USER MANUAL
tAPjXWQBe
MICROWAVE OVEN
ZM17ML
8221914-04-02
t
ZM17ML
Contents
Before using your microwave oven
4
Safety instructions
– Utensil safety
– Testing suitability of cookware
– Food safety
– Oven utensils and accessories guide
Technical data
4
4
5
5
6
6
Getting Started
– Unpacking
Installation
– Connecting to the mains
– Electrical connections
7
7
7
7
7
How to operate your microwave oven
– Name and function of parts
– Turntable Installation
– Control panel
– Microwave Cooking
– Microwave Power Setting Guide
8
8
8
9
10
10
– Defrosting instructions using (230W)
– Microwave Hints
– Care and cleaning
– Cleaning the accessories (turntable and support)
– Cleaning the interior
– Cleaning the exterior
11
12
13
13
13
13
Guarantee conditions
14
3
English
t
ZM17ML
English
Congratulations on the purchase of your new Microwave Oven
Thank you for having chosen a Zanussi product. We are convinced that you will find your new microwave oven
very useful and that it will be of great help to you. As with all new kitchen appliances, it will take some time to
learn all the new functions and features, but with time, this oven will become indispensable to you.
Before using your Microwave Oven
Read through the instruction manual carefully and ensure that you follow the recommendations given, these
instructions have been prepared so that you get the best from your new Zanussi Microwave Oven.
It is important that this instruction book is retained with the appliance for future reference. Should the appliance
be sold or transferred to another owner, or if you move house and leave the appliance, always ensure that the
book is supplied with the appliance so that the new owner can be acquainted with the functioning of the
appliance and the relevant warnings.
Safety Instructions
•
•
•
•
•
•
•
•
•
•
The built-in safety interlock switches prevent the
microwave oven from operating when the door is
open.
Do not tamper with them, or attempt to operate
the oven with the door open as open door
operation can result in exposure to microwave
energy.
Do not allow food spills or cleaner residue to
accumulate on door sealing surfaces. See the
Cleaning and Care section for cleaning
instructions.
Do not operate the oven if it is damaged until it
has been repaired by qualified service personnel.
It is particularly important that the oven door
closes properly and that there is no damage to
the: (1) door (warped), (2) hinges and latches
(broken or insecure), (3) door seals and sealing
surface.
Under no circumstances should you attempt to
repair the appliance yourself. Repairs carried out
by inexperienced persons may cause injury or
serious malfunctioning. Contact your local Service
Force Centre.
Do not remove the outer case, door or control
panel at any time. Doing so may cause exposure
to extremely high voltage.
Install or locate this oven only in accordance with
“INSTALLATION INSTRUCTIONS” found in this
manual.
Use the appliance for its intended use as
described in this manual. Do not use corrosive
chemicals in this appliance. This type of oven is
specifically designed to heat, cook, or defrost
food. It is not designed for industrial or laboratory
use neither for commercial use as this will
invalidate the guarantee.
•
•
•
•
Do not operate the oven empty. If food or water is
not present to absorb the microwave energy, the
magnetron tube can be damaged.
The appliance is not intended for use by young
children or infirm persons without supervision;
Young children should be supervised to ensure
that they do not play with the appliance
Do not store this appliance outdoors. Do not use
this product near water.
Do not attempt to dry clothing or newspapers in
the microwave oven. These items can ignite.
Do not use the cavity for storage purposes. Do
not leave paper products, cooking utensils, or
food in the cavity when not in use.
Utensil safety
Most glass, glass ceramic and heat-resistant
glassware utensils are excellent for use in the
microwave oven. Although microwave energy will not
heat most glass and ceramic items, these utensils
can become hot as heat transfers from the food to
the container. The use of oven gloves to remove
dishes is recommended.
4
t
ZM17ML
Testing suitability of cookware
•
•
•
•
•
•
•
English
Food safety
•
Place the cookware in the cavity along with a
glass half full of water. Heat on 700 W (100%) for
one minute. If the cookware feels hot, you should
not use it. If it is just slightly warm, you can use it
for reheating but not for cooking. If the dish is
room temperature, it is suitable for microwave
cooking.
Paper napkins, wax paper, paper towels, plates,
cups, cartons, freezer wrap and cardboard are
great convenience utensils. Always be sure
containers are filled with food to absorb energy
and thus avoid the possibility of overheating.
Many plastic dishes, cups, freezer containers and
plastic wraps may be used in the microwave
oven. Follow manufacturer’s instructions when
using plastics in the oven. Avoid using plastic
utensils with foods that have high fat or sugar
content since these foods reach high
temperatures and could melt some plastics.
Do not leave oven unattended, and look at it from
time to time when heating or cooking food in
plastic, paper or other combustible containers. If
smoke is observed, keep door closed, switch the
oven off or disconnect oven until smoke stops.
Metal utensils and utensils with metallic trim
should not be used in the microwave oven, unless
specifically recommended for microwave use.
Containers with restricted openings, such as
bottles, should not be used for microwave
cooking.
Use caution when removing a lid or cover from a
dish to avoid steam burns.
•
•
•
Do not heat food in a can in the microwave oven.
Always remove the food to a suitable container.
Deep fat frying should not be done in the
microwave oven, because the fat temperature
cannot be controlled, hazardous situations can
result.
Popcorn may be prepared in the microwave oven,
but only in special packages or utensils designed
specifically for this purpose. This cooking
operation should never be un-attended.
Pierce foods with non-porous skins or
membranes to prevent steam build-up and
bursting. Apples, potatoes, chicken livers, and
egg yolks are examples of items that should be
pierced.
WARNING: When heating liquids, e.g. soups, sauces
and beverages in your microwave oven, overheating
the liquid beyond boiling point can occur without
evidence of bubbling. This could result in a sudden
boil over of the hot liquid. To prevent this possibility
the following steps should be taken:
1. Avoid using straight-sided containers with narrow
necks.
2. Do not overheat.
3. Stir the liquid before placing the container in the
oven and again halfway through the heating time.
4. After heating, allow to stand in the oven for a
short time, stirring again before carefully removing
the container.
•
Some products such as whole eggs and sealed
containers – for example, closed glass jars – may
explode and should not be heated in this oven.
Occasionally, poached eggs may explode during
cooking. Always pierce the yolk, then cover and
allow the standing time of one minute before
removing cover.
NOTE:
• Do not force the turntable to rotate by hand. This
may cause malfunctioning.
• Arcing in the oven during microwave operation
usually occurs from use of metallic utensils.
Continuous arcing, however, can damage the
unit. Stop the programme and check the utensil.
• Care should be taken not to obstruct any air vents
located on the top, rear, side and bottom of the
oven.
Do not use this oven for commercial purposes.
This oven is made for domestic use only.
Keep these instructions
5
t
ZM17ML
English
Oven utensils and accessories guide
A variety of Utensils and Materials may be used for cooking in your microwave oven. For your safety and to
prevent damaging utensils and your oven choose, appropriate utensils and materials for each cooking method.
The list below is a general guide.
Material
Ceramic & Glass
China
Pottery
Plastic
Utensils
Corning ware
Heat resistant glass ware
Glass ware with metal decoration
Lead crystal glass
Without metal decoration
Microwave oven heat-proof wear
Plastic wrap
Metal baking pan
Aluminium foil*
Cups, plates, towels
Metal
Paper
Waxed Paper
Wood
Accessories
Turntable
Turntable support
Microwave Cooking
YES
YES
NO
NO
YES
YES
YES
YES
NO
YES
YES
YES
NO
YES
YES
YES: Utensils and accessories to use
NO: Utensils and accessories to avoid
*NOTE: Use aluminium foil only for shielding purposes, overuse may cause arcing.
Technical data
Overall dimension
Weight 14 kg
Width 459 mm
Depth 368 mm
Height 296 mm
Volume 17 Litre
Cavity dimension
Fuse 10 A
Width 282 mm
Depth 282 mm
Height 206 mm
Power consumption 1200W
Power source 230V, 50 Hz
Power output 700W
6
t
ZM17ML
English
GETTING STARTED
Unpacking
Connecting to the mains
N.B. When you unpack the oven, check that the
product is free from damage. Damage or any missing
parts must be reported immediately to the retailer.
The oven, parts of the oven or the accessories may
be wrapped by a protection foil. If so, you must
remove this foil before using the oven. Do not leave
packing material so that small children can play with
it. This can be hazardous.
The oven is delivered with the power cord and a plug
for 230V, 50Hz, earthed socket outlet. Earth
protection minimises the risks should a short-circuit
occur. Check to ensure the voltage of the oven
matches the supply.
N.B. If the oven is connected to the socket via an
extension cord, make sure the cord is earthed.
WARNING! This appliance must not be used on a
non-earth protected power supply.
Installation
Contact an electrician if you are uncertain regarding
electrical connection of the oven or provision of earth
protection of the supply.
1. Remove any promotion label from the door.
2. Install the oven on a flat, level surface. The
surface must be strong enough to safely bear the
weight (14kg) of the oven, and the contents. To
avoid the possibility of causing vibration or noise
the oven must be in a stable position.
3. Keep the oven away from heat and water.
Exposure to heat and water can lower oven
efficiency and lead to malfunctioning, so be sure
to install the oven away from heat and water
sources.
4. Do not block air vents on the top and the sides of
the cabinet and also do not place any articles on
the top of the oven. If air vents are blocked during
operation, the oven may overheat, and this may
lead to malfunctioning. Hot air escapes from the
vents, so be sure not to obstruct it or let curtains
come between the oven and the rear wall.
5. Place the oven as far away from radios and TV’s
as possible. This oven does conform to EEC
requirements* of radio interference suppression,
but some interference may occur if it is placed too
close to a radio or TV, so keep them as far apart
as possible.
6. If positioned in a corner, leave a gap of at least
10 cm from the walls to meet ventilation
demands.
This appliance must be earthed. If this appliance is
fitted with a non-rewireable plug for which your socket
is unsuitable, the plug should be cut off and the
appropriate plug fitted. If it is necessary to change the
fuse in a non-rewireable plug, the fuse cover must be
refitted. If the fuse cover is lost or damaged, the plug
must not be used until a replacement is obtained.
Electrical connections
This appliance come fitted with a standard 2 pin
moulded euro plug
WARNING! THIS APPLIANCE MUST BE
EARTHED.
The manufacturer declines any liability should
this safety measure not be observed.
•
Important! The oven can be placed almost anywhere
in the kitchen. Make sure the oven is placed on a flat,
level surface and that vents as well as the surface
underneath the oven are not blocked (for sufficient
ventilation).
If the plug that is fitted to your appliance is not
suitable for your socket outlet, it must be cut off
and the appropriate plug fitted.
Remove the fuse from the cut off plug. The cut off
plug should then be disposed of to prevent the
hazard of shocks in case it should be plugged into a
13 Amp socket in another part of your home.
* This appliance conforms to the requirements of
EEC Radio Interference Directive 87/308/EEC.
7
t
ZM17ML
English
How to operate your microwave oven
1
3
2
5
4
8
4
7
6
Name and function of parts
Turntable Installation
1. Cooking compartment. Wipe the compartment
clean after using the oven.
2. Viewing window. Food can be checked while the
microwave oven is in operation.
3. Oven door. The door must always be firmly
closed while cooking.
4. Latch hook and safety interlock system.
5. Control panel.
6. Turntable support. Place the support on the floor
of the cooking chamber to support the turntable.
7. Turntable. Made of special heat-resistant glass.
Food in a suitable container is placed on this tray
for cooking. Do not use the oven without the
turntable.
8. Drive shaft for turntable
1. Place the turntable support on the cavity Bottom.
2. Place the turntable on top of the turntable support
as shown in the diagram. Make sure that turntable
hub is securely locked in the turntable shaft. Never
place the turntable upside down.
• Both turntable and turntable support must always be
used during cooking.
• All food and containers of food are always placed on
this turntable for cooking.
• This turntable rotates clockwise and anticlockwise;
this is normal.
Turntable
Roller rest
Turntable Shaft
8
t
ZM17ML
English
CONTROL PANEL
1. Power Selector
Adjust this knob to select the correct power
level for your food.
2. Timer
Set for desired cooking time. Cooking
will start. All clockwork timers will operate
more accurately if wound past the desired
time first, and then back.
9
t
ZM17ML
English
MICROWAVE COOKING
When cooking for less than 2 minutes, turn the timer
for a longer period and than return to the desired
time.
To turn off the oven during cooking, simply turn the
Timer to 0.
1. Open the door, place the food on the turntable.
Close the door.
2. Set the Power Selector to the desired power
level.(See table below.)
3. Set the Timer to the desired time.
The oven begins cooking.
Note: After use, be sure to return the Timer to 0,
or the oven will continue to operate.
Example: To cook at 385W for 15 minutes
1. Turn the power selector to 385W.
2. Turn the timer to 15
3. The Oven will automatically start cooking for 15 minutes at 385W
Microwave Power setting Guide
Power Setting
120W
(230W)
350W
540W
700W
Suggested use
Keeping warm; Keeping foods warm
Defrost; Thawing frozen foods.
Medium; Faster defrosting and reheating for casseroles and
stews.
Reheat; Reheating pre-cooked foods.
Roasting joints of meat and poultry.
Boiling or reheating liquids.
Cooking vegetables.
Preheating a browning dish.
10
t
ZM17ML
Recommendations for Defrosting using
English
(230W)
Some foods such as bread and fruit, can successfully be thawed manually by using the power setting.
FOOD
STANDING
TIME
PREPARATION
Bread
Small loaf
Sliced large loaf
2 slices
1 bread roll
2 bread rolls
Cakes and Pastry
Gateau 450g/1 lb
Cheesecake
450g/1 lb
Pie (cooked)
450g/1 lb
Pastry 450g/1 lb
Butter
250g/8.8 oz
(1 packet)
Fruit
225g/8 oz
Soft berry fruits
450g/1 lb
Soft berry fruits
Plated meal
400g/14 oz
Place on microwave-proof rack or kitchen paper.
Turn over halfway through defrosting time.
Place on microwave-proof rack or kitchen paper.
Turn over halfway through defrosting time.
Place on kitchen paper.
Place on kitchen paper.
Place on kitchen paper.
8–10 min.
10–15 min.
10–13 min.
10 min
45–60 sec.
45–60 sec.
1–11/2 min.
5 min.
5 min.
5 min.
Remove from packaging, place on plate.
9–11 min.
15–30 min.
Remove from packaging, place on plate.
9–11 min.
15–30 min.
Remove from packaging, place on plate.
7– 9 min.
15–30 min.
Remove from packaging, place on plate.
7– 9 min.
15–30 min.
If foil wrapped, remove from wrapper and place on a
plate
3– 4 min.
5–10 min.
Place in a single layer in a shallow dish.
5– 6 min.
5–10 min.
7– 8 min.
5–10 min.
7– 8 min
5–10 min.
Place in a single layer in a shallow dish.
Cover with a plate or non P.V.C. cling film.
To reheat, microwave on 100% (700W)for 3–4 minutes.
Vegetables
It is not necessary to defrost vegetables before cooking.
All vegetables can be thawed and cooked on
100% (700W)
11
t
ZM17ML
Microwave Hints
•
•
•
•
•
•
•
•
•
•
•
•
•
•
•
•
•
English
Microwave Tips
Always keep the oven clean – avoid spill-overs
and do not forget to clean under the glass tray
and the inside of the door.
Preferably use round or oval casseroles with a lid
when cooking in your microwave oven.
Do not use metal or metal decorated casseroles.
Certain plastic materials can melt and be warped
by hot food.
Cover the food when cooking. Use a glass lid, a
plate or grease proof paper.
Pastry, bread and the like can be defrosted
directly in a bread basket or on a paper towel.
If frozen food is heated in its packaging, the
packaging should be opened. Packaging
containing metal or metal decoration must not be
used unless specifically recommended for use in
the microwave. Remove metal clips and wire ties.
Smaller pieces of aluminium foil can be used to
cover parts that easily over cook such as chicken
legs.
Food with peel or skin should be pierced with a
fork – e.g. potatoes and sausages. Do not boil
eggs in the microwave oven as they can explode.
Put large, thick pieces close to the edge of the
casserole and try to cut the food in to even sized
pieces. Always place the food in the centre of the
oven.
The food will be evenly cooked if you stir or turn it
a few times.
Always set a shorter cooking time than indicated
in your recipe to avoid over cooking. The larger
the amount of food the longer it takes.
Use little or no water for vegetables.
Use less salt and spices than for ‘normal’ cooking.
Season afterwards.
Allow a few minutes ‘standing’ time after the oven
has switched off to ensure complete and even
cooking results.
Always ensure food is piping hot throughout
before serving.
Use pot holders or gloves when taking dishes and
food from the oven.
12
•
Softening Honey
If you have a jar of honey which has
crystallised, remove lid and place the jar in the
oven, microwave on medium power for 2
minutes.
•
Melting Chocolate
Break 100g of chocolate into squares, place in
a bowl and heat on high power for 1-2
minutes and stir well.
•
Softening or Melting Butter
Melting takes a few seconds on high power.
Softening is best done more gently on low
power.
•
Freshen or Warm Bread
Use medium power for few seconds.
•
Peeling Garlic easily
Heat 3 or 4 cloves of garlic on high power for
15 seconds. Squeeze at one end until the
clove pops out.
•
Fruit Juice
Citrus fruits will yield more juice if they are
heated on high power for 15 seconds before
squeezing.
•
Cooking Porridge
Porridge is easily cooked in the serving dish
with no sticky pan to wash. Follow food
manufacturers’ recommendations.
t
ZM17ML
English
Care and cleaning
The oven must always be clean. Residue of food from spillovers or spatters will attract microwave energy
causing it to burn on. This could reduce the efficiency of the oven and may cause bad odours. Do not attempt
to tamper with or make any adjustments or repairs to any part of the oven. Repairs should only be done by a
qualified service technician.
Be sure the oven is disconnected from the electricity supply before cleaning.
Cleaning the accessories (turntable and support)
Clean them with mild detergent after removing them from the cavity. The turntable support should be carefully
handled.
CAUTION: The inside of the oven and turntable get very hot, so do not touch them immediately after use.
Cleaning the interior
Always keep the inside of the oven clean. Wipe up spill-overs and food spatters immediately. Deposits that are
allowed to remain on the oven walls, door seal and door surface will absorb microwave energy, reduce the
efficiency of the oven, and possibly damage the oven interior. Use mild, liquid detergent, warm water and a
soft, clean cloth to remove deposits.
NEVER USE ABRASIVE CLEANERS, COMMERCIAL OVEN CLEANERS OR STEEL WOOL PADS ON
ANY PART OF THE MICROWAVE OVEN.
To loosen difficult deposits, boil a cup of water in the microwave oven for 2 or 3 minutes.
NEVER USE A KNIFE OR ANY UTENSIL TO REMOVE DEPOSITS FROM OVEN SURFACES.
To remove odours from the oven interior, boil a cup of water plus 2 tablespoons of lemon juice for 5 minutes.
Cleaning the exterior
Open the oven door when cleaning the control panel. This will prevent the oven from being turned on
accidentally. You should clean outside surfaces of the oven with mild liquid detergent and water followed by a
wiping with clear water to remove any excess detergent. Dry with a soft cloth.
Spray-on window cleaners or all purpose spray-on kitchen cleaners can also be used. Never use abrasive
cleaners, scouring pads or harsh chemicals on outside surfaces of your oven. To prevent damage to the
working parts, do not allow water to seep into ventilation openings.
13
t
ZM17ML
English
GUARANTEE CONDITIONS
Zanussi offer the following guarantee to the first purchaser of this appliance:
1. The guarantee is valid for 24 months commencing when the appliance is handed over to the first retail
purchaser, which must be verified by purchase invoice or similar documentation. The guarantee does not
cover commercial use.
2. The guarantee covers all parts or components which fail due to faulty workmanship or faulty material. The
guarantee does not cover appliances where defects or poor performance are due to misuse, accidental
damage, neglect, faulty installation, unauthorised modification or attempted repair, commercial use or
failure to observe requirements and recommendations set out in the instruction book. This guarantee does
not cover such parts as light bulbs, removable glassware, or plastic.
3. Should guarantee repairs be necessary the purchaser must inform the nearest customer service office
(ZANUSSI’s service or authorised agent). ZANUSSI reserves the right to stipulate the place of repair (i.e.
the customer’s home, place of installation or ZANUSSI workshop).
4. The guarantee or free replacement includes both labour and materials.
5. Repairs carried out under guarantee do not extend the guarantee period for the appliance. Parts removed
during guarantee repairs become the property of ZANUSSI.
6. The Purchaser’s statutory rights are not affected by this guarantee.
European Guarantee
If you should move to another country within Europe then your guarantee moves with you to your new home
subject to the following qualifications:
•
The guarantee starts from the date you first purchased your product
•
The guarantee is for the same period and to the same extent for labour and parts as exists in the new
country of use for this brand or range of products
•
This guarantee relates to you and cannot be transferred to another user
•
Your new home is within the European Community (EC) or European Free Trade Area
•
The product is installed and used in accordance with our instructions and is only used domestically, i.e. a
normal household
•
The product is installed taking into account regulations in your new country
14
A
EMM2005
Tartalomjegyzék
$PLNURKXOOiP~VW
KDV]QiODWDHO
4
WW
Biztonsági tudnivalók
Edények biztonsága
$I ] HGpQ\HNDONDOPDVViJiQDNYL]VJiODWD
Az ételek biztonsága
6W HGpQ\HNpVWDUWR]pNRN
4
4
5
5
6
0
V]DNLDGDWRN
6
(O
NpV]OHWHND]]HPEHKHO\H]pVKH]
Kicsomagolás
7
7
Elhelyezés
Csatlakoztatás a hálózatra
7
7
+RJ\DQP
N|GLNDPLNURKXOOiP~VW
"
) UpV]HNPHJQHYH]pVHpVIXQNFLyL
Forgótányér behelyezése
.H]HO SDQHO
0LNURKXOOiP~I ]pV
Mikrohullámú teljesítmény táblázat
Felolvasztási tudnivalók 230 W beállításnál
Mikrózási tanácsok
Tisztítás és ápolás
Tartozékok tisztítása (forgótányér és támasz)
8
8
8
9
10
10
11
12
.OV WLV]WtWiV
13
13
13
13
Üzemzavarok - pótalkatrészek
14
Jótállás
14
%HOV WLV]WtWiV
3
A
ZM17ML
*UDWXOiOXQND]~MPLNURKXOOiP~VW PHJYiViUOiViKR]
.|V]|QMNKRJ\=DQXVVLWHUPpNHWYiODV]WRWW0HJJ\ ] GpVQNKRJ\QDJ\RQKDV]QRVQDNWDOiOMDPDMGD]~M
PLNURKXOOiP~ VW W DPHO\ QDJ\V]HU VHJtW WiUVD OHV] 0LQW PLQGHQ NRQ\KDL NpV]OpN H] LV PHJN|YHWHOL
KRJ\ PHJLVPHUMH D I UpV]HNHW pV D]RN IXQNFLyLW PLYHO D NpV]OpN QpONO|]KHWHWOHQ OHV] PDMG D] gQ
számára.
$PLNURKXOOiP~VW KDV]QiODWDHO WW
0LHO WW D NpV]OpNpW KDV]QiODWED YHQQp IHOWpWOHQO ROYDVVD HO H]W D +DV]QiODWL ~WPXWDWyW $] =DQXVVL
PLNURKXOOiP~VW KDV]QiODWDNRUDOHJMREEHUHGPpQ\HOpUpVHpUGHNpEHQWDUWVDEHD+DV]QiODWL~WPXWDWyEDQ
leírtakat. Figyelmesen olvassa el a tudnivalókat. Ügyeljen arra, hogy a Használati útmutató mindig a
rendelkezésére álljon.
Ha a készüléket eladja, vagy elajándékozza, akkor ezt a Használati útmutatót is adja át az új tulajdonosnak,
KRJ\
LVWLV]WiEDQOHJ\HQDNpV]OpNP N|GpVpYHOpVPHJLVPHUMHDYRQDWNR]yEL]WRQViJL~WPXWDWiVRNDWLV
$ KDV]QiODWED YpWHO HO WW MyO LVPHUMH PHJ D NH]HO HOHPHNHW D NO|QE|] IXQNFLyNDW pV N|YHVVH D]
ajánlásokban leírtakat is.
Biztonsági tudnivalók
• A
beépített
megakadályozza,
•
biztonsági
kapcsoló
hogy
nyitott
ajtónál
EHKHO\H]pVH QpONO $PHQQ\LEHQ D VW EHQ
nincs étel, vagy víz, amelyek képesek a
mikrohullámú energia elnyelésére, akkor
károsodhat a magnetron.
• Ha gyerekek tartózkodnak a készülék
közelében, akkor az csak felügyelet mellett
P N|GM|QDPLNURKXOOiP~VW • Ne próbálja meg "bütykölni" a kapcsolót és ne
SUyEiONR]]RQ D VW Q\LWRWW DMWyYDO W|UWpQ
P N|GWHWpVpYHO VHP PHUW D] D PLNURKXOOiP~
energia veszélyes kijutását eredményezheti.
• Ne hagyja a kifröccsent étel- és tisztítószer
PDUDGYiQ\RNDW
UiUDNyGQL
D]
DMWyW
]HPHOWHWKHW • Ne tárolja a készüléket a szabadban. Ne
használja víz közelében sem.
• 1H SUyEiOMRQ UXKDQHP W YDJ\ ~MViJSDStUW
szárítani
a
mikróban,
mert
azok
meggyulladhatnak.
• 1H KDV]QiOMD D VW WHUHW WiUROiVL FpOUD 1H
hagyjon
benne
papírtermékeket,
W|PtW
felületekre. Vegye figyelembe a tisztításra
YRQDWNR]yIHMH]HWHO tUiVDLW
•
.O|Q|VHQ IRQWRV KRJ\ D VW DMWy W|NpOHWHVHQ
zárjon, ne legyen sérült, vagy deformálódott
(1). A zsanéroknak (2) és a zárszerkezetnek
biztonságosnak, az ajtó tömítésének (3) és a
W|PtW IHOOHWHNQHNNLIRJiVWDODQ iOODSRWEDQ NHOO
I ] HGpQ\HNHW YDJ\ pWHOHNHW DPLNRU QHP
lenni.
• Soha ne próbálkozzon saját maga a készülék
javításával.
A
meghibásodott
készülék
javítását, beleértve a csatlakozó vezeték
cseréjét is, csak a jótállási jegyben megjelölt
szerviz végezheti. Hiba esetén forduljon a
kijelölt szervizhez.
• 6RKD QH WiYROtWVD HO D NpV]OpN NOV
használja.
Edények biztonsága
$
VW EHQ
I ]pVpUH
Ki]WDUWiVL
pV
W|UWpQ K MpW O
$]
YpG NHV]W\ W
HO tUiVDLW
NLIHMH]HWWHQ
YHJNHUiPLD
pV
K iOOy
KDV]QiODWUD
$
PLNURKXOOiP~
D]RQEDQ PpJLV IHOPHOHJV]HQHN D EHQQH OpY pWHO
• A készüléket kizárólag az Útmutatóban leírtak
figyelembe vételével használja. Ne használjon
maró vegyi anyagokat a készülékben. Ezt a
VW W
YHJ
energia nem melegíti fel a legtöbb edényt, azok
nagyfeszültség rendkívül veszélyes.
• A készülék elhelyezésénél vegye figyelembe
az „Elhelyezési tudnivalók´ FtP IHMH]HW
WtSXV~
OHJW|EE
üvegedény tökéletesen alkalmas a mikrohullámú
EXUNRODWiW D] DMWyW YDJ\ D NH]HO SDQHOW $
PHOHJtWpVpUH
1HP N|GWHVVHDVW WDIRUJyWiQ\pUpVpWHOHN
pWHOHN
IHOROYDV]WiViUD
tervezték. Nem alkalmas ipari, laboratóriumi,
vagy
kereskedelmi
használatra,
amely
UHQGHOWHWpVHOOHQHV KDV]QiODWQDN PLQ VO pV
nem vonatkozik rá a jótállás.
4
HGpQ\HN
NLYpWHOpKH]
KDV]QiOMRQ
A
ZM17ML
$ I ] HGpQ\HN DONDOPDVViJiQDN
vizsgálata
•
Az ételek biztonsága
• Az ételeket mindig alkalmas tárolóedényben
melegítse.
• 1H KDV]QiOMD D NpV]OpNHW IULW ]pVUH PHUW D]
+HO\H]]HDI ] HGpQ\WDPLNUyEDHJ\IpOSRKiU
vízzel együtt. Melegítse egy percig 700 W-os
WHOMHVtWPpQ\HQ
+D
D
•
YpJH]KHW W|UWpQ HONpV]tWpVUHJ\iUWRWWDN(]WDP YHOHWHW
PpUVpNOHW PDUDGW DNNRU
$
SDStUWiOFiN
]VtUSDStURN
DPHO\HW
NLIHMH]HWWHQ
PLNUyEDQ
tilos felügyelet nélkül végezni.
•
SDStUW|U|ON|] N
$ QHP SRUy]XVRV KpMDV pWHOHN E UpW V]XUNiOMD
tányérok, csészék, fagyasztó tálcák és
kartonpapírok nagyon kényelmes edények.
PHJ KRJ\ D NHOHWNH] J
0LQGLJW|OWVH NHWWHOHpWHOOHOKRJ\HOQ\HOMpND]
EXURN NLV]~UiViUyO DOPD EXUJRQ\D FVLUNHE U
energiát, mert így elkerülheti az edények
túlmelegedését.
élelmiszer ne "robbanjon" szét.
]|N NLMXWKDVVDQDN
1pKiQ\pOHOPLV]HUQpOJRQGRVNRGQLNHOODNOV
WRMiVKpM
KRJ\
NHOHWNH] D
J
]|NW O
D]
6RNIDMWD P DQ\DJ HGpQ\ SO WiOFD WiQ\pU
Vigyázat! Amikor folyadékot melegít, pl. levest,
W|UWpQ KDV]QiODWUD 0LQGLJ N|YHVVH D J\iUWy
V]yV]WLWDOWDNNRUDIRUUiVSRQWIHOHWWLW~OI WpVPLDWW
ajánlását. A túl zsíros, vagy magas
cukortartalmú ételek esetében azonban kerülje
el ezeknek az edényeknek a használatát, mivel
a folyadék kifuthat. Hogy ezt elkerülhesse, tartsa
EHDN|YHWNH] NHW
1.
PpUVpNOHW PLDWW H]HN N|QQ\HQ
2.
3.
1H KDJ\MD D VW W IHOJ\HOHW QpONO DPLNRU
HGpQ\EHQ PHOHJtW YDJ\ I ] +D IVW|W pV]OHO
kapcsolja ki a készüléket, húzza ki a dugót és
KDJ\MDD]DMWyW]iUYDDPtJDIVWPHJV] QLN
pV
IpPGtV]tWpV HGpQ\HN
QHP
használhatók a mikróban, kivéve a speciálisan
erre a célra tervezett edényeket.
6] N
Q\tOiV~
HGpQ\HN
YHJHN
.HUOMHHODW~OI WpVW
.DYDUMD IHO D IRO\DGpNRW PLHO WW EHWHV]L D
készülékbe, majd a melegítés félidejében a
kavarást ismételje meg.
4. A melegítés után rövid ideig hagyja a
folyadékot állni a készülékben, majd keverje
meg és óvatosan vegye ki az edényt.
P DQ\DJ SDStU YDJ\ PiV N|QQ\HQ pJKHW
)pP
1H KDV]QiOMRQ HJ\HQHV ROGDO~ V] N V]iM~
edényt.
megolvadhatnak.
•
pV
PHOHJtWpVUH KDV]QiOKDWy GH I ]pVUH QHP +D
D PDJDV K
•
V]DEiO\R]KDWy
D] HGpQ\ V]REDK
GRER] VWE DONDOPDV D PLNURKXOOiP~ VW EHQ
•
QHP
könnyen meggyulladhat.
• A mikróban csak olyan kukorica pattogtatása
DONDOPDVDPLNUyEDQW|UWpQ I ]pVUH
•
K IRND
RODM]VtU
I ] HGpQ\
felforrósodik, akkor az nem alkalmas
mikrózásra. Ha csak éppen meleg, akkor
• Néhány élelmiszer, mint pl. egész tojás,
valamint néhány edény, pl. zárt lekvárosüveg
szétrobbanhatnak. Rántotta sütésénél szúrja ki
a tojás sárgáját, majd takarja le és hagyja 1
QHP
KDV]QiOKDWyNDPLNURKXOOiP~I ]pVUH
• Az égési sérülések elkerülése érdekében
SHUFLJiOOQLPLHO WWHOWiYROtWMDDWHW W
yYDWRVDQYHJ\HOHD IHG W YDJ\ WiYROtWVD HO D]
edényt.
FIGYELEM:
• 1H HU OWHVVH D IRUJyWiQ\pU IRUJiViW Np]]HO
Meghibásodást okozhat.
• $PHQQ\LEHQ D PLNUy P N|GpVH N|]EHQ
V]LNUi]iV IRUGXO HO DNNRU D]W IpP YDJ\
fémtartalmú edény okozza. A folyamatos
szikrázás károsíthatja a készüléket. Ilyenkor
D]RQQDONDSFVROMDNLpVHOOHQ UL]]HD]HGpQ\W
• Ha az edény deformálódik, akkor hagyja abba
a sütést és válasszon másik edényt.
• hJ\HOMHQ DUUD KRJ\ VHPPL QH ]iUMD HO D VW
V]HOO ] Q\tOiVDLW
1HKDV]QiOMDDVW
(] D VW
WNHUHVNHGHOPLFpOUD
NL]iUyODJ Ki]WDUWiVL KDV]QiODWUD
készült.
0LQGLJWDUWVDEHD]HO
5
]
HNEHQOHtUWDNDW
A
ZM17ML
6W HGpQ\HNpVWDUWR]pNRN
$ PLNUy]iVKR] V]iPRV HV]N|] pV DQ\DJ KDV]QiOKDWy (J\ DGRWW I ]pVL VWpVL PyGKR] EL]WRQViJL RNRN
miatt mindig a legalkalmasabb eszközöket és anyagokat válassza ki. Vegye figyelembe az alábbi táblázatot.
Anyag
Kerámia és üveg
Edény
0LNURKXOOiP~I
) ] HGpQ\
+ iOOyYHJiUX
Üvegáru fémdíszítéssel
Ólomkristály
Porcelán
Fémdíszítés nélkül
IGEN
Agyagedény
0 DQ\DJ
IGEN
IGEN
IGEN
+ iOOyHGpQ\PLNURKXOOiP~VW EH
0 DQ\DJFVRPDJROyDQ\DJ
Fém
Alumínium fólia*
NEM
IGEN
&VpV]HWiQ\pUSDStUW|U|ON|]
IGEN
Zsírpapír
IGEN
)pPVW VHUSHQ\
Papír
Fa
NEM
Tartozékok
IGEN
NEM
* MEGJEGYZÉS
Forgótányér
Forgótányér támasz
IGEN
IGEN
Használható edények és tartozékok
Nem használható edények és tartozékok
Alumínium fóliát csak árnyékolásra használjon, a túl sok fólia szikrázást okoz
0 V]DNLDGDWRN
.OV PpUHWHN
6W WpULPpUHWHN
Szélesség
Mélység
Magasság
Szélesség
Mélység
Magasság
UWDUWDORP
Teljesítmény-felvétel
Mikrohullámú teljesítmény
Tömeg
Feszültség
Biztosíték igény
Zajkibocsátás
459 mm
368 mm
296 mm
282 mm
282 mm
206 mm
17 liter
1200 W
700 W
14 kg
230V/50Hz
10 A
60 dB(A)
Ez a készülék megfelel az alábbi irányelveknek:
−
−
]pV
IGEN
IGEN
NEM
NEM
(:*NLVIHV]OWVpJ LUiQ\HOYDYiOWR]iVRNNDOEH]iUyODJ
89/336/EWG - 1989.05.03. (EMC-irányelv a 92/31/EWG változásokkal bezárólag)
6
A
ZM17ML
(O NpV]OHWHND]]HPEHKHO\H]pVKH]
Kicsomagolás
Csatlakoztatás a hálózatra
Figyelem:$PLNRUNLFVRPDJROWDDVW
WIHOWpWOHQO
$VW WDJ\iUWyEHN|W|WWFVDWODNR]yYH]HWpNNHOpV
HOOHQ UL]]H KRJ\ D V]iOOtWiV N|]EHQ QHP pUWHH
dugóval szállítja, amelyet 230 V 50 Hz-es földelt
konnektorba kell csatlakoztatni. A földelés
minimálisra csökkenti a rövidzárlat kockázatát.
valamilyen sérülés a készüléket. A sérült, vagy
KLiQ\]y UpV]HNNHO UHQGHONH] VW W WLORV ]HPEH
helyezni, azt azonnal vissza kell vinni az eladás
&VDWODNR]WDWiV HO WW HOOHQ UL]]H KRJ\ D ODNiV
KHO\pUH $ VW W LV pV D WDUWR]pNRNDW LV YpG IyOLD
elektromos hálózatának adatai megegyeznek-e a
fent leírtakkal.
ERUtWKDWMD $ VW KDV]QiODWD HO WW H]W D YpG IyOLiW
(amennyiben van) el kell távolítani. Ne engedje,
hogy a gyermekek játsszanak a csomagoló
anyagokkal. A csomagoló anyagok veszélyesek
lehetnek a gyerekek számára.
0HJMHJ\]pV +D D VW W KRVV]DEEtWyQ NHUHV]WO
csatlakoztatja a hálózatra, akkor annak is földelt
NLYLWHO QHNNHOOOHQQLH
FIGYELEM! Tilos a készüléket
konnektorból üzemeltetni.
Elhelyezés
1.
0LQGHQ UHNOiPFtPNpW WiYROtWVRQ HO D VW
+D D PHJIHOHO I|OGHOW NRQQHNWRU QHP iOO D
ajtajáról.
2.
rendelkezésére, akkor arra illetékes szakemberrel
$ VW W VWDELO VLPD IHOOHWUH KHO\H]]H $
NHOODPHJIHOHO NLpStWWHWpVU OJRQGRVNRGQLD
IHOOHWQHN RO\DQ HU VQHN NHOO OHQQLH KRJ\ D
készüléket is (14 kg) és a tartalmát is
biztonsággal megtartsa. A vízszintes felületre
a rendellenes zaj és vibráció elkerülése
érdekében van szükség.
3.
Elektromos csatlakoztatás
Ez a készülék egy az európai szabványnak
PHJIHOHO $ VW W WDUWVD WiYRO K W O pV Yt]W O 0LQGNHWW
FV|NNHQWL
D
VW KDWiVIRNiW
földeletlen
NpWFVDSRV
FVDWODNR]y
GXJyYDO
YDQ
felszerelve.
V W
FIGYELEM! A KÉSZÜLÉKET FÖLDELNI KELL.
meghibásodáshoz vezethet. Az elhelyezésnél
H]pUW J\HOMHQ DUUD KRJ\ K IRUUiVWyO pV Yt]W O
PHJIHOHO WiYROViJEDQOHJ\HQDVW 4.
1H]iUMDHODEXUNRODWIHOV pVROGDOVyV]HOO
Q\tOiVDLW pV VHPPLYHO QH WDNDUMD OH
$ J\iUWy PLQGHQ IHOHO
]
HO
WHJ\HQ VHPPLO\HQ WiUJ\DW D VW WHWHMpUH +D
D V]HOO ] Q\tOiVRN D P N|GpV VRUiQ WDNDUYD
YDQQDN
DNNRU
D
IHOOpS meghibásodáshoz vezet.
KRJ\
D
V]HOO ] .
W~OPHOHJHGpV
Arra is ügyeljen,
Q\tOiVRNRQ
WiYR]y
IRUUy
OHYHJ HOWiYR]iViW VHP IJJ|Q\ VHP PiV
tárgy ne
hátoldalán.
5.
akadályozhassa
a
készülék
$ NpV]OpNHW UiGLyWyO pV 79W O D OHKHW
OHJWiYRODEE KHO\H]]H HO $ VW PHJIHOHO D]
EMC
(elektromágneses
kompatibilitásra
vonatkozó) irányelveknek, azonban ha túl
közel üzemel a rádióhoz, vagy a TV-hez,
akkor zavarokat okozhat.
6. Ha a készüléket sarokban helyezi el, akkor
hagyjon legalább 10 cm-es távolságot a faltól,
KRJ\
D
PHJIHOHO V]HOO ]pV
EL]WRVtWKDWy
legyen.
)RQWRV $ VW D NRQ\KiEDQ EiUKRO HOKHO\H]KHW Ügyeljen azonban arra, hogy sík felületre állítsa a
NpV]OpNHW pV D V]HOO
HOWDNDUYD pV D V]HOO
VVpJHW HOKiUtW PDJiWyO
ha a meghibásodás, illetve kár a biztonsági
NHW 1H
] Q\tOiVRN QH OHJ\HQHN
]pV DOXOUyO LV EL]WRVtWYD
legyen.
7
tUiVRNEHQHPWDUWiVDPLDWWN|YHWNH]LNEH
A
ZM17ML
+RJ\DQP N|GLNDPLNURKXOOiP~VW "
1
3
2
5
4
8
4
6
7
Forgótányér behelyezése
)
1.
UpV]HNPHJQHYH]pVHpVIXQNFLyL
6W WpU
±
D
KDV]QiODW
XWiQ
W|U|OMH
NL
1. +HO\H]]HDIRUJyWiQ\pUWiPDV]WDVW DOMiUD
2. Helyezze a forgótányért a meghajtó tengelyre
a képen látható módon. Ügyeljen arra, hogy a
D
VW WHUHW
2.
3.
ÈWOiWV]y DEODN ± D VW P N|GpVH N|]EHQ
IRUJyWiQ\pU
ILJ\HOHPPHONtVpUKHWLDNpV]O pWHOW
meghajtó tengelyre. Soha ne tegye be a
forgótányért lefelé fordítva.
− 6WpVI ]pVNRU D IRUJyWiQ\pU WiPDV]W pV
a forgótányért is használni kell.
− Az edénybe helyezett ételt mindig a
forgótányérra kell betenni.
− A forgótányér az óramutató járásával
azonos és ellentétes irányba is foroghat.
Ez teljesen normális.
6W DMWy ± VWpV N|]EHQ D] DMWyQDN V]LOiUGDQ
záródnia kell.
4. Kampós zárnyelv – ez a biztonsági ajtózár
rendszer része.
5. .H]HO SDQHO
6. )RUJyWiQ\pUWiPDV]±~J\KHO\H]]H EHDVW
aljára, hogy jól megtartsa a forgótányért.
7. )RUJyWiQ\pU ± VSHFLiOLV K iOOy YHJE O
PHJIHOHO HQ
NpV]OW 6WpVI ]pVNRU HUUH D WiQ\pUUD NHOO D
tartóba elhelyezett ételt rakni. Ne használja a
Forgótányér
VW WIRUJyWiQ\pUQpONO
8. Forgótányért meghajtó tengely
Forgótányér
támasz
Meghajtó
8
tengely
LOOHV]NHGMHQ
D
A
ZM17ML
.H]HO SDQHO
1. Mikrohullámú teljesítményt beállító gomb
A gomb segítségével lehet a szükséges mikrohullámú
teljesítményt beállítani.
2. Beállító gomb
ÈOOtWVD EH D NtYiQW I ]pVL LG W $ I ]pV DXWRPDWLNXVDQ
PHJNH]G GLN
0LQGHQ
LG NDSFVROy
SRQWRVDEEDQ
P N|GLN KD D V]NVpJHV I ]pVL LG Q W~O HOIRUJDWMD D
gombot, majd visszafelé forgatva állítja be a pontos
LG WDPHGGLJDI ]pVWYpJH]QLDNDUMD
9
A
ZM17ML
0LNURKXOOiP~I ]pV
1. Nyissa ki az ajtót, helyezze be az ételt a
forgótányérra és zárja be az ajtót.
2. ÈOOtWVD EH D V]NVpJHV I ]pVL WHOMHVtWPpQ\W
Vegye figyelembe az alábbi táblázatot.
3. A beállító gomb óramutató járásával
PHJHJ\H] LUiQ\ED
W|UWpQ +D D I ]pVL LG SHUFQpO NHYHVHEE DNNRU
PLQGHQNpSSHQ IRUJDVVD HO D] LG EHiOOtWy JRPERW
egy a 2-nél nagyobb számra, majd vissza a kívánt
LG UH
$ VW NLNDSFVROiViKR] HJ\V]HU HQ IRUJDVVD HO
HOIRUJDWiViYDO
iOOtWVDEHDV]NVpJHVI ]pVLLG W
D]LG EHiOOtWyJRPERWDÄ´SR]tFLyED
9LJ\i]DW 0LQGHQ KDV]QiODW XWiQ HOOHQ
$NpV]OpNP N|GpVHPHJNH]G GLN
KRJ\ D] LG
UL]]H
EHiOOtWy D Ä´ SR]tFLyEDQ YDQH
vagy ha folytatni akarja a sütést, akkor állítson
EHHJ\~MLG
W
Példa: Sütés 540 W teljesítményen, 15 percig
1. Forgassa el a teljesítmény beállító gombot a 540 W-os beállításba.
2. )RUJDVVDHOD]LG EHiOOtWyJRPERWD|VV]iPKR]
3. $VW P N|GpVHPHJNH]G GLNpVSHUFLJDXWRPDWLNXVDQ:RVWHOMHVtWPpQ\HQ]HPHO
Mikrohullámú teljesítmény táblázat
Teljesítmény beállítás
Felhasználási javaslat
120 W
Melegentartó funkció: Ételek melegen tartásához
Felolvasztó funkció: Fagyasztott élelmiszerek felolvasztásához
230 W
350 W
Közepes fokozat:
felmelegítéséhez
Gyorsabb
540 W
Közepes fokozat: Kekszek sütéséhez, puddingok készítéséhez
700 W
/HYHVHN
IHOPHOHJtWpVpKH]
felolvasztáshoz,
I ]pVpKH]
tálban készült ételek felmelegítéséhez
10
casserole
]|OGVpJHN
és
I ]pVpKH]
ragu
EDUQtWy
A
ZM17ML
Felolvasztási tudnivalók 230 W beállításnál
Néhány ételfajta (kenyér, gyümölcs) felolvasztása jobb eredményt ad ezen a 180 W teljesítményen való
felolvasztáskor.
Étel
(O
NpV]tWpV
,G
V]NVpJOHW
ÈOOiVLG
230 W-on
Kenyér
.LVPpUHW HJpV]NHQ\pU
Mikrohullámálló rácsra vagy
8-10 perc
10-15 perc
10-13 perc
10 perc
45-60 mp
45-60 mp
1-1,5 perc
5 perc
5 perc
5 perc
Távolítsa el a csomagolást és tegye
tányérra.
Távolítsa el a csomagolást és tegye
tányérra.
Távolítsa el a csomagolást és tegye
tányérra.
Távolítsa el a csomagolást és tegye
tányérra.
9-11 perc
15-30 perc
9-11 perc
15-30 perc
7-9 perc
15-30 perc
7-9 perc
15-30 perc
Távolítsa el róla a fóliát és tegye tányérra.
3-4 perc
5-10 perc
Egy rétegben helyezze lapos tányérra.
5-6 perc
5-10 perc
Egy rétegben helyezze lapos tányérra.
7-8 perc
5-10 perc
7DNDUMDOHWiQ\pUUDO0HOHJtWVHHO 7-8 perc
5-10 perc
SDStUW|U|ON|] UHWHJ\H$IHOROYDV]WiV
1DJ\PpUHW V]HOHWHOW
félidejében fordítsa meg.
Mikrohullámálló rácsra vagy
kenyér
SDStUW|U|ON|] UHWHJ\H$IHOROYDV]WiV
félidejében fordítsa meg.
2 szelet
1 zsemlye
2 zsemlye
7HJ\HSDStUW|U|ON|] UH
7HJ\HSDStUW|U|ON|] UH
7HJ\HSDStUW|U|ON|] UH
Sütemények és tészták
Torta (450 g)
Sajtos sütemény (450 g)
Pite (450 g)
Tészta (450 g)
Vaj
250 g (1 csomag)
Gyümölcs
Puha bogyós gyümölcs
(225 g)
Puha bogyós gyümölcs
(450 g)
Tányéros készétel
450 g
is mikrohullámú teljesítményen 3-4 percig.
Zöldségek
) ]pVHO WWQHPV]NVpJHVD]|OGVpJHNHW
felolvasztani. Indokolt esetben minden
zöldség felolvasztható 100 %-on (700 Won).
11
A
ZM17ML
Mikrózási tanácsok
•
Méz felolvasztása±+DD]YHJEHQOpY Pp]
kikristályosodott, akkor vegye le az üveg
tetejét, majd az üveget helyezze a mikróba 2
percre, közepes teljesítmény beállításával.
•
Csokoládé felolvasztása – 100 g csokoládét
darabolja fel, helyezze egy mély tálba és
magas teljesítménnyel 1-2 percig olvassza,
majd jól keverje meg.
•
Vaj puhítása, vagy felolvasztása – Az
olvasztást néhány másodpercig magas
teljesítménnyel végezze. Ha csak meg akarja
puhítani, akkor alacsonyabb teljesítményt
állítson be.
• Tésztát, kenyeret és hasonlókat közvetlenül a
kenyértartó kosárban is, vagy szalvétán is
felolvaszthat.
•
Kenyér frissítése, melegítése – Néhány
másodpercig végezze, közepes teljesítmény
beállításával.
• Ha a fagyasztott ételt a csomagolásában
•
•
0LQGLJWDUWVDD PLNUyW WLV]WiQ OHKHW OHJ NHUOMH
el az ételek kifröccsenését és ne felejtkezzen
HO PHJWLV]WtWDQL D IRUJyWiQ\pUW YDODPLQW D VW
belsejét.
•
0LNUy]iVQiO UpV]HVtWVH HO Q\EHQ D IHG YHO
UHQGHONH] NHUHNYDJ\RYiOLVHGpQ\HNHW
•
1H
KDV]QiOMRQ
IpP
YDJ\
IpPGtV]tWpV
HGpQ\HNHW %L]RQ\RV P DQ\DJ HGpQ\HN D]
étel forróságától megolvadhatnak.
•
) ]pVNRU WDNDUMD OH D] pWHOHNHW +DV]QiOMRQ
HUUH D FpOUD YHJIHG W WiQ\pUW YDJ\ ]VtUiOOy
papírt.
PHOHJtWLIHODNNRUDFVRPDJROiVWHO V]|UNLNHOO
nyitni. Ha a csomagolás fémet, vagy
fémdekorációt is tartalmaz, akkor azt csak
akkor nem kell eltávolítani, ha a gyártó
kifejezetten erre a célra ajánlja. Távolítsa el a
fém zárókapcsot is.
•
$ QDJ\REE VRYiQ\ GDUDERNDW D K iOOy HGpQ\
PpUHW HNUH
IHOYiJQL
egyenletesen
fog
elkészülni,
$]
ha
LG QNpQWPHJNHYHULYDJ\PHJIRUJDWMD
•
0LQGLJ U|YLGHEE I ]pVL LG W iOOtWVRQ EH PLQW
amennyit a receptkönyvek írnak, hogy a
W~OI ]pVW HONHUOMH $ QDJ\REE PHQQ\LVpJHN
KRVV]DEEI ]pVLLG WLJpQ\HOQHN
• Zöldségek párolásánál ne használjon vizet,
vagy ha kell, akkor csak kis mennyiséget.
• .HYHVHEE VyW pV I V]HUW KDV]QiOMRQ PLQW
DPHQQ\LWDKDJ\RPiQ\RVI ]pVQpOV]RNRWW
•
•
•
•
Gyümölcslé – A citrusfélék több levet adnak,
=DENiVD I
]pVH
– A zabkása a szervírozó
lábos aljára. Kövesse a gyártó útmutatásait.
edényt mindig a készülék közepére helyezze.
• Az étel
N|QQ\
WiQ\pUEDQ LV HONpV]tWKHW pV QHP UDJDG OH D
szélére tegye és ha lehet, próbálja a nagyobb
NLVHEE
D
teljesítménnyel melegítik.
•
W~OI ]pVHONHUOpVHDFpOSOFVLUNHOiE
GDUDERNDW
KpMiQDN
KD IDFVDUiV HO WW PiVRGSHUFLJ PDJDV
• Kisebb darab alumínium fólia használható a
mikróban olyan részek burkolására, ahol a
•
)RNKDJ\PD
eltávolításához – 3-4 gerezd fokhagymát 15
másodpercig
melegítsen
magas
teljesítményen. Préselje össze az egyik végét,
amíg a fokhagyma gerezd kipattan a héjából.
) V]HUH]]HQNpV EE
$ I ]pV EHIHMH]pVH XWiQ KDJ\MD iOOQL D] pWHOW
hogy jobb eredményt kapjon.
0LQGLJW ]IRUUyOHJ\HQD]pWHOPLHO WWWiODOMD
0LQGLJ KDV]QiOMRQ HGpQ\IRJyW YDJ\ NHV]W\ W
DPLNRUD]HGpQ\WNLYHV]LDNpV]OpNE O
12
A
ZM17ML
Tisztítás és ápolás
$VW QHNPLQGLJWLV]WiQDNNHOOOHQQLH$]pWHOPDUDGYiQ\RNHOQ\HOLNDPLNURKXOOiP~HQHUJLiWpVHOpJKHWQHN
(]FV|NNHQWLDVW KDWpNRQ\ViJiWpVNHOOHPHWOHQV]DJRNDWHUHGPpQ\H]KHW 1H SUyEiOMD PHJ VDMiW PDJD D
VW MDYtWiViWYDJ\EHiOOtWiViW$PHJKLEiVRGRWWNpV]OpNMDYtWiViWEHOHpUWYHDFVDWODNR]yYH]HWpNFVHUpMpW
is, csak a jótállási jegyben megjelölt szerviz végezheti.
hJ\HOMHQ DUUD KRJ\ EiUPLO\HQ WLV]WtWiVL PXQND HO
WW D PLNURKXOOiP~ VW
OH OHJ\HQ YiODV]WYD D]
elektromos hálózatról!
Tartozékok tisztítása (forgótányér és támasz)
$ VW WpUE O W|UWpQ
HOWiYROtWiVXN XWiQ PRVRJDWyV]HUHV Yt]EHQ WLV]WtWVD PHJ D WDUWR]pNRNDW $ IRUJyWiQ\pU
támaszát óvatosan kell tisztítani.
$VW WpUpVDIRUJyWiQ\pUQDJ\RQIHOIRUUyVRGKDWH]pUWDKDV]QiODWXWiQQHpULQWVHPHJD]RQQDO
%HOV WLV]WtWiV
$ VW ROGDOIDODLQ D] DMWy W|PtWpVpQ pV D] DMWy IHOOHWpQ YLVV]DPDUDGy V]HQQ\H] GpVHN HOQ\HOLN D
PLNURKXOOiP~HQHUJLiWH]iOWDOFV|NNHQWLNDVW KDWpNRQ\ViJiWV WNiURVtWKDWMiNDVW EHOVHMpWLV
$V]HQQ\H] GpVHOWiYROtWiViKR]KDV]QiOMRQNHYpVIRO\pNRQ\PRVyV]HUWPHOHJYL]HWpVSXKDUXKiW
62+$
1(
+$6=1È/-21
)e06=È/$6
7,6=7Ë7Ï
0$5Ï
3È51È7
7,6=7Ë7Ï6=(57
$
.(5(6.('(/0,
0,.52+8//È0Ò
6h7
6h7
7,6=7Ë7Ï7
(*<(7/(1
9$*<
5e6=e1(.
$
TISZTÍTÁSÁHOZ SEM.
$PDNDFVV]HQQ\H] GpVHNHOWiYROtWiViKR]SHUFLJIRUUDOMRQHJ\FVpV]HYL]HWDPLNUyEDQ
62+$
6h7
1(
+$6=1È/-21
)(/h/(75
/7g57e1
.e67
9$*<
%È50,/<(1
0È6
(6=.g=7
$
6=(11<(=
'e6
(/7È92/Ë7È6È+2=
$ VW EHQ OpY NHOOHPHWOHQ V]DJRN HOWiYROtWiViKR] D N|YHWNH] W DMiQOMXN WHJ\HQ HJ\ FVpV]H Yt]EH HY NDQiOFLWURPOHYHWpVD]WSHUFLJIRUUDOMDDPLNUyEDQ
.OV WLV]WtWiV
$ NH]HO SDQHO WLV]WtWiVDNRU Q\LVVD NL D] DMWyW (]]HO HONHUOKHWL D YpOHWOHQV]HU EHNDSFVROiVW $ NOV
felületeket enyhe mosogatószeres meleg vízzel tisztítsa meg egy puha ruha segítségével. A
mosogatószeres ruhával való letörlés után tiszta vizes ruhával, majd száraz ruhával törölje át a felületeket.
Ablaktisztító, vagy hasonló konyhai tisztító-spray is használható az ajtó ablakához. Soha ne használjon
maró, karcoló vegyszert, mert károsíthatja a felületet. A károsodás elkerülése érdekében fokozottan ügyelni
NHOODUUDKRJ\DV]HOO ] Q\tOiVRNEDYt]VHPPLO\HQN|UOPpQ\HNN|]|WWQHMXWKDVVRQEH
13
A
ZM17ML
ÜZEMZAVAROK - PÓTALKATRÉSZEK
+D D NpV]OpN P
N|GpVpEHQ KLEiW pV]OHO DNNRU HOOHQ
UL]]H D] DOiEELDNEDQ OHtUWDNDW PLHO
WW D
szervizhez fordul.
+DDVW
•
•
•
•
•
QHPLQGXOHO
(OOHQ UL]]HKRJ\DNpV]OpNHWFVDWODNR]WDWWDHD]HOHNWURPRVKiOy]DWUD
(OOHQ UL]]HKRJ\PHJIHOHO HQEHQ\RPWDHDFVDWODNR]yGXJyWDNRQQHNWRUED
+DDFVDWODNR]yGXJyEDQOpY EL]WRVtWpNNDOYDQSUREOpPDFVHUpOWHVVHNLHJ\~MUD
(OOHQ UL]]HKRJ\YDQHiUDPDIDOLFVDWODNR]yDOM]DWEDQYDJ\QHPROGRWWHOHDODNiVI EL]WRVtWpND
(OOHQ UL]]H KRJ\ XJ\DQDEEDQ D W|EE IpU KHO\HV FVDWODNR]y DOM]DWEDQ QHP ]HPHOH PiV NpV]OpN
DPHO\QDJ\WHOMHVtWPpQ\ •
(OOHQ UL]]HDODNiVI EL]WRVtWpNiW
+DDPLNURKXOOiPQHPP
•
•
•
N|GLN
(OOHQ UL]]HDEHiOOtWyJRPERNDWKRJ\KHO\HVHD]RNEHiOOtWiVD
(OOHQ UL]]HKRJ\DEHiOOtWiVWDKDV]QiODWL~WPXWDWyOHtUiVDV]HULQWYpJH]WHH
(OOHQ UL]]H KRJ\ PHJIHOHO HQ EH]iUWDH D] DMWyW KD pWHOPDUDGYiQ\RN UDJDGQDN D] DMWyVW WpU ]iUyGy
IHOOHWpUH DNNRU D] LV DNDGiO\R]KDWMD D PHJIHOHO ]iUyGiVW DPL D PLNUy P N|GpVNpSWHOHQVpJpW
eredményezheti.)
+DDIHQWLHOOHQ U]pVHNXWiQVHPPHJIHOHO DNpV]OpNP N|GpVHDNNRUIRUGXOMRQDMyWiOOiVLMHJ\EHQNLMHO|OW
szervizhez.
Fontos! Ha hívja a szervizt, akkor a bejelentkezéskor az alábbi adatokat adja meg a szerviznek:
1.
2.
3.
4.
5.
6.
Az Ön nevét, címét, postai irányítószámát:
Az Ön telefonszámát:
A hiba pontos leírását:
A készülék modellszámát:
A készülék sorozatszámát:
A készülék vásárlásának dátumát:
Azért, hogy az azonosító adatok mindig kéznél legyenek, javasoljuk, hogy írja be azokat az alábbi sorokba:
Modellszám:
ZM17ML
Sorozatszám:
………………………
Vásárlási dátum:
………………………
+D D NpV]OpN PpJ MyWiOOiVL LG
PLHO
Q EHOO YDQ D IHQWLHNEHQ UpV]OHWH]HWW HOOHQ
U]pVHNHW HO NHOO YpJH]QL
WW KtYMD D V]HUYL] V]DNHPEHUpW +D D V]DNHPEHU NLKtYiViUD QHP D NpV]OpN PHFKDQLNXV YDJ\
elektromos hibája miatt kerül sor, akkor annak költsége a vásárlót terheli.
Pótalkatrészek
3yWDONDWUpV]D]$ONDWUpV]HOOiWiVWyOV]HUH]KHW EH
Jótállás
A jótállási feltételeket és kötelezettségeket a készülékhez mellékelt jótállási jegy tartalmazza.
9HY
V]ROJiODW%XGDSHVW(U]VpEHWNLUiO\Qp~W
Forgalmazó: Zanussi Lehel Kft. Háztartási Készülékek
1142 Budapest, Erzsébet királyné út 87.
14
P
ZM17ML
6SLVWUH FL
3U]HGUR]SRF]
FLHPNRU]\VWDQLD]NXFKQLPLNURIDORZHM
:VND]yZNLEH]SLHF]H
VWZD
– Naczynia
±6SUDZG]HQLHSU]\GDWQR FLQDF]\
±
\ZQR ü
±7DEHODQDF]\
Dane techniczne
3U]HGZá
F]HQLHGR]DVLODQLD
±3RGá
F]HQLHHOHNWU\F]QH
2EVáXJDNXFKQLPLNURIDORZHM
– Elementy
– Podstawa obrotowa / talerz
±3DQHOVWHUXM
F\
– Gotowanie mikrofalowe
±7DEHODXVWDZLH
±:VND]yZNLGRW\F] FHUR]PUD DQLD
(230W)
– Praktyczne wskazówki
– Konserwacja i czyszczenie
– Czyszczenie akcesoriów (talerz / podstawa)
±&]\V]F]HQLHZQ
WU]DNXFKQL
±&]\V]F]HQLHHOHPHQWyZ]HZQ
6HUZLVLF]
4
5
5
5
7
7
8
8
8
8
8
F]HQLHP
– Rozpakowanie
Instalacja
±3RGá
4
WU]Q\FK
9
9
9
10
11
11
12
13
14
14
14
14
15
FL]DPLHQQH
Gwarancja
16
3
P
ZM17ML
Gratulujemy zakupu nowej kuchni mikrofalowej
VWZX WUDIQHJR Z\ERUX L G]L NXMHP\ ]D ]DNXS SURGXNWX ILUP\ =DQXVVL -HVWH P\
*UDWXOXMHP\ 3D
SU]HNRQDQL
H
QRZD
NXFKQLD
PLNURIDORZD
E G]LH
3D VWZX
EDUG]R
SU]\GDWQD
L
XáDWZL
przygotowywanie potraw.
3U]HGUR]SRF] FLHPNRU]\VWDQLD]NXFKQLPLNURIDORZHM
wnego wykorzystania
nnych wskazówek i porad.
3URVLP\RGRNáDGQH]DSR]QDQLHVL ]QLQLHMV] LQVWUXNFM REVáXJL:FHOXHIHNW\
3D VWZDQRZHMNXFKQLPLNURIDORZHMZLQVWUXNFMLREVáXJL]DZDUWRZLHOHFH
=DOHFDP\ GRNáDGQH SU]HF]\WDQLH QLQLHMV]HM LQVWUXNFML REVáXJL SU]HG UR]SRF] FLHP X \ZDQLD NXFKQL
,QVWUXNFM QDOH \]DFKRZDüDE\SRGF]DVX \WNRZDQLDPyFZND GHMFKZLOL]QLHMVNRU]\VWDü
:SU]\SDGNXVSU]HGD \XU] G]HQLDSURVLP\RSU]HND]DQLHLQVWUXNFMLQRZHPXX \WNRZQLNRZL
:VND]yZNLEH]SLHF]H VWZD
•
:EXGRZDQ\
SU]Há F]QLN
]DEH]SLHF]D
•
NXFKQL EORNXM
PLNURIDORZ
•
F\
uruchomieniem przy otwartych drzwiach.
•
1LH QDOH \ PDQLSXORZDü SU]\ GU]ZLDFK DQL
XPLH FLü
w
.XFKQL QDOH \
X \WNRZDü
]JRGQLH
]
LQVWUXNFML
energii mikrofalowej.
VWRVRZDü FKHPLNDOLyZ NRUR]\MQ\FK 7HQ W\S
1LH
QDOH \
GRSXV]F]Dü
DE\
UHV]WNL
JRWRZDQLD
GU]ZL
XVXQL FLD
GR
URGNyZ F]\V]F] F\FK
LFK
SU]H]
DXWRU\]
]ZUDFDü
SUDZLGáRZH
V]F]HJyOQ
]DP\NDQLH
VL
E\ü
]ZLFKURZDQH]DZLDV\L]DWU]DVNLQLHPRJ
E\ü
S
NQL WH
L
SRZLQQ\
G]LDáDü
QLH]
•
Z
FHODFK
NRPHUF\MQ\FK
Zá
F]Dü
SXVWHM
QLH
PD
SRFKáRQ ü
OXE
HQHUJL
NXFKQL
Z
ZRG\
PLNURIDORZHM
QLHM
SURGXNWyZ
NWyUH
PRJá\E\
PLNURIDORZ PR H
Z\VW SLüXV]NRG]HQLHPDJQHWURQX
•
.XFKQLD PLNURIDORZD PR H E\ü REVáXJLZDQD
SLHQLD XVWHUNL RSLVDQHM
•
.XFKQLQLHQDOH \SU]HFKRZ\ZDüQD]HZQ WU]
•
1LH VXV]\ü Z NXFKQL PRNU\FK SU]HGPLRWyZ
•
.XFKQLD
VNRQWDNWRZDü
VL ]
]DNáDGHP
Z\á F]QLH SU]H] SHUVRQHO
FL
SRPLHV]F]H RUD]ZSREOL XZRG\
ORNDOQ\P
VHUZLV
OXEJD]HWJG\ PR HGRM üGRLFK]DSDOHQLD
DXWRU\]RZDQ\FK
VWHUXM FHJR
JG\ GU]ZL
PR H
WR
RUD]
SU]HGPLRWyZ
goWRZDQLD
SDQHOX
GR
SU]HFKRZ\ZDQLD
OXE
znym o
Z\VRNLPQDSL FLX
4
L
LQQ\FK
\ SR]RVWDZLDü Z QLHM
SDSLHURZ\FK
SURGXNWyZ
JG\NXFKQLDQLHMHVWX \ZDQD
VSRZRGRZDü
]DJUR HQLHSRUD HQLDSU GHPHOHNWU\F
VáX \
\ZQR FLRZ\FK
przedPLRWyZ 1LH QDOH
: DGQ\PSU]\SDGNXQLH ZROQR GHPRQWRZDü
REXGRZ\
QLH
SURGXNWyZ
]DNáDGyZVHUZLVRZ\FK
]HZQ WU]QHM
o
Z\á F]QLHSU]H]RVRE\GRU VáH
owym.
Wszelkie prace o charakterze naprawczym i
UHJXODF\MQ\P
PXV] E\ü
Zykonywane
DXWRU\]RZDQ\P
F]\
MDN UyZQLH QLH PR H E\ü
FH QLH
SRZ\ HM E G NRQLHF]QR FL Z\PLDQ\ F]
QDOH \
SURGXNWyZ
SU]HP\VáRZ\FK
\ZQR FLRZ\FK
E\üXV]NRG]RQH
: SU]\SDGNX Z\VW
1LH
-H HOL
awodnie, (3)
XV]F]HONL RUD] SRZLHU]FKQLH XV]F]HOQLDM
PRJ
XU] G]HQLX
anie niezgodne z przeznaczeniem
powoduje anulowanie gwarancji.
QD
HZHQWXDOQH XVWHUNL WM GU]ZL QLH PRJ
W\P
UR]PUD DQLD
FHOyZ
X \ZDQD
QD
RUD]
Z
8 \WNRZ
owany
XZDJ
GU]ZL
L
laboraWRU\MQ\FK
]DNáDGVHUZLVRZ\
3URVLP\
QDOH \
\ZQR FLRZ\FK 1LH MHVW RQD SU]H]QDF]RQD
SURGXNWyZ
: SU]\SDGNX XVWHUHN QLH X \ZDü NXFKQL GR
F]DVX
1LH
NXFKQL VáX \ Z\á F]QLH GR SRGJU]HZDQLD
QD
XV]F]HOQLDM F\FK
\ZQR FLRZ\FK OXE
•
L
zawartymi
WR QDUD]Lü REVáXJXM FHJR QD RGG]LDá\ZDQLH
SDWU]UR]G]LDáÄ&]\V]F]HQLHLNRQVHUZDFMD´
•
]DLQVWDORZDü
wskazówkami
przeznaczeniem - jak podano w niniejszej
pozostaZDá\
•
QDOH \
ze
Zá F]DüNXFKQLNLHG\GU]ZLV RWZD WH0R H
SRZLHU]FKQLDFK
•
LQVWUXNFMLREVáXJL
r
•
.XFKQL
zgodnie
SU]HG
VSU] WX
GR
\ZQR FLRZ\FK
P
ZM17ML
Naczynia
:L NV]R ü QDF]\
]H V]NáD WZRU]\Z V]NODQR FHUDPLF]Q\FK L V]NáD
DURRGSRUQHJR QDGDMH VL
GRVWRVRZDQLDZNXFKQLH PLNURIDORZHM 0LPR H
energia mikroIDORZD QLH SU]HJU]HZD ZL
QDF]\ V]NODQ\FKLFHUDPLF]Q\FKPRJ
NV]R FL
RQHXOHF
QDJU]DQLX Z Z\QLNX SU]HQRV]HQLD VL FLHSáD ]
produktu na pojemnik. Dlatego zalecamy
yZDQLH U NDZLF SU]\ Z\MPRZDQLX ] NXFKQL
X
QDF]\ 6SUDZG]HQLHSU]\GDWQR FLQDF]\
•
Z\á
8PLH FLü Z NXFKQLH PLNURIDORZHM QDF]\QLH
ZUD] ]H V]NODQN Z\SHáQLRQ
GR S
oáRZ\
e
•
HOL QDF]\QLH
RGá F]\ü
RG
]DVLODQLD
6SU] W PHWDORZ\ OXE ] HOHPHQWDPL PHWDORZ\PL
MHVW JRU FH QLH QDOH \ VWRVRZDü JR Z NXFKQL
QLH
PLNURIDORZHM -H HOL MHVW RQR OHNNR FLHSáH PLNURIDORZHM
PR HE\ü X \ZDQH GR SRGJU]HZDQLD DOH QLH
Z\UD QLH RNUH OL L ]DOHFL PR OLZR ü X \Z
do gotowaQLD
kuchniach mikrofalowych.
WR
H QDGDMH VL
•
GR JRWRZDQLD Z NXFKQLH
mikrofalowej.
Papierowe serwetki,
U F]QLNL
SDSLHURZH
papier
WDFNL
woskowany,
NXENL
E\ü
]
VWRVRZDQ\
Z\M WNLHP
Z
MH HOL
NXFKQLH
SURGXFHQW
3RMHPQLNL
]
RJUDQLF]RQ\PL
RWZLHUDQLD
QS
X \ZDQH
GR
EXWHONL
SU]\U]
PR OLZR FLDPL
QLH
SRZLQQ\
G]DQLD
E\ü
SRWUDZ
Z
kuchniach mikrofalowych.
•
NDUWRQ\
RSDNRZDQLD PUR RQHN L WHNWXUD V EDUG]R
Z\JRGQH Z X \FLX =DZV]H QDOH \ MH
SRZLQLHQ
ania w
-H HOL QDF]\QLH XWU]\PDáR
QRUPDOQ WHPSHUDWXU RWRF]HQLD R]QDF]D
•
NXFKQL VL Z\GRE\ZDü]ZQ WU]DXU] G]HQLD
ZRG 3RGJU]Dü SU]\ XVWDZLHQLX QD :
SU]H] MHGQ PLQXW -
F]\ü
HOHNWU\F]QHJR L RGF]HNDü D G\P SU]HVWDQLH
3URVLP\
R
V]F]HJyOQ XZDJ
SU]\
]GHMPRZDQLX SRNU\ZHN E G SU]\NU\ZHN ]
dnak
naF]\
DE\QLHSRSDU]\üVL
SDU XSHZQLü VL F]\ SRMHPQLN Z\SHáQLRQ\ MHVW
SURGXNWHP
SRFKáDQLDá
PR QD
\ZQR FLRZ\P
HQHUJL XQLNQ ü
6WRVRZDü
VL NWyU\
PLNURIDORZ L
\ZQR ü
aczynia).
oducenta
SU]HJU]DQLD
Q
ZVND]yZHN
SU
GR
E G]LH
E G]LH
\ZQR FL
•
•
:LHOH QDF]\ ] WZRU]\Z V]WXF]Q\FK NXENL
GR
VWRVRZDQLD
Z
NRU]\VWDü
inIRUPDFM
UDG]LP\
]DSR]QDü
SURGXFHQWD
1DOH \
VL •
]DJUR
•
SR]RVWDZLDü
WHPSHUDWXU FR
Zá F]RQHM
SRMHPQLNyZ
Z\NRQDQ\FK
PDWHULDáyZ -H HOL ]DXZD
3D VWZR G\P
3URGXNW\
Z WUyENL
specjalnych
FHM
G]DQD
opakowaniach
SRVLDGDM FH
QLHSRURZDW GURELRZH
yáWND
QDNáXFLD
MDM
]
lub
ewentualnemu poparzeniu.
SURVLP\ QLH RWZLHUDü GU]ZL OHF] QDW\FKPLDVW
5
VNyU
mniaki,
Z\PDJDM
eZQ
ZDUVWZ\DE\]DSRELHFWZRU]HQLXVL
]H
G áDWZRSDOQ\FK
w
ZF]H QLHMV]HJR
SRGF]DV SRGJU]HZDQLD L JRWRZDQLD ]
X \FLHP
VWZDU]DM
E G SRZáRN WDNLH MDN MDEáND ]LH
NXFKQL
V]WXF]Q\FK SDSLHURZ\FK E
V\WXDFML
Z\PDJDQDG]RUXREVáXJXM FHJR
•
PLNURIDORZHM EH] QDG]RUX NRQWURORZDü MHM
praF
GR
SU]\VWRVRZDQ\FK QDF]\QLDFK F]\QQR ü WD
gatunków tworzyw sztucznych.
1LH
Z
enie.
3UD RQD NXNXU\G]D PR H E\ü SU]\U]
tylko
JDM Z
PR H VSRZRGRZDü WRSLHQLH VL QLHNWyU\FK
•
SRWUDZ
1LH QDOH \ VPD \ü SRWUDZ QD WáXV]F]X -HJR
GRSURZDG]Lü
XQLNDü
ZUD] ] SURGXNWDPL ]DZLHUDM F\PL GX H LOR FL
kuchnie miNURIDORZHMZ\VRN
NXFKQL
WHPSHUDWXUD QLH MHVW NRQWURORZDQD FR PR H
]
VWRVRZDQLD RSDNRZD ] WZRU]\Z V]WXF]Q\FK
FXNUX OXE WáXV]F]X 3URGXNW\ WH RVL
Z
XPLH FLüZRGSRZLHGQLPQDF]\QLX
NXFKQLDFK
PLNURIDORZ\FK -H HOL FKFHFLH 3D VWZR ]
QLFK
SRGJU]HZDü
SXV]NDFK 3URGXNW QDOH \ Z\M ü ] SXV]NL L
WDOHU]H RSDNRZDQLD PUR RQHN L LQQH QDGDMH
VL 1LH
WU]QHM
SDU\ OXE
P
ZM17ML
UWAGA: 3RGF]DVSRGJU]HZDQLDSá\QyZWM]XS
sosów, napojów) doprowadzenie ich do
WHPSHUDWXU\
SRMDZLHQLD
PR H
ZU]HQLD
VL QDVW
SLü
EH]
FKDUDNWHU\VW\F
znych
JRWRZDQLD=DZV]HQDOH \SU]HNáXZDü yáWND
SU]\NU\ü
MH
SRNU\ZN L
SR
]DNR
goWRZDQLD RGF]HNDü MHV]F]H PLQXW
F]HQLX
SU]HG MHM
]GM FLHP
S FKHU]\NyZ $E\ WHJR XQLNQ ü QDOH \ SU]\M ü
SRQL V]HZVN
azówki:
=$3$0,
•
7$-
1.
XQLNDü
2.
QLH
3.
SU]HG XPLHV]F]HQLHP Sá\QX Z NXFKQL QDOH \
QDF]\ PHWDORZ\FK PR H Z VW
JRXSU]HGQLR]DPLHV]DüF]\QQR üSRZWyU]\ü
&L JáH LVNU]HQLH PR H XV]NRG]Lü XU]
X \ZDQLD
SRMHPQLNyZ
FLDQNDFK]Z VNLPLV]\
GRSURZDG]Dü
R
SURVW\FK
jkami;
GR
]X \FLHPVLá\JG\ P
•
•
.LHG\
X \ZDP\
Z
NXFKQLH
PLNURIDORZHM
SLü LVNU]HQLH
G]HQLH
:WDNLP SU]\SDGNX QDOH \ SU]HUZDü SURJUDP
LVSUDZG]LüQDF]\QLH]NWyUHJRNRU]\VW
SRSRGJU]DQLXQDF]\QLH]Sá\QHP SR]RVWDZLü
Z NXFKQL S
HWRVSRZRGRZDü MHM
y
owie cyklu podgrzewania);
MHV]F]H SU]H] FKZLO
o
uszkodzenie.
QDGPLHUQHJR
przegrzewania;
ZSRá
3RVWDZ\REURWRZHMQLHZROQRREUDFDüU F]QLH
•
onownie
amy.
2WZRU\ ZHQW\ODF\MQH NXFKQL QLH PRJ E\ü
]DVáRQL WHJyUQHERF]QHRUD]GROQH
]DPLHV]Dü D QDVW SQLH Z\M ü SRMHPQLN SU]\
]DFKRZDQLXV]F]HJyOQHMRVWUR QR FL
1LHX \ZDüNXFKQLGRFHOyZNRPHUF\MQ\FK
•
Niektóre produkty, np. jaja oraz szczelnie
]DPNQL WH SRMHPQLNL V]NODQH VáoLNL PRJ
.XFKQLDMHVWSU]H]QDF]RQDGRX \WNXZ
warunkach gospodarstwa domowego.
XOHF HNVSOR]ML L GODWHJR QLH SRZLQQ\ E\ü
SRGGDZDQH G]LDáDQLX HQHUJLL PLNURIDORZHM
=DFKRZDMLQVWUXNFM
&]DVDPL MDMD PRJ HNVSORGRZDü SRGF]DV
6
REVáXJL
P
ZM17ML
7DEHODQDF]\
'RJRWRZDQLDZNXFKQLPLNURIDORZHMPR HFLH3D VWZRVWRVRZDüUy QRURGQHQDF]
ynia. Dla Waszego
h
EH]SLHF]H VWZD RUD] GOD ]DSRELHJDQLD ]QLV]F]HQLX QDF]\ L NXF QL QDOH \ Z\EUDü RGSRZLHGQLH
pojemniki i materiaá\
3RQL V]DOLVWDSR]ZROL3D
VWZX]DSR]QDüVL
] RJyOQ\PL ]DVDGDPL GRERUX QDF]\
GR VWRVRZDQLD Z
kuchni mikrofalowej.
Naczynie
0DWHULDá
&HUDPLNDLV]NáR
Gotowanie mikrofalowe
TAK
1DF]\QLD]HV]NáD
DURR
dpornego
6]NáR]PHWDORZ\PL
NIE
NIE
dekoracjami
6]NáRRáRZLDQH
Porcelana
Wyroby garncarskie
Tworzywa sztuczne
TAK
TAK
TAK
Bez dekoracji metalowych
Wyroby z tworzyw odpornych
TAK
QDRGG]LDá\ZDQLHPLNURIDO
opakowania z tworzyw
sztucznych
Metalowe rondle do pieczenia;
folia aluminiowa*
.XENLWDFNLU F]Qiki
Naczynia metalowe
Naczynia papierowe
NIE
TAK
TAK
TAK
Papier
woskowany
Drewno
Akcesoria
NIE
TAK
Talerz obrotowy
Podstawa talerza obrotowego
TAK
7$.PR QDX \ZDü
1,(QLHZROQRX \ZDü
e
IROLLDOXPLQLRZHMX \ZDüW\ONRGRSU]\NU\ZDQLDQSNR FLXGHNNXUF]DNDVNU]\G áHN
folia mo
HLVNU]\ü
Dane techniczne
:\PLDU\]HZQ
Waga 14 kg
WU]QH
3RMHPQR
6]HURNR üPP
*á
17 litrów
ü
ERNR üPP
:\VRNR üPP
Zasilanie elektryczne 230V, 50
Hz
Wymiary komory
Bezpiecznik 10 A
6]HURNR üPP
Pobór mocy 1200W
*á
ERNR üPP
0RFX \WHF]QD
:\VRNR üPP
7
700W
P
ZM17ML
35=(':à &=(1,(0
Rozpakowanie
8:$*$ .XFKQLD PR H E\ü XVWDZLRQD Z SUDZLH
3RGF]DV UR]SDNRZ\ZDQLD NXFKQL QDOH \ VSUDZG]Lü
ND G\P PLHMVFX NXFKQL 0XVL RQD
czy nie jest ona uszkodzona. Uszkodzenia lub braki
Z
Z\SRVD HQLX
QDOH \
jednostce hanGORZHM
QDW\FKPLDVW
]JáRVLü
JG]LH GRNRQDOL FLH 3D
]DSHZQLRQ
Z
RGSRZLHGQL
VWZR
VL
]DNXSX .XFKQLD MHM Z\SRVD HQLH OXE DNFHVRULD
PRJ
E\ü RSDNRZDQH Z IROL
WDN QDOH \ XVXQ
NXFKQL
ü M
]DEH]SLHF]DM
F
1LH
QDOH \
* 7RXU]
SR]RVWDZLDü
elementów opakoZDQLD Z PLHMVFDFK GRVW
SQ\FK GOD
G]LHFL 0DWHULDá ] NWyUHJR Z\NRQDQH V
HOHPHQW\
RSDNRZDQLDPR HE\ü]DJUR HQLHPGODG]L
eci.
RGQR
2.
ü
]
VL
.XFKQL
GU]ZL
UHNODPRZH
XPLH FLü
L
]DLQVWDORZDü
G]LHZVWDQLH XWU]\PDü FL
ZUD] ] MHM ]DZDUWR FL
XU]
SRGF]DV
jego efektywQR
üDQ
aZHWVSRZRGRZDüDZDUL
-H HOL
SRGá
FLHGODNWyUHJRXU]
PDM
F]HQLD
3D
VWZR
NXFKQL
GR
]DEH]SLHF]HQLD X]LHPLDM
QD VZRERGQ\ SU]HSá\Z
owych -
aOH
\M
F\]
SRGá
F]\ü
F\PLVSUDZG]Lü
G]HQLHMHVW
FLXZVLHFL
F]HQLDNXFKQL
F]RQDGRJQLD]GND
VL
ylacyjnych. Nie
]XSUDZQLRQ\PHOH
Z
WSOLZR FL
VLHFL
GRW\F]
HOHNWU\F]QHM
FHJR SURV]
E
FH
G
VNRQWDNWRZDü
ktrykiem.
DGQ\FK SU]HGPLRWyZ QD JyUQ\P EODFLH
G]HQLD
=
ablokowanie
otworów
3RGá F]HQLHHOHNWU\F]QH
ZHQW\ODF\MQ\FK PR H SURZDG]Lü GR SU]HJU]DQLD
NXFKQL
UDGL
G]HQLH((&
G]LH QDUD RQH QD
SRZLHWU]D ZRNyá RWZRUyZ ZHQW
XU]
G
G]HQLHRGSRZLDGDQRUPRP(:*
UWAGA! .XFKQLDPXVLE\üSRGá
z uziemieniem.
lnej.
G]HQLH E
3URVLP\ ]ZUyFLü XZDJ
VWDZLDü
]DEORNRZDQHE
1LHX \ZDüSU]HGáX DF]\GRSRGá
XVWDZLHQLH
.XFKQLDQLHSRZLQQDVWDüZSREOL X UyGHáFLHSáDL
ZRG\ -H HOL XU]
L
elektrycznej.
ü ZLEUDFML OXE
]DOHFDP\
G]HQLDZSR]\FMLVWDEL
DU NXFKHQNL NJ
$E\ XQLNQ
SUDF\
MHGQDN
FLVSRGQLHM
GOD9+]1
czy naSL
RGG]LDá\ZDQLH FLHSáD OXE ZRG\ PR H WR REQL \ü
4.
WHWDN HZF]
]DSURMHNWRZDQHRGSRZLDGDQDSL
QD
owierzchni, która
3.
PLHü
SRZLHU]FKQL
: W\P FHOX QDOH \ XSHZQLü
GRJQLD]GND]HVW\NLHPX]LHPLDM
MH HOL
dzeniu.
QDXU]
QDOH \
QDNOHMNL
SáDVNLHM Z\SR]LRPRZDQHM S
KDáDVX
.XFKQLDMHVWZ\SRVD RQDZSU]HZyG]DVLODM
]QDMGXM
E
ZHQW\ODFM
UyZQ
3RGá F]HQLHGR]DVLODQLD
ZW\F]N
8VXQ
QLHHOLPLQDFML]DNáyFH
UR]SRU]
Instalacja
1.
SáDVN
HRWZRU\ZHQW\ODF\MQHQLHV
przyVáRQL
-H OL
SU]HG SLHUZV]\P X \FLHP
PLNURIDORZHM
D
WR
]
IXQNFMRQRZDQLD E
2WZRU\
NROHL
QLHZáD FLZHJR
G XV]NRG]HQLD XU]
ZHQW\ODF\MQH
SRZLHWU]H
GR
GODWHJR
RGSURZDG]DM
QDOH \
VZRERGQ\SU]HSá\ZQSPL
SRPLHV]F]HQLD QLH PRJ
G]HQLD
8U]
JRU
ZW\F]N
XPR OLZLü
G]\NXFKQL
j
]QD GRZDü VL
FH
G]HQLHMHVWZ\SRVD RQHZVWDQGDUGRZ
SU]HZRGX]DVLODM
FHJR
MHJR
D FLDQ
aVáRQ\
8:$*$85=
]
'=(1,(086,%<û8=,(0,21(
itp.).
5.
.XFKQL
i
telewizyjnych.
Urz dzenie
RGSRZLDGD QRUPRP 8( GRW\F]
]DNáyFH
3URGXFHQWQLHSRQRVLRGSRZLHG]LDOQR
QDOH \ XPLH FLü ] GDOD RG RGELRUQLNyZ
radiowych
UDGLRZ\FK OHF] PRJ
MH HOL XVWDZLFLH 3D
QLHSU]HVWU]HJDQLHPSU]HSLVyZEH]SLHF]H
F\P HOLPLQDFML
RQH VL
VWZR NXFKHQN
-H HOL
NXFKQLD
E
G]LH
]E\W EOLVNR
XV\WXRZDQD
8U]
G]HQLH SRGá
F]\ü GR JQLD]GND ] X]LHPLHQLHP
(zabezpieczenie 13 A).
Z
URJX
SRPLHV]F]HQLD QDOH \ SR]RVWDZLü V]F]HOLQ
V]HURNR FL SU]\QDMPQLHM FP SU]\
VWZD
SRMDZLü
radioodbiornika lub telewizora.
6.
FLZ
przypadku usterek spowodowanych
to
R
FLDQLH ]
prawej strony.
8
P
ZM17ML
2EVáXJDNXFKQLPLNURIDORZHM
1
3
2
5
4
8
4
6
7
Elementy
1.
Podstawa obrotowa / talerz
.RPRUD NXFKQL PLNURIDORZHM:\F]\ FLü L Z\WU]Hü
1.
SRND G\PX \FLX
2.
2NQR
SU]H]
NWyUH
PR QD
VSUDZG]Dü
DURRGSRUQHJR
1D
WDOHU]
QDOH \
REURWRZ
XPLH FLüZGROQHMF]
FL
kuchni.
2.
przygotowania potrawy.
3. 'U]ZL1DOH \MHGRNáDGQLH]DP\NDü
4. Zaczepy zatrzaskowe i blokada drzwi.
5. 3DQHOVWHUXM F\
6. Podstawa obrotowa talerza; umieszczana w
GROQHMF]
FLNXFhni pod talerzem
7. 7DOHU] REURWRZ\ Z\NRQDQ\ ]H VSHFMDOQHJR V]NáD
RGSRZLHGQLH QDF]\QLH ] SRWUDZ
3RGVWDZ
VWDQ
7DOHU]REURWRZ\SRáR \üQDSRGVWDZLHZ
VSRVyESRND]DQ\QDU\VXQNX1DOH \XSHZQLü
VL
HWDOHU]]RVWDáRGSRZLHGQLR]DPRFRZDQ\
w wypustce. 1LHZROQRNáD
üWDOHU]DZ
SRáR HQLXRGZURWQ\P
-
=DUyZQR WDOHU] MDN L MHJR
]QDMGRZDüVL
-
SRVWDZLü
1LH X \ZDü
kuchni bez talerza obrotowego.
8. .Zaczep dla talerza obrotowego
SRGVWDZD
Produkty oraz pojemniki umieszczamy zawsze na
talerzu obrotowym.
7DOHU] REUDFD VL
Z SUDZ
L Z OHZ
VWURQ
]MDZLVNRQRUPDOQH1LHREUDFDüWDOHU]DU
PR QD
XV]NRG]Lü
mechanizm obrotowy.
Talerz obrotowy
Podstawa obrotowa
Zaczep dla talerza
9
PXV]
ZNXFKQLHSRGF]DVMHMSUDF\
MHVW WR
F]QLHJG\
P
ZM17ML
3$1(/67(58- &<
1.
3RNU
WáRZ\ERUXPRF\
6áX \GRZ\ERUXSR]LRPXPRF\PLNURIDO
2.
3RNU
WáR]HJDUD
6áX \GRXVWDZLHQLDF]DVXJRWRZDQLD
1DMSLHUZQDOH \XVWDZLüQLHFRGáX V]\F]DV
SRF]\PSRZUyFLüGRSUDZLGáRZHMZDUWR FL
10
P
ZM17ML
GOTOWANIE MIKROFALOWE
1.
2.
3.
2WZRU]\ü GU]ZL QD WDOHU]X REURWRZ\P SRáR \ü
$E\Z\á
SRWUDZ
REUyFLüSRNU
3RNU
ZQDF]\QLX=DPNQ
üGU]ZL
F]\üXU]
G]HQLHZWUDNFLHSUDF\QDOH \
WáR]HJDUDGRSRáR HQLD
WáHPZ\ERUXPRF\XVWDZLüZ\PDJDQ\
SR]LRPSDWU]SRQL V]DWDEHOD
8ZDJD3R]DNR
3RNU
XSHZQLüVL
WáHP]HJDUDXVWDZLüF]DVJRWRZDQLD
5R]SRF]QLHVL
JRWRZDQLH
F]HQLXJRWRZDQLDQDOH \
HSRNU
WáR]HJDUD]QDMGXMHVL
SRáR HQLX:SU]HFLZQ\PUD]LHNXFKQLDE
QDGDOSUDFRZDáD
-H HOLF]DVJRWRZDQLDMHVWNUyWV]\QL PLQXW\
QDOH \XVWDZLüGáX V]\F]DVDQDVW
SQLHSRZUyFLüGR
SUDZLGáRZHMZDUWR FL
3U]\NáDG*RWRZDQLH:SU]H]PLQXW
1.
3RNU
WáRZ\ERUXPRF\XVWDZLüQD:
2.
3RNU
WáR]HJDUDXVWDZLüQD
3.
.XFKQLDE
G]LHSUDFRZDáDSU]H]PLQXW]PRF
QDSR]LRPLH:
7DEHODXVWDZLH
Poziom mocy
120W
(230W)
3URSRQRZDQHX \FLH
Utrzymywanie w cieple
5R]PUD DQLH
350W
gotowanie i podgrzewanie delikatnych potraw, zapiekanek
pieczenie ciast z serem
540W
3LHF]HQLHFLDVWSU]\U]
700W
G]DQLHEXG\QLX
*RWRZDQLHOXESRGJU]HZDQLHSá\QyZ
Gotowanie warzyw.
11
Z
G]LH
P
ZM17ML
:VND]yZNLGRW\F] FHUR]PUD DQLD
1LHNWyUHSURGXNW\SLHF]\ZRLRZRFHPR QDUR]PUD DüSU]\U
PRODUKT
(230W)
F]Q\PXVWDZLHQLXPRF\
CZAS
“ODCZEKANIA”
PRZYGOTOWANIE
Pieczywo
aczyniu do
mikrofaOyZNLREUyFLüZSRáRZLHF]DVXRGPUa DQLD
'X \ERFKHQHN
3RáR \üQDSDSLHU]HNXFKHQQ\POXEQaczyniu do
(krojony) mikrofaOyZNLREUyFLüZSRáRZLHF]DVXRGPUa DQLD
2 kromki
3RáR \üQDSDSLHU]HNXFKHQQ\P
0Dá\ERFKHQHN
3RáR \üQDSDSLHU]HNXFKHQQ\POXEQ
EXáND
3RáR \üQDSDSLHU]HNXFKHQQ\P
EXáNL
3RáR \üQDSDSLHU]HNXFKHQQ\P
Ciasta i wyroby cukiernicze
Sernik (450 g)
=GM üRSDNRZDQLHXáR
Ciasto
=GM üRSDNRZDQLHXáR
(upieczone) (450
g)
Placek (450 g)
=GM üRSDNRZDQLHXáR
\üQDWDOHU]X
8–10 min.
10–15 min.
10–13 min.
10 min
45–60 sek.
45–60 sek.
1–11/2 min.
5 min.
5 min.
5 min.
9–11 min.
15–30 min.
7– 9 min.
15–30 min.
7– 9 min.
15–30 min.
3– 4 min.
5–10 min.
5– 6 min.
5–10 min.
7– 8 min.
5–10 min.
7– 8 min
5–10 min.
\üQDWDOHU]X
\üQDWDOHU]X
0DVáR
250 g (1 kostka)
-H HOLRSDNRZDQHZIROL
±]GM
üLSRá
o
\üQD
talerzu
Owoce
Drobne owoce
(225 g)
Drobne owoce
(450 g)
Dania gotowe
400 g
8áR \üMHGQ
ZD VWZ
r
QDSá\WNLPW
alerzu
8áR \üMHGQ
ZDUVWZ
QDSá\WNLPW
alerzu
3U]\NU\üWDOHU]HPOXEVSHFMDOQ
IROL GR
PLNURIDOyZHNDE\SRGJU]Dü±Zá
F]\üPLNURIDOHQD
100% (700W) na 3-4 minuty
Warzywa
Nie ma konieczno FLRGPUD DQLDZarzyw przed
gotowaQLHP:V]\VWNLHZDU]\ZDPR QDXJRWRZDü
przy ustawieniu 100% (700W)
12
P
ZM17ML
Praktyczne wskazówki
•
.XFKQL
QDOH \
XWU]\P\ZDü
Z
Porady
F]\VWR FL
•
±
Z\FLHUDü SR ND G\P X \FLX WDN H SRGVWDZ
REURWRZ
•
LZ
eZQ
WU]Q
1LHX \ZDüQDF]\
HOHPHQWDPL
RSDNRZD
•
]SRNU\
URG]DMH
SODVWLNRZ\FK PRJ
VL
QDF]\
•
OXE
&KOHEPR QDUR]PUD DüQDSDSLHURZ\PU
F]QLNX
•
-H HOL
VZRLFK
6WRSLHQLH PDVáD QD QDMZ\ V]\P SR]LRPLH PRF\
PUR RQNL
'HOLNDWQH
V
NDZDáNL
SRGJU]HZDQH
Z
QS
DOXPLQLRZHM
VNU]\GHáND
RNU\ü
•
DE\
XQLNQ
ü
OXE
Qy NL
IROLL
SU]HJU]DQLD
•
SRZáRN
FH QLHSRURZDW
WDNLH MDN MDEáND ]LH
GURELRZH
yáWND
MDM
NLHáEDVNL
ZF]H QLHMV]HJR QDNáXFLD ]HZQ
DE\
]DSRELHF
VNyU
mQLDNL
WZRU]HQLX
•
SDU\
:L NV]H
]HZQ
NDZDáNL
s
HN SORGRZDü
\ZQR FL
XPLHV]F]Dü
WU]QHM VWURQLH QDF]\QLD 6WDUDü VL
\ZQR ü
SRUFMRZDQ
Z
SR
JRWRZDü
PQLHMV]H
NDZDáNL
\ZQR üXNáDGDüQD URGNXWDOHU]DREURWRZHJR
•
\ZQR ü E
E
G]LH
G]LH XJRWRZDQD UyZQRPLHUQLH MH HOL
REUDFDQD
OXE
PLHV]DQD
SRGF]DV
gotowania.
1DOH \
QLHFR
VNUDFDü
F]DV
SU]\JRWRZDQLD
SRWUDZ\ZVND]DQ\SU]H]SURGXFHQWDDE\XQLNQ
UR]JRWRZDQLD ,P ZL
NV]H NDZDáNL
ü
\ZQR FL W\P
GáX V]\F]DVMHVWF]DVLFKJRWRZDQLD
'R
JRWRZDQLD
ZDU]\Z
QDOH \
GRGDZDü
MDN
QDMPQLHMV]HLOR FLZRG\OXEJRWRZDüEH]ZRG\
8 \ZDü PQLHM VROL L LQQ\FK SU]\SUDZ QL Z
przypadku gotowania tradycyjnego.
•
\ZQR ü
SU]\SUDZLDü
SR
Z\M
FLX
]
NXFKQL
mikrofalowej.
•
3R
]DNR
ÄF]DV
F]HQLX
JRWRZDQLD
RGF]HNDQLD´
DE\
QDOH \
]DFKRZDü
SRWUDZ\
E\á\
równomiernie ugotowane.
•
3R Z\M
MX FLX ] NXFKQL SRWUDZ\ VSUDZG]Lü F]\ MHVW
Z\VWDUF]DM
FR
JRU
FD
XJRWRZDQD
równomiernie).
•
3U]\Z\MPRZDQLXQDF]\
]DZV]HX \ZDüU
ENL F]RVQNX RJU]HZDü QD QDMZ\ V]\P
Sok owocowy
Z\FL QL
OXE
ewentualnemu poparzeniu.
1LHJRWRZDüMDMJG\ PRJ
Obieranie czosnku
G
EDUG]LHM VRF]\VWH SR SRGJU]DQLX QD
QDMZ\ V]\P SR]LRPLH PRF\ SU]H] VHNXQG SU]HG
Z\PDJDM
ZLH DQLHOXESRGJU]HZDQLHSLHF]\ZD
2ZRFH E
WUyENL
WU]QHM ZDUVWZ\
VL
2G
poziomie mocy przez 15 sekund.
OXE
E G
Z
NF]HQLH±SU]\QDMQL V]\PSR]LRPLHPRF\
OXE ]
spalenia.
3URGXNW\ SRVLDGDM
NF]DQLHPDVáD
UHGQLSR]LRPPRF\SU]H]NLONDVHNXQG
ü
NDZDáNDPL
7RSLHQLHOXE]PL
]PL
E\ü
\ZQR FL WR ]DOHFLá =GM
QDOH \
NXUF]DND
•
J QD NRVWNL ZáR \ü GR PLVNL L
PLHV]Dü
erza.
metalowe klipsy.
•
3URGXNW\ QDOH \ SU]\NU\ü SRGF]DV JRWRZDQLD
JG\ LFK SURGXFHQW
•
SU]H]
SRGJU]HZDü QD QDMZ\ V]HM PRF\ SU]H] PLQXW\
umieszczane w kuchni mikrofalowej tylko wtedy,
•
•
XVWDZLHQLX
gotowania w kuchni mikrofalowej.
RU\JLQDOQ\FK RSDNRZDQLDFK QDOH \ MH RWZRU]\ü
•
UHGQLP
Topienie czekolady
3RG]LHOLü WDEOLF]N
VWRSLü SRGF]DV
2SDNRZDQLD]HOHPHQWDPLPHWDORZ\PL PRJ
•
SU]\
minuty.
PHWDORZ\FKOXE]PHWDORZ\PL
1LHNWyUH
ü
LZáR \üVáRLNGRNXFKQLSRGJU]HZDüIDODPL
PLNURIDORZ\PL
Já\FK
wkami.
8 \üV]NODQHMSRNU\ZNLOXEWDO
•
•
SRNU\ZN
GU]ZL
'R JRWRZDQLD PLNURIDORZHJR X \ZDü RNU
OXERZDOQ\FKQDF]\
•
VWURQ
Miód
-H HOL PLyG Z VáRLNX XOHJá NU\VWDOL]DFML QDOH \ ]GM
LSRWUDZ]NXFKQLQDOH \
NDZLFRFKURQQ\FK
13
FLHP
P
ZM17ML
Konserwacja i czyszczenie
.XFKQLD PLNURIDORZD PXVL E\ü XWU]\P\ZDQD Z F]\VWR FL 1LHXVXQL
SRFKáDQLDM
HQHUJL PLNURIDORZ
7RSU]\F]\QLDVL
RUD]XOHJDM
SU]
WH UHV]WNL SU
oduktów niepotrzebnie
ypaleniu.
GR]PQLHMV]HQLDZ\GDMQR FLXU]
G]HQLDRUD]SRZVWDZDQLDQLHSU]
yjemnych zapachów.
asnym zakresie. Naprawy
DGQH F]\QQR FL QDSUDZF]H F]\ UHJXODF\MQH QLH SRZLQQ\ E\ü GRNRQ\ZDQH ZH Zá
PRJ
E\üSU]HSURZDG]DQHZ\á
F]QLHSU]H]WHFKQLNyZD
utoryzowanych zaNáDGyZVHUZLVRZ\FK
SLHQLHP GR F]\V]F]HQLD QDOH \ XSHZQLü VL
3U]HG SU]\VW
F]\ NXFKQLD MHVW Z\á
F]RQD LOXE RGá
czona
od zasilania.
Czyszczenie akcesoriów (talerz i podstawa)
&]\ FLü GHOLNDWQ\PL
URGNDPL SR Z\M
FLX ] NXFKQL QDOH \ RVWUR QLH REFKRG]Lü VL
] SRGVWDZ
WDOHU]D
obrotowego.
UWAGA:
]DNR
:Q
WU]H NXFKQL RUD] WDOHU] V
EDUG]R JRU
FH ZL
F QLH QDOH \ LFK GRW\NDü EH]SR UHGQLR SR
F]HQLXF\NOXJRWRZDQLD
&]\V]F]HQLHZQ WU]DNXFKQL
.XFKQL
k
QDOH \ XWU]\P\ZDü Z F]\VWR FL 1DW\FKPLDVW XVXZDü SR]RVWDáR FL SURGX WyZ
oZRGXM
FLDQHN XV]F]HOHN SRZLHU]FKQL XV]F]HOQLDM
PLNURIDORZHMSU]\F]\QLDM
FVL
GR]PQLH
F\FK JG\ S
jszenia jej efekW\ZQR
'RF]\V]F]HQLDVWRVRZDüGHOLNDWQHGHWHUJHQW\Sá\QQHFLHSá
1,( 1$/(
< 8
<:$û
52'.Ï:
FLDPRFQ\FK]DEUXG]H
'2868:$1,$=$1,(&=<6=&=(
:FHOXXVXQL
ZRG
RUD]PL
HQHUJLL
NNLHLF]\VWH FLHUHF]NL
OWYCH ZMYWAKÓW DO
OWEJ.
PR QDJRWRZDüZNXFKQLV]NODQN
1,(8
\ZQR FLRZ\FK ]H
DEVRUSFM
FLDQDZHWSRZVWDQLDSRZD QHMXVWHUNL
&,(51<&+ 35=(0<6à2:<&+ 67$/
$'1(*2=(/(0(17Ï:.8&+1,0,.52)$/
:FHOXXVXQL
RQH QDGPLHUQ
<:$û12
ZRG\SU]H]PLQXW\
<,,11<&+2675<&+1$5=
FLDQLHSU]\MHPQHJR]DSDFKXQDOH \JRWRZDüZNXFKQLV]NODQN
'=,
ZRG\]á\ NDPLVRNX]F
ytryny
przez 5 minut.
&]\V]F]HQLHHOHPHQWyZ]HZQ WU]Q\FK
3RGF]DV F]\V]F]HQLD HOHPHQWyZ SDQHOX VWHUXM
Zá
F]HQLXNXFKQL(OHPHQW\ ]HZQ
VSUD\XFLHSá
ZRG
LRVXV]DüPL
1LH ZROQR VWRVRZDü
URGNyZ
FHJR QDOH \ RWZRU]\ü GU]ZL FR ]DSRELHJQLH SU]\SDGNRZHPX
WU]QHQDOH \F]\ FLüáDJRGQ\PL
NN
V]PDWN
URGNDPLWDN HXQLZHUVDOQ\PL
URGNDPL Z
FLHUQ\FK V]RUVWNLFK ]P\ZDNyZ GR QDF]\
FKHPLF]Q\FK 3RGF]DV F]\V]F]HQLD SURVLP\ ]ZUyFLü XZDJ
woda.
14
F]\ WH V]RUVWNLFK
URGNyZ
DE\ GR RWZRUyZ ZHQW\ODF\MQ\FK QLH GRVWDáD VL
P
ZM17ML
FL]DPLHQQH
SHUZLVLF]
-H HOL NXFKQLD QLH G]LDáD SUDZLGáRZR SU]HG ZH]ZDQLHP VHUZLVX SURV]
PR QDXV
uQ
VSUDZG]Lü F]\ XVWHUNL QLH
üVDPRG]LHOQLH
1LHPR QDXUXFKRPLüNXFKQL
•
•
•
•
6SUDZG]LüF]\XU]
F]RQHGR]DVLODQLDHOHNWU\F]Q
ego.
-H OLWRNRQLHF]QHZ\PLHQLüEH]SLHF]QLNQDVSUDZQ\RW\FKVDP\FKSDUDPHWUDFK
6SUDZG]Lü F]\ SU]Há
Zá
•
•
G]HQLHMHVWSUDZLGáRZRSRGá
6SUDZG]LüF]\ZW\F]NDMHVWSUDZLGáRZRZáR RQDGRJQLD]GND
F]QLN JQLD]GNR
FLHQQH OXE LQQ\ SXQNW REZRGX ]QDMGXMH VL
Z SR]\FML 21
F]RQ\
6SUDZG]LüF]\ZJQLD]GNXMHVWQDSL
FLHSRSU]H]SRGá
F]HQLHLQQHJRVSUDZQHJRXU]
G]HQLD
6SUDZG]LüEH]SLHF]QLNZVNU]\QFH
Kuchnia nie podejmuje pracy:
• 6SUDZG]Lü F]\ Zá F]RQR ]DEH]SLHF]HQLH SU]HG SU]\SDGNRZ\P XUXFKRPLHQLHP SU]H] G]LHFL GRVW SQH Z
niektórych modelach).
• 6SUDZG]LüZ\NRQDQHXVWDZLenia.
• 6SUDZG]LüF]\XVWDZLHQLD]RVWDá\GRNRQDQH]JRGQLH]RSLVHPZLQVWUXNFMLREVáXJL
• 6SUDZG]LüF]\SUDZLGáRZR]DPNQL WRGU]ZLRUD]F]\]DPNQL FLXQLHSU]HV]NaG]DM UHV]WNLSURGXktów).
• 6SUDZG]LüF]\SU]\FLVN6WDUW]RVWDáZFL QL W\
-H HOL Z\NRQDQLH SRZ\ V]\FK F]\QQR FL QLH SU]\QLRVáR HIHNWX L NXFKQLD QDGDO QLH IXQNFMRQXMH QDOH \
VNRQWDNWRZDüVL
]QDMEOL V]\PDXWRU\]RZDQ\P]DNáDGHPVHUZ
isowym Zanussi.
8:$*$.RV]WZH]ZDQLHWHFKQLND]SRZRGXXVWHUNLZ\PLHQLRQHMSRZ\ HMOXEQLHSUDZLGáRZHMREVáXJL
LQVWDODFMLXU]
-H HOL E
G
G]HQLDSRNU\ZDNOLHQWQDZHWZF]DVLHWUZDQLDJZDUDQFML
3D
VWZR ]DPDZLDOL XVáXJL VHUZLVRZH OXE F]
FL ]DPLHQQH SURVLP\ R SRGDQLH QDVW
SXM
F\FK
informacji:
1. objawy usterki
2. oznaczenie modelu
3. numer seryjny/produktu
4. data zakupu
=DOHFDP\]DSLVDQLHW\FKLQIRUPDFMLSRQL HM
Model :
ZM17ML
Numer seryjny:
Data zakupu:
-H HOL XU]
G]HQLH SRGOHJD JZDUDQFML SU]HG ZH]ZDQLHP VHUZLVX QDOH \ VSUDZG]Lü F]\ XVWHUNL QLH
PR QD XVXQ
ü VDPRG]LHOQLH :L]\WD E
G]LH RGSáDWQD JG\ XVWHUND QLH E
G]LH PLDáD FKDUDNWHUX
mechanicznego lub elektrycznego.
:UD]LHQDSUDZ\ZF]DVLHJZDUDQFMLQDOH \XGRVW
SQLüGRZyG]DNXSXXU]
&]
FL]DPLHQQH
&]
FL]DPLHQQHPR QDQDE\üZDXWRU\]RZDQ\FK]DNáDGDFKVHUZLVRZ\FK
G]HQLD
Serwis
,QIRUPDFMLRSURGXNWDFKXG]LHODSURGXFHQW:SU]\SDGNXZ
]ZUyFLüVL
GRDXWRU\]RZDQHJRVHUZLVX
15
WSOLZR FLGRW\F]
F\FKG]LDáDQLDXU]
G]HQLDQDOH \
P
ZM17ML
WARUNKI GWARANCJI
:DUXQNLXG]LHORQHMJZDUDQFML]QDMGXM
XU]
VL
ZNDUFLHJZDUDQF\MQHMNWyU
G]HQLD
16
RWU]\PDOL3D
VWZRSU]\]DNXSLH
j
ZM17ML
Obsah
' tYHQHå]DþQHWHPLNURYOQQRXWURXEXSRXåtYDW
4
%H]SHþQRVWQtSRN\Q\
4
4
5
5
6
6
%H]SHþQRVWQiGREt
=NRXãHQtYKRGQRVWLNXFK\ VNpKRQiGREt
%H]SHþQRVWSRWUDYLQ
1iYRGQDSRXåLWtQiGREtDS tVOXãHQVWYtWURXE\
Technické údaje
3 tSUDYDSURXåtYiQt
- Vybalení
Instalace
3 LSRMHQtQDKODYQtHOHNWULFNêUR]YRG
(OHNWULFNpS LSRMHQt
Jak provozovat vaší mikrovlnnou troubu
7
7
7
7
7
ýLãW QtH[WHULpUX
8
8
8
9
10
10
11
12
13
13
13
13
Servis a náhradní díly
14
=iUXþQtSRGPtQN\
15
Záruka, servis a náhradní díly
16
3RSLVDIXQNFHMHGQRWOLYêFKGtO
,QVWDODFHRWRþQpKRWDOt H
- Ovládací panel
3 tSUDYDSRNUP YPLNURYOQQpWURXE
3U
YRGFHQDVWDYRYiQtYêNRQXPLNURYOQQpWURXE\
1iYRGQDUR]PUD]RYiQtS LYêNRQX:
5DG\SURSRXåLWtPLNURYOQQpWURXE\
3pþHDþLãW QtWURXE\
ýLãW QtS tVOXãHQVWYtRWRþQêWDOt DYR]tN
ýLãW QtLQWHULpUX
3
j
ZM17ML
%ODKRS HMHPHYiPNQiNXSXYDãtQRYpPLNURYOQQpWURXE\
' NXMHPHYiPåHMVWHVLY\EUDOLSURGXNWILUP\=DQXVVL-VPHS HVY GþHQLåHVKOHGiWHWXWRQRYRXPLNURYOQRX
WURXEXXåLWHþQRXDåHYiPEXGHYêWHþQêPSRPRFQtNHP%XGHWRY\åDGRYDWQ MDNêþDVVHQDXþLWYãHFKQ\
IXQNFHDPRåQRVWLYDãHKRQRYpKRNXFK\ VNpKRSRPRFQtNDVWHMQ MDNRMVWHQDWR]Y\NOtXNDåGpKRQRYpKR
NXFK\ VNpKRVSRW HELþH
' tYHQHå]DþQHWHPLNURYOQQRXWURXEXSRXåtYDW
3 HþW WH VL SHþOLY FHOê QiYRG N REVOX]H D XMLVW WH VH åH S L SRXåtYiQt YDãt QRYp PLNURYOQQp WURXE\ =DQXVVL
SRVWXSXMHWHSRGOHQ MDGRViKOLMVWHWDNFRQHMOHSãtFKYêVOHGN -HG OHåLWpDE\WDWRS tUXþNDE\ODXFKRYiYiQDSURQiVOHGXMtFtSRXåLWtVSROXVHVSRW HELþHP9S tSDG SURGHMH
WURXE\MLQpPXYODVWQtNRYLQHERNG\E\MVWHVHQ NG\VW KRYDOLYåG\VHSURVtPXMLVW WHåHWDWRS tUXþNDMHY
EOt]NRVWLVSRW HELþHLQDQRYpPPtVW DDE\LMHMtQRYêYODVWQtNVHPRKOVVH]QiPLWVMHMtPREVDKHP
%H]SHþQRVWQtSRN\Q\
•
9HVWDY Qp
VStQDþH
EH]SHþQRVWQtKR
•
EORNRYiQt
MVRXGYt NDVSRW HELþHRWHY HQD
•
P
åH
PtW
]D
QiVOHGHN
VH
1HGRYROWH
DE\
QDVKURPiåGLO\
VH
QD
]E\WN\
SRYUFKX
SRNUP W VQ Qt
QHER
GYH t
1HQt
•
NYDOLILNRYDQêP
VHUYLVQtP
D
QHGRãOR
N
SRãNR]HQt
S tSUDYN\
SUR
SU P\VORYp
ODERUDWRUQt
QHER
1HSRXåtYHMWH
WURXEX
SRWUDYLQD
SUi]GQRX
QHER
YRGD
-HVWOLåH
NWHUi
QHQt
Y
DEVRUEXMH
PLNURYOQQê]i LþPDJQHWURQ
•
GYt HN
SRNURXFHQt ]iY V D ]iPN SRãNR]HQt QHER
YODVWQtKRW VQ Qt
1HVNODGXMWH
VSRW HELþ
YH
YHQNRYQtP
SURVW HGt
1HSRXåtYHMWHKRYEOt]NRVWLYRG\
•
9 åiGQpP S tSDG VH QHSRNRXãHMWH WURXEX RSUDYLW
svépomocí. Pokusy o opravu nezkušenými osobami
1HSRNRXãHMWH VH VXãLW Y WURXE SUiGOR QHER SDStU
Tyto materiály se mohou vznítit.
•
PRKRX YpVW NH ]UDQ Qt RVRE QHER N YiåQpPX
1HSRXåtYHMWHYQLW Qt SURVWRU WURXE\ SUR VNODGRYiQt
1HQHFKiYHMWH YêUREN\ ] SDStUX NXFK\ VNp SRW HE\
SRãNR]HQt WURXE\ 9åG\ NRQWDNWXMWH Yiã PtVWQt
autorizovaný servis.
• Nikdy nesnímejte vn
9 S tSDG åH WURXED MH SRXåtYiQD G WPL MH QXWQp
]DMLVWLWGRKOHGGRVS OêFK
•
QHVSROHKOLYRVW W VQ Qt GYH t QHER SRYUFKX
•
QHSRXåtYHMWH
Y\]D RYDQp PLNURYOQQp ]i HQt P åH VH SRãNRGLW
-H RE]YOiãW G OHåLWp DE\ VH GYt ND WURXE\ GRE H
]DYtUDOD
WURXE XUþHQ
WURXE technikem.
•
m ke
QiVOHGHN]WUiWX]iUXN\QDWHQWRVSRW HELþ
enou troubu do doby
RSUDYHQD
Y
NRPHUþQt SRXåLWt .DåGp WDNRYp SRXåLWt E\ P OR ]D
1HGRYROWH SRXåtYDW SRãNR]
MH
SRX]H
XUþHQ SUR RK HY YD HQt D UR]PUD]RYiQt SRWUDYLQ
þLVWtFtKR
SUR~GUåEXXYHGHQ\
QHå
WURXEX
]S VREXMtFt NRUR]L 7HQWR W\S WURXE\ MH VSHFLiOQ
SURVW HGNX9L]þiVW3pþHDþLãW QtNGHMVRXSRN\Q\
•
WXWR
7HQWR VSRW HELþ SRXåtYHMWH SRX]H N ~þHO
PLNURYOQQp
Y\VWDYHQt]i HQtPLNURYOQQpHQHUJLH
•
XPtVW WH
NWHUêP MH XUþHQ D MDN MH SRSViQR Y WpWR S tUXþFH 9
SURYR]RYDW WURXEX V RWHY HQêPL GYt N\ 3URYR] V
GYt N\
UHVS
S tUXþFH
• Nemanipulujte s nimi a ani se nepokoušejte
RWHY HQêPL
,QVWDOXMWH
souladu s pokyny pro instalaci, uvedenými v této
]DEUD XMt SURYR]RYiQt PLNURYOQQp WURXE\ NG\å
QHER SRWUDYLQ\ Y WURXE NG\å ML QHSRXåtYiWH
MãtNU\W GYt ND QHER RYOiGDFt
SDQHO 7DNRYp MHGQiQt YiV P åH Y\VWDYLW QHEH]SHþt
GRW\NXY\VRNpKRQDS Wt
%H]SHþQRVWQiGREt
9 WãLQDYêUREN ]HVNODVNORNHUDPLN\DåiUXY]GRUQpKRVNODMHSURSRXåLWtYPLNURYOQQpWURXE YHOLFHYKRGQi
3 HVWRåHPLNURYOQQiHQHUJLHW\WRYêUREN\QHRK tYiPRKRXVHRK iWS HQRVHPWHSODRGYQLFKRK iWêFKSRWUDYLQ
3RXåtYHMWHSURWRSURY\MtPiQtQiGREUXNDYLFHXUþHQpSURWURXEX
4
j
ZM17ML
=NRXãHQtYKRGQRVWLNXFK\ VNpKRQiGREt
•
8PtVW WH QiGREt GR PLNURYOQQp WURXE\ VSROX VH
7HQWR W\S SRWUDYLQ VH RK HMH QD Y\VRNRX WHSORWX D
VNOHQLFt GR SRORYLQ\ QDSOQ QRX YRGRX 2K tYHMWH ML
SODVWRYp REDO\ E\ VH PRKO\ ]DþtW GHIRUPRYDW QHER
SR GREX PLQXW\ S L YêNRQX : tavit.
•
-HVWOLåH VH YiP QiGREt ]Gi KRUNp QHP OL E\ MVWH MH
•
RK tYiWHQHERYD tWHSRNUP\XORåHQpYSDStURYêFK
-HVWOLåH VH YiP ]Gi YODåQp P åHWH MH SRXåtYDW SUR
SODVWRYêFK QHER MLQêFK KR ODYêFK PDWHULiOHFK
RS WRYQêRK HYDOHQHSURYD HQt0iOLSRNRMRYRX
.G\å ]SR]RUXMHWH NRX XQLNDMtFt ] WURXE\ WDN ML
WHSORWXMHYKRGQpSURSRXåLWtYPLNURYOQQpWURXE QHRWYtUHMWH DOH WURXEX Y\SQ WH D SRþNHMWH GR GRE\
QHåWYRUEDNRX HXVWDQH
9HOLFH YKRGQp SUR SRXåLWt MVRX SDStURYp XEURXVN\
• Kovové nádobí nebo nádobí s kovovými díly a
YRVNRYê SDStU SDStURYp XW UN\ NHOtPN\ NUDELþN\
WiFN\ D NDUWyQ\ ]PUD]HQêFK SRWUDYLQ 9åG\ VH
R]GREDPL
S HVY GþHWH ]GD MVRX SOQp SRWUDYLQ DE\ PRKO\
SRXåtYiQRQHQtOLYêVORYQ XUþHQRSURWRWRSRXåLWt
•
DEVRUERYDWHQHUJLLDQHGRFKi]HORWDNNS HK tYiQt
•
1LNG\ QHQHFKiYHMWH WURXEX EH] GR]RUX NG\å Y Qt
SURS tSUDYXSRNUP YPLNURYOQQpWURXE SRXåtYDW
7DNp PQRKRW\S SODVWRYêFK WDOt N WiFN ãiON
QHVPt
EêW
Y
PLNURYOQQp
WURXE
2EDO\ QHER ]iVREQtN\ V SHYQêPL X]iY U\ QDS ODKYH QHVP Mt EêW Y WURXE SRXåtYiQ\ SUR YD HQt
D
krabic, spolu s plastovými obaly zmrazených
PLNURYOQQêP]i HQtP
SRWUDYLQ O]H Y PLNURYOQQp WURXE SRXåtYDW 9åG\
‡%X
GEHMWH QiYRGX YêUREFH EXGHWHOL SODVW SRXåtYDW Y
WHSHOQpS tSUDY SRNUPXþLQiSRMHQiKOHXQLNOiSiUD
WURXE by
1HSRXåtYHMWH
SODVWLNRYp
QiGREt
SUR
potraviny s vysokým obsahem tuku nebo cukru.
WHRSDWUQtS LVQtPiQtYtNþLSRNORS QiGRESR
PRKOD]S VRELWRSD HQt
%H]SHþQRVWSRWUDYLQ
•
1LNG\
QHRK tYHMWH
Y
SURMHYXMH RNDPåLWêP SUXGNêP YDUHP $E\ MVWH
SOHFKRYNiFK 9åG\ S HQGHMWH SRWUDYLQX GR YKRGQp
Y
WURXE SRWUDYLQ\
zabránili tomuto efektu, postupujte dle tohoto návodu:
1. 1HSRXåtYHMWHQiGRE\VRVWUêPLYQLW QtPLKUDQDPLD
úzkými hrdly.
2. 3RNUP\QHS HK tYHMWH
3. =DPtFKHMWH NDSDOLQX Y QiGRE S HG MHMtP
nádoby.
•
0LNURYOQQi WURXED QHQt YKRGQi SUR VPDåHQt QD
WXNX SURWRåH QHO]H GRE H NRQWURORYDW WHSORWX ROHMH
DWtPE\PRKORGRFKi]HWNQHEH]SHþQêPVLWXDFtP
•
3RSFRUQ O]H S LSUDYRYDW SRX]H Y QiGREt N WRPX
YORåHQtP GR WURXE\ 2S WRYQ ML ]DPtFKHMWH Y
XUþHQpPX QHER Y RULJLQiOQtP EDOHQt NWHUp MH
SRORYLQ GRE\SOiQRYDQpGRE\RK HYX
4.
YêVORYQ XUþHQR SUR PLNURYOQQê RK HY 3 tSUDYX
• PotrDYLQ\ V SHYQRX VOXSNRX N
MVWH
WDN
]DEUiQLO\
QDKURPDG QRX
SiURX
åt SURStFKHMWH DE\
UR]WUåHQt
SRG
S tNODG\
SRWp
ML
S HG
RSDWUQêP
]S VREHQêP
SRYUFKHP
SRWUDYLQ
RGSRþLQRXW
Y\MPXWtP]WURXE\RS W]DPtFKHMWH
•
-DEOND
EUDPERU\ NX HFt MiWUD D YDMHþQp åORXWN\ MVRX
W\SLFNp
dobu s kapalinou chvíli v
3R RK iWt SRQHFKHMWH Qi
WURXE SRSFRUQXP MWHYåG\SRGGRKOHGHP
NWHUp
PXVt
1 NWHUpSRWUDYLQ\MDNRQDS tNODGFHOiYHMFHYH
VNR iSFHQHERX]DY HQp]DYD RYDFtVNOHQLFHPRKRX
EêW
YWURXE H[SORGRYDW3URWRMHQLNG\YWURXE
propíchané.
QHRK tYHMWH1 NG\L]WUDFHQiYHMFHYDMtþNDEH]
VNR iSN\PRKRXYWURXE E KHPS tSUDY\
8SR]RUQ Qt
H[SORGRYDW3URWRYåG\SURStFKQ WHåORXWHN
2K tYiWHOL Y WURXE NDSDOLQ\ MDNR
QDS SROpYN\ RPiþN\ D QiSRMH NWHUp VH PRKRX RK iW
S LNORSWHYtNRDSRS tSUDY MHMQHFKHMWHMHãW nad teplotu varu bez typického projevu varu
(bubláním). Jedná se o tzv. utajený var a ten se
PLQXWXS LNORSHQp
Poznámka:
•
1HSRNRXãHMWH
VH
XYQLW WURXE\ 0
VLORX
RWiþHW
RWRþQêP
•
WDOt HP
åHWH WtP ]S VRELW MHMt YiåQp
RWYRU XPtVW QêFK QD KRUQt VSRGQt ]DGQt D RERX
poškození.
•
'EHMWH DE\ QHGRFKi]HOR N XFSiQt YHQWLODþQtFK
ERþQtFKVWUDQiFKWURXE\
-HVWOLåH S L PLNURYOQQpP RK HYX SRXåLMHWH NRYRYp
1HSRXåtYHMWHWXWRWURXEXSURNRPHUþQt~þHO\
QiGREt WDN VH EXGH XYQLW WURXE\ REY\NOH MLVN LW
=DWDYWH SUREtKDMtFt RK HY D ]NRQWUROXMWH QiGREt
7DWR PLNURYOQQi WURXED MH Y\UREHQD D XUþHQD
%XGHWHOL SRNUDþRYDW Y S tSUDY SRNUPX E KHP
SRX]HSURSRXåLWtYGRPiFQRVWHFK
MLVN HQtP åHWHWURXEXYiåQ SRãNRGLW
'RGUåXMWHWHQWRQiYRGNSRXåLWt
5
j
ZM17ML
1iYRGQDSRXåLWtQiGREtDS tVOXãHQVWYtWURXE\
9H YDãt PLNURYOQQp WURXE P åH EêW SRXåtYiQD SRP UQ ãLURNi ãNiOD GUXK QiGREt Y\UREHQêFK ] U ]QêFK
PDWHULiO $E\VWH]DEUiQLOLMDNSRãNR]HQtSRXåLWêFKSRP FHNDQiGREt WDNL YODVWQt WURXE\ SRXåtYHMWH SRX]H W\
GUXK\NWHUpMVRXSURNRQNUpWQt]S VRES tSUDY\GRSRUXþHQp
6H]QDPYWDEXOFHE\OS LSUDYHQSURYDãtRULHQWDFL
Materiál
Nádobí
0LNURYOQQpYD HQt
Keramika a sklo
tvrzené sklo
Porcelán
sklo s kovovým dekorem
olovnaWêN Lã iO
bez kovového dekoru
ANO
ANO
NE
NE
ANO
teplovzdorné pro mikrovlnné trouby
plastové obaly
ANO
ANO
SHþtFtSiQYH
NE
ANO
åiURY]GRUQpVNOR
Pálená hlína
Plasty
Kovy
ANO
hliníkové fólie*
Papír
ANO
ANO
ãiON\WDOt N\XEURXVN\
voskový papír
NE
' HYR
3 tVOXãHQVWYt
ANO
ANO
otoþQêWDOt
YR]tNWDOt H
$121iGREtDS tVOXãHQVWYtYKRGQpSURSRXåLWt
1(1iGREtDS tVOXãHQVWYtQHYKRGQpSURSRXåLWt
•
3R]QiPND+OLQtNRYRXIyOLLSRXåtYHMWHSRX]H]D~þHOHPVWtQ QtPLNURYOQQpKR]i HQt
QDGE\WHþQpPQRåVWYtDOREDOXP
åH]S
VRELWY]QLNHOHNWULFNpKRREORXNX
Technické údaje
&HONRYpUR]P U\
Hmotnost: 14kg
ãt NDPP
Objem:OLWU
hloubka 368 mm
výška 296 mm
Napájení 230V, 50Hz
5R]P U\YQLW QtKRSURVWRUX
-LãW Qt
ãt NDPP
3 tNRQPLNURYOQQpWURXE\
hloubka 282 mm
výška 206 mm
Výkon mikrovlnné trouby 700W
10A
6
1200W
j
ZM17ML
3 tSUDYDSURSRXåtYiQt
3 LSRMHQtQDHOHNWULFNêUR]YRG
Vybalení
3R]QiPND.G\åWURXEXY\EDOtWH]NRQWUROXMWHåHQHQt
0LNURYOQQi WURXED MH GRGiQD V NDEHOHP D ]iVWUþNRX
SRãNR]HQi =MLãW Qp YDG\ QHER FK\E MtFt GtO\ MH W HED
pro 230V, 50Hz pro zásuvku se zemnícím kolíkem.
co nejrychleji nahlásit vašemu prodejci. Trouba,
2FKUDQD ]HPQ QtP PLQLPDOL]XMH QHEH]SHþt Y]QLNX
VRXþiVWLWURXE\DS tVOXãHQVWYt PRKRX EêW ]DEDOHQ\ GR
]NUDWX3 HGS LSRMHQtPVHS HVY GþHWHåHQDS WtYVtWL
RFKUDQQp IyOLH -HOL WRPX WDN MH QXWQp ML S HG
RGSRYtGiKRGQRW XYHGHQpSURWHQWRVSRW HELþ
SRXåLWtP WURXE\ RGVWUDQLW 1HSRQHFKiYHMWH REDORYp
PDWHULiO\ YROQ GRVWXSQpPDOêPG WHPDE\ VLVQLPL
8SR]RUQ Qt
PRKOLKUiW0RKORE\WREêWYHOLFHQHEH]SHþQp
SURGOXåRYDFt ã
-HOL
QXWQp
SRXåtW
SUR
]DSRMHQt
UX S HVY GþHWH VH åH SURGOXåRYDFt
NDEHOMHY\EDYHQ]HPQtFtPYRGLþHP
Instalace mikrovlnné trouby
Pozor!
1. 2GVWUD WH]GYt Hk všechny reklamní samolepky.
2. Troubu instalujte na plochou vodorovnou plochu.
1RVQRVW SORFK\ PXVt EêW GRVWDWHþQi DE\ PRKOD
QHGRFKi]HOR
N
UXãLYpPX
FKY Qt
VSRW HELþ
QHVPt
EêW
SRXåtYiQ
Y
.RQWDNWXMWH HOHNWULNi H Y S tSDG åH VL QHMVWH MLVWL VH
unést celou hmotnost trouby (14kg) a i její obsah.
$E\
7HQWR
HOHNWULFNpVtWLEH]MLãW Qt]HPQ QtP
zapojením nebo nevíte-li zda váš elektrický obvod je
QHER
MLãW Q]HPQ QtP
QHåiGRXFtPX KOXNX PXVt EêW WURXED SRORåHQD YH
stabilní poloze.
3.
7HQWR VSRW HELþ PXVt EêW X]HPQ Q -HVWOLåH ]iVWUþND
7URXEX LQVWDOXMWH Y GRVWDWHþQp Y]GiOHQRVWL RG WHSOD
vaší trouby neodpovídá zásuvce vašeho elektrického
D YRG\9\VWDYHQt WURXE\ ~þLQN P YRG\ D WHSOD
UR]YRGX MH W HED ML RG t]QRXW D QDKUDGLW ML YKRGQRX
P åH VQtåLW MHMt ~þLQQRVW D QHER ]DS tþLQLW Y]QLN
QiKUDGQt]iVWUþNRX
SRUXFK\ 3URWR VH XMLVW WH åH WURXED MH LQVWDORYiQD
mimo zdroje vody a tepla.
4.
WURXE\ D DQL QD Qt QHSRNOiGHMWH åiGQp S HGP W\
(OHNWULFNpS LSRMHQt
1HEXGRXOL Y WUDFt RWYRU\ E KHP SURYR]X YROQp
7HQWR VSRW HELþ MH VWDQGDUGQ GRGiYiQ V GYRX
WURXEDVHP åHS HK iWDWR P åH YpVW Då NH Y]QLNX
NROtNRYRX(852]iVWUþNRX
1HEORNXMWH Y WUDFt RWYRU\ QDKR H D SR VWUDQiFK
]iYDG\ % KHP SURYR]X WURXE\ EXGH XQLNDW ]
Y WUDFtFK RWYRU KRUNê Y]GXFK SURWR GEHMWH QD WR
DE\ Y WUDFt RWYRU\ E\O\ YROQp D DE\ VH QDS tNODG
]iFORQDQHGRVWDODPH]L]H
5.
XPtVW WH
7URXEX
UiGLRYêFK S LMtPDþ
FR
3R]RU7HQWRVSRW HELþPXVtEêWX]HPQ Q
D]DGQtþiVWWURXE\
QHMGiOH
RG
WHOHYL]QtFK
D
9êUREFH
3 HVWRåH WDWR WURXED Y\KRYXMH
RGPtWi
MDNRXNROLY
RGSRY GQRVW
]D
QHGRGUåHQtWRKRWREH]SHþQRVWQtKRS HGSLVX
SRåDGDYN P HYURSVNp QRUP\ ((& R ~URYQL
UiGLRYpKR
XPtVW Qt
S LMtPDþ
UXãHQt
WURXE\
P
WDN
S tOLã
PRKOR
E\
S HVWR
EOt]NR
N
Y
‡-HOL]iVWUþNDNWHUiE\ODGRGiQDVHVSRW HELþHP
S tSDGHFK
MPHQRYDQêP
GRFKi]HW
N
QHY\KRYXMtFtPXVtEêWRG t]QXWDDQDKUD]HQDMLQRX
vhodnou.
UXãLYêP
interferencím (rušení televizního nebo rádiového
VLJQiOX3URWRWURXEXXPtVW WHFRQHMGiOHRGQLFK
6. Umístíte-li troXEX GR URKX SRQHFKHMWH PH]L VW
QRX
WURXE\ D ]Gt PLQLPiOQ FP SUR ]DUXþHQt GREUp
ventilace.
' OHåLWp
7XWR
WURXEX
P åHWH
XPtVWLW
SUDNWLFN\
NGHNROLY Y NXFK\QL 8MLVW WH VH DOH åH MH WURXED
LQVWDORYiQD QD SORFKpP D YRGRURYQpP SRYUFKX D åH
Y WUDFt
RWYRU\
WURXE\
D
SURVWRU
SRG
WURXERX
MH
GRVWDWHþQêDYROQêSURGREUpRGY WUiYiQt
7HQWR VSRW HELþ VSO XMH SRåDGDYN\ HYURSVNp QRUP\
((&3 HGSLVRUiGLRYpPUXãHQt((&
7
j
ZM17ML
Jak provozovat vaší mikrovlnou troubu
1
3
2
5
4
8
4
6
7
3RSLVDIXQNFHMHGQRWOLYêFKGtO
,QVWDODFHRWRþQpKRWDOt H
1.
1.
9ODVWQt SURVWRU WURXE\ 3R SRXåLWt WHQWR SURVWRU
2.
3.
3U KOHGQp
RNpQNR
9ORåWH YR]tN RWRþQpKR WDOt H QD GQR YQLW QtKR
prostoru.
GRE HY\þLVW WH
SRPRFt
Q KRå
MH
2.
PRåQp
3RORåWH
WDOt
navrch
vozíku jak je
QD]QDþHQR QD REUi]NX 8MLVW WH VH åH VW HGRYê
'Yt ND WURXE\ NWHUp S L SURYR]X WURXE\ PXVt EêW
YêVWXSHN EH]SHþQ ]DSDGO GR KQDFt K tGHOH
YåG\SHYQ X]DY HQ\
QHVPtWHSRORåLWRWRþQêWDOt REUiFHQ •
4. =iSDGN\]iPNXDEH]SHþQRVWQtEORNRYDFtV\VWpP
5. Ovládací panel
6. 6OZ·KOTO N³HOTAL· E0OLOÓTEHONADNO
TROUBYTAKABYMOHLN³STOTO NáTAL·
7. 2WRþQê WDOt -H Y\UREHQ ]H VSHFLiOQtKR
Nikdy
2WRþQê WDOt V YR]tNHP PXVt EêW YåG\ SRXåLW\
E KHPXåtYiQtWURXE\
• Veškeré potraviny a nádoby s potravinami musí být
YåG\SRORåHQ\QDWRPWRRWRþQpPWDOt L
•
2WRþQêWDOt VHRWiþtMDNYHVP UXWDNLSURWLVP UX
åiUXY]GRUQpKR VNOD 3RNUP YH YKRGQp QiGRE
KRGLQRYêFKUXþLþHNDMHWRQRUPiOQtIXQNFHWRKRWR
SRNOiGHMWH QD WHQWR WDOt 1HSRXåtYHMWH WURXEX EH]
]D t]HQt
WRKRWRRWRþQpKRWDOt H
8.
RWRþQê
NRQWURORYDWS tSUDYXSRNUPX
+QDFtK tGHORWRþQpKRWDOt H
RWRþQêWDOt
vozík
KQDFtK tGHO
8
j
ZM17ML
Ovládací panel
1.
9ROLþYêNRQX
1DVWDYWHRWRþQêRYODGDþQDSRåDGRYDQRXKRGQRWX
výkonu.
2.
ýDVRYDþPLQXWND
1DVWDYXMHSRåDGRYDQêþDV=DKDMXMHSUiFLWURXE\
3URGRVDåHQtS HVQpKRQDVWDYHQtþDVX
GRSRUXþXMHPHRWRþLWPLQXWNXQDSOQRDSDNYUiWLW
QDSRåDGRYDQRXKRGQRWX
9
j
ZM17ML
3 tSUDYDSRNUP YPLNURYOQQpWURXE
1.
2.
3.
2WHY HWHGYH HWURXE\YORåWHSRNUPQDRWRþQêWDOt =DY HWHGYH HWURXE\
1DVWDYWHYROLþYêNRQXQDSRåDGRYDQRXKRGQRWXYL]WDEXONDGROH
1DPLQXWFHQDVWDYWHSRåDGRYDQêþDVS tSUDY\SRNUPX
7URXED]DþtQiSUDFRYDW
-HVWOLåH GRED S tSUDY\ SRNUPX MH NUDWãt QHå PLQXW\ QDWRþWH PLQXWNX QD GHOãt þDV D SDN ML YUD WH QD
SRåDGRYDQRXKRGQRWX
-HVWOLåHFKFHWHWURXEXY\SQRXWRWRþWHPLQXWNXQDQXOX
3R]QiPND3RSRXåLWtVHXMLVW WHåHPLQXWNDMHQDVWDYHQiQDQXOX9RSDþQpS tSDG E\GiOHSUDFRYDOD
3 tNODG9D LWS LYêNRQX:SRGREXPLQXW
1.
2WRþWHYROLþYêNRQXQD
2.
0LQXWNXRWRþWHQDKRGQRWX
3.
0W
7URXEDWDN]DþQHS LSUDYRYDWSRNUPSRGREXPLQXWDS LYêNRQX:
3U YRGFHQDVWDYRYiQtYêNRQXPLNURYOQQpWURXE\
Nastavení výkonu
120W
230W
350W
'RSRUXþHQpSRXåLWt
8GUåRYiQtKRUNpKRSRNUPX
5R]PUD]RYiQtUR]WDYHQt]PU]OêFKSRNUP
6W HGQtU\FKOHMãtUR]PU]QXWtDRS WRYQpRK iWtGXãHQpKRSRNUPXQHERSRNUPXY
rendlíku
540W
700W
3HþHQtGRUW DSLãNRWRYêFKW VW
0D[LPiOQtYêNRQYD HQtDRK tYiQtWHNXWLQ
9D HQt]HOHQLQ\
3 HGHK iWt]DSpNDFtPtV\
10
j
ZM17ML
1iYRGQDUR]PUD]RYiQtS LYêNRQX:
1 NWHUpSRWUDYLQ\MDNRFKOpEDRYRFHPRKRXEêWUR]PUDåHQ\PDQXiOQ SRPRFtWRKRWRQiYRGX
POTRAVINA
3
Ë35$9$
xxxx
'2%$2'32ý,1.8
PO ROZMRAZENÍ
FKOpEDSHþLYR
malý bochník
3RORåLWQDSDStURYê
8-10 min
10-15 min
10-13 min
10 min
45-60 sec
5 min
45-60 sec
5 min
1-1,5 min
5 min
9-11 min
15-30 min
9-11 min
15-30 min
7-9 min
15-30 min
7-9 min
15-30 min
3-4 min
5-10 min
5-6 min
5-10 min
7-8 min
5-10 min
7-8 min
5-10 min
ubrousek nebo na
SRGORåNXYKRGQRXGR
PLNURYOQQpWURXE\2WRþLW
KRYS OFHGRE\
rozmrazování
nakrájený velký 3RORåLWKRQDSDStURYê
bochník ubrousek nebo na
SRGORåNXYKRGQRXGR
PLNURYOQQpWURXE\2WRþLW
KRYS OFHGRE\
rozmrazování
2 krajíce
3RORåLWMHQDSDStURYê
ubrousek.
NXVSHþLYD
3RORåLWKRQDSDStURYê
ubrousek.
NXV\SHþLYD
3RORåLWMHQDSDStURYê
ubrousek.
NROiþHDFXNURYLQN\
krémový dort 450g
9\EDOLW]REDOXSRORåLWQD
WDOt
MHPQêNROiþJ
9\EDOLW]REDOXSRORåLWQD
WDOt
SOQ QêNROiþJ
9\EDOLW]REDOXSRORåLWQD
WDOt
PiVORYpSHþLYR
9\EDOLW]REDOXSRORåLWQD
WDOt
máslo
250g / 1 balení
9\EDOLW]REDOXSRORåLWQD
WDOt
ovoce
225g
P NNpEREXORYLQ\
450g
3RORåLWGRMHGQpYUVWY\GR
P ONpPLVN\
3RORåLWGRMHGQpYUVWY\GR
P NNpEREXORYLQ\
P ONpPLVN\
porce pokrmu na
Zakrýt poklopem nebo
WDOt LJ
IyOLtQH]39&2K iWS L
100%výkonu mikrovln
(700W)
po dobu 3-4 min
zelenina
1HQtQXWQpMLS HGYD HQtP
rozmrazovat. Veškerá
]HOHQLQDP åHEêW
UR]PUDåHQD
DGiOH]SUDFRYiYiQDS L
100% (700W) výkonu
trouby
11
j
ZM17ML
5DG\SURSRXåLWtPLNURYOQQpWURXE\
•
9åG\ XGUåXMWH WURXEX Y þLVWRW ]DPH]WH S HWpNiQt D
QHER SiUN\ YH VW tYNX 1LNG\ QHYD WH Y PLNURYOQQp
Y\WpNiQt WHNXWLQ S HV RNUDM QiGRE 1H]DSRPH WH
WURXE FHOiYHMFHPRKODE\H[SORGRYDW
•
YåG\Y\þLVWLWYQLW HNWURXE\YþHWQ RWRþQpKRWDOt H
•
3 LS tSUDY SRNUP YWURXE S HGQRVWQ SRXåtYHMWH
D VQDåWH VH Y Wãt NXV\ SRUFRYDW QD VWHMQ YHONp
NRXVN\9åG\XPLV XMWHQiGRE\GRVW HGXWURXE\
NXODWpQHERRYiOQpPtV\VSRNOLþNRX
•
•
1HSRXåtYHMWH NRYRYp QHER NRYHP ]GREHQp PtV\
•
SRNUP WDYLWQHERGHIRUPRYDW
3 L
S tSUDY VNOHQ Qp
SRNUP\
SRNOLþN\
]DNUêYHMWH
WDOt H
QHER
GREX
S tSUDY\
QHå
MH
MVRX SRUFH SRNUP Y Wãt WtP GHOãt GRED EXGH
SRW HEQiSURMHMLFKS tSUDYX
3HþLYR FKOpE D SRGREQp
potraviny mohou být
•
1D S tSUDYX ]HOHQLQ\ QHSRXåtYHMWH åiGQRX QHER
PLQLPiOQtPQRåVWYtYRG\
•
3RXåtYHMWH PHQãt PQRåVWYt NR HQt D VROL QHå SUR
•
•
.R H WHSRNUP\DåSRS tSUDY YWURXE QRUPiOQtYD HQt
-HVWOLåH]PUD]HQpSRWUDYLQ\RK tYiWHY MHMLFK REDOX
P OL E\VWH REDO RWHY tW 2EDO\ REVDKXMtFt NRY QHER
NRYRYp R]GRE\ NWHUp QHMVRX YêVORYQ GRSRUXþHQ\
3R S tSUDY Y WURXE SRQHFKHMWH SRNUP Q NROLN
SUR RK HY Y PLNURYOQQp WURXE VH QHVPt Y WURXE
PLQXW RGSRþLQRXW DE\ E\OD ]DMLãW QD ~SOQi D
SRXåtYDW2GVWUD WHNRYRYpVSRQN\D~YD]N\
URYQRP UQiWHSHOQiS tSUDYD
•
9åG\VHXMLVW WHåHSRNUP\S HGSRGiYiQtPQDVW O
N LGêOND
•
3 LY\MtPiQtQiGREtDSRNUP ]WURXE\SRXåtYHMWH
3RWUDYLQ\ VH VOXSNRX QHER N åt E\ VH P OL S HG
EX
0HQãt NXV\ DOREDOX P åHWH SRXåtW QD ]DNU\Wt þiVWt
NWHUp
•
QLåãt
QHSURPDVWLWHOQê
papírovém ubrousku.
•
QDVWDYWH
GRSRUXþHQR ]DEUiQtWH WtP S HYD HQt SRNUPX ýtP
UR]PUD]RYiQ\ S tPR Y NRãtNX QD FKOpE QHER Y
•
9åG\
3RXåtYHMWH
papír.
•
3RWUDYLQ\ VH EXGRX URYQRP UQ ML RK tYDW EXGHWHOL
MHE KHPS tSUDY\SURPtFKiYDWQHERREUDFHW
1 NWHUp SODVWRYp PDWHULiO\ VH PRKRX RG WHSOêFK
•
9HONp VLOQp NXV\ GiYHMWH N YQ MãtPX RNUDML QiGRE\
VH
VQDGQR
S HK tYDMt
MDNR
QDS NX HFt
MVRX iGQ WHSHOQ ]SUDFRYiQ\
GUåiN\NWRPXXUþHQpQHERUXNDYLFHSUR
mikrovlnné trouby.
S tSUDYRX SURStFKDW YLGOLþNRX MDNR QDS EUDPERU\
Tipy a Triky
•
•
=P NQXWtPHGX
0iWHOL
PHG
NWHUê
MH
MLå
YH
VNOHQLFL
3RXåLMWH
]FXNHUQDW Oê WDN ]H VNOHQLFH RGVWUD WH YtþNR D
YORåWH
VNOHQLFL
GR
WURXE\
3RXåLMWH
2K iWtQHERRåLYHQtVWDUãtKRFKOHED
VW HGQt
KRGQRW\
YêNRQX
SR
GREX
Q NROLNDVHNXQG
VW HGQt
hodnoty mikrovln po dobu 2 minut
•
-DNMHGQRGXãHRORXSDWþHVQHN
=DK HMWH VWURXåN\ þHVQHNX S L Y\VRNpP
•
YêNRQX SR GREX VHNXQG 6WLVNQ WH MHGHQ
7DYHQtþRNROiG\
konec, dokud se neodloupne slupka
1DOiPHMWH J WDEXONX þRNROiG\ QD þWYHUHþN\
YV\SWH MH GR QiGRE\ D ]DK tYHMWH S L Y\VRNpP
výkonu po dobu 1-2 minut za dobrého
promíchávání
•
3 tSUDYDRYRFQpKRGåXVX
&LWUXVRYp SORG\ Y\GDMt YtFH ã iY\ MHVWOLåH MH
S HG Y\PDþNiQtP SR GREX VHNXQG RK HMHWH
•
5R]SRXãW QtQHERP NQXWtPiVOD
S LY\VRNpPYêNRQX
5R]SRXãW Qt ]DEHUH Q NROLN VHNXQG S L Y\VRNpP
YêNRQX 0 NQXWt MH OpSH SURYiG W S L QLåãtP
•
výkonu po delší dobu.
9ORþNRYRXNDãLMHGQRGXãHS LSUDYtWHEH]
9D HQtYORþNRYpNDãH
QHS tMHPQpKROHSLYpKR]DãSLQ Qt9L]QiYRG
výrobce.
12
j
ZM17ML
3pþHDþLãW QtWURXE\
0LNURYOQQi WURXED PXVt EêW YåG\ þLVWi=E\WN\ S HWHNOêFK SRNUP D UR]VW tNQXWêFK ]E\WN VSRW HERYiYDMt
PLNURYOQRX HQHUJLL D WD P åH ]DS tþLQLW L MHMLFK Y]QtFHQt =iURYH VH WtP VQLåXMH ~þLQQRVW WURXE\ D GRFKi]t NH
Y]QLNX QHS tMHPQêFK SDFK 1HSRNRXãHMWH VH PDQLSXORYDW V åiGQêP QDVWDYRYDFtP SUYNHP QHER SURYiG W
RSUDYX MDNpNROLY þiVWL WURXE\ VYpSRPRFt 2SUDY\ P
åH SURYiG W MHQ NYDOLILNRYDQê SUDFRYQtN DXWRUL]RYDQpKR
servisu.
3 HGþLãW QtPVHXMLVW WHåHWURXEDMHRGSRMHQDRGHOHNWULFNpVtW ýLãW QtS tVOXãHQVWYtRWRþQêWDOt DYR]tN
3 tVOXãHQVWYtY\QGHMWH]WURXE\DYHQNXMH]DSRPRFtMHPQpKRP\FtKRSURVW HGNXY\þLVW WH6YR]tNHPRWRþQpKR
WDOt HPDQLSXOXMWHYHOLFHRSDWUQ 8SR]RUQ Qt9QLW HNWURXE\RWRþQêWDOt DYR]tNWDOt HVHRK tYDMtQDY\VRNRXWHSORWXSURWRVHMLFK
EH]SURVW HGQ SRY\SQXWtWURXE\QHGRWêNHMWH
ýLãW QtLQWHULpUX
9åG\FN\XGUåXMWHYQLW HNWURXE\ YþLVWRW 9\þLVW WHYãHFKQ\VNYUQ\SRUR]OLWêFKSRNUPHFKDRGVWUD WH YãHFKQ\
]E\WN\SRNUP 1HRGVWUDQ Qp]E\WN\XOS QpQDVW QiFKWURXE\W VQ QtGYH tDGYH tSRKOFXMtPLNURYOQQp]i HQt
DWtPVQLåXMt~þLQQRVWWURXE\0RKRXWDNp]DS tþLQLWSRãNR]HQtYQLW NXWURXE\ .þLãW QtSRXåtYHMWHMHPQpWHNXWp
P\FtSURVW HGN\KRUNRXYRGXDP NNêþLVWêKDG tN
1LNG\NþLãW QtMDNpNROLYþiVWL PLNURYOQQpWURXE\QHSRXåtYHMWHDEUD]LYQtP\FtSURVW HGN\DDQL NRPHUþQt
þLVWLþHWUXEQHERRFHORYRXGUiW QNX
.XYROQ QtVLOQ XOS QêFKQHþLVWRWQHFKHMWHYWURXE SRGREXPLQXW\YD LWKUQHNVYRGRX
1LNG\VHQHSRNRXãHMWHNRGVWUDQ QtQiQRV
SRXåtWQ
åQHERMLQêNXFK\
VNêQiVWURM
3URRGVWUDQ Qt]iSDFKX]YQLW QtKRSURVWRUXWURXE\QHFKHMWHYD LWSRGREXDVLPLQXWKUQHNVYRGRXGRNWHUp
MVWHS LGDOLþDMRYpOåLþN\FLWUyQRYpã iY\
ýLãW QtH[WHULpUX
3 HGþLãW QtPRYOiGDFtKRSDQHOXRWHY HWHGYt NDWURXE\7tP]DEUiQtWHWRPXDE\QHGRãORNQHFKW QpPX]DSQXWt
WURXE\9Q MãtSRYUFKWURXE\MHW HEDþLVWLWYRGRXV QHDJUHVLYQtP P\FtP SURVW HGNHPD SRWp S HW tW SRX]H þLVWRX
YRGRXDE\VHRGVWUDQLO]E\OêP\FtSURVW HGHN1DNRQHFWURXEXY\W HWHGRVXFKDP NNêPVXFKêPKDG tNHP
0 åHWHWDNpSRXåtWVSUHMRYpþLVWLþHRNHQQHERXQLYHU]iOQtNXFK\ VNpþLVWtFtSURVW HGN\1LNG\QHSRXåtYHMWHQD
P\WtYQ MãtFKþiVWtDEUD]LYQtFKP\FtFKSURVW HGN GUiW QHNQHERDJUHVLYQtFKFKHPLNiOLt$E\QHGRãORN
SRãNR]HQtSUDFRYQtFKþiVWtWURXE\QHGRYROWHDE\VHGRY WUDFtFKRWYRU GRVWDODYRGD
13
j
ZM17ML
Servis a náhradní díly
-HVWOLåH VSRW HELþ QHIXQJXMH VSUiYQ WDN MHãW S HG WtP QHå EXGHWH NRQWDNWRYDW DXWRUL]RYDQê VHUYLV
SURYH
WHQiVOHGXMtFtNRQWURO\
-HVWOLåHVHWURXEDQH]DSQXOD
• =NRQWUROXMWH]GDMHWURXEDS LSRMHQDQDHOHNWULFNRXVt • Zkontrolujte]GDMH]iVWUþNDVSUiYQ ]DVXQXWi
• =NRQWUROXMWH]GDS tSDGQêY\StQDþþLMLVWLþYHGRXFtNWURXE MH]DSQXWê
• =NRQWUROXMWH]GDMH]iVXYNDIXQNþQtDWR]DSRMHQtPMLQpKRVSRW HELþHGRSRXåtYDQp]iVXYN\
• Zkontrolujte stav pojistky v domácím rozvodu.
-HVWOLåHWURXEDQHSUDFXMH
•
•
•
•
' WVNiSRMLVWNDP åHEêWDNWLYRYDQiXQ NWHUêFKPRGHO =NRQWUROXMWH]GDMVRXYROLþHVSUiYQ QDVWDYHQp
=NRQWUROXMWHåHYHãNHUpNRUHNFHDSRXåLWpSRVWXS\RGSRYtGDMtWRPXWRQiYRGXNSRXåLWt
3 HVY GþHWHVHåHGYH HWURXE\MVRXSHYQ ]DY HQp-HVWOLåH]E\WN\SRWUDY\QHERMLQpGtO\S HNiåtVSUiYQpPX
]DY HQtGYH tWDNWURXEDQHS MGH]DSQRXW
•
=NRQWUROXMWH]GDE\ODQDVWDYHQDSRåDGRYDQiGREDS tSUDY\
-HVWOLåHDQLSRSURYHGHQêFKNRQWUROiFKWURXEDQHSUDFXMHVSUiYQ NRQWDNWXMWHQHMEOLåãtDXWRUL]RYDQêVHUYLVILUP\
=DQXVVL$GUHV\MHGQRWOLYêFKVHUYLV QDOH]QHWHQDGDOãtFKVWUiQNiFKWRKRWRQiYRGX
'
OHåLWp
-HVWOLåHS LYRODQê WHFKQLN ]MLVWtåH SRUXFKD MH ]S
VREHQi QHVSUiYQRX LQVWDODFt QHER SRXåtYiQtP WDN YiP
QiNODG\VSRMHQpVMHKRQiYãW YRXEXGRX~þWRYiQ\LYS tSDG åHWURXEDMHVWiOHY]iUXþQtGRE Po zavolání do autorizovaného servisu budete dotazován na následující informace.
1. 9DãHMPpQRDGUHVDD36ý
2. 9DãHWHOHIRQQtþtVOR
3. 3 HVQêSRSLVSRUXFK\
4. ýtVORPRGHOX
5. 6pULRYpþtVOR
6. 'DWXPQiNXSXVSRW HELþH
'RSRUXþXMHPHYiPDE\VWHVLGRYROQêFKNRORQHNQDSVDOLS tVOXãQpLQIRUPDFHSURS tSDGSRW HE\
ýtVORPRGHOX
................ZM17ML .....................................
6pULRYpþtVOR
................. ......................................................
Datum prodeje: ............ ......................................................
-HVWOLåH MH Yiã VSRW HELþ VWiOH Y ]iUXFH PXVtWH VH XMLVWLW åH MVWH SURYHGOL YHãNHUp NRQWURO\ YL] QDKR H 9
RSDþQpPS tSDG YiPEXGRXQD~þWRYiQ\QiNODG\VSRMHQpVS LYRODQêPVHUYLVQtPWHFKQLNHP
Náhradní díly
9HãNHUpQiKUDGQtGtO\O]H]DNRXSLWSURVW HGQLFWYtPDXWRUL]RYDQêFKRSUDYHQ
Zákaznický servis
9HãNHUpLQIRUPDFHWêNDMtFtVHYDãHKRVSRW HELþH]QDþN\=DQXVVLQHERLQIRUPDFHRMLQêFKVSRW HELþtFKILUP\
=DQXVVL]tVNiWHNG\å]DWHOHIRQXMHWHQHERVHStVHPQ VSRMtWHVQDãtP]iND]QLFNêPVHUYLVHP
14
j
ZM17ML
=iUXþQtSRGPtQN\
)LUPD=DQXVVLQDEt]tW\WR]iUXþQtSRGPtQN\WRKRWRVSRW HELþH
1.
=iUXND MH SODWQi SR GREX P VtF RG GRE\ NG\ E\O VSRW HELþ SURGiQ SUYQtPX ]iND]QtNRYL FRå PXVt EêW
SRWYU]HQR GRNODGHP R QiNXSX QHER SRGREQêP GRNXPHQWHP =iUXND QHSRNUêYi NRPHUþQt XåLWt WRKRWR
VSRW HELþH
2. Záruka je platná na všechny vady vzniklé chybnou výrobou nebo vadou materiálu. Záruka se nevztahuje na
YDG\ ]S
VREHQp QHVSUiYQêP SRXåtYiQtP KUXEêP ]DFKi]HQtP ãSDWQRX LQVWDODFt SRãNR]HQtP ] YQ MãNX
MLQêP REMHNWHP ãSDWQRX ~GUåERX QHDXWRUL]RYDQêPL PRGLILNDFHPL QHER SRNXV\ R RSUDYX NRPHUþQtP
SRXåtYiQtP QHER QHGRGUåHQtP SUDYLGHO Y\MPHQRYDQêFK Y S LORåHQp S tUXþFH =iUXND VH GiOH QHY]WDKXMH QD
åiURYN\Y\MtPDWHOQpVNOHQ QpQHERSODVWLFNpGtO\
3.
3URGHMFH PXVt QHSURGOHQ LQIRUPRYDW QHMEOLåãt DXWRUL]RYDQp VHUYLVQt FHQWUXP R SRåDGDYNX QD ]iUXþQt
RSUDYX =DQXVVL VL Y\KUD]XMH SUiYR XUþLW NGH VH RSUDYD SURYHGH QDS GRPD X ]iND]QtND Y PtVW LQVWDODFH
QHERYVHUYLVQtGtOQ 4.
5.
=iUXNDVHY]WDKXMHQDEH]SODWQRXYêP QXQiKUDGQtFKGtO DQDSRW HEQRXSUiFL
2SUDY\SURYiG QpYGRE ]iUXN\QHSURGOXåXMtFHONRYRXGREX]iUXN\QDVSRW HELþ'tO\ Y\P Q QpS LRSUDY
se stávají majetkem firmy Zanussi.
6.
3UiYD]iND]QtNDXUþHQD]iNRQHPQHMVRXW PLWR]iUXþQtPLSRGPtQNDPL]SRFK\EQ QD
15
j
ZM17ML
Záruka, servis a náhradní díly
3 HþW WHVLWHQWRQiYRGNREVOX]HDGRGUåXMWHYQ PXYHGHQpUDG\D SRN\Q\9 PQRKD S tSDGHFK VL EXGHWH PRFL
Y\MDVQLW MDNpNROL SRFK\EQRVWL VDPL D WXGtå Y\KQRXW VH ]E\WHþQêP YROiQtP GR VHUYLVX 3 HGFKR]t þiVWL QD]YDQp
&R G ODW NG\å D 6HUYLV REVDKXMt GRSRUXþHQt FR E\ VH P OR ]NRQWURORYDW G tYH QHå ]DYROiWH VHUYLVQtKR
technika.
-HVWOLåH SR W FKWR NRQWUROiFK ]iYDGD VWiOH H[LVWXMH ]DYROHMWH YDãH QHMEOLåãt DXWRUL]RYDQp VHUYLVQt VW HGLVNR
Zanussi.
8MLVW WH VH åH P åHWH VG OLW PRGHO D VHULRYp þtVOR VSRW HELþH 7\WR LQIRUPDFH QDOH]QHWH QD GDWRYpP ãWtWNX
S tVWURMH
2ULJLQiOQtQiKUDGQtGtO\O]HNRXSLWRGDXWRUL]RYDQêFKVW HGLVHNVHUYLVX=DQXVVL
Podmínky záruky
0\ YêUREFH ]DUXþXMHPH åH MHVWOLåH E KHP P VtF RG GDWD ]DNRXSHQt WRKRWR VSRW HELþH =DQXVVL VH WHQWR
VSRW HELþ QHER MDNiNROL MHKR þiVW XNiåRX MDNR YDGQp SRX]H ] G YRGX YDGQpKR ]SUDFRYiQt QHER YDGQpKR
RSUDYXQHER YêP QX WpKRå EH] SODFHQt ]D SUiFLPDWHULiO QHER
PDWHULiOXSURYHGHPHSRGOHQDãHKRXYiåHQtEX
S HSUDYX]DS HGSRNODGXåH
-
štítku jmenovitých hodnot
VSRW HELþE\OVSUiYQ LQVWDORYiQDSRXåtYiQSRX]HQDQDS WtXYHGHQpQD
VSRW HELþE\OSRXåtYiQSRX]HSURQRUPiOQtGRPiFt~þHO\DYVRXODGXVSRN\Q\YêUREFHSURSURYR]D~GUåEX
QD VSRW HELþL QHSURYiG OD VHUYLV ~GUåEX DQL RSUDYX MLQi QHå QiPL DXWRUL]RYDQi RVRED NWHUi VSRW HELþ
nerozebírala ani s ním jinak nemanipulovala
-
YãHFKQ\VHUYLVQtSUiFHSRGOHWpWR]iUXN\PXVtSURYiG WVHUYLV=DQXVVLQHERMtPDXWRUL]RYDQpVW HGLVNR
NDåGêY\P Q QêVSRW HELþQHERY\P Q QiYDGQiVRXþiVWVHVWDQRXQDãtPYODVWQLFWYtP
tato záruka platí vedle vašich zákonných nHERMLQDNSUiYQ
SRGORåHQêFKSUiY
UR]KRGXMtFtSRGPtQN\]iUXN\MVRXXYHGHQ\QD]iUXþQtPOLVWX
Výjimky - tato záruka se nevztahuje na:
- SRãNR]HQt QHER SRåDGDYN\ Y]QLNOp Y G
VOHGNX S HSUDY\ QHVSUiYQpKR SRXåLWt QHER QHGEDORVWL YêP Q\
åiURYHNDVQtPDWHOQêFKþiVWt]HVNODQHERSODVWLFNêFKKPRW
-
QiNODG\VSRMHQpVSRåDGDYN\QDRGVWUDQ Qt]iYDGVSRW HELþHNWHUêMHQHVSUiYQ LQVWDORYiQ
VSRW HELþHNWHUpMVRXSRXåtYiQ\YNRPHUþQtPSURVW HGtYþHWQ SURQDMtPDQêFK
]HP (YURSVNpKRVSROHþHQVWYt/]HSRXåtWVWDQGDUGQt]iUXNXDOH]DMLãW QtåHVSRW HELþVSO XMHQRUP\SODWQp
Y S tVOXãQp ]HPL NDP E\O VSRW HELþ GRSUDYHQ MH QD ]RGSRY GQRVWL D QD QiNODG\ YODVWQtND 0 åH EêW
Y\åDGRYiQGRNODGRNRXSL
Model.....................................................
ýtVORYêURENX(31&1R
...................
6HULRYpþtVOR)6HULDO1R
..................
HYHQWXHOQ .'
9 S tSDG WHFKQLFNêFK SUREOpP YiP EXGH L Qiã ]QDþNRYê VHUYLV NG\NROLY N GLVSR]LFL YROHMWH Adresy:
6HUYLVQtVW HGLVNR=DQXVVL
Hanusova ulice
140 21 Praha 4
Tel.: 2 6112 6112
%H]SHþQRVW
3 HþW WHVLWHQWRQiYRGDYDURYQiXSR]RUQ QtQD]DþiWNXWRKRWRQiYRGX9êUREFHQH]RGSRYtGi]DYDG\
]S VREHQpQHVSUiYQ SRXåtYDQêPYêURENHPQHERYêURENHPSRXåtYDQêPSURMLQp~þHO\QHåMVRX~þHO\
specifikované v tomto návodu.
16
X
ZM17ML
ýHVWLWDPRYDPGDVWHVHRGORþLOL]DQDNXSQRYHPLNURYDORYQHSHþLFH
Zanussi.
Zahvaljujemo se vam za zaupanje, ki ste nam ga izkazali, ko ste izbrali naš proizvod.
3UHSULþDQLVPRGDERVWHKLWURXJRWRYLOLNDNRXSRUDEQDMHYDãDQRYDPLNURYDORYQDSHþLFD
LQGDYDPERYYHOLNRSRPRþ.RWSULYVHKNXKLQMVNLKDSDUDWLKERWXGLSULXSRUDEL
PLNURYDORYQHSHþLFHWUDMDORQHNDMþDVDGDVHERVWHVH]QDQLOL]YVHPLIXQNFLMDPLLQ
PRåQRVWPLXSRUDEHYHQGDUSDVPRSUHSULþDQLGDYDPERVþDVRPDYDãDPLNURYDORYQD
SHþLFDSRVWDODQHSRJUHãOMLYD
3UHGHQSUYLþXSRUDELWHVYRMRQRYRPLNURYDORYQRSHþLFR
QDWDQþQRSUHEHULWHYVDQDYRGLOD]DXSRUDER7DQDYRGLODVPRSULSUDYLOL]åHOMRGDELYDP
RPRJRþLOLUHVRSWLPDOQRLQYDUQRXSRUDER]DWRYDVSURVLPRGDMLKSD]OMLYRSUHEHUHWH
.QMLåLFR]QDYRGLOLLPHMWHYHGQRSULURNLWDNRGDERVWHODKNRYVDNLþNRERVWHYGYRPLK
SRLVNDOLXVWUH]QRQDYRGLORýHERVWHVYRMRPLNURYDORYQRSHþLFRSURGDOLMRNRPXSRGDULOLDOL
MRREVHOLWYLSXVWLOLYVWDUHPVWDQRYDQMXSRVNUELWHGDERQRYLODVWQLNREHQHPVSHþLFRGRELO
tudi navodila za uporabo in se bo lahko tako tudi sam seznanil z varno in optimalno
uporabo.
Navodila za varno uporabo
•
•
9JUDMHQDYDUQRVWQDVWLNDODSUHSUHþXMHMR
pomenijo veliko tveganje za uporabnika
GHORYDQMHPLNURYDORYQHSHþLFHþHVR
PLNURYDORYQHSHþLFH
•
vrata odprta.
Nikoli ne poskušajte spremeniti
delovanje teh stikal, saj bi delovanje
7RELODKNRSRY]URþLORL]SRVWDYOMDQMH
izjemno visoki napetosti.
SHþLFHSULRGSUWLKYUDWLKODKNRSRY]URþLOR
•
•
izpostavljanje oseb mikrovalovni
energiji.
Pazite, da se na tesnilu vrat ne bi
•
UHGQRþLVWLWHJOHMSRJODYMHRþLãþHQMXLQ
namene, ki so opisani v teh navodilih. V
njej ne smete segrevati korozivnih
je ne smete uporabljati, ampak se takoj
NHPLNDOLM7DWLSPLNURYDORYQHSHþLFHMH
REUQLWHQDSRREODãþHQLVHUYLV
L]NOMXþQRQDPHQMHQVHJUHYDQMXLQ
Izjemno pomembno je, da se vrata
kuhanju ter odtaljevanju zamrznjene
PLNURYDORYQHSHþLFHSUDYLOQR]DSLUDMRLQ
KUDQH7DPLNURYDORYQDSHþLFDQL
da niso poškodovani naslednji deli:
primerna za industrijsko uporabo ali
uporabo v laboratorijih, ravno tako pa
tudi ni namenjena komercialni uporabi.
YUDWDXVORþHQDWHþDMLYUDWLQ
•
0LNURYDORYQRSHþLFRXSRUDEOMDMWHVDPRY
ýHMHPLNURYDORYQDSHþLFDSRNYDUMHQD
Y]GUåHYDQMXPLNURYDORYQHSHþLFH
•
0LNURYDORYQRSHþLFRVPHWHLQãWDOLUDWLLQ
postavite samo v skladu z navodili za
inštalacijo, ki so podana v teh navodilih
za uporabo.
QDEUDOLRVWDQNLKUDQHDOLþLVWLOWHVQLOR
•
Nikoli ne smete sneti ohišja, vrat ali
XSUDYOMDOQHSORãþH]PLNURYDORYQHSHþLFH
zapahi (zlomljeni ali zrahljani); (3)tesnila
vrat in tesnilne površine.
Nikoli ne poskušajte sami popraviti
3ULWDNLXSRUDELPLNURYDORYQHSHþLFH
•
SRNYDUMHQRPLNURYDORYQRSHþLFR
vam garancije ne moremo priznati.
Nikoli ne vklapljajte prazne
PLNURYDORYQHSHþLFHýHYQMHMQLKUDQH
3RSUDYLODY]GUåHYDOQDGHODLQ
ali vode, ki bi absorbirali mikrovalovno
energijo, lahko pride do poškodbe
magnetrona.
VSUHPLQMDQMH]QDþLOQRVWLSHþLFHVPHMR
opravljati samo za to usposobljeni
VWURNRYQMDNLSRREODãþHQHJDVHUYLVD9VL
posegi s strani nestrokovnih oseb
3
ZM17ML
• ýHPLNURYDORYQRSHþLFRXSRUDEOMDMR
otroci, jih je pri tem treba skrbno
•
SHþLFHQHQDG]RURYDQHSUHGYVHPþH
VHJUHYDWHDOLNXKDWHKUDQRYSODVWLþQLDOL
QDG]LUDWLSUHGWHPSDVHSUHSULþDMWHGD
•
so sposobni sami uporabljati
papirnati posodi oz. taki, ki se lahko
PLNURYDORYQRSHþLFRLQGDUD]XPHMR
YQDPHYHþNUDWSUHYHULWHGHORYDQMH
nevarnosti, ki so lahko posledica
nepravilne uporabe.
SHþLFHýHRSD]LWHGLPSXVWLWHYUDWD
0LNURYDORYQDSHþLFDQHVPHVWDWLQD
SRWHJQLWHYWLNDþL]YWLþQLFHLQSRþDNDMWH
]DSUWDL]NORSLWHPLNURYDORYQRSHþLFRDOL
da se preneha kaditi.
• Kovinska posoda in posoda s kovinsko
obrobo ni primerna za uporabo v
SURVWHPDOLYEOLåLQLYRGH
•
1HSRVNXãDMWHYPLNURYDORYQLSHþLFL
VXãLWLREOHNDOLþDVRSLVRYWLSUHGPHWLEL
se lahko vneli.
•
PLNURYDORYQLSHþLFLUD]HQþH
proizvajalec izrecno tega ne dovoljuje.
• Posoda z ozkimi grli, kot so to n.pr.
steklenice, za uporabo v mikrovalovni
1HXSRUDEOMDMWHPLNURYDORYQHSHþLFH]D
shranjevanje; nikakor ne smete v njej
SXãþDWLSUHGPHWRYL]SDSLUMDNXKLQMVNLK
SHþLFLQLSULPHUQD
SULSRPRþNRYDOLKUDQH
•
RSHþH
9DUQRVWSULSULSUDYOMDQMXåLYLO
3RVWDYLWHSRVRGRYPLNURYDORYQRSHþLFR
• Nikoli ne segrevajte hrane v konzervah;
skupaj s kozarcem, polnim vode.
6HJUHYDMWHPLNURYDORYQRSHþLFRHQR
SUHGVHJUHYDQMHPMRSUHORåLWHYGUXJR
posodo.
PLQXWRQD:ýHVHMH
•
posoda segrela, je ne uporabljajte
FYUHQMHKUDQHYPDãþRELNHU
lahko uporabljate za segrevanje jedi, ne
WHPSHUDWXUHPDãþREHQLPRJRþH
nadzirati, bi lahko prišlo do poškodb
uporabnika.
• Pokovko (pop-corn) smete pripravljati v
segrevanju sobne temperature, je
primerna za kuhanje v mikrovalovni
SHþLFL
PLNURYDORYQLSHþLFLOHþHXSRUDELWH
3DSLUQDWLSUWLþNLSRYRãþHQLSDSLU
posebno, temu namenjeno posodo oz.
SDSLUQDWHEULVDþHNURåQLNLVNRGHOLFH
SRVHEQH]DYRMþNHSRNRYNHSULSUDYOMHQH
škatle, ovojni papir in lepenka so zelo
]DSULSUDYRYPLNURYDORYQLSHþLFL0HG
SUDNWLþQLSULSRPRþNL]DXSRUDERY
pripravo pokovke nadzirajte delovanje
PLNURYDORYQLSHþLFL9HGQRVHSUHSULþDMWH
PLNURYDORYQHSHþLFH
•
GDVWHMLKYSHþLFRSRVWDYLOLSROQHKUDQHDOL
•
0LNURYDORYQDSHþLFDQLSULPHUQD]D
PLNURYDORYQLSHþLFLýHMHOHPODþQDMR
SD]DNXKDQMHýHMHSRVRGDWXGLSR
•
.RåHOLWHRGNULWLSRVRGRYNDWHULVWH
NXKDOLSD]LWHGDYDVYURþDSDUDQH
Testiranje ustreznosti posode
•
X
1HSXãþDMWHYNORSOMHQHPLNURYDORYQH
äLYLOD]QHSRUR]QROXSLQRSUHGNXKDQMHP
WHNRþLQHVDMWDDEVRUELUDHQHUJLMRLQMHQD
YPLNURYDORYQLSHþLFLYHþNUDWSUHERGLWH
WDQDþLQL]NOMXþHQDPRåQRVWSUHJUHYDQMD
WDNRERVWHSUHSUHþLOLQDELUDQMHSDUHSRG
9HþLQDSODVWLþQLKSRVRGVNRGHOLFãNDWHO
OXSLQR]DUDGLþHVDUELQSUNURPSLUSRþLO
za shranjevanje v zamrzovalniku in
7DNDåLYLODVRQSUMDERONDNURPSLU
SODVWLþQLKRYRMHYMHSULPHUQD]DXSRUDER
SLãþDQþMDMHWUDLQMDMþQLUXPHQMDNL
YPLNURYDORYQLSHþLFL3ULXSRUDELSODVWLNH
upoštevajte navodila proizvajalca.
POZOR!ýHYPLNURYDORYQLSHþLFL
,]RJLEDMWHVHXSRUDELSODVWLþQLKSRVRG]D
VHJUHYDWHWHNRþLQHQSUMXKHRPDNHLQ
SULSUDYRKUDQHNLYVHEXMHYHOLNRPDãþRE
SLMDþHVHWHODKNRSUHJUHMHMRþH]YUHOLãþH
DOLVODGNRUMDNHUGRVHåHMRWDNDåLYLOD
ne da bi se to pokazalo z nastajanjem
YLãMRWHPSHUDWXURLQELVHGRORþHQDYUVWD
PHKXUþNRY=DWRODKNRSULGHGRQHQDGQHJD
SODVWLNHODKNR]DþHODWRSLWL
NLSHQMDYURþHWHNRþLQH'DELWRSUHSUHþLOL
XNUHSDMWHQDQDVOHGQMLQDþLQ
4
ZM17ML
1. Izogibajte se uporabi posod z ravnimi
stranicami in ozkim grlom.
2. 1HSUHJUHYDMWHWHNRþLQ
3. 3UHGHQYOLMHWHWHNRþLQRYSRVRGRMR
premešajte; ponovno jo premešajte na
sredi kuhanja.
4. 3RVHJUHYDQMXSXVWLWHWHNRþLQRãHQHNDM
• Nikoli ne poskušajte na silo zavrteti
QRVLOFD]DYUWOMLYRSORãþRODKNRELJD
pokvarili.
•
,VNUHQMHYPLNURYDORYQLSHþLFLPHG
GHORYDQMHPMHRELþDMQRSRVOHGLFD
uporabe kovinskih predmetov. Pogosto
iskrenje pa bi lahko pokvarilo
þDVDYPLNURYDORYQLSHþLFLLQMRãH
PLNURYDORYQRSHþLFR]DWRXVWDYLWH
preden jo vzamete iz nje, še enkrat
premešajte.
•
X
GHORYDQMHSHþLFHLQSUHYHULWHNDMJD
SRY]URþD
• Pazite, da ne zakrijete odprtin za
1HNDWHUDåLYLODNRWQSUFHODMDMFDLQ
zaprte posode, n.pr. zaprti kozarci za
vlaganje, lahko eksplodirajo in niso
primerni za kuhanje ali segrevanje v
]UDþHQMHNLVRQDYUKX]DGDMREVWUDQL
LQQDGQXPLNURYDORYQHSHþLFH
PLNURYDORYQLSHþLFL2EþDVQRWXGL
zakrknjena jajca med kuhanjem
eksplodirajo. Vedno pred kuhanjem
prebodite rumenjak in jajce pokrijte;
7RPLNURYDORYQRSHþLFRVPHWH
uporabljati samo v gospodinjske
namene; za uporabo v komercialne
namene ni primerna!
SXVWLWHJDSRþLYDWLHQRPLQXWRLQãHOH
nato dvignite pokrov.
Ta navodila shranite!
5
X
ZM17ML
3RVRGDLQSULSRPRþNLSULPHUQL]DXSRUDERYPLNURYDORYQLSHþLFL
3ULNXKDQMXYPLNURYDORYQLSHþLFLODKNR
Zaradi vaše varnosti, pa tudi zato, da ne bi
XSRUDELWHPQRJRUD]OLþQLKPDWHULDORY
SRãNRGRYDOLSRVRGHYYDãLPLNURYDORYQLSHþLFL
se pri izbiri posode ravnajte po spodnji tabeli.
Material
Keramika in
steklo
Porcelan
Keramika**
Plastika
Mikrovalovi
DA*
3RVRGDR]SULSRPRþNL
Toplotnoodporno steklo
Steklena posoda s kovinskimi
obrobami ali okraski
NE
6YLQþHQRNULVWDOQRVWHNOR
NE
DA
DA
DA
brez kovinskih okraskov
=DXSRUDERYPLNURYDORYQLSHþLFL
primerna, toplotnoodporna plastika
DA
NE
DA
DA
NE
NE
3ODVWLþQHYUHþNH
Kovina
.RYLQVNLSHNDþL
Aluminijasta folija***
Papir
Les
Dodatna
oprema
6NRGHOLFHNURåQLNLEULVDþH
5HãHWND]DSULSUDYRMHGLQDåDUX
DA
DA
9UWOMLYDSORãþD
1RVLOHFYUWOMLYHSORãþH
DA: za uporabo primerna posoda
NE: posoda, ki ni primerna
*Samo posoda brez kovinske obrobe
6DPRþHJOD]XUDQHYVHEXMHNRYLQVNLKVQRYL
$OXPLQLMDVWRIROLMRXSRUDEOMDMWHVDPRYPDQMãLKNROLþLQDKYHþMHNROLþLQHELSRY]URþLOHLVNUHQMH
7HKQLþQLSRGDWNL
Mere
Širina 459 mm
Globina 368 mm
Višina 296 mm
1RWUDQMRVWSHþLFH
Širina 282 mm
Globina 282 mm
Višina 206 mm
14 kg
Prostornina 17 litrov
7HåD
3ULNOMXþQDQDSHWRVW
Varovalka 10 A
Poraba energije
Mikrovalovi 1200 W
0Rþ
Mikrovalovi 700 W
6
230 V, 50 Hz
X
ZM17ML
Navodila za namestitev in priklop
3ULNOMXþLWHYQDHOHNWULþQRRPUHåMH
2GVWUDQMHYDQMHHPEDODåH
.RRGVWUDQLWHHPEDODåRVHQDMSUHM
0LNURYDORYQDSHþLFDPRUDELWL
SUHSULþDMWHGDMHYDãDQRYDPLNURYDORYQD
ozemljena! Proizvajalec ne prevzema
odgovornosti za škodo ali poškodbe zaradi
neupoštevanja teh navodil.
SHþLFDQHSRãNRGRYDQD9QDVSURWQHP
primeru se takoj obrnite na prodajalca. Deli
SHþLFHERGRPRUGD]DãþLWHQLVIROLMRWR
PRUDWHSUHGSUYRXSRUDERSHþLFHRGVWUDQLWL
3HþLFDMHGREDYOMHQDVSULNOMXþQLP
3D]LWHGDNRVLHPEDODåHQHSULGHMRYURNH
HOHNWULþQLPNDEORPLQYWLNDþHP]DRPUHåMH]
majhnim otrokom!
napetostjo 230 V, 50 Hz. Ozemljitev
zmanjšuje tveganje v primeru kratkega
stika.
Namestitev
1. Snemite nalepke z vrat.
2. 3RVWDYLWHSHþLFRQDUDYQRJODGNR
ýHQLVWHSUHSULþDQLþHMHYDãHKLãQR
RPUHåMHXVWUH]QRR]LURPDþHMHSRVNUEOMHQR
SRYUãLQRNLSUHQHVHWHåRSHþLFHNJ
za ozemljitev, se posvetujte s
strokovnjakom.
LQYVHELQH'DSUHSUHþLWHPRUHELWQH
vibracije in glasnost delovanja, mora biti
PLNURYDORYQDSHþLFDVWDELOQD
3.
ýHYWLNDþVNDWHULPMHSHþLFDGREDYOMHQDQL
3HþLFDQDMQHERL]SRVWDYOMHQDYODJLLQ
XVWUH]HQ]DYDãRYWLþQLFRJDMHSRWUHEQR
YURþLQLVDMELVHSRãNRGRYDOD
4.
]DPHQMDWL]XVWUH]QLP,]YWLNDþDNLVWHJD
2GSUWLQHQDYUKXLQREVWUDQHKSHþLFH
RGUH]DOLVSULNOMXþQHJDHOHNWULþQHJDNDEOD
morajo ostati proste, zato ne odlagajte
RGVWUDQLWHYDURYDONRLQJDQDWR]DYUåLWHGD
QLþHVDUQDPLNURYDORYQRSHþLFRýHVR
SUHSUHþLWHPRUHELWQRQH]JRGR
odprtine zakrite, lahko pride do
SUHJUHYDQMDLQGRRNYDUHSHþLFH,]
ýHQDYWLNDþXPDQMNDSRNURYþHNQDG
RGSUWLQXKDMDYURþ]UDN]DWRSD]LWHGD
YDURYDONRWDNHJDYWLNDþDQHVPHWH
VHQHRSHþHWH=DSHþLFRQHREHãDMWH
SULNOMXþLWLQDHOHNWULþQRRPUHåMHDPSDN
zaves.
5.
PRUDWHQDMSUHMQDPHVWLWLQRYSRNURYþHN
3HþLFDQDMERþLPGOMHRGUDGLMVNLKDOL
79VSUHMHPQLNRYGDQHELSRY]URþDOD
ýHXSRUDEOMDWHSRGDOMãHNPRUDELWLWD
PRWHQM7DPLNURYDORYQDSHþLFDMH
ozemljen!
izdelana skladno s predpisi EEC o
odpravljanju radijskih motenj, vendar pa
Aparat mora biti ozemljena!
Proizvajalec ne prevzema odgovornosti za
škodo ali poškodbe zaradi neupoštevanja
teh navodil.
• ýHSULORåHQLYWLNDþQHXVWUH]DYDãLP
REVWDMDPRåQRVWGRORþHQLKPRWHQMþH
MHSHþLFDSRVWDYOMHQDSUHEOL]X
radijskega ali televizijskega
sprejemnika.
6.
ýHSRVWDYLWHSHþLFRYNRWPRUDELWLRG
YWLþQLFDPQDMJD]DPHQMD]DWR
desnega zida odmaknjena vsaj 10 cm!
Pozor! 0LNURYDORYQRSHþLFRODKNRSRVWDYLWH
kamorkoli v kuhinji. Paziti pa morate, da jo
postavite na ravno, površino in da so
usposobljena oseba.
•
,]RGUH]DQHJDYWLNDþDRGVWUDQLWH
YDURYDONRLQJD]DYU]LWHGDSUHSUHþLWH
morebitno nezgodo.
RGSUWLQH]D]UDþHQMHSURVWHSUDYWDNRSD
PRUDELWLRPRJRþHQRWXGLNURåHQMH]UDND
SRGSHþLFR
Aparat je izdelan skladno s predpisi EEC št.
]GQHRSUHSUHþHYDQMX
radijskih motenj.
7
X
ZM17ML
2SLVPLNURYDORYQHSHþLFH
1
3
2
5
8
4
4
7
1.
2.
3.
4.
5.
6.
7.
6
3URVWRU]DNXKDQMH3RYVDNLXSRUDELJDRþLVWLWH
2NQRVNR]LNDWHUHJDODKNRQDG]RUXMHWHNXKDQMHPHGGHORYDQMHPSHþLFH
9UDWDSHþLFH0HGNXKDQMHPPRUDMRELWLYHGQRGREUR]DSUWD
.DYHOMþNL]DSDKDLQYDUQRVWQLVLVWHP]DSLUDQMD
8SUDYOMDOQDSORãþD
1RVLOHFYUWOMLYHSORãþH3RVWDYLWHJDQDGQRSURVWRUD]DNXKDQMH
9UWOMLYDSORãþDL]SRVHEQHJDQDYURþLQRRGSRUQHJDVWHNOD1DQMRSRVWDYLWHMHGY
XVWUH]QLSRVRGL1HXSRUDEOMDMWHPLNURYDORYQHSHþLFHEUH]YUWOMLYHSORãþH
8.
3RJRQVNDRVYUWOMLYHSORãþH
9UWOMLYDSORãþDLQQRVLOHF
9UWOMLYDSORãþD
1DPHVWLWHMXNRWNDåHVNLFD3D]LWHGDMH
YUWOMLYDSORãþDSUDYLOQRSRVWDYOMHQDQD
QRVLOHF1LNROLQHREUDþDMWHYUWOMLYHSORãþHV
VSRGQMRVWUDQMRQDY]JRU9UWOMLYDSORãþDVH
vrti na levo ali na desno.
Nosilec
=DSULSUDYOMDQMHMHGLQDåDUXMHSULORåHQD
tudi rešetka, ki jo postavite na sredino
Os vrtljive
YUWOMLYHSORãþH
SORãþH
8
X
ZM17ML
8SUDYOMDOQDSORãþD
1.
*XPE]DQDVWDYOMDQMHPRþL
mikrovalov in izbiranje funkcij
=DQDVWDYOMDQMHXVWUH]QHPRþLPLNURYDORY
2. Gumb programske ure
Za nastavljanje trajanja kuhanja;
PLNURYDORYQDSHþLFD]DþQHGHORYDWL9VH
SURJUDPVNHXUHVREROMQDWDQþQHþH
JXPEQDMSUHM]DYUWLWHQDSUHMRGåHOHQHJD
þDVDLQQDWRQD]DMQDåHOHQRYUHGQRVW
9
X
ZM17ML
Kuhanje z mikrovalovi
1. Odprite vrata in postavite jed na vrtljivo
YHþMRYUHGQRVWLQQDWRQD]DMQDXVWUH]QR
vrednost.
SORãþR=DSULWHYUDWD
2.
3.
6SRPRþMRJXPED]DQDVWDYOMDQMHPRþL
PLNURYDORYQDVWDYLWHXVWUH]QRPRþJO
ýHåHOLWHSHþLFRL]NORSLWLPHGNXKDQMHP
spodnjo razpredelnico).
preprosto obrnite gumb programske ure na 0..
1DVWDYLWHSRWUHEHQþDV]REUDþDQMHP
Opomba: Po uporabi obrnite gumb programske
JXPED]DQDVWDYOMDQMHþDVD
XUHQD]DMQDVLFHUERSHþLFDãHQDSUHM
delovala.
3HþLFD]DþQHGHORYDWL
ýHåHOLWHQDVWDYLWLNUDMãLþDVNXKDQMDRG
minut, gumb programske ure obrnite naprej na
2SRPED6SULWLVNRPQDWLSNR0LFURSRYHþDWH
PRþPLNURYDORY]:QD:
Primer: .XKDQMHPLQXWSULPRþLPLNURYDORY:
*XPE]DQDVWDYOMDQMHPRþLPLNURYDORYREUQLWHQD:
*XPE]DQDVWDYOMDQMHþDVDREUQLWHQD
3HþLFD]DþQHGHORYDWLGHORYDODERPLQXWSULPRþL:
Segrevanje ohlajenih gotovih jedi
•
8SRãWHYDMWHQDYRGLODSURL]YDMDOFDYHQGDUSDVHYHGQRSUHSULþDMWHþHMHMHGUHVGREUR
VHJUHWDýHQHþDVVHJUHYDQMDSRGDOMãDMWH±SRGREQRNRWYRELþDMQLSHþLFL
•
•
-HGREþDVQRSUHPHãDMWHSUHGYVHPSULVHJUHYDQMXHQRORQþQLFRPDN«
ýDVSRþLYDQMDMH]HORSRPHPEHQWDþDVMHGHOSURFHVDNXKDQMDLQRPRJRþDGDVH
temperatura enakomerno razporedi.
8VWUH]QHQDVWDYLWYHPRþLPLNURYDORY
0RþPLNURYDORY
120 W
230 W
350 W
Primerno za:
Ohranjanje toplote
2GWDOMHYDQMH]DPU]QMHQLKåLYLO
6UHGQMDPRþ±KLWUHMãHRGWDOMHYDQMHLQVHJUHYDQMHHQRORþQLF
JRODåD«
540 W
6UHGQMDPRþVHJUHYDQMHJRWRYLKMHGLSHþHQMHGRORþHQLK
SHFLYLQNXKDQMHSXGLQJRYSHþHQMHPHVDSHUXWQLQH«
700 W
1DMYHþMDPRþVHJUHYDQMHWHNRþLQGRYUHOLãþDNXKDQMH
]HOHQMDYH«6HJUHYDQMHSRVRGH]DKUXVWOMDYR]DSHþHQH
jedi.
10
X
ZM17ML
2GWDOMHYDQMH]DPU]QMHQLKåLYLOVIXQNFLMR
Priprava
äLYLOR
230 W
ýDVPLQXWH
ýDV
(230 W)
SRþLYDQMD
(minute)
Kruh
âWUXþND
3RORåLWHQDNURåQLNDOLSDSLU1D
8 – 10
10 – 15
10 – 13
10
45 – 60 sekund
45 – 60 sekund
1–1½
5
5
5
9 – 11
15 – 30
9 – 11
15 – 30
7–9
15 – 30
7–9
15 – 30
3–4
5 – 10
5–6
5 – 10
7–8
5 – 10
7–8
5 – 10
SRORYLFLSUHGYLGHQHJDþDVD
obrnite.
Narezana štruca
3RORåLWHQDNURåQLNDOLSDSLU1D
SRORYLFLSUHGYLGHQHJDþDVD
obrnite.
2 rezini
3RORåLWHQDNURåQLNDOLSDSLU
URJOMLþ
3RORåLWHQDNURåQLNDOLSDSLU
URJOMLþD
3RORåLWHQDNURåQLNDOLSDSLU
Pecivo
.RODþJ
2GVWUDQLWHHPEDODåRSRVWDYLWH
QDNURåQLN
6LURYNRODþJ
2GVWUDQLWHHPEDODåRSRVWDYLWH
QDNURåQLN
Pita (s kuhanim
nadevom) 450 g
Piškoti 450 g
2GVWUDQLWHHPEDODåRSRVWDYLWH
QDNURåQLN
2GVWUDQLWHHPEDODåRSRVWDYLWH
QDNURåQLN
Maslo 250 g
Odstranite folijo, postavite na
NURåQLN
Sadje
-DJRGLþMHJ
Eno plast razgrnite na plitek
NURåQLN
-DJRGLþMHJ
Eno plast razgrnite na plitek
NURåQLN
Gotove jedi 400
g
1DNURåQLNXSRNULMWH]GUXJLP
NURåQLNRPDOL39&IROLMRýH
åHOLWHMHGWXGLVHJUHWLMR
Zelenjava
minute segrevajte pri 700 W.
Odtaljevanje pred kuhanjem ni
potrebno. Vso zelenjavo odtajate
LQVNXKDWHSULPRþL
W).
11
X
ZM17ML
3UDNWLþQLQDVYHWL
•
•
3HþLFRUHGQRþLVWLWH9VDNLþREULãLWH
GRGDOLSR]QHMHþHERWRSRWUHEQR
SR]DELWHRþLVWLWLWXGLSRGVWHNOHQRSORãþR
in notranjo stran vrat.
•
8SRUDEOMDWHPDQMVROLLQ]DþLPENRWSUL
RELþDMQHPNXKDQMX=DþLPEHERVWH
WHNRþLQRNLVHYDPMHPRUGDSROLODQH
•
.RL]NORSLWHSHþLFRSXVWLWHKUDQRQHNDM
•
3UHGHQSRVWUHåHWH]MHGPLVHYHGQR
•
8SRUDEOMDMWH]DãþLWQHNXKLQMVNHURNDYLFH
þDVDSRþLYDWLWDNRERGRUH]XOWDWLEROMãL
ýHMHOHPRJRþHSULNXKDQMXY
PLNURYDORYQLSHþLFLXSRUDEOMDMWHRNURJOH
ali ovalne posode s pokrovom.
• Nikoli ne uporabljajte kovinskih posod ali
posod s kovinskimi okraski ali obrobami.
Tudi nekatere vrste plastike za uporabo
SUHSULþDMWHGDVRVHGRYROMVHJUHOH
NRMHPOMHWHKUDQRL]PLNURYDORYQHSHþLFH
Taljenje medu
Med, ki je kristaliziral, v odprtem kozarcu
YPLNURYDORYQLSHþLFLQLVRSULPHUQHVDM
VHODKNR]DUDGLYURþHKUDQHNLVHYQMLK
segreva, stalijo.
• Med kuhanjem naj bo hrana pokrita.
SRVWDYLWHYPLNURYDORYQRSHþLFR6HJUHYDMWH
JDPLQXWLSULVUHGQMLPRþLPLNURYDORY
8SRUDEOMDMWHVWHNOHQHSRNURYHNURåQLNH
•
•
DOLSRYRãþHQLSDSLU
7DOMHQMHþRNRODGH
3HFLYRNUXKLQSRGREQDåLYLODODKNR
JþRNRODGHQDNRãþNHQDORPLWHY
postavite v mikrovalovno kar v košarici
posodo. Segrevajte jo 1 do 2 minuti pri
]DNUXKDOLQDSDSLUQDWLEULVDþL
QDMYHþMLPRþLPLNURYDORYLQGREUR
ýH]DPU]QMHQDåLYLODWDMDWHNDUYYUHþNL
premešajte.
v kateri so bila zamrznjena, morate to
SUHMRGYH]DWLDOLRGSUHWLäLYLODNLVRELOD
0HKþDQMHDOLWDOMHQMHPDVOD
zamrznjena v posodah, smete v isti
3ULQDMYHþMLPRþLPLNURYDORYVHPDVORY
HPEDODåLRGWDOMHYDWLYPLNURYDORYQLSHþLFL
QHNDMVHNXQGDKVWDOLýHJDåHOLWHVDPR
OHþHMHHPEDODåDSULPHUQD]DXSRUDERY
RPHKþDWLL]EHULWHQLåMRPRþPLNURYDORY
PLNURYDORYQLSHþLFL2GVWUDQLWLSDPRUDWH
Segrevanje kruha
Kruh od prejšnjega dne nekaj sekund
YVHNRYLQVNHVSRQNHDOLåLþNH
• Manjše kose aluminijaste folije uporabite,
VHJUHYDMWHSULVUHGQMLPRþL
GD]DãþLWLWHWDQMãHGHOHR]LURPDGHOHNL
ELVH]ODKNDSUHNXKDOLQSUSLãþDQþMD
•
krilca.
(QRVWDYQROXSOMHQMHþHVQD
äLYLOD]OXSLQRDOLNRåRSUHGNXKDQMHP
GRVWURNHþHVQDVHNXQGVHJUHYDMWH
prebodite z vilico, n.pr. krompir ali
klobase. Jajc v lupini ne smete kuhati v
SULQDMYHþMLPRþL1DWRQDHQHPNRQFX
VWLVQLWHVWURN±þHVHQERVNRþLOL]OXSLQH
PLNURYDORYQLSHþLFLNHUELODKNR
•
•
eksplodirala.
Sadni sok
9HOLNHGHEHOHNRVHSRORåLWHNUREX
,]DJUXPRYERVWHL]WLVQLOLYHþVRNDþHMLK
SRVRGHåLYLODUD]UHåLWHQDNDUQDMEROM
najprej za 15 minut postavite v
enakomerno debele kose.
PLNURYDORYQRSHþLFRSULQDMYHþMLPRþL
+UDQDEREROMHQDNRPHUQRNXKDQDþHMR
Pripravljanje instant hrane
Upoštevajte navodila proizvajalcev!
ERVWHPHGNXKDQMHPYHþNUDWSUHPHãDOL
•
9HGQRQDVWDYLWHQHNROLNRNUDMãLþDV
NXKDQMDNRWJDSULSRURþDUHFHSW7DNR
VHYDPKUDQDQHERSUHNXKDOD9HþMH
NROLþLQHKUDQHVHNXKDMRGOMHþDVD
•
=HOHQMDYRNXKDMWHY]HORPDMKQLNROLþLQL
vode ali brez nje.
12
X
ZM17ML
ýLãþHQMHLQY]GUåHYDQMH
3HþLFDQDMERYHGQRþLVWD2VWDQNLKUDQHNL
ýLãþHQMH]XQDQMRVWL
ELRVWDOLYPLNURYDORYQLSHþLFLELSULYODþLOL
.RþLVWLWHXSUDYOMDOQRSORãþRQDMERGRYUDWD
PLNURYDORYQRHQHUJLMRLQVHVHåJDOL7DNREL
SHþLFHRGSUWD7DNRMHQHERVWHPRJOL
VHODKNRXþLQNRYLWRVWSHþLFH]PDQMãDOD
nehote vklopiti.
pojavil bi se pa tudi neprijeten vonj.
Nikoli ne poskušajte sami spreminjati
=XQDQMRVWSHþLFHþLVWLWH]EODJLPWHNRþLP
]QDþLOQRVWLSHþLFHDOLMRVDPLSRSUDYOMDWL7R
REULãLWHVþLVWRYRGRLQGRVXKHJDREULãLWH]
GHWHUJHQWRPLQYRGRQDWRSDMRGRþLVWHJD
SUHSXVWLWHVWURNRYQMDNRPVSRREODãþHQHJD
mehko krpo.
servisa.
3ULþLãþHQMXODKNRXSRUDELWHWXGLþLVWLOD]D
RNQDDOLYHþQDPHQVNDþLVWLOD]D
3UHSULþDMWHVHGDMHPLNURYDORYQDSHþLFD
razprševanje. Nikoli pa ne smete uporabljati
L]NORSOMHQDL]HOHNWULþQHJDRPUHåMD
DEUD]LYQLKþLVWLOLQSULSRPRþNRY3ULþLãþHQMX
pazite, da voda ne prodre v odprtine za
SUHGHQMR]DþQHWHþLVWLWL
]UDþHQMHNHUELVHWDNRSHþLFD
ýLãþHQMHRSUHPH
poškodovala.
Dele v notranjosti poberite iz mikrovalovne
SHþLFHLQMLKRSHULWH]EODJLPþLVWLORP=
QRVLOFHPYUWOMLYHSORãþHUDYQDMWHãH
posebno previdno.
1RWUDQMRVWSHþLFHLQYUWOMLYLSODGHQMVHPHG
kuhanjem zelo segrejeta; po uporabi
PLNURYDORYQHSHþLFHQDMSUHMSRþDNDMWHGD
se notranjost popolnoma ohladi.
ýLãþHQMHQRWUDQMRVWL
3HþLFDQDMERYHGQRþLVWD7DNRMSRXSRUDEL
MRREULãLWHLQRþLVWLWH2VWDQNLKUDQHQD
stenah, vratih in tesnilu vrat absorbirajo,
mikrovalovno energijo, zmanjšujejo
XþLQNRYLWRVWSHþLFHLQYGRORþHQLKSULPHULK
poškodujejo notranjost.
=DþLãþHQMHXSRUDEOMDMWHEODJDWHNRþDþLVWLOD
WRSORYRGRLQPHKNRþLVWRNUSR1LNROLQH
XSRUDEOMDMWHDEUD]LYQLKþLVWLOþLVWLO]D
HOHNWULþQHSHþLFHDOLEOD]LQLFMHNOHQHYROQH
7UGRYUDWQHPDGHåHERVWHODåMHRþLVWLOLþH
prej v mikrovalovni 2 do 3 minute segrevate
NR]DUHFYRGH3ULþLãþHQMXVLQHVPHWH
QLNROLSRPDJDWL]RVWULPLNRQLþDVWLPL
predmeti!
ýHVHYSHþLFLUD]YLMHQHSULMHWHQYRQM
segrevajte v njej 5 minut kozarec vode z
GYHPDåOLFDPDOLPRQLQHJDVRND
13
X
ZM17ML
Nepravilnosti v delovanju in servisiranje
ýHPLNURYDORYQDSHþLFDQHGHOXMHQDMSUHMSRVNXãDMWHVDPLRGSUDYLWLQHSUDYLOQRVWSR
VSRGQMLKQDYRGLOLKãHOHQDWRVHREUQLWHQDSRREODãþHQLVHUYLV
ýHPLNURYDORYQDSHþLFDQHGHOXMH
ýHYDPQHXVSHRGSUDYLWLQHSUDYLOQRVWLY
pravilno:
• 3UHSULþDMWHVHGDVRYWLNDþYWLþQLFDLQ
varovalka brezihibni; po potrebi
zamenjajte varovalko.
• 3UHSULþDMWHVHGDMHRPUHåMHSRGWRNRP
GHORYDQMXVHREUQLWHQDSRREODãþHQLVHUYLV
Zahtevajte uporabo originalnih rezervnih
delov.
Rezervni deli so vam na voljo pri
SRREODãþHQLKVHUYLVLK]DSURL]YRGH
=DQXVVL.RVHREUQHWHQDSRREODãþHQL
YYWLþQLFRYNORSLWHGUXJLHOHNWULþQLDSDUDW
•
servis, prosimo, da navedete vaše ime in
ýHYDURYDONDYHþNUDWSUHJRULSRNOLþLWH
QDVORYQDWDQþHQRSLVQHSUDYLOQRVWLPRGHO
XVWUH]QRXVSRVREOMHQHJDHOHNWULþDUMD
in serijsko številko proizvoda (navedeni na
tablici s podatki) ter datum nakupa..
ýHPLNURYDORYQDSHþLFDQHGHOXMHY
QDþLQX]DPLNURYDORYH
• Morda je nastavljena varnostna funkcija
(nekateri modeli).
• Morda niste izbrali pravilnih nastavitev.
• 0RUGDQLVR]DSUWDYUDWDýHYUDWDQLVR
]DSUWDPLNURYDORYQDSHþLFDQHGHOXMH
• Morda ostanki hrane ovirajo zapiranje
vrat.
3ULGUåXMHPRVLSUDYLFRWRWHKQLþQLKVSUHPHPEEUH]SUHGKRGQHJDREYHVWLOD3ULGUåXMHPRVLSUDYLFR
do tiskarskih napak.
14
W
ZM17ML
Obsah
3UHGSUYêPSRXåLWtP
4
%H]SHþQRVWQpSRN\Q\
4
4
5
5
–
–
–
Vhodný kuchynský riad
Testovanie kuchynského riadu
Príprava pokrmov
Technické údaje
6
7DEX NDYDUQêFKQiGREDSUtVOXãHQVWYD
6
Inštalácia
– Vybalenie
– Inštalácia
– Zapojenie do elektrickej siete
7
7
7
7
3RXåtYDQLHPLNURYOQQHMU~U\
–
–
–
–
–
2]QDþHQLDDIXQNFLDMHGQRWOLYêFKþDVWt
,QãWDOiFLDURWDþQpKRWDQLHUD
Ovládací panel
Mikrovlnná prevádzka
7DEX NDYêNRQRYêFKVWXS
RY
11
11
12
7DEX N\DWLS\
–
–
Rozmrazovanie
Tipy pre mikrovlnnú prevádzku
13
13
13
13
2ãHWURYDQLHDþLVWHQLH
–
–
–
8
8
8
9
10
10
ýLVWHQLHSUtVOXãHQVWYD
ýLVWHQLHVSRWUHELþD]YQ~WUD
ýLVWHQLHVSRWUHELþD]YRQND
Servis a náhradné diely
– Náhradné diely
– Záruka
14
14
14
3
W
ZM17ML
%ODKRåHOiPHYiPNXN~SHQRYHMPLNURYOQQHMU~U\
DNXMHPHYiPåHVWHVLY\EUDOLYêURERN]QDþN\=DQXVVL6PHSUHVYHGþHQtåHVD YDãD QRYi PLNURYOQQi U~UD VWDQH XåLWRþQêP
SRPRFQtNRP YR YDãHM GRPiFQRVWL 7DN DNR SUL LQêFK GRPiFLFK HOHNWURVSRWUHELþRFK DM SUL WRPWR YêURENX EXGHWH SRWUHERYD
XUþLWêþDVDE\VWHVDQDXþLOL Y\XåtYD YãHWN\ MHKR IXQNFLH D SUHGQRVWL 9HUtPH åH VD SUH YiV VWDQH YDãD QRYi PLNURYOQQi U~UD
QHSRVWUiGDWH QRX
3UHGSUYêPSRXåLWtP
7HQWR QiYRG QD SRXåtYDQLH VL G{NODGQH SUHþtWDMWH $N KR SUHãWXGXMHWH SR]RUQH D EXGHWH VD ULDGL XYHGHQêPL SRN\QPL
GRVLDKQHWHRSWLPiOQHY\XåLWLHYDãHMPLNURYOQQHMU~U\=DQXVVL
1iYRG QD SRXåtYDQLH MH G{OHåLWRX V~þDV RX PLNURYOQQHM U~U\ $N VSRWUHELþ SUHGiWH GDUXMHWH DOHER KR QHFKiWH Y VWDURP E\WH
SRVWDUDMWH VD R WR DE\ VD QiYRG QD SRåtYDQLH GRVWDO GR U~N QRYpKR PDMLWH D
DOãt XåtYDWH VD WDN EXGH P{F RER]QiPL
sREVOXKRXVSRWUHELþDDEH]SHþQRVWQêPLSRN\QPL
3UHGSUYêPSRXåLWtPVSRWUHELþDVLSR]RUQHSUHþtWDMWHWHQWRQiYRGDULD
WHVDXYHGHQêPLSRN\QPL
%H]SHþQRVWQpSRN\Q\
Œ
9
Œ
DND ]DEXGRYDQpPX EH]SHþQRVWQpPX VStQDþX VD
PLNURYOQQi U~UD QHGi VSXVWL NH
=D åLDGQ\FK RNROQRVWt VD QHVQDåWH XYLHV PLNURYOQQ~
Œ
rúru do prevádzky pri otvorených dvierkach, aby ste
sa nevystavili vplyvu mikURY Q
Dbajte na to, aby sa na tesnení dvierok neusadzovali
]Y\ãN\MHGiODOHERþLVWLDFHKRSURVWULHGNX3UHþtWDMWHVL
Œ
NDSLWROXRþLVWHQtDošetrovaní mikrovlnnej rúry.
V prípade poruchy alebo poškodenia mikrovlnnú rúru
våLDGQRP SUtSDGH QHSRXåtYDMWH 2SUDYX VSRWUHELþD
prenechajte kvalifikovaným servisným technikom.
SUREOpPRY
'YLHUND
QHVP~
E\ LQDN
SRãNRGHQp
D
WHVQHQLH
GYLHURN
QHVPLH
E\
narušené.
=D
åLDGQ\FK
RNROQRVWt
VD
QHSRN~ãDMWH
RSU
aYL
oYD
DOHER
SR]PH RYD VSRWUHELþ D MHKR YODVWQRVWL 9
prípade
VSRWUHELþ VDPL -H QHEH]SHþQp XSUDY
SRUXFK\
VD
servisné
Œ
Œ
REUi WH
QD
stredisko.
1LNG\ QHRGVWUD
QDMEOLåãLH
Zoznam
DXWRUL]RYDQp
autorizovaných
XMWH YRQNDMãt SOiã GYLHUND DOHER
RYOiGDFt SDQHO VSRWUHELþD +UR]t QeEH]SHþHQVWYR
zásahu elektrickým prúdom.
Pri inštalácii a zapájaní mikrovlnnej rúry do elektrickej
VLHWHVDULD WHSRN\QPLY kapitole Inštalácia.
0LNURYOQQ~ U~UX SRXåtYDMWH OHQ QD ãSHFLILFNp ~þHO\
QHSRXåtYDMWHNRUR]tYQHFKHPLNiOLH
edovšetkým na tepelnú
rozmrazovanie jedál.
0LNURYOQQi U~UD MH XUþHQi SU
úpravu,
zohrievanie
0LNURYOQQi
laboratórne
U~UD
a
QLH
a
MH
XUþHQi
koPHUþQp
QD
~þHO\
SULHP\VHOQp
3UL
SRXåtYDQt
PLNURYOQQHM U~U\ QD QHYKRGQp ~þHO\ ]iUXND VWUiFD
SODWQRV Œ
Œ
U~U\
WH[WtOLH
GRVWDOL
0{åX
VD
Œ
dospelých, len ak sú oboznámeQp V EH]SHþQRX
prevádzkou a sú si vedoPp QHEH]SHþHQVWYD NWRUp
súvisí s neVSUiYQ\PSRXåtYDQtP
0LNURYOQQ~
U~UX
QHSRXåtYDMWH
QD
VNODGRYanie
potravín. Ak je mikrovlnná rúra mimo prevádzky,
nenechávajte v nej zvyšky papierov, obalov a
kuchynské náradie.
1D SRXåtYDQLH Y mikrovlnnej rúre je vhodné najmä
sklo, sklokeramika a predovšetkým tepluvzdorný
sklenený riad. Mikrovlnná energia nepôsobí na
YlþãLQX VNOHQHQêFK D SRUFHOánových nádob, riad sa
však zohreje vplyvom tepla z pokrmov. Pri vyberaní
]
PLNURYOQQHM
U~U\
SRXåLWH
rukavice, aby ste predišli popáleninám.
SRStVDQpYWRPWRQiYRGH 3UL þLVWHQt PLNURYOQQHM U~U\
Œ
PLNURYOQQHM
VXFKp
'HWL VP~ REVOXKRYD PLNURYOQQ~ U~UX EH] GRK DGX
SRNUPRY
VHUYLVQêFKVWUHGtVNMHSULORåHQê
Œ
GR
DOHER
Œ
Œ
RKQXWp
VSRMRYDFLH N E\ D þDS\ QHVP~ E\ ]ORPHQp DOHER
Œ
VD
Vhodný kuchynský riad
-H G{OHåLWp DE\ VD GYLHUND PLNURYOQQHM U~U\ ]DWYiUDOL
EH]
DE\
SDSLHU
Y]QLHWL Œ
Œ
1HGRYR WH
QRYLQRYê
V~ MHM GYLHUND
otvorené.
Nikdy nezapínajte prázdnu mikrovlnnú rúru.
VRSDþQRP SUíSDGH P{åH G{MV N poškodeniu
vnútorného magnetrónového zariadenia.
0LNURYOQQ~ U~UX QLNG\ QHXPLHVW XMWH Y exteriéroch.
Rovnako mikrovlnnú rúru nepoXåtYDMWH Y EOt]NRVWL
vody.
4
RFKUDQQp
W
ZM17ML
Testovanie kuchynského riadu
Príprava pokrmov
Œ
Œ
pohárom plným vody a výkon nastavte na 700 W
V mikrovlnnej rúre nikdy nezohrievajte potraviny
vSOHFKRYLFLDFK 1DMSUY LFK SUHORåWH GR Qádoby, ktorú
ýDVRKULHYDQLDQDVWDYWHQDMHGQXPLQ~WX$N
MHYKRGQpSRXåtYD YPLNURYOQQHMU~UH
'RPLNURYOQQHMU~U\YORåWHNXFK\QVN~QiGREXVSROXV
Œ
MHULDGKRU~FLQHPDOLE\VWHKRSRXåtYD $NMHPLHUQH
Œ
SUtOLã PDVWQp MHGOi 9]K DGRP QD WR åH VD WHSORWD
tuNX QHGi NRQWURORYD
situáciám.
Œ
Œ
vPLNURYOQQHM U~UH 3UHG SRXåLWtP VD YåG\ XEH]SHþWH
åHQLHV~SUi]GQHDE\VWH]DEUiQLOLSUHKULatiu.
YåG\ SUHSLFKQLWH DE\ VWH ]DEUánili
tak
utajenému varu vo vnútri pokrmov a ich následnej
explózii.
WHSRN\QPLYêUREFX3ODVWRYp REDO\ QHSRXåtYDMWH
Œ
ak obsahujú príliš mastné jedlá alebo jedlá s vysokým
Œ
FXNUX
3UL
LFK
]RKULDWt
P{åH
G{MV Œ
Œ
'HWVN~ YêåLYX SR ]RKULDWt GREUH SUHPLHãDMWH DOHER
pretrepte, aby sa teplo rovnomerne rozORåLOR 6N{U
DNR
YêåLYX
GLH D X
SRGiWH
EHzSRGPLHQHþQH
skontrolujte jej teplotu.
N
poškodeniu obalu.
V mikrovlnnej rúre nikdy nepripravujte bez dozoru
jedlá v plastových, papierových aOHER KRU DYêFK
obaloch. Ak sa objaví dym, nechajte dvierka
zatvorené, rúru vypnite, odpojte ju od elektrickej siete
Upozornenie:
3UL ]RKULHYDQt SROLHYRN QiSRMRY D RPiþRN
YPLNURYOQQHMU~UHVDP{åHVWD åHSRNUPY\N\StEH]WRKR
aby ste spozorovali bod varu. Aby ste sa vyhli uvedenému
javu, odporúþDPH
DSRþNDMWHNêPSRNUPSUHVWDQHG\PL Œ
3RWUDYLQ\ V SHYQRX ãXSRX UHVS QHSyURYLWRX NRåRX
å WND
XPHORKPRWQêFK ULDGRY ãiORN D REDORY 9åG\ VD
REVDKRP
ným
QDSU MDEONi ]HPLDN\ NXUDFLH SHþLHQN\ YDMHþQp
9 PLNURYOQQHM U~UH P{åHWH SRXåtYD YH D GUXKRY
ULD
P{åH GRMV N QHEH]SHþ
3XNDQFH P{åHWH Y PLNURYOQQHM U~UH SULSUDYRYD OHQ
vãSHFLiOQ\FK REDORFK XUþHQêFK QD WHQWR ~þHO 7HQWR
proces treba neustále sledoYD ãNDWXOH D OHSHQNRYp REDO\ V~ YKRGQp SUH SRXåLWLH
Œ
V mikrovlnnej rúre nikdy nefritujte a nepripravujte
WHSOê P{åHWH KR SRXåtYD QD ]RKULHYDQLH MHGiO $N
má riad izbovú tepORWX P{åHWH KR SRXåtYD DM QD
tepelnú úpravu pokrmov.
Obaly z materiálov, ako sú napr. servítky, voskový
papier, papierové utierky, papierové šálky, kartónové
Kovový riad alebo riad s kovovým lemovaním, resp.
ornamentom by ste v mikrovlnnej rúre nemali
oYHQHQHRGSRU~þD
V mikrovlnnej rúre nezohrievajte pokrmy v obaloch
s~]N\PRWYRURPDNRV~QDSUI DãH
Pri snímaní pokrievok a uzáverov kuchynských nádob
SRXåtYD DNWRYêUREFDY\VO
1.
2.
3.
EX
4.
WH RSDWUQt D SRXåLWH UXNDYLFH DE\ VWH SUHGLãOL
popáleninám.
Œ
1HSRXåtYDMWHQiGRE\V~]N\PKUdlom.
Pokrmy neprehrievajte.
Pokrmy pred ich zohrievaním v mikrovlnnej rúre, ako
aj v polovici procesu zohrievania premiešajte.
3R]RKULDWtQHFKDMWHSRNUP\HãWHFKYt XY mikrovlnnej
rúre, a potom ich zamiešajte.
Niektoré potraviny ako napr. celé vajcia alebo pokrmy
Y
X]DWYRUHQêFK
SRKiURFK
P{åX
SUL
]RKULHYDQt
aPH SULSUDYRYD
v mikrovlnnej rúre. Ak chcete v mikrovlnnej rúre
H[SORGRYD SUHWR
LFK
QHRGSRU~þ
SULSUDYL YDMtþND å WRN YåG\ SUHSLFKQLWH D SRWRP
vajcia zakryte. Pred odoNU\WtPSRNULHYN\SRþNDMWHFFD
jednu minútu.
Upozornenia:
Œ
1LNG\ VD QHSRN~ãDMWH QiVLOtP RWRþL URWDþQê WDQLHU
mohli by ste ho poãNRGL
Œ
3UtþLQRX LVNUHQLD Y PLNURYOQQHM U~UH EêYD NRYRYi
NXFK\QVNi QiGRED ,VNUHQLH P{åH VSRWUHELþ YiåQH
SRãNRGL SUHWR WUHED SURJUDP RNDPåLWH ]DVWDYL D
SRXåLW~QiGREXVNRQWURO
Œ
'EDMWH
QD
WR
DE\
oYD
YHQWLODþQp
RWYRU\
YR
vrchnej,
]DGQHM ERþQHM D VSRGQHM þDVWL VSRWUHELþD ]RVWDOL
YR Qp
6SRWUHELþQHSRXåtYDMWHQDNRPHUþQp~þHO\
0LNURYOQQiU~UDMHXUþHQiQDSRXåtYDQLHY
'RGUåLDYDMWHY\ããLHXYHGHQpSRN\Q\
5
domácnosti.
W
ZM17ML
7DEX NDYDUQêFKQiGREDSUtVOXãHQVWYD
záujme
bezproblémovej preYiG]N\ YODVWQHM EH]SHþQRVWL D PD[LPiOQHM ~þLQQRVWL VL Y\EHUWH WR QDMYKRGQHMãLH SUH GDQê GUXK WHSHOQHM
1D WHSHOQ~ ~SUDYX SRNUPRY Y PLNURYOQQHM U~UH P{åHWH SRXåtYD PQRåVWYR GUXKRY ULDGRY D SUtVOXãHQVWYD 9
~SUDY\SRNUPX3RQ~NDPH9iPVWUXþQêSUHK DGYãHREHFQHSRXåtYDQêFKQiGRE
Riad
MATERIÁL
Mikrovlnná tepelná úprava
keramika a sklo
porcelán bez kovovej dekorácie
tepluvzdorné sklenené nádoby
sklenené nádoby s kovovými ornamentami
þtQVN\SR
rcelán
porcelán *
plast
bez kovových ozdôb
bez kovových ozdôb
tepluvzdorné plastové obaly
plastové obaly
kov
SOHFK\QDSHþHQLH
papier
alobal**
šálky, tanieriky
ÁNO
ÁNO*
NIE
NIE
QiGRE\]RORYQDWpKRNULãWi X
ÁNO
ÁNO
ÁNO
ÁNO
NIE
ÁNO
ÁNO
voskový papier
ÁNO
drevo
NIE
príslušenstvo
ÁNO
ÁNO
URWDþQêWDQLHU
SRGORåNDSRGWDQLHU
È12YKRGQpSRXåtYD Y
mikrovlnnej rúre
1,(QHYKRGQpSRXåtYD YPLNURYOQQHMU~UH
* Ak glazúra neobsahuje kov, alebo ak nádoby nemajú kovovú dekoráciu.
** POZNÁMKA: Alobal sa SRXåtYDQD]DNU\WLHDRFKUDQXSRWUDYtQP{åHVS{VRERYD
LVNUHQLH
Technické údaje
Vonkajšie rozmery
šírka 459 mm
K ENDPP
výška 296 mm
šírka 282 mm
Vnútorné rozmery dutiny
K ENDPP
výška 206 mm
17 litrov
14 kg
230 V, 50 Hz
10 A
1200 W
Objem
+PRWQRV
Zapojenie
Poistka
Spotreba energie mikrovlnnej rúry
6
W
ZM17ML
Inštalácia
Vybalenie
Zapojenie do elektrickej siete
3R Y\EDOHQt VNRQWUROXMWH þL VSRWUHELþ SRþDV SUHSUDY\
086Ë
%< %(=32D0,(1(ý1(
UZEMNENÝ!
Výrobca
nezodpovedá
za
škody
spôsobené
nerešpektovaním tohto bezSHþQRVtného pokynu.
63275(%,ý
QHXWUSHO ãNRG\ $ ]LVWtWH åH MH U~UD SRãNRGHQi DOHER
QHMDNi MHM þDV FKêED EH]RGNODGQH VD REUi WH QD YiãKR
GRGiYDWH D 5~UD D MHM SUtVOXãHQVWYR P{åH E\ ]DEDOHQp
GR RFKUDQQHM IyOLH 3UHG SUYêP SRXåLWtP VSRWUHELþD WUHED
IyOLXEH]SRGPLHQHþQHRGVWUiQL 2EDORYêPDWHULiORGVWUi
6SRWUHELþ MH GRGiYDQê V SUtSRMQêP NiEORP D ãWDQGDUGQRX
WH]GRVDKXGHWt
HXUR]iVWUþNRX
1.
=
2.
nálepky.
SpotreELþ
GYLHURN
VSRWUHELþD
RGVWUi
WH
YãHWN\
UHNODPQp
8]HPQHQLH
HOHNWULFNHM
VLHWH
SUHGOåRYDFLHKRNiEODVNR
9
0LNURYOQQ~ U~UX XPLHVWQLWH Y GRVWDWRþQHM Y]GLDOHQRVWL
6SRWUHELþ
spotUHELþD
VSRWUHELþD
SUtSDGH
VNUDWX
nWUROXMWHþLMHNiEHOX]HPQený.
SUREOpPRY
REUi WHQDNYDOLILNRY
DE\ VWH VD Y\KOL ]QtåHQLX YêNRQX D SRãNRGHQLX
VSRWUHELþD
QHEH]SHþHQVWYR
DOHER
Y
GROQHM
QHFKDMWH
YR Qp
QHGiYDMWH
D
ERþQêFK
1D
åLDGQH
KRUQ~
þDVWLDFK
PXVt
E\ MX
3UL
QRYRX
=
RGGHOHQHM
]iVWUþN\
RGVWUi
WH
SRLVWNX
D
]iVWUþNX ]OLNYLGXMWH DE\ QHGRãOR N MHM ]DSRMHQLX Y LQHM
zablokoYDQtYHQWLODþQêFKRWYRURYSRþDVSUHYiGzky sa
P{åH
U~UD
SUHKULD D
QiVOHGQH
SoãNRGL ZYHQWLODþQêFKRWYRURYSU~GLKRUúci vzduch. Dbajte na
]iVXYNH þR E\ PRKOR PD ]D QiVOHGRN ~UD] HOHNWULFNêP
QDSlWtP $N WUHED Y GRGiYDQHM ]iVXYNH Y\PHQL SRLVWNX
PXVtWH
WR DE\ EROL RWYRU\ YåG\ YR Qp D DE\ VD PHG]L U~UX D
QDKUDGL DM
NU\W
SRLVWN\
$N
MH
NU\W
SRLVWN\
SRãNRGHQê DOHER VD VWUDWLO QHVPLHWH ]iVWUþNX SRXåtYD
zadnú stenu nedostali napr. záclony.
0LNURYOQQ~U~UX XPLHVWQLWH þR QDM
X]Hmnený.
Ak
ibilná so zásuvkou na
EH]SRGPLHQHþQH
PLHVWHXPLHVWQHQLDP{åHWH]iVWUþNXRGVWULKQ~ DQDKUDGL
VWUDQX
SUHGPHW\
RK DGQH
aného elektrikára.
]iVWUþND VSRWUHELþD QLH MH NRPSDW
RWYRU\
SRFK\EQRVWt
]DSRMHQLD VSRWUHELþD GR HOHNWULFNHM VLHWH D X]HPQHQLD VD
od vody a zdrojov tepla, ako sú napr. radiátor a boiler,
9HQWLODþQp
PLQLPDOL]XMH
$NKRGOiWHU~UX]DSRML GRHOHNWULFNHMVLHWHSURVWUHGQtFWYRP
SHYQp DE\ XGUåDOR KPRWQRV VSRWUHELþD NJ D
5.
GR
prípojnému napätiu na mieste inštalácie.
0LHVWR XPLHVWQHQLD VSRWUHELþD PXVt E\ GRVWDWRþQH
4.
]DSRMHQLH
6NRQWUROXMWH þL QRPLQiOQH QDSlWLH VSRWUHELþD ]RGSRYHGi
XPLHVWQLWH QD URYQê D KODGNê SRYUFK
jeho obsah, a stabilné, aby nedošlo k vzniku vibrácií.
3.
SUH
s parametrami 230 V, 50 Hz prostredníctvom uzemnenej
elektrickej zásuvky.
Inštalácia
dovtedy, kým vám autorizovaný
nenainštaluje nový kryt poistky.
DOHM RG UiGLD DOHER
servisný
technik
WHOHYt]LH 7HQWR VSRWUHELþ ]RGSRYHGi SRåLDGDYNiP
SUH SRWODþHQLH UXãHQLD SUtMPX DN KR YãDN SRORåtWH
3ULYêPHQH]iVWUþN\VSRWUHELþDSRVWXSXMWHWDNWR
SUtOLã EOt]NR UiGLD DOHER WHOHYt]LH P{åH VD SUtMHP
naruãL
6.
=RGVWULKQXWHM]iVWUþN\RGVWUi
YHQWLOiFLH]DFKRYDMWHRGVWXSRGVWLHQDVSR
niektorej zásuvky elektrickej inštalácie.
7HQWR VSRWUHELþ ]RGSRYHGi VPHUQLFL (:* NWRUi
'{OHåLWpXSR]RUQHQLH
5~UXP{åHWHXPLHVWQL NGHNR YHNY NXFK\QL 3RORåWH MX QD
i
URYQ~ D SHYQ~ SRGORåNX 9HQW ODþQp RWYRU\ D GROQi þDV
PXVLD
]RVWD EH]SRGPLHQHþQH
WH DE\ VWH SUHGLãOL
QHEH]SHþHQVWYX NWRUp KUR]t SUL ]DSRMHQt ]iVWUþN\ GR
FP
sa týka opatrení proti rušeniu príjmu.
VSRWUHELþD
WHSRLVWNX
2GVWULKQXW~ ]iVWUþNX SRWRP RGVWUi
$N U~UX XPLHVWQLWH GR URKX Y ]iXMPH GRVWDWRþQHM
YR Qp
GRVWDWRþQiYHQWLOiFLD
7
W
ZM17ML
3RXåtYDQLHPLNURYOQQHMU~U\
1
3
2
5
4
8
4
6
7
2]QDþHQLHDIXQNFLDMHGQRWOLYêFKþDVWt
,QãWDOiFLDURWDþQpKRWDQLHUD
1.
1.
Pracovný priestor na tepelnú úpravu
3RGORåNX URWDþQpKR WDQLHUD SRORåWH QD GQR GXWLQ\
rúry.
3RNDåGRPSRXåLWtGXWLQXU~U\Y\WULWHYOKNRX
2.
KDQGULþNRX
1DSRGORåNXXPLHVWQLWH URWDþQê WDQLHU SRG D SRN\QRY
2.
3ULHK DGQpRNLHQNRGYHUt
QD REUi]NX 'EDMWH QD WR DE\ ERO URWDþQê WDQLHU
$NMHU~UDYSUHYiG]NHP{åHWHFH]RNLHQNRVOHGRYD
pevne prichytený v hriadeli.
nedávajte obrátene.
3.
prípravu pokrmu.
Dvierka mikrovlnnej rúry
-
3RþDVSUHYiG]N\VSRWUHELþDPXVLDE\ GYLHUNDU~U\
3UtFK\WN\GYLHURNDEH]SHþQRVWQêEORNRYDFtV\
5~UX QLNG\ QHSRXåtYDMWH EH] SRGORåN\ D URWDþQpKR
taniera.
YåG\~SOQH]DWYRUHQp
4.
5.
6.
stém
-
3UL WHSHOQHM ~SUDYH PXVt E\ SRNUP YR YKRGQHM
-
5RWDþQê WDQLHU VD RWiþD Y VPHUH DM SURWL VPHUX
Ovládací panel
QiGREHSRORåHQêQDURWDþQRPWDQLHUL
3RGORåNDSRGURWDþQêWDQLHU
3RGORåNXXPLHVWQLWHQDGQRGXWLQ\U~U\SRGURWDþQê
KRGLQRYêFKUXþLþLHN
tanier.
7.
5RWDþQêWDQLHU
Je vyrobený zo špeciálneho tepluvzdorného skla.
URWDþQêWDQLHU
3RNUPYRYKRGQHMQiGREHWUHEDSRORåL QDURWDþQê
WDQLHU5~UXQHSRXåtYDMWHEH]URWDþQpKRWDQLHUD
8.
5RWDþQê WDQLHU QLNG\
+ULDGH URWDþQpKRWDQLHUD
SRGORåND
KULDGH
8
W
ZM17ML
Ovládací panel
2YOiGDþYêNRQX
6O~åL QD QDVWDYHQLH SRåDGRYDQpKR YêNRQX Y ãNiOH
od 120 do 700 W.
2YOiGDþþDVX
6O~åL
QD
QDVWDYHQLH
SRåDGRYDQpKR
þDVX
3R
QDVWDYHQt þDVX VD U~UD VSXVWt 2YOiGDþ þDVX EXGH
SUDFRYD SUHVQHMãLH DN QDMSUY QDVWDYtWH Y\ããLX
KRGQRWX
D
SRWRP
SRåDGRYDQ~KRGQRWX
9
KQH
YUiWLWH
RYOiGDþ
QD
W
ZM17ML
Mikrovlnná prevádzka
1.
2.
3.
2WYRUWH GYLHUND SRNUP YR KRGQHM QiGREH SRORåWH QD
$NVLåHOiWHDE\ WHSHOQi ~SUDYD SRNUPX WUYDOD NUDWãLH DNR
URWDþQêWDQLHUDGYLHUND]DWYRUWH
2 minúty,
2YOiGDþRP
YêNRQX
QDVWDYWH
]YR WH
SRåDGRYDQê
QDVWDYWH QDMSUY Y\ããLX KRGQRWX D SRWRP KQH
YUi WHRYOiGDþQDSRåDGRYDQ~KRGQRWX
YêNRQSR]ULQDVOHGXM~FXWDEX NX
$N FKFHWH WHSHOQ~ ~SUDYX SRNUPX VNRQþL RWRþWH RYOiGDþ
2WRþHQtP RYOiGDþD þDVX QDVWDYWH SRåDGRYDQê þDV
þDVXGRSRORK\
tepelnej úpravy pokrmu.
4.
8SR]RUQHQLH3RNDåGRPSRXåLWtU~U\QDVWDYWHRYOiGDþ
5~UD]DþQHSUDFRYD þDVX
GR
SRORK\
LQDN
EXGH
U~UD
SRNUDþRYD
v prevádzke.
Príklad: 20-minútová tepelná úprava pri výkone 540W
1.
2.
3.
2WRþQêRYOiGDþYêNRQXQDVWDYWHQDKRGQRWX:
2WRþQêRYOiGDþþDVXQDVWDYWHQDKRGQRWX
5~UDEXGHDXWRPDWLFN\SUDFRYD PLQ~WSULYêNRQH:
Zohrievanie hotových chladených pokrmov
•
3RN\Q\YêUREFRYKRWRYêFKSRNUPRYRK DGQHþDVX]RKULHYDQLDXYHGHQpQDREDOHYêURENXVO~åLDOHQSUHRULHQWiFLX$NSR
XSO\QXWtRGSRUXþHQpKRþDVX]RKULHYDQLHSRNUPQLHMHWHSOêYUi WHKRGRPLNURYOQQHMU~U\D]RKULHYDMWHKRGOKãLH
3RVWXSXMWHSRGREQHDNRSUL]RKULHYDQtYEHåQHMU~UHQDSHþHQLH
•
•
3RNUP\SUDYLGHOQHSUHPLHãDYDMWHSUHGRYãHWNêPRPiþN\DSROLHYN\
9H PLG{OHåLWêMHDMþDVRGVWDYHQLDSRNUPXNWRUêMHV~þDV RXSURFHVXWHSHOQHM~SUDY\SRNUPXD]DEH]SHþXMHURYQRPHUQp
rozdelenie teploty v celom pokrme.
7DEX NDYêNRQRYêFKVWXS RY
Výkon
9\XåLWLH
120 W
8GUåLDYDQLHWHSORW\
230 W
350 W
540 W
700 W
pokrmov.
Rozmrazovanie mrazených pokrmov
Stredný výkon
rýchlejšie rozmrazovanie a zohrievanie hustých polievok a gulášov
Stredný výkon
SHþHQLHNROiþRYDSXGLQJRY
Max. výkon
zohrievanie vody alebo tekutín, tepelná úprava zeleniny, prehrievanie a zapekanie pokrmov
10
W
ZM17ML
Rozmrazovanie
1LHNWRUpSRNUP\DNRV~QDSURYRFLHDFKOLHEP{åHWH~þLQQHUR]PUD]RYD SULYêNRQRYRPVWXSQL
Pokrm
Chlieb
Menší bochník
3RORåWH
Príprava
.UiMDQêYlþãtERFKQtN
3RORåWH
QD
YKRGQê
SRGVWDYHF
DOHER
ãSHFLiOQ\
.
ýDV
Odstátie
8-10 min
10-15 min
10-13 min
10 min
45-60 s
45-60 s
1-1,5 min
5 min
5 min
5 min
15-30 min
15-30 min
15-30 min
15-30 min
NXFK\QVNêSDSLHU9SRORYLFLUR]PUD]RYDQLDREUi WH
QD
YKRGQê
SRGVWDYHF
DOHER
ãSHFLiOQ\
NXFK\QVNêSDSLHU9SRORYLFLUR]PUD]RYDQLDREUi WH
2 krajce
3RORåWHQDãSHFLiOQ\NXFK\QVNêSDSLHU
åHP D
3RORåWHQDãSHFLiOQ\NXFK\QVNêSDSLHU
åHPOH
3RORåWHQDãSHFLiOQ\NXFK\QVNêSDSLHU
.ROiþHDFHVWRYLQ\
Torta 450 g
2GED WHDSRORåWHQDWDQLHU
6\URYêNROiþJ
2GED WHDSRORåWHQDWDQLHU
.ROiþJ
2GED WHDSRORåWHQDWDQLHU
0~þQHMHGORJ
2GED WHDSRORåWHQDWDQLHU
9-11 min
9-11 min
7-9 min
7-9 min
Maslo
250 g (1 balenie)
Ovocie
2GED WHDSRORåWHQDWDQLHU
3-4 min
5-10 min
0lNNp
EREX RYLWp
3RORåWHYMHGQHMYUVWYHQDSO\WNêWDQLHU
5-6 min
5-10 min
EREX RYLWp
3RORåWHYMHGQHMYUVWYHQDSO\WNêWDQLHU
7-8 min
5-10 min
Prikryte tanierom alebo vhodnou fóliou (nie PVC). Ak
7-8 min
5-10 min
ovocie 225 g
0lNNp
ovocie 450 g
Krájaný pokrm
400 g
FKFHWHSRNUP DM ]RKULD ]YR WH YêNRQ :
DQDVWDYWHþDVPLQ~W\
Zelenina
Zeleninu
pred
UR]PUD]RYD $N
tepelnou
FKFHWH
úpravou
]HOHQLQX
11
nemusíte
UR]PUD]L ]RKULD ]YR WHPD[LPiOQ\YêNRQ
DM
W
ZM17ML
Tipy pre mikrovlnnú prevádzku
Œ
•
QHY\N\SHOL
D
QH]DEXGQLWH
Y\þLVWL SORFKX
VNOHQHQêP URWDþQêP WDQLHURP D YQ~WRUQ~ VWU
SRG
VWDYX RGQtPWH YHNR QiGRE\ QiGREX
anu
mikrovlnnej rúry, nastavte stredný výkon a rúru
3UL WHSHOQHM ~SUDYH Y PLNURYOQQHM U~UH SRXåtYDMWH
•
okrúhle a oválne nádoby.
Œ
1HSRXåtYDMWH
NRYRYê
ULDG
DOHER
ULDG
V
kovovou
tepla z pokrPXUR]WRSL
Œ
•
0DVORVDUR]WRSt]DQLHNR NR VHN~QG SUL PD[LPiOQRP
priamo v košíku alebo na kuchynskom papieri.
Ak rozmrazujete jedlo v pôvodnom obale, otvorte ho.
2GVWUi WH NRYRYp VSRMH D VSLnky. Obaly s obsahom
kovu nikdy nedávajte do mikrovlnnej rúry, iba ak to
YêNRQH
VWXSH
Œ
YêNRQRYê
•
Zohrievanie chleba
•
Jednoduché šúpanie cesnaku
Y\VRNRPYêNRQH1DNRQFLVWU~þLNVWODþWHDFHVQDNVD
DKNR]EDYtãXS\
3UL WHSHOQHM ~SUDYH YlþãtFK NXVRY GEDMWH QD WR DE\
•
2YRFQiã DYD
&LWUXVRYp SORG\ GDM~ YLDF ã DY\ DN LFK QDMSUY QD sekúnd zohrejete pri vysokom výkone.
-HGOR VD SULSUDYt URYQRPHUQH DN KR SRþDV WHSHOQHM
•
ešate.
3UL
SUtSUDYH
]HOHQLQ\
.DãX P{åHWH SULSUDYL MHGQRGXFKR Y
bný na jeho prípravu.
SRXåtYDMWH
OHQ
PLQLPi
5LD
lne
PQRåVWYRYRG\
Œ
3RXåtYDMWH PHQHM GRFKXFRYDGLHO DNR SUL QRUPiOQHM
Œ
tepelnej úpravy.
V záujme rovnomernej tepelnej úpravy nechajte jedlo
YPLNURYOQQHMU~UHYåG\SiUPLQ~WRdVWi Œ
3UHG VHUYtURYDQtP VNRQWUROXMWH þL MH MHGOR GRVWDWRþQH
WHSHOQHM ~SUDYH 3RNUP RNRUH
WH Då SR VNRQþHQt
teplé.
3ULY\EHUDQtSRNUPX]U~U\SRXåtYDMWHUXNDY
Príprava obilnej kaše
mikrovlnnej rúre
priamo v servírovacom tanieri bez ulepených hrncov.
3UL SUtSUDYH SRNUPX ]YR WH QDMVN{U NUDWãLX GREX
YLDFWêPGOKãtþDVMHSRWUH
Œ
QLåãt
DOHER VWU~þLN\ FHVQDNX ]RKULHYDMWH VHN~QG SUL
SUtSUDY\ DE\ VWH VD Y\KOL SUHYDUHQLX ýtP MH MHGOD
Œ
SRVWDþt
klobásy) pred tepelnou prípravou prepichnite. V rúre
nepripraYXMWHYDMFLDSUHWRåHP{åXH[SORGRYD ~SUDY\REþDVSUHPL
Œ
]PlNþHQLH
-HGOi Y ãXSNH DOHER SRWLDKQXWp NRåRX ]HPLDN\
boli najhrubšie kusy na okrajoch nádoby. Pokrm sa
VQDåWH UR]SRUFLRYD URYQRPHUQH 3RNUP umiestnite
YåG\GRVWUHGXQádoby.
Œ
1D
1DQLHNR NRVHN~QG]YR WHVWUHGQêYêNRQRYêVWXSH
Na ochranu tenkých a chúlostivých kúskov (nohy
NXUþD DSRXåLWHDOREDO
Œ
=PlNþHQLHDOHERUR]WRSHQLHPDVOD
3HþLYR FKOLHE D LQp P~þQLN\ P{åHWH UR]PUD]RYD
YêUREFDYêVORYQHRGSRU~þD
Œ
5R]WRSHQLHþRNROiG\
nádoby, zohrievajte 1-2 minúty pri najvyššom výkone
a potom dobre premiešajte.
D]GHIRUPRYD -HGOR SULSUDYXMWH YåG\ ]DNU\Wp 3RXåLWH VNOHQHQ~
pokrievku, tanier alebo špeciálny papier.
Œ
GR
JþRNROiG\ UR]OiPWH QD N~VN\ YORåWH GR YKRGQHM
GHNRUiFLRX 1LHNWRUp GUXK\ SODVWX VD P{åX YSO\YRP
Œ
YORåWH
QHFKDMWHSUDFRYD PLQ~W\
dvierok.
Œ
Zjemnenie medu
$N FKFHWH YUiWL VNU\ãWDOL]RYDQê PHG RG S{YRGQpKR
5~UX XGUåXMWH YåG\ þLVW~ 'EDMWH QD WR DE\ SRNUP\
ice.
12
WHVDSRN\QPLYêUREFXSRNUPX
W
ZM17ML
2ãHWURYDQLHDþLVWHQLH
6SRWUHELþXGUåXMWHYþLVWRWH=Y\ãN\MHGiOSUL
aKXM~HQHUJLXPLNURY QDSULSD XM~VD 7RP{åHPD
]DQiVOHGRNQLåãLXYêNRQQRV
VSRWUHELþDDY]QLNQHSUtMHPQpKR]iSDFKX
1LNG\VDQHSRN~ãDMWHVSRWUHELþRSUDYRYD VDPL2SUDY\VSRWUHELþDVPLHY\NRQiYD YêOXþQHNYDOLILNRYDQêVHUYLVQêWHFKQLN
3UHGþLVWHQtPVSRWUHELþRGSRMWHRGHOHNWULFNHMVLHWH
ýLVWHQLHSUtVOXãHQVWYD
URWDþQpKRWDQLHUDDSRGORåN\
3RRGPRQWRYDQtXP\WHSUtVOXãHQVWYRãHWUQêPþLVWLDFLPSURVWULHGNRP6
príslušenstvom manipulujte opatrne.
Pozor:9Q~WURU~U\DURWDþQêWDQLHUVDSRþDVSUHYiG]N\U~U\]QDþQH]RKUHM~SUHWRVDLFKEH]SURVWUHGQHSRSRXåLWtQHGRWêNDMWH
ýLVWHQLHVSRWUHELþD]YQ~WUD
nFH RNDPåLWH XWULWH 1HþLVWRW\ QD VWHQiFK U~U\ SRYUFKX GYLHURN D WHVQHQt
pohlcujú mikrovlnnú energiu, redukujú výkon rúry a vNUDMQRPSUtSDGHP{åXSRãNRGL MHMYQ~WUR
1DþLVWHQLHSRXåtYDMWHãHWUQêWHNXWêþLVWLDFLSURsWULHGRNWHSO~YRGXDPlNN~þLVW~KDQGULþNX
9Q~WUR U~U\ XGUåXMWH þLVWp =Y\ãN\ MHGiO D SUVND
=È6$'1(1(328äË9$-7($%5$=Ë91($*5(6Ë91($.20(5ý1eý,67,$&(352675,('.<$'5Ð7(1.<
2GROQêFKQHþLVW{WVD]EDYtWHMHGQRGXFKêPVS{VRERPYPLNURYOQQHMU~UHQHFKDMWH]RYULH SRKiUYRG\SRGREXFFDPLQ~W\
1$ 2'675È1(1,( 1(ý,67Ð7 =
VNÚTORNÉHO POV5&+8
0,.529/11(- 5Ò5< 1(328äË9$-7( 1Ðä $ ,1e
PREDMETY.
Nepríjemný zápach po jedle odstránite týmto spôsobom: v mikrovlnnej rúre nechajte zoYULH
YODåQHMYRG\DSROLHYNRYêFKO\åtFFLWUyQoYHMã DY\
SRGREXPLQ~WSRKiUVUR]WRNRP
ýLVWHQLHVSRWUHELþD]YRQND
i
3ULþLVWHQtRYOiGDFLHKRSDQHOXVSRWUHELþDQHFKDMWHSRRWYRUHQpGYLHUND=DEUiQLWHWêPQH~P\VHOQpPXVSXVWHQLXVSRWUHE þD
9RQNDMãtSOiã Y\þLVWLWHUR]WRNRPãHWUQpKRþLVWLDFHKRSURVWULHGNXSRWRPþLVWRXYRGRXRGVWUi
WH]Y\ãN\þLVWLDFHKRSURVWULHGNXD
následne vytrite dosucha mäkkou handriþkou.
1DþLVWHQLHRNQDGYLHURNP{åHWHSRXåL EHåQêXQLYHU]iOQ\SURVWULHGRNVUR]SUDãRYDþRP1DþLVWHQLHYRQNDMãHMþDVWLVSRWUHELþD
QHSRXåtYDMWH DEUD]tYQH D DJUHVtYQH þLVWLDFH SURVWULHGN\ D GU{WHQN\ 'EDMWH QD WR DE\ VD SUL þLVWHQt GR YHQWLODþQêFK RWYRURY
nedostala voda.
13
W
ZM17ML
Servis a náhradné diely
$NVSRWUHELþQHSUDFXMHWDNDNRE\PDOSUHþtWDMWHVLQDVOHGXM~FXNDSLWROXDULD
WHVDXYHGHQêPLSRN\QPL
6SRWUHELþY{EHFQHIXQJXMH"
6NRQWUROXMWHþL
-
MHVSRWUHELþ]DSRMHQêGRHOHNWULFNHMVLHWH
MH]iVWUþND]DVXQXWiY]iVXYNH
YSUtSDGHSRWUHE\Y\PH
WHSRLVWNXY]iVWUþNH]DQRY~VURYQDNêPLSDUDPHWUDPLDVNRQWUROXMWHþLMH]iVWUþNDVSUiYQH
pripojená ku káblu;
-
MH]DSQXWêVStQDþ]iVXYN\DOHERHOHNWULFNpKRREYRGX
sú v poriadku poistky domácej elektrickej inštalácie;
neide o prerušenie dodávky elektrického prúdu;
$NVDSRLVWN\Y\SiOLDYLDFNUiW]DVHERXREUi WHVDQDNYDOLILNRYDQpKRHOHNWURLQãWDODWpUD
Mikrovlnná rúra nepracuje?
6NRQWUROXMWHþL
-
sú dvierka dobre zatvorené;
na dvierkach nie sú zachytené zvyšky pokrmov alebo iné predmety;
V~WHVQHQLDGYLHURNGRNRQDOHþLVWp
VWHVSUiYQHQDVWDYLOLYãHWN\RYOiGDþH
$N YiP XYHGHQp SRN\Q\ QHSRP{åX D SRUXFKD SUHWUYiYD DM QD
DOHM REUi WH VD QD DXWRUL]RYDQp VHUYLVQp VWUHGLVNR =R]QDP
DXWRUL]RYDQêFKVHUYLVQêFKVWUHGtVNMHSULORåHQê
.RPSHWHQWQêVHUYLVQêFKWHFKQLNEXGHRGYiVSRåDGRYD QDVOHGXM~FH~GDMH
1.
2.
3.
4.
5.
0HQRDGUHVXD36ý
7HOHIyQQHþtVOR
6WUXþQêSRSLVSRUXFK\
0RGHODVpULRYpþtVOR
Dátum kúpy
7LHWR ~GDMH XPRåQLD SUDFRYQtNRP VHUYLVX SULSUDYL VSUiYQH QiKUDGQp GLHO\ 9\KQHWH VD WDN RSDNRYDQHM QiYãWHYH VHUYLVQêFK
technikov a ušetríte.
0RGHODYêUREQpþtVORQiMGHWHQD W\SRYRP ãWtWNX VSRWUHELþD 'RSRUXþXMHPH ]DStVD VL LFK GR QDVOHGXM~FHKR ]R]QDPX DE\ VWH
uke:
LFKPDOLYåG\SRU
Model:
ZM17ML
9êUREQpþtVORBBBBBBBBBBBBBBBBBBBBBB
Dátum kúpy: ._______________________
i
$NVD]iYDGDY\VN\WODSRþDV]iUXþQHMGRE\WUHEDVLSULFK\VWD DMGRNODGRN~SHVSRWUHE þD
6OXåE\VHUYLVQpKRVWUHGLVNDSRþDV]iUXþQHMGRE\QHEXG~EH]SODWQpDNVDMHGQiRQHRSR
VS{VREHQ~QHVSUiYQ\PSRXåLWtPVSRWUHELþD3UHWRVDG{VOHGQHULD
dstatnenú reklamáciu alebo poruchu,
WHSRN\QPLYWHMWRSUtUXþNH
Náhradné diely
1iKUDGQp GLHO\ PDM~ N GLVSR]tFLL YêOXþQH DXW
orizované servisné strediská a zákaznícke centrum. V prípade poruchy sa preto
YåG\REUi WHQDDXWRUL]RYDQpVHUYLVQpVWUHGLVNR3UtVOXãQê]R]QDPMHSULORåHQê
Záruka
Zanussi Slovakia, divízia Domáce spotUHELþH SRVN\WXMH QD YêUREN\ URþQ~ ]iUXNX 9LDF LQIRUPiFLt R ]iUXNH QiMGHWH QD
SULORåHQRP]iUXþQRPOLVWH
14
Q
ZM17ML
&RQ LQXW
Inainte de a util iza cuptorul cu microu nde
6LJXUDQ DvQXWLOL]DUH,QVWUXF LXQL
±*KLGXOXVWHQVLOHORUúLDFFHVRULLORUFXSWRUXOXL
4
5
5
6
Date tehnice
6
3XQHUHDvQIXQF LXQH
7
7
±6LJXUDQ
vQXWLOL]DUHDJU
±7HVWDUHDFRPSDWLELOLW
±6LJXUDQ DPkQF
WDUXOXL,QVWUXF LXQL
LLYDVHORU
ULL
– Despachetarea
Instalare
7
7
7
±&RQHFWDUHDODUH HD
– Conexiuni electrice
&XPV
XWLOL]H]LFXSWRUXOW
±1XPHOHúLUROXOS
XFXPLFURXQGH
U LORUFRPSRQHQWH
– Instalarea platanului
±7DEORXOGHFRPDQG
±*
WLWXOFXPLFURXQGH
±*KLGXOVHW
ULLHQHUJLHLHOHFWULFHSHQWUXFXSWRUXOFXPLFURXQGH
±,QVWUXF LXQLGHGHFRQJHODUHXWLOL]kQG
– Sugestii pentru utilizarea cuptorului cu microunde
±,QJULMLUHúLFXU
DUH
±&XU
DUHDDFFHVRULLORUSODWDQúLVXSRUW
±&XU
LUHDLQWHULRUXOXL
±&XU
LUHDH[WHULRUXOXL
6HUYLFHúLSLHVHGHUH]HUY
8
8
8
9
10
10
11
12
13
13
13
13
14
15
&RQGL LLGHJDUDQ LH
3
Q
ZM17ML
6WLPD L&OLHQ L
9 PXO XPLPF D LDOHVXQSURGXV=DQXVVL6XQWHPFRQYLQúLF YH LDMXQJHODFRQFOX]LDF QRXOGYRDVWU FXSWRU
FXPLFURXQGHY HVWHH[WUHPGHXWLOúLGHPDUHDMXWRU&DúLvQFD]XODOWRUDSDUDWHGHEXF W ULHYH LDYHDQHYRLHGH
WLPSSHQWUXDY IDPLOLDUL]DFXWRDWHIXQF LXQLOHúLFDUDFWHULVWLFLOHOXLGDUWUHSWDWFXSWRUXOYDGHYHQLXQDFFHVRULX
LQGLVSHQVDELOSHQWUXEXF W ULDGYRDVWU Înainte de a utiliza Cuptorul cu Microunde
&LWL LFXDWHQ LHLQVWUXF LXQLOHúLXUPD LWRDWHUHFRPDQG ULOHGDWHHOHDXIRVWFRQFHSXWHSHQWUXDY GDSRVLELOLWDWHD
V RE LQH LXQUDQGDPHQWPD[LPGHODFXSWRUXOFXPLFURXQGH=DQXVVLUHFHQWDFKL]L LRQDW(VWHLPSRUWDQWV S VWUD L
PDQXDOXOFXLQVWUXF LXQLSHQWUXDSXWHDILFRQVXOWDWúLvQYLLWRU'DF YLQGH LVDXvQVWU LQD LDSDUDWXOVDXGDF Y
PXWD LODVkQGXOODYHFKHDORFXLQ
DVLJXUD LY F QRXOSURSULHWDUSULPHúWHPDQXDOXORGDW FXFXSWRUXODYkQG
DVWIHOSRVLELOLWDWHDV FXQRDVF PRGXOOXLGHIXQF LRQDUHúLSULQFLSDOHOHSUHFDX LLFDUHWUHEXLHXUPDWHSHSHULRDGD
XWLOL] ULLVDOH
I6LJXUDQ DXWLOL] ULLLQVWUXF LXQL
•
,QWUHUXS WRDUHOHGHVLJXUDQ
FXSODWHúLvQFRUSRUDWH
vPSLHGLF FXSWRUXOFXPLFURXQGHV IXQF LRQH]H
•
FkQGXúDHVWHGHVFKLV •
HDGHVFULV vQPDQXDO1XXWLOL]D LFKLPLFDOHFRUR]LYH
1XY DWLQJH LGHvQWUHUXS WRDUHVDXQXvQFHUFD LV
vQDFHVWFXSWRUFRQFHSXWSHQWUXDvQF O]LJ WLVDX
SXQH LvQIXQF LXQHFXSWRUXOFkQGXúDHVWHGHVFKLV
decongela preparatele culinare. El nu a fost proiectat
pentru utilizare
vQWUXFkWRSHUDUHDOXLFXXúDGHVFKLV Y SRDWH
•
expune energiei microundelor.
LQGXVWULDO VDXvQODERUDWRUúLQLFLSHQWUXXQD
1XO VD LFDVWURSLLGHPkQFDUHLPSU úWLD LVDX
FRPHUFLDO vQWUXFkWDFHVWOXFUXDULQYDOLGDJDUDQ LD
•
VFDPHOHO VDWHGHODYHW V VHDFXPXOH]HSH
&XU
LUHúL,QJULMLUHSHQWUXLQVWUXF LXQLOHGHFXU
energia microundelor, tubul magnetronului se poate
deteriora.
LUH
1XSXQH LvQIXQF LXQHFXSWRUXOGDF HVWHGHIHFW
SkQ FkQGQXHVWHUHSDUDWGHXQSHUVRQDOFDOLILFDW
•
(VWHGHRVHELWGHLPSRUWDQWFDXúDFXSWRUXOXLV VH
vQFKLG FRPSOHWúLFDXúDRQGXO UL
EDODPDOHOHúL] YRDUHOHVWULFDWHVDXQHVLJXUH
HWDQú ULOHXúLORUúLVXSUDIH HOHGHHWDQúDUHVXV QX
•
•
•
1XvQFHUFD LV XVFD LKDLQHVDX]LDUHvQFXSWRU
Aceste articole se pot aprinde.
6XEQLFLXQSUHWH[WVDQXvQFHUFD LV UHSDUD L
•
1XXWLOL]D LVSD LXOJROGLQLQWHULRUXOFXSWRUXOXLSHQWUX
FXSWRUXOSULQIRU HSURSULL5HSDUD LLOHHIHFWXDWHGH
DVWRFDSURGXVH1XO VD LEXF
SHUVRDQHI U H[SHULHQ
GHEXF W ULHVDXDOLPHQWHvQLQWHULRUXOFXSWRUXOXL
SRWSURYRFDDFFLGHQWHVDX
când acesta nu este utilizat.
&RQWDFWD L$WHOLHUXOGH6HUYLFHGLQORFDOLWDWH
1XGLVORFD LFDUFDVDH[WHULRDU XúDVDXWDEORXOGH
FRPDQG vQWUXFkWY H[SXQH LXQXLYROWDMH[WUHPGH
înalt.
•
1XS VWUD LDFHVWDSDUDWvQH[WHULRU1XOIRORVL LvQ
apropierea apei.
IXQF LRQDUHDQHFRUHVSXQ] WRDUHDDSDUDWXOXL
•
(VWHQHYRLHGHRVXSUDYHJKHUHDWHQW DFXSWRUXOXL
când este utilizat de copii.
SUH]LQWHGHIHF LXQL
•
1XSXQH LFXSWRUXOvQIXQF LXQHFkQGHVWHJRO'DF
HOQXFRQ LQHDOLPHQWHVDXDS FDUHV DEVRDUE
VXSUDIH HOHL]RODWRDUHDOHXúLL9H]LVHF LXQHD
•
8WLOL]D LDSDUDWXOSHQWUXGHVWLQD LDOXLDúDFXPHVWH
,QVWDOD LVDXSR]L LRQD LDFHVWFXSWRUvQFRQIRUPLWDWH
cu
“INSTRUCTIUNILE DE INSTALARE” pe care le
J VL LvQPDQXDO
4
LGHKkUWLHXVWHQVLOH
Q
ZM17ML
7HVWDUHDFRPSDWLELOLW
LLYHVHOHLXWLOL]DWH
6LJXUDQ DDOLPHQWHORU
ODJ WLW
•
3XQH LXQYDVGHJ WLWvQFDYLWDWHvPSUHXQ FXXQ
•
SDKDUSHMXP WDWHSOLQFXDS $F LRQD LFXSWRUXOOD
:WLPSGHXQPLQXW'DF YDVXOVD
vQILHUEkQWDWQXWUHEXLHIRORVLW'DF VDvQF O]LWXúRU
•
ILFRQWURODW H[LVWkQGULVFXODSDUL LHLXQRUVLWXD LL
J WLW'DF DU PDVODWHPSHUDWXUDvQF SHULLSRDWHIL
•
6HUYH HOHOHGHKkUWLHK UWLDGHSDUDILQ IDUIXULLOH
neprevazute.
•
GHVHPQDWHvQDFHVWVFRS$FHDVW RSHUD LHGH
VXQWXVWHQVLOHH[WUHPGHXWLOH$VLJXUD LY
FDUHV DEVRDUE HQHUJLDHYLWkQGDVWIHOSRVLELOLWDWHD
SUHSDUDWHQXWUHEXLHO VDW QHVXSUDYHJKHDW •
FU SDUHDORU0HUHOHFDUWRILLILF
0XOWHWLSXULGHIDUIXULLGHSODVWLFFHúWLUHFLSLHQWH
1XO VD LFXSWRUXOQHVXSUDYHJKLDWúLXLWD LY ODHO
GLQWLPSvQWLPSDWXQFLFkQGvQF O]L LVDXJ WL L
mâncare în plastic, hârtie sau alte recipiente
FRPEXVWLELOH'DF REVHUYD LIXP LQH LXúDvQFKLV
úLRSUL LVDXGHFRQHFWD LFXSWRUXOSkQ ODRSULUHD
fumului.
•
WUHEXLHvQ HSDWH
ATENTIE: &kQGvQF
O]L LOLFKLGHH[VXSHVDXE XWXULvQ
FXSWRUXOFXPLFURXQGHVXSUDvQF O]LUHDOLFKLGXOXLGLQFROR
GHSXQFWXOGHILHUEHUHSRDWHDYHDORFI U EDUERWDUH
ceea ce poate duce la darea în clocot a lichidului
ILHUELQWH3HQWUXDvPSLHGLFDDFHDVW SRVLELOLWDWHHVWH
ELQHV XUPD LSDúLLXUP WRUL
8VWHQVLOHOHPHWDOLFHúLXVWHQVLOHOHFXPDUJLQL
1.
(YLWD LIRORVLUHDUHFLSLHQWHORUFXSHUH LLGUHS LúL
2.
3.
1XVXSUDvQF O]L L
JkWXOVXE LUH
metalice nu ar trebui introduse în cuptorul cu
PLFURXQGHGDF QXVXQWUHFRPDQGDWHVSHFLDOvQ
•
HLLGHSXLúL
J OEHQXúXULOHGHRXVXQWH[HPSOHGHSURGXVHFDUH
SHQWUXSURGXVHFRQJHODWHúLDPEDODMHGLQSODVWLFSRW
fi utilizate în cuptorul cu microunde.
,Q HSD LDOLPHQWHOHFXVXSUDIH HVDXPHPEUDQH
QHSRURDVHSHQWUXDvPSLHGLFDDFXPXODUHDGHDEXUúL
VXSUDvQF O]LULL
•
3XWH LSUHJ WLSRSFRUQvQFXSWRUXOFXPLFURXQGH
vQV GRDUvQSDFKHWHVDXXVWHQVLOHVSHFLDO
FHúWLOHFDUWRDQHOHDPEDODMHOHGHSURGXVHFRQJHODWH
vQWRWGHDXQDF UHFLSLHQWHOHVXQWSOLQHFXDOLPHQWH
1XSU ML LFDUQHIRDUWHJUDV vQFXSWRUXOFX
PLFURXQGHvQWUXFkWWHPSHUDWXUDJU VLPLORUQXSRDWH
SRDWHILXWLOL]DWODUHvQF O]LUHDPkQF ULLGDUQXúLOD
IRORVLWODJ WLWXOFXPLFURXQGH
1XvQF O]L LPkQFDUHvQF QL7UDQVIHUD L
întotdeauna alimentele în recipiente potrivite.
acest sens.
Recipientele cu deschideri mici, de exemplu sticlele,
$JLWD LOLFKLGXOvQDLQWHGHDLQWURGXFHUHFLSLHQWXO
vQFXSWRUúLvQF RGDW ODMXP WDWHDWLPSXOXL
DIHFWDWvQF O]LULL
QXWUHEXLHXWLOL]DWHODJ WLWXOFXPLFURXQGH)L L
4.
SUHFDX LFkQGvQGHS UWD LFDSDFXOXQHLIDUIXULLSHQWUX
'XS vQF O]LUHO VD LOLFKLGXOvQFXSWRUR
SHULRDGDVFXUW GHWLPSDPHVWHFkQGXOFXJULM
a evita arsurile provocate de aburi.
înainte de a scoate recipientul.
•
8QHOHSURGXVHFXPDUILRX OHvQWUHJLVDX
UHFLSLHQWHOHVLJLODWH±GHH[HPSOXERUFDQHOHGHVWLFO
FXFDSDF±SRWH[SORGDúLQXDUWUHEXLvQF O]LWHvQ
cuptorul cu microunde. Ocazional, ochiurile pot
H[SORGDvQWLPSXOJ WLULL,Q HSD LvQWRWGHDXQD
J OEHQXúXODSRLDFRSHUL LOHúLO VD LOHDúDXQPLQXW
vQDLQWHGHDvQGHS UWDFDSDFXO
127
•
1XIRU D LURWLUHDPDQXDO DSODWDQXOXL$FHVWOXFUX
•
aparatului.
Formarea unui arc electric în cuptor atunci când
SRDWHGXFHODIXQF LRQDUHDQHFRUHVSXQ] WRDUHD
PLFURXQGHOHVXQWvQVWDUHGHIXQF LXQHVHGDWRUHD]
XWLOL] ULLXVWHQVLOHORUPHWDOLFH7RWXúLIRUPDUHD
FRQWLQX DDFHVWRUDUFXULSRDWHGHWHULRUDDSDUDWXO
2SUL LSURJUDPXOúLYHULILFD LXVWHQVLOD
•
7UHEXLHV HYLWD LREWXUDUHDRULILFLLORUGHDHULVLUH
SODVDWHvQS U LOHGHVXVGLQVSDWHODWHUDOHúLGHMRV
ale cuptorului.
1XIRORVL LDFHVWFXSWRUvQVFRSXULFRPHUFLDOH
Acest cuptor a fost proiectat doar pentru uz casnic.
3 VWUD LDFHVWHLQVWUXF LXQL
5
Q
ZM17ML
*KLGXOXVWHQVLOHORUúLDFFHVRULLORUFXSWRUXOXL
3HQWUXDJ WLvQFXSWRUXOFXPLFURXQGHSRWILXWLOL]DWHPDLPXOWHWLSXULGHXVWHQVLOHúLPDWHULDOH3HQWUXVLJXUDQ DG
YRDVWU úLSHQWUXDSUHYHQLGHWHULRUDUHDXVWHQVLOHORUúLDFXSWRUXOXLDOHJH LXVWHQVLOHúLPDWHULDOHSRWULYLWHSHQWUX
ILHFDUHPHWRG GHJ WLW
Lista de mai jos este un ghid general.
Materiale
Mod de operare
Microunde
DA
DA*1
Ustensile
Corning ware
6WLFO UH]LVWHQW ODF OGXU
&HUDPLF 9DVHGHVWLFO FXGHFRUD LLGHPHWDO
NU
Sticla de cristal plumbuit
NU
3RU HODQXULI U GHFRUD LLGHPHWDO
DA
Materiale
plastice
Cuptorul de microunde
DA
DA
Ambalaje din materiale plastice
DA
Metal
7LJDLHPHWDOLF SHQWUXFRSW
NU
Folie de alumuniu*3
DA
DA
DA
NU
NU
DA
DA
6WLFO
Portelan
&HUDPLF Hârtie
&HúWLIDUIXULLúHUYHWH
+ UWLHFHUXLW
Lemn
*ULODMJU WDU
Platan
Suport platan
Accesorii
'$8VWHQVLOHúLDFFHVRULLXWLOL]DELOH
188VWHQVLOHúLDFFHVVRULLGHHYLWDW
'RDUGDF QXDXPDUJLQHPHWDOLF 'RDUGDF QXDUHHPDLOFDUHFRQ LQHPHWDO
127$8WLOL]D LIROLHGHDOXPLQLXGRDUvQVFRSXULGHSURWHF LHVXSUDXWLOL]DUHDSRDWHFUHDDUFXULHOHFWULFH
Date tehnice
Dimensiuni generale
Greutate 14 kg
Volum 17 Litri
/ WLPHPP
6XUV GHHQHUJLH9+]
Adâncime 368 mm
6LJXUDQ
$
,Q O LPHPP
'LPHQVLXQHD&DYLW
Consum energie
Microunde 1200W
LL
LPHPP
(QHUJLHIXUQL]DW
Adâncime 282 mm
Microunde 700W
/
,Q O LPHPP
6
Q
ZM17ML
3XQHUHDvQIXQF LXQH
Despachetare
&RQHFWDUHDODUH HD
1%& QGGHVSDFKHWD LFXSWRUXOYHULILFD LGDF
&XSWRUXOHVWHOLYUDWvPSUHXQ FXXQFDEOXHOHFWULFúLR
DSDUDWXOQXHVWHGHWHULRUDW'HWHULRU ULOHVDXRULFH
fisa de contact pentru o priza cu impamantare de
S U LOLSV WUHEXLHLPHGLDWUDSRUWDWHGHWDLOLVWXOXL
9+]3URWHF LDRIHULW GHvPS PkQWDUH
&XSWRUXOS U LFRPSRQHQWHDOHFXSWRUXOXLVDX
PLQLPDOL]HD] ULVFXULOHvQFD]XOXQXLVFXUWFLUFXLW
accesoriile ar putea fi protejate de o folie ce trebuie
9HULILFD LGDF YROWDMXOFRUHVSXQGHDOLPHQW ULL
vQGHS UWDW vQDLQWHGHDXWLOL]DFXSWRUXO1X
1%'DF FXSWRUXOHVWHFRQHFWDWODSUL] SULQWUXQ
DEDQGRQD LDPEDODMHOHFDUHDUSXWHDF GHDvQPkQD
SUHOXQJLWRUYHULILFD LGDF FDEOXOGHSUHOXQJLUHHVWH
copiilor. Acest lucru poate provoca accidente.
vPS PkQWDW
Instalare
ATENTIE! Acest aparat nu trebuie alimentat de la o
VXUV GHHQHUJLHQHvPS
PkQWDW $SHOD LODXQ
,QGHS UWD LRULFHHWLFKHW SURPR LRQDO GHSHXú HOHFWULFLDQSHQWUXRULFHSUREOHP UHIHULWRDUHOD
,QVWDOD LFXSWRUXOSHRVXSUDID
FRQHFWDUHDHOHFWULF DFXSWRUXOXLVDXODDVLJXUDUHD
SODW 6XSUDID
SURWHF LHLSULQvPS PkQWDUHDIXUQL] ULLGHFXUHQW
WUHEXLHV ILHVXILFLHQWGHUH]LVWHQW SHQWUXDVXSRUWD
I U SUREOHPHJUHXWDWHDFXSWRUXOXLNJúL
FRQ LQXWXOXOWHULRUDODFHVWXLD3HQWUXDHYLWD
$FHVWDSDUDWWUHEXLHvPS PkQWDW'DF HOHVWH
SRVLELOLWDWHDSURGXFHULLGHYLEUD LLVDX]JRPRWH
SUHY ]XWFXRILVDGHFRQWDFWQHUHFDEODELO SHQWUX
FXSWRUXOWUHEXLHV ILHvQWURSR]L LHVWDELO FDUHSUL]DGYRDVWU HVWHQHSRWULYLW ILVDWUHEXLH
$úH]D LFXSWRUXOGHSDUWHGHVXUVHGHF OGXU úL
W LDW úLFXSWRUXOSUHY ]XWFXRILVDFRUHVSXQ] WRDUH
DS ([SXQHUHDODF OGXU úLXPH]HDO SRDWHUHGXFH
'DF VLJXUDQ DGLQWURILVDQHUHFDEODELO WUHEXLH
HILFLHQ DúLUDQGDPHQWXODúDF LQVWDOD LFXSWRUXO
VFKLPEDW vQYHOLúXOVLJXUDQ HLWUHEXLHUHDMXVWDW'DF
GHSDUWHGHVXUVHOHPHQ LRQDWH
vQYHOLúXOHVWHSLHUGXWVDXGHWHULRUDWILVDQXWUHEXLH
1XEORFD LRULILFLLOHGHYHQWLOD LHGLQS U LOHGHVXVúL
XWLOL]DW SkQ FkQGDFHVWLQYHOLúQXHVWHvQORFXLW
ODWHUDOHDOHFXSWRUXOXLúLQXSXQH LRELHFWHSHFXSWRU
Conexiuni electrice
'DF RULILFLLOHGHDHULVLUHVXQWEORFDWHvQWLPSXO
IXQF LRQ
ULLFXSWRUXOVHSRDWHVXSUDvQF O]LFHHDFH
SRDWHGXFHODXQUDQGDPHQWQHFRUHVSXQ] WRUDO
Acest aparat este livrat echipat cu o fisa euro
DSDUDWXOXL$HUXOILHUELQWHLHVHSULQDFHVWHRULILFLLúLLQ
VWDQGDUGFXúWLIWXUL
FRQVHFLQWDDVLJXUD LY F QXOHREWXUD LVDXF QX
H[LVW HFUDQ ULvQWUHFXSWRUúLSHUHWHOHGLQVSDWH
ATENTIE! ACEST APARAT TREBUIE
$úH]D LFXSWRUXOF WPDLGHSDUWHSRVLELOGHDSDUDWH
Ì03
GHUDGLRúLWHOHYL]RDUH$FHVWDSDUDWVHFRQIRUPHD]
0Æ17$7
3URGXF WRUXOvúLGHFOLQ RULFHUHVSRQVDELOLWDWH
FHULQ HORU&((UHIHULWRDUHODVXSULPDUHD
GDF DFHDVW P VXU GHVLJXUDQ
LQWHUIHUHQ HORUUDGLRGDUXQHOHLQWHUIHUHQ HSRWDSDUH
QXHVWHOXDW
în considerare.
GDF DSDUDWXOHVWHSODVDWSUHDDSURDSHGHUDGLRVDX
televizor.
•
'DF DúH]D LFXSWRUXOvQWUXQFRO O VD LXQVSD LX
·'DF
ILVDFXFDUHHVWHHFKLSDWDSDUDWXOQX
GHFHOSX LQFPÌQWUHDSDUDWúLSHUHWHGLQPRWLYH
HVWHSRWULYLW SHQWUXSUL]DGHFDUHGLVSXQH L
GHYHQWLOD LH
HDWUHEXLHW LDW VLvQORFXLW FXXQDSRWULYLW Important! Cuptorul poate fi plasat aproape oriunde în
EXF W ULH$VLJXUD LY F HVWHDúH]DWSHRVXSUDID
,QGHS UWD LVLJXUDQ DGLQILVDvQORFXLW )LVDvQORFXLW
SODW úLF RULILFLLOHGHYHQWLOD LHúLVXSUDID DGHVXE
WUHEXLHDUXQFDW SHQWUXDSUHYHQLFXUHQW ULOHFDUHV
FXSWRUQXVXQWEORFDWHSHQWUXDVHRE LQHRYHQWLOD LH
DUSURGXFHGDF GLQvQWkPSODUHDUILLQWURGXV vQWUR
VXILFLHQW SUL]DvQDOW SDUWHDFDVHL
$FHVWDSDUDWVHFRQIRUPHD] FHULQ HORU'LUHFWLYHL
&((UHIHULWRDUHOD,QWHUIHUHQ HOH5DGLR
7
Q
ZM17ML
* WLWXOODPLFURXQGH
1
3
2
5
4
8
4
6
7
1XPHOHúLIXQF LDS
&XPV
U LORUFRPSRQHQWHDOH
XWLOL]D LFXSWRUXOFXPLFURXQGH
platanului
1&RPSDUWLPHQWXOSHQWUXJ
WLW&XU
1.3XQH LVXSRUWXOSODWDQXOXLvQFDYLWDWH
D LFRPSDUWLPHQWXO
FXRFkUS GXS XWLOL]DUHDFXSWRUXOXL
2.3XQH LSODWDQXOSHVXSRUWDúDFXPHVWHDU
WDWvQ
2.)HUHDVWUDVSUHLQWHULRU0kQFDUHDSRDWHILREVHUYDW
GLDJUDP $VLJXUD LY F EXWXFXOHVWHELQHIL[DWvQD[XO
vQWLPSFHFXSWRUXOHVWHvQIXQF LXQH
platanului. 1XDúH]D
jos.
3.8úDFXSWRUXOXL8úDWUHEXLHvQWRWGHDXQDvQFKLV
ELQH
vQWLPSXOJ WLWXOXL
4.&kUOLJXO]
$WkWSODWDQXOFkWúLVXSRUWXOWUHEXLHIRORVLWHvQ
YRUXOXLúLVLVWHPXOGHEORFDUHGHVLJXUDQ
5.7DEORXOGHFRPDQG
LQLFLRGDW SODWDQXOFXID DvQ
SHUPDQHQ
vQWLPSXOJ WLWXOXL
$WkWPkQFDUHDFkWúLUHFLSLHQWHOHYRUILSXVHSHSODWDQ
vQWLPSXOJ WLWXOXL
6. 6XSRUWSODWDQ3XQH LVXSRUWXOvQFDPHUDGHJ
WLWúL
3ODWDQXOVHURWHúWHDWkWvQVHQVXODFHORUGHFHDVRUQLF
DúH]D LSODWDQXOSHHO
FkWúLLQYHUV$FHVWOXFUXHVWHQRUPDO
0kQFDUHDDIODW vQWUXQUHFLSLHQWHVWHSXV SHDFHDVW
WDY SHQWUXDILJ WLW 1XIRORVL LFXSWRUXOI U SODWDQ
7.3ODWDQXO5HDOL]DWGLQWURVWLFO
Platan
VSHFLDO UH]LVWHQW OD
F OGXU Suport rotativ
0kQFDUHDDIODW vQWUXQUHFLSLHQWHVWHSXV SHDFHDVW
WDY SHQWUXDILJ WLW 1XIRORVL LFXSWRUXOI U SODWDQ
8. Axul de transmisie pentru platan
Axul platanului
8
Q
ZM17ML
7DEORXOGHFRPDQG
1. Selectorul de putere
$F LRQD LDFHVWEXWRQSHQWUXDDOHJHQLYHOXOGHSXWHUHFRUHFW
SHQWUXPkQFDUHDGRULW 2. Cronometror
)L[D LOODWLPSXOGRULWSHQWUXJ WLW2SHUD LDGHJ WLWvQFHSH
Toate cronometroarele cu mecanism de ceasornic
DF LRQHD] PDLSUHFLVGDF VXQWIL[DWHODPDLPXOWGHFkW
WLPSXOGRULWúLDSRLUHYHQL LODFHOLQL LDOVWDELOLW
9
Q
ZM17ML
* WLWXOODPLFURXQGH
1.
2.
3.
'HVFKLGH LXúDSXQH LPkQFDUHDSHSODWDQ
&XSWRUXOvQFHSHV J WHDVF ,QFKLGH LXúD
&DQGSHULRDGDGHJ WLWHVWHIL[DW ODPDLSX LQGH
)L[D LVHOHFWRUXOGHSXWHUHODSXWHUHDGRULW 9H]L
PLQXWHIL[D LFURQRPHWURUXOODPDLPXOWGHPLQXWHúL
tabelul de mai jos)
DSRLUHYHQL LODWLPSXOGRULW
)L[D LFURQRPHWURUXOODWLPSXOGRULW
3HQWUXDRSULFXSWRUXOvQWLPSXOJ WLWXOXLSXUúLVLPSOX
vQWRDUFH LFURQRPHWURUXOODSR]LWLD
1RW 'XS XWLOL]DUHYHULILFD LGDF D LvQWRUV
FURQRPHWURUXOODSHQWUXF vQFD]FRQWUDU
FXSWRUXOYDFRQWLQXDV IXQF LRQH]H
([DPSOX3HQWUXDJ WLOD:WLPSGHGHPLQXWH
1.
)L[D LVHOHFWRUXOGHSXWHUHOD:
2.
)L[D LFURQRPHWURUXOOD¶
3.
&XSWRUXOYDvQFHSHDXWRPDWV J WHDVF WLPSGHPLQXWHOD:
5HvQF O]LUHDPkQF UXULORUJ WLWHLQVXILFLHQWGHILHUELQ L
•
7LPSXOSURSXVGHSURGXF WRUSHQWUXJ WLUHDXQXLIHOGHPkQFDUHHVWHGRDURULHQWDWLY'DF GXS H[SLUDUHD
WLPSXOXLSURSXVPkQFDUHDQXHVWHH[WUHPGHILHUELQWHLQWURGXFH LRvQDSRLvQFXSWRUúLO VD LRDFRORSkQ YD
DMXQJHODWHPSHUDWXUDFRUHVSXQ] WRDUH$FHVWPRGGHDSURFHGDQXGLIHU GHJ WLWXOvQFXSWRDUHOHFODVLFH
•
•
$PHVWHFD LPkQFDUHDvQPRGUHJXODWPDLDOHVVRVXULOH
7LPSXOGHVWD LRQDUHFkQGPkQFDUHDHVWHO VDW vQFXSWRUvQF RSHULRDG GXS RSULUHDDFHVWXLDHVWHIRDUWH
LPSRUWDQWHVWHSDUWHLQWHJUDQW DJ WLWXOXLúLSHUPLWHDWLQJHUHDXQHLWHPSHUDWXULHJDOHvQvQWUHDJDPkQFDUH
Ghid pentru setarea puterii microundelor
Fixarea Puterii
5HFRPDQG ULGHXWLOL]DUH
120W
,QF O]LUH,QF O]LUHDPkQF ULL
(230W)
350W
540W
700W
'HFRQJHODUH'H]JKH DUHDPkQF UXULORUFRQJHODWH
0HGLX'HFRQJHODUHPDLUDSLG úLUHvQF O]LUHSHQWUXPXVDFDOHúLJKLYHFLXUL
0HGLX/DZVHFRFSU MLWXULúLSXGGLQJULELVFXLWVHUHvQF O]HVFDOLPHQWHJ WLWHvQ
SUHDODELOVHSU MHúWHFDUQHDGHSRUFYLW úLSXL
6HILHUEVDXVHUHvQF O]HVFOLFKLGH6H3UHSDU OHJXPH6HSUHvQF O]HVFPkQF UXULOH
rumenite.
10
Q
ZM17ML
5HFRPDQG ULSHQWUXXWLOL]DUHDGHFRQJHO ULL
8QHOHDOLPHQWHGHH[HPSOXSkLQHDúLIUXFWHOHSRWILGHFRQJHODWHPDQXDOXWLOL]kQGVHW ULOHGHSXWHUH
ALIMENTE
TIMP de
STATIONARE
PREPARARE
Pâine
3XQH LIUDQ]HODSHVXSRUWXOGHVLJXUDQ
)UDQ]HO PLF
DO
FXSWRUXOXLVDXSHXQúHUYH HOGHEXF W ULH
,QWRDUFH LIUDQ]HODODMXP WDWHDWLPSXOXLGH
8-10 min.
10-15 min.
10-13 min.
10 min.
decongelare
3XQH LIUDQ]HODSHVXSRUWXOGHVLJXUDQ
)UDQ]HO PDUHIHOLDW
VDXSHXQ
úHUYH HOGHEXF W ULH,QWRDUFH LIUDQ]HODOD
MXP WDWHDWLPSXOXLGHGHFRQJHODUH
2 felii
3XQH LOHSHXQúHUYH HOGHEXF W ULH
45–60 sec.
5 min.
FKLIO GHSkLQH
3XQH LFKLIODSHXQúHUYH HOGHEXF W ULH
45–60 sec.
5 min.
2 chifle de pâine
3XQH LFKLIOHOHSHúHUYH HOHGHEXF W ULH
1–11/2 min.
5 min.
6FRDWH LSU MLWXUDGLQDPEDODMúLSXQH LRSHIDUIXULH
9-11 min.
15–30 min.
6FRDWH LSU MLWXUDGLQDPEDODMúLSXQH LRSHIDUIXULH
9–11 min.
15–30 min.
7– 9 min.
15–30 min.
7– 9 min.
15–30 min.
3– 4 min.
5–10 min.
3U MLWXULúLSURGXVHGHSDWLVHULH
3U MLWXU JOE
3U MLWXU FXEUkQ]
450g/1 lb
3O FLQW JDWD
6FRDWH LSO FLQWDGLQDPEDODMúLSXQH LRSH
SUHSDUDW JOE
farfurie.
Produse de patiserie
450g/1 lb
Unt
250g/8.8 oz (1 pachet)
6FRDWH LSURGXVHOHGLQDPEDODMúLSXQH LOHSH
farfurie.
'DF HVWHDPEDODWVFRDWH LXQWXOGLQDPEDODMúL
SXQH LOSHRIDUIXULH
Fructe
225g/8 oz Fructe boabe
moi.
3XQH LOHSHXQVLQJXUVWUDWvQWURIDUIXULHvQWLQV 5– 6 min.
5–10 min.
450g/1 lb Fructe boabe
moi
3XQH LOHSHXQVLQJXUVWUDWvQWURIDUIXULHvQWLQV 7– 8 min.
5–10 min.
7– 8 min
5–10 min.
0 QFDUHDFRSHULW
$FRSHUL LPkQFDUHDFXRIDUIXULHVDXFXRSHOLFXO
400g/14 oz
DGH]LY QRQ&393HQWUXDRUHvQF O]LIRORVL L
microundele 100% (700W) timp de 3–4 minute
Legume
1XHVWHQHFHVDUV GH]JKH D LOHJXPHOHvQDLQWHGH
DILJ WLWH7RDWHOHJXPHOHSRWILGH]JKH DWHúLJ WLWH
100% la (700W)
11
Q
ZM17ML
Sfaturi pentru utilizarea microundelor
Sugestii pentru utilizarea microundelor
Fluidizarea mierii
Â
Â3 VWUD LvQWRWGHDXQDFXSWRUXOFXUDW±HYLWD L
vPSU úWLHUHDVWURSLORUGHPkQFDUHúLQXXLWD LV
FXU
D LVXEWDYDGHVWLFO úLLQWHULRUXOXúLL
'DF DYH LXQERUFDQGHPLHUHFDUHVDFULVWDOL]DW
Â(VWHGHSUHIHUDWV IRORVL LFDVHUROHURWXQGHVDX
VFRDWH LFDSDFXOvQWURGXFH LERUFDQXOvQFXSWRUúL
RYDOHFXFDSDFF QGJ WL LvQFXSWRUXOFXPLFURXQGH
DF LRQD LPLFURXQGHOHODSXWHUHPHGLHWLPSGH
minute.
Â1XIRORVL LFDVHUROHGHPHWDOVDXFXGHFRUD LLGH
PHWDO$QXPLWHPDWHULDOHGHSODVWLFVHSRWWRSLúL
Topirea ciocolatei
GHIRUPDGLQFDX]DPkQF UXULORUILHUELQ L
Â
Â$FRSHUL LPkQFDUHDFkQGJ WL L)RORVL LXQFDSDF
GHVWLFO RIDUIXULHVDXXQFDUWRQUH]LVWHQWODJU VLPH
5XSH LXQEDWRQGHFLRFRODW GHJvQEXF
Â3URGXVHOHGHSDWLVHULHSkLQHDúLDOWHSURGXVH
L
S WUDWHSXQH LOHvQWURFXS úLvQF O]L LOHODSXWHUH
mare 1-2 minute amestecând bine.
DVHP Q WRDUHSRWILGHFRQJHODWHGLUHFWvQWUXQFRúGH
S LQHVDXSHXQúHUYHWGHKkUWLH
Â'DF DOLPHQWHOHvQJKH DWHVXQWvQF O]LWHvQSURSULXO
Fluidizarea sau topirea untului
Â
DPEDODMDPEDODMXOWUHEXLHGHVI FXW$PEDODMHOH
FRQ LQkQGPHWDOVDXGHFRUD LLPHWDOLFHQXWUHEXLH
Topirea ia doar câteva secunde la putere mare.
XWLOL]DWHGDF QXH[LVW UHFRPDQG ULVSHFLDOHvQDFHVW
3HQWUXIOXLGL]DUHHVWHPDLELQHV IRORVLPRSXWHUH
sens.. ,QGHS
UWD LDJUDIHOHPHWDOLFHúLOHJ WXULOHGH
PLF DPLFURXQGHORU
VkUP Â)ROLLOHGHDOXPLQLXGHGLPHQVLXQLPDLPLFLSRWIL
Â,PSURVS WDUHDVDXvQF O]LUHDSkLQLL
utilizate pentru a acoperi tipuri de carne care se pot
DUGHXúRUFXPDUILSLFLRUXúHOHGHSXL
Â$OLPHQWHOHFXFRDM VDXSLHOL
)RORVL LRSXWHUHPHGLHWLPSGHFkWHYDVHFXQGH
HJFDUWRILLVDX
FkUQD LLWUHEXLHvQ HSDWHFXRIXUFXOL
1XILHUEH LRX
Â'HFRMLUHDIDFLO DXVWXURLXOXL
în cuptorul cu microunde deoarece pot exploda.
Â3XQH LEXF
LOHPDULúLJURDVHDSURDSHGH
,QF O]L LVDXF
PDUJLQHDFDVHUROHLúLvQFHUFD LV W LD LPkQFDUHDvQ
EXF
HLGHXVWXURLODSXWHUHPDUHWLPS
GHVHFXQGH6WUkQJH LF S
LHJDOH3XQH LDOLPHQWHOHvQWRWGHDXQDvQ
kQDODXQFDS WSkQ
LHVHGLQWHDF centrul cuptorului.
Â0 QFDUHDYDILJ WLW HJDOGDF RDPHVWHFD LVDX
Sucul de fructe
Â
RvQWRDUFH LGHFkWHYDRUL
Â)L[D LvQWRWGHDXQDXQWLPSGHJ WLWPDLVFXUWGHFkW
Fructele citrice vor da mai mult suc dacâ sunt
FHOLQGLFDWvQUH HWDGYRDVWU SHQWUXDHYLWDDUGHUHD
vQF O]LWHVHFXQGHODSXWHUHPDUHvQDLQWHGHDOH
PkQF ULL&XFkWFDQWLWDWHDGHPkQFDUHHVWHPDL
stoarce.
PDUHFXDWkWHVWHQHYRLHGHPDLPXOWWLPSGHJ WLW
Â)RORVL LDS SX LQ VDXFKLDUGHORFSHQWUXOHJXPH
Â&XPVHJ WHúWHSRUULGJH
Â)RORVL LPDLSX LQHFRQGLPHQWHúLVDUHGHFkWSHQWUX
XQJ WLW³QRUPDO´
3RUULGJHXOSRDWHILJ WLWXúRUvQIDUIXULDvQFDUHHVWH
Â$VH]RQD LXOWHULRU
VHUYLWI U DPDLILQHYRLHV VS OD LWLJ LXQVXURDVH
Â$FRUGD LPkQF ULLFkWHYDPLQXWHFDWLPSGH
8UPD LUHFRPDQG ULOHSURGXF WRULORUGHDOLPHQWH
³VWD LRQDUH´GXS FHFXSWRUXODIRVWRSULWSHQWUXD
DVLJXUDXQJ WLWFRPSOHWúLHJDO
Â9HULILFD LvQWRWGHDXQDGDF WRDW PkQFDUHDHVWH
IRDUWHILHUELQWHvQDLQWHGHDILVHUYLW Â)RORVL LVXSRUWXULGHYDVHVDXP QXúLSHQWUXD
scoate mâncarea din cuptor.
12
Q
ZM17ML
,QJULMLUHúL&XU LUH
&XSWRUXOWUHEXLHPHQ LQXWvQWRWGHDXQDFXUDW5HVWXULOHGHPkQFDUHY UVDWHVDXvPSURúFDWHDWUDJHQHUJLD
PLFURXQGHORUFDUHOHYRUDUGH$FHVWOXFUXUHGXFHHILFLHQ DFXSWRUXOXLúLSRDWHSURGXFHPLURVXULQHSO FXWH1X
vQFHUFD LV UHSDUD LVDXV DGXFH LDMXVW ULXQRUS U LFRPSRQHQWHDOH5HSDUD LLOHWUHEXLHI FXWHGRDUGHXQ
tehnician calificat.
$VLJXUD LY F DSDUDWXOHVWHGHFRQHFWDWGHODVXUVDGHHOHFWULFLWDWH
vQDLQWHGHFXU
LUH
&XU LUHDDFFHVRULLORUSODWDQúLVXSRUW
&XU
L LOHFXXQGHWHUJHQWVODEGXS FHOHD LVFRVGLQFDYLWDWH6XSRUWXOSODWDQXOXLWUHEXLHPDQLSXODWFX
JULM ATENTIE: ,QWHULRUXOFXSWRUXOXLúLSODWDQXOGHYLQIRDUWHILHUELQ LDúDF
QXOHDWLQJH LLPHGLDWGXS XWLOL]DUH
&XU LUHDLQWHULRUXOXL
0HQ LQH LLQWHULRUXOFXSWRUXOXLvQWRWGHDXQDFXUDW6WHUJH LGHSXQHULOHGHPkQFDUHY UVDWHVDXvPSURúFDWHLPHGLDW
5HVWXULOHO VDWHSHSHUH LLFXSWRUXOXLSHL]ROD LDXúLLúLSHVXSUDIH HOHGHHWDQúDUHLYRUDEVRUELHQHUJLD
PLFURXQGHORUUHGXFHHILFLHQ DFXSWRUXOXLúLSRVLELOGHWHULRUDLQWHULRUXOFXSWRUXOXL)RORVL LXQGHWHUJHQWVODEOLFKLG
DS FDOG úLRFkUS PRDOHúLXVFDW SHQWUXDvQGHS UWDGHSXQHULOH
18)2/26,7,1,&,2'$7
3(51,
&85
,72$5($%5$=,9(&85
(',19$7$'(67,&/$3(1758$&85
,72$5('(&83725',1&20(5
6$8
,25,&(3$57($&837258/8,&80,&5281'(
3HQWUXDIDFLOLWDvQGHS UWDUHDGHSXQHULORUGLILFLOHILHUEH LRFHDúF GHDS vQFXSWRUWLPSGHPLQXWH
1887,/,=$7,1,&,2'$7
3(6835$)$
&8
,7(6$825,&($/7(867(16,/(3(1758$,1'(3
57$'(381(5,/('(
$&837258/8,
3HQWUXDvQGHS UWDPLURVXULOHQHSO FXWHGLQLQWHULRUXOFXSWRUXOXLILHUEH LRFHDúF GHDS FXOLQJXULGHVXFGH
O PkLHWLPSGHPLQXWH
&XU LUHDH[WHULRUXOXL
'HVFKLGH LXúDFXSWRUXOXLFkQGFRQWUROD LWDEORXOGHFRPDQG $FHVWOXFUXYDvPSLHGLFDvQWRDUFHUHDDFFLGHQWDO D
FXSWRUXOXL6XSUDIH HOHH[WHULRDUHDOHFXSWRUXOXLDUWUHEXLFXU
DWHFXXQGHWHUJHQWOLFKLGXúRUúLFXDS úLDSRL
FO WLWHFXDS FXUDW SHQWUXDvQGHS UWDH[FHVXOGHGHWHUJHQW8VFDUHDWUHEXLHI FXW FXRFkUS PRDOH6SUD\XULOH
SHQWUXFXU
LUHDIHUHVWUHORUVDXDEXF W ULLORUSRWILGHDVHPHQHDXWLOL]DWH1XIRORVL LQLFLRGDW FXU
DEUD]LYHVDXFKLPLFDOHGXUHSHQWUXDFXU
LWRDUH
DVXSUDIH HOHH[WHULRDUHDOHFXSWRUXOXL3HQWUXDSUHYHQLGHWHULRUDUHD
S U LORUOXFU WRDUHQXO VD LV LQWUHDS vQRULILFLLOHGHYHQWLOD LH
13
Q
ZM17ML
6HUYLFHúLSLHVHGHUH]HUY
'DF DSDUDWXOQXIXQF LRQHD] FRUHFWHIHFWXD LXUP WRDUHOHYHULILF ULvQDLQWHGHDFRQWDFWD6HUYLFHXOORFDO
'DF FXSWRUXOQXSRUQHúWH
Â9HULILFD LGDF DSDUDWXOHVWHFRQHFWDWODUH HD
Â9HULILFD LGDF ILúDGHFRQWDFWHVWHLQWURGXV FRPSOHW
Â'DF HFD]XOvQORFXL LUH]LVWHQ DGLQILú FXRDOWDGHDFHODúLWLSúLYHULILFD LGDF ILúDHVWHFRQHFWDW FRUHFW
Â9HULILFD LGDF RULFHFRPXWDWRUODSUL]DGLQSHUHWHVDXvQDOW SDUWHvQFLUFXLWHVWH'(6&+,6
Â9HULILFD LGDF SUL]DGLQSHUHWHIXQF LRQHD] SXQkQGvQSUL] XQDSDUDWFDUHúWL LF IXQF LRQHD] Â9HULILFD LUH]LVWHQ DGLQFXWLDGHUH]LVWHQ H
'DF PLFURXQGHOHQXIXQF LRQHD] Â6DUSXWHDFD'LVSR]LWLYXOSHQWUXVHFXULWDWHDFRSLOXOXLFXFDUHHVWHSUHY ]XWDSDUDWXOV ILIRVWVHWDWOXFUXSRVLELO
la unele modele).
Â9HULILFD LGDF FRPHQ]LOHDXIRVWVHWDWHFRUHFW
Â9HULILFD LDMXVW ULOHSURFHGXULOHFRQVXOWkQGPDQXDOXOFXLQVWUXF LXQL
Â9HULILFD LGDF XúDHVWHvQFKLV FRUHFW'DF SDUWLFXOHOHGHPkQFDUHVDXDOWHOXFUXULU PkQvQFDGUXOXúLLXúDQX
VHYDvQFKLGHFRUHFWúLFXSWRUXOQXYDIXQF LRQD
Â9HULILFD LGDF EXWRQXO67$57HVWHDFWLYDW
'DF FXSWRUXOWRWXúLQXIXQF LRQHD]
FRUHFWGXS YHULILF ULOHGHPDLVXVFRQWDFWD L6HUYLFHXO=DQXVVLORFDO
$GUHVHOHSRWILJ VLWHvQXUP WRDUHOHSDJLQLDOHDFHVWXLJKLG
IMPORTANT :
'DF FKHPD LXQWHKQLFLDQSHQWUXXQDGLQGHIHF LXQLOHGHPDLVXVVDXVDXSHQWUXDUHSDUDRGHIHF LXQH
FDX]DW GHRLQVWDODUHLQFRUHFW YH LILREOLJD LV SO WL LUHSDUD LDFKLDUGDF DSDUDWXOPDLHDWHvQJDUDQ LH
&kQGDSHOD L6HUYLFHXOYLVHYRUFHUHXUP WRDUHOHLQIRUPD LL
1XPHOHDGUHVDúLFRGXOSRúWDO
1XP UXOGHWHOHIRQ
'HWDOLLFODUHúLFRQFLVHGHVSUHGHIHF LXQH
1XP UXOPRGHOXOXL
1XP UXOVHULHL
'DWDGHFXPS UDUH
9 VI WXLPV Y QRWD LLQIRUPD LLOHGHPDLMRVSHQWUXDDYHDODvQGHPkQ LQIRUPD LLOH
1XP UXOPRGHOXOXL
1XP UXOVHULHL
'DWDFXPS U ULL
'DF DSDUDWXOHVWHvQF vQJDUDQ LHWUHEXLHV IL LVLJXULF YHULILF ULOHQHFHVDUHDXIRVWHIHFWXDWHSHQWUXF
FKHPDUHDXQXLWHKQLFLDQY FRVW GDF SUREOHPDQXHVWHGHQDWXU PHFDQLF VDXHOHFWULF 9 UXJ PV QRWD LF WUHEXLHV SUH]HQWD LGRYDGDFXPS U ULLDSDUDWXOXLFkQGFKHPD LXQWHKQLFLDQvQ
SHULRDGDGHJDUDQ LH
3LHVHGHUH]HUY
3LHVHOHGHUH]HUY SRWILFXPS UDWHSULQ6HUYLFHXO=DQXVVLGLQORFDOLWDWHDGYRDVWU 6HUYLFLXO&OLHQ L
3HQWUXWRDWHvQWUHE ULOHJHQHUDOHOHJDWHGHDSDUDWXO=DQXVVLDFKL]L LRQDWVDXSHQWUXDOWHLQIRUPD LLGHVVSUHDOWH
SURGXVH=DQXVVLFRQWDFWD L6HUYLFLXOQRVWUX&OLHQ LSULQHPDLOVDXWHOHIRQ
14
Q
ZM17ML
&RQGL LLGHJDUDQ LH
1*DUDQ LDHVWHYDODELO
GHOXQLvQFHSkQGGLQPRPHQWXOvQFDUHDSDUDWXOHVWHvQPkQDWSULPXOXLFXPS U WRU
GHWDLOLVWOXFUXFDUHWUHEXLHYHULILFDWSULQIDFWXUDGHFXPS UDUHVDXSULQWUXQGRFXPHQWVLPLODU*DUDQ LDQXDFRSHU
XWLOL]DUHDFRPHUFLDO 2.*DUDQ LDDFRSHU
WRDWHS U LOHVDXFRPSRQHQWHOHFDUHVHGHIHFWHD] GDWRULW H[HFX LHLGHIHFWXRDVHVDX
PDWHULDOXOXLGHSURDVW FDOLWDWH*DUDQ LDQXDFRSHU DSDUDWHOHDOHF URUSHUIRUPDQ HQHFRUHVSXQ] WRDUHVH
GDWRUHD] XWLOL] ULLJUHúLWHQHJOLMHQ HLLQVWDO ULLGHIHFWXRDVHPRGLILF ULORUVDXvQFHUF ULORUGHUHSDUD LLQHDXWRUL]DWH
DYDULLORUDFFLGHQWDOHXWLOL] ULLFRPHUFLDOHVDXQHREVHUY ULLUHFRPDQG ULORUVDXFHULQ HORUVWLSXODWHvQPDQXDOXOGH
LQVWUXF LXQL$FHDVW JDUDQ LHQXDFRSHU S U LFRPSRQHQWHSUHFXOEHFXULDUWLFROHGLQVWLFO VDXGLQPDWHULDOH
plastice.
3'DF
DSDUDWXOQHFHVLW UHSDUD LLDFRSHULWHGHJDUDQ LHFXPS U WRUXOWUHEXLHV LQIRUPH]HFHOPDLDSURSLDWELURX
ZANUSSI sau un agent autorizat). ZANUSSI vúLUH]HUY
ZANUSSI.
GHVHUYLFLXFOLHQ L6HUYLFLX
GUHSWXOGHDVWLSXODORFXO
UHSDUD LHLLHORFXLQ DFOLHQWXOXLORFXOGHLQVWDODUHVDXXQDWHOLHU
4*DUDQ LDVDXvQORFXLUHDJUDWXLW
LQFOXGHDWkWPDQRSHUDFkWúLPDWHULDOHOH
55HSDUD LLOHHIHFWXDWHvQSHULRDGDGHJDUDQ LHQXH[WLQGDFHDVW
JDUDQ LHGHYLQSURSULHWDWHDZANUSSI-ului.
6. 'UHSWXULOHVWDWXWDUHDOHFXPS
SHULRDG 3 U LOHvQORFXLWHvQSHULRDGDGH
U WRUXOXLQXVXQWDIHFWDWHGHDFHDVW JDUDQ LH
15
B
ZM17ML
6DGUåDM
3ULMHXSRUDEHYDãHPLNURYDOQHSHüQLFH
....................... 4
Sigurnosne upute ........................................................... 4
- Sigurnost pribora ............................................................ 4
3URYMHUDSULNODGQRVWLSRVX D .......................................... 5
- Sigurnost namirnica........................................................ 5
9RGLþNUR]SULERULRSUHPXSHüQLFH ................................ 6
7HKQLþNLSRGDFL
.............................................................. 6
............. 7
......................................................... 7
3ULSUHPD]DXNOMXþLYDQMHPLNURYDOQHSHüQLFH
6NLGDQMHDPEDODåH
Postavljanje..................................................................... 7
..................................... 7
(OHNWULþNLSULNOMXþDN ......................................................... 7
3ULNOMXþDNQDPUHåQRQDSDMDQMH
..................... 8
- Naziv i funkcija dijelova .................................................. 8
- Postavljanje okretnog tanjura ......................................... 8
8SUDYOMDþNDSORþD ........................................................... 9
- Kuhanje s mikrovalovima ............................................. 10
9RGLþ]DSRGHãDYDQMHVQDJHPLNURYDORYD ................... 10
- Upute za odmrzavanje ................................................. 11
1DWXNQLFHRPLNURYDOQRMSHüQLFL ................................... 12
2GUåDYDQMHLþLãüHQMH ................................................... 13
ýLãüHQMHRSUHPHRNUHWQLWDQMXULSRGXSLUDþ................ 13
ýLãüHQMHXQXWUDãQMRVWL .................................................. 13
ýLãüHQMHYDQMVNRJGLMHODSHüQLFH.................................. 13
.DNRVHNRULVWLYDãDPLNURYDOQDSHüQLFD
Servis i nadomjesni dijelovi ........................................ 14
3
B
ZM17ML
ýHVWLWDPRQDNXSRYLQLYDãHQRYHPLNURYDOQHSHüQLFH
+YDODYDPQDRGDELUX=DQXVVLSURL]YRGD6LJXUQLVPRGDüHYDPQRYDPLNURYDOQDSHüQLFDELWLYUORNRULVQDLRG
YHOLNHSRPRüL.DRãWRMHVOXþDMLVRVWDOLPQRYLPNXKLQMVNLPXUH
DMLPDSRWUHEQRMHRGUH HQRYULMHPHGDQDXþLWH
VYHQRYHIXQNFLMHLPRJXüQRVWLDOLVYUHPHQRPRYDSHüQLFDüHYDPSRVWDWLQH]DPMHQMLYD
3ULMHXSRUDEHYDãHPLNURYDOQHSHüQLFH
3DåOMLYRSURþLWDMWHXSXWH]DXSRUDEX8SXWHNRMHVOLMHGHSULSUHPOMHQHVXNDNRELYDPRPRJXüLOHRSWLPDOQR
NRULãWHQMHYDãHQRYHPLNURYDOQHSHüQLFH
0ROLPRYDVGDLKSURþLWDWHSDåOMLYR9UORMHYDåQRGDRYHXSXWHVDþXYDWHX]XUH
XUH DMSURGDWHLOLSRVXGLWHGUXJRMRVRELLOLDNRVHSUHVHOLWHLRVWDYLWHXUH
DM]DGDOMQMHNRULãWHQMH$NR
DMXYLMHNSURYMHULWHGDOLVXXSXWH
SRKUDQMHQHX]XUH DMNDNRELVHQRYLYODVQLNPRJDRXSR]QDWLVQDþLQRPUDGDLRGJRYDUDMXüLPXSR]RUHQMLPD
0ROLPRYDVGDSULMHNRULãWHQMDXUH
DMDSURþLWDWHRYHXSXWHXSRWSXQRVWLLSRWRPVOLMHGLWHGDQHSUHSRUXNH
Sigurnosne upute
•
8JUD HQLVLJXUQRVQLSUHNLGDþ]DEORNDGX
RQHPRJXüDYDNRULãWHQMHPLNURYDOQHSHüQLFHGRN
•
•
su otvorena vrata.
•
1HSRNXãDYDMWHVXãLWLRGMHüXLOLQRYLQHX
•
1HNRULVWLWHXQXWUDãQMRVWSHüQLFHNDRVSUHPQLN
PLNURYDOQRMSHüQLFL0RåHGRüLGRSRåDUD
1H³SUþNDMWH´RNRYUDWDLQHSRNXãDYDMWHXNOMXþLWL
Ne ostavljajte papirnate proizvode, pribor za
SHüQLFXDNRVXYUDWDRWYRUHQDMHUVHQDWDMQDþLQ
NXKDQMHLOLKUDQXXXQXWUDãQMRVWLSHüQLFHNDGDMX
PRåHWHL]ORåLWLHQHUJLMLPLNURYDORYD
ne koristite.
Ne dopustite prosipanje hrane ili nakupljanje
RVWDWDNDVUHGVWYD]DþLãüHQMHQDSRYUãLQLEUWYH
Sigurnost pribora
YUDWD3RJOHGDMWHSRJODYOMHýLãüHQMHLRGUåDYDQMH
]DXSXWHXYH]LþLãüHQMD
•
1HNRULVWLWHRãWHüHQXUH DMGRNJDQHSRSUDYL
•
3RVHEQRMHYDåQRGDYUDWDSHüQLFHEXGXSUDYLOQR
9HüLQDVWDNOHQRJVWDNORNHUDPLþNRJLYDWURVWDOQRJ
VWUXþQDLRYODãWHQDVHUYLVQDRVRED
kuhinjskog pribora izvrsna je za uporabu u mikrovalnoj
SHüQLFL3UHPGDPLNURYDOQDHQHUJLMDQHüH]DJULMDWL
]DWYRUHQDLGDQHPDRãWHüHQMDQDYUDWLPD
•
YHüLQXVWDNOHQLKLNHUDPLþNLKSUHGPHWDRYDMSULERU
(svinuta), (2) šarkama i zasunima (slomljeni ili
nesigurni), (3) brtve na vratima i površini brtve
vrata.
PRåHSRVWDWLYUXü]ERJSULMHQRVDWRSOLQHVDKUDQHQD
VSUHPQLN3UHSRUXþXMHPRVWRJDXSRUDEX]DãWLWQLK
WHUPRUXNDYLFDSULYD HQMXSRVX D
1LNDGQHSRNXãDYDMWHVDPLSRSUDYOMDWLSHüQLFX
QHVWUXþQLSRSUDYFLPRJXX]URNRYDWLR]OMHGHL
XJUR]LWLIXQNFLRQLUDQMHSHüQLFH$NRWUHEDWH
VHUYLVQXXVOXJXSRWUDåLWHMHXQDMEOLåHP
•
ovlaštenom servisu.
1LNDGDQHVNLGDMWHYDQMVNRNXüLãWHYUDWDLOL
XSUDYOMDþNXSORþX$NRWRXþLQLWHSRVWRMLRSDVQRVW
•
od izlaganja iznimno visokom naponu.
3RVWDYOMDQMHLVPMHãWDQMHRYHSHüQLFHL]YUãLWH
samo u skladu s poglavljem “UPUTE ZA
POSTAVLJANJE” ovih uputa.
•
2YDMXUH DMNRULVWLWHVDPRXVYUKH]DNRMHMH
proizveden, kao što je opisano u ovom uputstvu.
Ne koristite korozivna kemijska sredstva u
XUH DMX2YDMWLSSHüQLFHSRVHEQRMHGL]DMQLUDQ]D
zagrijavanje, kuhanje ili odmrzavanje hrane.
8UH DMQLMHQDPLMHQMHQ]DLQGXVWULMVNX
laboratorijsku ili komercijalnu uporabu i u tom
VOXþDMXJXELWHSUDYRQDMDPVWYR
•
1HNRULVWLWHSHüQLFXDNRMHSUD]QD$NRQHPD
•
'MHFDVPLMXNRULVWLWLSHüQLFXVDPRX]VWURJL
•
1HVSUHPDMWHXUH DML]YDQNXüH1HNRULVWLWHRYDM
hrane ili vode za apsorpciju mikrovalne energije,
PRåHGRüLGRRãWHüHQMDFLMHYLPDJQHWURQD
nadzor.
proizvod u blizini vode.
4
B
EMM2005
3URYMHUDSULNODGQRVWLSRVX D
•
Sigurnost namirnica
•
3RVWDYLWHSRVXGXXPLNURYDOQXSHüQLFX]DMHGQR
Zagrijavajte je na 700 W (100%) jednu minutu.
•
$NRMHQDNRQWRJDSRVXGDYUXüDQHELMHWUHEDOL
•
spremnik.
3UåHQMHXXOMXIULWLUDQMHQHPRåHWHYUãLWLX
NRULVWLWL$NRMHODJDQR]DJULMDQDPRåHWHMH
PLNURYDOQRMSHüQLFLMHUVHWHPSHUDWXUDPDVWLQH
koristiti za prigrijavanje ali ne i za kuhanje. Ako je
posuda sobne temperature, prikladna je za
mikrovalno kuhanje.
PRåHNRQWUROLUDWLãWRPRåHGRYHVWLGRRSDVQLK
•
3DSLUQDWLXEUXVLYRãWDQLSDSLUSDSLUQDWLUXþQLFL
WDQMXULþDãHRPRWL]D]DPU]LYDþLNDUWRQLVX
pribor velike prikladnosti. Uvijek budite sigurni da
MHVSUHPQLNQDSXQMHQKUDQRPNRMDüHDSVRUELUDWL
•
Ne zagrijavajte hranu u konzervama u mikrovalnoj
SHüQLFL8YLMHNSUHEDFLWHKUDQXXSULNODGDQ
VDþDãRPQDSXQMHQRPGRSRORYLFHYRGRP
•
HQHUJLMXLXNORQLWLPRJXüQRVWSUHJULMDYDQMD
5D]QRSODVWLþQRSRVX
situacija.
.RNLFHPRåHWHSULSUHPDWLXPLNURYDOQRMSHüQLFL
ali samo u posebnim pakiranjima ili priboru
dizajniranom posebno za ovu namjenu. Ova
operacija kuhanja se nikada ne bi trebala izvoditi
bez nadzora.
1DPLUQLFHVQHSRUR]QRPNRåLFRPLOLOMXVNRP
probušite kako bi izbjegli stvaranje pare i
HþDãHVSUHPQLFL]D
]DPU]LYDþLSODVWLþQLRPRWLPRJXVHNRULVWLWLX
UDVSUVNDYDQMH-DEXNHNUXPSLULSLOHüDMHWUDL
PLNURYDOQRMSHüQLFL6OLMHGLWHXSXWHSURL]YR
åXPDQMFLVXSULPMHUQDPLUQLFDNRMHWUHEDSUREXãLWL
DþD
NDGDNRULVWLWHSODVWLNXXSHüQLFL,]EMHJDYDMWH
•
NRULãWHQMHSODVWLþQRJSULERUDVKUDQRPNRMDVDGUåL
UPOZORENJE:.DGD]DJULMDYDWHWHNXüLQHNDRãWRVX
YLVRNLSRVWRWDNPDVQRüDLOLãHüHUDWDKUDQD
QSUMXKHXPDFLLQDSLWFLXYDãRMPLNURYDOQRMSHüQLFL
SRVWLåHYLVRNHWHPSHUDWXUHLPRåHUDVWRSLWLQHNH
PRåHVHGRJRGLWLSUHJULMDYDQMHWHNXüLQHL]QDGWRþNH
plastike.
YUHQMDEH]YLGOMLYLKPMHKXULüD7RPRåHUH]XOWLUDWL
1HRVWDYOMDMWHSHüQLFXEH]QDG]RUDSRJOHGDMWHMH
L]QHQDGQLPNOMXþDQMHPYUXüHWHNXüLQH.DNREL
s vremena na vrijeme kada podgrijavate ili kuhate
VSULMHþLOLRYXPRJXüQRVWXþLQLWHVOMHGHüH
KUDQXXSODVWLþQLPSDSLUQDWLPLOLRVWDOLP
zapaljivim spremnicima. Ako ste zapazili dim,
1.
Izbjegavajte korištenje spremnika s pravilnim
stranicama i uskim grlima.
2.
3.
1HSUHJULMDYDMWHWHNXüLQX
]DGUåLWHYUDWD]DWYRUHQLPDLVNOMXþLWHSHüQLFXLOL
•
L]YXFLWHPUHåQLXWLNDþGRNGLPQHQHVWDQH
Metalni pribor i pribor s metalnim ukrasima ne bi
zagrijavanja.
SRVHEQRSUHSRUXþHQ]DXSRUDEXXPLNURYDOQRM
•
•
3URPLMHãDMWHWHNXüLQXSULMHVWDYOMDQMDVSUHPQLNDX
SHüQLFXLSRQRYLWHWRQDSRODSXWDNUR]YULMHPH
WUHEDOLNRULVWLWLXPLNURYDOQRMSHüQLFLRVLPDNRQLMH
4.
SHüQLFL
1DNRQ]DJULMDYDQMDRVWDYLWHVSUHPQLNXSHüQLFL
kratko vrijeme, promiješajte ponovno prije
Spremnici sa malim otvorima, kao što su boce, ne
bi trebali biti korišteni za mikrovalno kuhanje.
Budite oprezni pri skidanju poklopaca ili pokrova s
SDåOMLYRJXNODQMDQMDVSUHPQLND
•
SRVX DNDNRELL]EMHJOLRSHNOLQHSDURP
Neki proizvodi kao što su cijela jaja i zabrtvljeni
spremnici - kao što su npr. zatvorene staklenke mogu eksplodirati i ne smiju se zagrijavati u ovoj
SHüQLFL3RYUHPHQRMDMDPRJXHNVSORGLUDWLL]D
vrijeme dok se peku. Zato uvijek probušite
åXPDQMDN]DWLPSRNULMWHLSXVWLWHGDRGVWRMLMHGQX
minutu prije skidanja pokrova.
NAPOMENA:
•
1HRNUHüLWHUXNRPRNUHWQLWDQMXU7RPRåHGRYHVWL
do kvara.
•
,VNUHQMHXSHüQLFL]DYULMHPHNRULãWHQMD
PLNURYDORYDQDMþHãüHMHSRVOMHGLFDNRULãWHQMD
PHWDOQRJSULERUD.RQWLQXLUDQRLVNUHQMHPRåH
RãWHWLWLXUH
•
DM=DXVWDYLWHSURJUDPLSURYMHULWH
pribor.
3D]LWHGDQH]DþHSLWHELORNRMLRGRWYRUD]D
SURYMHWUDYDQMHVPMHãWHQLKQDJRUQMRMVWUDåQMRM
ERþQRMLGRQMRMVWUDQLFLSHüQLFH
1HNRULVWLWHRYXSHüQLFXXNRPHUFLMDOQHVYUKH
2YDSHüQLFDQDþLQMHQDMHVDPR]DNRULãWHQMHX
GRPDüLQVWYLPD
ýXYDMWHRYHXSXWH
5
B
ZM17ML
9RGLþNUR]SULERULRSUHPXSHüQLFH
5D]QLSULERULPDWHULMDOLPRJXVHNRULVWLWL]DNXKDQMHXYDãRMPLNURYDOQRMSHüQLFL=DYDãXVLJXUQRVWNDNREL
VSULMHþLOLRãWHüHQMDSULERUDLYDãHSHüQLFHRGDEHULWHRGJRYDUDMXüLSULERULPDWHULMDOH]DVYDNXYUVWXNXKDQMD
7DEHODLVSRGWHNVWDMHRSüHQLWLYRGLþ
Materijal
Keramika i staklo
Pribor
-HGQRVWDYQRSRVX
.XKDQMHXPLNURYDOQRMSHüQLFL
DA
DA
NE
H
9DWURVWDOQRVWDNOHQRSRVX H
6WDNOHQRSRVX HVPHWDOQLPXNUDVLPD
Olovo-kristal staklo
Porculan
Bez metalnih ukrasa
/RQþDUVNLSURL]YRGL
Plastika
3RVX H]DPLNURYDOQXSHüQLFXRWSRUQRQD
NE
DA
DA
DA
toplinu
DA
NE
DA
DA
NE
DA
DA
3ODVWLþQLRPRW
Metal
3RVXGH]DSHþHQMH
Aluminijska folija*
Papir
Drvo
Oprema
ýDãHWDQMXULUXþQLFL
Okretni tanjur
3RGXSLUDþRNUHWQRJWDQMXUD
DA: Pribor i oprema za uporabu
NE: Pribor i oprema koju treba izbjegavati
1$320(1$$OXPLQLMVNXIROLMXNRULVWLWHVDPRNDR]DãWLWXSUHWMHUDQRNRULãWHQMHPRåHX]URNRYDWL
iskrenje.
7HKQLþNLSRGDFL
14 kg
Ukupne dimenzije
7HåLQD
Širina 459 mm
Dubina 368 mm
Visina 296 mm
Volumen 17 litara
Dimenzije unutrašnjosti
2VLJXUDþ
Širina 282 mm
Dubina 282 mm
Visina 206 mm
Potrošnja energije 1200W
3ULNOMXþDN
230V, 50 Hz
10 A
Snaga 700W
6
B
ZM17ML
3ULSUHPD]DXNOMXþLYDQMHPLNURYDOQHSHüQLFH
8NODQMDQMHDPEDODåH
3ULNOMXþDNQDPUHåQRQDSDMDQMH
.DGDRWSDNLUDWHSHüQLFXSURYMHULWHGDOLMHSURL]YRG
3HüQLFDVHLVSRUXþXMHVPUHåQLPNDEHORPLXWLNDþHP
EH]RãWHüHQMD(YHQWXDOQDRãWHüHQMDLOLDNRQHGRVWDMH
QHNLGLRRGPDKPRUDWHMDYLWLLVSRUXþLWHOMX3HüQLFD
za 230 V, 50 Hz sa zaštitnim uzemljenjem. Uzemljenje
umanjuje rizik kod pojave kratkog spoja. Provjerite
GLMHORYLSHüQLFHLOLRSUHPDPRJXELWLRPRWDQL]DãWLWQRP
RGJRYDUDOLQDSRQSHüQLFHQDSRQXQDSDMDQMD
folijom. Ako je to tako, morate ukloniti foliju prije
NRULãWHQMDSHüQLFH1HRVWDYOMDMWHXNORQMHQLPDWHULMDO]D
$NRMHSHüQLFDSULNOMXþHQDQDPUHåQLQDSRQSXWHP
SDNLUDQMHQDGRKYDWXPDORMGMHFL7RPRåHELWLYUOR
SURGXåQRJNDEHODRQLVWRWDNRPRUDELWLX]HPOMHQ
opasna igra.
Upozorenje!2YDMXUH DMQHVPLMHELWLVSRMHQQDL]YRU
napajanja bez uzemljenja.
Postavljanje
1.
2.
.RQWDNWLUDMWHRYODãWHQRJHOHNWULþDUDDNRLPDWH
QHGRXPLFDYH]DQRX]HOHNWULþNLSULNOMXþDNSHüQLFHLOL
Uklonite sve reklamne naljepnice s vrata.
osiguranja zaštitnog uzemljenja.
3RVWDYLWHSHüQLFXQDUDYQXXUDYQRWHåHQX
SRGORJX3RYUãLQDPRUDELWLGRYROMQRMDNDGDL]GUåL
2YDMXUH DMPRUDELWLX]HPOMHQ$NRMHRYDMXUH
WHåLQXNJSHüQLFHLVDGUåDMD.DNRELL]EMHJOL
XWLþQLFLXWLNDþWUHEDRGUH]DWLLSRVWDYLWLRGJRYDUDMXüL
PRUDELWLXVWDELOQRPSRORåDMX
3.
$NRMHQXåQDL]PMHQDRVLJXUDþDXXWLNDþXSRNORSDF
'UåLWHSHüQLFXSRGDOMHRGL]YRUDWRSOLQHLYRGH
RVLJXUDþDPRUDVHYUDWLWLQDPMHVWR$NRMHSRNORSDF
,]ODJDQMHWRSOLQLLYRGLPRåHVPDQMLWLHILNDVQRVW
L]JXEOMHQLOLRãWHüHQXWLNDþVHQHVPLMHNRULVWLWLGRNVH
SHüQLFHLGRYHVWLGRNYDURYDWDNRGDREYH]QR
ne izvrši zamjena.
SURYMHULWHGDMHSHüQLFDSRVWDYOMHQDGDOMHRG
4.
DM
RSVNUEOMHQPUHåQLPXWLNDþHPNRMLQHRGJRYDUDYDãRM
PRJXüQRVWVWYDUDQMDYLEUDFLMDLOLEXNHSHüQLFD
izvora topline i vode.
Ne pokrivajte otvore za provjetravanje na gornjoj i
(OHNWULþNLSULNOMXþDN
ERþQLPVWUDQLFDPDNXüLãWDWHLVWRWDNRQH
stavljajte nikakve predmete na gornju stranicu
SHüQLFH$NRVXRWYRUL]DSURYMHWUDYDQMHSRNULYHQL
832=25(1-(29$-85(
]DYULMHPHUDGDSHüQLFDVHPRåHSUHJULMDWLãWR
UZEMLJEN.
$-025$%,7,
PRåHGRYHVWLGRNYDUD9UXüL]UDNL]OD]LNUR]
3URL]YR
RWYRUH]DWREXGLWHVLJXUQLGDQLVX]DþHSOMHQLLOLGD
QLMHSDOD]DYMHVDL]PH
5.
3RVWDYLWHSHüQLFXãWRMHGDOMHPRJXüHRGUDGLRL
•
79SULMHPQLND2YDSHüQLFDRGJRYDUD((&
zahtjevima* u vezi potiskivanja radio-smetnji, ali
neke smetnje se ipak mogu pojaviti ako je
smještena preblizu radio ili TV prijemniku, tako da
6.
DþRGELMDVYDNXRGJRYRUQRVWDNRVHQH
SULGUåDYDWHRYLKVLJXUQRVQLKPMHUD
XSHüQLFHLVWUDåQMHJ]LGD
$NRXWLNDþQDYDãHPXUH DMXQHRGJRYDUDXWLþQLFL
WUHEDJDRGUH]DWLL]DPLMHQLWLRGJRYDUDMXüLP
XWLNDþHP
MHGUåLWHãWRMHGDOMHPRJXüH
8NORQLWHRVLJXUDþL]RGVWUDQMHQRJXWLNDþD8WLNDþWDGD
Ako je smještena u kutu, ostavite razmak od
najmanje 10 cm od zidova, kako bi se osiguralo
pravilno provjetravanje.
WUHEDRGORåLWLQDVLJXUQRNDNRELVSULMHþLOLPRJXüL
VWUXMQLXGDUXNROLNRELXWLNDþXNOMXþLOLXXWLþQLFXRG
$PSXQHNRPGUXJRPGMHOXNXüDQVWYD
9DåQR3HüQLFDPRåHELWLVPMHãWHQDJRWRYRQDELOR
NRMHPPMHVWXXNXKLQML3URYMHULWHGDOLMHSHüQLFD
smještena na glatku, vodoravnu površinu i da otvori za
SURYMHWUDYDQMHNDRLSRYUãLQDLVSRGSHüQLFHQLVX
blokirani (za efikasno provjetravanje).
2YDMXUH DMRGJRYDUD]DKWMHYLPDGDQLPX((&
odredbi o radio-smetnjama 87/308/EEC.
7
B
ZM17ML
.DNRVHNRULVWLYDãDPLNURYDOQDSHüQLFD
1
3
2
5
8
4
4
7
6
Naziv i funkcija dijelova
Postavljanje okretnog tanjura
1.
Odjeljak za kuhanje. Obrišite odjeljak nakon
uporabe.
3RVWDYLWHSRGXSLUDþRNUHWQRJWDQMXUDQDGQR
2.
3UR]RU+UDQXPRåHWHNRQWUROLUDWL]DYULMHPH
3RVWDYLWHRNUHWQLWDQMXUQDYUKSRGXSLUDþD
UDGDPLNURYDOQHSHüQLFH
8SUDYOMDþNDSORþD
okretnog tanjura kao što je prikazano na slici.
Provjerite da li je središte okretnog tanjura sigurno
uglavljeno u pogonsku osovinu okretnog tanjura.
Nikada ne postavljajte okretni tanjur naopako.
• Za vrijeme kuhanja obavezno morate koristiti i
3RGXSLUDþRNUHWQRJWDQMXUD3RVWDYLWH
RNUHWQLWDQMXULSRGXSLUDþRNUHWQRJWDQMXUD
SRGXSLUDþQDGQRRGMHOMND]DNXKDQMHNDNREL
• Sva hrana i spremnici hrane moraju se uvijek
postaviti na ovaj tanjur za vrijeme kuhanja.
• Ovaj tanjur se vrti u smjeru kazaljki na satu i u
smjeru suprotnom od kazaljki na satu; to je
normalno.
3.
4.
5.
6.
7.
XQXWUDãQMRVWLSHüQLFH
9UDWDSHüQLFH=DYULMHPHSULSUHPHKUDQHYUDWD
moraju uvijek biti dobro zatvorena.
Kuke zasuna i sigurnosni sistem zabravljivanja.
poduprli okretni tanjur.
Okretni tanjur. Napravljen je od posebnog
vatrostalnog stakla. Hranu za kuhanje postavite
na njega u prikladnom spremniku. Ne koristite
SHüQLFXEH]RNUHWQRJWDQMXUD
8.
Pogonska osovina okretnog tanjura.
Okretni tanjur
3RGXSLUDþVYDOMþLüLPD
Pogonska osovina
okretnog tanjura
8
B
ZM17ML
8SUDYOMDþNDSORþD
1.
2.
Kontrola za odabir snage
Namjestite kontrolu tako da odredite
ispravnu snagu za vašu hranu.
Vremenski sklop
1DPMHVWLWHåHOMHQRYULMHPHNXKDQMD
.XKDQMHüH]DSRþHWL
Svi satni vremenski
VNORSRYLUDGLWüHWRþQLMHDNRSUL
QDPMHãWDQMXPDORSUHNRUDþLWHåHOMHQR
vrijeme i potom ih vratite.
9
B
ZM17ML
Kuhanje s mikrovalovima
1.
Otvorite vrata, smjestite hranu na okretni tanjur.
Zatvorite vrata.
Kad kuhate manje od 2 minute, okrenite kontrolu
vremenskog sklopa na dulje trajanje i potom je
2.
1DPMHVWLWHNRQWUROX]DRGDELUVQDJHGRåHOMHQH
YUDWLWHQDåHOMHQRYULMHPH
razine snage (vidi tablicu).
$NRåHOLWHLVNOMXþLWLSHüQLFXWLMHNRPNXKDQMD
3.
1DPMHVWLWHYUHPHQVNLVNORSGRåHOMHQRJ
jednostavno okrenite kontrolu vremenskog sklopa
na 0.
vremena.
3HüQLFD]DSRþQHVNXKDQMHP
Napomena: Nakon uporabe, provjerite da je
NRQWURODYUHPHQVNRJVNORSDYUDüHQDQDX
VXSURWQRPüHSHüQLFDQDVWDYLWLVUDGRP
Primjer: Kuhanje na 385 W u trajanju 15 minuta
1.
Okrenite kontrolu za odabir snage na 385 W.
2.
Okrenite vremenski sklop na 15.
3.
3HüQLFDüHDXWRPDWVNL]DSRþHWLNXKDWLPLQXWDQD:
9RGLþ]DSRGHãDYDQMHVQDJHPLNURYDORYD
Podešena snaga
120W
(230W)
385W
540W
700W
Preporuka za korištenje
2GUåDYDQMHWRSOLQH2GUåDYDKUDQXWRSORP
2GOH LYDQMH2WDSDQMH]DPU]QXWHKUDQH
6UHGQMH%UåHRGOH LYDQMHLSRGJULMDYDQMHVORåHQDFDLSDSULNDãD
3RGJULMDYDQMH3RGJULMDYDQMHYHüVSUDYOMHQHKUDQH3HþHQMHYHüLKNRPDGDPHVD
i peradi.
.OMXþDQMHLOLSRGJULMDYDQMHWHNXüLQD
.XKDQMHSRYUüD
10
B
ZM17ML
Upute za odmrzavanje korištenjem snage
(230W)
1HNDKUDQDNDRãWRVXNUXKLYRüHPRåHVHXVSMHãQRUXþQRRGPU]QXWLNRULVWHüLRYXVQDJX
HRANA
VRIJEME
STAJANJA
PRIPREMA
Kruh
2 kriške
1 kruh
Postavite ga na rešetku otpornu na mikrovalove ili na
kuhinjski papir.
Okrenite na polovici vremena odmrzavanja.
Postavite ga na rešetku otpornu na mikrovalove ili na
kuhinjski papir.
Okrenite na polovici vremena odmrzavanja.
Postavite na kuhinjski papir.
Postavite na kuhinjski papir.
2 kruha
Postavite na kuhinjski papir.
Mali kruh
Narezan
veliki kruh
8–10 min.
10–15 min.
10–13 min.
10 min
45–60 sek.
45–60 sek.
1–11/2
min.
5 min.
5 min.
Izvadite iz omota, stavite na tanjur.
9–11 min.
15–30 min.
Izvadite iz omota, stavite na tanjur.
9–11 min.
15–30 min.
Izvadite iz omota, stavite na tanjur.
7– 9 min.
15–30 min.
Izvadite iz omota, stavite na tanjur.
7– 9 min.
15–30 min.
Ako je omotan folijom, uklonite ju i postavite ga na tanjur.
3– 4 min.
5–10 min.
Postaviti u jednom sloju u plitku posudu.
5– 6 min.
5–10 min.
7– 8 min.
5–10 min.
7– 8 min
5–10 min.
5 min.
.HNVLLNRODþL
Gateau 450g
.RODþRGVLUD
450g
Pita
(spravljena)
450g
.RODþLJ
Maslac
250g
(1 pakiranje)
9RüH
225g
9RüHV
mekim
bobicama
450g
9RüHV
Postaviti u jednom sloju u plitku posudu.
mekim
bobicama
Obrok
3RNULWLWDQMXURPLOLSULDQMDMXüRPIROLMRPEH]39&D=D
400g
podgrijavanje, mikrovalovi na 100% (800 W) u trajanju 34 minute.
3RYUüH
2GPU]DYDQMHSRYUüDSULMHNXKDQMD
QLMHQXåQR6YRSRYUüHPRåHVH
odmrzavati i kuhati na 100% (800 W).
11
B
ZM17ML
1DWXNQLFHRPLNURYDOQRMSHüQLFL
•
6DYMHWLRPLNURYDOQRMSHüQLFL
•
3HüQLFXXYLMHNGUåLWHþLVWRP±L]EMHJDYDMWH
SUROMHYDQMHQDPLUQLFDLQH]DERUDYLWHSRþLVWLWL
•
ispod staklene plitice i unutrašnju stranu vrata.
3RPRJXüQRVWLNRULVWLWHRNUXJORLOLRYDOQRSRVX
VWDYLWHXSHüQLFXXNOMXþLWHPLNURYDORYHVUHGQMH
snage na 2 minute.
H
s poklopcem kada kuhate u svojoj mikrovalnoj
•
•
SHüQLFL
1HNRULVWLWHPHWDOQRSRVX HLOLSRVX
•
•
stavite ih u posudu i zagrijavajte na velikoj snazi
1-2 minute. Dobro miješajte.
PRJXUDVWRSLWLLLVNULYLWLRGYUXüHKUDQH
Pokrijte hranu kada kuhate. Koristite staklene
•
.RODþLNUXKLVOLþQRPRJXVHRGPU]DYDWLGLUHNWQR
Omekšavanje ili otapanje maslaca
Na velikoj snazi za otapanje je potrebno nekoliko
XNRãDUL]DNUXKLOLQDSDSLUQDWRPUXþQLNX
VHNXQGL0DVODFüHWHQDMEROMHRPHNãDWLQMHåQLMH
SRNORSFHWDQMXUHLOLSDSLURWSRUDQQDPDVRüX
na niskoj snazi.
Ako se smrznuta hrana zagrijava u svom omotu,
SRWUHEQRJDMHRWYRULWL2PRWHNRMLVDGUåHPHWDOLOL
•
metalne dekoracije ne smijete koristiti osim ako
•
SHüQLFL8NORQLWHPHWDOQHNRSþHLåLþDQHYH]LFH
•
6LWQHNRPDGLüHDOXPLQLMVNHIROLMHPRåHWHNRULVWLWL
•
•
=DJULMWHGRþHQDþHãQMDNDQDMDNRMVQD]L
ãWRVXSLOHüLEDWDFL
VHNXQGL6WLVQLWHVMHGQHVWUDQHGRNþHQRYLQH
ispadnu.
+UDQXVDOMXVNDPDLOLNRåRPWUHEDWHSUREXãLWL
•
PLNURYDOQRMSHüQLFLMHUPRJXHNVSORGLUDWL
Velike, debele komade postavite blizu ruba
posude i pokušajte narezati hranu na nekoliko
jednakih komada. Hranu uvijek postavite u
•
VUHGLQXSHüQLFH
Kuhanje kaše
+UDQDüHELWLXMHGQDþHQRNXKDQDDNRMH
.DãXüHWHODNRVNXKDWLXWDQMXULPDSRVX
promiješate ili okrenete nekoliko puta.
SRVOXåLYDQMHEH]OMHSOMLYLKSRVXGD]DSUDQMH
8YLMHNSRGHVLWHNUDüHYULMHPHNXKDQMDQHJRãWRMH
'UåLWHVHXSXWDSURL]YR DþDKUDQH
vrijeme.
.RULVWLWHPDORLOLQLãWDYRGH]DSRYUüH
.RULVWLWHPDQMHVROLL]DþLQDQHJR]DQRUPDOQR
kuhanje.
=DþLQHGRGDMWHQDNUDMX
Dopustite nekoliko minuta "stajanja" nakon što se
SHüQLFDLVNOMXþLODNDNRELRVLJXUDOLSRWSXQHL
•
•
HQMD
sekundi zagrijete na jakoj snazi.
SUHNXKD9HüDNROLþLQDKUDQH]DKWLMHYDGXåH
•
•
9RüQLVRN
$JUXPLüHGDWLYLãHVRNDDNRLKSULMHFLMH
dano u vašem receptu kako bi izbjegli da se hrana
•
•
/DJDQRJXOMHQMHþHãQMDND
za pokrivanje dijelova koji se lako prekuhaju kao
vilicom - npr. krumpiri i kobasice. Ne kuhajte jaja u
•
2VYMHåDYDQMHLOL]DJULMDYDQMHNUXKD
Nekoliko sekundi koristite srednju snagu.
QLVXSUHSRUXþHQL]DXSRUDEXXPLNURYDOQRM
•
2WDSDQMHþRNRODGH
,]ORPLWHJþRNRODGHQDþHWYUWDVWHNRPDGH
HVPHWDOQLP
GHNRUDFLMDPD2GUH HQLSODVWLþQLPDWHULMDOLVH
•
Omekšavanje meda
Ako imate teglu kristaliziranog meda, otklopite ju i
XMHGQDþHQHUH]XOWDWHNXKDQMD
8YLMHNVHUYLUDMWHYUXüXKUDQX
.RULVWLWHGUåDþHSRVXGDLOLUXNDYLFHNDGDYDGLWH
SRVX HLKUDQXL]SHüQLFH
12
X]D
B
ZM17ML
2GUåDYDQMHLþLãüHQMH
3HüQLFDXYLMHNPRUDELWLþLVWD2VWDFLSUROLYHQHKUDQHLOLSUVNDQMDüHSULYODþLWLHQHUJLMXPLNURYDORYDãWRüHGRYHVWL
GR]DJDUDQMD7RPRåHVPDQMLWLHILNDVQRVWSHüQLFHLVWYRULWLORãPLULV1HGLUDMWHLQHSRNXãDYDMWHL]PLMHQLWLLOL
SRSUDYLWLELORNRMLGLRSHüQLFH3RSUDYDNPRUDREDYLWLVWUXþQDLRYODãWHQDRVRED
3URYMHULWHGDOLMHSHüQLFDLVNOMXþHQDLPUHåQLXWLNDþL]YXþHQL]XWLþQLFHSULMHþLãüHQMD
ýLãüHQMHRSUHPHRNUHWQLWDQMXULSRGXSLUDþ
2þLVWLWHLKEODJLPVUHGVWYRP]DþLãüHQMHQDNRQYD
HQMDL]XQXWUDãQMRVWLSHüQLFH
3DåOMLYRUXNXMWHVSRGXSLUDþHP
3$ä1-$8QXWUDãQMRVWSHüQLFHLRNUHWQLWDQMXUSRVWDMXYUORYUXüLSDLKQHPRMWHGRGLULYDWLRGPDKSRXSRUDEL
ýLãüHQMHXQXWUDãQMRVWL
8YLMHNGUåLWHXQXWUDãQMRVWSHüQLFHþLVWRP2GPDKSRþLVWLWHSHüQLFXDNRGR HGRSUROLMHYDQMDLOLSUVNDQMDKUDQH
2VWDFLQDVWMHQNDPDSHüQLFHEUWYLYUDWDLSRYUãLQLYUDWDDSVRUELUDWüHHQHUJLMXPLNURYDORYDVPDQMLWLHILNDVQRVW
SHüQLFHLPRJXGRYHVWLGRRãWHüHQMDXQXWUDãQMRVWLSHüQLFH=DXNODQMDQMHRVWDWDNDNRULVWLWHEODJDWHNXüD
VUHGVWYD]DþLãüHQMHWRSOXYRGXLPHNXþLVWXNUSX
1,.$'$1(.25,67,7($%5$=,91$65('679$=$ý,âû(1-(65('679$=$ý,âû(1-(./$6,ý1,+
3(û1,&$,/,-$678ý,û(2'ý(/,ý1(981(=$ý,âû(1-(%,/2.2-(*',-(/$0,.529$/1(
3(û1,&(
=DRPHNãDYDQMHWHåLKPUOMD]DJULMWHþDãXYRGHXPLNURYDOQRMSHüQLFLXWUDMDQMXPLQXWH
1,.$'$1(.25,67,7(12ä,/,.$.$9'58*,$/$7=$8./$1-$1-(05/-$63295â,1(3(û1,&(
=DXNODQMDQMHPLULVDL]XQXWUDãQMRVWLSHüQLFH]DJULMWHþDãXYRGHVDGYLMHåOLFHOLPXQRYRJVRNDXWUDMDQMXRG
minuta.
ýLãüHQMHYDQMVNRJGLMHODSHüQLFH
2WYRULWHYUDWDSHüQLFHNDGDþLVWLWHXSUDYOMDþNXSORþX1DWDMQDþLQQHPRåHGRüLGRVOXþDMQRJQHåHOMHQRJ
XNOMXþLYDQMDSHüQLFH9DQMVNXSRYUãLQXSHüQLFHþLVWLWHEODJLPWHNXüLPVUHGVWYRP]DþLãüHQMHLYRGRPQDNRQ
þHJDREULãLWHþLVWRPYRGRPRVWDWNHGHWHUGåHQWD2VXãLWHPHNRPNUSRP
6UHGVWYD]DþLãüHQMHSUR]RUDXVSUHMXLOLYLãHQDPMHQVNDNXKLQMVNDVUHGVWYD]DþLãüHQMHXVSUHMXPRJXVHLVWR
WDNRNRULVWLWL1LNDGDQHNRULVWLWHDEUD]LYQDVUHGVWYD]DþLãüHQMHåLþDQHMDVWXþLüH]DULEDQMHLOLMDNHNHPLNDOLMHQD
YDQMVNLPSRYUãLQDPDYDãHSHüQLFH.DNRELVHL]EMHJODRãWHüHQMDUDGQLKGLMHORYDQHGRSXVWLWHXOLMHYDQMHYRGHX
ventilacione otvore.
13
B
ZM17ML
Servis i nadomjesni dijelovi
$NRPLNURYDOQDSHüQLFDQHUDGLPROLPRGDSURYMHULWHVOMHGHüHSULMHQHJRSR]RYHWHRYODãWHQLVHUYLV
$NRPLNURYDOQDSHüQLFDQH]DSRþLQMHVUDGRP
•
•
•
•
•
Provjerite da je aparat pravilno spojen.
3URYMHULWHGDMHXWLNDþSUDYLOQRXNOMXþHQXXWLþQLFX
$NRMHSRWUHEQR]DPLMHQLWHRVLJXUDþXNDEHOXVDQRYLPLVWRYMHWQLPSRVQD]L
3URYMHULWHGDXXWLþQLFLLPDQDSRQDWDNRGDXNOMXþLWHQHNLGUXJLXUH DM
3URYMHULWHLVSUDYQRVWRVLJXUDþDXGRPDüLQVWYX
Ako mikrovalovi ne rade:
•
0RåGDMHQDPMHãWHQDVLJXUQRVQD]DãWLWDGRVWXSQDQDQHNLPPRGHOLPD
•
Provjerite da su kontrole pravilno podešene.
•
3URYMHULWHSRGHãHQMHSRVWXSDNNRULVWHüLXSXWX]DXSRUDEX
•
Provjerite da su vrata pravilno zatvorena. (Ako su dijelovi hrane ili nešto drugo ostali zaglavljeni u otvoru
YUDWDYUDWDVHQHüHSUDYLOQR]DWYRULWLLPLNURYDOQDSHüQLFDQHüHUDGLWL
$NRQDNRQRYLKSURYMHUDPLNURYDOQDSHüQLFDLGDOMHQHUDGLSUDYLOQRVWXSLWHXNRQWDNWVDQDMEOLåLPRYODãWHQLP
servisnim centrom.
9$ä12$NRSR]RYHWHVHUYLVHUDUDGLMHGQHRGRYGMHQDYHGHQLKVPHWQMLLOL]ERJSRJUHãQRJUXNRYDQMDLOL
SRVWDYOMDQMDPLNURYDOQHSHüQLFHGROD]DNQHüHELWLEHVSODWDQþDNLXQXWDUMDPVWYHQRJURND
Servisne usluge i nadomjesne dijelove nude ovlašeni Zanussi servisi.
.DGDQDUXþXMHWHVHUYLVQXXVOXJXLOLGLMHORYHPROLPRYDVGDSULSUHPLWHWRþDQQD]LYLPRGHOPLNURYDOQHSHüQLFH
7HSRGDWNHüHWHQDüLQDQDWSLVQRMSORþLFL
Zapišite ih tako da su vam uvijek pri ruci kada ih trebate.
Model: ZM17ML
Serijski broj: ............................................
Datum kupnje: .........................................
1DSRPHQD3RVSUHPLWHYDãHXSXWHLMDPþHYQLOLVW
14
e
ZM17ML
4
4
5
5
5
6
7
7
7
8
8
9
9
9
10
11
11
12
13
14
14
14
14
15
16
3
e
ZM17ML
=DQXVVL
•
•
•
•
•
4
•
•
•
•
•
³
•
•
•
´
Zanussi
•
.
e
ZM17ML
•
•
2.
3.
5
4.
1.
•
•
•
•
•
•
•
700 W (100%)
•
•
e
ZM17ML
•
•
•
:
•
*
6
e
ZM17ML
14
17
230 V, 50 Hz
1200 W
3.
6.
7
4.
5.
2.
1.
700 W
e
ZM17ML
9+]
•
8
e
ZM17ML
1
3
2
5
4
8
4
6
7
1.
1.
4.
5.
6.
•
9
•
8.
7.
3.
2.
2.
e
ZM17ML
1.
2.
10
e
ZM17ML
1.
2.
3.
1.
2.
3.
385:
385 W.
385 W.
120 W
540 W
11
700 W
230 W
385 W
.
e
ZM17ML
8 - 10
10 –13
2
45 – 60
45 –60
1–1½
9 – 11
9 – 11
7–9
7–9
3–4
5–6
7–8
00W 00 W ).
12
7–8
e
ZM17ML
•
•
•
•
±
•
•
•
•
•
•
•
±
•
•
•
13
•
•
•
•
•
•
±
±
•
•
•
•
e
ZM17ML
14
e
ZM17ML
±
±
•
•
•
1.
2.
•
3.
15
Zanussi
•
:
:
•
•
•
6.
•
4.
5.
•
•
Zanussi
Zanussi
e
ZM17ML
Zanussi
1.
3.
4.
5.
6.
±
=DQXVVL
=DQXVVL
2.
=DQXVVL
•
•
•
•
•
•
16