D Glaswaage Gebrauchsanleitung G Glass scale Instruction for Use

GS 42
D Glaswaage
Gebrauchsanleitung
I Bilancia in vetro
Instruzioni per l’uso
G Glass scale
Instruction for Use
T Cam Terazi
Kullanma Talimatı
F Pèse-personne en verre
Mode d’emploi
r Стеклянные весы
Инструкция по
применению
E Báscula de vidrio para
personas
Instrucciones para el uso
Q Waga szklana
Instrukcja obsługi
Beurer GmbH t Söflinger Str. 218 t 89077 Ulm (Germany)
Tel. +49 (0) 731 / 39 89-144 t Fax: +49 (0) 731 / 39 89-255
www.beurer.de t Mail: kd@beurer.de
D DEUTSCH
Sehr geehrte Kundin, sehr geehrter Kunde,
wir freuen uns, dass Sie sich für ein Produkt unseres Sortimentes entschieden haben. Unser Name
steht für hochwertige und eingehend geprüfte Qualitätsprodukte aus den Bereichen Wärme, Gewicht, Blutdruck, Körpertemperatur, Puls, Sanfte Therapie, Massage und Luft.
Bitte lesen Sie diese Gebrauchsanleitung aufmerksam durch, bewahren Sie sie für späteren Gebrauch auf, machen Sie sie anderen Benutzern zugänglich und beachten Sie die Hinweise.
Mit freundlicher Empfehlung
Ihr Beurer-Team
1
Zum Kennenlernen
Funktionen des Gerätes
Diese digitale Glaswaage dient zum Wiegen und zur Berechnung Ihres persönlichen BodyMass-Index (Körpermassenzahl).
Die Waage ist für die Eigenanwendung im privaten Bereich bestimmt.
Die Waage verfügt über folgende Funktionen, die von bis zu 10 Personen genutzt werden können:
š0HVVXQJGHV.ąUSHUJHZLFKWV
š%HUHFKQXQJGHV%RG\0DVV,QGH[%0,.ąUSHUPDVVHQ]DKO
šIDUELJH,QWHUSUHWDWLRQGHV%0,]XUHLQIDFKHQ(LQVWXIXQJ
Die Speicherfunktion ermöglicht bis zu 10 Personen den Zugriff auf bis zu 10 zuletzt gemessene
Gewichtswerte und die dabei zusätzlich berechneten BMI-Werte.
2
Zeichenerklärung
Folgende Symbole werden in der Gebrauchsanweisung verwendet.
3
Warnung
Warnhinweis auf Verletzungsgefahren oder Gefahren für Ihre Gesundheit
Achtung
Sicherheitshinweis auf mögliche Schäden am Gerät/Zubehör
Hinweis
Hinweis auf wichtige Informationen
Sicherheitshinweise
Sicherheitshinweise
Warnung:
š6WHLJHQ6LHQLFKWHLQVHLWLJDXIGHQËXĔHUVWHQ5DQGGHU:DDJH.LSSJHIDKU
š+DOWHQ6LH.LQGHUYRP9HUSDFNXQJVPDWHULDOIHUQ(UVWLFNXQJVJHIDKU
š'LH2EHUIJËFKHGHU:DDJHLVWLQIHXFKWHPRGHUQDVVHP=XVWDQGUXWVFKLJ
2
Hinweise zum Umgang mit Batterien
Warnung:
š%DWWHULHQNąQQHQEHL9HUVFKOXFNHQOHEHQVJHIËKUOLFKVHLQ%HZDKUHQ6LH%DWWHULHQXQG
Waage für Kleinkinder unerreichbar auf. Wurde eine Batterie verschluckt, nehmen Sie sofort
medizinische Hilfe in Anspruch.
š%DWWHULHQGĞUIHQQLFKWJHODGHQRGHUPLWDQGHUHQ0LWWHOQUHDNWLYLHUWQLFKWDXVHLQDQGHUJH
nommen, in Feuer geworfen oder kurzgeschlossen werden.
š%DWWHULHQNąQQHQ*LIWVWRijHHQWKDOWHQGLHGLH*HVXQGKHLWXQGGLH8PZHOWVFKËGLJHQ
Entsorgen Sie die Batterien deshalb unbedingt entsprechend der geltenden gesetzlichen
Bestimmungen. Werfen Sie die Batterien niemals in den normalen Hausmüll.
Achtung:
š:HFKVHOQ6LHVFKZËFKHUZHUGHQGH%DWWHULHQUHFKW]HLWLJDXV
š:HFKVHOQ6LHLPPHUDOOH%DWWHULHQJOHLFK]HLWLJDXVXQGYHUZHQGHQ6LH%DWWHULHQGHV
gleichen Typs.
š$XVODXIHQGH%DWWHULHQNąQQHQ%HVFKËGLJXQJHQDP*HUËWYHUXUVDFKHQ:HQQ6LHGDV*HUËW
längere Zeit nicht benutzen, nehmen Sie die Batterien aus dem Batteriefach.
š:HQQHLQH%DWWHULHDXVJHODXIHQLVW]LHKHQ6LH6FKXW]KDQGVFKXKHDQXQGUHLQLJHQ6LHGDV
Batteriefach mit einem trockenen Tuch.
Allgemeine Hinweise
š'DV*HUËWLVWQXU]XU(LJHQDQZHQGXQJQLFKWIĞUGHQPHGL]LQLVFKHQRGHUNRPPHU]LHOOHQ
Gebrauch vorgesehen.
š%HDFKWHQ6LHGDVVWHFKQLVFKEHGLQJW0HVVWROHUDQ]HQPąJOLFKVLQGGDHVVLFKXPNHLQH
geeichte Waage für den professionellen, medizinischen Gebrauch handelt.
š'LH%HODVWEDUNHLWGHU:DDJHEHWUËJWPD[NJOE6W%HLGHU*HZLFKWVPHVVXQJ
werden die Ergebnisse in 100 g-Schritten (0,2 lb) angezeigt.
š3UĞIHQ6LHYRUMHGHU5HNODPDWLRQ]XHUVWGLH%DWWHULHQXQGZHFKVHOQ6LHGLHVHJHJHEHQHQ
falls aus.
š5HSDUDWXUHQGĞUIHQQXUYRP.XQGHQGLHQVWRGHUDXWRULVLHUWHQ+ËQGOHUGXUFKJHIĞKUWZHUGHQ
š6ROOWHQ6LHQRFK)UDJHQ]XU$QZHQGXQJXQVHUHU*HUËWHKDEHQVRZHQGHQ6LHVLFKELWWHDQ
Ihren Händler oder an den Kundenservice.
š$OOH:DDJHQHQWVSUHFKHQGHU(*5LFKWOLQLH(&
4
Gerätebeschreibung
2
Übersicht
1
2
Anzeige
Auf-Taste
86(57DVWH
$E7DVWH
6(77DVWH
1
3
3
5
Inbetriebnahme
Batterien einlegen (3 x 1,5 V AAA Mikro)
%LWWHHQWIHUQHQ6LHGHQ%DWWHULHVFKXW]VWUHLIHQXQGRGHUVHW]HQ6LHGLH%DWWHULHQJHPËĔGHULP%DWteriefach dargestellten Polung ein. Zeigt die Waage keine Funktion, so entfernen Sie die Batterien
komplett und setzen Sie sie erneut ein.
Gewichtseinheit ändern
Die Waage zeigt in der Grundeinstellung die Werte in kg an. Sie können die Einheit über den auf der
5ĞFNVHLWHGHV*HUËWVEHıQGOLFKHQ'UXFNVFKDOWHU]ZLVFKHQ.LORJUDPPŚNJŗ3IXQGŚOEŗXQG6WRQH
ŚVWŗHLQVWHOOHQ
Waage aufstellen
6WHOOHQ6LHGLH:DDJHDXIHLQHQHEHQHQXQGIHVWHQ8QWHUJUXQG(LQHIHVWH6WDQGIJËFKHLVW9RUDXVsetzung für eine korrekte Messung.
6
Informationen
Das Messprinzip
'HU%0,ZLUGDXVHLQJHJHEHQHU.ąUSHUJUąĔHXQGJHPHVVHQHP*HZLFKWHUUHFKQHW
Allgemeine Tipps
š:LHJHQ6LHVLFKPąJOLFKVW]XUVHOEHQ7DJHV]HLWDPEHVWHQPRUJHQVQDFKGHP7RLOHWWHQJDQJ
nüchtern und ohne Bekleidung, um vergleichbare Ergebnisse zu erzielen.
7
Waage einschalten
6FKODJHQ6LHPLWGHP)XĔNXU]NUËIWLJXQGJXWKąUEDUDXIGLH:DDJHXPGHQ(UVFKĞWWHUXQJVVHQsor zu aktivieren.
(VHUVFKHLQWDOV6HOEVWWHVWŚŗXQGGDV'DWXPELVŚŗDQJH]HLJWZLUG:HFKVHOQ6LHGDQQJJI
den Benutzerspeicher.
8
Einstellung
Datum und Uhrzeit einstellen
Tag Monat Jahr
SET
Datum und Uhrzeit können nur nach Entnahme und erneutem Einlegen der Batterien geändert
werden.
Bei der Einstellung des aktuellen Datums und der Uhrzeit gehen Sie in mehreren Schritten vor:
Tag – Monat – Jahr – Stunden – Minuten.
(VEOLQNWGHUMHZHLOV]XËQGHUQGH7HLOEHUHLFK
š'UĞFNHQ6LHGLH7DVWHQ und , um eine Einstellung zu ändern.
š'UĞFNHQ6LHGLH7DVWH6(7XPGLH(LQVWHOOXQJ]XVSHLFKHUQXQG]XPQËFKVWHQ(LQVWHOOEHUHLFK]X
JHODQJHQRGHUXPGLH(LQVWHOOXQJDE]XVFKOLHĔHQ
Nach diesem Vorgang schaltet sich die Waage automatisch aus.
(UIROJWOËQJHUDOV6HNXQGHQODQJNHLQH7DVWHQEHWËWLJXQJVFKDOWHWGLH:DDJHHEHQIDOOVDXV
Benutzerdaten einstellen
Die Waage verfügt über 10 Benutzerspeicherplätze und pro Benutzer über 10 MessergebnisSpeicherplätze. Auf den Benutzerspeicherplätzen können Sie und beispielsweise die Mitglieder
Ihrer Familie die folgenden persönlichen Einstellungen abspeichern und wieder abrufen:
5HLKHQIROJH
Benutzerdaten
Einstellwerte
1
Speicherplatz
1 bis 10
2
.ąUSHUJUąĔH
100 bis 220 cm
(3'-03" bis 7'-03")
6FKDOWHQ6LHGLH:DDJHHLQV:DDJHHLQVFKDOWHQ:HQQGLH$Q]HLJHŚNJŗHUVFKHLQW
š'UĞFNHQ6LHGLHŚ86(5ŗ7DVWHVRRIWELVGHUJHZĞQVFKWH6SHLFKHUSODW]HUVFKHLQW(VZLUG
]XQËFKVWGLHYRUHLQJHVWHOOWH.ąUSHUJUąĔHDQJH]HLJW:DUWHQ6LHELVZLHGHUŚNJŗHUVFKHLQW
š8PGLH.ąUSHUJUąĔH]XËQGHUQGUĞFNHQ6LHŚ6(7ŗ
š'UĞFNHQ6LHGLH7DVWHQ und XPGLH*UąĔHHLQ]XVWHOOHQ)ĞU6FKQHOOGXUFKODXI7DVWHJHGUĞFNW
halten.
š%HHQGHQ6LHGLH(LQJDEHPLWGHU7DVWH6(7
2 sec
USER
3 sec
SET
SET
Beachten Sie: Wenn Sie die Einstellung Ihrer Größe zu einem späteren Zeitpunkt
ändern, werden alle bisher gespeicherten Messergebnisse Ihres Benutzerspeicher
platzes gelöscht.
9
Bedienung
Wiegen und Berechnen des BMI
Um sich zu wiegen und den persönlichen Body-Mass-Index zu berechnen:
š6FKDOWHQ6LHGLH:DDJHHLQV:DDJHHLQVFKDOWHQ
š:ËKOHQ6LHGDQQPLW„USER“ den Benutzerspeicherplatz mit Ihren gespeicherten Einstellungen
DXV(VZLUG]XQËFKVW,KUHHLQJHJHEHQH.ąUSHUJUąĔHDQJH]HLJW
:DUWHQ6LHELVZLHGHUŚNJŗHUVFKHLQW-HW]WNąQQHQ6LHGLH:DDJH]XU0HVVXQJEHWUHWHQ
Stehen Sie während des Messvorgangs still.
3 sec
USER
2 sec
(VZHUGHQMHZHLOVGDV'DWXPGDV*HZLFKWXQGGHU%0,DQJH]HLJW
'DV'LVSOD\YHUËQGHUWVHLQH)DUEHMDQDFK%0,V(UJHEQLVVHEHZHUWHQ
Pro Tag und Person wird ein Wert gespeichert. Sollten Sie mehrere Messungen pro Tag durchführen,
ZLUGGHUMHZHLOV]XOHW]WJHPHVVHQH:HUWJHVSHLFKHUW'LHELVKHULJHQDQGLHVHP7DJJHVSHLFKHUWHQ
Daten werden überschrieben.
Nach ca. 10 Sek. schaltet die Waage automatisch ab.
Abfrage der gespeicherten Messergebnisse
Um die gespeicherten Messergebnisse des aktuell gewählten Benutzers abzufragen:
t4DIBMUFO4JFEJF8BBHFein (s. 7. Waage einschalten)/BDIEFS"O[FJHFEFT4FMCTUUFTUFTFSTDIFJOUEJF"O[FJHFv kg“.
t8ÊIMFO4JFEFO#FOVU[FSTQFJDIFSQMBU[EVSDIHHGNFISNBMJHFT%SàDLFOEFS5BTUFv64&3i#FUÊUJHFO4JFLFJOFXFJUFSF5BTUFFSTDIFJOUOBDIDB4FLVOEFO[VOÊDITUOPDINBMTEJF(SڕFEFT
HFXÊIMUFO#FOVU[FSTVOEEBSBVGIJOv kg“.
t#MÊUUFSO4JFEBOONJU PEFS EFS3FJIFOBDIEVSDIEJF.FTTFSHFCOJT4QFJDIFSQMÊU[F
t&TXFSEFOKFXFJMTEBT%BUVNEBT(FXJDIUVOEEFS#.*BOHF[FJHU%BT%JTQMBZWFSÊOEFSUTFJOF
'BSCFKBOBDI#.*T&SHFCOJTTFCFXFSUFO
6
USER
3 sec
2 sec
BMI
kg
10 Ergebnisse bewerten
Body-Mass-Index (Körpermassenzahl)
'HU%RG\0DVV,QGH[%0,LVWHLQH=DKOGLHKËXıJ]XU%HZHUWXQJGHV.ąUSHUJHZLFKWVKHUDQJH]RJHQZLUG'LH=DKOZLUGDXVGHQ:HUWHQ.ąUSHUJHZLFKWXQG.ąUSHUJUąĔHEHUHFKQHWGLH)RUPHO
KLHU]XODXWHW%RG\0DVV,QGH[ .ąUSHUJHZLFKW.ąUSHUJUąĔHŵ'LH(LQKHLWIĞUGHQ%0,ODXWHW
GHP]XIROJH>NJPŵ@'LH*HZLFKWVHLQWHLOXQJDQKDQGGHV%0,HUIROJWEHL(UZDFKVHQHQDE-DKUHQ
PLWIROJHQGHQ:HUWHQ4XHOOH:+2
Display
Kategorie
Pink
Untergewicht
BMI
Starkes Untergewicht
< 16
0ËĔLJHV8QWHUJHZLFKW
16-16,9
Leichtes Untergewicht
grün
Normalgewicht
gelb
Übergewicht
Präadipositas
rot
Adipositas
(Übergewicht)
Adipositas Grad I
Adipositas Grad II
Adipositas Grad III
Ɗ
Zeitlicher Zusammenhang der Ergebnisse
Beachten Sie, dass nur der langfristige Trend von Bedeutung ist. Kurzfristige
Gewichtsabweichungen innerhalb von wenigen Tagen sind in der Regel durch
Flüssigkeitsverlust bedingt.
7
11 Batteriewechsel
%HLGHU:DDJHPĞVVHQGLH%DWWHULHQHUVHW]WZHUGHQZHQQLP'LVSOD\GHU+LQZHLVŚ/RŗHUVFKHLQW
Falls die Batterien zu schwach sind, schaltet sich die Waage automatisch aus.
Hinweis:
š9HUZHQGHQ6LHEHLMHGHP%DWWHULHZHFKVHO%DWWHULHQJOHLFKHQ7\SVJOHLFKHU0DUNHXQG
gleicher Kapazität.
š:HFKVHOQ6LHDOOH%DWWHULHQLPPHUJOHLFK]HLWLJ
š9HUZHQGHQ6LHNHLQHZLHGHUDXIJDGEDUHQ$NNXV
š9HUZHQGHQ6LHVFKZHUPHWDOOIUHLH%DWWHULHQ
12 Aufbewahrung und Pflege
Die Genauigkeit der Messwerte und Lebensdauer des Gerätes hängt ab vom sorgfältigen Umgang:
Achtung:
š9RQ=HLW]X=HLWVROOWHGDV*HUËWJHUHLQLJWZHUGHQ%HQXW]HQ6LH]XU5HLQLJXQJHLQOHLFKW
DQJHIHXFKWHWHV7XFKDXIGDV6LHEHL%HGDUIHWZDV5HLQLJXQJVPLWWHODXIEULQJHQNąQQHQ
%HQXW]HQ6LHNHLQHVFKDUIHQ5HLQLJXQJVPLWWHOXQGKDOWHQ6LHGDV*HUËWQLHPDOVXQWHU
Wasser.
š6FKĞW]HQ6LHGLH:DDJHYRU6WąĔHQ)HXFKWLJNHLW6WDXE&KHPLNDOLHQVWDUNHQ7HPSHUDWXU
schwankungen, elektromagnetischen Feldern und zu nahen Wärmequellen (Öfen,
Heizungskörper).
13 Entsorgen
%DWWHULHQXQG$NNXVJHKąUHQQLFKWLQGHQ+DXVPĞOO$OV9HUEUDXFKHUVLQG6LHJHVHW]OLFKYHUSIJLFKWHW
gebrauchte Batterien zurückzugeben. Sie können Ihre alten Batterien bei den öffentlichen Sammelstellen Ihrer Gemeinde oder überall dort abgeben, wo Batterien der betreffenden Art verkauft
werden.
Hinweis:
'LHVH=HLFKHQıQGHQ6LHDXIVFKDGVWRijKDOWLJHQ%DWWHULHQ
Pb = Batterie enthält Blei,
&G %DWWHULHHQWKËOW&DGPLXP
Hg = Batterie enthält Quecksilber.
,P,QWHUHVVHGHV8PZHOWVFKXW]HVGDUIGLH:DDJHHLQVFKOLHĔOLFKGHU%DWWHULHQDP(QGHLKUHU
Lebensdauer nicht mit dem Hausmüll entfernt werden. Die Entsorgung kann über entsprechende
Sammelstellen in Ihrem Land erfolgen.
Befolgen Sie die örtlichen Vorschriften bei der Entsorgung der Materialien.
(QWVRUJHQ6LHGDV*HUËWJHPËĔGHU(OHNWURXQG(OHNWURQLN$OWJHUËWH(*5LFKWOLQLH
2002/96/EC – WEEE (Waste Electrical and Electronic Equipment).
%HL5ĞFNIUDJHQZHQGHQ6LHVLFKDQGLHIĞUGLH(QWVRUJXQJ]XVWËQGLJHNRPPXQDOH
Behörde.
14 Was tun bei Problemen?
Stellt die Waage bei der Messung einen Fehler fest, wird Folgendes angezeigt.
Displayanzeige
Ursache
Behebung
2/
Die maximale Tragkraft von
NJZXUGHĞEHUVFKULWWHQ
1XUELVNJEHODVWHQ
Lo
Die Batterien sind fast leer.
Wechseln Sie die Batterien.
no
Abfrageversuch der Speicherplätze eines Benutzers,
zu dem noch keine Werte
gespeichert wurden.
Die Waage schaltet automatisch nach kurzer Zeit
aus; erneut einschalten und
Messvorgang durchführen.
Err
%0,OLHJWDXĔHUKDOEGHV
messbaren Bereichs.
Waage erneut einschalten
und Messvorgang wiederholen.
Keine Messung möglich
Mögliche Fehler
Behebung
Wenn Sie sich zur Messung auf die Waage :DDJHNRUUHNWDNWLYLHUHQDXIŚNJŗZDUWHQ
VWHOOHQEHYRULP'LVSOD\ŚNJŗDQJH]HLJW und Messung wiederholen.
wird, funktioniert die Waage nicht korrekt.
Die Batterien in der Waage sind leer.
Wechseln Sie die Batterien.
Falsche Gewichtsmessung
Mögliche Fehler
Behebung
Waage steht auf Teppichboden.
Waage auf ebenen und festen Boden stellen.
Waage hat falschen Nullpunkt.
Waage auf ebenen, festen Boden stellen. Waage
aktivieren und warten, bis sich die Waage wieder
abschaltet (Waage bis dahin nicht betreten). Danach
Waage erneut aktivieren und Messung wiederholen.
9
15 Garantie und Service
6LHHUKDOWHQ-DKUH*DUDQWLHDE.DXIGDWXPDXI0DWHULDOXQG)DEULNDWLRQVIHKOHUGHV3URGXNWHV
Die Garantie gilt nicht:
šLP)DOOHYRQ6FKËGHQGLHDXIXQVDFKJHPËĔHU%HGLHQXQJEHUXKHQ
šIĞU9HUVFKOHLĔWHLOH]%%DWWHULHQ
šIĞU0ËQJHOGLHGHP.XQGHQEHUHLWVEHL.DXIEHNDQQWZDUHQ
šEHL(LJHQYHUVFKXOGHQGHV.XQGHQ
Die gesetzlichen Gewährleistungen des Kunden bleiben durch die Garantie unberührt. Für Geltendmachung eines Garantiefalles innerhalb der Garantiezeit ist durch den Kunden der
Nachweis des Kaufes zu führen.
'LH*DUDQWLHLVWLQQHUKDOEHLQHV=HLWUDXPHVYRQ-DKUHQDE.DXIGDWXPJHJHQĞEHUGHU
Beurer GmbH
6ąIJLQJHU6WUDĔH
8OP*HUPDQ\
JHOWHQG]XPDFKHQ'HU.XQGHKDWLP*DUDQWLHIDOOGDV5HFKW]XU5HSDUDWXUGHU:DUHEHLXQVHUHQ
HLJHQHQRGHUEHLYRQXQVDXWRULVLHUWHQ:HUNVWËWWHQ:HLWHUJHKHQGH5HFKWHZHUGHQGHP.XQGHQ
(aufgrund der Garantie) nicht eingeräumt.
10
G ENGLISH
Dear Customer,
7KDQN\RXIRUFKRRVLQJRQHRIRXUSURGXFWV2XUQDPHVWDQGVIRUKLJKTXDOLW\WKRURXJKO\WHVWHG
products for the applications in the areas of heat, weight, blood pressure, body temperature, pulse,
gentle therapy, massage and air.
Please read these instructions for use carefully and keep them for later use, be sure to make them
accessible to other users and observe the information they contain.
Best regards,
Your Beurer Team
1
Getting to know your instrument
Function of the unit
These digital glass scale allows you to weigh yourself and to calculate your personal body mass
index (BMI).
The scale is intended for individual, household use.
The scale is equipped with the following functions, which can be used by up to ten different people:
š0HDVXUHPHQWRI\RXUERG\ZHLJKW
š&DOFXODWLRQRI\RXUERG\PDVVLQGH[%0,
š&RORXUHGLQWHUSUHWDWLRQRI\RXU%0,IRUVLPSOHUDWLQJ
The memory function lets up to ten people access up to ten previously measured
weight values as well as the corresponding BMI values.
2
Signs and symbols
The following symbols appear in these instructions.
3
Warning
:DUQLQJLQVWUXFWLRQLQGLFDWLQJDULVNRILQMXU\RUGDPDJHWRKHDOWK
Important
Safety note indicating possible damage to the unit/accessory.
Note
Note on important information.
Safety notes
Safety notes
Warning:
š'RQRWVWDQGRQWKHRXWHUHGJHWRRQHVLGHRIWKHVFDOHRWKHUZLVHLWPD\WLS
š.HHSFKLOGUHQDZD\IURPSDFNDJLQJPDWHULDOVULVNRIVXijRFDWLRQ
š7KHVXUIDFHRIWKHVFDOHLVVOLSSHU\ZKHQGDPSRUZHW
11
Notes on handling batteries
Warning:
š6ZDOORZLQJEDWWHULHVFDQEHH[WUHPHO\GDQJHURXV.HHSWKHEDWWHULHVDQGVFDOHRXWRIWKH
reach of small children. Should a child swallow a battery, seek medical assistance
immediately.
š%DWWHULHVPXVWQRWEHUHFKDUJHGWDNHQDSDUWWKURZQLQWRDQRSHQıUHRUVKRUWFLUFXLWHG
š%DWWHULHVFDQFRQWDLQWR[LQVWKDWDUHKDUPIXOWRKHDOWKDQGWKHHQYLURQPHQW
Always dispose of batteries in accordance with applicable legal regulations.
Do not dispose of batteries with the normal household waste.
Warning:
š5HSODFHZHDNEDWWHULHVEHIRUHWKH\GLVFKDUJHFRPSOHWHO\
š$OZD\VUHSODFHDOOEDWWHULHVDWWKHVDPHWLPHDQGXVHEDWWHULHVRIWKHVDPHW\SH
š/HDNLQJEDWWHULHVPD\GDPDJHWKHGHYLFH,I\RXGRQRWLQWHQGWRXVHWKHGHYLFHIRUORQJHU
periods, remove the batteries from the battery compartment.
š,IDEDWWHU\KDVOHDNHGSXWRQSURWHFWLYHJORYHVDQGFOHDQWKHEDWWHU\FRPSDUWPHQWZLWKD
dry cloth.
General notes
š7KHXQLWLVIRUSHUVRQDOXVHRQO\DQGLVQRWLQWHQGHGIRUPHGLFDORUFRPPHUFLDODSSOLFDWLRQV
š3OHDVHQRWHWKDWWHFKQLFDOO\UHODWHGPHDVXULQJWROHUDQFHVDUHSRVVLEOHDVWKHVFDOHLVQRW
calibrated for professional medical applications.
š7KHVFDOHFDQDFFHSWDPD[LPXPORDGRINJOEVW7KHZHLJKWPHDVXUHPHQWLV
displayed in increments of 100 g (0.2 lb).
š%HIRUHVXEPLWWLQJDQ\FRPSODLQWıUVWFKHFNWKHEDWWHULHVDQGUHSODFHWKHPLIQHFHVVDU\
š5HSDLUVPXVWRQO\EHFDUULHGRXWE\&XVWRPHU6HUYLFHVRUDXWKRULVHGVXSSOLHUV
š6KRXOG\RXKDYHDQ\TXHVWLRQVFRQFHUQLQJWKHXVHRIRXUGHYLFHVSOHDVHFRQWDFW\RXU
dealer or customer service.
š$OOVFDOHVFRPSO\ZLWK(&'LUHFWLYH(&
4
Unit description
2
Overview
1
2
Display
Up button
86(5EXWWRQ
'RZQEXWWRQ
6(7EXWWRQ
1
3
12
5
Initial use
Inserting the batteries (3 x 1,5 V AAA Micro)
Please remove the battery insulating strips and/or position the batteries correctly with regards to
the polarity displayed in the battery compartment. If the scale fails to operate, remove the batteries
completely and reinsert them.
Changing the weight unit
The scale shows the values in kg. You can set the device to measure in kilograms ('kg'), pounds ('lb')
and stones ('st') using the button on the back of the device.
Setting up the scale
Set up the scale on a level and solid surface. A solid surface is a prerequisite for a correct
measurement.
6
Information
The measuring principle
The BMI is calculated using the height value entered and the measured weight value.
General tips
š,ISRVVLEOHDOZD\VZHLJK\RXUVHOIDWWKHVDPHWLPHRIGD\SUHIHUDEO\LQWKHPRUQLQJDIWHUXVLQJ
the toilet, on an empty stomach and unclothed, in order to achieve comparable results.
7
Switch on the scale
Tap your foot quickly, forcefully and audibly on the scale to activate the vibration sensor.
'' and the date appear as a self test until '' is displayed. If necessary, change the location
where the user data is saved.
8
Settings
Set time and date
day month year
SET
The date and time can only be changed when the batteries are taken out and replaced.
To set the current date and time, you must proceed in several stages as follows:
day – month – year – hour – minute.
13
7KHVHWWLQJWREHFKDQJHGZLOOIJDVKHDFKWLPH
š7RFKDQJHDVHWWLQJSUHVVWKHEXWWRQV and .
š7RVDYHWKHVHWWLQJDQGPRYHRQWRWKHQH[WRQHRUWRFORVHWKHVHWWLQJSUHVVWKH6(7EXWWRQ
The scale will switch off automatically after this procedure.
7KHVFDOHZLOODOVRVZLWFKRijLIQREXWWRQVDUHSUHVVHGIRUPRUHWKDQVHFRQGV
Setting user data
The scale comes equipped with 10 locations for storing user data and space for more than 10
measurement values per user. You and, for example, the members of your family can save and
later access the following personal settings in the storage locations:
Sequence
User data
Parameters
1
Memory position
1 to 10
2
Body height
100 to 220 cm
(3'-03" to 7'-03")
6ZLWFKRQWKHVFDOHVHH6ZLWFKRQWKHVFDOH:KHQŗ kg” is displayed:
š3UHVVWKH
86(5
EXWWRQXQWLO\RXKDYHUHDFKHGWKHGHVLUHGPHPRU\VSDFH$IWHUWKHGLVSOD\
VKRZVWKHSUHVHWERG\KHLJKWŗ kg” will appear.
š7RFKDQJHWKHERG\KHLJKWSUHVVŗ6(7Ř
š3UHVVWKH and buttons to set your height. Keep button pressed for quicker run.
š)LQLVKHQWHULQJGDWDE\SUHVVLQJWKH6(7EXWWRQ
USER
2 sec
3 sec
SET
SET
Please note: if you change the height value at a later date, all measurement data
saved in your storage location up until that point will be deleted.
9
Operation
Weighing yourself and calculating BMI
To weigh yourself and to calculate your personal body mass index:
š6ZLWFKRQWKHVFDOHVHH6ZLWFKRQWKHVFDOH
š7KHQVHOHFWWKHVWRUDJHORFDWLRQZKHUH\RXUVHWWLQJVKDYHEHHQVDYHGXVLQJWKH'USER' button.
1H[W\RXUVDYHGKHLJKWYDOXHZLOOEHGLVSOD\HG:DLWXQWLOŗ kg” is displayed again. You can
now use the scale. Stand still whilst weighing yourself.
3 sec
USER
2 sec
The date, weight and BMI are each displayed.
The display changes colour depending on the BMI (see page 10, Evaluate results).
2QHYDOXHZLOOEHVDYHGSHUGD\SHUSHUVRQ,I\RXWDNHVHYHUDOPHDVXUHPHQWVSHUGD\WKH
most recent value will be saved. The data saved previously on that day up will be overwritten.
The scale switches itself off after approx. 10 seconds.
Accessing saved measurements
To access the saved measurements of the currently selected user:
t4XJUDIPOUIFTDBMFTFF4XJUDIPOUIFTDBMF
hLHhJTEJTQMBZFEBGUFSUIFTFMGUFTUEJTQMBZ
t4FMFDUUIFNFNPSZTQBDFCZQSFTTJOHUIFh64&3hCVUUPOTFWFSBMUJNFTJGOFDFTTBSZ5IFIFJHIU
PGUIFTFMFDUFEVTFSBOEUIFOIJTIFSMBTUTBWFESFTVMUJTEJTQMBZFEBHBJOJGZPVEPOPUQSFTTBOZ
CVUUPOTGPSUISFFTFDPOETBGUFSUIBUhLHhXJMMBQQFBS
t5IFOCSPXTFUISPVHIUIFNFNPSZTQBDFTGPSUIFTBWFEWBMVFTPOFCZPOFVTJOHUIF PS
CVUUPOT
t5IFEBUFXFJHIUBOE#.*BSFFBDIEJTQMBZFE5IFEJTQMBZDIBOHFTDPMPVSEFQFOEJOHPOUIF#.*
TFF&WBMVBUJPOPGSFTVMUT
USER
3 sec
2 sec
BMI
kg
10 Evaluation of results
Body mass index (BMI)
The body mass index (BMI) is a number that is often called upon to evaluate body weight. The
number is calculated from body weight and height, the formula is – body mass index = body
ZHLJKWKHLJKWŵ7KHPHDVXUHPHQWXQLWIRU%0,LV>NJPŵ@$FFRUGLQJWRWKH%0,ZHLJKWLV
FODVVLıHGIRUDGXOWV\HDUVDQGRYHUXVLQJWKHIROORZLQJYDOXHVVRXUFH:+2
Display
&DWHJRU\
Pink
Underweight
BMI
Severely underweight
< 16
Moderately underweight
16-16,9
Slightly underweight
Green
Normal weight
Yellow
2YHUZHLJKW
Pre-obese
5HG
2EHVHRYHUZHLJKW
&ODVV,REHVH
&ODVV,,REHVH
&ODVV,,,REHVH
Ɗ
Results in relation to time
Remember that only long-term trends are important. Short-term fluctuations in
weight over a few days are usually the result of a loss of fluid.
11 Replacing batteries
7KHEDWWHULHVLQWKHVFDOHPXVWEHUHSODFHGLIWKHPHVVDJHŗ/RŘDSSHDUVLQWKHGLVSOD\,IWKH
EDWWHULHVDUHWRRIJDWWKHQWKHVFDOHZLOOVZLWFKRijDXWRPDWLFDOO\
Note:
š:KHQFKDQJLQJEDWWHULHVDOZD\VXVHEDWWHULHVRIWKHVDPHW\SHEUDQGDQGFDSDFLW\
Always replace all batteries simultaneously.
š'RQRWXVHUHFKDUJHDEOHEDWWHULHV
š8VHEDWWHULHVWKDWDUHIUHHRIKHDY\PHWDOV
12 Storage and maintenance
The precision of the measurements and service life of the device depends on its careful handling:
Important:
š7KHXQLWVKRXOGEHFOHDQHGRFFDVLRQDOO\8VHDVOLJKWO\GDPSFORWKWRFOHDQWKHGHYLFH<RX
may also use a small quantity of cleaning agent if desired. Do not use abrasive detergents
and never immerse the unit in water.
š3URWHFWWKHVFDOHIURPNQRFNVGDPSGXVWFKHPLFDOVGUDVWLFFKDQJHVLQWHPSHUDWXUH
HOHFWURPDJQHWLFıHOGVDQGQHDUE\VRXUFHVRIKHDWRYHQVKHDWHUV'RQRWSUHVVWKH
EXWWRQVYLROHQWO\RUZLWKSRLQWHGREMHFWV
16
13 Disposal
Standard and rechargeable batteries should not be disposed of separately from the household
waste. As a consumer, you are legally obliged to return used batteries for proper disposal. You can
hand in your used batteries at public collection points in your district or sales outlets where batteries
of this type are sold.
Note:
The codes below are printed on batteries containing harmful substances:
Pb = Battery contains lead,
&G %DWWHU\FRQWDLQVFDGPLXP
Hg = Battery contains mercury.
For environmental reasons, do not dispose of the scale with the batteries in the household waste at
the end of its useful life. Dispose of the unit at a suitable local collection or recycling point.
2EVHUYHWKHORFDOUHJXODWLRQVIRUPDWHULDOGLVSRVDO
'LVSRVHRIWKHXQLWLQDFFRUGDQFHZLWK(&'LUHFWLYH2002/96/EC – WEEE (Waste
Electrical and Electronic Equipment).
If you have any questions, please contact the local authorities responsible for waste
disposal.
14 What if there are problems?
If the scale detects and error when measuring, the following is displayed.
Display
&DXVH
5HPHG\
2/
The maximum load capacity
RINJZDVH[FHHGHG
Do not load the unit with
RYHUNJ
Lo
The batteries are almost
empty.
5HSODFHWKHEDWWHULHV
no
Accessing a user storage
location in which no values
have been saved.
The scale will switch off
automatically after a short
while; switch the scale on
again and proceed with the
measurements.
Err
BMI is outside the measurable range.
Switch the scale on again
and repeat the measurements.
17
No measurement possible
Possible errors
5HPHG\
If you stand on the scale to measure your
YDOXHVEHIRUHWKHGLVSOD\VKRZVŗ kg”,
the scale will not function correctly.
&RUUHFWO\DFWLYDWHWKHVFDOHZDLWIRUŗ kg” to be
displayed) and repeat the measurement.
The batteries in the scale are empty.
5HSODFHWKHEDWWHULHV
Incorrect weight measurement
Possible errors
5HPHG\
Scale is on carpeting.
Place the scale on a level and solid surface.
Incorrect zero point of scale.
3ODFHDVFDOHRQDVHFXUHIJDWVXUIDFH6ZLWFKRQ
the scale and wait until the scale automatically
switches off again (do not step onto the scale before
then). Then switch on the scale again and repeat the
measurement.
F FRANÇAIS
Chère cliente, cher client,
Nous sommes heureux que vous ayez choisi un produit de notre assortiment. Notre nom est synoQ\PHGHSURGXLWVGHTXDOLWÜKDXWGHJDPPHD\DQWVXELGHVYÜULıFDWLRQVDSSURIRQGLHVLOVWURXYHQW
leur application dans le domaine de la chaleur, du contrôle du poids, de la pression artérielle, de la
mesure de température du corps et du pouls, des thérapies douces, des massages et de l’air.
Lisez attentivement ce mode d’emploi, conservez-le pour un usage ultérieur, mettez-le à la disposition des autres utilisateurs et suivez les consignes.
Avec nos sentiments dévoués
Beurer et son équipe
1
Familiarisation avec l’appareil
Fonctions de l’appareil
&HWWHEDODQFHHQYHUUHQXPÜULTXHVHUWÇYRXVSHVHUHWÇFDOFXOHUYRWUHLQGLFHGHPDVVHFRUSRUHOOH
,0&
Le pèse-personne est conçu pour une utilisation propre dans le domaine privé.
La balance dispose des fonctions suivantes pouvant être utilisées par un maximum de 10 personnes :
šPHVXUHGXSRLGVFRUSRUHO
šFDOFXOGHOŖLQGLFHGHPDVVHFRUSRUHOOH,0&
šFRGHFRXOHXUGŖLQWHUSUÜWDWLRQGHOŖ,0&SRXUXQFODVVHPHQWIDFLOH
La fonction d’enregistrement permet à 10 personnes d’accéder aux 10 derniers poids mesurés
HWDX[YDOHXUVGŖ,0&FDOFXOÜHV
2
Symboles utilisés
Voici les symboles utilisés dans la notice d’utilisation :
Avertissement &HV\PEROHYRXVDYHUWLWGHVULVTXHVGHEOHVVXUHVRXGHVGDQJHUV
pour votre santé.
Attention
&HV\PEROHYRXVDYHUWLWGHVÜYHQWXHOVGRPPDJHVDXQLYHDXGH
l’appareil ou d’un accessoire.
Remarque
&HV\PEROHLQGLTXHGHVLQIRUPDWLRQVLPSRUWDQWHV
19
3
Consignes de sécurité
Consignes de sécurité
Avertissement:
š1HPRQWH]SDVVXUXQVHXOFăWÜQLVXUOHERUGGXSÛVHSHUVRQQHLOULVTXHUDLWGHEDVFXOHUHW
GHYRXVIDLUHWRPEHU
š1HODLVVH]SDVOŖHPEDOODJHÇODSRUWÜHGHVHQIDQWVULVTXHGŖÜWRXijHPHQW
š/DVXUIDFHGHODEDODQFHHVWJOLVVDQWHORUVTXŖHOOHHVWKXPLGHRXPRXLOOÜH
Remarques relatives aux piles
Avertissement :
š/HVSLOHVVRQWH[WUÝPHPHQWGDQJHUHXVHVVLHOOHVVRQWDYDOÜHV/HVSLOHVHWOHSÛVHSHUVRQQH
doivent être tenus hors de portée des enfants. En cas d’accident, consultez immédiatement
XQPÜGHFLQ
š/HVSLOHVQHGRLYHQWÝWUHQLUHFKDUJÜHVQLUÜDFWLYÜHVSDUGŖDXWUHVPÜWKRGHVQLGÜPRQWÜHV
QLMHWÜHVDXIHXQLFRXUWFLUFXLWÜHV
š/HVSLOHVSHXYHQWFRQWHQLUGHVSURGXLWVWR[LTXHVTXLVRQWQXLVLEOHVSRXUODVDQWÜHW
l’environnement. Eliminez les piles conformément aux dispositions légales en vigueur. Ne
MHWH]MDPDLVOHVSLOHVDYHFOHVRUGXUHVPÜQDJÛUHV
Attention :
š5HPSODFH]ÇWHPSVOHVSLOHVXVDJÜHV
š&KDQJH]V\VWÜPDWLTXHPHQWOHVSLOHVÇWHPSVHWXWLOLVH]GHVSLOHVGHPÝPHW\SH
š'HVSLOHVTXLIXLHQWSHXYHQWHQGRPPDJHUOŖDSSDUHLO6LYRXVQŖXWLOLVH]SDVOŖDSSDUHLOSHQGDQW
une période prolongée, retirez les piles du compartiment à piles.
š(QFDVGHIXLWHHQıOH]GHVJDQWVSURWHFWHXUVHWQHWWR\H]OHFRPSDUWLPHQWÇSLOHVDYHFXQ
chiff on sec.
Remarques générales
š/ŖDSSDUHLOHVWSUÜYXSRXUXQXVDJHH[FOXVLYHPHQWSHUVRQQHO,OQŖHVWHQDXFXQFDVGHVWLQÜÇ
GHVıQVPÜGLFDOHVRXFRPPHUFLDOHV
š'HVYDULDWLRQVGHPHVXUHGŖRUGUHWHFKQLTXHVRQWSRVVLEOHVFHSÛVHSHUVRQQHQŖÜWDQWSDV
étalonné en vue d’un usage médical professionnel.
š/DSRUWÜHPD[LPDOHGHODEDODQFHHVWGHNJOE6W/RUVGHODSHVÜHOHV
résultats s‘affichent par incréments de 100 g (0,2 lb).
š&HSHQGDQWDYDQWWRXWHUÜFODPDWLRQYÜULıH]GŖDERUGOHVSLOHVHWFKDQJH]OHVOHFDVÜFKÜDQW
š6HXOOHVHUYLFHFOLHQWRXXQRSÜUDWHXUDXWRULVÜSHXWSURFÜGHUÇXQHUÜSDUDWLRQ
š3RXUWRXWHTXHVWLRQVXUOŖXWLOLVDWLRQGHQRVDSSDUHLOVDGUHVVH]YRXVÇYRWUHUHYHQGHXURXÇ
notre service après-vente.
š7RXVOHVSÛVHSHUVRQQHVVRQWFRQIRUPHVÇODGLUHFWLYH&(0&((
20
4
Description de l’appareil
2
Aperçu
1
2
5
Affichage
Touche Haut
86(5%DV
7RXFKH%DV
7RXFKHGHPLVHHQPDUFKH6(7
1
3
Mise en service
Insérez les piles (3 x 1,5V AAA Micro)
Veuillez retirer la bande de protection des batteries et/ou insérez les batteries selon la polarisation
illustrée dans le compartiment à piles. Si la balance n’affiche aucune fonction, retirez complètement
les piles et replacez-les à nouveau.
Modifi cation de l’unité de poids
Le pèse-personne affi che les valeurs en kg. Vous pouvez régler l’unité en kilogrammes « kg », livres
« lb » ou stones « st » à l’aide du bouton poussoir situé à l’arrière de l’appareil.
Installation du pèse-personne
Posez le pèse-personne sur un support stable et plan. Une surface d’assise solide constitue la
condition préalable pour une mesure correcte.
6
Informations
Principe de mesure
/Ŗ,0&HVWFDOFXOÜÇSDUWLUGHODWDLOOHVDLVLHHWGXSRLGVPHVXUÜ
Conseils généraux
š3HVH]YRXVVLSRVVLEOHÇODPÝPHKHXUHGHSUÜIÜUHQFHOHPDWLQDSUÛVODVHOOHÇMHXQHWQXH
DıQGŖREWHQLUGHVUÜVXOWDWVFRPSDUDEOHV
7
Mise en marche de la balance
)UDSSH]ODEDODQFHGXSLHGEULÛYHPHQWIRUWHPHQWHWGHID×RQELHQDXGLEOHDıQGŖDFWLYHUOHFDSWHXU
de choc.
Elle affiche « ŞHQDXWRWHVWSXLVODGDWHMXVTX
ÇFHTXHŝ » s’affiche.
21
8
Réglage
La date et l’heure
MRXU
mois année
SET
/DGDWHHWOŖKHXUHQHSHXYHQWÝWUHPRGLıÜHVTXŖDSUÛVDYRLUUHWLUÜHWUÜLQVÜUÜOHVSLOHV
Suivez les étapes suivantes lors du réglage de la date et de l’heure actuelles :
MRXUşPRLVşDQQÜHşKHXUHVşPLQXWHV
/DSDUWLHÇPRGLıHUFOLJQRWH
š$SSX\H]VXUOHVWRXFKHV et SRXUPRGLıHUXQSDUDPÛWUH
š$SSX\H]VXUODWRXFKH6(7SRXUHQUHJLVWUHUOHUÜJODJHHWSDVVHUDXUÜJODJHVXLYDQWRXSRXUTXLWWHU
les réglages.
La balance s’éteint automatiquement après cette opération.
6LDXFXQHWRXFKHQŖHVWDFWLRQQÜHSHQGDQWSOXVGHVHFRQGHVODEDODQFHVŖÜWHLQWÜJDOHPHQW
Réglage des données de l’utilisateur
La balance dispose de 10 emplacements de sauvegarde utilisateur et de 10 emplacements de
sauvegarde des résultats de mesure par utilisateur. Dans les emplacements de sauvegarde
utilisateur, vous et par exemple les membres de votre famille pouvez enregistrer et récupérer les
paramètres personnels suivants:
Séquence
Données de l’utilisateur
Valeurs de réglage
1
Emplacement de mémoire
1 à 10
2
Taille
100 à 220 cm
(3'-03" à 7'-03")
Allumez la balance (cf. 7. Mise en marche de la balance). Quand la valeur « kg » s’affiche :
š$SSX\H]VXUODWRXFKHŝ86(5ŞMXVTXŖÇFHTXHOŖHPSODFHPHQWGHVDXYHJDUGHGHYRWUHFKRL[
s’affiche. La taille que vous avez réglée s'affiche d'abord. Attendez que « kg » s’affiche de
nouveau.
š3RXUPRGLıHUODWDLOOHDSSX\H]VXUŝ6(7Ş
š$SSX\H]VXUOHVWRXFKHV et SRXUUÜJOHUODWDLOOH0DLQWHQH]ODWRXFKHHQIRQFÜHSRXUGÜıOHU
rapidement.
š7HUPLQH]ODVDLVLHDYHFODWRXFKHŝ6(7Ş
2 sec
USER
3 sec
SET
22
SET
Attention : si vous modifi ez le réglage de votre taille ultérieurement, tous les
résultats de mesure enregistrés jusque là sur votre emplacement de sauvegarde
utilisateur seront supprimés.
9
Utilisation
Pesée et calcul de l’IMC
Pour se peser et calculer son indice de masse corporelle :
š$OOXPH]ODEDODQFHFI$OOXPHUODEDODQFH
š&KRLVLVVH]HQVXLWHO
HPSODFHPHQWGHVDXYHJDUGHXWLOLVDWHXUDYHF86(5FRPSUHQDQWYRVUÜJODJHV
enregistrés. La taille que vous avez saisie s'affiche d'abord. Attendez que « kg » s’affiche de
nouveau. Vous pouvez à présent monter sur la balance pour une mesure. Ne bougez pas pendant
la mesure.
3 sec
USER
2 sec
/DGDWHOHSRLGVRXOŖ,0&VŖDĴFKHQW
/DFRXOHXUGHOŖÜFUDQVHPRGLıHVHORQOŖ,0&YRLUSxYDOXHUOHVUÜVXOWDWV
8QHYDOHXUHVWHQUHJLVWUÜHSDUMRXUHWSDUSHUVRQQH6LYRXVHijHFWXH]SOXVLHXUVPHVXUHVSDU
MRXUODGHUQLÛUHYDOHXUPHVXUÜHVŖDĴFKH/HVGRQQÜHVHQUHJLVWUÜHVSOXVWăWGDQVODMRXUQÜH
sont remplacées.
Au bout d’environ 10 secondes, la balance s’éteint automatiquement.
Récupération des résultats de mesure enregistrés
Pour récupérer les résultats de mesure enregistrés de l’utilisateur actuel :
tAllumez la balance (cf. 7. Mise en marche de la balance).
t$IPJTJTTF[MFNQMBDFNFOUEFTBVWFHBSEFVUJMJTBUFVSFOBQQVZBOUQMVTJFVSTGPJTTVSMBUPVDIFj
64&3x4JWPVTOBQQVZF[QMVTTVSBVDVOFUPVDIFMBUBJMMFEFMVUJMJTBUFVSDIPJTJTBGmDIFBVCPVU
EFOWJSPOTFDPOEFTQVJTj kg ».
t"WFD PV QBSDPVSF[MFTFNQMBDFNFOUTEFTBVWFHBSEFEFTSÏTVMUBUTEFNFTVSF
t-BEBUFMFQPJETFUM*.$TBGmDIFOU-BDPVMFVSEFMÏDSBOTFNPEJmFTFMPOM*.$WPJSQ²WBMVBUJPOEFTSÏTVMUBUT
23
USER
3 sec
2 sec
BMI
kg
10 Evaluation des résultats
Indice de masse corporelle
/ŕLQGLFHGHPDVVHFRUSRUHOOH,0&HVWXQFKLijUHVRXYHQWXWLOLVÜSRXUOŖÜYDOXDWLRQGXSRLGV,OHVW
calculé à partir des valeurs de poids et de taille. La formule est la suivante : Indice de masse corpoUHOOH,0& SRLGVWDLOOHŵ/ŖXQLWÜXWLOLVÜHSRXUOŖ,0&HVWODVXLYDQWH>NJPŵ@&KH]OHVDGXOWHVÇ
SDUWLUGHDQVOHVSRLGVVRQWFODVVÜVÇOŖDLGHGHOŖ,0&VHORQOHVYDOHXUVVXLYDQWHV6RXUFH206
xFUDQ
&DWÜJRULH
rose
Insuffi sance pondérale
,0&
Forte insuffi sance pondérale
< 16
Faible insuffi sance
pondérale
16-16,9
Légère insuffi sance
pondérale
Vert
Poids normal
Jaune
Surpoids
Préadipose
5RXJH
Adipose (surpoids)
Adipose de degré I
Adipose de degré II
Adipose de degré III
Ɗ
Corrélation des résultats dans le temps
Seule compte la tendance à long terme. Des écarts de poids de courte durée
enregistrés en l’espace de quelques jours ne sont généralement dus qu’à une simple
perte de liquides.
11 Remplacement des piles
Les batteries de la balance doivent être remplacées lorsque l’indication « Lo » s’affiche.
Lorsque les batteries sont trop faibles, la balance s’éteint automatiquement.
Remarque:
š8WLOLVH]SRXUFKDTXHFKDQJHPHQWGHSLOHVGHVSLOHVGHPÝPHW\SHGHPÝPHPDUTXHHWGH
même capacité.
š5HPSODFH]V\VWÜPDWLTXHPHQWWRXWHVOHVSLOHVHQPÝPHWHPSV
š1ŖXWLOLVH]SDVGŖDFFXPXODWHXUVUHFKDUJHDEOHV
š8WLOLVH]GHVSLOHVVDQVPÜWDOORXUG
12 Stockage et entretien
La précision des valeurs mesurées et la durée de vie de l’appareil dépend du maniement avec soin :
Attention:
š1HWWR\H]GHWHPSVHQWHPSVOŖDSSDUHLO3RXUOHQHWWR\DJHXWLOLVH]XQHVHUYLHWWHKXPLGHVXU
laquelle vous pouvez mettre un peu de produit nettoyant au besoin.
1ŖXWLOLVH]SDVGHSURGXLWVGHQHWWR\DJHDJUHVVLIVHWQŖLPPHUJH]MDPDLVOŖDSSDUHLOGDQVOŖHDX
š3URWÜJH]ODEDODQFHFRQWUHOHVFRXSVOŖKXPLGLWÜODSRXVVLÛUHOHVSURGXLWVFKLPLTXHVOHV
fortes variations de température, les champs électromagnétiques et les sources de chaleur
WURSSURFKHVIRXUUDGLDWHXU1ŖDSSX\H]SDVYLROHPPHQWRXDYHFGHVREMHWVSRLQWXV
sur les touches.
13 Elimination
/HVSLOHVXVDJÜHVQHGRLYHQWSDVÝWUHMHWÜHVDYHFOHVRUGXUHVPÜQDJÛUHV(QWDQWTXHFRQVRPPDteur / consommatrice, la législation vous impose de restituer les piles usagées. Vous pouvez
déposer les piles usagées dans les points de collecte locaux réservés à cet usage ou dans tout
magasin vendant des piles de ce type.
Remarque:
&HSLFWRJUDPPHVHWURXYHVXUOHVSLOHVÇVXEVWDQFHVQRFLYHV
Pb = pile contenant du plomb,
&G SLOHFRQWHQDQWGXFDGPLXP
Hg = pile contenant du mercure.
$ıQGHUHVSHFWHUOŖHQYLURQQHPHQWQHMHWH]SDVOHSÛVHSHUVRQQHQLOHVSLOHVGDQVOHVRUGXUHV
ménagères, une fois ceux-ci devenus inutilisables. L’élimination doit se faire par le biais des
points de collecte compétents dans votre pays.
5HVSHFWH]OHVUÜJOHPHQWDWLRQVORFDOHVHQPDWLÛUHGŖÜOLPLQDWLRQGHPDWÜULDX[
Eliminez l’appareil conformément à la directive européenne 2002/96/EC – WEEE
(Waste Electrical and Electronic Equipment) relative aux appareils électriques et
électroniques usagés.
Pour toute question, adressez-vous aux collectivités locales responsables de
l’élimination et du recyclage de ces produits.
14 Que faire en cas de problèmes ?
L’affichage suivant apparaît si le pèse-personne détecte une erreur lors de la mesure.
Affichage
&DXVH
5HPÛGH
2/
La force portante maximale
GHNJDÜWÜGÜSDVVÜH
&KDUJH]XQLTXHPHQWMXVTXŖÇ
NJ
Lo
Les piles sont presque
déchargées.
5HPSODFH]OHVSLOHV
no
Tentative de récupérer les
emplacements de sauvegarde d’un utilisateur
pour lequel aucune valeur
n’a encore été enregistrée.
La balance s’éteint automatiquement après quelques
instants ; rallumez et effectuez les mesures.
Err
/Ŗ,0&HVWKRUVSODJH
5DOOXPH]ODEDODQFHHW
effectuez de nouveau les
mesures.
Pas de mesure possible
&DXVHVSRVVLEOHVGŖHUUHXUV
5HPÛGH
Si vous montez sur la balance pour la
mesure avant que « kg » s’affiche sur
l’écran, la balance ne fonctionnera pas
correctement.
Activer correctement la balance (attendre le
« kg ») et répéter la mesure.
Les piles du pèse-personne sont déchargées.
5HPSODFH]OHVSLOHV
Mesure de poids erronée
&DXVHVSRVVLEOHVGŖHUUHXUV
5HPÛGH
Le pèse-personne repose sur une moquette. Posez le pèse-personne sur un sol plan et stable.
La position 0 du pèse-personne est fausse. Activez le pèse-personne et attendez qu’il
s’éteigne (ne montez pas sur le pèse-personne
pendant ce temps). Activez ensuite de nouveau le
pèse-personne et recommencez la mesure.
26
E ESPAÑOL
Estimados clientes:
Es un placer para nosotros que usted haya decidido adquirir un producto de nuestra colección.
Nuestro nombre es sinónimo de productos de alta y calidad estrictamente controlada en los
campos de energía térmica, peso, presión sanguínea, temperatura del cuerpo, pulso, terapias
VXDYHVPDVDMH\DLUH
Sírvase leer las presentes instrucciones para el uso detenidamente; guarde el manual para usarlo
ulteriormente; póngalo a disposición de otros usuarios y observe las instrucciones.
Les saluda cordialmente
Su equipo Beurer
1
Introducción
Funciones del aparato
(VWDEÈVFXODGLJLWDOGHYLGULRVLUYHSDUDSHVDUVH\FDOFXODUVXìQGLFHGHPDVDFRUSRUDO,0&
La báscula está diseñada para el uso doméstico.
La báscula dispone de las siguientes funciones, que pueden usar un máximo de 10 personas:
šPHGLFLĂQGHOSHVRFRUSRUDO
šFÈOFXORGHOìQGLFHGHPDVDFRUSRUDO,0&
šLQWHUSUHWDFLĂQSRUFRORUHVGHO,0&SDUDXQDIÈFLOFODVLıFDFLĂQ
La función de almacenamiento permite a un máximo de 10 personas acceder a los 10 últimos valoUHVGHSHVRREWHQLGRV\DORVYDORUHVGH,0&FDOFXODGRVDGLFLRQDOPHQWH
2
Aclaración de las ilustraciones
En estas instrucciones de uso se utilizan los símbolos siguientes.
Advertencia Nota de advertencia sobre peligro de lesiones o riesgo para su salud.
3
Atención
Indicación de seguridad sobre posibles daños en el aparato/accesorios.
Aviso
Aviso sobre informaciones importantes.
Indicaciones de seguridad
Indicaciones de seguridad
Advertencia:
š1RVHFRORTXHVREUHHOERUGHPÈVH[WHULRUGHODEÈVFXODSHOLJURGHYXHOFR
š0DQWHQJDDORVQLþRVDOHMDGRVGHOPDWHULDOGHHPEDODMHSHOLJURGHDVı[LD
š/DVXSHUıFLHGHODEÈVFXODSXHGHUHVEDODUVLHVWÈPRMDGDRKěPHGD
27
Indicaciones para el manejo de pilas
Advertencia:
š/DVSLODVSXHGHQUHSUHVHQWDUXQJUDYHULHVJRSDUDODVDOXGHQFDVRGHTXHVHWUDJXHQ
Mantenga las pilas y la báscula fuera del alcance de los niños pequeños.
En caso de tragarse una pila, acuda de inmediato al médico.
š/DVSLODVQRVHSXHGHQFDUJDURUHDFWLYDUSRURWURVPHGLRVGHVPRQWDUHFKDUDOIXHJRR
poner en cortocircuito.
š/DVSLODVSXHGHQFRQWHQHUVXVWDQFLDVQRFLYDVSDUDODVDOXG\HOPHGLRDPELHQWH
Elimínelas según lo establecido en la normativa legal correspondiente. No tire nunca las
pilas a la basura doméstica normal.
Atención:
š&DPELHODVSLODVTXHWHQJDQSRFDFDUJDFRQODGHELGDDQWHODFLĂQ
š&DPELHVLHPSUHWRGDVODVSLODVDOPLVPRWLHPSR\XWLOLFHSLODVGHOPLVPRWLSR
š/DVIXJDVHQODVSLODVSXHGHQRFDVLRQDUGDþRVHQHODSDUDWR6LQRYDDXWLOL]DUHODSDUDWR
durante un periodo prolongado, retire las pilas del compartimento.
š6LXQDSLODVHGHUUDPDSĂQJDVHJXDQWHVGHSURWHFFLĂQ\OLPSLHHOFRPSDUWLPHQWRGHODV
pilas con un paño seco.
Indicaciones generales
š(ODSDUDWRHVGHXVRěQLFDPHQWHSULYDGRQRVHSXHGHXWLOL]DUFRQıQHVPÜGLFRVR
comerciales.
š7HQJDHQFXHQWDTXHHVSRVLEOHTXHH[LVWDQWROHUDQFLDVGHPHGLFLĂQ\DTXHQRVHWUDWDGH
una báscula apropiada para el empleo médico profesional.
š/DFDSDFLGDGGHFDUJDGHODEÈVFXODHVGHNJFRPRPÈ[LPROE6W(QHO
SHVDMHORVUHVXOWDGRVVHLQGLFDQHQSDVRVGHJOEOE
š$QWHVGHXQDUHFODPDFLĂQFRPSUXHEHSULPHURODVSLODV\FÈPELHODVVLIXHUDQHFHVDULR
š/DVUHSDUDFLRQHVVĂORGHEHQVHUUHDOL]DGDVSRUHOVHUYLFLRGHDWHQFLĂQDOFOLHQWHRSRU
comerciantes autorizados.
š6LDěQWLHQHSUHJXQWDVVREUHODXWLOL]DFLĂQGHQXHVWURDSDUDWRSĂQJDVHHQFRQWDFWRFRQHO
vendedor o el servicio de asistencia al cliente.
š7RGDVODVEÈVFXODVFXPSOHQOD'LUHFWLYD&((&
4
Descripción del aparato
2
Vista general
1
2
Indicación
Botón de subir
%RWĂQ86(5
%RWĂQGHEDMDU
%RWĂQ6(7
1
3
5
Puesta en marcha
Colocación de las pilas (3 x 1,5V AAA Micro)
5HWLUHODFLQWDGHVHJXULGDGGHODVSLODV\RLQVHUWHODVSLODVGHDFXHUGRFRQODSRODULGDGUHSUHVHQtada en el compartimento de pilas. Si la báscula no muestra ninguna función, retire completamente
las pilas y vuelva a colocarlas.
Cambio de unidades
La báscula muestra los valores en kg. Utilizando el botón que se encuentra en la parte posterior del
DSDUDWRSXHGHDMXVWDUODXQLGDGGHSHVRDNLORJUDPRŗNJŘOLEUDŗOEŘRVWRQHŗVWŘ
Colocación de la báscula
&RORTXHODEÈVFXODVREUHXQDVXSHUıFLHıUPH\SODQDSDUDREWHQHUXQDPHGLFLĂQFRUUHFWD
6
Información
El principio de medición
(O,0&VHFDOFXODDSDUWLUGHODHVWDWXUDLQWURGXFLGD\HOSHVRREWHQLGR
Consejos generales
š,QWHQWHSHVDUVHVLHPSUHDODPLVPDKRUDPHMRUSRUODPDþDQDWUDVKDEHUHVWDGRHQHOVHUYLFLR
en ayunas y sin ropa para obtener resultados comparables.
7
Conectar la báscula
Suba en la báscula con el pie brevemente y con fuerza hasta que se oiga, para así activar el sensor
de vibraciones.
&RPRDXWRFRPSUREDFLĂQDSDUHFHŗŘ\ODIHFKDKDVWDTXHVHPXHVWUDŗ”.
8
Ajustes
Ajuste de los datos de usuario
dia mes
añ
SET
Sólo se pueden cambiar la fecha y la hora después de sacar y volver a colocar las pilas.
$ODMXVWDUODIHFKD\ODKRUDDFWXDOHVSURFHGDSDVRDSDVRGìDşPHVşDþRşKRUDVşPLQXWRV
29
/DSDUWHTXHHVWÜDFWLYDGDSDUDVXPRGLıFDFLĂQSDUSDGHDUÈ
š3XOVHORVERWRQHV y SDUDPRGLıFDUXQYDORU
š3XOVHHOERWĂQ6(7SDUDDOPDFHQDUXQDMXVWH\DFFHGHUDODSUĂ[LPDÈUHDGHDMXVWHRELHQ
FHUUDUORVDMXVWHV
Tras este proceso la báscula se desconecta automáticamente.
/DEÈVFXODVHGHVFRQHFWDWDPELÜQVLWUDQVFXUUHQPÈVGHVHJXQGRVVLQTXHVHDFFLRQHQLQJěQ
botón.
Ajuste de los datos de usuario
La báscula dispone de 10 espacios de memoria para usuarios y de 10 espacios para resultados
GHPHGLFLĂQSRUFDGDXVXDULR(QORVHVSDFLRVGHPHPRULDSDUDXVXDULRXVWHG\SRUHMHPSORORV
PLHPEURVGHVXIDPLOLDSXHGHQJXDUGDU\YROYHUDDFFHGHUDORVVLJXLHQWHVDMXVWHVSHUVRQDOHV
Secuencia
Datos de usuario
9DORUHVGHDMXVWH
1
Posición de la memoria
de 1 a 10
2
Altura
de 100 a 220 cm
(de 3'-03" a 7'-03")
(QFLHQGDODEÈVFXODYÜDVH&RQHFWDUODEÈVFXOD&XDQGRDSDUH]FDODLQGLFDFLĂQŗ kg”:
š3XOVHODWHFODŗ86(5ŘKDVWDTXHVHYLVXDOLFHHOSXHVWRGHDOPDFHQDPLHQWRGHVHDGR3ULPHURVH
muestra la estatura introducida. Espere hasta que vuelva a aparecer " kg".
š3DUDPRGLıFDUODHVWDWXUDSXOVHŗ6(7Ř
š3XOVHORVERWRQHV y SDUDDMXVWDUODHVWDWXUD0DQWHQJDODWHFODSXOVDGDSDUDDYDQ]DUGHSULVD
š)LQDOLFHODLQWURGXFFLĂQFRQODWHFODŗ6(7Ř
USER
2 sec
3 sec
SET
SET
Atención: Si modifi ca posteriormente el valor de su estatura, se borrarán todos los
resultados de medición guardados hasta ese momento en su espacio de memoria
personal.
9
Manejo
Pesaje y cálculo del IMC
Para pesarse y calcular su índice de masa corporal:
š$FFHQGHUHODELODQFLDYÜDVH&RQHFWDUODEÈVFXOD
š6HOHFFLRQHHQWRQFHVFRQ86(5HOHVSDFLRGHPHPRULDGHXVXDULRFRQVXVDMXVWHVDOPDFHQDdos. Primero se muestra la estatura introducida. Espere hasta que vuelva a aparecer " kg". Ya
puede subirse a la báscula para efectuar la medición. Durante el proceso de medición permanezca quieto.
30
3 sec
USER
2 sec
6HYLVXDOL]DQUHVSHFWLYDPHQWHODIHFKDHOSHVR\HO,0&
/DSDQWDOODFDPELDGHFRORUHQIXQFLĂQGHO,0&S(YDOXDFLĂQGHORVUHVXOWDGRV
Se guarda un valor por día y persona. Si se pesa varias veces un mismo día se guarda el último
valor obtenido. Se sobrescriben los datos guardados anteriormente ese día.
Después de aprox. 10 segundos, la báscula se desconecta automáticamente.
Consulta de los resultados de medición guardados
Para consultar los resultados de medición guardados correspondientes al usuario seleccionado
actualmente:
t"DDFOEFSFMBCJMBODJBYÜDVH&RQHFWDUODEÈVFXOD).
t4FMF[JPOBSFMBQPTJ[JPOFEJNFNPSJBVUFOUFQSFNFOEPQJáWPMUFJMUBTUP64&34FFOUSPTFDPOEJOPOWFOHPOPQSFNVUJBMUSJUBTUJWJFOFWJTVBMJ[[BUBOVPWBNFOUFMhBMUF[[BEFMMhVUFOUFTFMF[JPOBUP
RVJOEJDPNQBSFJMWBMPSFLH
t%FTQMÈDFTFFOUPODFTDPOiBSSJCBwPiBCBKPwQPSMPTFTQBDJPTEFNFNPSJBQBSBSFTVMUBEPTEF
NFEJDJØO
t4FWJTVBMJ[BOSFTQFDUJWBNFOUFMBGFDIBFMQFTPZFM*.$-BQBOUBMMBDBNCJBEFDPMPSFOGVODJØO
EFM*.$Q&WBMVBDJØOEFMPTSFTVMUBEPT
USER
3 sec
2 sec
BMI
kg
31
10 Evaluación de los resultados
Índice de masa corporal (número de masa corporal)
(OìQGLFHGHPDVDFRUSRUDO,0&HVXQQěPHURTXHDPHQXGRVHXWLOL]DSDUDHYDOXDUHOSHVRGHOFXerpo. El número se calcula de los valores del peso corporal y la estatura, y la fórmula es la siguiente:
‡QGLFHGHPDVDFRUSRUDO SHVRGHOFXHUSRHVWDWXUDŵ/DXQLGDGGHO,0&HVSRUORWDQWR>NJPŵ@/D
GLYLVLĂQGHOSHVRPHGLDQWHHO,0&VHUHDOL]DHQORVDGXOWRVDSDUWLUGHORVDþRVFRQORVVLJXLHQWHVYDORUHVIXHQWH206
Pantalla:
&DWHJRUìD
5RVD
Infrapeso
,0&
Delgadez severa
< 16
Delgadez moderada
16-16,9
Delgadez aceptable
Verde
Peso normal
Amarillo
Sobrepeso
Preobesidad
5RMR
2EHVLGDG
(sobrepeso)
2EHVLGDGWLSR,
2EHVLGDGWLSR,,
2EHVLGDGWLSR,,,
Ɗ
Relación temporal de los resultados
Tenga en cuenta que sólo posee importancia la tendencia a largo plazo. Las diferencias de
peso en el espacio de pocos días suelen ser consecuencia de la pérdida de líquidos.
11 Cambio de pilas
/DVSLODVGHODEÈVFXODGHEHQUHHPSOD]DUVHFXDQGRHQODSDQWDOODDSDUH]FDODLQGLFDFLĂQŗ/RŘ
Si las pilas tienen poca carga, la báscula se apaga automáticamente.
Aviso:
š$OFDPELDUODVSLODVXWLOLFHVLHPSUHSLODVGHOPLVPRWLSRGHODPLVPDPDUFD\FRQODPLVPD
capacidad.
š&DPELHVLHPSUHWRGDVODVSLODVDOPLVPRWLHPSR
š1RXWLOLFHSLODVUHFDUJDEOHV
š(PSOHHSLODVVLQPHWDOHVSHVDGRV
12 Limpieza y conservación
La precisión de la báscula, así como su vida útil, dependen de su correcta utilización.
32
Atención:
š(ODSDUDWRGHEHOLPSLDUVHGHYH]HQFXDQGR3DUDODOLPSLH]DXVHXQSDþROLJHUDPHQWH
humedecido, al que puede añadir un poco de detergente en caso necesario.
1RXWLOLFHGHWHUJHQWHVDJUHVLYRV\QRVXPHUMDHODSDUDWRQXQFDHQDJXD
š3URWHMDODEÈVFXODGHJROSHVKXPHGDGSROYRVXVWDQFLDVTXìPLFDVJUDQGHVFDPELRVGH
temperatura, campos electromagnéticos y de la cercanía de fuentes de calor (hornos,
UDGLDGRUHV1RHMHU]DSUHVLĂQVREUHODVWHFODVFRQYLROHQFLDRFRQHOHPHQWRVDıODGRV
13 Eliminación
/DVSLODV\ORVDFXPXODGRUHVQRGHEHQWLUDUVHDODEDVXUDGRPÜVWLFD&RPRFRQVXPLGRUHVWÈ
obligado por ley a devolver las pilas usadas. Puede entregar las pilas usadas en los puntos
OLPSLRVRıFLDOHVGHVXPXQLFLSLRRHQFXDOTXLHUVLWLRGRQGHVHYHQGDQSLODVGHHVWHWLSR
Aviso::
En las pilas que contienen sustancias nocivas aparecen los siguientes
símbolos:
Pb = la pila contiene plomo,
&G ODSLODFRQWLHQHFDGPLR
Hg = la pila contiene mercurio.
3DUDSURWHJHUHOPHGLRDPELHQWHODEÈVFXOD\ODVSLODVQRVHSXHGHQHOLPLQDUMXQWRFRQODEDVXUD
GRPÜVWLFDDOıQDOGHVXYLGDěWLO/DHOLPLQDFLĂQVHSXHGHHIHFWXDUDWUDYÜVGHOSXQWRGHUHFRJLGD
correspondiente en su país.
Siga las disposiciones locales referentes a la eliminación de materiales.
(OLPLQHHODSDUDWRVHJěQODGLUHFWLYD&(VREUHUHVLGXRVGHDSDUDWRVHOÜFWULFRV\
electrónicos 2002/96/EC – WEEE (Waste Electrical and Electronic Equipment).
Si tiene alguna duda o consulta le rogamos que se ponga en contacto con el organismo
responsable de su municipio.
14 Resolución de problemas
6LODEÈVFXODHQFXHQWUDXQHUURUHQODPHGLFLĂQVHPXHVWUDHOVLJXLHQWHPHQVDMH
Indicación en
pantalla
&DXVD
5HSDUDFLĂQ
2/
Se ha excedido la capacidad &DUJXHODEÈVFXODěQLFDGHFDUJDPÈ[LPDGHNJ PHQWHKDVWDNJ
Lo
Las pilas están casi vacías.
&DPELHODVSLODV
no
Intento de consultar los
espacios de memoria de un
usuario para el cual
todavía no se ha guardado
ningún valor.
La báscula se desconecta automáticamente tras
un tiempo breve; volver
a encender y realizar una
medición.
33
Err
(O,0&VHHQFXHQWUDIXHUD
del límite de medición.
Vuelva a encender la báscula y repita el proceso de
medición.
No es posible realizar la medición
Posible fallo
5HSDUDFLĂQ
Si se sube a la báscula para pesarse antes
de que en la pantalla aparezca la indicaciĂQŗ kg”, la báscula no funcionará
correctamente.
Activar correctamente la báscula (esperar a
TXHDSDUH]FDODLQGLFDFLĂQŗ kg”) y repetir
la medición.
Las pilas de la báscula están vacías.
&DPELHODVSLODV
Medición de peso incorrecta
Posible fallo
5HSDUDFLĂQ
La báscula se encuentra encima de una
alfombra.
&RORTXHODEÈVFXODVREUHXQDVXSHUıFLHOLVD
y sólida.
El punto cero de la báscula es incorrecto.
&RORTXHODEÈVFXODVREUHXQDVXSHUıFLHOLVD
y sólida. Activar la báscula y esperar hasta que ésta
se vuelva a apagar (no subirse a la báscula
hasta entonces). Después volver a activar la
báscula y repetir la medición.
I ITALIANO
Gentile cliente,
siamo lieti che abbia scelto un prodotto della nostra gamma. Il nostro nome è sinonimo di prodotti
di alta qualità continuamente sottoposti a controlli nei settori del calore, del peso, della pressione
sanguigna, della temperatura corporea, delle pulsazioni, della terapia dolce, del massaggio e
dell’aria.
La preghiamo di leggere attentamente le presenti istruzioni, di conservarle per un’eventuale consultazione successiva, di metterle a disposizione di altri utenti e di osservare le avvertenze ivi riportate.
&RUGLDOLVDOXWL
Il Suo team Beurer
1
Introduzione
Funzioni dell'apparecchio
La bilancia digitale consente di misurare e calcolare l'indice di massa corporea.
La bilancia è destinata all'uso personale in ambiente privato.
La bilancia dispone delle seguenti funzioni, utilizzabili da un massimo di 10 persone:
š0LVXUD]LRQHGHOSHVR
š&DOFRORGHOO
LQGLFHGLPDVVDFRUSRUHD%0,%RG\0DVV,QGH[
š,QWHUSUHWD]LRQHGHOO
,0&HVHPSOLFHFODVVLıFD]LRQHWUDPLWHLOGLVSOD\DFRORUL
La funzione di memoria consente di richiamare le ultime 10 misurazioni di peso e i relativi valori di
indice di massa corporea per un massimo di 10 persone.
2
Spiegazione dei simboli
Nelle istruzioni d'uso sono utilizzati i seguenti simboli.
3
Pericolo
Segnalazione di rischi di lesioni o pericoli per la salute.
Attenzione
Segnalazione di rischi di possibili danni all'apparecchio.
Avvertenza
Indicazione di importanti informazioni.
Norme di sicurezza
Norme di sicurezza
Pericolo:
š1RQVDOLUHVXOERUGRGHOODELODQFLDGDXQVRORODWRSHULFRORGLULEDOWDPHQWR
š7HQHUHLOPDWHULDOHGLLPEDOORIXRULGDOODSRUWDWDGHLEDPELQLSHULFRORGLVRijRFDPHQWR
š6HEDJQDWDRXPLGDODVXSHUıFLHGHOODELODQFLDGLYHQWDVFLYRORVD
Avvertenze sull'uso delle batterie
Pericolo:
š6HLQJRLDWHOHEDWWHULHUDSSUHVHQWDQRXQSHULFRORPRUWDOH&RQVHUYDUHEDWWHULHHELODQFLD
fuori dalla portata dei bambini. In caso di ingestione di una batteria, richiedere immediatamente assistenza medica.
š/HEDWWHULHQRQGHYRQRHVVHUHULFDULFDWHRULDWWLYDWHFRQDOWULPH]]LLQROWUHQRQGHYRQR
essere aperte, gettate nel fuoco o cortocircuitate.
š/HEDWWHULHSRVVRQRFRQWHQHUHVRVWDQ]HQRFLYHSHUODVDOXWHHO
DPELHQWH4XLQGLGHYRQR
essere smaltite correttamente, nel rispetto delle norme di legge vigenti.
1RQJHWWDUHPDLOHEDWWHULHQHLQRUPDOLULıXWLGRPHVWLFL
Avvertenza:
š6RVWLWXLUHLQWHPSRXWLOHOHEDWWHULHTXDVLVFDULFKH
š6RVWLWXLUHVHPSUHWXWWHOHEDWWHULHFRQDOWUHGHOORVWHVVRWLSR
š/DIXRULXVFLWDGLOLTXLGRGDOOHEDWWHULHSXāGDQQHJJLDUHO
DSSDUHFFKLR6HO
DSSDUHFFKLRQRQ
venisse utilizzato per lunghi periodi, togliere le batterie dall'apposito scomparto.
š6HXQDEDWWHULDSUHVHQWDXQDSHUGLWDGLOLTXLGRLQGRVVDUHJXDQWLSURWHWWLYLHSXOLUHOR
scomparto con un panno asciutto.
Avvertenze generali
š/
DSSDUHFFKLRÛGHVWLQDWRDXQXVRSHUVRQDOHQRQYDXWLOL]]DWRSHUXVLPHGLFLRFRPPHUFLDOL
š3RLFKÜQRQVLWUDWWDGLXQDELODQFLDWDUDWDSHUXVRSURIHVVLRQDOHHPHGLFRVRQRSRVVLELOL
tolleranze intrinseche.
š/DSRUWDWDPDVVLPDGHOODELODQFLDÛGLNJOE6W,ULVXOWDWLGHOODPLVXUD]LRQHGHO
peso sono indicati in intervalli di 100 g (0,2 lb, 0,2 lb).
š3ULPDGLLQROWUDUHTXDOVLDVLUHFODPRFRQWUROODUHOHEDWWHULHHGHYHQWXDOPHQWHVRVWLWXLUOH
š/HULSDUD]LRQLSRVVRQRHVVHUHHijHWWXDWHVRORGDO6HUYL]LRFOLHQWLRGDULYHQGLWRULDXWRUL]]DWL
š3HUTXDOVLDVLDOWUDGRPDQGDVXOO
XVRGHLQRVWULDSSDUHFFKLULYROJHUVLDOULYHQGLWRUHR
all'Assistenza tecnica.
š7XWWHOHELODQFHVRQRFRQIRUPLDOODGLUHWWLYD&((&
4
Descrizione dell'apparecchio
2
Panoramica
1
2
Display
Tasto Su
7DVWR86(5
7DVWR*LĚ
SET button
1
3
36
5
Messa in funzione
Inserimento delle batterie (3 pile micro AAA da 1,5 V)
5LPXRYHUHODOLQJXHWWDSURWHWWLYDGHOOHEDWWHULHHRLQVHULUHOHEDWWHULHULVSHWWDQGRODSRODULWÇLQGLFDWD
nel vano batterie. Se la bilancia non funziona, rimuovere completamente le batterie e sostituirle.
Modifi care l'unità di misura
/DELODQFLDLQGLFDLYDORULLQNJ/
XQLWÇSXāHVVHUHLPSRVWDWDFRQPLVXUD]LRQHLQFKLOLNJOLEEUH
("lb") o stone ("st") mediante l'interruttore ubicato sul retro dell'apparecchio.
Collocazione della bilancia
&ROORFDUHODELODQFLDVXXQDVXSHUıFLHSLDQDHVWDELOH8QDVXSHUıFLHVWDELOHÛLQGLVSHQVDELOHSHU
una corretta pesatura.
6
Informazioni
Principio di misurazione
L'indice di massa corporea viene calcolato in base alla statura immessa e al peso misurato.
Consigli generali
š3HVDUVLSRVVLELOPHQWHVHPSUHDOODVWHVVDRUDPHJOLRODPDWWLQDGRSRHVVHUHDQGDWLLQEDJQRD
digiuno e senza indumenti addosso, per ottenere risultati comparabili.
7
Accensione della bilancia
Battere brevemente con il piede sulla bilancia con forza e in modo ben udibile per attivare il sensore
di vibrazione.
Viene eseguito l'autotest, compare la scritta "" e la data, quindi viene visualizzato il valore "".
8
Impostazioni
Pesatura e misurazione di altri valori
Anno Mese Giorno
SET
wSRVVLELOHPRGLıFDUHGDWDHRUDVRORGRSRDYHUULPRVVRHUHLQVHULWROHEDWWHULH
Per impostare la data e l'ora attuali, è necessario attenersi alla seguente sequenza:
*LRUQR0HVH$QQR2UH0LQXWL
37
9LHQHYLVXDOL]]DWDODSDUWHGDPRGLıFDUHGLYROWDLQYROWD
š3HUPRGLıFDUHXQ
LPSRVWD]LRQHSUHPHUHLSXOVDQWL e .
š3HUPHPRUL]]DUHO
LPSRVWD]LRQHHSDVVDUHDOVXFFHVVLYRFDPSRG
LPSRVWD]LRQHRSHUFKLXGHUH
l'impostazione, premere il pulsante SET.
Al termine della procedura la bilancia si spegne automaticamente.
/RVSHJQLPHQWRDXWRPDWLFRDYYLHQHDQFKHVHQRQYLHQHSUHPXWRDOFXQSXOVDQWHSHUROWUHVHFRQGL
Impostazione dei dati personali
La bilancia dispone di 10 posizioni di memoria utente e di oltre 10 posizioni di memoria di misurazione per ciascun utente. Nelle singole posizioni di memoria utente, l'utente e, ad esempio, i suoi
familiari possono memorizzare e richiamare le seguenti impostazioni personali:
Sequenza
Dati personali
Valori impostati
1
Posto di memoria
da 1 a 10
2
Altezza
100 - 220 cm
(da 3'-03" a 7'-03")
Accendere la bilancia (vedere a 7. Accensione della bilancia). Se sul display compare il valore
" kg":
š3UHPHUHSLĚYROWHLOWDVWR86(5ıQRDOODYLVXDOL]]D]LRQHGHOODSRVL]LRQHGLPHPRULDGHVLGHUDWD
Viene innanzitutto visualizzata la statura preimpostata. Attendere che venga visualizzato il valore
" kg".
š3HUPRGLıFDUHO
DOWH]]DSUHPHUH6(7
š3UHPHUHLSXOVDQWL e per impostare la statura. Per scorrere i valori velocemente, tenere premuto il relativo pulsante.
š7HUPLQDUHO
LPPLVVLRQHGHLGDWLFRQLOSXOVDQWH6(7
2 sec
USER
3 sec
SET
SET
Attenzione: se si modifica l'impostazione della statura in un momento successivo,
tutte le misurazioni della posizione di memoria utente memorizzate fino a quel
momento vengono cancellate.
9
Funzionamento
Peso e calcolo dell'indice di massa corporea
Per pesarsi e procedere al calcolo dell'indice di massa corporea personale:
š$FFHQGHUHODELODQFLDYHGHUHD$FFHQVLRQHGHOODELODQFLD
š6HOH]LRQDUHTXLQGLFRQ86(5 la posizione di memoria utente con le proprie impostazioni memorizzate. Viene innanzitutto visualizzata la statura immessa. Attendere che venga visualizzato il
valore "NJ2UDVLSXāVDOLUHVXOODELODQFLDSHUHijHWWXDUHODPLVXUD]LRQH5HVWDUHIHUPLGXUDQWH
il processo di pesatura.
3 sec
USER
2 sec
9HQJRQRYLVXDOL]]DWLLQVHTXHQ]DODGDWDLOSHVRHO
,0&
,OFRORUHGHOGLVSOD\FDPELDLQEDVHDOYDORUHGL,0&YHGHUH9DOXWD]LRQHGHLULVXOWDWL
3HURJQLJLRUQRHSHURJQLSHUVRQDYLHQHPHPRUL]]DWRXQYDORUH6HVLHijHWWXDQRSLĚPLVXUD]LRQLDO
giorno, viene memorizzato di volta in volta l'ultimo valore misurato. I dati memorizzati precedentemente nello stesso giorno vengono sovrascritti.
Dopo circa 10 secondi la bilancia si spegne automaticamente.
39
Interrogazione delle misurazioni memorizzate
Per interrogare le misurazioni memorizzate dell'utente attualmente selezionato:
t"DDFOEFSFMBCJMBODJBvedere a 7. Accensione della bilancia).
t4FMF[JPOBSFMBQPTJ[JPOFEJNFNPSJBVUFOUFQSFNFOEPQJáWPMUFJMUBTUP64&34FFOUSPTFDPOEJOPOWFOHPOPQSFNVUJBMUSJUBTUJWJFOFWJTVBMJ[[BUBOVPWBNFOUFMhBMUF[[BEFMMhVUFOUFTFMF[JPOBUP
RVJOEJDPNQBSFJMWBMPSFLH
t$POJQVMTBOUJ e TGPHMJBSFVOBEPQPMhBMUSBMFQPTJ[JPOJEJNFNPSJBEFMMFNJTVSB[JPOJ
t7FOHPOPWJTVBMJ[[BUJJOTFRVFO[BMBEBUBJMQFTPFMh*.$*MDPMPSFEFMEJTQMBZDBNCJBJOCBTFBM
WBMPSFEJ*.$WFEFSF7BMVUB[JPOFEFJSJTVMUBUJ
USER
3 sec
2 sec
BMI
kg
10 Valutazione dei risultati
Indice di massa corporea
/
LQGLFHGLPDVVDFRUSRUHD,0&ÛXQLQGLFHXWLOL]]DWRIUHTXHQWHPHQWHSHUODYDOXWD]LRQHGHOSHVR
L'indice viene calcolato in base ai valori di peso e statura, la relativa formula è la seguente:
,QGLFHGLPDVVDFRUSRUHD SHVRVWDWXUDŵ/
XQLWÇGHOO
,0&ÛSHUWDQWR>NJPŵ@/HFDWHJRULHGLSHVR
SHUJOLDGXOWLGDLDQQLLQEDVHDOO
,0&VRQROHVHJXHQWLIRQWH206
Display:
&DWHJRULD
5RVD
Sottopeso
,0&
Forte sottopeso
< 16
Sottopeso moderato
16-16,9
Leggero sottopeso
Verde
Normopeso
Giallo
Sovrappeso
Preadiposità
5RVVR
Adiposità
(sovrappeso)
Adiposità di I grado
Adiposità di II grado
Adiposità di III grado
Ɗ
Interazione temporale dei risultati
&RQVLGHUDUHFKHFRQWDVRORODWHQGHQ]DQHOOXQJRSHULRGR9DULD]LRQLGLSHVRQHOO
DPELWRGL
qualche giorno sono di regola da imputare a una perdita di liquidi.
11 Sostituzione batterie
Le batterie della bilancia devono essere sostituite quando nel display compare l'indicazione
"Lo". Quando le batterie sono troppo scariche, la bilancia si spegne automaticamente.
Avvertenza:
š4XDQGRVLVRVWLWXLVFRQROHEDWWHULHRFFRUUHXWLOL]]DUHEDWWHULHGHOORVWHVVRWLSRPDUFDH
potenza.
š6RVWLWXLUHVHPSUHWXWWHOHEDWWHULHFRQWHPSRUDQHDPHQWH
š1RQXWLOL]]DUHDFFXPXODWRULULFDULFDELOL
š8WLOL]]DUHEDWWHULHSULYHGLPHWDOOLSHVDQWL
12 Pulizia e cura
La precisione del valore misurato e la durata dell'apparecchio dipendono da un utilizzo attento
e scrupoloso:
Attenzione:
š/
DSSDUHFFKLRDQGUHEEHSXOLWRGLWDQWRLQWDQWR3HUODSXOL]LDXWLOL]]DUHXQSDQQR
leggermente inumidito e, se necessario, un po’ di detergente. Non utilizzare prodotti di
pulizia aggressivi e non immergere mai l'apparecchio nell'acqua.
š1RQHVSRUUHODELODQFLDDXUWLXPLGLWÇSROYHUHSURGRWWLFKLPLFLIRUWLVEDO]LGLWHPSHUDWXUD
campi elettromagnetici e fonti di calore troppo vicine (forni, caloriferi).
Non azionare i pulsanti bruscamente o con oggetti appuntiti.
13 Smaltimento
%DWWHULHHDFFXPXODWRULQRQVRQRULıXWLGRPHVWLFL/DOHJJHLPSRQHGLUHVWLWXLUHOHEDWWHULHXVDWH
Le vecchie batterie possono essere consegnate nei centri di raccolta comunali oppure dove
vengano vendute batterie dello stesso tipo.
Avvertenza:
Sulle batterie contenenti sostanze tossiche si trovano questi simboli:
Pb = batteria contenente piombo,
&G EDWWHULDFRQWHQHQWHFDGPLR
Hg = batteria contenente mercurio.
3HUULVSHWWRGHOO
DPELHQWHODELODQFLDEDWWHULHLQFOXVHQRQGHYHHVVHUHJHWWDWDWUDLQRUPDOLULıXWL
domestici al termine della sua vita utile. Lo smaltimento va effettuato negli appositi centri di raccolta.
Seguire le norme locali vigenti per lo smaltimento.
6PDOWLUHO
DSSDUHFFKLRULVSHWWDQGROHQRUPHSUHYLVWHGDOOD'LUHWWLYD&(VXLULıXWLGL
apparecchi elettrici ed elettronici 2002/96/CE – WEEE (Waste Electrical and Electronic
Equipment).
Per eventuali chiarimenti, rivolgersi alle autorità comunali competenti per lo smaltimento.
14 Che cosa fare in caso di problemi?
Se la bilancia rileva un errore nella pesatura, viene visualizzato:
Display
&DXVD
5LPHGLR
2/
È stata superata la portata
PDVVLPDGLNJ
Non superare la portata
PDVVLPDGLNJ
Lo
La batteria è quasi scarica.
Sostituire la batteria.
no
Tentativo di interrogazione
delle posizioni di memoria di
un utente che non ha ancora
memorizzato alcun valore.
La bilancia si spegne automaticamente dopo breve
tempo; riaccenderla ed
eseguire la procedura di
misurazione.
Err
,OYDORUH,0&ÛDOGLIXRUL
dell'intervallo misurabile.
5LDFFHQGHUHODELODQFLDH
ripetere la misurazione.
Misurazione impossibile
Possibili errori
5LPHGLR
Se ci si posiziona sulla bilancia per la
Attivare la bilancia in modo corretto (attendere
misurazione prima che sul display compaia che compaia il valore " kg") e ripetere la
la scritta " kg", la bilancia non funziona misurazione.
correttamente.
Le batterie nella bilancia sono scariche.
Sostituire le batterie.
Misurazione del peso non corretta
Possibili errori
5LPHGLR
La bilancia poggia sulla moquette.
Posare la bilancia su un fondo piano e solido.
La bilancia presenta un valore di base
diverso da .
Posare la bilancia su un fondo piano e solido. Attivare la bilancia e aspettarne lo spegnimento
automatico (evitando di salire sopra).
Attivare nuovamente la bilancia e ripetere la
misurazione.
T TÜRKÇE
Sayın Müşterimiz,
İmalatımız olan bir ürünü tercih etmenizden dolayı memnuniyetimizi belirtmek isteriz. Adımız, Isı,
$åêUOêN.DQ%DVêQFê9ĞFXW,VêVê1DEê]<XPXĒDN7HUDSL0DVDMYH+DYDDODQODUêQGDD\UêQWêOêRODUDN
kontrolden geçirilmiş yüksek kaliteli ürünlerin simgesidir. Lütfen bu kullanma talimatını dikkatle
okuyup sonrakı kullanımlar için saklayınız, diğer kullanıcıların da okumasına olanak tanıyınız ve
belirtilen açıklamalara uyunuz.
Dostane tavsiyelerimizle
Beurer Müessesesi
1
Tanıtım
Cihazın fonksiyonları
%XGLMLWDOFDPWHUD]LNLĒLVHO%RG\0DVV,QGH[ŖLQL]LQ9ĞFXWNĞWOHHQGHNVLWDUWêOPDVêQêYH
hesaplanmasını sağlar.
Bu baskül özel alandaki kişisel kullanım için tasarlanmıştır.
Terazi, 10 farklı kişi tarafından kullanılabilen aşağıdaki işlevleri içerir:
š9ĞFXWDåêUOêåêąO×ĞPĞ
š%RG\0DVV,QGH[%0,9ĞFXWNĞWOHHQGHNVLKHVDSODPD
š.ROD\VêUDODPDL×LQUHQNOL%0,D×êNODPDVê
Kayıt işlevi, farklı 10 kişiye kadar en son ölçülmüş maksimum 10 ağırlık değerine ve bu arada ilave
olarak hesaplanmış olan BMI-değerlerine erişilmesine olanak verir.
2
Sembol Açıklaması
Kullanım kılavuzunda aşağıdaki semboller kullanılacaktır.
3
Uyarı
Yaralanma tehlikelerine veya sağlığınızla ilgili tehlikelere yönelik uyarılar.
Dikkat
&LKD]ODDNVHVXDUODUê\ODLOJLOLRODVêKDVDUODUD\ąQHOLNJĞYHQOLNX\DUêODUê
Not
Önemli bilgilere yönelik notlar.
Güvenlik Uyarıları
Güvenlik Uyarıları
Uyarı:
š%DVNĞOĞQGêĒNHQDUêQDWHNWDUDIêQGDQEDVPD\êQ'HYULOPHWHKOLNHVL
šsRFXNODUêDPEDODMPDO]HPHVLQGHQX]DNWXWXQ%RåXOPDWHKOLNHVL
š7HUD]LQLQĞVW\Ğ]ĞQHPOLYH\DêVODNROGXåXQGDND\JDQGêU
Pillerle temas etme durumu için uyarılar
Uyarı:
š<XWPDGXUXPXQGDSLOOHUKD\DWLWHKOLNH\HQHGHQRODELOLU3LOOHULYHEDVNĞOĞNĞ×ĞN×RFXNODUêQ
erişemeyeceği bir yerde saklayınız. Pil yutulduysa hemen tıbbi yardım alınmalıdır.
š3LOOHU\HQLGHQĒDUMHGLOPHPHOLL×LQGHNLPDGGHOHU×êNDUWêOPDPDOêDWHĒHDWêOPDPDOêYHNêVD
devre yaptırılmamalıdır.
š3LOOHUVDåOêåêYH×HYUH\LWHKGLWHGHQ]HKLUOLPDGGHOHUL×HUHELOLU3LOOHULJH×HUOL\DVDO
belirlemelere uygun bir şekilde imha ediniz. Pilleri hiçbir zaman normal ev çöpüne
koymayınız.
Dikkat:
š=D\êIJD\DQSLOOHULKHPHQGHåLĒWLULQL]
š+HU]DPDQD\QêWLSSLOOHUNXOODQêQYHWĞPSLOOHULD\QêDQGDGHåLĒWLULQL]
š$NPêĒSLOOHUFLKD]GDDUê]DODUDQHGHQRODELOLU&LKD]êX]XQVĞUHNXOODQPD\DFDNVDQê]SLOOHUL
yuvasından çıkartınız.
š(åHUELUSLODNPêĒVDNRUX\XFXHOGLYHQWDNêQYHSLO\XYDVêQêNXUXELUEH]OHWHPL]OH\LQL]
Genel Uyarılar
š%XFLKD]NHQGLNXOODQêPêQê]L×LQGLUWêEELYH\DWLFDULDPD×OêNXOODQêPL×LQĞUHWLOPHPLĒWLU
š%DVNĞOSURIHV\RQHOYHWêEELNXOODQêPL×LQWDVDUODQPDGêåêQGDQWHNQLNRODUDNEHOLUOLąO×ĞP
toleranslarının mümkün olduğunu dikkate alınız.
š7DUWêQêQWDĒê\DELOHFHåLDåêUOêND]DPLNJŕGêUOE6W$åêUOêNąO×ĞPĞQGHVRQX×ODU
100 g’lık adımlar (0,2 lb, 0,2 lb) halinde gösterilir.
š«LND\HWWHEXOXQPDGDQąQFHSLOOHULNRQWUROHGLQYHJHUHNOL\VHGHåLĒWLULQL]
š7DPLULĒOHPOHUL\DOQê]FDPĞĒWHULKL]PHWOHULYH\D\HWNLOLVDWêFêODUWDUDIêQGDQ\DSêODELOLU
š&LKD]êPê]êQNXOODQêPêQDLOLĒNLQVRUXODUêQê]L×LQVDWêFêQê]DYH\DPĞĒWHULKL]PHWOHULQH
başvurmalısınız.
š7ĞPEDVNĞOOHU$%\ąQHUJHVL(&Ŗ\HX\JXQGXU
4
Cihaz Açıklaması
2
Genel görünüm
1
2
Gösterge
Yukarı düğmesi
86(5GĞåPHVL
$ĒDåêGĞåPHVL
6(7GĞåPHVL
1
3
5
Çalıştırma
Pillerin takılması (3 x 1,5 V AAA Mikro)
Lütfen pil koruma şeridini çıkarın ve/veya pilleri pil bölmesinde gösterilen kutup pozisyonlarına dikkat
ederek yerleştirin. Terazi çalışmıyorsa, pilleri tamamen çıkartın ve yeniden takın.
Ağırlık biriminin değiştirilmesi
Baskül, değerleri kg olarak görüntüler. Birimi cihazın arkasında yer alan düğmeyi kullanarak Kilogram
ŚNJŗ3RXQGŚOEŗYH6WRQHŚVWŗRODUDND\DUOD\DELOLUVLQL]
Baskülün yerleştirilmesi
Baskülü düz ve sabit bir zemin üzerine yerleştiriniz. Ölçümün doğru yapılabilmesi için zeminin
düzgün olması bir önkoşuldur.
6
Bilgiler
Çalışma Prensibi
BMI, verilen beden ölçüsünden ve ölçülen ağırlıktan hesaplanır.
Genel İpuçları
š.DUĒêODĒWêUêODELOLUVRQX×ODUHOGHHWPHNL×LQPĞPNĞQVHJĞQĞQD\QêVDDWLQGHHQL\LVLVDEDKWXYDOHWH
gittikten sonra, aç karnına ve kıyafetsiz olarak tartılmalısınız.
7
Teraziyi açma
Titreşim sensörünü etkinleştirmek için ayağınızla kısa, kuvvetlice ve iyi duyulabilecek şekilde teraziye
vurun.
(NUDQGDŚŗEHOLULQFH\HGHNNHQGLNHQGLQHWHVWDQODPêQDJHOHQŚŗYHWDULKJąUĞQĞU
8
Ayar
Tarihi ve saati ayarlayın
Yıl
Ay
Gün
SET
Tarih ve saat sadece pillerin çıkartılmasından ve yeniden yerleştirilmesinden sonra değiştirilebilir.
Güncel tarihin ve saatin ayarlanması sırasında aşağıdaki adımları izleyin: Gün – Ay – Yıl – Saat –
Dakika.
Her seferinde değiştirilen bölüm alanı yanıp söner.
š%LUD\DUêGHåLĒWLUPHNL×LQ ve düğmelerine basın.
š$\DUêND\GHWPHN ve bir sonraki ayar bölgesine geçmek veya ayarlamayı kapatmak için SET
düğmesine basın.
Bu işlemden sonra terazi otomatik olarak kapanır.
VDQL\HGHQGDKDX]XQVĞUH\OHKL×ELUGĞåPH\HEDVêOPD]VDWHUD]LD\QêĒHNLOGHNDSDQêU
Kullanıcı verilerinin ayarlanması
Terazinin 10 kullanıcı kayıt yeri ve her kullanıcı için 10 ölçüm sonucu kayıt yeri vardır. Kullanıcı
kayıt yerlerine, ailenizin diğer üyeleriyle birlikte aşağıdaki kişisel ayarları kaydedebilir ve yeniden
çağırabilirsiniz:
Sıralama
Kullanıcı verileri
Ayar değerleri
1
Hafıza alanı
1'den 10'a kadar
2
Boy
100 ile 220 cm arasında
(3 ft 3 inç ila 7 ft 3 inç)
7HUD]L\LD×êQEN]7HUD]L\LD×PD*ąVWHUJHGHŗ kg” göründüğünde:
šVWHGLåLQL]ND\êW\HULJąUĞQĞQFH\HGHNDUWDUGD86(5GĞåPHVLQHEDVêQžQFHJLULOPLĒRODQER\
ölçünüz görüntülenir. Tekrar " kg" görüntüleninceye kadar bekleyin.
š%R\ąO×ĞVĞQĞGHåLĒWLUPHNL×LQ6(7GĞåPHVLQHEDVêQ
š%R\XD\DUODPDNL×LQ ve düğmelerine basın. Hızlı bir şekilde ayarlamak için ilgili düğmeyi basılı
tutun.
š6(7GĞåPHVLQHEDVDUDNJLULĒLWDPDPOD\êQ
USER
2 sec
3 sec
SET
SET
Dikkat edin: Boyunuzun ayarını ileriki bir zaman noktasında değiştirirseniz,
kullanıcı kayıt alanınızda daha önce kaydedilmiş tüm ölçüm sonuçları silinir.
9
Kullanım
Tartılma ve BMI hesaplanması
Tartılmak ve kişisel Body-Mass-Index’i hesaplamak için:
š7HUD]L\LD×êQEN]7HUD]L\LD×PD
š$UGêQGDQ86(5LOHNHQGLND\GHGLOPLĒD\DUODUêQê]êQEXOXQGXåXNXOODQêFêND\êW\HULQLVH×LQONRODUDN
girilmiş olan boy ölçünüz gösterilecektir. Tekrar "NJJąUĞQWĞOHQLQFH\HNDGDUEHNOH\LQ«LPGL
teraziye tartılmak için çıkabilirsiniz. Tartma esnasında hareketsiz durun.
3 sec
USER
2 sec
Her seferinde tarih, ağırlık ve BMI görünür.
Ekranın rengi, BMI değerine göre değişir (bkz. 7. Teraziyi açma).
Her gün ve kişi başına bir değer kaydedilir. Gün başına daha fazla ölçüm gerçekleştirmek
istediğinizde, her seferinde en son ölçülen değer kaydedilecektir. Bu güne kadar kaydedilmiş
verilerin üzerine yazılacaktır.
Yaklaşık 10 saniye sonra terazi otomatik olarak kapanır.
Kaydedilmiş olan ölçüm sonuçlarının sorgulanması
Seçili durumdaki kullanıcının kaydedilmiş ölçüm sonuçlarını sorgulamak için:
š7HUD]L\LD×êQV7HUD]LQLQD×êOPDVê
š86(5GĞåPHVLQHDUWDUGDEDVDUDNNXOODQêFêND\êW\HULQLVH×LQ%DĒNDELUGĞåPH\HEDVPD]VDQê]
yaklaşık 3 saniye sonra yeniden seçili kullanıcının boy ölçüsü ve ardından " kg" görüntülenir.
š$UGêQGDQ veya düğmesini kullanarak ölçüm sonuçlarının kayıt yerlerini sırayla gözden geçirebilirsiniz.
š+HUVHIHULQGHWDULKDåêUOêNYH%0,JąUĞQĞU(NUDQêQUHQJL%0,GHåHULQHJąUHGHåLĒLUEN]
Sonuçların değerlendirilmesi).
USER
3 sec
2 sec
BMI
kg
10 Sonuçların değerlendirilmesi
Body Mass Index (Vücut kütle endeksi)
Body-Mass-Index (BMI), çoğunlukla vücut ağırlığının değerlendirilmesi için yararlanılan bir sayıdır.
Sayı, vücut ağırlığı ve boy ölçüsü değerlerinden hesaplanır, bununla ilgili formül şöyledir: Body0DVV,QGH[ 9ĞFXWDåêUOêåê%R\ąO×ĞVĞŵ%XUDGDQ\ROD×êNêODUDN%0,ELULPL>NJPŵ@ŖGLU%0,X\DUêQFD
DåêUOêNGDåêOêPODUê\HWLĒNLQOHUGH\DĒêQGDQLWLEDUHQDĒDåêGDNLGHåHUOHUGHGLU.D\QDN:+2
Ekran
Kategori
Pembe
Düşük ağırlık
BMI
sRNGĞĒĞNDåêUOêN
< 16
2UWDGĞĒĞNDåêUOêN
16-16,9
+DıIGĞĒĞNDåêUOêN
Yeşil
Normal ağırlık
Sarı
Yüksek ağırlık
Preadipositas
Kırmızı
Adipositas (Yüksek
ağırlık)
Adipositas Derece I
Adipositas Derece II
Adipositas Derece III
Ɗ
Sonuçların Zamansal İlişkisi
Yalnız uzun süreli eğilimin anlamlı olduğuna dikkat ediniz. Birkaç gün içindeki kısa süreli
ağırlık değişikliklerine genelde sıvı kaybı neden olur.
11 Pillerin değiştirilmesi
(NUDQGDŗ/RŘJąUĞQWĞOHQGLåLQGHWHUD]LQLQSLOOHULGHåLĒWLULOPHOLGLU3LOOHU×RN]D\êIJDGêåêQGDWHUD]L
otomatik olarak kapanır.
Uyarı:
š+HUSLOGHåLĒLPLVêUDVêQGDD\QêWLSWHPDUNDGDYHJĞ×WHSLOOHULWHUFLKHGLQL]
š7ĞPSLOOHULKHU]DPDQD\QêDQGDGHåLĒWLULQL]
š<HQLGHQĒDUMHGLOHELOLUDNĞOHULNXOODQPD\êQê]
š$åêUPHWDOL×HUPH\HQSLOOHULNXOODQêQê]
12 Saklama ve bakım
Ölçüm değerlerinin kesinliği ve cihazın kullanım ömrü, kullanıldığı çevreye gösterilen özene
bağlıdır:
Dikkat:
š&LKD]]DPDQ]DPDQWHPL]OHQPHOLGLU7HPL]OLNL×LQJHUHNWLåLQGHĞ]HULQHELUD]WHPL]OHPH
PDO]HPHVLGHGąNHFHåLQL]KDıIQHPOLELUEH]NXOODQêQ7HPL]OHPHL×LQNHVLQOLNOHFLKD]êQ
üzerine su dökmeyin ve keskin temizlik maddeleri kullanmayınız.
š7HUD]L\LGDUEHOHUGHQQHPGHQWR]GDQNLP\DVDOODUGDQDĒêUêVêFDNOêNGHåLĒLNOLNOHULQGHQ
elektromanyetik alanlardan ve çok yakın ısı kaynaklarından (soba, kalorifer radyatörü)
koruyun. Düğmelere kuvvetli bir şekilde veya sivri nesnelerle basmayın.
13 İmha
Piller ve aküler ev çöpüne ait değildir. Tüketici olarak kullanılmış pilleri iade etmekle yasal olarak
yükümlüsünüz. Eski pillerinizi bölgenizdeki toplama noktalarına veya ilgili türdeki pilleri satan her
yere verebilirsiniz.
Uyarı:
Zehirli madde içeren pillerde aşağıdaki işaret mevcuttur:
Pb = Pil kurşun içeriyor,
&G 3LONDGPL\XPL×HUL\RU
Hg = Pil cıva içeriyor.
sHYUHQLQNRUXQPDVêDGêQDEDVNĞOYHSLOOHUNXOODQêPąPĞUOHULQLQVRQXQGDHYDWêNODUê\ODEHUDEHU
atılmamalıdır. İmha işlemi ülkenizdeki ilgili atık toplama yerlerinde gerçekleştirilmelidir.
Malzemelerin atılması sırasında yerel yönetmeliklere uyunuz.
&LKD]DLOLĒNLQLPKDHWPHLĒOHPLQL(OHNWULNOLYH(OHNWURQLN(VNL&LKD]ODU$%<ąQHUJHVL
2002/96/EC – WEEE (Waste Electrical and Electronic Equipment) doğrultusunda
gerçekleştiriniz.
Atma işlemiyle ilgili sorularınız için yetkili yerel makamlarla irtibat kurunuz.
14 Problemle karşılaşılması durumunda ne yapılmalıdır?
Tartma sırasında baskül bir hata belirlerse, bu hatayı aşağıdaki şekilde gösterir.
Ekran göstergesi
Neden
Giderme
2/
NJŖOLNPDNVLPXPWDĒêPD 6DGHFHNJŖ\HNDGDURODQ
kapasitesinin üzerine çıkıldı. ağırlıklar tartılabilir.
Lo
Piller neredeyse boş.
Pilleri değiştiriniz.
no
Henüz hiç bir değer
kaydedilmemiş olan bir
kullanıcının kayıt yerlerinin
sorgulanması.
Terazi otomatik olarak kısa
bir süre sonra kapanır; yeniden açın ve ölçüm işlemini
gerçekleştirin.
Err
Terazi doğru olan sıfır
noktasını arar.
Teraziyi düz, sağlam yüzey
Ğ]HULQHNR\XQ7HUD]Lŗ
NJŗJąVWHUHQHNDGDUEHNleyin.
Ölçüm olanaklı değil
2ODVê+DWDODU
Giderme
(NUDQGDŗ kg” gösterilmeden önce ölçüm için terazinin üzerine çıkarsanız, terazi
doğru çalışmaz.
7HUD]L\LGRåUXĒHNLOGHHWNLQOHĒWLULQŗNJŗJąUĞQtülenmesini bekleyin) ve ölçümü tekrarlayın.
Basküldeki piller boş.
Pilleri değiştiriniz.
Yanlış ağırlık ölçümü
2ODVê+DWDODU
Giderme
Baskül, halı üzerinde bulunuyor.
Baskülü düz ve sert bir zemin üzerine yerleştiriniz.
Terazinin sıfır noktası yanlış.
Baskülü düz ve sert bir zemin üzerine yerleştiriniz.
Teraziyi etkinleştirin ve terazi kapanıncaya kadar
bekleyin (kapanıncaya kadar terazinin üzerine
çıkmayın). Ardından teraziyi yeniden etkinleştirin ve
ölçümü tekrarlayın
r РУССКИЙ
Многоуважаемый покупатель!
Мы рады тому, что Вы выбрали товар из нашего ассортимента. Изделия нашей компании
являются продуктами высочайшего качества, используемые для измерения веса,
артериального давления, температуры тела, частоты пульса, в области мягкой терапии и
массажа.
Внимательно прочтите данную инструкцию по эксплуатации, сохраняйте ее для дальнейшего
использования, дайте ее прочитать и другим пользователям и строго следуйте приведенным в
ней указаниям.
С дружескими пожеланиями сотрудники компании Beurer
1
Для ознакомления
Функции прибора
Данные электронные весы служат для взвешивания и расчета Вашего личного индекса
массы тела (BMI). Весы предназначены для использования в домашнем хозяйстве.
Весы обладают следующими функциями, которые могут использовать до 10 человек:
šɄɃɈɁɌɁɉɄɁȾɁɍȼɎɁɇȼ
šɌȼɍɓɁɎɄɉɀɁɆɍȼɈȼɍɍɗɎɁɇȼ%0,%RG\0DVV,QGH[
šɒȾɁɎɊȾȼɛɄɉɎɁɌɋɌɁɎȼɒɄɛ%0,ɀɇɛɏɀɊȽɍɎȾȼɆɇȼɍɍɄɐɄɆȼɒɄɄ
Функция сохранения информации позволяет максимально 10 пользователям получить
информацию о 10 последних значениях веса, а также о дополнительно рассчитанных
показателях BMI.
2
Пояснения к символам
В инструкции по применению используются следующие символы.
Предостережение
Предупреждает об опасности травмирования или ущерба
для здоровья.
Внимание
Указывает на возможные повреждения прибора/принадлежностей.
Указание
Отмечает важную информацию.
3
Указания по технике безопасности
Указания по технике безопасности
Предостережение:
šȩɁȾɍɎȼȾȼɅɎɁɉȼɊɀɉɏɍɎɊɌɊɉɏȾɁɍɊȾɏɍȼɈɊȿɊɆɌȼɛȪɋȼɍɉɊɍɎɘɊɋɌɊɆɄɀɗȾȼɉɄɛ
šȩɁɀȼȾȼɅɎɁɀɁɎɛɈɏɋȼɆɊȾɊɓɉɗɁɈȼɎɁɌɄȼɇɗɊɎȾɁɍɊȾɊɋȼɍɉɊɍɎɘɏɀɏɔɘɛ
šȫɊȾɁɌɑɉɊɍɎɘȾɁɍɊȾɍɆɊɇɘɃɆȼɛȾɊȾɇȼɂɉɊɈɄɇɄɍɄɇɘɉɊɈɊɆɌɊɈɍɊɍɎɊɛɉɄɄɉɊȿ
опасность поскальзывания.
Обращение с элементами питания
Предостережение:
šȹɇɁɈɁɉɎɗɋɄɎȼɉɄɛɍɊɀɁɌɂȼɎȾɌɁɀɉɗɁɋɌɄɋɊɋȼɀȼɉɄɄȾɉɏɎɌɘɊɌȿȼɉɄɃɈȼȾɁɕɁɍɎȾȼ
Проследите, чтобы маленькие дети не имели доступа к элементам питания. Если
кто-либо проглотит элемент питания, следует немедленно обратиться к врачу.
šȹɇɁɈɁɉɎɗɋɄɎȼɉɄɛɉɁɇɘɃɛɋɁɌɁɃȼɌɛɂȼɎɘɄɇɄɌɁȼɆɎɄȾɄɌɊȾȼɎɘɍɋɊɈɊɕɘɚɌȼɃɇɄɓɉɗɑ
средств, не разбирайте их, не бросайте в огонь и не замыкайте накоротко.
šȹɇɁɈɁɉɎɗɋɄɎȼɉɄɛɈɊȿɏɎɍɊɀɁɌɂȼɎɘɎɊɆɍɄɓɉɗɁȾɁɕɁɍɎȾȼȾɌɁɀɉɗɁɀɇɛɃɀɊɌɊȾɘɛ
и окружающей среды. В связи с этим утилизируйте элементы питания в строгом
ɍɊɊɎȾɁɎɍɎȾɄɄɍɀɁɅɍɎȾɏɚɕɄɈɄɃȼɆɊɉɊɀȼɎɁɇɘɉɗɈɄɉɊɌɈȼɈɄȩɄȾɆɊɁɈɍɇɏɓȼɁɉɁ
выбрасывайте отработавшие элементы питания в обычный мусор.
Внимание:
šȬɁȿɏɇɛɌɉɊɃȼɈɁɉɛɅɎɁəɇɁɈɁɉɎɗɋɄɎȼɉɄɛ
šȣȼɈɁɉɛɅɎɁɊɀɉɊȾɌɁɈɁɉɉɊɍɌȼɃɏȾɍɁəɇɁɈɁɉɎɗɋɄɎȼɉɄɛȤɍɋɊɇɘɃɏɅɎɁɋɌɄəɎɊɈ
элементы одного типа.
šȬȼɃɌɛɂɁɉɉɗɁəɇɁɈɁɉɎɗɋɄɎȼɉɄɛɈɊȿɏɎɍɎȼɎɘɋɌɄɓɄɉɊɅɉɁɄɍɋɌȼȾɉɊɍɎɄɋɌɄȽɊɌȼȫɌɄ
длительном перерыве в использовании прибора выньте элементы питания из
батарейного отсека.
šȡɍɇɄɊɀɄɉɄɃəɇɁɈɁɉɎɊȾɋɄɎȼɉɄɛɌȼɃɌɛɀɄɇɍɛɉȼɀɁɉɘɎɁɃȼɕɄɎɉɗɁɋɁɌɓȼɎɆɄɄɋɊɓɄɍɎɄɎɁ
батарейный отсек сухой салфеткой.
Общие указания
šȫɌɄȽɊɌɌȼɃɌȼȽɊɎȼɉɀɇɛɇɄɓɉɊȿɊɋɊɇɘɃɊȾȼɉɄɛɄɉɁɋɌɁɀɉȼɃɉȼɓɁɉɀɇɛɄɍɋɊɇɘɃɊȾȼɉɄɛȾ
медицинских или коммерческих целях.
šȪȽɌȼɎɄɎɁȾɉɄɈȼɉɄɁɓɎɊɋɊɎɁɑɉɄɓɁɍɆɄɈɋɌɄɓɄɉȼɈɀɄȼɋȼɃɊɉɋɊȿɌɁɔɉɊɍɎɄɄɃɈɁɌɁɉɄɛ
весов не является удовлетворительным для использования их в профессиональных
медицинских целях.
šȫɌɁɀɁɇɘɉɊɀɊɋɏɍɎɄɈȼɛɉȼȿɌɏɃɆȼɉȼȾɁɍɗɍɊɍɎȼȾɇɛɁɎɆȿOE6WȬɁɃɏɇɘɎȼɎɗ
измерения веса указываются с шагом 100 г (0,2 lb, 0,2 lb).
šȫɌɄȾɊɃɉɄɆɉɊȾɁɉɄɄɊɎɆȼɃȼȾɌȼȽɊɎɁɍɉȼɓȼɇȼɋɌɊȾɁɌɘɎɁəɇɁɈɁɉɎɗɋɄɎȼɉɄɛ
При необходимости замените их.
šȬɁɈɊɉɎɉɗɁɌȼȽɊɎɗɀɊɇɂɉɗɋɌɊɄɃȾɊɀɄɎɘɍɛɎɊɇɘɆɊɍɁɌȾɄɍɉɊɅɍɇɏɂȽɊɅɄɇɄ
авторизованными торговыми представителями.
šȫɌɄȾɊɃɉɄɆɉɊȾɁɉɄɄȾɊɋɌɊɍɊȾɋɊɄɍɋɊɇɘɃɊȾȼɉɄɚɋɌɄȽɊɌȼɊȽɌȼɕȼɅɎɁɍɘɆɋɊɍɎȼȾɕɄɆɏ
или в Сервисный центр.
šȞɍɁȾɁɍɗɍɊɊɎȾɁɎɍɎȾɏɚɎȠɄɌɁɆɎɄȾɁȡȹȭ(&
4
Описание прибора
2
Обзор
1
5
Индикация
ȦɉɊɋɆȼŚȯȾɁɇɄɓɄɎɘŗ
ȦɉɊɋɆȼ86(5
ȦɉɊɋɆȼŚȯɈɁɉɘɔɄɎɘŗ
ȦɉɊɋɆȼ6(7
1
3
Подготовка к работе
Установка батареек (3 x 1,5 V тип AAA Mikro)
Удалите защитную полоску отсека батареек и/или вставьте батарейки, соблюдая полярность,
указанную на отсеке батареек. Если весы не работают, полностью извлеките батарейки и
вставьте обратно.
Изменение весовых единиц
Весы настроены на весовую единицу кг. С помощью кнопочного переключателя на обратной
стороне прибора Вы можете выбрать настройку: "кг", "фунты" или "стоуны".
Установка весов
Устанавливайте весы на ровную и твёрдую поверхность. Только на твёрдой поверхности
весы будут показывать правильный вес.
6
Информация
Принцип измерения
Индекс массы тела высчитывается, исходя из вводимого показателя роста тела и веса,
определяемого прибором.
Общие советы
šȳɎɊȽɗɋɊɇɏɓɄɎɘȽɊɇɁɁɎɊɓɉɗɁɌɁɃɏɇɘɎȼɎɗȾɃȾɁɔɄȾȼɅɎɁɍɘɋɌɄɈɁɌɉɊȾɊɀɉɊɄɎɊɂɁȾɌɁɈɛ
суток (лучше утром), посетив предварительно туалет, натощак и без одежды.
7
Включите весы
ȬɁɃɆɊɏȾɁɌɁɉɉɊɍɊɃȾɏɆɊɈɏɀȼɌɘɎɁɍɎɏɋɉɁɅɋɊȾɁɍȼɈɓɎɊȽɗȼɆɎɄȾɄɌɊȾȼɎɘȾɄȽɌȼɒɄɊɉɉɗɅ
датчик.
В качестве самопроверки появляется индикация "" и дата "".
8
Настройка
Взвешивание и расчет дополнительных физических показателей
Год месяц день
SET
Дата и время могут быть изменены после изъятия и нового закладывания батареек.
Для установки актуальной даты и времени выполните процедуру из нескольких шагов:
ȠɁɉɘşȨɁɍɛɒşȟɊɀşȳȼɍɗşȨɄɉɏɎɗ
ȬȼɃɀɁɇɆɊɎɊɌɗɅɉɁɊȽɑɊɀɄɈɊɍɁɅɓȼɍɄɃɈɁɉɄɎɘɈɄȿȼɁɎ
šȩȼɂɈɄɎɁɆɉɊɋɆɄ и , чтобы изменить настройку.
šȩȼɂɈɄɎɁɆɉɊɋɆɏ6(7ɓɎɊȽɗɍɊɑɌȼɉɄɎɘɉȼɍɎɌɊɅɆɏɄɋɁɌɁɅɎɄɆɍɇɁɀɏɚɕɁɈɏɌȼɃɀɁɇɏ
настроек или чтобы завершить настройку.
После этого весы автоматически отключаются.
ȡɍɇɄȾɎɁɓɁɉɄɁɍɁɆɏɉɀɉɁɉȼɂɄɈȼɇɊɍɘɉɄɊɀɉɊɅɆɉɊɋɆɄȾɁɍɗɊɎɆɇɚɓȼɚɎɍɛȼȾɎɊɈȼɎɄɓɁɍɆɄ
Установка данных пользователя
Весы имеют память на 10 пользователя и более 10 результатов измерений на каждого
пользователя. В памяти пользователя Вы или члены Вашей семьи могут сохранять и
просматривать следующие личные данные:
Последовательность
Данные пользователя
ȣɉȼɓɁɉɄɛ
1
ȩɊɈɁɌɛɓɁɅɆɄ
от 1 до 10
2
ȬɊɍɎ
от 100 до 220 см
(от 3'-03" до 7'-03")
ȞɆɇɚɓɄɎɁȾɁɍɗɍɈȞɆɇɚɓɄɎɁȾɁɍɗȦɊȿɀȼɋɊɛȾɇɛɁɎɍɛɄɉɀɄɆȼɒɄɛŚNJŗ
฀
฀
฀
฀ ฀ ฀
฀
฀ ฀
฀
฀
฀
฀
฀
฀
฀
฀
฀
฀
฀ ฀
฀ ฀
฀
฀
฀
฀
฀
฀
฀
฀฀ ฀ ฀ ฀
฀
฀
฀
฀
฀
฀
฀
฀
฀
฀
฀
฀
฀
฀
฀
USER
3 sec
SET
2 sec
SET
Обратите внимание: Когда Вы позднее меняете показания своего роста, все
сохраненные данные измерений в памяти пользователя будут удалены.
9
Обслуживание
Взвешивание и расчет индекса массы тела
ȳɎɊȽɗɋɌɊȾɁɍɎɄȾɃȾɁɔɄȾȼɉɄɁɄɌȼɍɓɁɎɍɊȽɍɎȾɁɉɉɊȿɊɄɉɀɁɆɍȼɈȼɍɍɗɎɁɇȼ
šȞɆɇɚɓɄɎɁȾɁɍɗɍɈȞɆɇɚɓɄɎɁȾɁɍɗ
šȮɊȿɀȼȾɗȽɁɌɄɎɁɍɋɊɈɊɕɘɚ86(5ɋȼɈɛɎɘɋɊɇɘɃɊȾȼɎɁɇɛɍɍɊɑɌȼɉɁɉɉɗɈɄɉȼɍɎɌɊɅɆȼɈɄ
ȭɉȼɓȼɇȼȽɏɀɁɎɋɊɆȼɃȼɉȞȼɔɌɊɍɎȠɊɂɀɄɎɁɍɘɋɊɆȼɍɉɊȾȼɉɁɊɎɊȽɌȼɃɄɎɍɛŚ ŗȮɁɋɁɌɘȞɗ
ɈɊɂɁɎɁȾɍɎȼɎɘɉȼȾɁɍɗɀɇɛɄɃɈɁɌɁɉɄɛȞɊȾɌɁɈɛȾɃȾɁɔɄȾȼɉɄɛɍɎɊɅɎɁɉɁɋɊɀȾɄɂɉɊ
3 sec
USER
2 sec
Каждый раз отображаются дата, вес и индекс BMI.
Цвет дисплея меняется в зависимости от BMI (см. 10 оценок результатов).
Показатель будет сохраняться с учетом дня измерения и пользователя. Если Вы будете
проводить несколько измерений в день, сохраняться будет последний результат. Данные,
о более ранних показаниях в этот день, не будут сохранены.
Примерно через 10 сек. весы автоматически отключаются.
Запрос сохраненных данных измерений
ȳɎɊȽɗȾɗɃȾȼɎɘɍɊɑɌȼɉɁɉɉɗɁɌɁɃɏɇɘɎȼɎɗɄɃɈɁɌɁɉɄɅȾɗȽɌȼɉɉɊȿɊɋɊɇɘɃɊȾȼɎɁɇɛ
฀
฀
฀
฀ ฀Включите весы
฀
฀
฀
฀ ฀
฀ ฀
฀
฀
฀ ฀
฀
฀
฀
฀
฀
฀
฀
฀
฀
฀
฀
฀
฀
฀
฀
฀ ฀
฀
฀ ฀
฀
฀ ฀
฀
฀
฀
฀
฀
฀
฀
฀ ฀
฀
฀
฀
฀
฀
฀
฀
฀
฀
฀
฀
฀ ฀
฀
฀
฀
฀
฀ ฀
฀ ฀
฀
฀
฀
USER
3 sec
2 sec
BMI
kg
10 Оценка результатов
Индекс массы тела (BMI)
Индекс массы тела (BMI) - это число, которое часто используется при оценке массы
ɎɁɇȼɓɁɇɊȾɁɆȼȹɎɊɓɄɍɇɊɌȼɍɍɓɄɎɗȾȼɁɎɍɛɄɍɑɊɀɛɄɃɈȼɍɍɗɎɁɇȼɓɁɇɊȾɁɆȼɄɁȿɊɌɊɍɎȼ
ɋɊɍɇɁɀɏɚɕɁɅɐɊɌɈɏɇɁȤɉɀɁɆɍɈȼɍɍɗɎɁɇȼ ɈȼɍɍȼɎɁɇȼȬɊɍɎŵȡɀɄɉɄɒɁɅɄɃɈɁɌɁɉɄɛ
ɄɉɀɁɆɍȼɈȼɍɍɗɎɁɇȼɍɊɊɎȾɁɎɍɎȾɁɉɉɊɛȾɇɛɁɎɍɛ>ɆȿɈŵ@ȠɇɛȾɃɌɊɍɇɗɑɇɚɀɁɅɇɁɎɄɍɎȼɌɔɁ
распределение по весу на основании индекса BMI происходит следующим образом (источник:
ȞȪȣ
Дисплей:
Категория
розовый
ȩɁɀɊɍɎȼɎɊɓɉȼɛ
масса
тела
BMI
Острый дефицит массы
< 16
Средний дефицит массы
16-16,9
Легкий дефицит массы
ȣɁɇɁɉɗɅ
ȩɊɌɈȼɇɘɉɗɅȾɁɍ
Желтый
Избыточный вес
Предожирение
Красный
Ожирение
(избыточный вес)
Ожирение I-й степени
Ожирение II-й степени
Ожирение III-й степени
Ɗ
Временная связь результатов
Обратите внимание, что это всё имеет значение только при достаточно
длительном наблюдении. Кратковременные изменения массы тела в пределах
нескольких дней как правило вызваны потерей жидкости.
11 Замена батареек
Произведите замену батареек в случае появления на дисплее значка «Lo». Если
батарейки будут почти разряжены , то весы автоматически выключатся:
Внимание:
šȫɌɄɃȼɈɁɉɁȽȼɎȼɌɁɁɆɄɍɋɊɇɘɃɏɅɎɁȾɍɁȿɀȼȽȼɎȼɌɁɅɆɄɊɀɉɊȿɊɎɄɋȼɈȼɌɆɄɄɈɊɕɉɊɍɎɄ
šȨɁɉɛɅɎɁȾɍɁȿɀȼɍɌȼɃɏȾɍɁȽȼɎȼɌɁɅɆɄ
šȩɁɄɍɋɊɇɘɃɏɅɎɁȾȾɁɍȼɑȼɆɆɏɈɏɇɛɎɊɌɗɀɇɛɈɉɊȿɊɌȼɃɊȾɗɑɃȼɌɛɀɊɆ
12 Хранение и уход
Точность взвешивания и срок службы прибора зависят от бережного обращения с ним:
Внимание:
šȫɁɌɄɊɀɄɓɁɍɆɄɍɇɁɀɏɁɎɓɄɍɎɄɎɘɋɌɄȽɊɌȫɌɄɓɄɍɎɆɁɄɍɋɊɇɘɃɏɅɎɁɍɇɁȿɆȼȾɇȼɂɉɏɚɎɆȼɉɘ
ɉȼɆɊɎɊɌɏɚɋɌɄɂɁɇȼɉɄɄɈɊɂɉɊɉȼɉɁɍɎɄɉɁɈɉɊȿɊɓɄɍɎɛɕɁȿɊɍɌɁɀɍɎȾȼȩɁɄɍɋɊɇɘɃɏɅɎɁ
абразивные моющие средства, не погружайте прибор в воду.
šȞɁɍɗɍɇɁɀɏɁɎɋɌɁɀɊɑɌȼɉɛɎɘɊɎɏɀȼɌɊȾȾɇȼɂɉɊɍɎɄɋɗɇɄɑɄɈɄɆȼɎɊȾɍɄɇɘɉɗɑ
колебаний температуры, электромагнитных полей и не устанавливать их вблизи
ɄɍɎɊɓɉɄɆɊȾɎɁɋɇȼɋɁɓɄɌȼɀɄȼɎɊɌɗɊɎɊɋɇɁɉɄɛȩɁɉȼɂɄɈȼɅɎɁɉȼɆɇȼȾɄɔɏɍɇɄɔɆɊɈ
сильно и не используйте для этого острые предметы.
13 Утилизация
Использованные элементы питания и аккумуляторы утилизируются отдельно от бытового
мусора. Как потребитель Bы обязаны сдавать отработавшие элементы питания
в специализированные приёмные пункты по месту жительства, занимающиеся сбором
такого вида отходов
Указание:
ȹɎɄɃɉȼɆɄɋɌɁɀɏɋɌɁɂɀȼɚɎɊɉȼɇɄɓɄɄȾəɇɁɈɁɉɎȼɑɋɄɎȼɉɄɛɍɇɁɀɏɚɕɄɑ
токсичных веществ:
Pb = свинец,
&G ɆȼɀɈɄɅ
Hg = ртуть.
В интересах охраны окружающей среды отработавшие весы с элементами питания ни
в коем случае нельзя выбрасывать в обычный мусор. Утилизация должна производиться
в соответствии с местными законодательными нормами.
Соблюдайте местные законодательные нормы по утилизации отходов.
Прибор следует утилизировать согласно Директиве ЕС по отходам электрического
и электронного оборудования 2002/96/EC – WEEE (Waste Electrical and Electronic
Equipment).
В случае вопросов обращайтесь в местную коммунальную службу, ответственную
за утилизацию отходов.
14 Что делать при возникновении каких-либо проблем?
Если при взвешивании произошла ошибка, на дисплей выводится одно из следующих
сообщений.
Дисплейное
сообщение
Причина
Устранение
2/
Превышена допустимая
ȿɌɏɃɊɋɊɀɖɝɈɉɊɍɎɘɆȿ
Вес не должен превышать
Ɇȿ
Lo
ȹɇɁɈɁɉɎɗɋɄɎȼɉɄɛɋɊɓɎɄ
разряжены.
ȣȼɈɁɉɄɎɁəɇɁɈɁɉɎɗ
питания.
no
ȣȼɋɌɊɍɊɋȼɈɛɎɄ
пользователя, в которую
еще не было внесено ни
одной записи.
Весы автоматически
отключаются через
короткий промежуток
времени; снова включить
и провести измерения.
Err
BMI находится за
пределами измеряемой
зоны
Снова включите весы
и повторите процесс
измерения.
Весы не производят измерений
Возможные ошибки
Устранение
Если для проведения измерений, Вы
встаете на весы до появления на
дисплее значения « kg», то весы
будут работать некорректно.
Корректно включите режим пользователя
(дождитесь « kg») и повторите измерение.
ȹɇɁɈɁɉɎɗɋɄɎȼɉɄɛȾȾɁɍȼɑɌȼɃɌɛɂɁɉɗ
ȣȼɈɁɉɄɎɁəɇɁɈɁɉɎɗɋɄɎȼɉɄɛ
Весы показывают неправильный вес
Возможные ошибки
Устранение
Весы стоят на ковровом покрытии.
Установите весы на ровное и устойчивое
основание.
ȩɏɇɁȾȼɛɎɊɓɆȼȾɁɍɊȾɉȼɍɎɌɊɁɉȼ
неверно.
Установите весы на ровное и устойчивое
основание. Включить весы и подождать, пока
весы снова не выключатся (не вставать на весы
до открючения). После этого снова вклю- чить
весы и повторить измерение.
15 ž»Ë»ÈÍÃÚ
฀
฀
฀
฀
฀
฀
฀
฀
฀
฀
฀
฀ ฀
฀
฀ ฀
฀
฀
฀
฀
฀
฀
฀
฀ ฀
฀
฀
฀
฀
฀
฀฀
฀
฀
฀
฀ ฀
฀
฀
฀
฀
฀
฀
฀ ฀
฀
฀
฀ ฀
฀
฀ ฀ ฀ ฀ ฀
฀
฀
฀
฀ ฀
฀ ฀
฀
฀ ฀
฀
฀
฀
฀
฀
฀
฀
฀
฀
฀ ฀
฀ ฀
฀ ฀
฀
Q POLSKI
Szanowni Klienci,
EDUG]RG]LãNXMHP\]DZ\EĂUMHGQHJR]QDV]\FKZ\UREĂZ1D]ZDQDV]HMıUP\R]QDF]DZ\VRNLHM
MDNRďFLZ\URE\GRNúDGQLHVSUDZG]RQHZ]DNUHVLH]DVWRVRZDüZREV]DUDFKQDJU]HZDQLDSRPLDUĂZ
PDV\FLDúDFLďQLHQLDNUZLWHPSHUDWXU\FLDúDWãWQDúDJRGQHMWHUDSLLPDVDĮXLSRZLHWU]D
3URVLP\RGRNúDGQHSU]HF]\WDQLHQLQLHMV]HMLQVWUXNFMLREVúXJLRUD]R]DWU]\PDQLHMHMGRSĂĬQLHMV]HJR
XĮ\WNXXGRVWãSQLDMÐFMÐLQQ\PXĮ\WNRZQLNRPRUD]SU]HVWU]HJDMÐF]DZDUW\FKZQLHMLQIRUPDFML
=SRZDĮDQLHP
=HVSĂúıUP\%HXUHU
1
Informacje o urządzeniu
Funkcje urządzenia
7DF\IURZDZDJDV]NODQDVúXĮ\GRRNUHďODQLDFLãĮDUXFLDúDRUD]REOLF]DQLDZVNDĬQLND%0,ZVNDĬQLND
PDV\FLDúD
:DJDMHVWSU]H]QDF]RQDGRXĮ\WNXSU\ZDWQHJRZZDUXQNDFKGRPRZ\FK
:DJDSRVLDGDQDVWãSXMÐFHIXQNFMH]NWĂU\FKPRĮHNRU]\VWDÓQDZHWRVĂE
šSRPLDUPDV\FLDúD
šREOLF]DQLHZVNDĬQLNDPDV\FLDúD%0,
šNRORURZDLQWHUSUHWDFMDZVNDĬQLND%0,ZFHOXúDWZHMNODV\ıNDFML
)XQNFMDSDPLãFLXPRĮOLZLDPDNV\PDOQLHRVRERPVSUDZG]HQLHGRRVWDWQLR]PLHU]RQ\FK
ZDUWRďFLPDV\FLDúDLREOLF]RQHJRZVNDĬQLND%0,
2
Objaśnienia do rysunków
:LQVWUXNFMLREVúXJL]DVWRVRZDQRQDVWãSXMÐFHV\PEROH
Ostrzeżenie 2VWU]HĮHQLHSU]HGQLHEH]SLHF]HüVWZHPREUDĮHüFLDúDOXEXWUDW\]GURZLD
Uwaga
2VWU]HĮHQLHSU]HGQLHEH]SLHF]HüVWZHPXV]NRG]HQLDXU]ÐG]HQLDOXEDNFHVRULĂZ
Wskazówka :DĮQHLQIRUPDFMH
3
Wskazówki dotyczące bezpieczeństwa
Wskazówki dotyczące bezpieczeństwa
Ostrzeżenie:
š1LHVWDZDÓ]MHGQHMVWURQ\QDEU]HJXZDJL:DJDPRĮHVLãSU]HFK\OLÓ
š1LH]H]ZDODÓG]LHFLRPQD]DEDZãRSDNRZDQLHPQLHEH]SLHF]HüVWZRXGXV]HQLD
š0RNUDOXEZLOJRWQDSRZLHU]FKQLDZDJLPRĮHE\ÓďOLVND
60
Wskazówki dotyczące obchodzenia się z bateriami
Ostrzeżenie:
š3RúNQLãFLHEDWHULLVWDQRZL]DJURĮHQLHGODĮ\FLD%DWHULHLZDJãSU]HFKRZ\ZDÓZPLHMVFX
QLHGRVWãSQ\PGODPDú\FKG]LHFL:SU]\SDGNXSRúNQLãFLDEDWHULLQDW\FKPLDVWVNRQWDNWRZDÓ
się z lekarzem.
š%DWHULLQLHZROQRúDGRZDÓDQLUHJHQHURZDÓZĮDGHQLQQ\VSRVĂEUR]NúDGDÓQDF]ãďFL
ZU]XFDÓGRRJQLDRUD]QLHZROQRGRSXďFLÓGR]ZDUFLDEDWHULL
š%DWHULHPRJÐ]DZLHUDÓVXEVWDQFMHWUXMÐFHV]NRGOLZHGOD]GURZLDLďURGRZLVND
%DWHULHQDOHĮ\XW\OL]RZDÓ]JRGQLH]SU]HSLVDPLRERZLÐ]XMÐF\PLZGDQ\PNUDMX
1LJG\QLHZ\U]XFDÓEDWHULL]RGSDGDPL]JRVSRGDUVWZDGRPRZHJR
Uwaga:
š6úDERQDúDGRZDQHEDWHULHQDOHĮ\]DZF]DVXZ\PLHQLÓ
š=DZV]HQDOHĮ\Z\PLHQLDÓUĂZQRF]HďQLHZV]\VWNLHEDWHULHRUD]VWRVRZDÓEDWHULHMHGQHJR
typu.
š:\FLHNDMÐF\]EDWHULLHOHNWUROLWPRĮHXV]NRG]LÓXU]ÐG]HQLH-HĮHOLXU]ÐG]HQLHQLHEãG]LH
SU]H]GúXĮV]\F]DVXĮ\ZDQHQDOHĮ\Z\MÐÓEDWHULH
š-HďOL]EDWHULLZ\FLHNúHOHNWUROLWQDOHĮ\]DúRĮ\ÓUãNDZLFHRFKURQQHLVXFKÐďFLHUHF]NÐ
Z\F]\ďFLÓSU]HJURGãQDEDWHULH
Wskazówki ogólne
š8U]ÐG]HQLHSU]H]QDF]RQHMHVWGRXĮ\WNXZúDVQHJR1LHQDOHĮ\XĮ\ZDÓJRGRFHOĂZ
PHG\F]Q\FKOXENRPHUF\MQ\FK
š1DOHĮ\SDPLãWDÓĮHZ]DNUHVLHWROHUDQFMLPRĮOLZHVÐWHFKQLF]QLHXZDUXQNRZDQHRGFK\OHQLD
SRPLDUĂZSRQLHZDĮZDJDQLHMHVWSU]H]QDF]RQDGRSURIHVMRQDOQHJRPHG\F]QHJR
zastosowania.
š1RďQRďÓZDJLZ\QRVLPDNVNJOE6W3U]\SRPLDU]HPDV\FLDúDZ\QLNLVÐ
Z\ďZLHWODQH]GRNúDGQRďFLÐGRJOEOE
š3U]HG]úRĮHQLHPUHNODPDFMLQDOHĮ\VSUDZG]LÓF]\EDWHULHVÐQDúDGRZDQHLHZHQWXDOQLHMH
Z\PLHQLÓ
š1DSUDZ\PRJÐE\ÓZ\NRQ\ZDQHW\ONRSU]H]VHUZLVSURGXFHQWDOXEDXWRU\]RZDQHJR
dystrybutora.
š:SU]\SDGNXS\WDüGRW\F]ÐF\FK]DVWRVRZDQLDQDV]HJRXU]ÐG]HQLDQDOHĮ\]ZUĂFLÓVLãGR
sprzedawcy lub serwisu.
š:V]\VWNLHZDJLVÐ]JRGQH]G\UHNW\ZÐ:((&
4
Opis urządzenia
2
Budowa
:\ďZLHWODF]
3U]\FLVNŚ'Ăúŗ
3U]\FLVN86(5
3U]\FLVNŚ=PQLHMV]DQLHŘ
3U]\FLVNSET
1
3
61
5
Uruchomienie
Włóż baterie (3 x 1,5 V AAA Mikro)
8VXüWDďPãRFKURQQÐLOXEZúĂĮEDWHULH]JRGQLH]R]QDF]HQLHPELHJXQĂZQDNRPRU]HEDWHULL-HĮHOL
ZDJDQLHEãG]LHG]LDúDÓZ\MPLMEDWHULHLZúĂĮMHSRQRZQLH
Zmiana jednostki wagowej
:DJDSRGDMHZDUWRďFLZNJ'RXVWDZLDQLDMHGQRVWNLPDV\VúXĮ\SU]\FLVN]QDMGXMÐF\VLã]W\úX
XU]ÐG]HQLD'RVWãSQHMHGQRVWNLWRNLORJUDPŚNJŘIXQWŚOEŘRUD]NDPLHüŚVWŘ
Ustawianie wagi
:DJãXVWDZLÓQDSúDVNLPLWZDUG\PSRGúRĮX7ZDUGHSRGúRĮHMHVWZDUXQNLHPSUDZLGúRZHJR
ZDĮHQLD
6
Informacje
Zasada działania
:VNDĬQLN%0,REOLF]DVLãQDSRGVWDZLHZSURZDG]RQHJRZ]URVWXRUD]]PLHU]RQHJRFLãĮDUXFLDúD
Porady
š$E\Z\QLNLE\ú\SRUĂZQ\ZDOQHQDOHĮ\ZDĮ\ÓVLãRPRĮOLZLHVWDú\FKSRUDFKQDMOHSLHMUDQRSR
VNRU]\VWDQLX]WRDOHW\QDWU]HĬZRLEH]XEUDü
7
Włączanie wagi
.UĂWNRPRFQRLZVú\V]DOQ\VSRVĂEXGHU]VWRSÐZZDJãDE\XDNW\ZQLÓF]XMQLNZVWU]ÐVRZ\
:UDPDFKWHVWXQDZ\ďZLHWODF]XSRMDZLVLãŚŗGDWDLQDVWãSQLH"
8
Ustawienia
Wprowadzanie danych użytkownika
G]LHü PLHVLÐF rok
SET
'DWãLJRG]LQãPRĮQD]PLHQLÓZ\úÐF]QLHSRZ\FLÐJQLãFLXLSRQRZQ\PZúRĮHQLXEDWHULL
3RGF]DVXVWDZLDQLDDNWXDOQHMGDW\LJRG]LQ\QDOHĮ\XVWDZLÓSRNROHLG]LHüşPLHVLÐFşURNşJRG]LQ\
– minuty.
62
=PLHQLDQDZDUWRďÓEãG]LHPLJDÓ
š1DFLďQLMSU]\FLVN i DE\]PLHQLÓXVWDZLRQÐZDUWRďÓ
š1DFLďQLMSU]\FLVN6(7DE\]DSLVDÓXVWDZLHQLHLSU]HMďÓGRXVWDZLDQLDNROHMQHMZDUWRďFLOXEDE\
]DNRüF]\ÓXVWDZLDQLH
3RWHMF]\QQRďFLZDJDZ\úÐF]\VLãDXWRPDW\F]QLH
:DJDZ\úÐF]\VLãUĂZQLHĮZĂZF]DVJG\SU]H]VHNXQGQLH]RVWDQLHZFLďQLãW\ĮDGHQSU]\FLVN
Wprowadzanie danych użytkownika
:DJDSR]ZDOD]DSLVDÓGDQHXĮ\WNRZQLNĂZ.DĮG\]XĮ\WNRZQLNĂZPRĮH]DSLVDÓZ\QLNĂZ
SRPLDUĂZ:SDPLãFLPRĮHV]ZUD]]QSLQQ\PLGRPRZQLNDPL]DSLVDÓLVSUDZG]DÓ
QDVWãSXMÐFHXVWDZLHQLDRVRELVWH
.ROHMQRďÓ
'DQHXĮ\WNRZQLND
:DUWRďFLQDVWDZF]H
1
0LHMVFHZSDPLãFL
1 do 10
2
Wzrost
100 do 220 cm
(3'-03" do 7'-03")
:úÐF]ZDJãSNW:úÐF]DQLHZDJL*G\QDZ\ďZLHWODF]XSRMDZLVLãZDUWRďÓŚ kg”:
š:FLVNDMSU]\FLVNŚ86(5ŘGRPRPHQWXSRMDZLHQLDVLãZúDďFLZHJRPLHMVFDZSDPLãFL1DMSLHUZ]RVWDQLHZ\ďZLHWORQ\GRP\ďOQ\Z]URVW2GF]HNDMDĮQDZ\ďZLHWODF]XSRMDZLVLãSRQRZQLHZDUWRďÓ
Ś kg”.
š$E\]PLHQLÓZ]URVWQDOHĮ\ZFLVQÐÓSU]\FLVNŚ6(7Ř
š:FLďQLMSU]\FLVN i DE\XVWDZLÓZ]URVW$E\ZúÐF]\ÓV]\ENLHSU]HZLMDQLHQDOHĮ\SU]\WU]\PDÓ
przycisk.
š=DWZLHUGĬZSURZDG]RQHGDQH]DSRPRFÐSU]\FLVNXŚ6(7Ř
2 sec
USER
3 sec
SET
63
SET
Uwaga: Jeśli w późniejszym czasie użytkownik zmieni ustawienie swojego wzrostu,
wszystkie zapisane dotąd wyniki pomiarów masy ciała zostaną skasowane.
9
Obsługa
Ważenie i obliczanie wskaźnika BMI
:DĮHQLHLREOLF]DQLHZVNDĬQLNDPDV\FLDúD%0,
š:úÐF]ZDJãSNW:úÐF]DQLHZDJL
š=DSRPRFÐSU]\FLVNX86(5Z\ELHU]SDPLãÓXĮ\WNRZQLND]]DSLVDQ\PLXVWDZLHQLDPL1DMSLHUZ
Z\ďZLHWORQ\]RVWDQLHZSURZDG]RQ\Z]URVW2GF]HNDMDĮQDZ\ďZLHWODF]XSRMDZLVLãSRQRZQLH
ZDUWRďÓŚNJŘ7HUD]ZHMGĬQDZDJãZFHOXGRNRQDQLDSRPLDUXPDV\FLDúD3RGF]DVZDĮHQLD
QLHUXV]DMVLã
3 sec
USER
2 sec
:\ďZLHWORQD]RVWDQLHGDWDPDVDFLDúDL%0,
:\ďZLHWODF]]PLHQLVZĂMNRORUZ]DOHĮQRďFLRGZDUWRďFL%0,S2FHQDZ\QLNĂZ
.DĮGHJRGQLDGODGDQHMRVRE\]DSLV\ZDQ\MHVWMHGHQSRPLDU:SU]\SDGNXGRNRQDQLDNLONX
SRPLDUĂZMHGQHJRGQLD]DSLV\ZDQ\MHVW]DZV]HZ\QLNRVWDWQLHJRSRPLDUX:\QLN]DSLVDQ\
ZF]HďQLHMWHJRGQLD]RVWDQLH]DVWÐSLRQ\
3RXSú\ZLHRNVHNXQGQDVWÐSLDXWRPDW\F]QHZ\úÐF]HQLHZDJL
Wyświetlanie zapisanych wyników pomiaru
:FHOXZ\ďZLHWOHQLD]DSLVDQ\FKZ\QLNĂZSRPLDUĂZDNWXDOQLHZ\EUDQHJRXĮ\WNRZQLND
š:úÐF]ZDJãSNW:úÐF]DQLHZDJL
š:\ELHU]ZúDďFLZHJRXĮ\WNRZQLNDSU]H]NLONXNURWQHZFLďQLãFLHSU]\FLVNXŚ86(5ŗ:SU]\SDGNX
QLHZFLďQLãFLDLQQHJRSU]\FLVNXSRXSú\ZLHRNVHNXQGSRMDZLVLãSRQRZQLHZ]URVWZ\EUDQHJR
XĮ\WNRZQLNDDQDVWãSQLHZDUWRďÓŚ kg”.
š=DSRPRFÐSU]\FLVNX lub PRĮQDSU]HJOÐGDÓSRNROHLSRV]F]HJĂOQHZ\QLNLSRPLDUĂZ
š:\ďZLHWORQD]RVWDQLHGDWDPDVDFLDúDL%0,:\ďZLHWODF]]PLHQLDVZĂMNRORUZ]DOHĮQRďFLRG
ZDUWRďFL%0,S2FHQDZ\QLNĂZ
USER
3 sec
2 sec
BMI
kg
10 Ocena wyników
Wskaźnik masy ciała BMI
:VNDĬQLNPDV\FLDúD%0,WRZDUWRďÓNWĂUDF]ãVWRMHVWZ\NRU]\VW\ZDQDGRRFHQ\PDV\
FLDúD:LHONRďÓWDMHVWREOLF]DQDQDSRGVWDZLHPDV\FLDúDLZ]URVWX2EOLF]DVLãMÐZHGúXJ
QDVWãSXMÐFHJRZ]RUXZVNDĬQLNPDV\FLDúD%0, PDVDFLDúDZ]URVWŵ-HGQRVWNÐ%0,MHVW]DWHP
>NJPŵ@.ODV\ıNDFMDPDV\FLDúDQDSRGVWDZLH%0,ZSU]\SDGNXRVĂEGRURVú\FKSRZ\ĮHM
ODWRGE\ZDVLãZRSDUFLXRSRQLĮV]HZDUWRďFLĬUĂGúR¨ZLDWRZD2UJDQL]DFMD=GURZLD
:\ďZLHWODF]
Kategoria
5ĂĮRZ\
Niedowaga
BMI
'XĮDQLHGRZDJD
< 16
¨UHGQLDQLHGRZDJD
16-16,9
Lekka niedowaga
Zielony
:DJDSUDZLGúRZD
ÆĂúW\
Nadwaga
=DJURĮHQLHRW\úRďFLÐ
&]HUZRQ\
2W\úRďÓQDGZDJD
,VWRSLHüRW\úRďFL
,,VWRSLHüRW\úRďFL
,,,VWRSLHüRW\úRďFL
Ɗ
Czasowa zależność wyników pomiarów
:DĮQHMHVWDE\SRPLDU\SU]HSURZDG]DÓSU]H]GúXĮV]\RNUHVF]DVX=UHJXú\NUĂWNRWUZDúH
ZDKDQLDFLãĮDUXFLDúDXZDUXQNRZDQHVÐSU]H]XWUDWãZRG\ZRUJDQL]PLH
11 Wymiana baterii
3RSRMDZLHQLXVLãQDZ\ďZLHWODF]XNRPXQLNDWXŚ/RŗQDOHĮ\Z\PLHQLÓEDWHULHZDJL:SU]\SDGNX
]E\WVúDE\FKEDWHULLZDJDZ\úÐF]\VLãDXWRPDW\F]QLH
Wskazówka:
š3U]\NDĮGHMZ\PLDQLHEDWHULLXĮ\ZDÓEDWHULLWHJRVDPHJRW\SXWHMVDPHMPDUNLLSRMHPQRďFL
š:V]\VWNLHEDWHULHZ\PLHQLDÓMHGQRF]HďQLH
š1LHXĮ\ZDÓúDGRZDOQ\FKDNXPXODWRUĂZ
š8Į\ZDÓEDWHULLQLH]DZLHUDMÐF\FKPHWDOLFLãĮNLFK
12 Przechowywanie i konserwacja
'RNúDGQRďÓSRPLDUĂZLWUZDúRďÓXU]ÐG]HQLD]DOHĮÐRGSUDZLGúRZHJRREFKRG]HQLDVLã
]XU]ÐG]HQLHP
Uwaga:
š2GF]DVXGRF]DVXQDOHĮ\F]\ďFLÓXU]ÐG]HQLH'RF]\V]F]HQLDXĮ\ZDMOHNNRZLOJRWQHM
V]PDWNLQDNWĂUÐPRĮHV]ZUD]LHSRWU]HE\GRGDÓRGURELQãďURGNDGRF]\V]F]HQLD1LH
XĮ\ZDÓĮUÐF\FKďURGNĂZF]\V]F]ÐF\FKLQLJG\QLHP\ÓXU]ÐG]HQLDSRGELHĮÐFÐZRGÐ
š:DJãQDOHĮ\FKURQLÓSU]HGZVWU]ÐVDPLZLOJRFLÐNXU]HPFKHPLNDOLDPLGXĮ\PLZDKDQLDPL
WHPSHUDWXU\RUD]SRODPLHOHNWURPDJQHW\F]Q\PL8U]ÐG]HQLHQLHSRZLQQR]QDMGRZDÓVLã]E\W
EOLVNRĬUĂGHúFLHSúDQSSLHFĂZJU]HMQLNĂZ1LHQDFLVNDÓSU]\FLVNĂZQDVLúãOXE]DSRPRFÐ
ostrych przedmiotów.
13 Utylizacja
1LHZ\U]XFDÓEDWHULL]RGSDGDPL]JRVSRGDUVWZDGRPRZHJR8Į\WNRZQLNMHVWSUDZQLH]RERZLÐ]DQ\
GR]ZURWX]XĮ\W\FKEDWHULL=XĮ\WHEDWHULHQDOHĮ\RGGDÓGRSXQNWXXW\OL]DFMLOXEGR
VNOHSXNWĂU\SURZDG]LVSU]HGDĮEDWHULLWHJRW\SX
Wskazówka:
1DEDWHULDFK]DZLHUDMÐF\FKV]NRGOLZHVXEVWDQFMH]DPLHV]F]RQHVÐ
QDVWãSXMÐFHR]QDF]HQLD
3E EDWHULD]DZLHUDRúĂZ
&G EDWHULD]DZLHUDNDGP
+J EDWHULD]DZLHUDUWãÓ
=HZ]JOãGXQDRFKURQãďURGRZLVNDZDJLLEDWHULLQLHZROQRZ\U]XFDÓ]ZUD]]RGSDGDPL
]JRVSRGDUVWZDGRPRZHJR8U]ÐG]HQLHQDOHĮ\RGQLHďÓGRSXQNWX]ELĂUNL]XĮ\WHJRVSU]ãWX
elektrycznego i elektronicznego.
1DOHĮ\SU]HVWU]HJDÓNUDMRZ\FKSU]HSLVĂZGRW\F]ÐF\FKXW\OL]DFMLPDWHULDúĂZ
8U]ÐG]HQLHQDOHĮ\]XW\OL]RZDÓ]JRGQLH]Z\W\F]QÐ2002/96/EC – WEEE (Waste
(OHFWULFDODQG(OHFWURQLF(TXLSPHQWR]XĮ\W\FKXU]ÐG]HQLDFKHOHNWU\F]Q\FKL
elektronicznych.
:UD]LHS\WDüQDOHĮ\]ZUĂFLÓVLãGRRGSRZLHGQLHMLQVW\WXFMLRGSRZLHG]LDOQHM]D
XW\OL]DFMã
66
14 Co robić w przypadku problemów?
-HďOLZWUDNFLHSRPLDUXZDJDZ\NDĮHEúÐGQDZ\ďZLHWODF]XSRMDZLDMÐVLãQDVWãSXMÐFH
wskazania.
:\ďZLHWODF]
Przyczyna
5R]ZLÐ]DQLH
2/
Przekroczono maksymalny
XGĬZLJNJ
'RSXV]F]DOQHREFLÐĮHQLHGR
NJ
Lo
%DWHULHVÐSUDZLHZ\F]HUpane.
:\PLHQLÓEDWHULH
no
3UĂEDZ\ďZLHWOHQLDSRPLDUĂZXĮ\WNRZQLNDGOD
którego nie zapisano
MHV]F]HĮDGQ\FKZDUWRďFL
:DJDZ\úÐF]\VLãSRFKZLOLDXWRPDW\F]QLHZúÐF]
SRQRZQLHZDJãLGRNRQDM
pomiaru.
Err
%0,]QDMGXMHVLãSR]D]DNUHsem pomiaru.
3RQRZQLHZúÐF]ZDJãLSRZtórz pomiar.
Brak możliwości pomiaru
%úÐG
5R]ZLÐ]DQLH
-HĮHOLVWDQLHV]QDZDG]H]DQLPQD
Z\ďZLHWODF]XSRMDZLVLãŚNJŗQLH
EãG]LHRQDSUDZLGúRZRG]LDúDÓ
:úÐF]ZDJãZHZúDďFLZ\VSRVĂESRF]HNDM
QDSRMDZLHQLHVLãŚNJŗLSRZWĂU]SRPLDU
%DWHULHZDJLVÐZ\F]HUSDQH
:\PLHQLÓEDWHULH
Błędny pomiar ciężaru ciała
%úÐG
5R]ZLÐ]DQLH
Waga stoi na dywanie.
8VWDZLÓZDJãQDWZDUG\PSRGúRĮX
:DJDPDĬOHXVWDZLRQ\SXQNW]HURZ\
8VWDZLÓZDJãQDWZDUG\PSRGúRĮX8DNW\ZQLÓ
ZDJãLRGF]HNDÓDĮZDJDVLãSRQRZQLHZ\úÐF]\
QLHZFKRG]LÓGRWHJRPRPHQWXQDZDJã
1DVWãSQLHSRQRZQLHXDNW\ZQLÓZDJãLSRZWĂU]\Ó
pomia.
67
,UUWXPXQGgQGHUXQJHQYRUEHKDOWHQ