPXVtEêWRG t]QXWDDQDKUD]HQD
jinou vhodnou.
7
Downloaded From Microwave-Manual.com Manuals
j
EMM2015
Jak provozovat vaší mikrovlnou troubu
1
2
3
9
5
8
6
4
4
7
10
3RSLVDIXQNFHMHGQRWOLYêFKGtO
1.
9ODVWQt SURVWRU WURXE\ 3R SRXåLWt WHQWR
,QVWDODFHRWRþQpKRWDOt H
1.
2.
3.
3URKOtåHFtRNpQNRSRPRFtQ KRåMHPRåQp
2.
3RORåWH RWRþQê WDOt QDYUFK YR]tNX MDN MH
NRQWURORYDWS tSUDYXSRNUPX
QD]QDþHQRQDREUi]NX8MLVW WHVHåHVW HGRYê
'Yt ND WURXE\ NWHUp S L SURYR]X WURXE\
YêVWXSHN EH]SHþQ ]DSDGO GR KQDFt K tGHOH
1LNG\QHVPtWHSRORåLWRWRþQêWDOt REUiFHQ PXVtEêWYåG\SHYQ X]DY HQ\
4.
9ORåWH YR]tN RWRþQpKR WDOt H QD GQR YQLW QtKR
prostoru.
SURVWRUGRE HY\þLVW WH
=iSDGN\ ]iPNX D EH]SHþQRVWQt EORNRYDFt
systém
5. Ovládací panel
6. +QDFtK tGHORWRþQpKRWDOt H
7. 2WRþQê WDOt -H Y\UREHQ ]H
•
2WRþQê WDOt V YR]tNHP PXVt EêW YåG\ SRXåLW\
E KHPSURYR]XWURXE\
• Veškeré potraviny a nádoby s potravinami musí
EêWYåG\SRORåHQ\QDWRPWRRWRþQpPWDOt L
VSHFLiOQtKR
•
2WRþQê WDOt VH RWiþt MDN YH VP UX WDN L SURWL
åiUXY]GRUQpKR VNOD 3RNUP YH YKRGQp
VP UX KRGLQRYêFK UXþLþHN D MH WR QRUPiOQt
QiGRE IXQNFHWRKRWR]D t]HQt
SRNOiGHMWH
QD
WHQWR
WDOt 1HSRXåtYHMWH WURXEX EH] WRKRWR RWRþQpKR
WDOt H
8.
9R]tN RWRþQpKR WDOt H 3RORåWH KR QD GQR
WURXE\WDNDE\PRKOQpVWRWRþQêWDOt
9. Gril
10. Grilovací rošt
RWRþQêWDOt
vozík
KQDFtK tGHO
8
Downloaded From Microwave-Manual.com Manuals
j
EMM2015
Ovládací panel
1. 9ROLþYêNRQX
1DVWDYWHRWRþQêRYODGDþQDSRåDGRYDQRXKRGQRWX
výkonu.
2. ýDVRYDþPLQXWND
ajuje práci trouby. Pro
1DVWDYXMHSRåDGRYDQêþDV=DK
GRVDåHQtS HVQpKRQDVWDYHQtþDVXGRSRUXþXMHPH
RWRþLWPLQXWNXQDSOQRDSDNYUiWLWQDSRåDGRYDQRX
hodnotu.
9
Downloaded From Microwave-Manual.com Manuals
j
EMM2015
3 tSUDYDSRNUP YPLNURYOQQpWURXE
1.
2WHY HWH GYH H WURXE\ YORåWH SRNUP QD RWRþQê
7URXED]DþtQiSUDFRYDW
WDOt =DY HWHGYH HWURXE\
2.
3.
1DVWDYWH YROLþ YêNRQX QD SRåDGRYDQRX KRGQRWX
-HVWOLåHGREDS tSUDY\SRNUPXMHNUDWãtQHåPLQXW\
(viz tabulka dole)
QDWRþWH PLQXWNX QD GHOãt þDV D SDN ML YUD WH QD
1D PLQXWFH QDVWDYWH SRåDGRYDQê þDV S tSUDY\
SRåDGRYDQRXKRGQRWX
pokrmu.
-HVWOLåH FKFHWH WURXEX Y\SQRXW RWRþWH PLQXWNX QD
nulu
4.
(0).
3R]QiPND3RSRXåLWtVHXMLVW WHåHPLQXWNDMHQDVWDYHQiQDQXOX9RSDþQpPS tSDG E\GiOH
pracovala.
3 tNODG9D LWS LYêNRQX:SRGREXPLQXW
1.
2WRþWHYROLþYêNRQXQD:
2.
0LQXWNXRWRþWHQ
3.
7URXEDWDN]DþQHS LSUDYRYDWSRNUPSRGREXPLQXWDS LYêNRQX:
a hodnotu 15.
'RGDWHþQêRK HYQHKRWRYêFKSRNUP
•
9êUREFHPGRSRUXþHQRXGREXS tSUDY\SRNUPXMHQXWQpFKiSDWMDNRGREXRULHQWDþQt-HVWOLåHGRSRUXþHQi
GRED S tSUDY\ Y\SUãHOD D SRNUP MHãW QHQt YD tFt WDN MHMYUD WH ]S W GR WURXE\ D GRYD WH MHM 7R ]QDPHQi
SRGREQêP]S VREHPMDNRS LSRXåLWtQRUPiOQtWURXE\
•
•
3RWUDYLQXSUDYLGHOQ SURPtFKiYHMWH]YOiãW RPiþN\DSRNUP\YNDVWURONX
-H YKRGQp SRNUP LKQHG SR GRYD HQt FKYtOL SRQHFKDW Y WURXE 'RMGH WDN N Y\URYQiQt WHSORW SRNUPX D
]iURYH NGRNRQþHQtS tSUDY\
3U YRGFHQDVWDYRYiQtPLNURYOQQpWURXE\
Nastavení výkonu
100W
'RSRUXþHQpSRXåLWt
180W
300W
5R]PUD]RYiQtUR]WDYHQt]PU]OêFKSRNUP
8GUåRYiQtKRUNpKRSRNUPX
8GUåRYiQtPtUQpKRYDUX'RNRQþRYiQtSRNUP QDS tNODGQ NWHUpW\S\SHþHQ
Dušení a pokrmy v rendlíku
6YtWN\DMHPQpNROiþHQDS WYDURKRYê
450W
6W HGQtU\FKOHMãtUR]PU]QXWtDRS WRYQpRK iWtGXãHQpKRSRNUPXQHERSRNUPXY
rendlíku
600W
3HþHQtGRUW DSLãNRWRYêFKW VW
2S WRYQpRK iWtRS WRYQpRK iWtS HGYD HQêFKSRNUP
3HþHQtNRXVN PDVDDGU EHåH
800W
0D[LPiOQtYêNRQYD HQtDRK tYiQtWHNXWLQ
9D HQt]HOHQLQ\
3 HGHK iWt]DSpNDFtPtV\
10
Downloaded From Microwave-Manual.com Manuals
j
EMM2015
3 tSUDYDSRNUP QDJULOX
1. 2WRþWHYROLþYêNRQXQD]QDþNXJULOX
2. 3RPRFt PLQXWN\ QDVWDYWH SRåDGRYDQê
1DRWRþQêWDOt SRORåWHJULORYDFtP tåNXDDåQD
Qt
SRNUP
7HQWR
]S VRE
S tSUDY\
MH
QHMYKRGQ MãtSUR JULORYiQt NRWOHW VWHDN DSRG
þDV
S tSUDY\SRNUPX7URXEDVH WDN LKQHG ]DSQH
Pozor-trouba bude velmi horká.
3R]QiPND 3R SRXåLWt VH XMLVW WH åH PLQXWND MH QDVWDYHQi QD QXOX 9 RSDþQpP S tSDG
E\
dále trouba pracovala.
3 tNODG3RXåtWJULOSRGREXPLQXW
1.
2WRþWHYROLþYêNRQXQD]QDþNX
2.
Nastavte minutku na 15
grilu
3.
7URXED]DþQHDXWRPDWLFN\PLQXWJULORYDW
3 tSUDYDSRNUP PLNURYOQQêPRK HYHPVJULOHP
(kombinace)
1. 2WRþWH YROLþ YêNRQX QD SRåDGRYDQê YêNRQ
mikrovln a gril..
2. 1DVWDYWHPLQXWNXRWRþHQtPQDSRåDGRYDQRX
1DRWRþQêWDOt SRORåWHJULORYDFtP tåNXDDåQD
Qt
SRNUP
7HQWR
]S VRE
S tSUDY\
MH
QHMYKRGQ MãtSUR JULORYiQt NRWOHW VWHDN DSRG
Pozor-trouba bude velmi horká.
GREXS tSUDY\
3R]QiPND 3R SRXåLWt VH XMLVW WH åH PLQXWND MH QDVWDYHQi QD QXOX 9 RSDþQp S tSDG
E\
dále pracovala.
3 tNODG3RXåtWJULOSRGREXPLQXWS LYêNRQXPLNURYOQ:
1.
2WRþWHYROLþYêNRQXQD]QDþNX
2.
Nastavte minutku na 15
Combi 2
3.
7URXED]DþQHDXWRPDWLFN\PLQXWJULORYDWS LPLNURYOQQpPRK HYX[[[&RPEL
Poznámka:
-HVWOLåH RWHY HWH GYH H WURXE\ E KHP S tSUDY\ WDN VH DXWRPDWLFN\ Y\SQH 3R ]DY HQt GYH t EXGH
WURXED SRNUDþRYDW Y WHSHOQp S tSUDY
3R VNRQþHQt S tSUDY\ SRNUPX VH JULO D PLNURYOQQê RK HY
vypne a ozve se zvukový signál.
3 LYROE
PLNURYOQ\DJULOO]HYêNRQDþDVP QLWE
KHPSURYR]X
11
Downloaded From Microwave-Manual.com Manuals
j
EMM2015
'RSRUXþHQtSURSRXåLWtJULOX
9ãHFKQ\ JULORYDQp SRNUP\ SRORåHQp QD JULORYDFtP URãWX E\ P OL PtW SRG V VHERX GRVWDWHþQ YHONRX
]iFK\WQRXPLVNXQDRGNDSiYDMtFtã iY\DSDGDMtFtNRXVN\SRNUP 7tPXãHW tWHQDþDVH~GUåE\
Potravina
Toast (topinka)
Toast (topinka) se sýrem
0QRåVWYtKPRWQRVW
'REDS tSUDY\
Poznámka
2 krajíce
4 krajíce
4 -5 minut
6-7 minut
4-5 min topinka, 2 min sýr
'RSRUXþHQtSURSRXåLWtPLNURYOQQpKRRK HYXVJULOHP
3RXåLMWHJULORYDFtURãWSRORåHQêQDRWRþQpPWDOt LSURSHþHQtKRY ]tKRQHERYHS RYpKRPDVDRFKUD WHWHQNp
þiVWL D RNUDMH 3RORåWH GRVWDWHþQ YHONRX ]iFK\WQRX PLVNX SRG URãW QD ]DFK\WiYiQt NDSDMtFtFK ã iY D
SDGDMtFtFKNRXVN SRNUP *ULORYDQpNXV\E KHPS tSUDY\GRVWDWHþQ REUDFHMWH
Potravina
0QRåVWYt
slanina
(hmotnost)
4 (100g)
900g
SHþHQpKRY
]tV
kostí
SHþHQpYHS RYp
Pozice nastavení
výkonu
Combi 3
Pouze mikrovlny 800W
Combi 2
'REDS tSUDY\
7 - 9min
25 min
5 - 6 min
900g
Poznámka
3RW HWHROHMHP
2NR H WHVROtD
SHS HP
Nechte po tepelné
(panenka)
~SUDY
PLQ
RGOHåHW
YHS RYpNRWOHW\
2-3 (450g)
Combi 2
20 - 25 min
3RW HWHROHMHP
2NR H WHVROt
SDSULNRXDSHS HP
NX H
S OHQiVWHKQD
450g
800g
Combi 1
Combi 1
15 - 20min
25 - 30 min
3RW HWHROHMHP
2NR H WHVROt
SDSULNRXDSHS HP
zmrzlý hamburger
párky
rybí steak
4 (200g)
450g
2 (350g)
Combi 2
Combi 1
Combi 3
12 - 15 min
10 - 15 min
22 - 24 min
3RW HWHROHMHP
2NR H WHVROtD
SHS HP
zmrzlé brambory,
sekaná masa
2 (150g)
Combi 2
16 - 18 min
6WXSQ YêNRQXPLNURYOQQpKRRK HYXDJULOX
Symbol
Nastavení
Gril
Combi 1
Combi 2
Combi 3
12
Downloaded From Microwave-Manual.com Manuals
Výkon mikrovln
0W
300 W
450 W
600 W
Výkon grilu
1000 W
1000 W
1000 W
1000 W
j
EMM2015
Návod na rozmrazování
1
NWHUpSRWUDYLQ\MDNRFKOpEDRYRFHPRKRXEêWUR]PUDåHQ\PDQXiOQ
POTRAVINA
3
S LYêNRQX:
SRPRFtWRKRWRQiYRGX
'2%$2'32ý,1.8
Ë35$9$
PO ROZMRAZENÍ
FKOpEDSHþLYR
malý bochník
3RORåLWQDSDStURYêXEURXVHNQHER
8-10 min
10-15 min
10-13 min
10 min
QDSRGORåNXYKRGQRXGRPLNURYOQQp
WURXE\2WRþLWKRYS OFHGRE\
rozmrazování
nakrájený velký
bochník
3RORåLWKRQDSDStURYêXEURXVHN
QHERQDSRGORåNXYKRGQRXGR
PLNURYOQQpWURXE\2WRþLWKRYS OFH
doby rozmrazování
2 krajíce
3RORåLWMHQDSDStURYêXEURXVHN
45-60 sec
5 min
NXVSHþLYD
3RORåLWKRQDSDStURYêXEURXVHN
45-60 sec
5 min
NXV\SHþLYD
3RORåLWMHQDSDStURYêXEURXVHN
1-1,5 min
5 min
krémový dort 450g
9\EDOLW]REDOXSRORåLWQDWDOt
9-11 min
15-30 min
MHPQêNROiþJ
9\EDOLW]REDOXSRORåLWQDWDOt
9-11 min
15-30 min
SOQ QêNROiþJ
9\EDOLW]REDOXSRORåLWQDWDOt
7-9 min
15-30 min
PiVORYpSHþLYR
9\EDOLW]REDOXSRORåLWQDWDOt
7-9 min
15-30 min
9\EDOLW]REDOXSRORåLWQDWDOt
3-4 min
5-10 min
3RORåLWGRMHGQpYUVWY\GRP ONp
5-6 min
5-10 min
3RORåLWGRMHGQpYUVWY\GRP ONp
7-8 min
5-10 min
porce pokrmu na
misky
Zakrýt poklopem nebo fólií (ne z
7-8 min
5-10 min
WDOt LJ
39&2K iWS LYêNRQX
NROiþHDFXNURYLQN\
máslo
250g / 1 balení
ovoce
225g
P NNpEREXORYLQ\
450g
P NNpEREXORYLQ\
misky
mikrovln (800W) po dobu 3-4 min
zelenina
1HQtQXWQpMLS HGYD HQtP
rozmrazovat. Veškerá zelenina
P åHEêWUR]PUDåHQDDGiOH
]SUDFRYiYiQDS L:
výkonu trouby
13
Downloaded From Microwave-Manual.com Manuals
j
EMM2015
5DG\SURSRXåLWtPLNURYOQQpWURXE\
•
9åG\XGUåXMWHWURXEXYþLVWRW ]DPH]WHS HWpNiQtDY\WpNiQtWHNXWLQS HVRNUDMQiGRE1H]DSRPH WHYåG\
Y\þLVWLWYQLW HNWURXE\YþHWQ RWRþQpKRWDOt H
•
•
3 LS tSUDY SRNUP YWURXE S HGQRVWQ SRXåtYHMWHNXODWpQHERRYiOQpPtV\VSRNOLþNRX
1HSRXåtYHMWHNRYRYpQHERNRYHP]GREHQpPtV\1 NWHUpSODVWRYpPDWHULiO\VHPRKRXRGWHSOêFKSRNUP
tavit nebo deformovat.
•
•
nebo nepromastitelný papír.
3 LS tSUDY SRNUP\]DNUêYHMWH3RXåtYHMWHVNOHQ QpSRNOLþN\WDOt H
3HþLYR FKOpE D SRGREQp SRWUDYLQ\ PRKRX EêW UR]PUD]RYiQ\ S tPR Y NRãtNX QD FKOpE QHER Y SDStURYpP
ubrousku.
•
-HVWOLåH ]PUD]HQp SRWUDYLQ\ RK tYiWH Y MHMLFK REDOX P OL E\VWH REDO RWHY tW 2EDO\ REVDKXMtFt NRY QHER
NRYRYp R]GRE\ NWHUp QHMVRX YêVORYQ GRSRUXþHQ\ SUR RK HY Y PLNURYOQQp WURXE VH QHVPt Y WURXE
SRXåtYDW2GVWUD WHNRYRYpVSRQN\D~YD]N\
• 0HQãtNXV\DOREDOXP åHWHSRXåtWQD]DNU\WtþiVWtNWHUpVHVQDGQRS HK tYDMtMDNRQDS NX HFtN LGêOND
• Potraviny se slupNRX QHER N åt E\ VH P OL S HG S tSUDYRX SURStFKDW YLGOLþNRX MDNR QDS EUDPERU\ QHER
SiUN\YHVW tYNX1LNG\QHYD WHYPLNURYOQQpWURXE FHOiYHMFHPRKODE\H[SORGRYDW
•
9HONp VLOQp NXV\ GiYHMWH N YQ MãtPX RNUDML QiGRE\ D VQDåWH VH Y Wãt NXV\ SRUFRYDW QD VWHMQ YHONp
NRXVN\9åG\XPLV XMWHQiGRE\GRVW HGXWURXE\
•
•
3RWUDYLQ\VHEXGRXURYQRP UQ MLRK tYDWEXGHWHOLMHE KHPS tSUDY\SURPtFKiYDWQHERREUDFHW
9åG\ QDVWDYWH QLåãt GREX S tSUDY\ QHå MH GRSRUXþHQR ]DEUiQtWH WtP S HYD HQt SRNUPX ýtP MVRX
porce
SRNUP Y WãtWtPGHOãtGREDEXGHSRW HEQiSURMHMLFKS tSUDYX
•
•
•
•
1DS tSUDYX]HOHQLQ\QHSRXåtYHMWHåiGQRXQHERPLQLPiOQtPQRåVWYtYRG\
3RXåtYHMWHPHQãtPQRåVWYtNR HQtDVROLQHåSURQRUPiOQtYD HQt
.R H WHSRNUP\DåSRS tSUDY YWURXE
3R S tSUDY Y WURXE SRQHFKHMWH SRNUP Q NROLN PLQXW RGSRþLQRXW DE\ E\OD ]DMLãW QD ~SOQi D
URYQRP UQiWHSHOQiS tSUDYD
•
•
9åG\VHXMLVW WHåHSRNUP\S HGSRGiYiQtPQDVW OMVRX iGQ WHSHOQ ]SUDFRYiQ\
3 LY\MtPiQtQiGREtDSRNUP ]WURXE\SRXåtYHMWHEX
GUåiN\NWRPXXUþHQpQHERUXNDYLFHSURPLNURYOQQp
trouby.
Tipy a Triky
•
=P NQXWtPHGX
0iWHOL PHG NWHUê MH MLå YH VNOHQLFL ]FXNHUQDW Oê WDN ]H VNOHQLFH RGVWUD WH YtþNR D YORåWH VNOHQLFL GR
WURXE\3RXåLMWHVW HGQtKRGQRW\PLNURYOQSRGREXPLQXW
•
7DYHQtþRNROiG\
1DOiPHMWHJWDEXONXþRNROiG\QDþWYHUHþN\YV\SWHMHGRQiGRE\D]DK tYHMWHS LY\VRNpPYêNRQXSR
dobu 1-2 minut za dobrého promíchávání.
•
5R]SRXãW QtQHERP NQXWtPiVOD
5R]SRXãW Qt]DEHUHQ NROLNVHNXQGS LY\VRNpPYêNRQX0 NQXWtMHOpSHSURYiG WS LQLåãtPYêNRQXSR
delší dobu.
•
2K iWtQHERRåLYHQtVWDUãtKRFKOHED
3RXåLMWHVW HGQtKRGQRW\YêNRQXSRGREXQ NROLNDVHNXQG
•
-DNMHGQRGXãHRORXSDWþHVQHN
=DK HMWH VWURXåN\ þHVQHNX S L Y\VRNpP YêNRQX SR GREX VHNXQG 6WLVNQ WH MHGHQ NRQHF GRNXG
se neodloupne slupka.
•
3 tSUDYDRYRFQpKRGåXVX
&LWUXVRYpSORG\Y\GDMtYtFHã iY\MHVWOLåHMHS HGY\PDþNiQtPSRGREXVHNXQGRK HMHWHS LY\VRNpP
výkonu.
•
9D HQtYORþNRYpNDãH
9ORþNRYRXNDãLMHGQRGXãHS LSUDYtWHEH]QHS tMHPQpKROHSLYpKR]DãSLQ Qt9L]QiYRGYêUREFH
14
Downloaded From Microwave-Manual.com Manuals
j
EMM2015
3pþHDþLãW QtWURXE\
0LNURYOQQi WURXED PXVt EêW YåG\ þLVWi=E\WN\ S HWHNOêFK SRNUP D UR]VW tNQXWêFK ]E\WN VSRW HERYiYDMt
PLNURYOQRXHQHUJLLDWDP åH]DS tþLQLWLMHMLFKY]QtFHQt=iURYH VHWtPVQLåXMH~þLQQRVWWURXE\DGRFKi]tNH
Y]QLNX QHS tMHPQêFK SDFK 1HSRNRXãHMWH VH PDQLSXORYDW V åiGQêP QDVWDYRYDFtP SUYNHP QHER SURYiG W
RSUDYXMDNpNROLYþiVWLWURXE\VYpSRPRFt2SUDY\P åHSURYiG WMHQNYDOLILNRYDQêSUDFRYQtN DXWRUL]RYDQpKR
servisu.
3 HGþLãW QtPVHXMLVW WHåHWURXEDMHRGSRMHQDRGHOHNWULFNpVtW ýLãW QtS tVOXãHQVWYtRWRþQêWDOt DYR]tN
3 tVOXãHQVWYt Y\QGHMWH ] WURXE\ D YHQNX MH ]D SRPRFt MHPQpKR P\FtKR SURVW HGNX Y\þLVW WH 6 YR]tNHP
RWRþQpKRWDOt HPDQLSXOXMWHYHOLFHRSDWUQ 8SR]RUQ Qt 9QLW HN WURXE\ RWRþQê WDOt D YR]tN WDOt H VH RK tYDMt QD Y\VRNRX WHSORWX SURWR VH MLFK
EH]SURVW HGQ SRY\SQXWtWURXE\QHGRWêNHMWH
ýLãW QtLQWHULpUX
9åG\FN\ XGUåXMWH YQLW HN WURXE\ Y þLVWRW 9\þLVW WH YãHFKQ\ VNYUQ\ SR UR]OLWêFK SRNUPHFK D RGVWUD WH
YãHFKQ\ ]E\WN\ SRNUP 1HRGVWUDQ Qp ]E\WN\ XOS Qp QD VW QiFK WURXE\ W VQ Qt GYH t D GYH t SRKOFXMt
PLNURYOQQp ]i HQt D WtP VQLåXMt ~þLQQRVW WURXE\ 0RKRX WDNp ]DS tþLQLW SRãNR]HQt YQLW NX WURXE\ . þLãW Qt
SRXåtYHMWHMHPQpWHNXWpP\FtSURVW HGN\KRUNRXYRGXDP NNêþLVWêKDG tN
1LNG\ N þLãW Qt MDNpNROLY þiVWL PLNURYOQQp WURXE\ QHSRXåtYHMWH DEUD]LYQt P\Ft SURVW HGN\ D DQL
NRPHUþQtþLVWLþHWUXEQHERRFHORYRXGUiW QNX
.XYROQ QtVLOQ XOS QêFKQHþLVWRWQHFKWHYWURXE SRGREXPLQXW\YD LWKUQHNVYRGRX
1LNG\VHQHSRNRXãHMWHNRGVWUDQ QtQiQRV
SRXåtWQ
åQHERMLQêNXFK\
VNêQiVWURM
3URRGVWUDQ Qt]iSDFKX]YQLW QtKRSURVWRUXWURXE\QHFKWHYD LWSRGREXDVLPLQXWKUQHNVYRGRXGRNWHUp
MVWHS LGDOLþDMRYpOåLþN\FLWUyQRYpã iY\
ýLãW QtH[WHULpUX
3 HG þLãW QtP RYOiGDFtKR SDQHOX RWHY HWH GYt ND WURXE\ 7tP ]DEUiQtWH WRPX DE\ QHGRãOR N QHFKW QpPX
]DSQXWt WURXE\9Q Mãt SRYUFK WURXE\ MH W HED þLVWLW YRGRX V QHDJUHVLYQtP P\FtP SURVW HGNHP D SRWp S HW tW
SRX]H þLVWRX YRGRX DE\ VH RGVWUDQLO ]E\Oê P\Ft SURVW HGHN 1DNRQHF WURXEX Y\W HWH GR VXFKD P NNêP
VXFKêPKDG tNHP
0 åHWHWDNp SRXåtW VSUHMRYp þLVWLþH RNHQ QHER XQLYHU]iOQt NXFK\ VNp þLVWtFt SURVW HGN\ 1LNG\ QHSRXåtYHMWH
QDP\WtYQ MãtFKþiVWt DEUD]LYQtFK P\FtFK SURVW HGN GUiW QHN QHER DJUHVLYQtFK FKHPLNiOLt $E\ QHGRãOR N
SRãNR]HQtSUDFRYQtFKþiVWtWURXE\QHGRYROWHDE\VHGRY WUDFtFKRWYRU GRVWDODYRGD
ÒGUåEDDþLãW QtJULOX
3RSRXåLWtJULOXPRKRXEêWþiVWLJULOX]QHþLãW QpUR]VW LNRYDQêPWXNHP3RþNHMWHDåVHYQLW HNWURXE\RFKODGt
D SDN SHþOLY Y\W HWH YãHFKQ\ PDVWQp VNYUQ\ 8VD]HQi PDVWQRWD QD WRSQpP W OHVH P
JULOX]S VRERYDWQHS tMHPQê]iSDFKDWYRUEXNRX H
15
Downloaded From Microwave-Manual.com Manuals
åH S L GDOãtP SRXåLWt
j
EMM2015
Servis a náhradní díly
-HVWOLåHVSRW HELþQHIXQJXMHVSUiYQ WDNMHãW S HGWtPQHåEXGHWHNRQWDNWRYDWDXWRUL]RYDQêVHUYLV
SURYH
WHQiVOHGXMtFtNRQWURO\
-HVWOLåHVHWURXEDQH]DSQXOD
• =NRQWUROXMWH]GDMHWURXEDS LSRMHQDQDHOHNWULFNRXVt • =NRQWUROXMWH]GDMH]iVWUþNDVSUiYQ ]DVXQXWi
• =NRQWUROXMWH]GDS tSDGQêY\StQDþþLMLVWLþYHGRXFtNWURXE MH]DSQXWê
• =NRQWUROXMWH]GDMH]iVXYNDIXQNþQtDWR]DSRMHQtPMLQpKRVSRW HELþHGRSRXåtYDQp]iVXYN\
• Zkontrolujte stav pojistky v domácím rozvodu.
-HVWOLåHWURXEDQHSUDFXMH
•
•
•
•
' WVNiSRMLVWNDP åHEêWDNWLYRYDQiXQ NWHUêFKPRGHO =NRQWUROXMWH]GDMVRXYROLþHVSUiYQ QDVWDYHQp
=NRQWUROXMWHåHYHãNHUpNRUHNFHDSRXåLWpSRVWXS\RGSRYtGDMtWRPXWRQiYRGXNSRXåLWt
3 HVY GþHWH VH åH GYH H WURXE\ MVRX SHYQ ]DY HQp -HVWOLåH ]E\WN\ SRWUDY\ QHER MLQp GtO\ S HNiåt
VSUiYQpPX]DY HQtGYH tWDNWURXEDQHS MGH]DSQRXW
•
=NRQWUROXMWH]GDMHDNWLYRYiQRVWDUWRYDFtWODþtWNR
-HVWOLåH DQL SR SURYHGHQêFK NRQWUROiFK WURXED QHSUDFXMH VSUiYQ NRQWDNWXMWH QHMEOLåãt DXWRUL]RYDQê VHUYLV
firmy Electrolux.
'
OHåLWp
-HVWOLåHS LYRODQêWHFKQLN]MLVWtåHSRUXFKDMH]S
VREHQiQHVSUiYQRXLQVWDODFtQHERSRXåtYiQtPWDN
YiPQiNODG\VSRMHQpVMHKRQiYãW YRXEXGRX~þWRYiQ\LYS tSDG åHWURXEDMHVWiOHY]iUXþQtGRE Po zavolání do autorizovaného servisu budete dotazován na následující informace.
1. 9DãHMPpQRDGUHVDD36ý
2. 9DãHWHOHIRQQtþtVOR
3. 3 HVQêSRSLVSRUXFK\
4. ýtVORPRGHOX
5. 6pULRYpþtVOR
6. 'DWXPQiNXSXVSRW HELþH
'RSRUXþXMHPHYiPDE\VWHVLGRYROQêFKNRORQHNQDSVDOLS tVOXãQpLQIRUPDFHSURS tSDGSRW HE\
ýtVORPRGHOX
........... EMM20017 ...............................
6pULRYpþtVOR
........... ................................................
Datum prodeje: ........ ................................................
-HVWOLåH MH Yiã VSRW HELþ VWiOH Y ]iUXFH PXVtWH VH XMLVWLW åH MVWH SURYHGOL YHãNHUp NRQWURO\ YL]
QDKR H 9 RSDþQpP S tSDG YiP EXGRX QD~þWRYiQ\ QiNODG\ VSRMHQp V S LYRODQêP VHUYLVQtP
technikem.
Náhradní díly
9HãNHUpQiKUDGQtGtO\O]H]DNRXSLWSURVW HGQLFWYtPVHUYLVQtFKRSUDYHQ
Zákaznický servis
9HãNHUp LQIRUPDFH WêNDMtFt VH YDãHKR VSRW HELþH ]QDþN\ (OHFWUROX[ QHER LQIRUPDFH R MLQêFK VSRW HELþtFK
ILUP\(OHFWUROX[]tVNiWHNG\å]DWHOHIRQXMHWHQHERVHStVHPQ VSRMtWHVQDãtP]iND]QLFNêPVHUYLVHP
16
Downloaded From Microwave-Manual.com Manuals
j
EMM2015
=iUXþQtSRGPtQN\
)LUPD(OHFWUROX[QDEt]tW\WR]iUXþQtSRGPtQN\SUYQtPX]iND]QtNRYLWRKRWRVSRW HELþH
1. Záruka je platná po dobXP VtF RGGRE\NG\E\OVSRW HELþSURGiQSUYQtPX]iND]QtNRYLFRå
musí být potvrzeno dokladem o nákupu nebo podobným dokumentem. Záruka nepokrývá
NRPHUþQtXåLWtWRKRWRVSRW HELþH
2. Záruka je platná na všechny vady vzniklé chybnou výrobou nebo vadou materiálu. Záruka se
QHY]WDKXMH QD YDG\ ]S VREHQp QHVSUiYQêP SRXåtYiQtP KUXEêP ]DFKi]HQtP ãSDWQRX
LQVWDODFt
SRãNR]HQtP
]
YQ MãNX
MLQêP
REMHNWHP
ãSDWQRX
~GUåERX
QHDXWRUL]RYDQêPL
PRGLILNDFHPL QHER SRNXV\ R RSUDYX NRPHUþQtP SRXåtYiQtP QHER QHGRGUåHQtP SUDYLGHO
Y\MPHQRYDQêFK Y S LORåHQp S tUXþFH =iUXND VH GiOH QHY]WDKXMH QD åiURYN\ Y\MtPDWHOQp
VNOHQ QpQHERSODVWLFNpGtO\
3. 3URGHMFH PXVt QHSURGOHQ
LQIRUPRYDW QHMEOLåãt DXWRUL]RYDQp VHUYLVQt FHQWUXP R SRåDGDYNX QD
]iUXþQt RSUDYX (OHFWUROX[ VL Y\KUD]XMH SUiYR XUþLW NGH VH RSUDYD SURYHGH QDS GRPD X
]iND]QtNDYPtVW LQVWDODFHQHERYVHUYLVQtGtOQ 4. =iUXNDVHY]WDKXMHQDEH]SODWQRXYêP QXQiKUDGQtFKGtO DQDVSRW HERYDQRXSUiFL
5. 2SUDY\ SURYiG Qp Y GRE ]iUXN\ QHSURGOXåXMt FHONRYRX GREX ]iUXN\ QD VSRW HELþ
Y\P
Q
QpS LRSUDY VHVWiYDMtPDMHWNHPILUP\(OHFWUROX[
6. 3UiYD]iND]QtNDXUþHQD]iNRQHPQHMVRXW
PLWR]iUXþQtPLSRGPtQNDPL]SRFK\EQ QD
17
Downloaded From Microwave-Manual.com Manuals
'tO\
j
EMM2015
Záruka, servis a náhradní díly
3 HþW WHVLWHQWRQiYRGNREVOX]HDGRGUåXMWHYQ PXYHGHQpUDG\D SRN\Q\ 9 PQRKD S tSDGHFK VL EXGHWH
PRFL Y\MDVQLW MDNpNROL SRFK\EQRVWL VDPL D WXGtå Y\KQRXW VH ]E\WHþQêP YROiQtP GR VHUYLVX 3 HGFKR]t þiVWL
QD]YDQp&RG ODWNG\åD 6HUYLV REVDKXMt GRSRUXþHQt FR E\ VH P OR ]NRQWURORYDW G tYH QHå ]DYROiWH
servisního technika.
-HVWOLåH SR W FKWR NRQWUROiFK ]iYDGD VWiOH H[LVWXMH ]DYROHMWH YDãH QHMEOLåãt DXWRUL]RYDQp VHUYLVQt VW HGLVNR
Electrolux.
8MLVW WH VH åH P
åHWH VG OLW PRGHO D VHULRYp þtVOR VSRW HELþH 7\WR LQIRUPDFH QDOH]QHWH QD GDWRYpP ãWtWNX
S tVWURMH
2ULJLQiOQtQiKUDGQtGtO\O]HNRXSLWRGDXWRUL]RYDQêFKVW HGLVHNVHUYLVX(OHFWUROX[
Podmínky záruky
0\ YêUREFH ]DUXþXMHPH åH MHVWOLåH E KHP P VtF RG GDWD ]DNRXSHQt WRKRWR VSRW HELþH (OHFWUROX[ VH
WHQWR VSRW HELþ QHER MDNiNROL MHKR þiVW XNiåRX MDNR YDGQp SRX]H ] G YRGX YDGQpKR ]SUDFRYiQt QHER
YDGQpKRPDWHULiOXSURYHGHPHSRGOHQDãHKRXYiåHQtEX RSUDYXQHERYêP QXWpKRåEH]SODFHQt]DSUiFL
PDWHULiOQHERS HSUDYX]DS HGSRNODGXåH
-
ých hodnot
VSRW HELþE\OVSUiYQ LQVWDORYiQDSRXåtYiQSRX]HQDQDS WtXYHGHQpQDãWtWNXMPHQRYLW
VSRW HELþ E\O SRXåtYiQ SRX]H SUR QRUPiOQt GRPiFt ~þHO\ D Y VRXODGX V SRN\Q\ YêUREFH SUR SURYR] D
~GUåEX
-
QD VSRW HELþL QHSURYiG OD VHUYLV ~GUåEX DQL RSUDYX MLQi QHå QiPL DXWRUL]RYDQi RVRED NWHUi VSRW HELþ
nerozebírala ani s ním jinak nemanipulovala
-
YãHFKQ\VHUYLVQtSUiFHSRGOHWpWR]iUXN\PXVtSURYiG WVHUYLV(OHFWUROX[QHERMtPDXWRUL]RYDQpVW HGLVNR
NDåGêY\P Q QêVSRW HELþQHERY\P Q QiYDGQiVRXþiVWVHVWDQRXQDãtPYODVWQLFWYtP
tato záruka platí vedle vašich zákonných nebo jinak priYQ
SRGORåHQêFKSUiY
UR]KRGXMtFtSRGPtQN\]iUXN\MVRXXYHGHQ\QD]iUXþQtPOLVWX
Výjimky - tato záruka se nevztahuje na:
- SRãNR]HQt QHER SRåDGDYN\ Y]QLNOp Y G
VOHGNX S HSUDY\ QHVSUiYQpKR SRXåLWt QHER QHGEDORVWL YêP Q\
åiURYHNDVQtPDWHOQêFKþiVWt]HVNODQHERSODVWLFNêFKKPRW
-
QiNODG\VSRMHQpVSRåDGDYN\QDRGVWUDQ Qt]iYDGVSRW HELþHNWHUêMHQHVSUiYQ LQVWDORYiQ
VSRW HELþHNWHUpMVRXSRXåtYiQ\YNRPHUþQtPSURVW HGtYþHWQ SURQDMtPDQêFK
]HP (YURSVNpKR VSROHþHQVWYt /]H SRXåtW VWDQGDUGQt ]iUXNX DOH ]DMLãW Qt åH VSRW HELþ VSO XMH QRUP\
SODWQp Y S tVOXãQp ]HPL NDP E\O VSRW HELþ GRSUDYHQ MH QD ]RGSRY GQRVWL D QD QiNODG\ YODVWQtND 0 åH
EêWY\åDGRYiQGRNODGRNRXSL
Model ..............................................
ýtVORYêURENX(31&1R
..............
6HULRYpþtVOR)6HULDO1R
.............
HYHQWXHOQ .'
9S tSDG WHFKQLFNêFKSUREOpP YiPEXGHLQiã]QDþNRYêVHUYLVNG\NROLYN GLVSR]LFL YROHMWH Adresy:
6HUYLVQtVW HGLVNR(OHFWUROX[
Hanusova ulice
140 21 Praha 4
Tel.: 2 6112 6112
%H]SHþQRVW
3 HþW WHVLWHQWRQiYRGDYDURYQiXSR]RUQ QtQD]DþiWNXWRKRWRQiYRGX9êUREFHQH]RGSRYtGi]DYDG\
]S VREHQpQHVSUiYQ SRXåtYDQêPYêURENHPQHERYêURENHPSRXåtYDQêPSURMLQp~þHO\QHåMVRX~þHO\
specifikované v tomto návodu.
18
Downloaded From Microwave-Manual.com Manuals
X
EMM2015
ýHVWLWDPRYDPGDVWHVHRGORþLOL]DQDNXSQRYHPLNURYDORYQHSHþLFH
Zanussi.
Zahvaljujemo se vam za zaupanje, ki ste nam ga izkazali, ko ste izbrali naš proizvod.
3UHSULþDQLVPRGDERVWHKLWURXJRWRYLOLNDNRXSRUDEQDMHYDãDQRYDPLNURYDORYQDSHþLFD
LQGDYDPERYYHOLNRSRPRþ.RWSULYVHKNXKLQMVNLKDSDUDWLKERWXGLSULXSRUDEL
PLNURYDORYQHSHþLFHWUDMDORQHNDMþDVDGDVHERVWHVH]QDQLOL]YVHPLIXQNFLMDPLLQ
PRåQRVWPLXSRUDEHYHQGDUSDVPRSUHSULþDQLGDYDPERVþDVRPDYDãDPLNURYDORYQD
SHþLFDSRVWDODQHSRJUHãOMLYD
3UHGHQSUYLþXSRUDELWHVYRMRQRYRPLNURYDORYQRSHþLFR
QDWDQþQRSUHEHULWHYVDQDYRGLOD]DXSRUDER7DQDYRGLODVPRSULSUDYLOL]åHOMRGDELYDP
RPRJRþLOLUHVRSWLPDOQRLQYDUQRXSRUDER]DWRYDVSURVLPRGDMLKSD]OMLYRSUHEHUHWH
.QMLåLFR]QDYRGLOLLPHMWHYHGQRSULURNLWDNRGDERVWHODKNRYVDNLþNRERVWHYGYRPLK
SRLVNDOLXVWUH]QRQDYRGLORýHERVWHVYRMRPLNURYDORYQRSHþLFRSURGDOLMRNRPXSRGDULOLDOL
MRREVHOLWYLSXVWLOLYVWDUHPVWDQRYDQMXSRVNUELWHGDERQRYLODVWQLNREHQHPVSHþLFRGRELO
tudi navodila za uporabo in se bo lahko tako tudi sam seznanil z varno in optimalno
uporabo.
Navodila za varno uporabo
•
posegi s strani nestrokovnih oseb
pomenijo veliko tveganje za uporabnika
9JUDMHQDYDUQRVWQDVWLNDODSUHSUHþXMHMR
GHORYDQMHPLNURYDORYQHSHþLFHþHVR
•
vrata odprta.
Nikoli ne poskušajte spremeniti
delovanje teh stikal, saj bi delovanje
PLNURYDORYQHSHþLFH
•
7RELODKNRSRY]URþLORL]SRVWDYOMDQMH
SHþLFHSULRGSUWLKYUDWLKODKNRSRY]URþLOR
•
izjemno visoki napetosti.
izpostavljanje oseb mikrovalovni
energiji.
Pazite, da se na tesnilu vrat ne bi
•
UHGQRþLVWLWHJOHMSRJODYMHRþLãþHQMXLQ
•
Y]GUåHYDQMXPLNURYDORYQHSHþLFH
•
0LNURYDORYQRSHþLFRVPHWHLQãWDOLUDWLLQ
postavite samo v skladu z navodili za
inštalacijo, ki so podana v teh navodilih
za uporabo.
QDEUDOLRVWDQNLKUDQHDOLþLVWLOWHVQLOR
•
Nikoli ne smete sneti ohišja, vrat ali
XSUDYOMDOQHSORãþH]PLNURYDORYQHSHþLFH
0LNURYDORYQRSHþLFRXSRUDEOMDMWHVDPRY
je ne smete uporabljati, ampak se takoj
namene, ki so opisani v teh navodilih. V
njej ne smete segrevati korozivnih
REUQLWHQDSRREODãþHQLVHUYLV
NHPLNDOLM7DWLSPLNURYDORYQHSHþLFHMH
Izjemno pomembno je, da se vrata
L]NOMXþQRQDPHQMHQVHJUHYDQMXLQ
ýHMHPLNURYDORYQDSHþLFDSRNYDUMHQD
PLNURYDORYQHSHþLFHSUDYLOQR]DSLUDMRLQ
kuhanju ter odtaljevanju zamrznjene
da niso poškodovani naslednji deli:
KUDQH7DPLNURYDORYQDSHþLFDQL
primerna za industrijsko uporabo ali
uporabo v laboratorijih, ravno tako pa
tudi ni namenjena komercialni uporabi.
YUDWDXVORþHQDWHþDMLYUDWLQ
zapahi (zlomljeni ali zrahljani); (3)tesnila
vrat in tesnilne površine.
3ULWDNLXSRUDELPLNURYDORYQHSHþLFH
•
Nikoli ne poskušajte sami popraviti
•
SRNYDUMHQRPLNURYDORYQRSHþLFR
vam garancije ne moremo priznati.
Nikoli ne vklapljajte prazne
PLNURYDORYQHSHþLFHýHYQMHMQLKUDQH
3RSUDYLODY]GUåHYDOQDGHODLQ
ali vode, ki bi absorbirali mikrovalovno
energijo, lahko pride do poškodbe
magnetrona.
VSUHPLQMDQMH]QDþLOQRVWLSHþLFHVPHMR
opravljati samo za to usposobljeni
VWURNRYQMDNLSRREODãþHQHJDVHUYLVD9VL
3
Downloaded From Microwave-Manual.com Manuals
X
EMM2015
•
Testiranje ustreznosti posode
ýHPLNURYDORYQRSHþLFRXSRUDEOMDMR
otroci, jih je pri tem treba skrbno
•
QDG]LUDWLSUHGWHPSDVHSUHSULþDMWHGD
•
skupaj s kozarcem, polnim vode.
PLNURYDORYQRSHþLFRLQGDUD]XPHMR
6HJUHYDMWHPLNURYDORYQRSHþLFRHQR
nevarnosti, ki so lahko posledica
nepravilne uporabe.
PLQXWRQD:ýHVHMH
posoda segrela, je ne uporabljajte
PLNURYDORYQLSHþLFLýHMHOHPODþQDMR
0LNURYDORYQDSHþLFDQHVPHVWDWLQD
lahko uporabljate za segrevanje jedi, ne
SURVWHPDOLYEOLåLQLYRGH
•
SD]DNXKDQMHýHMHSRVRGDWXGLSR
1HSRVNXãDMWHYPLNURYDORYQLSHþLFL
segrevanju sobne temperature, je
primerna za kuhanje v mikrovalovni
VXãLWLREOHNDOLþDVRSLVRYWLSUHGPHWLEL
se lahko vneli.
•
3RVWDYLWHSRVRGRYPLNURYDORYQRSHþLFR
so sposobni sami uporabljati
SHþLFL
1HXSRUDEOMDMWHPLNURYDORYQHSHþLFH]D
•
shranjevanje; nikakor ne smete v njej
3DSLUQDWLSUWLþNLSRYRãþHQLSDSLU
SDSLUQDWHEULVDþHNURåQLNLVNRGHOLFH
SXãþDWLSUHGPHWRYL]SDSLUMDNXKLQMVNLK
škatle, ovojni papir in lepenka so zelo
SULSRPRþNRYDOLKUDQH
SUDNWLþQLSULSRPRþNL]DXSRUDERY
PLNURYDORYQLSHþLFL9HGQRVHSUHSULþDMWH
1DYRGLOD]DYDUQRXSRUDERåDUD
GDVWHMLKYSHþLFRSRVWDYLOLSROQHKUDQHDOL
WHNRþLQHVDMWDDEVRUELUDHQHUJLMRLQMHQD
1.
ýHPHGNXKDQMHP]LQIUDåDURPSULGH
WDQDþLQL]NOMXþHQDPRåQRVWSUHJUHYDQMD
•
voda v stik s steklom na vratih, to lahko
za shranjevanje v zamrzovalniku in
SRþL
2. Pri postavljanju ali jemanju hrane iz
SODVWLþQLKRYRMHYMHSULPHUQD]DXSRUDER
SHþLFHYHGQRXSRUDEOMDMWH]DãþLWQH
YPLNURYDORYQLSHþLFL3ULXSRUDELSODVWLNH
NXKLQMVNHURNDYLFH3RVRGDVHYSHþLFL
upoštevajte navodila proizvajalca.
zelo segreje, zato pazite, da vas ne
,]RJLEDMWHVHXSRUDELSODVWLþQLKSRVRG]D
RSHþH9UWOMLYDSORãþDLQNRYLQVNDPUHåD
SULSUDYRKUDQHNLYVHEXMHYHOLNRPDãþRE
se ravno tako segrejeta, zato vedno
DOLVODGNRUMDNHUGRVHåHMRWDNDåLYLOD
XSRUDEOMDMWH]DãþLWQHURNDYLFH
YLãMRWHPSHUDWXURLQELVHGRORþHQDYUVWD
3. Pri postavljanju ali jemanju hrane v
SODVWLNHODKNR]DþHODWRSLWL
•
SHþLFRVHQHGRWLNDMWHRNHQFVNRYLQVNLPL
deli. Bodite previdni; notranjost vrat se
zelo segreje.
4.
9HþLQDSODVWLþQLKSRVRGVNRGHOLFãNDWHO
1HSXãþDMWHYNORSOMHQHPLNURYDORYQH
SHþLFHQHQDG]RURYDQHSUHGYVHPþH
VHJUHYDWHDOLNXKDWHKUDQRYSODVWLþQLDOL
papirnati posodi oz. taki, ki se lahko
1HSRODJDMWHYUWOMLYHSORãþHDOLSRVRGY
hladno vodo in jih ne poskušajte na silo
ohladiti.
5. Ne odlagajte raznih predmetov na
YQDPHYHþNUDWSUHYHULWHGHORYDQMH
SHþLFHýHRSD]LWHGLPSXVWLWHYUDWD
]DSUWDL]NORSLWHPLNURYDORYQRSHþLFRDOL
PLNURYDORYQRSHþLFR=JRUQMDVWHQD
SRWHJQLWHYWLNDþL]YWLþQLFHLQSRþDNDMWH
da se preneha kaditi.
• Kovinska posoda in posoda s kovinsko
obrobo ni primerna za uporabo v
PLNURYDORYQHSHþLFHVH]HORVHJUHMH
zato bi se lahko ti predmeti poškodovali.
3RSROQRPDQRUPDOQRMHþHL]]DYUDW
XKDMDSDUDþHVHYUDWD]DURVLMRDOLFHOR
PLNURYDORYQLSHþLFLUD]HQþH
þHL]SRGYUDWPHGNXKDQMHPNDSOMDYRGD
proizvajalec izrecno tega ne dovoljuje.
• Posoda z ozkimi grli, kot so to n.pr.
steklenice, za uporabo v mikrovalovni
To je posledica kondenzacije vlage
zaradi segrevanja hrane in ne vpliva na
YDUQRVWYDãHPLNURYDORYQHSHþLFH9UDWD
SHþLFLQLSULPHUQD
•
QH]DSLUDMRQRWUDQMRVWLSHþLFH
KHUPHWLþQR
.RåHOLWHRGNULWLSRVRGRYNDWHULVWH
NXKDOLSD]LWHGDYDVYURþDSDUDQH
RSHþH
4
Downloaded From Microwave-Manual.com Manuals
X
EMM2015
9DUQRVWSULSULSUDYOMDQMXåLYLO
4.
• Nikoli ne segrevajte hrane v konzervah;
þDVDYPLNURYDORYQLSHþLFLLQMRãH
SUHGVHJUHYDQMHPMRSUHORåLWHYGUXJR
preden jo vzamete iz nje, še enkrat
premešajte.
posodo.
•
•
0LNURYDORYQDSHþLFDQLSULPHUQD]D
FYUHQMHKUDQHYPDãþRELNHU
1HNDWHUDåLYLODNRWQSUFHODMDMFDLQ
zaprte posode, n.pr. zaprti kozarci za
vlaganje, lahko eksplodirajo in niso
primerni za kuhanje ali segrevanje v
WHPSHUDWXUHPDãþREHQLPRJRþH
nadzirati, bi lahko prišlo do poškodb
uporabnika.
• Pokovko (pop-corn) smete pripravljati v
PLNURYDORYQLSHþLFL2EþDVQRWXGL
posebno, temu namenjeno posodo oz.
zakrknjena jajca med kuhanjem
eksplodirajo. Vedno pred kuhanjem
prebodite rumenjak in jajce pokrijte;
SRVHEQH]DYRMþNHSRNRYNHSULSUDYOMHQH
SXVWLWHJDSRþLYDWLHQRPLQXWRLQãHOH
PLNURYDORYQLSHþLFLOHþHXSRUDELWH
nato dvignite pokrov.
• Nikoli ne poskušajte na silo zavrteti
]DSULSUDYRYPLNURYDORYQLSHþLFL0HG
pripravo pokovke nadzirajte delovanje
PLNURYDORYQHSHþLFH
•
3RVHJUHYDQMXSXVWLWHWHNRþLQRãHQHNDM
QRVLOFD]DYUWOMLYRSORãþRODKNRELJD
pokvarili.
äLYLOD]QHSRUR]QROXSLQRSUHGNXKDQMHP
•
YPLNURYDORYQLSHþLFLYHþNUDWSUHERGLWH
,VNUHQMHYPLNURYDORYQLSHþLFLPHG
WDNRERVWHSUHSUHþLOLQDELUDQMHSDUHSRG
GHORYDQMHPMHRELþDMQRSRVOHGLFD
OXSLQR]DUDGLþHVDUELQSUNURPSLUSRþLO
7DNDåLYLODVRQSUMDERONDNURPSLU
uporabe kovinskih predmetov. Pogosto
iskrenje pa bi lahko pokvarilo
SLãþDQþMDMHWUDLQMDMþQLUXPHQMDNL
PLNURYDORYQRSHþLFR]DWRXVWDYLWH
GHORYDQMHSHþLFHLQSUHYHULWHNDMJD
POZOR!ýHYPLNURYDORYQLSHþLFL
SRY]URþD
• Pazite, da ne zakrijete odprtin za
VHJUHYDWHWHNRþLQHQSUMXKHRPDNHLQ
SLMDþHVHWHODKNRSUHJUHMHMRþH]YUHOLãþH
]UDþHQMHNLVRQDYUKX]DGDMREVWUDQL
ne da bi se to pokazalo z nastajanjem
LQQDGQXPLNURYDORYQHSHþLFH
PHKXUþNRY=DWRODKNRSULGHGRQHQDGQHJD
NLSHQMDYURþHWHNRþLQH'DELWRSUHSUHþLOL
XNUHSDMWHQDQDVOHGQMLQDþLQ
7RPLNURYDORYQRSHþLFRVPHWH
1. Izogibajte se uporabi posod z ravnimi
stranicami in ozkim grlom.
2. 1HSUHJUHYDMWHWHNRþLQ
3. 3UHGHQYOLMHWHWHNRþLQRYSRVRGRMR
premešajte; ponovno jo premešajte na
sredi kuhanja.
uporabljati samo v gospodinjske
namene; za uporabo v komercialne
namene ni primerna!
Ta navodila shranite!
5
Downloaded From Microwave-Manual.com Manuals
X
EMM2015
3RVRGDLQSULSRPRþNLSULPHUQL]DXSRUDERYPLNURYDORYQLSHþLFL
3ULNXKDQMXYPLNURYDORYQLSHþLFLODKNR
Zaradi vaše varnosti, pa tudi zato, da ne bi
XSRUDELWHPQRJRUD]OLþQLKPDWHULDORY
SRãNRGRYDOLSRVRGHYYDãLPLNURYDORYQLSHþLFL
se pri izbiri posode ravnajte po spodnji tabeli.
Material
3RVRGDR]SULSRPRþNL
Keramika in
steklo
Mikrovalovi
äDU
Mikrovalo
Toplotnoodporno steklo
DA*
DA
DA*
Steklena posoda s kovinskimi
obrobami ali okraski
NE
NE
NE
6YLQþHQRNULVWDOQRVWHNOR
NE
DA
DA
DA
NE
DA
DA
NE
NE
NE
DA
NE
DA
NE
DA
DA
NE
NE
DA
DA
NE
NE
DA
NE
DA
NE
NE
DA
DA
DA
DA
DA
DA
DA
YLLQåDU
Porcelan
Keramika**
Plastika
brez kovinskih okraskov
=DXSRUDERYPLNURYDORYQLSHþLFL
primerna, toplotnoodporna plastika
3ODVWLþQHYUHþNH
Kovina
.RYLQVNLSHNDþL
Aluminijasta folija***
Papir
Les
Dodatna
oprema
6NRGHOLFHNURåQLNLEULVDþH
5HãHWND]DSULSUDYRMHGLQDåDUX
9UWOMLYDSORãþD
1RVLOHFYUWOMLYHSORãþH
DA: za uporabo primerna posoda
NE: posoda, ki ni primerna
*Samo posoda brez kovinske obrobe
6DPRþHJOD]XUDQHYVHEXMHNRYLQVNLKVQRYL
$OXPLQLMDVWRIROLMRXSRUDEOMDMWHVDPRYPDQMãLKNROLþLQDKYHþMHNROLþLQHELSRY]URþLOHLVNUHQMH
7HKQLþQLSRGDWNL
Mere
Širina 484 mm
Globina 376 mm
Višina 285 mm
1RWUDQMRVWSHþLFH
Širina 300 mm
Globina 292 mm
Višina 195 mm
13.5 kg
Prostornina 20 litrov
7HåD
230 V, 50 Hz
3ULNOMXþQDQDSHWRVW
Poraba energije
Mikrovalovi 1300 W
äDU 1000 W
0Rþ
Mikrovalovi 800 W
äDU 1000 W
6
Downloaded From Microwave-Manual.com Manuals
X
EMM2015
Navodila za namestitev in priklop
2GVWUDQMHYDQMHHPEDODåH
Aparat je izdelan skladno s predpisi EEC št.
.RRGVWUDQLWHHPEDODåRVHQDMSUHM
]GQHRSUHSUHþHYDQMX
SUHSULþDMWHGDMHYDãDQRYDPLNURYDORYQD
radijskih motenj.
SHþLFDQHSRãNRGRYDQD9QDVSURWQHP
3ULNOMXþLWHYQDHOHNWULþQRRPUHåMH
primeru se takoj obrnite na prodajalca. Deli
0LNURYDORYQDSHþLFDPRUDELWL
SHþLFHERGRPRUGD]DãþLWHQLVIROLMRWR
ozemljena! Proizvajalec ne prevzema
odgovornosti za škodo ali poškodbe zaradi
neupoštevanja teh navodil.
PRUDWHSUHGSUYRXSRUDERSHþLFHRGVWUDQLWL
3D]LWHGDNRVLHPEDODåHQHSULGHMRYURNH
majhnim otrokom!
3HþLFDMHGREDYOMHQDVSULNOMXþQLP
Namestitev
1. Snemite nalepke z vrat.
2. 3RVWDYLWHSHþLFRQDUDYQRJODGNR
HOHNWULþQLPNDEORPLQYWLNDþHP]DRPUHåMH]
napetostjo 230 V, 50 Hz. Ozemljitev
zmanjšuje tveganje v primeru kratkega
stika.
SRYUãLQRNLSUHQHVHWHåRSHþLFH
NJLQYVHELQH'DSUHSUHþLWHPRUHELWQH
ýHQLVWHSUHSULþDQLþHMHYDãHKLãQR
vibracije in glasnost delovanja, mora biti
RPUHåMHXVWUH]QRR]LURPDþHMHSRVNUEOMHQR
PLNURYDORYQDSHþLFDVWDELOQD
3.
za ozemljitev, se posvetujte s
strokovnjakom.
3HþLFDQDMQHERL]SRVWDYOMHQDYODJLLQ
YURþLQLVDMELVHSRãNRGRYDOD
4.
2GSUWLQHQDYUKXLQREVWUDQHKSHþLFH
ýHYWLNDþVNDWHULPMHSHþLFDGREDYOMHQDQL
morajo ostati proste, zato ne odlagajte
XVWUH]HQ]DYDãRYWLþQLFRJDMHSRWUHEQR
QLþHVDUQDPLNURYDORYQRSHþLFRýHVR
]DPHQMDWL]XVWUH]QLP,]YWLNDþDNLVWHJD
odprtine zakrite, lahko pride do
RGUH]DOLVSULNOMXþQHJDHOHNWULþQHJDNDEOD
SUHJUHYDQMDLQGRRNYDUHSHþLFH,]
RGVWUDQLWHYDURYDONRLQJDQDWR]DYUåLWHGD
RGSUWLQXKDMDYURþ]UDN]DWRSD]LWHGD
SUHSUHþLWHPRUHELWQRQH]JRGR
VHQHRSHþHWH=DSHþLFRQHREHãDMWH
zaves.
5.
ýHQDYWLNDþXPDQMNDSRNURYþHNQDG
3HþLFDQDMERþLPGOMHRGUDGLMVNLKDOL
YDURYDONRWDNHJDYWLNDþDQHVPHWH
79VSUHMHPQLNRYGDQHELSRY]URþDOD
SULNOMXþLWLQDHOHNWULþQRRPUHåMHDPSDN
PRWHQM7DPLNURYDORYQDSHþLFDMH
PRUDWHQDMSUHMQDPHVWLWLQRYSRNURYþHN
izdelana skladno s predpisi EEC o
odpravljanju radijskih motenj, vendar pa
ýHXSRUDEOMDWHSRGDOMãHNPRUDELWLWD
REVWDMDPRåQRVWGRORþHQLKPRWHQMþH
ozemljen!
MHSHþLFDSRVWDYOMHQDSUHEOL]X
radijskega ali televizijskega
sprejemnika.
6.
Aparat mora biti ozemljena!
Proizvajalec ne prevzema odgovornosti za
škodo ali poškodbe zaradi neupoštevanja
teh navodil.
• ýHSULORåHQLYWLNDþQHXVWUH]DYDãLP
ýHSRVWDYLWHSHþLFRYNRWPRUDELWLRG
desnega zida odmaknjena vsaj 10 cm!
Pozor! 0LNURYDORYQRSHþLFRODKNRSRVWDYLWH
kamorkoli v kuhinji. Paziti pa morate, da jo
postavite na ravno, površino in da so
YWLþQLFDPQDMJD]DPHQMD]DWR
usposobljena oseba.
RGSUWLQH]D]UDþHQMHSURVWHSUDYWDNRSD
•
PRUDELWLRPRJRþHQRWXGLNURåHQMH]UDND
,]RGUH]DQHJDYWLNDþDRGVWUDQLWH
YDURYDONRLQJD]DYU]LWHGDSUHSUHþLWH
SRGSHþLFR
morebitno nezgodo.
7
Downloaded From Microwave-Manual.com Manuals
X
EMM2015
2SLVPLNURYDORYQHSHþLFH
1
2
3
9
5
8
6
4
4
7
10
1.
2.
3.
4.
5.
6.
7.
3URVWRU]DNXKDQMH3RYVDNLXSRUDELJDRþLVWLWH
2NQRVNR]LNDWHUHJDODKNRQDG]RUXMHWHNXKDQMHPHGGHORYDQMHPSHþLFH
9UDWDSHþLFH0HGNXKDQMHPPRUDMRELWLYHGQRGREUR]DSUWD
.DYHOMþNL]DSDKDLQYDUQRVWQLVLVWHP]DSLUDQMD
8SUDYOMDOQDSORãþD
3RJRQVNDRVYUWOMLYHSORãþH
9UWOMLYDSORãþDL]SRVHEQHJDQDYURþLQRRGSRUQHJDVWHNOD1DQMRSRVWDYLWHMHGY
XVWUH]QLSRVRGL1HXSRUDEOMDMWHPLNURYDORYQHSHþLFHEUH]YUWOMLYHSORãþH
8. 1RVLOHFYUWOMLYHSORãþH3RVWDYLWHJDQDGQRSURVWRUD]DNXKDQMH
9. *UHOHFåDUD
10.5HãHWND]DSULSUDYOMDQMHMHGLQDåDUX
9UWOMLYDSORãþDLQQRVLOHF
9UWOMLYDSORãþD
1DPHVWLWHMXNRWNDåHVNLFD3D]LWHGDMH
YUWOMLYDSORãþDSUDYLOQRSRVWDYOMHQDQD
QRVLOHF1LNROLQHREUDþDMWHYUWOMLYHSORãþHV
VSRGQMRVWUDQMRQDY]JRU9UWOMLYDSORãþDVH
vrti na levo ali na desno.
Nosilec
=DSULSUDYOMDQMHMHGLQDåDUXMHSULORåHQD
tudi rešetka, ki jo postavite na sredino
Os vrtljive
YUWOMLYHSORãþH
SORãþH
8
Downloaded From Microwave-Manual.com Manuals
X
EMM2015
8SUDYOMDOQDSORãþD
1.
*XPE]DQDVWDYOMDQMHPRþL
mikrovalov in izbiranje funkcij
=DQDVWDYOMDQMHXVWUH]QHPRþL
PLNURYDORYIXQNFLMHåDUDLQNRPELQDFLMH
åDUDLQPLNURYDORY
2. Gumb programske ure
Za nastavljanje trajanja kuhanja;
PLNURYDORYQDSHþLFD]DþQHGHORYDWL9VH
SURJUDPVNHXUHVREROMQDWDQþQHþH
JXPEQDMSUHM]DYUWLWHQDSUHMRGåHOHQHJD
þDVDLQQDWRQD]DMQDåHOHQRYUHGQRVW
9
Downloaded From Microwave-Manual.com Manuals
X
EMM2015
Kuhanje z mikrovalovi
1. Odprite vrata in postavite jed na vrtljivo
YHþMRYUHGQRVWLQQDWRQD]DMQDXVWUH]QR
vrednost.
SORãþR=DSULWHYUDWD
2.
3.
6SRPRþMRJXPED]DQDVWDYOMDQMHPRþL
PLNURYDORYQDVWDYLWHXVWUH]QRPRþJO
ýHåHOLWHSHþLFRL]NORSLWLPHGNXKDQMHP
spodnjo razpredelnico).
preprosto obrnite gumb programske ure na 0..
1DVWDYLWHSRWUHEHQþDV]REUDþDQMHP
Opomba: Po uporabi obrnite gumb programske
JXPED]DQDVWDYOMDQMHþDVD
XUHQD]DMQDVLFHUERSHþLFDãHQDSUHM
delovala.
3HþLFD]DþQHGHORYDWL
ýHåHOLWHQDVWDYLWLNUDMãLþDVNXKDQMDRG
minut, gumb programske ure obrnite naprej na
2SRPED6SULWLVNRPQDWLSNR0LFURSRYHþDWH
PRþPLNURYDORY]:QD:
Primer: .XKDQMHPLQXWSULPRþLPLNURYDORY:
*XPE]DQDVWDYOMDQMHPRþLPLNURYDORYREUQLWHQD:
*XPE]DQDVWDYOMDQMHþDVDREUQLWHQD
3HþLFD]DþQHGHORYDWLGHORYDODERPLQXWSULPRþL:
Segrevanje ohlajenih gotovih jedi
•
8SRãWHYDMWHQDYRGLODSURL]YDMDOFDYHQGDUSDVHYHGQRSUHSULþDMWHþHMHMHGUHVGREUR
VHJUHWDýHQHþDVVHJUHYDQMDSRGDOMãDMWH±SRGREQRNRWYRELþDMQLSHþLFL
•
•
-HGREþDVQRSUHPHãDMWHSUHGYVHPSULVHJUHYDQMXHQRORQþQLFRPDN«
ýDVSRþLYDQMDMH]HORSRPHPEHQWDþDVMHGHOSURFHVDNXKDQMDLQRPRJRþDGDVH
temperatura enakomerno razporedi.
8VWUH]QHQDVWDYLWYHPRþLPLNURYDORY
0RþPLNURYDORY
100 W
180 W
300 W
Primerno za:
Ohranjanje toplote
2GWDOMHYDQMH]DPU]QMHQLKåLYLO
3RþDVQRVHJUHYDQMHGRNXKDYDQMHHQRORQþQLFVHJUHYDQMH
VLURYHJDNRODþDLSG
450 W
6UHGQMDPRþ±KLWUHMãHRGWDOMHYDQMHLQVHJUHYDQMHHQRORþQLF
JRODåD«
600 W
6UHGQMDPRþVHJUHYDQMHJRWRYLKMHGLSHþHQMHGRORþHQLK
SHFLYLQNXKDQMHSXGLQJRYSHþHQMHPHVDSHUXWQLQH«
800 W
1DMYHþMDPRþVHJUHYDQMHWHNRþLQGRYUHOLãþDNXKDQMH
]HOHQMDYH«6HJUHYDQMHSRVRGH]DKUXVWOMDYR]DSHþHQH
jedi.
10
Downloaded From Microwave-Manual.com Manuals
X
EMM2015
8SRUDEDåDUD
1.
2.
3RVWDYLWHYUWOMLYRSORãþRQDQRVLOHFQDGQX
SHþLFHLQSRVWDYLWHMHGQDNRYLQVNRUHãHWNR
,]EHULWHIXQNFLMR
äDU
1DVWDYLWHSRWUHEHQþDV]REUDþDQMHP
7DQDþLQMH]HORSULPHUHQ]DSHþHQMHPHVD
JXPED]DQDVWDYOMDQMHþDVD3HþLFD
– zrezkov, zarebrnic… Ne pozabite –
]DþQHGHORYDWL
SHþLFDVHER]HORVHJUHOD
.RMHMHGSHþHQDREUQLWHJXPE]D
QDVWDYOMDQMHþDVDQDYUHGQRVWþHQHER
PLNURYDORYQDSHþLFDãHQDSUHMGHORYDOD
Primer: 3HþHQMH]åDURPPLQXW
=JRUQMLJXPEREUQLWHQDVLPERO]DåDU
.
*XPE]DQDVWDYOMDQMHþDVDREUQLWHQD
3HþLFD]DþQHGHORYDWLVIXQNFLMRåDUD
8SRUDEDNRPELQDFLMHPLNURYDORYLQåDUD
1.
2.
3RVWDYLWHYUWOMLYRSORãþRQDQRVLOHFQDGQX
SHþLFHLQSRVWDYLWHMHGQDNRYLQVNRUHãHWNR
,]EHULWHIXQNFLMR
0LNURYDORYLåDU
1DVWDYLWHSRWUHEHQþDV]REUDþDQMHP
7DQDþLQMH]HORSULPHUHQ]DSHþHQMHPHVD
JXPED]DQDVWDYOMDQMHþDVD3HþLFD
– zrezkov, zarebrnic… Ne pozabite –
]DþQHGHORYDWL
SHþLFDVHER]HORVHJUHOD
.RMHMHGSHþHQDREUQLWHJXPE]D
QDVWDYOMDQMHþDVDQDYUHGQRVWþHQHER
PLNURYDORYQDSHþLFDãHQDSUHMGHORYDOD
Primer: .XKDQMHPLQXWSULPRþLPLNURYDORYLQLQ]JUHOFHP]DåDU
1.
=JRUQMLJXPEREUQLWHQDVLPERO]DNRPELQDFLMRPLNURYDORYLQåDUD
.
2.
*XPE]DQDVWDYOMDQMHþDVDREUQLWHQD
3.
3HþLFD]DþQHGHORYDWLMHGVHNXKDLQSHþHVNRPELQDFLMRPLNURYDORYLQåDUD
Opomba:
ýHPHGNXKDQMHPRGSUHWHYUDWDSHþLFHVHSHþLFDL]NORSL.RSRQRYQR]DSUHWHYUDWDVH
NXKDQMHQDGDOMXMH3RSRWHNXQDVWDYOMHQHJDþDVDVHL]NORSLMRPLNURYDORYLLQåDURJODVLVH
]YRþQLVLJQDO
9WHPQDþLQXODKNRPHGGHORYDQMHPSHþLFHVSUHPHQLWHQDVWDYOMHQRPRþLQWUDMDQMH
11
Downloaded From Microwave-Manual.com Manuals
X
EMM2015
3UDNWLþQLQDVYHWL]DXSRUDERåDUD
äLYLORSRVWDYLWHQDUHãHWNRSRGQMRSDSRGVWDYLWHNURåQLNYNDWHUHJDERGRNDSOMDOLVRNRYLLQPDãþREDGDER
þLãþHQMHODåMH1DSRORYLFLSUHGYLGHQHJDþDVDåLYLORREUQLWH
äLYLOR
.ROLþLQD
ýDV
Opombe
4-5 minut
6-7 minut
4-5 min. sam kruh, nato dodate sir za 2 min
WHåD
2SHþHQLNUXK
Toast s sirom
2 rezini
4 rezine
3UDNWLþQLQDVYHWL]DNXKDQMH]PLNURYDORYLLQåDURP
3ULSHþHQMXJRYHGLQHDOLVYLQMLQHSRVWDYLWHPHVRQDUHãHWNRWDQMãHGHOH]DãþLWLWHVIROLMR3RGUHãHWNR
SRGVWDYLWHNURåQLNYNDWHUHJDERGRNDSOMDOLVRNRYLLQPDãþREDGDERþLãþHQMHODåMH1DSRORYLFL
SUHGYLGHQHJDþDVDåLYLORREUQLWH
äLYLOR
.ROLþLQDWHåD
Slanina
Govedina
Svinjina
4 (100 g)
900 g
900 g
Funkcija
Combi 3
Samo mikrovalovi –
800 W
ýDVPLQXWH
Combi 2
5–6
Combi 2
20 - 25
7-9
25
Opombe
1DPDåLWH]ROMHP
]DþLQLWHVVROMRLQ
poprom. Po kuhanju
SXVWLWHSRþLYDWLGR
minut.
Svinjske
zarebrnice
2-3 (450 g)
1DPDåLWH]ROMHP
]DþLQLWHVVROMRSRSURP
in papriko.
450 g
800 g
3LãþDQHF
(polovica,
stegna)
Zamrznjeni
hamburgerji
Klobase
Ribji fileji
Combi 1
15 – 20
4 (200 g)
Combi 1
Combi 2
25 – 30
12 – 15
450 g
2 (350 g)
Combi 1
Combi 3
10 – 15
22 – 24
1DPDåLWH]ROMHP
]DþLQLWHVVROMRSRSURP
in papriko.
1DPDåLWH]ROMHP
]DþLQLWHVVROMRLQ
poprom.
Zamrznjen
krompir
2 (150 g)
Combi 2
16 – 18
6WRSQMHPLNURYDORYLLQåDU
Simbol
Nastavitev
0RþPLNURYDORY
0RþåDUD
äDU
0W
1000 W
Combi 1
300 W
1000 W
Combi 2
450 W
1000 W
Combi 3
600 W
1000 W
12
Downloaded From Microwave-Manual.com Manuals
X
EMM2015
2GWDOMHYDQMH]DPU]QMHQLKåLYLOVIXQNFLMR
Priprava
äLYLOR
180 W
ýDVPLQXWH
ýDV
(180 W)
SRþLYDQMD
(minute)
Kruh
âWUXþND
3RORåLWHQDNURåQLNDOLSDSLU1D
8 – 10
10 – 15
10 – 13
10
45 – 60 sekund
45 – 60 sekund
1–1½
5
5
5
9 – 11
15 – 30
9 – 11
15 – 30
7–9
15 – 30
7–9
15 – 30
3–4
5 – 10
5–6
5 – 10
7–8
5 – 10
7–8
5 – 10
SRORYLFLSUHGYLGHQHJDþDVD
obrnite.
Narezana štruca
3RORåLWHQDNURåQLNDOLSDSLU1D
SRORYLFLSUHGYLGHQHJDþDVD
obrnite.
2 rezini
3RORåLWHQDNURåQLNDOLSDSLU
URJOMLþ
3RORåLWHQDNURåQLNDOLSDSLU
URJOMLþD
3RORåLWHQDNURåQLNDOLSDSLU
Pecivo
.RODþJ
2GVWUDQLWHHPEDODåRSRVWDYLWH
QDNURåQLN
6LURYNRODþJ
2GVWUDQLWHHPEDODåRSRVWDYLWH
QDNURåQLN
Pita (s kuhanim
nadevom) 450 g
Piškoti 450 g
2GVWUDQLWHHPEDODåRSRVWDYLWH
QDNURåQLN
2GVWUDQLWHHPEDODåRSRVWDYLWH
QDNURåQLN
Maslo 250 g
Odstranite folijo, postavite na
NURåQLN
Sadje
-DJRGLþMHJ
Eno plast razgrnite na plitek
NURåQLN
-DJRGLþMHJ
Eno plast razgrnite na plitek
NURåQLN
Gotove jedi 400
g
1DNURåQLNXSRNULMWH]GUXJLP
NURåQLNRPDOL39&IROLMRýH
åHOLWHMHGWXGLVHJUHWLMR
Zelenjava
minute segrevajte pri 800 W.
Odtaljevanje pred kuhanjem ni
potrebno. Vso zelenjavo odtajate
LQVNXKDWHSULPRþL
W).
13
Downloaded From Microwave-Manual.com Manuals
X
EMM2015
3UDNWLþQLQDVYHWL
•
•
3HþLFRUHGQRþLVWLWH9VDNLþREULãLWH
WHNRþLQRNLVHYDPMHPRUGDSROLODQH
RELþDMQHPNXKDQMX=DþLPEHERVWH
SR]DELWHRþLVWLWLWXGLSRGVWHNOHQRSORãþR
GRGDOLSR]QHMHþHERWRSRWUHEQR
in notranjo stran vrat.
•
8SRUDEOMDWHPDQMVROLLQ]DþLPENRWSUL
•
.RL]NORSLWHSHþLFRSXVWLWHKUDQRQHNDM
•
3UHGHQSRVWUHåHWH]MHGPLVHYHGQR
•
8SRUDEOMDMWH]DãþLWQHNXKLQMVNHURNDYLFH
ýHMHOHPRJRþHSULNXKDQMXY
þDVDSRþLYDWLWDNRERGRUH]XOWDWLEROMãL
PLNURYDORYQLSHþLFLXSRUDEOMDMWHRNURJOH
ali ovalne posode s pokrovom.
• Nikoli ne uporabljajte kovinskih posod ali
posod s kovinskimi okraski ali obrobami.
Tudi nekatere vrste plastike za uporabo
SUHSULþDMWHGDVRVHGRYROMVHJUHOH
NRMHPOMHWHKUDQRL]PLNURYDORYQHSHþLFH
Taljenje medu
Med, ki je kristaliziral, v odprtem kozarcu
YPLNURYDORYQLSHþLFLQLVRSULPHUQHVDM
VHODKNR]DUDGLYURþHKUDQHNLVHYQMLK
segreva, stalijo.
• Med kuhanjem naj bo hrana pokrita.
SRVWDYLWHYPLNURYDORYQRSHþLFR6HJUHYDMWH
JDPLQXWLSULVUHGQMLPRþLPLNURYDORY
8SRUDEOMDMWHVWHNOHQHSRNURYHNURåQLNH
•
•
DOLSRYRãþHQLSDSLU
7DOMHQMHþRNRODGH
3HFLYRNUXKLQSRGREQDåLYLODODKNR
JþRNRODGHQDNRãþNHQDORPLWHY
postavite v mikrovalovno kar v košarici
posodo. Segrevajte jo 1 do 2 minuti pri
]DNUXKDOLQDSDSLUQDWLEULVDþL
QDMYHþMLPRþLPLNURYDORYLQGREUR
ýH]DPU]QMHQDåLYLODWDMDWHNDUYYUHþNL
premešajte.
v kateri so bila zamrznjena, morate to
SUHMRGYH]DWLDOLRGSUHWLäLYLODNLVRELOD
0HKþDQMHDOLWDOMHQMHPDVOD
zamrznjena v posodah, smete v isti
3ULQDMYHþMLPRþLPLNURYDORYVHPDVORY
HPEDODåLRGWDOMHYDWLYPLNURYDORYQLSHþLFL
QHNDMVHNXQGDKVWDOLýHJDåHOLWHVDPR
OHþHMHHPEDODåDSULPHUQD]DXSRUDERY
RPHKþDWLL]EHULWHQLåMRPRþPLNURYDORY
PLNURYDORYQLSHþLFL2GVWUDQLWLSDPRUDWH
Segrevanje kruha
Kruh od prejšnjega dne nekaj sekund
YVHNRYLQVNHVSRQNHDOLåLþNH
• Manjše kose aluminijaste folije uporabite,
GD]DãþLWLWHWDQMãHGHOHR]LURPDGHOHNL
VHJUHYDMWHSULVUHGQMLPRþL
ELVH]ODKNDSUHNXKDOLQSUSLãþDQþMD
•
krilca.
(QRVWDYQROXSOMHQMHþHVQD
äLYLOD]OXSLQRDOLNRåRSUHGNXKDQMHP
GRVWURNHþHVQDVHNXQGVHJUHYDMWH
prebodite z vilico, n.pr. krompir ali
klobase. Jajc v lupini ne smete kuhati v
SULQDMYHþMLPRþL1DWRQDHQHPNRQFX
VWLVQLWHVWURN±þHVHQERVNRþLOL]OXSLQH
PLNURYDORYQLSHþLFLNHUELODKNR
•
eksplodirala.
Sadni sok
9HOLNHGHEHOHNRVHSRORåLWHNUREX
,]DJUXPRYERVWHL]WLVQLOLYHþVRNDþHMLK
SRVRGHåLYLODUD]UHåLWHQDNDUQDMEROM
najprej za 15 minut postavite v
enakomerno debele kose.
PLNURYDORYQRSHþLFRSULQDMYHþMLPRþL
•
+UDQDEREROMHQDNRPHUQRNXKDQDþHMR
•
9HGQRQDVWDYLWHQHNROLNRNUDMãLþDV
Pripravljanje instant hrane
Upoštevajte navodila proizvajalcev!
ERVWHPHGNXKDQMHPYHþNUDWSUHPHãDOL
NXKDQMDNRWJDSULSRURþDUHFHSW7DNR
VHYDPKUDQDQHERSUHNXKDOD9HþMH
NROLþLQHKUDQHVHNXKDMRGOMHþDVD
•
=HOHQMDYRNXKDMWHY]HORPDMKQLNROLþLQL
vode ali brez nje.
14
Downloaded From Microwave-Manual.com Manuals
X
EMM2015
ýLãþHQMHLQY]GUåHYDQMH
3HþLFDQDMERYHGQRþLVWD2VWDQNLKUDQHNL
ýLãþHQMH]XQDQMRVWL
ELRVWDOLYPLNURYDORYQLSHþLFLELSULYODþLOL
.RþLVWLWHXSUDYOMDOQRSORãþRQDMERGRYUDWD
PLNURYDORYQRHQHUJLMRLQVHVHåJDOL7DNREL
SHþLFHRGSUWD7DNRMHQHERVWHPRJOL
VHODKNRXþLQNRYLWRVWSHþLFH]PDQMãDOD
nehote vklopiti.
pojavil bi se pa tudi neprijeten vonj.
Nikoli ne poskušajte sami spreminjati
=XQDQMRVWSHþLFHþLVWLWH]EODJLPWHNRþLP
]QDþLOQRVWLSHþLFHDOLMRVDPLSRSUDYOMDWL7R
REULãLWHVþLVWRYRGRLQGRVXKHJDREULãLWH]
GHWHUJHQWRPLQYRGRQDWRSDMRGRþLVWHJD
SUHSXVWLWHVWURNRYQMDNRPVSRREODãþHQHJD
mehko krpo.
servisa.
3ULþLãþHQMXODKNRXSRUDELWHWXGLþLVWLOD]D
RNQDDOLYHþQDPHQVNDþLVWLOD]D
3UHSULþDMWHVHGDMHPLNURYDORYQDSHþLFD
razprševanje. Nikoli pa ne smete uporabljati
L]NORSOMHQDL]HOHNWULþQHJDRPUHåMD
DEUD]LYQLKþLVWLOLQSULSRPRþNRY3ULþLãþHQMX
pazite, da voda ne prodre v odprtine za
SUHGHQMR]DþQHWHþLVWLWL
]UDþHQMHNHUELVHWDNRSHþLFD
ýLãþHQMHRSUHPH
poškodovala.
Dele v notranjosti poberite iz mikrovalovne
ýLãþHQMHJUHOFD]DåDU
SHþLFHLQMLKRSHULWH]EODJLPþLVWLORP=
QRVLOFHPYUWOMLYHSORãþHUDYQDMWHãH
*UHOHFVHPHGXSRUDERSHþLFHODKNR
posebno previdno.
XPDåH±PDãþREDDOLROMHEUL]JDQDQM
1RWUDQMRVWSHþLFHLQYUWOMLYLSODGHQMVHPHG
3RþDNDMWHGDVHQRWUDQMRVWSHþLFHRKODGLLQ
kuhanjem zelo segrejeta; po uporabi
QDWRREULãLWHJUHOHFGDSUHSUHþLWHQHSULMHWHQ
PLNURYDORYQHSHþLFHQDMSUHMSRþDNDMWHGD
vonj ali nastanek dima pri naslednji uporabi
se notranjost popolnoma ohladi.
SHþLFH
ýLãþHQMHQRWUDQMRVWL
3HþLFDQDMERYHGQRþLVWD7DNRMSRXSRUDEL
MRREULãLWHLQRþLVWLWH2VWDQNLKUDQHQD
stenah, vratih in tesnilu vrat absorbirajo,
mikrovalovno energijo, zmanjšujejo
XþLQNRYLWRVWSHþLFHLQYGRORþHQLKSULPHULK
poškodujejo notranjost.
=DþLãþHQMHXSRUDEOMDMWHEODJDWHNRþDþLVWLOD
WRSORYRGRLQPHKNRþLVWRNUSR1LNROLQH
XSRUDEOMDMWHDEUD]LYQLKþLVWLOþLVWLO]D
HOHNWULþQHSHþLFHDOLEOD]LQLFMHNOHQHYROQH
7UGRYUDWQHPDGHåHERVWHODåMHRþLVWLOLþH
prej v mikrovalovni 2 do 3 minute segrevate
NR]DUHFYRGH3ULþLãþHQMXVLQHVPHWH
QLNROLSRPDJDWL]RVWULPLNRQLþDVWLPL
predmeti!
ýHVHYSHþLFLUD]YLMHQHSULMHWHQYRQM
segrevajte v njej 5 minut kozarec vode z
GYHPDåOLFDPDOLPRQLQHJDVRND
15
Downloaded From Microwave-Manual.com Manuals
X
EMM2015
Nepravilnosti v delovanju in servisiranje
ýHPLNURYDORYQDSHþLFDQHGHOXMHQDMSUHMSRVNXãDMWHVDPLRGSUDYLWLQHSUDYLOQRVWSR
VSRGQMLKQDYRGLOLKãHOHQDWRVHREUQLWHQDSRREODãþHQLVHUYLV
ýHPLNURYDORYQDSHþLFDQHGHOXMH
ýHYDPQHXVSHRGSUDYLWLQHSUDYLOQRVWLY
pravilno:
• 3UHSULþDMWHVHGDVRYWLNDþYWLþQLFDLQ
varovalka brezihibni; po potrebi
zamenjajte varovalko.
• 3UHSULþDMWHVHGDMHRPUHåMHSRGWRNRP
GHORYDQMXVHREUQLWHQDSRREODãþHQLVHUYLV
Zahtevajte uporabo originalnih rezervnih
delov.
Rezervni deli so vam na voljo pri
SRREODãþHQLKVHUYLVLK]DSURL]YRGH
(OHFWUROX[.RVHREUQHWHQDSRREODãþHQL
YYWLþQLFRYNORSLWHGUXJLHOHNWULþQLDSDUDW
•
servis, prosimo, da navedete vaše ime in
ýHYDURYDONDYHþNUDWSUHJRULSRNOLþLWH
QDVORYQDWDQþHQRSLVQHSUDYLOQRVWLPRGHO
XVWUH]QRXVSRVREOMHQHJDHOHNWULþDUMD
in serijsko številko proizvoda (navedeni na
tablici s podatki) ter datum nakupa..
ýHPLNURYDORYQDSHþLFDQHGHOXMHY
QDþLQX]DPLNURYDORYH
• Morda je nastavljena varnostna funkcija
(nekateri modeli).
• Morda niste izbrali pravilnih nastavitev.
• 0RUGDQLVR]DSUWDYUDWDýHYUDWDQLVR
]DSUWDPLNURYDORYQDSHþLFDQHGHOXMH
• Morda ostanki hrane ovirajo zapiranje
vrat.
3ULGUåXMHPRVLSUDYLFRWRWHKQLþQLKVSUHPHPEEUH]SUHGKRGQHJDREYHVWLOD3ULGUåXMHPRVLSUDYLFR
do tiskarskih napak.
16
Downloaded From Microwave-Manual.com Manuals
e
EMM2015
4
4
4
5
6
6
7
8
8
8
8
9
9
9
10
11
11
12
12
13
13
13
14
15
16
W)
16
16
16
17
18
3
Downloaded From Microwave-Manual.com Manuals
e
EMM2015
•
•
1.
2.
4
Downloaded From Microwave-Manual.com Manuals
,
5.
´
4.
³
•
3.
•
•
•
•
•
•
Electrolux •
•
•
•
•
.
(OHFWUROX[
e
EMM2015
4.
5.
800
•
•
5
Downloaded From Microwave-Manual.com Manuals
•
: •
2.
3.
1.
e
EMM2015
•
•
•
•
V, 50 Hz
W
W
W
1.
•
•
:
4.
2.
3.
•
W
6
Downloaded From Microwave-Manual.com Manuals
e
EMM2015
*
3
7
Downloaded From Microwave-Manual.com Manuals
e
EMM2015
9+]
1.
2.
4.
5.
•
•
•
•
•
6.
3.
8
Downloaded From Microwave-Manual.com Manuals
e
EMM2015
1
2
3
9
5
8
6
4
4
7
10
1.
1.
2.
2.
4.
5.
6.
7.
•
9
Downloaded From Microwave-Manual.com Manuals
•
•
9.
10.
8.
3.
e
EMM2015
1.
2.
10
Downloaded From Microwave-Manual.com Manuals
e
EMM2015
1.
2.
1.
2.
3.
•
•
•
W.
W.
:
3.
100 W
(180) W
300 W
450 W
600 W
800W
11
Downloaded From Microwave-Manual.com Manuals
e
EMM2015
2.
1.
2.
3.
2.
1.
2.
3.
W
1.
12
Downloaded From Microwave-Manual.com Manuals
e
EMM2015
±
±
±
±
±
±
±
±
±
±
0W
1000 W
300 W
1000 W
450 W
1000 W
600 W
1000 W
13
Downloaded From Microwave-Manual.com Manuals
±
±
800 W
± e
EMM2015
8 - 10
10 –13
2
45 – 60
45 –60
1–1½
9 – 11
9 – 11
7–9
7–9
3–4
5–6
7–8
W W ).
14
Downloaded From Microwave-Manual.com Manuals
7–8
e
EMM2015
•
•
•
±
•
•
•
•
•
•
•
•
±
•
•
•
15
Downloaded From Microwave-Manual.com Manuals
•
•
•
•
•
•
±
±
•
•
•
•
e
EMM2015
16
Downloaded From Microwave-Manual.com Manuals
e
EMM2015
±
±
•
•
•
•
•
1.
2.
Downloaded From Microwave-Manual.com Manuals
17
Electrolux
:
•
•
:
•
•
•
6.
4.
5.
3.
•
Electrolux
Electrolux
e
EMM2015
Electrolux
1.
5.
6.
±
(OHFWUROX[
(OHFWUROX[
4.
3.
2.
(OHFWUROX[
•
•
•
•
•
•
18
Downloaded From Microwave-Manual.com Manuals
ødø1'(./ø(5
0LNURGDOJDIÕUÕQÕQÕ]ÕNXOODQPDGDQ|QFH«««««««««««««
(PQL\HW7DOLPDWODUÕ««««««««««««««««««««««
,]JDUDGDSLúLUPH\DSDUNHQDOÕQDFDNJYHQOLN|QOHPOHUL««««««««
0XWIDN*HUHoOHULQLQ.XOODQÕPDX\JXQOX÷XQXQ'HQHQPHVL««««««
<L\HFHNOHULQHPQL\HWL««««««««««««««««««««««
)ÕUÕQNDSODUÕYHDNVHVXDUODUNÕODYX]X««««««««««««««««
7HNQLN9HULOHU««««««««««««««««««««««««« dDOÕúWÕUPD\D+D]ÕUODQPDVÕ«««««««««««««««««««
$PEDODMÕQDoÕOPDVÕ««««««««««««««««««««««« <HUOHúWLUPH«««««««««««««««««««««««««« ùHEHNH\HED÷ODQWÕ««««««««««««««««««««««« (OHNWULN%D÷ODQWÕODUÕ«««««««««««««««««««««««
&LKD]ÕQg]HOOLNOHULYHdDOÕúWÕUÕOPDVÕ«««««««««««««««
3DUoDODUÕQIRQNVL\RQODUÕ«««««««««««««««««««««
'|QHUWDEODQÕQPRQWDMÕ««««««««««««««««««««« .RQWUROSDQHOL««««««««««««««««««««««««« 0LNURGDOJDLOHSLúLUPH««««««««««««««««««««« 0LNURGDOJDJoD\DUODUÕ««««««««««««««««««««
,]JDUDGDSLúLUPH««««««««««««««««««««««««
0LNURGDOJDYH,]JDUDGDSLúLUPH«««««««««««««««««
,]JDUDGDSLúLUPHLOHLOJLOLWDYVL\HOHU««««««««««««««««
0LNURGDOJDYH,]JDUDGDSLúLUPHLOHLOJLOLWDYVL\HOHU««««««««««
0LNURGDOJDYH,]JDUDJoVHYL\HOHUL««««««««««««««««
:NXOODQDQ'HIURVW%X]o|]PHWDOLPDWODUÕ««««««««««
0LNURGDOJDLOHLOJLOL|QHPOLKXVXVODU««««««««««««««««
%DNÕPYH7HPL]OLN«««««««««««««««««««««««
$NVHVXDUODUÕQWHPL]OHQPHVL'|QHUWDEODYHGHVWHN«««««««««
øoNÕVPÕQWHPL]OHQPHVL«««««««««««««««««««««
'ÕúNÕVPÕQWHPL]OHQPHVL««««««««««««««««««««
,]JDUDQÕQEDNÕPÕYHWHPL]OHQPHVL««««««««««««««««
&LKD]ÕQÕ]ÕQ NXOODQÕP |PU \ÕOGÕU .XOODQÕP |PU UHWLFL YHYH\D LWKDODWoÕ ILUPDQÕQ
FLKD]ÕQÕ]ODLOJLOL\HGHNSDUoDWHPLQLYHEDNÕPVUHVLQLLIDGHHGHU
(/(&752/8;$ù
7DUODEDúÕ&G1R7DNVLPø67$1%8/
7(/)$;
h&5(76ø=7h.(7ø&ø'$1,ù0$+$77,
2
Downloaded From Microwave-Manual.com Manuals
<HQLPLNURGDOJDIÕUÕQÕQÕ]ÕVDWÕQDOGÕ÷ÕQÕ]LoLQVL]LNXWODUÕ]
%LU(OHNWUROX[UQQVHoWL÷LQL]LoLQVL]HWHúHNNUHGHUL]<HQLPLNURGDOJDIÕUÕQÕQÕ]ÕoRNID\GDOÕEXOD
FD÷ÕQÕ]D YH VL]H E\N ID\GDVÕ RODFD÷ÕQD LQDQÕ\RUX] 7P \HQL PXWIDN DOHWOHULQGH ROGX÷X JLEL WP
\HQLIRQNVL\RQODUÕYH|]HOOLNOHUL|÷UHQPHN]DPDQDODFDNDQFDNEXIÕUÕQVL]LQLoLQJHUHNOLRODFDNWÕU
0LNURGDOJDIÕUÕQÕQÕ]ÕNXOODQPDGDQ|QFH
%XNXOODQÕPNÕODYX]XQXGLNNDWOHRNX\XQ<HQL(OHNWUROX[PLNURGDOJDIÕUÕQÕQÕ]GDQHQL\LELoLPGH\DUDU
ODQDELOPHQL]LoLQDúD÷ÕGDNLWDOLPDWODUKD]ÕUODQPÕúWÕUEXQODUÕGLNNDWOLFHRNXGX÷XQX]GDQHPLQROXQX]
%XNXOODQÕPNÕODYX]XQXVUHNOLELUEDúYXUXND\QD÷ÕRODUDNVDNODPD\ÕXQXWPD\ÕQ&LKD]ÕELUEDúNDVÕQD
YHULU \D GD VDWDUVDQÕ] YH\D RWXUGX÷XQX] HYGHQ WDúÕQÕS RUDGD EÕUDNÕUVDQÕ] KHU ]DPDQ NXOODQÕP
NÕODYX]XQX IÕUÕQ LOH ELUOLNWH YHULOPHVLQHYH\D\HQLVDKLELQLQNXOODQPDWDOLPDWODUÕQÕ|÷UHQPHVLQHGLNNDW
HGLQ/WIHQIÕUÕQÕNXOODQPDGDQ|QFHNÕODYX]XEDúWDQVRQDRNX\XQYHLoLQGHNLWDOLPDWODUDX\XQ
(PQL\HW7DOLPDWODUÕ
• *|PPH HPQL\HW NLOLW DQDKWDUODUÕ PLNURGDOJD
•
•
•
•
•
•
•
•
IÕUÕQÕQ NDSÕVÕ DoÕN ROGX÷XQGD oDOÕúPDVÕQD
HQJHOROXU
.DSÕQÕQVLYLoG÷PHOHULQLNXUFDODPD\ÕQYHIÕUÕQ
NDSÕ DoÕNNHQ NXOODQPD\D oDOÕúPD\ÕQ dQN
IÕUÕQÕQ NDSÕVÕ DoÕN ROGX÷XQGD PLNURGDOJD
HQHUMLVLGÕúDUÕ\D\ÕOÕU
%HVLQGHQ VÕoUD\DQ YH\D G|NOHQ SDUoDODUÕQ
\DGD WHPL]OH\LFL DUWÕNODUÕQÕQ IÕUÕQ NDSÕVÕQÕQ WDP
RODUDN NDSDQPDVÕQÕ VD÷OD\DQ E|OJHOHUL NLUOHW
PHPHVLQH |]HQ J|VWHULQ 7HPL]OLN YH EDNÕP
E|OPQHEDNÕQ
)ÕUÕQ KDVDUOÕ ROGX÷X WDNGLUGH \HWNLOL VHUYLV
SHUVRQHOL WDUDIÕQGDQ RQDUÕODQD GHN PLNURGDOJD
IÕUÕQoDOÕúWÕUÕOPDPDOÕGÕU
)ÕUÕQ NDSÕVÕQÕQ G]JQ RODUDN NDSDQPDVÕ YH
NDSÕ H÷ULOPLú PHQWHúHOHU YH NLOLWOHU
NÕUÕOPÕúYH\DHPQL\HWVL]NDSÕVUJOHULYH
VÕ]GÕUPD]\]H\OHUGHKDVDUROPDPDVÕ|]HOOLNOH
|QHPOLGLU
+HU QH úDUW DOWÕQGD ROXUVD ROVXQ FLKD]Õ NHQGL
EDúÕQÕ]D WDPLU HWPH\H oDOÕúPD\ÕQ 'HQH
\LPVL] NLúLOHU WDUDIÕQGDQ \DSÕODQ WDPLUOHU
\DUDODQPD\D YH\D FLGGL KDVDUODUD VHEHS
RODELOLU<HWNLOL6HUYLVLOHWHPDVNXUXQX]
+Lo ELU ]DPDQ GÕú PXKDID]D\Õ IÕUÕQ NDSÕVÕQÕ
YH\DNRQWUROSDQHOLQLoÕNDUPD\ÕQ$NVLWDNGLUGH
\NVHNJHULOLPHoDUSÕODELOLUVLQL]
)ÕUÕQÕQ WHVLVDWÕQÕ YH\D \HUOHúWLULOPHVLQL EX
NÕODYX]GDNL³WHVLVDWWDOLPDWODUÕQD´X\JXQRODUDN
\DSÕQ
&LKD]Õ VDGHFH EX NÕODYX]GD EHOLUWLOHQ GR÷
UXOWXGD NXOODQÕQ YH IÕUÕQÕ PHWDO HULWLFL NLP\DVDO
PDGGHOHUOH WHPDV HWWLUPH\LQ %X WLS IÕUÕQODU
VDGHFH EHVLQOHUL ÕVÕWPDN SLúLUPHN YH\D
GRQPXú \L\HFHNOHULQ EX]XQX o|]PHN LoLQ
WDVDUODQPÕúWÕU&LKD]HQGVWUL\HOELOLPVHO\DGD
WLFDUL DPDoOD NXOODQÕOPDN ]HUH WDVDU
•
•
•
•
•
ODQPDPÕú ROXS EX JLEL NXOODQÕPODU KDOLQGH
JDUDQWLVUHVLLSWDOHGLOHFHNWLU
+LoELU]DPDQIÕUÕQÕERúRODUDNNXOODQPD\ÕQ
(÷HU EHVLQ YH\D VX PLNURGDOJD HQHUMLVLQL
HPPH]VHPDJQHWURQERUXVX]DUDUJ|UHELOLU
dRFXNODUÕQ PLNURGDOJD IÕUÕQÕ HPQL\HWOH NXO
ODQPDODUÕ YH G]HQVL] NXOODQÕPÕQ WHKOLNOHULQL
DQOD\DELOPHOHUL LoLQ \HWHUOL WDOLPDWODU YHULOGL
÷LQGH EDúODUÕQGD ELU \HWLúNLQ ROPDGDQ NXO
ODQPDODUÕQDL]LQYHULQL]
&LKD]Õ X]XQ VUH ELQD GÕúÕQGD WXWPD\ÕQ YH
ÕVODN\HUOHUGHNXOODQPD\ÕQ
0LNURGDOJD IÕUÕQGD EH] YH\D JD]HWH NXUXW
PD\ÕQÕ]%XQODUDOHYDODELOLUOHU
)ÕUÕQÕQ Lo NÕVPÕQÕ VDNODPD DPDFÕ LOH NXOODQ
PD\ÕQ.D÷ÕW UQOHULQL SLúLUPH NDSODUÕQÕ
YH\D IÕUÕQÕQ NXOODQÕOPDGD÷Õ DQODUGD IÕUÕQÕQ Lo
NÕVPÕQGD\L\HFHNOHULEÕUDNPD\ÕQ
,]JDUDLOHSLúLUPH\DSDUNHQ
DOÕQDFDNJYHQOLN|QOHPOHUL
.ODVLNSLúLUPHYH\D,]JDUDGRQDQÕPÕQÕNXOOD
QÕUNHQ IÕUÕQ ]HULQH VX VÕoUDUVD NDSDN
FDPÕQÕNÕUDELOLU
<L\HFHNOHUL IÕUÕQD NR\DU YH oÕNDUÕUNHQ IÕUÕQ
HOGLYHQL NXOODQÕQ .DSODU IÕUÕQGD oRN ÕVÕQDEL
OLUOHU HOLQL]L \DNPDPD\D |]HQ J|VWHULQ %X
GRQDQÕP NXOODQÕOGÕ÷ÕQGD G|QHU WDEOD YH
PHWDO Õ]JDUD oRN ÕVÕQGÕ÷ÕQGDQ HOLQL]LQ \DQ
PDPDVÕLoLQJHQHELUIÕUÕQHOGLYHQLWDNÕQ
<L\HFHNOHULIÕUÕQDNR\DUYHoÕNDUÕUNHQNDSDN
FDPODUÕQÕQ Lo YH GÕú NÕVPÕQD PHWDO ELU úH\
GH÷PHPHVLQH GLNNDW HGLQ .DSÕQÕQ LoL YH
IÕUÕQoRNÕVÕQGÕ÷ÕQGDQJHUHNOL|QOHPOHULDOÕQ
'|QHU WDEOD\Õ YH NDSODUÕ ÕVÕWPD YH SLúLUPH
LúOHPOHULQGHQ VRQUD VR÷XN VX\D VRNPD\ÕQ
YHoDEXNVR÷XWPDNLoLQX÷UDúPD\ÕQ
)ÕUÕQÕQ VWQH KHUKDQJL ELU úH\ EÕUDNPD\ÕQ
)ÕUÕQÕQ VW oRN ÕVÕQGÕ÷ÕQGDQ ]HULQH EÕUD
3
Downloaded From Microwave-Manual.com Manuals
NÕODQ Hú\DQÕ]D ]DUDU JHOHELOLU 3LúLUPH VUH
VLQFH NDSÕQÕQ HWUDIÕQGDQ EXKDU oÕNPDVÕ YH\D
NDSÕQÕQ DOW E|OPQGH VX GDPODFÕNODUÕQÕQ
ROXúPDVÕ oRN GR÷DOGÕU %X VX GDPODFÕNODUÕ
IÕUÕQÕQ JYHQOL÷LQL ROXPVX] RODUDN HWNLOHPH]
.DSÕQÕQ IÕUÕQ ERúOX÷XQD WDP ELU \DOÕWÕP
VD÷ODPDVÕQGDQ|]HOOLNOHNDoÕQÕOPÕúWÕU
• '|QHU WDEOD\Õ HOOH oHYLUPHN LoLQ ]RUODPD\ÕQ
%|\OHELUúH\KDVDUD\RODoDELOLU
• 0LNURGDOJD\OD ÕVÕWPD HVQDVÕQGD IÕUÕQGD ELU DUN
ROXúDELOLU%|\OH GXUXPODU JHQHOOLNOH PHWDO
PXWIDN NDSODUÕQÕQ NXOODQÕOPDVÕQGDQ ND\QDNOD
QÕU 6UHNOL DUN IÕUÕQÕQÕ]D ]DUDUYHUHELOLU,VÕWPD
YH\D SLúLUPH SURJUDPÕQÕ GXUGXUXQ YH NXOODQ
GÕ÷ÕQÕ]NDSODUÕNRQWUROHGLQL]
• )ÕUÕQÕQVWQGHDUNDVÕQGD\DQÕQGDYHDOWÕQGD
\HUOHúLN KDYD ERúOXNODUÕQÕQ WÕNDQPDPDVÕQD
|]HQJ|VWHULOPHOLGLU
0XWIDN*HUHoOHULQLQ.XOODQÕPD
8\JXQOX÷XQXQ'HQHQPHVL
• <DUÕVÕQD NDGDU VX GROGXUXOPXú SLúLUPH NDEÕQÕ
•
•
•
•
•
PLNURGDOJD IÕUÕQD NR\XQ GN VUHVLQFH
: JFQGH ÕVÕWÕQ (÷HU SLúLUPH
NDEÕ VÕFDNVD RQX NXOODQPDPDOÕVÕQÕ] (÷HU
ELUD] VÕFDNVD EHVLQOHUL SLúLUPHN LoLQ GH÷LO
WHNUDUÕVÕWPDNLoLQNXOODQÕODELOLU(÷HUWDEDNRGD
ÕVÕVÕQGD LVH R ]DPDQ SLúLUPH NDEÕQÕ PLNUR
GDOJDIÕUÕQGDNXOODQDELOLUVLQL]
.D÷ÕW SHoHWH PXPOX ND÷ÕW ND÷ÕW KDYOXODU
WDEDNODU ILQFDQODU PXNDYYDODU GRQGXUXFX
VDUJÕODUÕ YH NDUWRQODU PLNURGDOJD\D JD\HW
X\JXQPXWIDNJHUHoOHULGLU%XNDSODUÕQHQHUML\L
HPPHVL YH EX\]GHQDúÕUÕÕVÕQPDRODVÕOÕ÷ÕQÕQ
EXOXQPDPDVÕ LoLQ PXWODND EHVLQOH GROX
ROPDODUÕQDGLNNDWHGLQ
dRN VD\ÕGD SODVWLN WDEDN ILQFDQ GRQGXUXFX
NDSODUÕYHSODVWLNVDUJÕODUGDPLNURGDOJDIÕUÕQGD
NXOODQÕODELOLU3ODVWLNNDSODUÕIÕUÕQGDNXOODQÕUNHQ
UHWLFLVLQLQ WDOLPDWODUÕQD X\XQ <NVHN RUDQGD
\D÷ YH úHNHU LoHUHQ \L\HFHNOHUL SODVWLN NDSODU
GD IÕUÕQD NR\PD\ÕQ dQN EX WU \L\HFHNOHU
oRNÕVÕQÕUYHED]ÕSODVWLNNDSODUÕHULWHELOLUOHU
)ÕUÕQÕoDOÕúÕUGXUXPGDEÕUDNÕSJLWPH\LQ3ODVWLN
ND÷ÕW YH\D GL÷HU \DQÕFÕ NDSODUGD EHVLQ ÕVÕWÕU
YH\DSLúLULUNHQGXUXPX ]DPDQ]DPDQJ|]OHP
OH\LQ (÷HU GXPDQ oÕNDUVD IÕUÕQÕQ NDSD÷ÕQÕ
NDSDOÕ WXWXQ YH GXPDQ NHVLOLQFH\H NDGDU
HOHNWULNED÷ODQWÕQÕNHVLQ
0HWDO PXWIDN YH PHWDO GHVHQOL PXWIDN NDSODUÕ
PLNURGDOJD IÕUÕQGD NXOODQÕOPDODUÕ LoLQ |]HO
RODUDNWDYVL\HHGLOPHGLNoHNXOODQÕOPDOÕGÕU
$÷]Õ GDU RODQ NDSODUÕ |UQH÷LQ úLúHOHUL PLNUR
GDOJD IÕUÕQGD ÕVÕWPD\ÕQÕ] )ÕUÕQGDQ \HQL oÕNPÕú
NDSODUÕQ NDSD÷ÕQÕ \DGD WDEDNODUÕQ ]HULQH
|UWW÷Q] NDSD÷Õ DoDUNHQ GLNNDWOL ROXQ
dQNoÕNDQEXKDU\DQÕNODUDQHGHQRODELOLU
<L\HFHNOHULQ(PQL\HWL
• <L\HFH÷L WHQHNH NXWX LOH PLNURGDOJD IÕUÕQGD
ÕVÕWPD\ÕQ'DLPDX\JXQELUNDEDWDúÕ\ÕQ
• 0LNURGDOJDIÕUÕQGD\D÷OÕNÕ]DUWPD\DSPD\ÕQ
dQN \D÷ÕQ VÕFDNOÕ÷Õ GHQHWOHQHPH]
WHKOLNHOLGXUXPODUPH\GDQDJHOHELOLU
• 0LNURGDOJD IÕUÕQGD PÕVÕU SDWODWÕODELOLU$PD
\DOQÕ]FD |]HO DPEDODMODUGD YH\D EX DPDo
LoLQ|]HORODUDNWDVDUODQPÕúPXWIDNJHUHoOHUL
LoLQGH KD]ÕUODQDELOLU %X SLúLUPH LúOHPL
EDúÕQGDEHNOHPHGHQDVOD\DSÕOPDPDOÕGÕU
• %XKDU ROXúXPXQX YH \DQPD\Õ |QOHPHN LoLQ
J|]HQHNOHUL ROPD\DQ \L\HFHNOHULQ GHULOHULQL
YH\D ]DUODUÕQÕ NHVLQ (OPD SDWDWHV WDYXN
FL÷HUOHUL YH \XPXUWD VDUÕVÕ NDEXNODUÕQÕQ
VÕ\UÕOPDVÕJHUHNHQ\L\HFHNOHUH|UQHNWLU
8<$5, 0LNURGDOJD IÕUÕQGD VÕYÕODUÕ ÕVÕWÕUNHQ
|UQH÷LQ oRUED VRVODU YH LoHFHNOHU VÕYÕ KLo
ND\QDPDGDQ ELUGHQELUH ND\QDPD QRNWDVÕQÕQ
]HULQGHELUÕVÕ\D\NVHOHELOLU%|\OHELUGXUXP
DQL ELU ND\QDPD\D QHGHQ RODELOLU %X LKWLPDOH
NDUúÕDúD÷ÕGDNL|QOHPOHUDOÕQPDOÕGÕU
.HQDUÕG]YHGDUD÷Õ]OÕNDSODUNXOODQPD\ÕQ
%HVLQOHULDúÕUÕÕVÕWPD\ÕQ
)ÕUÕQD NDEÕ NR\PDGDQ |QFH LoLQGHNL VÕYÕ\Õ
NDUÕúWÕUÕQ YH QRUPDO ÕVÕWPD VUHVLQLQ
\DUÕVÕQGDNDUÕúWÕUPDLúOHPLQLWHNUDUOD\ÕQ
,VÕWPD VUHVL VRQD HUGL÷LQGH NDEÕ IÕUÕQÕQ
LoLQGH NÕVD ELU VUH EÕUDNÕQ YH VÕYÕ\Õ ELU NH]
GDKD NDUÕúWÕUGÕNWDQ VRQUD NDEÕ GLNNDWOLFH
IÕUÕQGDQoÕNDUÕQ
• 6D÷ODP \XPXUWD YH VÕ]GÕUPD] NDSODU JLEL
ED]Õ UQOHU |UQH÷LQ NDSDOÕ FDP NDYDQR]
ODU SDWOD\DELOLU YH EX IÕUÕQGD ÕVÕWÕOPDPDOÕGÕU
1DGLUHQ VÕFDN VX\D NÕUÕOÕS SLúLULOPLú \XPXU
WDODU SLúLUPH HVQDVÕQGD SDWOD\DELOLU 'DLPD
\XPXUWD VDUÕVÕQÕQ ]DUÕQÕ GHOLQ YH NDSWDQ
oÕNDUPDGDQ|QFHGNEHNOHWLQ
127
• '|QHUWDEOD\ÕHOOHoHYLUPHNLoLQ]RUODPD\ÕQ
%|\OHELUúH\KDVDUD\RODoDELOLU
0LNURGDOJD\OD ÕVÕWPD HVQDVÕQGD IÕUÕQGD ELU DUN
ROXúPDVÕQD QHGHQ RODELOLU %|\OH GXUXPODU
JHQHOOLNOH PHWDO PXWIDN NDSODUÕQÕQ NXOODQÕOPD
VÕQGDQ ND\QDNODQÕU6UHNOL DUN IÕUÕQÕQÕ]D ]DUDU
YHUHELOLU ,VÕWPD YH\D SLúLUPH SURJUDPÕQÕ
GXUGXUXQYHNXOODQGÕ÷ÕQÕ]NDSODUÕNRQWUROHGLQ
• )ÕUÕQÕQ VWQGH DUNDVÕQGD \DQÕQGD YH
DOWÕQGDNL KDYD ERúOXNODUÕQÕQ WÕNDQPDPDVÕQD
|]HQJ|VWHULOPHOLGLU
&LKD]ÕNHVLQOLNOHWLFDULDPDoODNXOODQPD\ÕQ
4
Downloaded From Microwave-Manual.com Manuals
&LKD] VDGHFH HY NXOODQÕPÕQD \|QHOLN RODUDN
UHWLOPLúWLU
%XNXOODQÕPNÕODYX]XQXVDNOD\ÕQÕ]
)ÕUÕQ.DSODUÕYH$NVHVXDUODU.ÕODYX]X
)ÕUÕQNDSODUÕYHPDO]HPHOHULPLNURGDOJDIÕUÕQGDSLúLUPHDPDFÕLOHNXOODQÕODELOLUOHU*YHQOL÷LQL]
IÕUÕQYHNDSODUÕQÕ]ÕQKDVDUJ|UPHVLQL|QOHPHNLoLQKHUELUSLúLUPHPHWRGXLoLQX\JXQNDSODUÕ
YHPDO]HPHOHULVHoLQL]$úD÷ÕGDNLOLVWHJHQHOELUNÕODYX]GXU
0DO]HPH
6HUDPLNYH
&DP
dLQ3RUVHOHQL
dDQDN
o|POHN
3ODVWLN
0HWDO
.D÷ÕW
$÷DoWDKWD
$NVHVXDUODU
.DSODU
VHUDPLNHú\D
,VÕ\DGD\DQÕNOÕ
FDPHú\D
0HWDOLúOHPHOLFDP
Hú\D
øOHWNHQNULVWDOFDP
0HWDOLúOHPHVL]
0LNURGDOJD
3LúLUPH
(9(7
0LNURGDOJDIÕUÕQÕVÕ
JHoLUPH]NÕOÕI
3ODVWLNVDUJÕ
0HWDOSLúLUPH
WDYDVÕ
$OXPLQ\XPIRO\R
)LQFDQODUWDEDNODU
KDYOXODU
0XPOXND÷ÕWODU
,]JDUDNÕODYX]X
'|QHUWDEOD
'|QHUWDEODGHVWH÷L
3LúLUPH.RQXPX
,]JDUDGD
.RPELQHSLúLUPH
SLúLUPH
(9(7
(9(7
(9(7
(9(7
(9(7
+$<,5
+$<,5
+$<,5
+$<,5
(9(7
+$<,5
(9(7
+$<,5
+$<,5
(9(7
(9(7
(9(7
(9(7
+$<,5
+$<,5
(9(7
+$<,5
(9(7
+$<,5
(9(7
(9(7
(9(7
(9(7
+$<,5
+$<,5
(9(7
+$<,5
+$<,5
(9(7
(9(7
+$<,5
+$<,5
(9(7
(9(7
(9(7
+$<,5
+$<,5
(9(7
(9(7
(9(7
(9(7.XOODQÕODFDNNDSYHDNVHVXDUODU+$<,5.XOODQÕOPD\DFDNNDSYHDNVHVXDUODU
<DOQÕ]FDPHWDONHQDUPHYFXWGH÷LOVH
<DOQÕ]FDPHWDOLoHUHQFDPPHYFXWGH÷LOVH
127 .RUXPD DPDoODUÕ LoLQ \DOQÕ]FD DOPLQ\XP IRO\R NXOODQÕQ DúÕUÕ NXOODQÕQ DUN
ROXúXPXQDVHEHSROXU
7HNQLN%LOJLOHU
gOoOHU
)ÕUÕQERúOX÷X
$÷ÕUOÕN
+DFLP
*HQLúOLN
'HULQOLN
<NVHNOLN
*HQLúOLN
'HULQOLN
<NVHNOLN
PP
PP
PP
PP
PP
PP
NJ
OLWUH
*oND\QD÷Õ
6LJRUWD
*oWNHWLPL
9+]
$
0LNURGDOJD:
*ooÕNÕúÕ
,]JDUD
,]JDUD:
:
:
5
Downloaded From Microwave-Manual.com Manuals
$PEDODMÕQDoÕOPDVÕ
dDOÕúWÕUPD\DKD]ÕUODQPDVÕ
127 )ÕUÕQÕQ DPEDODMÕQÕ DoWÕ÷ÕQÕ]GD FLKD]ÕQ
KDVDUVÕ]ROGX÷XQXNRQWUROHGLQ+DVDUYH\DHNVLN
SDUoDODU GHUKDO \HWNLOL VDWÕFÕ\D ELOGLULOPHOLGLU)ÕUÕQ
IÕUÕQÕQ SDUoDODUÕ YH\D DNVHVXDUODUÕ NRUX\XFX ELU
IRO\R LOH VDUÕODELOLU .oN oRFXNODUÕQ DPEDODM
PDO]HPHVL LOH R\QDPDVÕ WHKOLNHOL RODELOHFH÷LQGHQ
PDO]HPH\LRUWDGDEÕUDNPD\ÕQÕ]
<HUOHúWLUPH
ùHEHNH\HED÷ODQWÕ
)ÕUÕQHOHNWULNNDEORVXYH9+]WRSUDNOÕ
SUL]LOHELUOLNWHYHULOLU
.ÕVD GHYUH PH\GDQD JHOGL÷L WDNGLUGH WRSUDN
NRUXPDVÕ ULVNOHUL D]DOWÕU )ÕUÕQÕQ YROWDMÕQÕQ
HOHNWULN EHVOHPH ND\QD÷ÕQÕQ YROWDMÕ LOH X\XPOX
ROGX÷XQXNRQWUROHGLQL]
+HUKDQJLSURPRV\RQHWLNHWLQLFLKD]GDQV|NQ
)ÕUÕQ G] ELU ]HPLQ ]HULQH \HUOHúWLULOPHOLGLU
<]H\IÕUÕQÕQNJOÕND÷ÕUOÕ÷ÕQÕYHLoLQGHNLOHUL
WDúÕ\DELOHFHN NDSDVLWHGH ROPDOÕGÕU7LWUHúLP YH
JUOW\HQJHOOHPHNLoLQIÕUÕQVDELWELUNRQXP
GDROPDOÕGÕU
)ÕUÕQÕQÕVÕGDQYHVXGDQX]DNWXWXOPDVÕJHUHNLU
,VÕ\D YH VX\D PDUX] NDOPD IÕUÕQÕQ YHULPLQL
D]DOWÕU YH ER]XOPDVÕQD \RO DoDU EX QHGHQOH
IÕUÕQÕ ÕVÕ YH VX ND\QDNODUÕQGDQ X]DNWD PRQWH
HWWL÷LQL]GHQHPLQROXQX]
'RODEÕQ ]HULQGH YH \DQ WDUDIÕQGDNL KDYD
JLULúOHULQL WÕNDPD\ÕQ YH IÕUÕQÕQ HQ VWQH KHU
KDQJL PDO]HPH\L NR\PD\ÕQÕ] dDOÕúPD HVQD
VÕQGD KDYD JLULúOHUL WÕNDQÕUVD IÕUÕQ ÕVÕQDELOLU YH
EX GD ER]XOPD\D VHEHS RODELOLU 6ÕFDN KDYD
KDYD GHOLNOHULQGHQ NDoDELOLU EX QHGHQOH KDYD
JLULúOHULQLWÕNDPDPD\DYH\DIÕUÕQLOHDUNDGXYDU
DUDVÕQD SHUGHOHULQ JHOPHPHVLQH |]HQ
J|VWHULQ
)ÕUÕQÕ PPNQ ROGX÷XQFD UDG\R YH 79¶OHUGHQ
X]D÷D \HUOHúWLULQ %X IÕUÕQ UDG\R SDUD]LWOHULQLQ
EDVWÕUÕOPDVÕQDDLW(&&WDOLPDWODUÕQDX\JXQGXU
DPD ED]Õ SDUD]LWOHU ELU UDG\R YH\D 79¶\H
\DNÕQ\HUH\HUOHúWLULOGL÷LQGHRUWD\DoÕNDELOLUEX
QHGHQOH PPNQ ROGX÷XQFD UDG\R YH 79¶OHUL
IÕUÕQGDQX]DNWDWXWXQ
)ÕUÕQELUN|úH\H\HUOHúWLULOGL÷LWDNGLUGHGXYDUÕQ
VD÷ NHQDUÕQGDQ LWLEDUHQ HQ D] FP OLN ELU
PHVDIHEÕUDNÕQÕ]
g1(0/ø )ÕUÕQ PXWID÷ÕQ KHUKDQJL ELU \HULQH
\HUOHúWLULOHELOLU )ÕUÕQÕQ G] ELU ]HPLQ ]HULQH
\HUOHúWLULOGL÷LQGHQ YH KDYD GHOLNOHUL LOH IÕUÕQÕQ
DOWÕQGDNL \]H\LQ \HWHUOL KDYDODQGÕUPD LoLQ WÕNDOÕ
ROPDGÕ÷ÕQGDQHPLQROXQX]
%X FLKD] UDG\R SDUD]LWOHULQLQ EDVWÕUÕOPDVÕ LOH
LOJLOL(&&\|QHUJHVL1RLOHX\XPOXGXU
127 )ÕUÕQ ELU X]DWPD NDEORVX LOH SUL]H WDNÕOÕ
LVH NDEORQXQ WRSUDNOÕ ROGX÷XQGDQ HPLQ
ROXQX]
8<$5, %X FLKD] WRSUDN KDWWÕ ROPD\DQ Jo
ND\QD÷Õ ]HULQGH NXOODQÕOPDPDOÕGÕU %HVOHPH
ND\QD÷ÕQÕQ WRSUDNODQPDVÕ YH IÕUÕQÕQ HOHNWULN
ED÷ODQWÕVÕ KXVXVXQGD NHQGLQL]GHQ HPLQ GH÷LO
VHQL]ELUHOHNWULNoLLOHWHPDVNXUXQX]
%X FLKD] WRSUDNOÕ ROPDOÕGÕU %X FLKD] SUL]LQ
X\JXQ ROPDGÕ÷Õ YH HOHNWULN WHVLVDWÕQGD NXOOD
QÕODQ NDEORODUÕQ \HWHUVL] ROGX÷X ELU WHVLVDWD
WDNÕODFDNVDILúLQ NHVLOPHVL YH X\JXQ ILúLQ WDNÕO
PDVÕ JHUHNLU %|\OH ELU GXUXPGD VLJRUWDQÕQ
GH÷LúWLULOPHVL JHUHNL\RUVD VLJRUWD NDSD÷ÕQÕQ
WHNUDU \HULQH WDNÕOPDVÕ JHUHNOLGLU 6LJRUWD
NDSD÷Õ ND\ÕS YH\D KDVDUOÕ LVH \HQL ELU SDUoD
HOGHHGLOHQHGHNILúNXOODQÕOPDPDOÕGÕU
(OHNWULN%D÷ODQWÕODUÕ
%XFLKD]DX\JXQRODUDNXoOXILúYHULOPH
OLGLU
8<$5,%8&ø+$=7235$./$10$/,',5
%X HPQL\HW |QOHPOHUL \HULQH JHWLULOPHGL÷L
WDNGLUGHøPDODWoÕVRUXPOXOXNNDEXOHWPH]
• &LKD]ÕQÕ]D WDNÕOÕ RODQ ILú SUL]LQL]H X\JXQ
GH÷LOVH ILúLQ NHVLOPHVL YH X\JXQ RODQ ELU
ILúLQWDNÕOPDVÕJHUHNOLGLU
.HVLOHQ ILúWHQ VLJRUWD\Õ oÕNDUÕQ .HVLOPLú ILú
HYLQL]LQEDúNDELU\HULQGH$PSHUOLNELUSUL]H
WDNÕOPDVÕKDOLQGHúRNWHKOLNHOHULQL|QOHPHNLoLQ
o|SHDWÕOPDVÕJHUHNLU
6
Downloaded From Microwave-Manual.com Manuals
&LKD]ÕQg]HOOLNOHUL
3DUoDODUÕQ)RQNVL\RQODUÕ
%HVLQOHULQ SLúLULOGL÷L E|OP IÕUÕQÕ NXOODQGÕNWDQ
VRQUDLoNDELQLWHPL]OH\LQYHVLOLQL]
)ÕUÕQÕQLoLQLJ|VWHUHQSHQFHUH0LNURGDOJDIÕUÕQ
oDOÕúÕUNHQEHVLQLQGXUXPXJ|]OHPOHQHELOLU
)ÕUÕQ NDSD÷Õ 3LúLUPH LúOHPL HVQDVÕQGD NDSÕ
GDLPDVÕNÕFDNDSDOÕROPDOÕGÕU
.DSÕ PDQGDOÕ YH NDSÕQÕQ L\LFH NDSDQPDVÕQÕ
VD÷OD\DQNLOLW\XYDVLVWHPL
.RQWURO3DQHOL
'|QHUWDEODLoLQPRWRUDNVÕ
'|QHUWDEODg]HO ÕVÕ\D GD\DQÕNOÕ FDPGDQ
\DSÕOPÕúWÕU8\JXQNDSWDNLEHVLQOHUEXWHSVL\H
\HUOHúWLULOLU '|QHUWDEOD ROPDGDQ IÕUÕQÕ NXOODQ
PD\ÕQÕ]
'|QHUWDEOD GHVWH÷L '|QHUWDEOD\Õ GHVWHNOH
PHN LoLQ SLúLUPH E|OPHVLQLQ ]HPLQL ]HULQH
\HUOHúWLULQL]
,]JDUD
,]JDUDUD\Õ
'|QHUWDEODQÕQ0RQWDMÕ
'|QHUWDEOD GHVWH÷LQL IÕUÕQ NDELQLQLQ DOWÕQD
\HUOHúWLULQ
'|QHUWDEOD\Õ DúD÷ÕGDNL JLEL G|QHUWDEOD
GHVWH÷LQLQ VWQH \HUOHúWLULQ '|QHUWDEOD
J|EH÷LQLQ G|QHUWDEOD úDIWÕQD HPQL\HWOL úH
NLOGHNLOLWOHQGL÷LQGHQHPLQROXQX]$VODG|
QHUWDEOD\ÕWHUV\|QGH\HUOHúWLUPH\LQL]
• +HP G|QHUWDEOD KHP GH GHVWH÷L GDLPD
SLúLUPHHVQDVÕQGDNXOODQÕOPDOÕGÕU
• 7P \L\HFHNOHU YH \L\HFHN NDSODUÕ SLúLUPH
LoLQG|QHUWDEODQÕQ]HULQH\HUOHúWLULOPHOLGLU
• '|QHU WDEOD oDOÕúPDVÕ HVQDVÕQGD VDDW G|
Qú\|QQGHYH\DDNVL\|QGHGHG|QHELOLU
7
Downloaded From Microwave-Manual.com Manuals
'|QHUWDEOD
'HVWHN3DUoDVÕ
$NV
8
Downloaded From Microwave-Manual.com Manuals
.RQWURO3DQHOL
*oVHoLFL
<L\HFH÷LQL]LoLQGR÷UXJoVHYL\HVLQL
VHoPHNLoLQEXG÷PH\LD\DUOD\ÕQÕ]
*oVHoLFL
<L\HFH÷LQL]LoLQGR÷UXJoVHYL\HVLQL
VHoPHNLoLQEXG÷PH\LD\DUOD\ÕQÕ]
± =DPDQOD\ÕFÕ
$U]X HGLOHQ SLúLUPH VUHVLQL D\DU
OD\ÕQ3LúUPHLúOHPLEDúOD\DFDNWÕU
øVWHQLOHQ Jo VHYL\HVLQH JHOHQH GHN
0LNURGDOJDLOH3LúLUPH
.DSD÷Õ DoÕQ \HPH÷L G|QHUWDEOD ]HULQH
NR\XQ.DSD÷ÕNDSDWÕQ
³3RZHU 6HOHFWRU´ WXúXQD EDVÕQ
$úD÷ÕGDNLWDEOR\DEDNÕQÕ]
=DPDQOD\ÕFÕ LOH LVWHGL÷LQL] SLúLUPH
9
Downloaded From Microwave-Manual.com Manuals
X]XQ ELU VUH LoLQ ]DPDQOD\ÕFÕ\Õ G|QGUQ
YHVRQUDGDDU]XHGLOHQVUH\HJHULJHWLULQ
VUHVLQLD\DUOD\ÕQ
)ÕUÕQSLúLUPH\HEDúOD\DFDNWÕU
3LúLUPH VUHVL GNGDQ GDKD D] LVH GDKD
gUQHN:JoWHGDNLNDSLúLUPH
*oVHoLFLVLQL:¶DoHYLULQ
)ÕUÕQ oDOÕúÕUNHQ NDSDWPDN LVWHUVHQL] \DS
PDQÕ] JHUHNHQ =DPDQOD\ÕFÕ\Õ ¶D
JHWLUPHNWLU
1RW .XOODQÕPGDQ VRQUD =DPDQOD\ÕFÕ\Õ
¶D JHWLUGL÷LQL]GHQ YH\D IÕUÕQÕQ oDOÕú
PDVÕQDGHYDPHWPHGL÷LQGHQHPLQROXQ
=DPDQOD\ÕFÕ\Õ¶\HoHYLULQ
)ÕUÕQ:DWW¶WDGDNLNDVUHVLQFHNHQGLOL÷LQGHQSLúLUPH\HEDúOD\DFDNWÕU
'RQPXúEHVLQOHUL\HQLGHQÕVÕWPD
• <L\HFHNUHWLFLVLQLQSLúLUPHVUHVL\DOQÕ]FDNÕODYX]RODUDNNXOODQÕOPDOÕGÕU%HOLUWLOHQ3LúLUPH
VUH GROGX÷X WDNGLUGH \L\HFHN oRN VÕFDN GH÷LOGLU \L\HFH÷L IÕUÕQD JHUL NR\XQ YH SLúHQH
NDGDUIÕUÕQGDEHNOHWLQ.ODVLNSLúLUPHXVOQGHROGX÷XJLEL\DSÕQÕ]
• <L\HFH÷LGDLPDG]HQOLRODUDNNDUÕúWÕUÕQÕ]|]HOOLNOHVRVYHJYHoOHUL
• %HNOHPH VUHVL oRN |QHPOLGLU SLúLUPH VUHFLQLQ ELU SDUoDVÕGÕU YH \L\HFH÷LQ LoHULVLQGH
GHQJHOLELUVÕFDNOÕ÷DL]LQYHULU
0LNURGDOJD*o$\DUODUÕ
*o$\DUÕ
gQHULOHQ.XOODQÕP
:
6ÕFDN7XWPD<L\HFHNOHULVÕFDNWXWDU
:
'HIURVW'RQPXú\L\HFHNOHULQEX]XQXo|]HU
:
<DYDúoD.D\QDWPD*YHoWH\DSÕODQED]ÕNÕ]DUWPDJYHoYH
\DKQLOHULWDPDPOD\ÕFÕSLúLUPH
)ÕUÕQGDPXKDOOHELYH\DSH\QLUOLNHN
:
2UWD*YHoYH<DKQLOHULQKÕ]OÕGHIURVWEX]o|]PHYHWHNUDU
ÕVÕWPDLúOHPOHULQGH
2UWD)ÕUÕQGDPXKDOOHELYHVQJHULPVLSXGLQJOHU
:
7HNUDU,VÕWPD*YHoYH\DKQLOHULQWHNUDUÕVÕWÕOPDVÕQGD
3LúPLú\L\HFHNOHULQÕVÕWÕOPDVÕQGD
.ÕUPÕ]ÕYHEH\D]HWNDYXUPDGD
:
0DNVLPXP*o6ÕYÕODUÕQND\QDWÕOPDVÕQGDYH\DWHNUDU
ÕVÕWÕOPDVÕQGD6HE]H\HPHNOHUL\DSPDGD.Õ]DUWPDWDED÷ÕQÕQ|Q
ÕVÕWÕOPDVÕQGD
,]JDUDGD3LúLUPH
'|QHUWDEOD\ÕIÕUÕQERúOX÷XQXQWDEDQՁ]HULQH
GD\DQDQ PLOLQ VWQH \HUOHúWLULQL] %X PHWRG
10
Downloaded From Microwave-Manual.com Manuals
ELUIWHN HW SDUoDODUÕ YV JLEL HWOHUL Õ]JDUDGD
SLúLUPHN LoLQ LGHDOGLU )ÕUÕQÕQ VÕFDN ROGX÷XQX
XQXWPD\ÕQÕ]
*oVHoLFL\LÕ]JDUDD\DUÕQDJHWLULQ
=DPDQOD\ÕFÕ\Õ oHYLUHUHN SLúLUPH VUHVL
QLDU]XHGLOHQ]DPDQDJHWLULQ
1RW .XOODQÕPGDQ VRQUD =DPDQOD\ÕFÕ\Õ
¶DJHWLUGL÷LQL]GHQYH\DIÕUÕQÕQoDOÕúPD
VÕQDGHYDPHWPHGL÷LQGHQHPLQROXQX]
gUQHNGDNLNDVUHVLQFHÕ]JDUD\ÕNXOODQDUDNSLúLUPHLúOHPL
*oVHoLFL\L ,]JDUDNRQXPXQDoHYLULQ
=DPDQOD\ÕFÕ\Õ¶DoHYLULQ
)ÕUÕQ ,]JDUDNRQXPXQGDGDNLNDVUHVLQFHSLúLUPH\HEDúOD\DFDNWÕU
0LNURGDOJDYH,]JDUDGDSLúLUPH
'|QHUWDEOD\ÕIÕUÕQERúOX÷XQXQWDEDQՁ]HULQH
GD\DQDQ PLOLQ VWQH \HUOHúWLULQL] %X PHWRG
ELUIWHN HW SDUoDODUÕ YV JLEL HWOHUL Õ]JDUDGD
SLúLUPHN LoLQ LGHDOGLU )ÕUÕQÕQ VÕFDNROGX÷XQX
XQXWPD\ÕQÕ]
*o VHoLFL\L DU]X HGLOHQ 0LNURGDOJD
*FYHÕ]JDUDVHYL\HVLQHD\DUOD\ÕQÕ]
=DPDQOD\ÕFÕ\Õ oHYLUHUHN SLúLUPH VUH
VLQL DU]X HGLOHQ ]DPDQD JHWLULQ 0LNUR
GDOJDNHQGLOL÷LQGHQoDOÕúÕU
1RW .XOODQÕPGDQ VRQUD =DPDQOD\ÕFÕ\Õ
¶DJHWLUGL÷LQL]GHQYH\DIÕUÕQÕQoDOÕúPD
VÕQDGHYDPHWPHGL÷LQGHQHPLQROXQX]
gUQHN:DWW¶WDSLúLUPHNYHGDNLNDVUHVLQFHÕ]JDUD\DSPDN
*oVHoLFL\L NRPELNRQXPXQDoHYLULQ
=DPDQOD\ÕFÕ\Õ¶DoHYLULQ
)ÕUÕQ NRPELNRQXPXQGDGDNLNDVUHVLQFHSLúLUPH\HNHQGLOL÷LQGHQ
EDúOD\DFDNWÕU
127
3LúLUPH HVQDVÕQGD NDSÕ\Õ DoDUVDQÕ] IÕUÕQÕQ oDOÕúPDVÕ GXUXU 3LúLUPH\L WHNUDUGDQ EDúODWPDN
LoLQNDSÕ\ÕNDSDWÕQÕ]3LúLUPHLúOHPLQLQVRQXQGDÕ]JDUDYHPLNURGDOJDQÕQoDOÕúPDVÕGXUXUYH
ELU]LOVHVLJHOLU
0LNURGDOJD YH Õ]JDUD NRQXPXQGD Jo VHoLPL YH SLúLUPH VUHVL PLNURGDOJD oDOÕúÕUNHQ
GH÷LúWLULOHELOLU
,]JDUDLOH3LúLUPH7DYVL\HOHUL
)ÕUÕQÕQ RODELOGL÷LQFH WHPL] NDODELOPHVL LoLQ EWQ \L\HFHNOHU hVW UDID \HUOHúWLULOGLNWHQ VRQUD DOWODUÕQD
WDúDQ \L\HFHNOHUL YH \HPHN VXODUÕQÕ WXWPDN PDNVDGÕ\OD PHWDO ROPD\DQ ELU WDEDN \HUOHúWLULOPHOLGLU
3LúPHVUHVLQLQRUWDVÕQGDEWQ\L\HFHNOHULWHUVG]HGLQL]
11
Downloaded From Microwave-Manual.com Manuals
%HVLQ
0LNWDU$÷ÕUOÕN 3LúPH6UHVL
g]HO1RWODU
7RVW
'LOLP
±GN
h]HULSH\QLUOLWRVW
'LOLP
±GN
7RVWLoLQHQD]±GNYH]HULQGHNL
LoLQGHGN
0LNURGDOJDYH,]JDUDLOHSLúLUPHKDNNÕQGDJHQHOWDYVL\HOHU
%LIWHN YH GRPX] HWL NÕ]DUWPDN LoLQ G|QHU WDEOD ]HULQGHNL DOoDN UDIÕ WHUFLK HGLQ YH LQFH NÕVÕPODUÕ YH
XoODUÕ NDSOD\ÕQ 7DúDQ \L\HFHNOHUL YH \HPHN VXODUÕQÕ WXWPDN PDNVDGÕ\OD PHWDO ROPD\DQ ELU WDEDN
\HUOHúWLULOPHOLGLU<HPHNSLúHUNHQX\JXQ]DPDQODUGD\L\HFHNOHULWHUVG]HGLQL]
%HVLQ
0LNWDU
$÷ÕUOÕN
*o
.RQXPX
3LúPH
6UHVL
g]HO1RWODU
3DVWÕUPD
OJ
J
GN
'RPX](WL
.Õ]DUWPD%HO
.RPEL
6DGHFH
0LNURGDOJD
:
GN
%LIWHN.Õ]DUWPD
.HPLNOL
J
.RPEL
GN
)ÕUoD LOH \D÷OD\ÕQÕ] 7X] YH ELEHU
LOH oHúQLOHQGLULQ 3LúWLNWHQ VRQUD
±GNEHNOH\LQL]
'RPX].Õ\PD
J
.RPEL
GN
J
.RPEL
±GN
J
.RPEL
±GN
)ÕUoDLOH\D÷OD\ÕQÕ]7X]YHELEHU
YHNHNLNLOHoHúQLOHQGLULQ
J
.RPEL
GN
J6DGH .RPEL
GN
J
.RPEL
GN
'RQPXú3DWDWHV
J
(WOL<HPHN
)ÕUoDLOH\D÷OD\ÕQÕ]7X]YHELEHU
LOHoHúQLOHQGLULQ
.RPEL
GN
7DYXN
3DUoDODQPÕú
%XW
'RQPXú
+DPEXUJHU
6RVLV
%DOÕN)OHWR
0LNURGDOJDYH,]JDUD*oVHYL\HOHUL
6HPERO
)ÕUoDLOH\D÷OD\ÕQÕ]7X]YHELEHU
YHNHNLNLOHoHúQLOHQGLULQ
$\DU
0LNURGDOJDJF
,]JDUDJF
,]JDUD
:
:
.RPEL
:
:
.RPEL
:
:
.RPEL
:
:
:
0DQXHOGHIURVWWDYVL\HOHUL
%X D\DU GH÷HUL NXOODQÕODUDN HNPHN YH PH\YH JLEL ED]Õ EHVLQOHULQ EX]ODUÕQÕ o|]PH LúOHPL
EDúDUÕOÕELUúHNLOGH\HULQHJHWLULOHELOLU
12
Downloaded From Microwave-Manual.com Manuals
%(6ø1
'HIURVW6UHVL
+$=,5/,.
(NPHN
8IDN'LOLP
%\NGLOLP
øNL'LOLP
EWQHNPHN
EWQHNPHN
0LNURGDOJD\DGD\DQÕNOÕELUWHSVLYH\D
PXWIDNND÷ÕGՁ]HULQH\HUOHúWLULQ
'HIURVWVUHVLQLQ\DUÕVÕQGDWHUV±G]
HGLQ
0LNURGDOJD\DGD\DQÕNOÕELUWHSVLYH\D
PXWIDNND÷ÕGՁ]HULQH\HUOHúWLULQ
'HIURVWVUHVLQLQ\DUÕVÕQGDWHUV±G]
HGLQ
0XWIDNND÷ÕGՁ]HULQH\HUOHúWLULQ
0XWIDNND÷ÕGՁ]HULQH\HUOHúWLULQ
0XWIDNND÷ÕGՁ]HULQH\HUOHúWLULQ
%(./(0(
6h5(6ø
±GN
GN
±GN
GN
±VQ
±VQ
±òGN
GN
GN
GN
.HNYH3DVWDODU
3DVWDJ
3H\QLUOL.HN
J
3D\3LúPLú
J
3DVWDJ
7HUH\D÷Õ
J
SDNHW
$PEDODMÕQGDQoÕNDUÕSWDED÷DNR\XQ
GN
±GN
$PEDODMÕQGDQoÕNDUÕSWDED÷DNR\XQ
GN
±GN
$PEDODMÕQGDQoÕNDUÕSWDED÷DNR\XQ
±GN
±GN
$PEDODMÕQGDQoÕNDUÕSWDED÷DNR\XQ
±GN
±GN
(÷HUIRO\RVXYDULVHoÕNDUÕSWDED÷D
NR\XQ
±GN
±GN
±GN
±GN
±GN
±GN
±GN
±GN
0H\YH
J<XPXúDN
<D\YDQELUWDED÷DWHNNDWRODUDNGL]LQ
NoNPH\YHOHU
J<XPXúDN
<D\YDQELUWDED÷DWHNNDWRODUDNGL]LQ
NoNPH\YHOHU
7DEDNWD<HPHN
7DEDNYH\D39&VWUHoILOPLOHNDSD\ÕQ
J
7HNUDUÕVÕWPDNLoLQPLNURGDOJD\Õ
:JoWH±GDNLNDoDOÕúWÕUÕQ
3LúLUPH|QFHVLVHE]HOHULQGHIURVW
HGLOPHVLJHUHNOLGH÷LOGLU
6HE]HOHU
%WQVHE]HOHU:JoLOH
EX]ODUÕo|]OHELOLUYHSLúLULOHELOLUOHU
0LNURGDOJDLOHLOJLOL|QHPOLKXVXVODU
• )ÕUÕQÕGDLPDWHPL]WXWXQ'|NQWOHULQHWUD
IÕQD JHOPHVLQL HQJHOOH\LQ.DSÕQÕQLoNÕVPÕ
QÕ YH FDP WDEODQÕQ DOWÕQÕ WHPL]OHPH\L
XQXWPD\ÕQ
• 0LNURGDOJD IÕUÕQGD SLúLULUNHQ WHUFLKHQ
VW NDSDNOÕ \XYDUODN YH\D RYDO FDP
WHQFHUHNXOODQÕQÕ]
13
Downloaded From Microwave-Manual.com Manuals
• 0HWDO YH\D PHWDO VVOHPHOL FDP WHQFHUH
0LNURGDOJDLOHLOJLOLLSXoODUÕ
OHUL NXOODQPD\ÕQÕ] %HOLUOL SODVWLN PDO]HPH
OHU HUL\HELOLU YH VÕFDN \L\HFHN WDUDIÕQGDQ
• %DOÕ\XPXúDWPD
VDUÕODELOLU
.ULVWDOOHúPLú ELU NDYDQR] EDOÕQÕ] YDUVD
• 3LúLULUNHQ \L\HFH÷L |UWQ &DP NDSDN
NDSD÷Õ DoÕQ YH NDYDQR]X IÕUÕQD \HUOHú
OHYKDYH\D\D÷JHoLUPH]ND÷ÕWNXOODQÕQ
WLULQ GDNLND VUHVLQFH RUWD NRQXPGD
• +DPXU LúL HNPHN YH EHQ]HUOHULQLQ ND÷ÕW
PLNURGDOJDGDWXWXQ
GHVWHVL]HULQGHYH\DHNPHNVHSHWLLoLQGH
• dLNRODWDHULWPH
GR÷UXGDQEX]Xo|]OHELOLU
JUDPOÕN oLNRODWD\Õ SDUoDODUD D\ÕUÕQ
• 'RQPXú \L\HFHN NHQGL DPEDODMÕQGD
ELU NDVH\H \HUOHúWLULQ YH GDNLND
ÕVÕWÕOÕUVDDPEDODMÕQDoÕOPDVÕJHUHNLU0HWDO
VUHVLQFH \NVHN NRQXPGD ÕVÕWÕQÕ] YH
YH\DPHWDOVVOHPHLoHUHQDPEDODMPLNUR
oRNL\LNDUÕúWÕUÕQÕ]
GDOJDGD NXOODQÕP LoLQ |]HOOLNOH WDYVL\H
HGLOLQFH\H NDGDU NXOODQÕOPDPDOÕGÕU 0HWDO
• <D÷Õ\XPXúDWPDYH\DHULWPH
NOLSVOHULYH\DWHOED÷ODUÕQÕV|NQ
(ULWPH \NVHN DWHúWH ELUNDo VDQL\H
• 'DKD NoN DOLPLQ\XP IRO\R SDUoDODUÕ
VUHU<XPXúDWPDHQPNHPPHOGúN
WDYXN EXGX JLEL NROD\FD SLúHQ SDUoDODUÕ
NRQXPGD\DSÕOÕU
|UWPHNLoLQNXOODQÕODELOLU
• (NPH÷L GDKD WD]H KDOH JHWLUPH YH\D
• .DEXNOX YH\D GHULVL EXOXQDQ \L\HFHNOHULQ
ÕVÕWPD
ELU oDWDO LOH NDEX÷XQXQ VR\XOPDVÕ JHUHNLU
%LUNDo VDQL\H VUHVLQFH RUWD NRQXPX
gUQH÷LQ SDWDWHV YH VRVLVOHU 3DWOD\DELOH
NXOODQÕQ
FHNOHULQGHQ GROD\Õ \XPXUWDODUÕ PLNURGDOJD
IÕUÕQGDND\QDWPD\ÕQ
• 6DUPÕVD÷ÕNROD\FDVR\PD
• %\N YH NDOÕQ SDUoDODUÕ FDP WHQFHUHQLQ
VQ VUHVLQFH YH\D VDUÕPVDN
XFXQD \DNÕQ NR\XQ YH \L\HFH÷L HúLW |Oo
GLúOHULQL ÕVÕWÕQÕ] 'Lú GÕúDUÕ oÕNDQD NDGDU
OHUGH NHVPH\H oDOÕúÕQ <L\HFH÷L GDLPD
ELUXFXQXH]LQL]
IÕUÕQÕQRUWD\HULQHNR\XQ
• 0H\YHVX\X
• %LU NDo NH] NDUÕúWÕUÕS oHYLUGL÷LQL] WDNGLUGH
(]PHGHQ |QFH VDQL\H VUHVLQFH
\L\HFHNGHQJHOLRODUDNSLúLULOHFHNWLU
\NVHN NRQXPGD ÕVÕWÕOGÕNODUÕ WDNGLUGH
• $úÕUÕ SLúLUPHGHQ NDoÕQPDN LoLQ \HPHN
WXUXQoJLOOHULQ PH\YH VXODUÕ GDKD ID]OD
WDULILQL]GHEHOLUWLOHQVUHGHQGDLPDNÕVDELU
VÕYÕYHULU
VUH\L D\DUOD\ÕQÕ] %\N \HPHN PLNWDUODU
GDKDX]XQSLúLUPHVUHOHULQLJHUHNWLULU
• <XODIODSDVÕ
• 6HE]HOHU LoLQ D] PLNWDUGD YH\D KLo VX NXO
<XODI ODSDVÕ \ÕNDPDN LoLQ \DSÕúNDQ
ODQPD\ÕQÕ]
WDYD\DVDKLSROPD\DQVHUYLVWDYED÷ÕQGD
• 1RUPDOSLúLUPHGHQGDKDD]WX]YHEDKDUDW
NROD\FD ÕVÕWÕOÕU *ÕGD LPDODWoÕODUÕQÕQ WDY
NXOODQÕQ
VL\HOHULQLL]OH\LQL]
• 7DP YH 'HQJHOL SLúLUPH VRQXoODUÕQÕ HOGH
HWPHNLoLQIÕUÕQNDSDWÕOGÕNWDQVRQUDELUNDo
GDNLNDOÕNGXUPDVUHVLQHL]LQYHULQL]
7HPL]OLNYH%DNÕP
• 6HUYLV \DSPDGDQ |QFH \L\HFH÷LQ VÕFDN
ROPDVÕQÕVD÷OD\ÕQÕ]
• 7DEDNODUÕ YH \L\HFHNOHUL IÕUÕQGDQ oÕNDUÕU
NHQ WHQFHUH NXOSODUÕQÕ WXWXQ YH\D HOGLYHQ
WDNÕQ
)ÕUÕQ GDLPD WHPL] ROPDOÕGÕU )ÕUÕQ GXYDUODUÕQGD WDúPD YH\D VÕoUDPD \ROX\OD \DSÕúDQ
\L\HFHNOHUIÕUÕQÕQHQHUMLVLQLoHNHFHNOHUYH\DQDFDNODUGÕU%XLVHIÕUÕQÕQYHULPLQGHGúPH\HYH
14
Downloaded From Microwave-Manual.com Manuals
N|WNRNXODUDVHEHSRODELOLU)ÕUÕQÕQKLoELUSDUoDVÕQÕQD\DUODUÕQÕGH÷LúWLUPH\HV|NPH\HYH\D
WDPLU HWPH\H NDONÕúPD\ÕQ 7DPLU LúOHPOHUL \DOQÕ]FD \HWNLOL VHUYLV WHNQLV\HQL WDUDIÕQGDQ
\DSÕOPDVÕJHUHNLU
7HPL]OL÷HEDúODPDGDQ|QFHIÕUÕQÕQSUL]LQLQILúGHQoHNLOLROGX÷XQGDQHPLQROXQ
$NVHVXDUODUÕQ'|QHUWDEOD'HVWHN7HPL]OL÷L
d|NHOWLOHULQLVÕYÕGHWHUMDQODWHPL]OH\LQ'|QHUWDEODGHVWH÷LGLNNDWOLFHWXWXOPDOÕGÕU
'LNNDW )ÕUÕQÕQ LoHULVL YH G|QHUWDEOD oDOÕúÕUNHQ DúÕUÕ ÕVÕQGÕNODUÕQGDQ NXOODQÕPÕQ KHPHQ
DUGÕQGDQHOGH÷PH\LQ
)ÕUÕQÕQøoLQLQ7HPL]OHQPHVL
)ÕUÕQÕQ LoLQL GDLPD WHPL] WXWXQX] øoHUL\H EXODúDQ \HPHN DUWÕNODUÕQÕ KHPHQ WHPL]OH\LQ )ÕUÕQ
GXYDUODUÕQD NDSDN NHQDUODUÕQD YH NDSDN ]HULQH \DSÕúDQ WR]XQ WHPL]OHQPHPHVL IÕUÕQ
HQHUMLVLQLQ WR] WDUDIÕQGDQ HPLOPHVL QHWLFHVLQGH YHULPLQGH GúPH\H YH KDWWD IÕUÕQ LoLQGH
DUÕ]D\DQHGHQRODELOLU
<XPXúDNÕOÕNVXLOHÕVODWÕOPÕúELUEH]HVÕYÕGHWHUMDQODWR]XWHPL]OH\LQ
),5,1,1+(5+$1*ø%ø5<(5ø1ø17(0ø=/øöø1'($ù,1',5,&,7(0ø=/(<ø&ø/(57ø&$5ø
),5,17(0ø=/ø.0$''(/(5ø1ø9(%8/$ù,.7(/ø.8//$10$<,1,=
dÕNDUÕODPD\DQ WR]XQ WHPL]OHQPHVL LoLQ IÕUÕQ LoHULVLQH NR\DFD÷ÕQÕ] ELU EDUGDN VX\X ± GN
ND\QDWÕQ
),5,1<h=(<ø1'(.ø72=8$/0$.ødø1%,d$.9(<$.$=,<,&,$/(7.8//$10$<,1
)ÕUÕQLoHULVLQGHNLN|WNRNXODUÕJLGHUPHNLoLQVHELUILQFDQVX\DoRUEDNDúÕ÷ÕOLPRQG|NS
GDNLNDND\QDWÕQ
)ÕUÕQÕQ'ÕúÕQÕQ7HPL]OHQPHVL
.RQWUROSDQHOLQLWHPL]OHUNHQIÕUÕQNDSD÷ÕQÕDoÕQ%|\OHFHIÕUÕQÕQND]DUDoDOÕúPDVÕ|QOHQHFHNWLU
)ÕUÕQÕQ GÕúÕ KDILI ÕVODN \XPXúDN ELU EH]H VÕYÕ GHWHUMDQ G|NHUHN WHPL]OHQHFHN YH GHWHUMDQ
NDOÕQWÕODUÕQÕJLGHUPHNLoLQWHPL]ELUEH]OHGXUXODQÕSVRQUD\XPXúDNELUEH]OHNXUXODQDFDNWÕU
'ÕúWHPL]OLNLoLQKHUKDQJLELUVSUH\FDPWHPL]OH\LFLYH\DPXWIDNWHPL]OH\LFLNLP\DVDOÕ
NXOODQÕODELOLU)ÕUÕQÕQÕ]ÕQGÕúÕQGDGDDúÕQGÕUÕFÕWHPL]OLNPDGGHOHULNLP\DVDOODUYHPHNDQLN
WHPL]OH\LFLOHULNXOODQDPD]VÕ]dDOÕúDQSDUoDODUÕQDUÕ]DODQPDPDVÕLoLQVX\XQKDYDODQGÕUPD
DoÕNOÕNODUÕQDJLWPHVLQHPVDDGHHWPH\LQ
,]JDUDQÕQ%DNÕPYH7HPL]OL÷L
)ÕUÕQ oDOÕúÕU GXUXPGD LNHQ IÕUÕQ DNVHVXDUODUÕ VÕoUD\DQ \D÷GDQ OHNHOHQHELOLU )ÕUÕQ Lo ERúOX÷X
VR÷X\DQD GHN EHNOH\LQ YH IÕUÕQ ELU GDKD NXOODQÕOPDGDQ |QFH \D÷ VÕoUDPÕú \HUOHUL VLOLQL]
,]JDUDGDNL\D÷ODUN|WNRNXODUDYHGXPDQDVHEHSRODELOLU
dönüşüm için verildiği özel toplama
simgesi, bu ürünün normal ev çöpü gibi
atılmayıp, elektrik ve elektronik cihazların geri
edilmesine katkıda bulunmakla hem çevreyi, 15
hem de çevrenizdekilerin sağlığını korumuş
olursunuz. Yanlış şekilde imha ise hem çevreye
hem sağlığa zararlıdır. Bu ürünün geri
Downloaded
From Microwave-Manual.com Manuals
15
noktalarından birine verilmesi gerektiğini
belirtir. Bu ürünün doğru şekilde imha
dönüşümüne ilişkin daha ayrıntılı bilgileri
belediyenizden, çöp dairenizden veya ürünü
satın almış olduğunuz bayiden edinebilirsiniz.
Downloaded From Microwave-Manual.com Manuals
Downloaded From Microwave-Manual.com Manuals
The symbol
on the product or on its packaging indicates that this product may not be treated as household waste. Instead it shall
be handed over to the applicable collection point for the recycling of electrical and electronic equipment. By ensuring this product is
disposed of correctly, you will help prevent potential negative consequences for the environment and human health, which could
otherwise be caused by inappropriate waste handling of this product. For more detailed information about recycling of this product,
please contact your local city office, your household waste disposal service or the shop where you purchased the product.
Символът
върху продукта или опаковката му показва, че този продукт не трябва да се третира като домакинските
отпадъци. Вместо това, той трябва да се предаде в специализиран пункт за рециклиране на електрическо и електронно
оборудване. Като се погрижите този продукт да бъде изхвърлен по подходящ начин, вие ще помогнете за предотвратяване
на възможните негативни последствия за околната среда и човешкото здраве, които иначе биха могли да бъдат предизвикани
от неправилното изхвърляне като отпадък на този продукт. За по-подробна информация за рециклиране на този продукт се
обърнете към местната градска управа, службата за вторични суровини или магазина, откъдето сте закупили продукта.
na proizvodu ili na njegovoj ambalaži označuje da se s tim proizvodom ne smije postupiti kao s otpadom iz domaćinstva.
Simbol
Umjesto toga treba biti uručen prikladnim sabirnim točkama za recikliranje elektroničkih i električkih aparata. Ispravnim odvoženjem
ovog proizvoda spriječit ćete potencijalne negativne posljedice na okoliš i zdravlje ljudi, koje bi inače mogli ugroziti
neodgovarajućim rukovanjem otpada ovog proizvoda. Za detaljnije informacije o recikliranju ovog proizvoda molimo Vas da
kontaktirate Vaš lokalni gradski ured, uslugu za odvoženje otpada iz domaćinstva ili trgovinu u kojoj ste kupili proizvod.
na výrobku nebo jeho balení udává, že tento výrobek nepatří do domácího odpadu. Je nutné odvézt ho do sběrného
Symbol
místa pro recyklaci elektrického a elektronického zařízení. Zajištěním správné likvidace tohoto výrobku pomůžete zabránit
negativním důsledkům pro životní prostředí a lidské zdraví, které by jinak byly způsobeny nevhodnou likvidací tohoto výrobku.
Podrobnější informace o recyklaci tohoto výrobku zjistíte u příslušného místního úřadu, služby pro likvidaci domovního odpadu nebo
v obchodě, kde jste výrobek zakoupili.
szimbólum aztjelzi, hogy a termék nem kezelhető háztartási hulladékként.Ehelyett a
A terméken vagy a csomagoláson található
terméket el kell szállítani az elektromos éselektronikai készülékek újrahasznosítására szakosodottmegfelelő begyűjtő helyre.Azzal,
hogy gondoskodik ezen termék helyes hulladékbahelyezéséről, segít megelőzni azokat, a környezetre és az emberiegészségre
gyakorolt potenciális kedvezőtlen következményeket,amelyeket ellenkező esetben a termék nem megfelelőhulladékkezelése
okozhatna.Ha részletesebb tájékoztatásra van szüksége a termékújrahasznosítására vonatkozóan, kérjük, lépjen kapcsolatba ahelyi
önkormányzattal, a háztartási hulladékok kezelését végzőszolgálattal vagy azzal a bolttal, ahol a terméket vásárolta.
Symbol
na produkcie lub na opakowaniu oznacza, że tego produktu nie wolno traktować tak, jak innych odpadów domowych.
Należy oddać go do właściwego punktu skupu surowców wtórnych zajmującego się złomowanym sprzętem elektrycznym i
elektronicznym. Właściwa utylizacja i złomowanie pomaga w eliminacji niekorzystnego wpływu złomowanych produktów na
środowisko naturalne oraz zdrowie. Aby uzyskać szczegółowe dane dotyczące możliwości recyklingu niniejszego urządzenia, należy
skontaktować się z lokalnym urzędem miasta, służbami oczyszczania miasta lub sklepem, w którym produkt został zakupiony.
de pe produs sau de pe ambalaj indică faptul că produsul nu trebuie aruncat împreună cu gunoiul menajer. Trebuie
Simbolul
predat la punctul de colectare corespunzător pentru reciclarea echipamentelor electrice şi electronice. Asigurându-vă că aţi eliminat în
mod corect produsul, ajutaţi la evitarea potenţialelor consecinţe negative pentru mediul înconjurător şi pentru sănătatea persoanelor,
consecinţe care ar putea deriva din aruncarea necorespunzătoare a acestui produs. Pentru mai multe informaţii detaliate despre
reciclarea acestui produs, vă rugăm să contactaţi biroul local, serviciul pentru eliminarea deşeurilor sau magazinul de la care l-aţi
achiziţionat.
na výrobku alebo na jeho obale znamená, že s výrobkom sa nesmie zaobchádzať ako s domovým odpadom. Namiesto
Symbol
toho ho treba odovzdať v zbernom stredisku na recykláciu elektrických alebo elektronických zariadení. Zabezpečte, že tento výrobok
bude zlikvidovaný správnym postupom, aby ste predišli negatívnym vplyvom na životné prostredie a ľudské zdravie, čo by bolo
spôsobené nesprávnym postupom pri jeho likvidácii. Podrobnejšie informácie o recyklácii tohto výrobku získate, ak zavoláte miestny
úrad vo Vašom bydlisku, zberné suroviny alebo obchod, v ktorom ste výrobok kúpili.
na izdelku ali njegovi embalaži označuje, da z izdelkom ni dovoljeno ravnati kot z običajnimi gospodinjskimi
Simbol
odpadki, Izdelek odpeljite na ustrenzo zbirno mesto za predelavo električne in elektronske opreme.
S pravilnim načinom odstranjevanja izdelka boste pomagali prepreViti morebitne negativne posledice in vplive na okolje
in zdravje ljudi, ki bi se lahko pojavile v primeru nepravilnega odstranjevanja izdelka.
Za podrobnejše informacije o odstranjevanju in predelavi izdelka se obrnite na pristojen mestni organ za odstranjevanje
odpadkov, komunalno službo ali na trgovino, v kateri ste izdelek kupili.
Downloaded From Microwave-Manual.com Manuals
Symbolet
på produktet eller på pakken angiver, at dette produkt ikke må behandles som husholdningsaffald. Det
skal i stedet overgives til en affaldsstation for behandling af elektrisk og elektronisk udstyr. Ved at sørge for at dette
produkt bliver bortskaffet på den rette måde, hjælper du med til at forebygge eventuelle negative påvirkninger af miljøet
og af personers helbred, der ellers kunne forårsages af forkert bortskaffelse af dette produkt. Kontakt det lokale
kommunekontor, affaldsselskab eller den forretning, hvor produkt er købt, for yderligere oplysninger om genanvendelse af
dette produkt.
, joka on merkitty tuotteeseen tai sen pakkaukseen, osoittaa, että tätä tuotetta ei saa käsitellä talousjätteenä.
Symboli
Tuote on sen sijaan luovutettava sopivaan sähkö- ja elektroniikkalaitteiden kierrätyksestä huolehtivaan keräyspisteeseen.
Tämän tuotteen asianmukaisen hävittämisen varmistamisella autetaan estämään sen mahdolliset ympäristöön ja
terveyteen kohdistuvat haittavaikutukset, joita voi aiheutua muussa tapauksessa tämän tuotteen epäasianmukaisesta
jätekäsittelystä. Tarkempia tietoja tämän tuotteen kierrättämisestä saa paikallisesta kunnantoimistosta,
talousjätehuoltopalvelusta tai liikkeestä, josta tuote on ostettu.
på produktet eller på emballasjen viser at dette produktet ikke må behandles som husholdningsavfall. Det
Symbolet
skal derimot bringes til et mottak for resirkulering av elektrisk og elektronisk utstyr. Ved å sørge for korrekt avhending av
apparatet, vil du bidra til å forebygge de negative konsekvenser for miljø og helse som gal håndtering kan medføre. For
nærmere informasjon om resirkulering av dette produktet, vennligst kontakt kommunen, renovasjonsselskapet eller
forretningen der du anskaffet det.
på produkten eller emballaget anger att produkten inte får hanteras som hushållsavfall. Den skall i stället
Symbolen
lämnas in på uppsamlingsplats för återvinning av el- och elektronikkomponenter. Genom att säkerställa att produkten
hanteras på rätt sätt bidrar du till att förebygga eventuellt negativa miljö- och hälsoeffekter som kan uppstå om produkten
kasseras som vanligt avfall. För ytterligare upplysningar om återvinning bör du kontakta lokala myndigheter eller
sophämtningstjänst eller affären där du köpte varan.
Downloaded From Microwave-Manual.com Manuals
Downloaded From Microwave-Manual.com Manuals
Downloaded From Microwave-Manual.com Manuals
Downloaded From Microwave-Manual.com Manuals
www.electrolux.hr
www.electrolux.cz
www.electrolux.hu
www.electrolux.pl
www.electrolux.ro
www.electrolux.ru
www.electrolux.sk
www.electrolux.si
8221913 - 91
- 00Microwave-Manual.com
032009
Downloaded
From
Manuals