Change for Life
Service Manual
Models: MULTI18HP230V1BO
MULTI24HP230V1BO
GREE ELECTRIC APPLIANCES,INC.OF ZHUHAI
Service Manual
Table of Contents
Part Ė : Technical Information ...............................................................................1
1. Summary ..............................................................................................................................1
6SHFL¿FDWLRQV ..................................................................................................................2
3. Outline Dimension Diagram ................................................................................6
4. Refrigerant System Diagram ..............................................................................7
5. Electrical Part...................................................................................................................8
5.1 Wiring Diagram.........................................................................................................................8
5.2 PCB Printed Diagram .............................................................................................................10
6. Function and Control ..............................................................................................12
Part ė : Installation and Maintenance .........................................................15
7. Notes for Installation and Maintenance..................................................15
8. Installation Manual ....................................................................................................17
8.1 Electrical Connections............................................................................................................18
8.2 Installing the Outdoor Unit......................................................................................................19
8.3 Installation Dimension Diagram..............................................................................................20
8.4 Check after Installation...........................................................................................................21
9. Troubleshooting ..........................................................................................................22
9.1 Flashing LED of Indoor/Outdoor Unit and Primary Judgement .............................................22
9.2 Malfunction Checking and Elimination ...................................................................................23
9.3 Maintenance Method for Normal Malfunction.........................................................................36
10. Exploded View and Parts List ......................................................................38
11. Removal Procedure ...............................................................................................42
Appendix: ................................................................................................................................55
Appendix 1: Reference Sheet of Celsius and Fahrenheit ............................................................55
$SSHQGL[&RQ¿JXUDWLRQRI&RQQHFWLRQ3LSH.............................................................................55
Appendix 3: Pipe Expanding Method ...........................................................................................56
Appendix 4: List of Resistance for Ambient Temperature Sensor ................................................57
Table of Contents
Service Manual
Part Ė : Technical Information
1. Summary
Outdoor Unit
MULTI18HP230V1BO
MULTI24HP230V1BO
Technical Information
1
Service Manual
6SHFL¿FDWLRQV
Model
Product Code
Rated Voltage
Power
Rated Frequency
supply
Phases
Cooling capacity(max~min)
Heating capacity(max~min)
Cooling Power Input(max~min)
Heating Power Input(max~min)
Cooling Current Input
Heating Current Input
Rated Power Input
Rated Current
EER
COP
Compressor Trademark
Compressor Model
Compressor Refrigerant Oil Type
Compressor Type
L.R.A
Compressor Rated Load Amp (RLA)
Compressor Power Input
Compressor Thermal Protector
Throttling Method
Cooling Operation Ambient Temperature Range
Heating Operation Ambient Temperature Range
Condenser Material
Condenser Pipe Diameter
Rows-Fin Gap(mm)
Coil length (l) X height (H) X coil width (L)
Fan Motor Speed (rpm) (H/M/L)
Output of Fan Motor
Fan Motor RLA
Outdoor
Fan Motor Capacitor
Unit
Air Flow Volume of Outdoor Unit
Fan Type-Piece
Fan Diameter
Defrosting Method
Climate Type
Isolation
Moisture Protection
Permissible Excessive Operating Pressure for the
Discharge Side
Permissible Excessive Operating Pressure for the
Suction Side
Dimension (W/H/D)
Dimension of Package (L/W/H)
Dimension of Package(L/W/H)
Net Weight
Gross Weight
efrigerant Charge
Refrigerant Charge
2
V~
Hz
W
W
W
W
A
A
W
A
W/W
W/W
A
A
W
O
F
F
O
inch
inch
inch
rpm
W
A
ȝ)
CFM
inch
MULTI18HP230V1BO
CB228W04100
208/230
60
1
5280(2051~6155)
5570(2500~6624)
1650
1640
10.67/10.56
6.78/6.10
2800
12.48
3.2
3.4
ZHUHAI LANDA COMPRESSOR CO.,LTD
QXA-B141zF030A
RB68EP
Inverter Rotary
/
7.2
1440
1NT11L-6233
Electron expansion valve
-0.4~118.4
-4~75.2
Aluminum Fin-copper Tube
ĭ
2-1/18
33 1/2X1 /12X26
630
60
/
/
1883
$[LDOÀRZ
ĭ
Automatic Defrosting
T1
I
IP24
MPa
4.3
MPa
2.5
inch
inch
inch
lb
lb
38X27 5/9X15 3/5
40 2/5X18X29
40 1/2X18X29 1/2
114.7
124.6
R410A
77.6
oz
Technical Information
Service Manual
Cross-sectional Area of Power Cable Conductor
Recommended Power Cable(Core)
Connection Pipe Connection Method
Not Additional Gas Connection Pipe Length
Connection Pipe Gas Additional Charge
Outer Diameter of Liquid Pipe1(GREE Allocation)
(Metric)
Outer Diameter of Liquid Pipe2(GREE Allocation)
(Metric)
Outer Diameter of Gas Pipe1(GREE Allocation)
Outdoor (Metric)
Outer Diameter of Gas Pipe2(GREE Allocation)
Unit
(Metric)
Connection Pipe Max. Height Distance(indoor and
indoor)
Connection Pipe Max. Height Distance(indoor and
outdoor and indoor up)
Connection Pipe Max. Height Distance(indoor and
outdoor and outdoor up)
Max. equivalent connection pipe length(outdoor to
last indoor)
Connection Pipe Max. Length Distance(total lenght)
sq in
N
ft
oz/ft.
0.0032
3
Flare Connection
16.4
0.2
inch
1/4
inch
1/4
inch
3/8
inch
3/8
ft
32.8
ft
32.8
ft
32.8
ft
32.8
ft
65.6
The above data is subject to change without notice; please refer to the nameplate of the unit.
Technical Information
3
Service Manual
Model
Product Code
Rated Voltage
Power
Rated Frequency
supply
Phases
Cooling capacity(max~min)
Heating capacity(max~min)
Cooling Power Input(max~min)
Heating Power Input(max~min)
Cooling Current Input
Heating Current Input
Rated Power Input
Rated Current
EER
COP
Compressor Trademark
Compressor Model
Compressor Refrigerant Oil Type
Compressor Type
L.R.A
Compressor Rated Load Amp (RLA)
Compressor Power Input
Compressor Thermal Protector
Throttling Method
Cooling Operation Ambient Temperature Range
Heating Operation Ambient Temperature Range
Condenser Material
Condenser Pipe Diameter
Rows-Fin Gap(mm)
Coil length (l) X height (H) X coil width (L)
Fan Motor Speed (rpm) (H/M/L)
Output of Fan Motor
Fan Motor RLA
Outdoor
Fan Motor Capacitor
Unit
Air Flow Volume of Outdoor Unit
Fan Type-Piece
Fan Diameter
Defrosting Method
Climate Type
Isolation
Moisture Protection
Permissible Excessive Operating Pressure for the
Discharge Side
Permissible Excessive Operating Pressure for the
Suction Side
Dimension (W/H/D)
Dimension of Package (L/W/H)
Dimension of Package(L/W/H)
Net Weight
Gross Weight
efrigerant Charge
Refrigerant Charge
4
V~
Hz
W
W
W
W
A
A
W
A
W/W
W/W
A
A
W
O
F
F
O
inch
inch
inch
rpm
W
A
ȝ)
CFM
inch
MULTI24HP230V1BO
CB228W04200
208/230
60
1
7620(2198~9672)
8500(2198~7500)
2400
2350
10.65
10.43
4550
20.19
3.0
3.5
ZHUHAI LANDA COMPRESSOR CO.,LTD
QXAS-D23zX090B
RB68EP
Inverter Rotary
/
11.5
2550
1NT11L-6233
Electron expansion valve
-0.4~118.4
-4~75.2
Aluminum Fin-copper Tube
ĭ
2-1/18
38 2/3X1 1/2X29 4/9
800
90
/
/
2354
$[LDOÀRZ
ĭ
Automatic Defrosting
T1
I
IP24
MPa
4.3
MPa
2.5
inch
inch
inch
lb
lb
38 4/7X31 1/9X17 1/3
42 1/2X19X33
42 2/3X19 1/5X33 2/3
153.2
164.3
R410A
77.6
oz
Technical Information
Service Manual
Cross-sectional Area of Power Cable Conductor
Recommended Power Cable(Core)
Connection Pipe Connection Method
Not Additional Gas Connection Pipe Length
Connection Pipe Gas Additional Charge
Outer Diameter of Liquid Pipe1(GREE Allocation)
(Metric)
Outer Diameter of Liquid Pipe2(GREE Allocation)
(Metric)
Outer Diameter of Liquid Pipe2(GREE Allocation)
(Metric)
Outer Diameter of Gas Pipe1(GREE Allocation)
Outdoor (Metric)
Outer Diameter of Gas Pipe2(GREE Allocation)
Unit
(Metric)
Outer Diameter of Gas Pipe2(GREE Allocation)
(Metric)
Connection Pipe Max. Height Distance(indoor and
indoor)
Connection Pipe Max. Height Distance(indoor and
outdoor and indoor up)
Connection Pipe Max. Height Distance(indoor and
outdoor and outdoor up)
Max. equivalent connection pipe length(outdoor to
last indoor)
Connection Pipe Max. Length Distance(total lenght)
sq in
N
ft
oz/ft.
0.0051
3
Flare Connection
16.4
0.2
inch
1/4
inch
1/4
inch
1/4
inch
3/8
inch
3/8
inch
3/8
ft
32.8
ft
32.8
ft
32.8
ft
65.6
ft
196.8
The above data is subject to change without notice; please refer to the nameplate of the unit.
Technical Information
5
Service Manual
3. Outline Dimension Diagram
MULTI18HP230V1BO
35 1/8
27 5/9
13 3/7
15 3/5
38
14 1/2
22
Unit:inch
MULTI24HP230V1BO
13 3/7
38 4/7
17 1/3
31 1/9
35 1/8
14 1/2
22
Unit:inch
6
Technical Information
Service Manual
4. Refrigerant System Diagram
outdoor
indoor
filter
A heat exchanger
A3
A1
filter
B heat exchanger
fan
A2
outdoor heat exchanger
4-way valve
B3
B1
SP
filter
B2
high pressure switch
Note: Not available for 14K/18K
model
discharge silencer
C heat exchanger
C3
C1
filter
D3
C2
D1
filter
D2
gas -liquid separator
inverter compressor
D heat exchanger
discharge temperature
sensor
Note: Not available for 14K/18K model
A1:A-unit electronic expansion valve B1:B-unit electronic expansion valve
C1:C-unit electronic expansion valve D1:D-unit electronic expansion valve
A2:A-unit gas pipe temperature sensor B2:B-unit gas pipe temperature sensor
C2:C-unit gas pipe temperature sensor D2:D-unit gas pipe temperature sensor
A3:A-unit liquid pipe temperature sensor B3:B-unit liquid pipe temperature sensor
C3:C-unit liquid pipe temperature sensor D3:D-unit liquid pipe temperature sensor
Technical Information
7
Service Manual
5. Electrical Part
5.1 Wiring Diagram
Ɣ,QVWUXFWLRQ
Symbol
WH
YE
RD
YEGN
VT
Symbol Color
White
Yellow
Symbol
GN
BN
Symbol Color
GREEN
Brown
Red
BU
Blue
Yellow/Green
BK
Black
Violet
OG
Orange
Symbol
COMP
Name
Compressor
Grouding wire
Ɣ,QGRRU8QLW
MULTI18HP230V1BO
7(50,1$/
%/2&.
/
/
7(50,1$/
%/2&.
%8
7(50,1$/
%/2&.
&2035(6625
%$1'+($7(5
<(*1
*
%1
%8
1
%1 $&/
%8 1
7(50,1$/
%/2&.
57
97
:$<
)$
8
5'
9
&20,11(5
*<
<9
:$<9$/9(
97
+($7%
;
28778%(
7(036(1625
)%
:
%8
;
/ %8
<(
/ <(
5'
/ 5'
&211(&725
%1
: 9 8
:+
*
(+
2875220
7(036(1625
:+ 57
(+
%.
%8
(;+$867
7(036(1625
76(1625
5'
%27720
%21'+($7(5
*
;7%
$&/
1
1
$&/
$3
1
(3(
%.
(/(&7521,&
(;3$16,21 (.9 ; 9$/9(%
:+
(/(&7521,& (.9
(;3$16,21
; 9$/9($
;7$
%. 57
%1
;7
*
7(50,1$/
%/2&. %8
,1'22581,7%
,1'22581,7$
32:(5
/
/
$30DLQ%RDUG
5'
+($7&
29&&203
2)$1
0
:$51,1*
<(*1
*
;
%.
:+
5'
4$ 57 <$ 57
;
%.
4% 57 <%
&203
:+ 29(5/2$'
3527(&725 &203
78%(%
78%($
5'
6$7
*
*
%.
5'
57
*
)$102725
8
Technical Information
Service Manual
MULTI24HP230V1BO
7(50,1$/%/2&.
/
/
/
%1
$&/
%8
/
<(*1
32:(5
;7
*
,1'22581,7&
,1'22581,7%
,1'22581,7$
;7$
1
1
7(50,1$/
%/2&.
*
;7%
1
*
;7&
1
1
7(50,1$/
%/2&.
*
%.
$&/
5'
+($7%
(+
(/(&7521,&
(;3$16,21 (.9
5' 9$/9(&
)&
;
(/(&7521,&
(;3$16,21 (.9
%. 9$/9(%
)%
2*
%8
28778%(
7(036(1625
:+
:$<
9$/9(
<9
:$<
97
)$
29&&203
29(5/2$'
3527(&725
:+
8
/;
9
:+
+,*+
35(6685(
6:,7&+
97
5($&725
%8
:
/;
%8
;
/ %8
<(
/ <( 9
5'
/ 5'
8
&203
&203
*
:
&211(&725
*
5'
1
&20,11(5
2)$1
*
<(*1
*
$30$,1%2$5'
:+
%.
)$1
02725
+($7&
;
5'
57 57
4$ <$
*$6
/,48,'
3,3(
3,3(
7(03 7(03
6(1625 6(1625
%.
%.
5'
&2035(6625
%$1'+($7(5
78%(&
78%(%
78%($
0
3OHDVHGRQ
WWRXFKDQ\WHUPLQDOZKHQ
WKHYROWDJHRIWHUPLQDO3'&DQG
1'&DW$3LVKLJKHUWKDQ9WR
SUHYHQWWKHULVNRIHOHFWULFDOVKRFN
57
:+
;
(/(&7521,&
(;3$16,21 (.9
9$/9($
:+
%1
7(50,1$/
%/2&.
2875220
7(036(1625
%8 +36 3
+33
;
*<
57
<(
5'
%8
(;+$867
7(036(1625
:+
%.
%1
57
1
76(1625
%27720
%$1'+($7(5
%1
7(50,1$/
%/2&.
%8
1
1
$30$,1%2$5'
(3(
*
%8
7(50,1$/
%/2&.
1
7(50,1$/
%/2&.
<(*1
%1
$&/
;
5'
57 57
4% <%
*$6
/,48,'
3,3(
3,3(
7(03 7(03
6(1625 6(1625
5'
%.
;
5'
57 57
4& <&
*$6
/,48,'
3,3(
3,3(
7(03 7(03
6(1625 6(1625
These circuit diagrams are subject to change without notice, please refer to the one supplied with the unit.
Technical Information
9
Service Manual
5.2 PCB Printed Diagram
MULTI18HP230V1BO
1
Terminal of compressor
2
Terminal of low-temperature
cooling temperature sensor
3
Overload protection terminal of
compressor
4
Temperature sensor terminal of
outdoor unit
5
High pressure protection
terminal
11
6
Low pressure protection
terminal
12
7
Terminal of outdoor unit
8
Electric heating belt terminal of
chassis
ƔTOP VIEW
1
2 3
4
5
6
7
8
9
10
1
9
Terminal of 4-way valve
10
Electric heating belt terminal of
compressor
11
Terminal of temperature sensor
wire for liquid valve and gas
valve
12
Terminal of electronic
expansion valve
13
Terminal of communication wire
for indoor unit and outdoor unit
14
Neutral wire terminal for
communication
13
14
15
16
15
Live wire terminal
16
Neutral wire terminal
ƔBOTTOM VIEW
10
Technical Information
Service Manual
MULTI24HP230V1BO
1
ƔTOP VIEW
1
2
3 4
5
6
7
8
2
9
3
10 4
11 5
12
13 6
14
15 7
16
8
17
9
10
18
11
19
12
13
14
20
21
15
16
17
23
ƔBOTTOM VIEW
Technical Information
22
18
Terminal of compressor
Low pressure protection
terminal
High pressure protection
terminal
Overload protection terminal of
compressor
Temperature sensor terminal of
outdoor unit
Electric heating terminal of
chassis
Electric heating terminal of
compressor
Terminal of outdoor unit
Terminal of 4-way valve
Temperature sensor for liquid
valve and gas valve for unit A
Temperature sensor for liquid
valve and gas valve for unit B
Temperature sensor for liquid
valve and gas valve for unit C
Temperature sensor for liquid
valve and gas valve for unit D
Electronic expansion vale for
unit A
Electronic expansion vale for
unit C
Electronic expansion vale for
unit B
Electronic expansion vale for
unit D
Communication wire with indoor
unit
19
Neutral wire for counication
20
Live wire
21
Neutral wire
22
Reactor wire 1
23
Reactor wire 2
11
Service Manual
6. Function and Control
1 Basic functions of the system
1.1 Cooling Mode
1.1.1 Cooling conditions and process:
If the compressor is in stop status and start the unit for cooling operation, when one of the indoor units reaches the cooling
operation condition, the unit start cooling operation; in this case, the electronic expansion valve, the outdoor fan and the
compressor start operation.
1.1.2 Stop in cooling operation
1.1.2.1 Compressor stops
The compressor stops immediately, the outdoor fan stops after 1min.
1.1.2.2 Some of the indoor units reach the stop condition (the compressor does not stop)
The compressor operates immediately according to the required frequency. For the indoor unit with no requirement, the
corresponding electronic expansion valve is closed to OP.
1.1.3 Cooling mode transfers to heating mode
When the unit transfers to heating mode, the 4-way valve is energized after the compressor stops for 2min. The other disposals
are the same as stopping in cooling mode.
1.1.4 4-way valve: in this mode, the 4-way valve is closed.
1.1.5 Outdoor fan control in cooling mode
The outdoor fan starts before 5s of the starting of compressor. The outdoor fan will run in high speed for 3min after starting and
then it will run in set speed. The fan shall run at every speed for at least 80s. (When the quantity of running indoor unit is
changed, the unit will enter the control described in 1.3.5.1 and 1.3.5.2);
When the compressor stops, the outdoor fan runs at present speed and stops after 1min.
1.2 Dry Mode
1.2.1 The dry conditions and process are the same as those in cooling mode;
1.2.2 The status of 4-way valve: closed;
1.2.3 The temperature setting range: 16 ~ 30ć;
1.2.4 Protection function: the same as those in cooling mode;
1.2.5 In dry mode, the maximum value A of the capacity requirement percentage of single unit is 90% of that in cooling mode.
The open condition of the electronic expansion valve, outdoor fan and compressor is the same as those in cooling mode.
1.3 Heating Mode
1.3.1 Cooling conditions and process:
When one of the indoor units reaches the heating operation condition, the unit starts heating operation.
1.3.2 Stop in heating operation:
1.3.2.1 When all the indoor units reach the stop condition, the compressor stops and the outdoor fan stops after 1min;
1.3.2.2 Some of the indoor units reach the stop condition
The compressor reduces the frequency immediately and operates according to the required frequency;
1.3.2.3 Heating mode transfers to cooling mode(dry mode), fan mode
a. The compressor stops; b. the power of 4-way valve is cut off after 2min; c. the outdoor fan stops after 1min; d. the status of
4-way valve: energized;
12
Technical Information
Service Manual
1.3.3 Outdoor fan control in heating mode
The outdoor fan starts before 5s of the starting of compressor and then it will run in high speed for 40s;
The fan shall run at every speed for at least 80s;
When the compressor stops, the outdoor fan stops after 1min.
1.3.4 Defrosting function
When the defrosting condition is met, the compressor stops; the electronic expansion valve of all indoor units open in big angle;
the outdoor fan stops after 40s of the stop of compressor, meanwhile, the 4-way valve reverses the direction; after the 4-way
valve reverses the direction, the compressor starts; then begin to calculate the time of defrosting, the frequency of the
compressor rises to reach the defrosting frequency.
1.3.5 Oil-returned control in heating mode
1.3.5.1 Oil-returned condition
The whole unit is operating in low frequency for a long time
1.3.5.2 Oil-returned process in heating mode
The indoor unit displays “H1”
1.3.5.3 Oil-returned finished condition in heating mode
The duration reaches 5min
1.4 Fan Mode
The compressor, the outdoor fan and the 4-way valve are closed; temperature setting range is 16̚30ć.
2. Protection Function
2.1 Mode Conflict Protection of indoor unit
When the setting mode is different of different indoor unit, the unit runs in below status:
a. The mode of the first operating indoor unit is the basic mode, then compare the mode of the other indoor units to see if there
is a conflict. Cooling mode (dry mode) is in conflict with heating mode.
b. Fan mode is in conflict with heating mode and the heating mode is the basic mode. No matter which indoor unit operates first,
the unit will run in heating mode.
2.2 Overload protection function
When the tube temperature is a little low, the compressor raises the operation frequency; when the tube temperature is a little
high, the compressor frequency is restricted or lows down the operation frequency; when the tube temperature is too high, the
compressor protection stops running.
If the discharge temperature protection continuously appears for 6 times, the compressor can’t resume running. The
compressor can resume running after cutting off the power and then putting through the power. (if the running time of the
compressor is longer than 7min, the protection times record will be cleared)
2.3 Discharge Protection Function
When the discharge temperature is a little low, the compressor raises the operation frequency; when the discharge temperature
is a little high, the compressor frequency is restricted or lows down the operation frequency; when the discharge temperature is
too high, the compressor protection stops running.
If the discharge temperature protection continuously appears for 6 times, the compressor can’t resume running. The
compressor can resume running after cutting off the power and then putting through the power. (if the running time of the
compressor is longer than 7min, the protection times record will be cleared)
Technical Information
13
Service Manual
2.4 Communication malfunction
Detection of the quantity of installed indoor units:
After 3min of energizing, if the outdoor unit does not receive the communication data of certain indoor unit, the outdoor unit will
judge that indoor unit is not installed and will treat it as it is not installed. If the outdoor unit receives the communication data of
that indoor unit later, the outdoor unit will treat that unit as it is installed.
2.5 Overcurrent Protection
a. Overcurrent protection of complete unit; b. phase wire current protection; c. compressor phase current protection
2.6 Compressor high-pressure protection
2.6.1 When the high-pressure switch is detected cut off for 3s continuously, the compressor will enter high-pressure protection
as it stops when reaching set temperature. Meanwhile, the outdoor unit will send the signal of “high-pressure protection” to the
indoor units;
2.6.2 After the appearance of high-pressure protection, when the high-pressure switch is detected closed for 6s continuously,
the compressor can resume running only after cutting off the power and then putting through the power.
2.7 Compressor overload protection
If the compressor overload switch is detected having movement, the indoor unit will display the corresponding malfunction as it
stops when the indoor temperature reaching set temperature. When the compressor stops for more than 3min and the
compressor overload switch is reset, the unit will resume operation status automatically. If the protection appears for more than
6 times (if the running time of the compressor is longer than 30min, the protection times record will be cleared), the unit can not
resume operation status automatically, but can resume running only after cutting off the power and then putting through the
power.
2.8 Compressor Phase-lacking Protection
When the compressor starts, if one of the three phases is detected open, the compressor will enter phase-lacking protection.
The malfunction will be cleared after 1min, the unit will restart and then detect if there is still has phase-lacking protection. If the
phase-lacking protection is detected for 6 times continuously, the compressor will not restart but can resume running only after
cutting off the power and then putting through the power. If the running time of the compressor is longer than 7min, the
protection times record will be cleared.
2.9 IPM Protection
2.9.1 When the IMP module protection is detected, the unit will stop as the indoor temperature reaching set temperature, PFC is
closed, display IMP protection malfunction. After the compressor stops for 3min, the unit will resume operation status
automatically; if the IMP protection is detected for more than 6 times continuously (If the running time of the compressor is
longer than 7min, the protection times record will be cleared), the system will stop and send the signal of module protection to
indoor unit. The unit can not resume operation status automatically, but can resume running only after cutting off the power and
then putting through the power.
2.9.2 IMP module overheating protection
2.9.2.1 When TIMPη85ć, prohibit to raise frequency;
2.9.2.2 When TIMP≥ 90ć, the operation frequency of compressor lows down by 15% every 90s according to the present
capacity requirement of the complete unit. It will keep 90s after lowing down the frequency. After lowing down the frequency, if
TIMP≥ 90ć, the unit will circulate the above movement until reaching the minimum frequency; if 85ćζTIMPζ90ć, the unit will
run at this frequency; when TIMP≤ 85ć, the unit will run at the frequency according to the capacity requirement;
2.9.2.3 When TIMP≥ 95ć, the compressor stops. After the compressor stops for 3min, if TIMPζ85ć, the compressor and the
outdoor fan will resume operation.
14
Technical Information
Service Manual
Part ė : Installation and Maintenance
7. Notes for Installation and Maintenance
Safety Precautions:
Important!
Please read the safety precautions carefully before
installation and maintenance.
The following contents are very important for installation
and maintenance.
Please follow the instructions below.
Ɣ7KHLQVWDOODWLRQRUPDLQWHQDQFHPXVWDFFRUGZLWKWKH
instructions.
Ɣ&RPSO\ZLWKDOOQDWLRQDOHOHFWULFDOFRGHVDQGORFDO
electrical codes.
Ɣ3D\DWWHQWLRQWRWKHZDUQLQJVDQGFDXWLRQVLQWKLV
manual.
Ɣ$OOLQVWDOODWLRQDQGPDLQWHQDQFHVKDOOEHSHUIRUPHGE\
GLVWULEXWRURUTXDOL¿HGSHUVRQ
Ɣ$OOHOHFWULFZRUNPXVWEHSHUIRUPHGE\DOLFHQVHG
technician according to local regulations and the
instructions given in this manual.
Ɣ%HFDXWLRQGXULQJLQVWDOODWLRQDQGPDLQWHQDQFH3URKLELW
LQFRUUHFWRSHUDWLRQWRSUHYHQWHOHFWULFVKRFNFDVXDOW\DQG
other accidents.
Warnings
Electrical Safety Precautions:
1. Cut off the power supply of air conditioner before
FKHFNLQJDQGPDLQWHQDQFH
2. The air condition must apply specialized circuit and
prohibit share the same circuit with other appliances.
3. The air conditioner should be installed in suitable
location and ensure the power plug is touchable.
0DNH VXUH HDFK ZLULQJ WHUPLQDO LV FRQQHFWHG ILUPO\
during installation and maintenance.
5. Have the unit adequately grounded. The grounding wire
can’t be used for other purposes.
6. Must apply protective accessories such as protective
boards, cable-cross loop and wire clip.
7. The live wire, neutral wire and grounding wire of power
supply must be corresponding to the live wire, neutral
wire and grounding wire of the air conditioner.
8. The power cord and power connection wires can’t be
SUHVVHGE\KDUGREMHFWV
,I SRZHU FRUG RU FRQQHFWLRQ ZLUH LV EURNHQ LW PXVW EH
UHSODFHGE\DTXDOL¿HGSHUVRQ
Installation and Maintenance
10. If the power cord or connection wire is not long enough,
please get the specialized power cord or connection wire
from the manufacture or distributor. Prohibit prolong the wire
by yourself.
11. For the air conditioner without plug, an air switch must
be installed in the circuit. The air switch should be all-pole
parting and the contact parting distance should be more than
LQFK
0DNHVXUHDOOZLUHVDQGSLSHVDUHFRQQHFWHGSURSHUO\DQG
the valves are opened before energizing.
&KHFNLIWKHUHLVHOHFWULFOHDNDJHRQWKHXQLWERG\,I\HV
SOHDVHHOLPLQDWHWKHHOHFWULFOHDNDJH
5HSODFHWKHIXVHZLWKDQHZRQHRIWKHVDPHVSHFL¿FDWLRQ
if it is burnt down; don’t replace it with a cooper wire or
conducting wire.
15. If the unit is to be installed in a humid place, the circuit
EUHDNHUPXVWEHLQVWDOOHG
Installation Safety Precautions:
1. Select the installation location according to the requirement of this manual.(See the requirements in installation
part)
2. Handle unit transportation with care; the unit should not
be carried by only one person if it is more than 44.09lb.
:KHQ LQVWDOOLQJ WKH LQGRRU XQLW DQG RXWGRRU XQLW D VXI¿FLHQW¿[LQJEROWPXVWEHLQVWDOOHGPDNHVXUHWKHLQVWDOODWLRQ
VXSSRUWLV¿UP
:DUH VDIHW\ EHOW LI WKH KHLJKW RI ZRUNLQJ LV DERYH inch.
5. Use equipped components or appointed components during installation.
0DNHVXUHQRIRUHLJQREMHFWVDUHOHIWLQWKHXQLWDIWHU¿Qishing installation.
Refrigerant Safety Precautions:
$YRLG FRQWDFW EHWZHHQ UHIULJHUDQW DQG ¿UH DV LW JHQHUDWHV
poisonous gas; Prohibit prolong the connection pipe by
welding.
$SSO\ VSHFL¿HG UHIULJHUDQW RQO\ 1HYHU KDYH LW PL[HG ZLWK
any other refrigerant. Never have air remain in the refrigerant
line as it may lead to rupture or other hazards.
0DNHVXUHQRUHIULJHUDQWJDVLVOHDNLQJRXWZKHQLQVWDOODWLRQ
is completed.
,IWKHUHLVUHIULJHUDQWOHDNDJHSOHDVHWDNHVXI¿FLHQWPHDVXUH
to minimize the density of refrigerant.
5. Never touch the refrigerant piping or compressor without
wearing glove to avoid scald or frostbite.
,PSURSHULQVWDOODWLRQPD\OHDGWR¿UHKD]DUGH[SORVLRQ
HOHFWULFVKRFNRULQMXU\
15
Service Manual
Main Tools for Installation and Maintenance
1. Level meter, measuring tape
2. Screw driver
3. Impact drill, drill head, electric drill
16
4. Electroprobe
5. Universal meter
6. Torque wrench, open-end wrench, inner
hexagon spanner
(OHFWURQLFOHDNDJHGHWHFWRU
8. Vacuum pump
9. Pressure meter
10. Pipe pliers, pipe cutter
11. Pipe expander, pipe bender
12. Soldering appliance, refrigerant container
Installation and Maintenance
Service Manual
8. Installation Manual
Installation procedures
Start installation
Preparation before installation
Read the requirements
for electric connection
select installation
location
Select indoor unit
installation location
Prepare tools
Select outdoor unit
installation location
Install the support of outdoor unit
(select it according to the actual situation)
Install wall-mounting
frame, drill wall holes
Connect pipes of indoor
unit and drainage pipe
Fix outdoor unit
Connect wires of indoor unit
Install drainage joint of outdoor unit
(only for cooling and heating unit)
Bind up pipes and
hang the indoor unit
Make the bound pipes pass
through the wall hole and then
connect outdoor unit
Connect pipes of outdoor unit
Connect wires of outdoor unit
Neaten the pipes
Vacuum pumping and leakage detection
Check after installation and test operation
Finish installation
Note: this flow is only for reference; please find the more detailed installation steps in this section.
Installation and Maintenance
17
Service Manual
8.1 Electrical Connections
1. Remove the handle at the right side plate of the outdoor
unit (one screw).
2. Remove the cable clamp, connect the power connection
cable with the terminal at the row of connection and fix the
FRQQHFWLRQ7KH¿WWLQJOLQHGLVWULEXWLQJPXVWEHFRQVLVWHQWZLWK
the indoor unit. terminal of line bank. Wiring should meet that of
indoor unit.
3. Fix power connection wire by wire clamp.
(QVXUHZLUHKDVEHHQ¿[HGZHOO
5. Install the handle.
MULTI18HP230V1BO
To unit B
To unit A
Including an air switch with suitable capacity, please note
the following table. Air switch should be included magnet
buckle and heating buckle function, it can protect the
circuit-short and overload. (Caution: please do not use
thefuse only for protect the circuit)
L1 L2
connecting
cable
Power cord
connecting
cable
An all-pole disconnection switch having a contact
separation of at least 3mm in all pole should be connected
LQ¿[HGZLULQJ
To the power supply
L1 L2
Wrong wire connection may cause malfunction of some
HOHFWULF FRPSRQHQWV$IWHU¿[LQJFDEOHHQVXUHWKDW OHDGV
EHWZHHQFRQQHFWLRQWR¿[HGSRLQWKDYHVRPHVSDFH
The connection pipes and the connectiong wirings of
the unit A and unit B must be corresponding to each
other respective.
L2
L1
MULTI24HP230V1BO
The appliance shall be installed in accordance with
national wiring regulations.
To unit A
1RWHWKHDERYH¿JXUHVDUHRQO\LQWHQGHGWREHDVLPSOH
diagram of the appliance and may not correspond to the
appearance of the units that have been purchased.
To unit B
To unit C
L1 L2
Power cord
connecting
cable
connecting
cable
connecting
cable
To the power supply
C
L1 L2
L2
L1
C
18
Installation and Maintenance
Service Manual
8.2 Installing the Outdoor Unit
,QVWDOOWKHGUDLQ¿WWLQJDQGWKHGUDLQKRVHIRUPRGHOZLWK
heat pump only)
Location
Condensation is produced and flows from the outdoor unit
8VHEROWVWRVHFXUHWKHXQLWWRDÀDWVROLGÀRRU
when the appliance is operating in the heating mode. In order
When mounting the unit on a wall or the roof, make sure the support is
not to disturb neighbours and to respect the environment,
¿UPO\VHFXUHGVRWKDWLWFDQQRWPRYHLQWKHHYHQWRILQWHQVHYLEUDWLRQVRU install a drain fitting and a drain hose to channel the
condensate
a strong wind.
water. Install the drain fitting and rubber washer on the
Do not install the outdoor unit in pits or air vents
outdoor unit chassis and connect a drain hose to it as shown
Installing the pipes
LQWKH¿JXUH
Use suitable connecting pipes and equipment for the
refrigerant R410A.
Models(ft)
Max. connection pipe
length(ft)
Max. connection pipe
length(Simpleone
18K
24K
65.6
196.8
32.8
65.6
indoor unit)(ft)
The refrigerant pipes must not exceed the maximum heights 16.4ft(18K)
or 32.8ft(24K).
Wrap all the refrigerant pipes and joints.
Tighten the connections using two wrenches working in opposite
directions.
Caution: Installation Must be Performed in Accordance with the
1(&&(&E\$XWKRUL]HG3HUVRQQHO2QO\
Humid air left inside the refrigerant circuit can cause compressor
malfunction. After having connected the indoor and outdoor units, bleed
the air and humidity from the refrigerant circuit using a vacuum pump.
(1) Unscrew and remove the caps from the 2-way and 3-way valves.
(2) Unscrew and remove the cap from the service valve.
(3) Connect the vacuum pump hose to the service valve.
(4) Operate the vacuum pump for 10-15 minutes until an absolute
vacuum of 10 mm Hg has been reached.
(5) With the vacuum pump still in operation, close the low-pressure knob
Vacuum pump
on the vacuum pump coupling. Stop the vacuum pump.
Vacuum pump
(6) Open the 2-way valve by 1/4 turn and then close it after 10 seconds.
Check all the joints for leaks using liquid soap or an electronic leak
device.
(7) Turn the body of the 2-way and 3-way valves. Disconnect
the vacuum pump hose.
(8) Replace and tighten all the caps on the valves.
Vacuum pump
Hex nut diameter(inch) Tightening torque(ft·Ibf)
ĭ
11.10~4.75
ĭ
20.12~29.50
ĭ
33.19~40.56
ĭ
44.24~47.94
ĭ
51.32~55.31
(8) Secure
INDOOR
UNIT
Refrigerant fluid direction of flow
3-way valve
(6) Open by 1/4 turn
(7) Turn to open fully
18K unit need to be installed the indoor unit
Service
inlet
(2)Turn
(8) Secure
conversion joint
Installation and Maintenance
2-way valve
(7) Turn to open fully
Valve cap
(2)Turn
(2)Turn
Valve cap
(8) Secure
Connect to the
indoor unit
19
Service Manual
8.3 Installation Dimension Diagram
Use suitable instruments for the refrigerant R410A.
Ɣ'RQRWXVHDQ\RWKHUUHIULJHUDQWWKDQ5$
Do not use mineral oils to clean the unit.
7KHLQVWDOODWLRQPXVWEHGRQHE\WUDLQHGDQGTXDOL¿HGVHUYLFHSHUVRQQHOZLWKUHOLDELOLW\DFFRUGLQJWRWKLVPDQXDO
Contact service center before installation to avoid the malfunction due to unprofessional installation.
:KHQSLFNLQJXSDQGPRYLQJWKHXQLWV\RXPXVWEHJXLGHGE\WUDLQHGDQGTXDOL¿HGSHUVRQ
Ensure that the recommended space is left around the appliance .
MULTI18HP230V1BO
50cm or more
Space to the cover
30cm or above
Space to the cover
30cm or above
(Air inlet side)
200cm or above
(Air outlet side)
50 cm or
ab ov e
Sp ac e to
the wa ll
MULTI24HP230V1BO
50cm or more
Space to the cover
30cm or above
Space to the cover
30cm or above
(Air inlet side)
200cm or above
(Air outlet side)
50 cm or
ab ov e
Sp ac e to
the wa ll
20
Installation and Maintenance
Service Manual
&KHFNDIWHU,QVWDOODWLRQ
Check Items
Problems Owing to Improper Installation
Is the installation reliable?
The unit may drop, vibrate or make noises
Has the gas leakage been checked?
May cause unsatisfactory cooling (heating)
effect
Is the thermal insulation of the unit
May cause condensation and water dropping
sufficient?
Is the drainage smooth?
May cause condensation and water dropping
Does the power supply voltage accord
The unit may bread down or the components
with the rated voltage specified on the
may be burned out
nameplate?
Are the lines and pipelines correctly
The unit may bread down or the components
installed?
may be burned out
Has the unit been safely grounded?
Risk of electrical leakage
Are the models of lines in conformity
The unit may bread down or the components
with requirements?
may be burned out
Are there any obstacles near the air
The unit may bread down or the components
inlet and outlet of the indoor and outdoor
may be burned out
units?
Have the length of refrigerating pipe
It is not easy to decide the charge amount
and refrigerant charge amount been
of refrigerant.
recorded?
Installation and Maintenance
21
Service Manual
9. Troubleshooting
)ODVKLQJ/('RI,QGRRU2XWGRRU8QLWDQG3ULPDU\-XGJHPHQW
1. Requirement of malfunction display
When several malfunctions happen at the same time, malfunction codes will be displayed circularly.
2. Malfunction display method
(1) Hardware malfunction: it will be displayed immediately, please refer to “Malfunction status sheet”;
(2) Operation status: it will be displayed immediately, please refer to “Malfunction status sheet”;
(3) Other malfunction: It will be displayed after the compressor has been stopped for 200s, please refer to “Malfunction
status sheet”.
(Note: when the compressor starts up again, malfunction display waiting time (200s) will be cleared.)
3. Malfunction display control
Indoor unit displays malfunction code as shown in the sheet below. ODU communication light will be off for 1s and then blink
for 1s circularly.
4. Viewing malfunction code through remote controller
Enter viewing malfunction code: pressing light button for 6 times within 3S to view malfunction code;
Exit viewing malfunction code: pressing light button for 6 times within 3S or after the malfunction code is displayed for 5min.
Malfunction status sheet
Malfunction name
Zero cross detection circuit malfunction(for indoor unit)
Malfunction protection of jumper cap(for indoor unit)
Malfunction type
Hardware malfunction
Hardware malfunction
Nixie tube
U8
C5
Feedback of without IDU motor(for indoor unit)
Indoor ambient temperature sensor is open/short circuited
Hardware malfunction
Hardware malfunction
H6
F1
Indoor evaporator temperature sensor is open/short circuited
Liquid valve temperature sensor is open/short circuited
Hardware malfunction
Hardware malfunction
F2
b5
Gas valve temperature sensor is open/short circuited
Modular temperature sensor is open/short circuited
Hardware malfunction
Hardware malfunction
b7
P7
Outdoor ambient temperature sensor is open/short circuited
Outdoor condenser middle pipe temperature sensor is
open/short circuited
Outdoor discharge temperature sensor is open/short
circuited
Communication malfunction
Malfunction of phase current detection circuit for compressor
Hardware malfunction
F3
Hardware malfunction
F4
Hardware malfunction
F5
Hardware malfunction
Hardware malfunction
Viewing malfunction code
through remote controller within
200s; displayed directly on
nixietube after 200s
E6
U1
P8
Hardware malfunction
PU
Hardware malfunction
Hardware malfunction
E1
E3
Module high temperature protection
Refrigerant lacking or blockage protection of system (not
available for residential ODU)
Charging malfunction of capacitor
High pressure protection of system
Low pressure protection of system (reserved)
22
F0
Installation and Maintenance
Service Manual
Compressor overload protection
Indoor unit and outdoor unit do not match
Viewing malfunction code
through remote controller within
200s; displayed directly on
nixietube after 200s
Hardware malfunction
Malfunction of memory chip
Wrong connection of communication wire or malfunction of
electronic expansion valve
Malfunction protection of outdoor fan 1
Detection status of wrong connection of communication wire
or malfunction of electronic expansion valve
Mode conflict
Refrigerant recycling mode
X-fan
Defrosting or oil return in heating mode
H3
LP
Hardware malfunction
EE
Hardware malfunction
dn
Hardware malfunction
L3
Operation status
dd
Operation status
E7
Operation status
Operation status
Operation status
Fo
AL
H1
Start failure of compressor
High discharge temperature protection of compressor
Overload protection
Lc
E4
E8
Whole unit overcurrent protection
Compressor phase current protection
E5
P5
Compressor desynchronizing
Compressor phase-lacking/phase-inverse protection
IPM modular protection
Viewing malfunction code
through remote controller within
200s; displayed directly on
nixietube after 200s
H7
Ld
H5
DC bus-bar low voltage protection
DC bus-bar high voltage protection
PL
PH
PFC protection
The four-way valve is abnormal
HC
U7
0DOIXQFWLRQ&KHFNLQJDQG(OLPLQDWLRQ
Note: discharge the position in below pictures with discharge resistance after open the top cover and
check if the voltage is below 20V with universal meter, then begin to check.
18K:
24K:
1 IPM protection malfunction:
Main checking point:
●
If the input voltage of the unit is within normal range?
●
If the connection wire of compressor is connected well? Is it loose? If the connection sequence is correct?
●
If the resistance of compressor coil is normal? If the isolation of compressor coil with copper pipe is good?
●
If the unit is overloaded? If the heat radiation of the unit is good?
●
If the refrigerant charge is suitable?
Flow chart:
Installation and Maintenance
23
Service Manual
●
If the resistance of compressor coil is normal? If the isolation of compressor coil with copper pipe is good?
●
If the unit is overloaded? If the heat radiation of the unit is good?
●
If the refrigerant charge is suitable?
Energize the unit
Flow chart:
Please check:
1. if the indoor and outdoor heat exchanges are
dirty, if there is obstacle to affect the radiation;
2. if the indoor and outdoor fans are running
normally;
3. if the pressure of the system is too high;
4. if the refrigerant is too much which causes
the high level of pressure;
yes
If the above cases are existed?
no
Correct according to the service
manual and then energize the
unit to operate
no
If the wire of compressor is connected
well and correctly?
yes
Reconnect the wire of the
compressor according to the
correct wiring method
Test the resistance between
the three phases
no
If the resistance is normal?
yes
Test the isolation impedance
between the three phases of the
compressor and thecopper pipe
yes
If the resistance is above 500M
?
no
Replace the
compressor
yes
Malfunction is eliminated
no
Replace the outdoor
mainboard
End
24
Installation and Maintenance
Service Manual
2. PFC protection malfunction, capacity charging malfunction
Main checking points:
If the wiring of the induction is connected well and if the induction is broken;
If the mainboard is broken;
Flow chart:
Start
Check if power supply is normal
yes
Power supply is abnormal?
Turn on the unit
after power supply
resumes normal
no
Replace the outdoor
mainboard
End
Installation and Maintenance
25
Service Manual
Start
Check If the power supply is normal
Turn on the unit after the
yes
power supply resumes to
Power supply is abnormal
normal situation
no
Check if the outdoor induction is broken
yes
The induction is broken
Replace the induction
no
no
Malfunction is eliminated
Replace the outdoor
mainboard
yes
End
26
Installation and Maintenance
Service Manual
3. Compressor desynchronizing malfunction
Main checking points:
If the pressure of the system is too high;
If the eletric expansion valve is working normally or it is broken;
If the radiation of the unit is good;
Flow chart:
The unit appears desynchronizing
as soon as energizing and starting
no
The stop duration of the compressor is longer
than 3min?
yes
The wiring of the compressor is
no
Reconnect the wire properly
connected properly?
yes
no
yes
Eliminate the malfunction
no
Replace the eletric
expansion valve
The eletric expansion valve is broken?
yes
no
yes
Eliminate the malfunction
Replace the outdoor mainboard
yes
Eliminate the malfunction
no
Replace the compressor
End
Installation and Maintenance
27
Service Manual
Desynchronizing happens
during operation
Outdoor unit is working?
no
Check if fan
terminal is
connected well
Replace the fan capacitor
Improve radiation
situation of the unit
(such as cleaning
the heat exchanger,
improve ventilation
Replace the outdoor unit
yes
Unit radiation is good?
no
yes
Input voltage is normal?
no
Turn on the unit
after the power
supply voltage
resumes normal
yes
Charge refrigerant
Refrigerant amount is too much?
yes
according to the
service manual
no
Replace the outdoor
mainboard
Eliminate the malfunction
yes
no
Replace the compressor
End
28
Installation and Maintenance
Service Manual
4. Compressor overload, diacharge protectionmalfunction
Main checking points:
If the eletric expansion valve is connected well or it is broken;
If there is refrigerant leakage;
If the overload protector is broken;
Flow chart:
Start
If the overload protector is connected well?
no
yes
no
Check the resistance between the two
ends of the overload protector in ambient temperature,
if the resistance is below 1k
yes
If the wiring of the eletric expansion valve
is coonected well?
no
Reconnect according
to the wiring diagram
yes
Replace the
overload
protector
Check the coil of the eletric
expansion valve, replace
it if it is broken
Eliminate the malfunction
yes
no
Check the refrigerant status, if there is
refrigerant leakage, recharge it according
to the service manual
yes
Eliminate the malfunction
no
Replace outdoor
mainboard
End
Note: the detection method of the coil of the eletric expansion valve: there is five pieces of coil of the eletric expansion valve,
the resistance of one of them (the leftmost or the rightmost one) is almost the same as the resistance of other terminal (within
100
). Judge the condition of the electronic expansion valve through detecting these resistance.
Installation and Maintenance
29
Service Manual
5. Start failuremalfunction
Main checking points:
If the connection wire of the compressor is connected properly;
If the stop duration of the compressor is sufficient;
If the compressor is broken;
If the
; refrigerant charging amount is too much;
Flow chart:
Energize and
start the unit
no
If the stop duration of the compressor
is longer than 3min
yes
If the connection wire of the compressor
is connected well and correctly
yes
no
Reconnect the connection wire
of the compressor according
to the wiring diagram
no
no
If the refrigerant charging
amount is too much
Eliminate the malfunction
yes
yes
Charge the refrigerant
according to the
service manual
yes
Eliminate the malfunction
no
The stop duration of the unit is
not enough, the high and low
pressure of the system is not
balanced, restart it after 3min
Replace the outdoor
mainboard
yes
Eliminate the malfunction
no
Replace the compressor
End
30
Installation and Maintenance
Service Manual
6. Temperature sensor malfunction
Main checking points:
If the temperature; sensor is damaged or broken
If the terminal of the temperature sensor is loosended or not connected;
If the mainboard is broken;
Flow chart:
Start
Check whether the wiring terminal between
temperature sensor and controller is loosened or poorly
yes
contacted?
Insert the temperature
sensor tightly
no
no
Check whether the
temperature senspr is normal according to
Eliminate the
malfunction
no
yes
Replace the temperature sensor
with the same model
resistance table
no
yes
Eliminate the malfunction6.
yes
Replace the controller with
the same model
End
Installation and Maintenance
31
Service Manual
7. DC fan malfunction
Main checking points:
If the outdoor fan is blocked by foreign objects;
The connection wire of DC fan is connected reliably? If it is loose?
Flow chart:
Start
Check if the
outdoor fan is blocked by
yes
foreign objects?
Turn on the unit
after removing the
foreign objects
no
If the connection wire
of DC fan is loose?
yes
Turn on the unit after
the connection wire
is properly connected
no
Replace the outdoor
mainboard
End
32
Installation and Maintenance
Service Manual
8. Communication malfunction
Main checking points:
If the connection wire between the indoor unit and outdoor unit is connected well, if the wires inside the unit is connected well;
If the indoor mainboard or outdoor main board is broken;
Flow chart:
Communication malfunction of some
indoor units
De-energize,check if the connection
wire of indoor and outdoor unit and
the wire of the eletric box is
connected correctly
Connected correctly
no
Reconnect according to
the wiring diagram
yes
Eliminate the malfunction
no
yes
De-energize, change the communication wire of the wellcommunicated indoor unit and malfunction indoor unit,
then energize the unit and wait for 3min
The malfunction indoor unit
resumes normal
yes
Replace outdoor
mainboard
no
Replace the mainboard of the
malfunction indoor unit
End
Installation and Maintenance
33
Service Manual
All the indoor units appear
communication malfunction
De-energize,check if the connection
wire of indoor and outdoor unit and
the wire of the eletric box is
connected correctly
no
Reconnect according to
Connected correctly?
yes
Eliminate the malfunction
the wiring diagram
yes
De-energize, check if the connection wire between
the outdoor mainboard and the filter board
according to the wiring diagram
Reconnect according to
the wiring diagram
no
Connected correctly?
yes
Eliminate the malfunction
no
yes
yes
The connection wire is broken?
Replace the
connection wire
yes
Eliminate the malfunction
no
no
Check if there is power input
bewtween the netrual wire and live
wire of the outdoor mainboard
no
There is power input?
Replace the filter board of
the outdoor unit
yes
Eliminate the malfunction
no
yes
Replace the outdoor
mainboard
Resume communication?
no
Replace indoor
mainboard
yes
End
34
Installation and Maintenance
Service Manual
9. Anti-high temperatureand overload malfunction
Main checking points:
If the outdoor ambient temperature is within the normal range;
If the indoor fan and outdoor fan are running normally;
If the indoor and outdoor radiation environment is good;
Flow chart:
Start
yes
If the outdoor ambient temperature
is above 53
It is a normal protection, please
operate the unit after the outdoor
ambient temperature has changed
no
yes
Improve the radiation
environment of the unit
no
Check if the terminal of the fan is
connected well, if the fan is broken
If the indoor and outdoor radiation
is insufficient
no
If the outdoor fan is working normally
yes
Replace fan capacitor
Replace outdoor
mainboard
Replace outdoor fan
End
Installation and Maintenance
35
Service Manual
9.3 Maintenance Method for Normal Malfunction
1. Air Conditioner Can't be Started Up
Possible Causes
No power supply, or poor
connection for power plug
Discriminating Method (Air conditioner Status)
Troubleshooting
&RQ¿UPZKHWKHULW
VGXHWRSRZHUIDLOXUH,I\HV
After energization, operation indicator isn’t bright wait for power recovery. If not, check power
DQGWKHEX]]HUFDQ
WJLYHRXWVRXQG
supply circuit and make sure the power plug is
connected well.
Wrong wire connection between
indoor unit and outdoor unit,
Under normal power supply circumstances,
or poor connection for wiring
RSHUDWLRQLQGLFDWRULVQ
WEULJKWDIWHUHQHUJL]DWLRQ
terminals
Check the circuit according to circuit diagram
and connect wires correctly. Make sure all
ZLULQJWHUPLQDOVDUHFRQQHFWHG¿UPO\
Make sure the air conditioner is grounded
reliably
Make sure wires of air conditioner is connected
After energization, room circuit breaker trips off at
Electric leakage for air conditioner
correctly
once
Check the wiring inside air conditioner. Check
whether the insulation layer of power cord is
damaged; if yes, place the power cord.
Model selection for air switch is
After energization, air switch trips off
Select proper air switch
improper
After energization, operation indicator is bright,
Replace batteries for remote controller
Malfunction of remote controller while no display on remote controller or buttons
Repair or replace remote controller
have no action.
2. Poor Cooling (Heating) for Air Conditioner
Possible Causes
Set temperature is improper
Rotation speed of the IDU fan
motor is set too low
Filter of indoor unit is blocked
Discriminating Method (Air conditioner Status)
Troubleshooting
Observe the set temperature on remote controller Adjust the set temperature
Small wind blow
Set the fan speed at high or medium
&KHFNWKH¿OWHUWRVHHLW
VEORFNHG
&OHDQWKH¿OWHU
Check whether the installation postion is proper
Adjust the installation position, and install the
Installation position for indoor unit
according to installation requirement for air
rainproof and sunproof for outdoor unit
and outdoor unit is improper
conditioner
Discharged air temperature during cooling is
higher than normal discharged wind temperature;
Discharged air temperature during heating is
Find out the leakage causes and deal with it.
Refrigerant is leaking
lower than normal discharged wind temperature; Add refrigerant.
8QLW
VSUHVVXUHLVPXFKORZHUWKDQUHJXODWHG
range
Malfunction of 4-way valve
blow cold wind during heating
Replace the 4-way valve
Discharged air temperature during cooling is
higher than normal discharged wind temperature;
Discharged air temperature during heating is
Malfunction of capillary
lower than normal discharged wind temperature; Replace the capillary
8QLW
WSUHVVXUHLVPXFKORZHUWKDQUHJXODWHG
range. If refrigerant isn’t leaking, part of capillary
is blocked
Flow volume of valve is
The pressure of valves is much lower than that
Open the valve completely
LQVXI¿FLHQW
VWDWHGLQWKHVSHFL¿FDWLRQ
Refer to point 3 of maintenance method for
Malfunction of horizontal louver Horizontal louver can’t swing
details
Refer to troubleshooting for H6 for maintenance
Malfunction of the IDU fan motor The IDU fan motor can’t operate
method in details
Refer to point 4 of maintenance method for
Malfunction of the ODU fan motor 7KH2'8IDQPRWRUFDQ
WRSHUDWH
details
Refer to point 5 of maintenance method for
Malfunction of compressor
&RPSUHVVRUFDQ
WRSHUDWH
details
3. Horizontal Louver Can't Swing
Possible Causes
Wrong wire connection, or poor
connection
Check the wiring status according to circuit
diagram
Stepping motor is damaged
6WHSSLQJPRWRUFDQ
WRSHUDWH
Others are all normal, while horizontal louver
FDQ
WRSHUDWH
Main board is damaged
36
Discriminating Method (Air conditioner Status)
Troubleshooting
Connect wires according to wiring diagram to
make sure all wiring terminals are connected
¿UPO\
Repair or replace stepping motor
Replace the main board with the same model
Installation and Maintenance
Service Manual
4. ODU Fan Motor Can't Operate
Possible causes
Wrong wire connection, or poor
connection
Discriminating method (air conditioner status)
Check the wiring status according to circuit
diagram
Troubleshooting
Connect wires according to wiring diagram to
make sure all wiring terminals are connected
¿UPO\
Measure the capacity of fan capacitor with an
Capacity of the ODU fan motor is XQLYHUVDOPHWHUDQG¿QGWKDWWKHFDSDFLW\LVRXWRI
Replace the capacity of fan
damaged
the deviation range indicated on the nameplate of
fan capacitor.
Power voltage is a little low or
Use universal meter to measure the power supply
Suggest to equip with voltage regulator
high
voltage. The voltage is a little high or low
When unit is on, cooling/heating performance
Change compressor oil and refrigerant. If no
Motor of outdoor unit is damaged is bad and ODU compressor generates a lot of
better, replace the compressor with a new one
noise and heat.
5. Compressor Can't Operate
Possible causes
Wrong wire connection, or poor
connection
Discriminating method (air conditioner status)
Check the wiring status according to circuit
diagram
Troubleshooting
Connect wires according to wiring diagram to
make sure all wiring terminals are connected
¿UPO\
Measure the capacity of fan capacitor with an
XQLYHUVDOPHWHUDQG¿QGWKDWWKHFDSDFLW\LVRXWRI
Replace the compressor capacitor
the deviation range indicated on the nameplate of
fan capacitor.
Power voltage is a little low or
Use universal meter to measure the power supply
Suggest to equip with voltage regulator
high
voltage. The voltage is a little high or low
Use universal meter to measure the resistance
Coil of compressor is burnt out
Repair or replace compressor
EHWZHHQFRPSUHVVRUWHUPLQDOVDQGLW
V
Cylinder of compressor is blocked &RPSUHVVRUFDQ
WRSHUDWH
Repair or replace compressor
Capacity of compressor is
damaged
$LU&RQGLWLRQHULV/HDNLQJ
Possible causes
Discriminating method (air conditioner status)
Troubleshooting
Eliminate the foreign objects inside the drain
pipe
Replace drain pipe
Drain pipe is blocked
Water leaking from indoor unit
Drain pipe is broken
Water leaking from drain pipe
Water leaking from the pipe connection place of
Wrap it again and bundle it tightly
indoor unit
Wrapping is not tight
7. Abnormal Sound and Vibration
Possible causes
Discriminating method (air conditioner status)
When turn on or turn off the unit,
the panel and other parts will
7KHUH
VWKHVRXQGRI3$3$
H[SDQGDQGWKHUH
VDEQRUPDO
sound
When turn on or turn off the unit,
WKHUH
VDEQRUPDOVRXQGGXH
Water-running sound can be heard
WRÀRZRIUHIULJHUDQWLQVLGHDLU
conditioner
Foreign objects inside the indoor
XQLWRUWKHUH
UHSDUWVWRXFKLQJ
7KHUH
VDEQRUPDOVRXQGIURLQGRRUXQLW
together inside the indoor unit
Foreign objects inside the outdoor
XQLWRUWKHUH
UHSDUWVWRXFKLQJ
7KHUH
VDEQRUPDOVRXQGIURRXWGRRUXQLW
together inside the outdoor unit
Short circuit inside the magnetic During heating, the way valve has abnormal
coil
electromagnetic sound
Abnormal shake of compressor
Outdoor unit gives out abnormal sound
Abnormal sound inside the
compressor
Abnormal sound inside the compressor
Installation and Maintenance
Troubleshooting
Normal phenomenon. Abnormal sound will
disappear after a few minutes.
Normal phenomenon. Abnormal sound will
disappear after a few minutes.
5HPRYHIRUHLJQREMHFWV$GMXVWDOOSDUWV
position of indoor unit, tighten screws and stick
damping plaster between connected parts
5HPRYHIRUHLJQREMHFWV$GMXVWDOOSDUWV
position of outdoor unit, tighten screws and
stick damping plaster between connected parts
Replace magnetic coil
Adjust the support foot mat of compressor,
tighten the bolts
If add too much refrigerant during maintenance,
please reduce refrigerant properly. Replace
compressor for other circumstances.
37
Service Manual
10. Exploded View and Parts List
MULTI18HP230V1BO
38
Installation and Maintenance
Service Manual
NO.
Description
Product Code
1
Front Grill
Part Code
MULTI18HP230V1BO
Qty
CB228W04100
01473050
1
2
Front Panel Assy
01433069
1
3
Chassis Sub-assy
02803280P
1
4
Drainage Connecter
/
/
5
Drainage hole Cap
/
/
6
Gas-liquid Separator Assy
7
Compressor and Fittings
8
Electric Heater(Compressor)
9
Tube Connector Sub-assy
07223048
1
0010524501G
1
7651873215
1
06643008
1
10
Magnet Coil
4300040045
1
11
4-Way Valve Assy
03015200001
1
12
Right Side Plate
0131410000901P
1
13
Valve Support Assy
0713395401
1
14
Electronic Expansion Valve assy
0713395301
1
15
Valve Support Sub-Assy
07133845
1
16
Cut off Valve
071302391
1
17
Cut off Valve
07130239
1
18
Valve Cover
/
1
19
Electric Expand Valve Fitting
43000084
1
20
Electric Expand Valve Fitting
4300008401
1
21
Temperature Sensor
39000073
1
22
Temperature Sensor
39000073
1
23
Wiring Clamp
26115004
1
24
Temperature Sensor
25
Rear Grill
26
27
28
29
39000073
1
01574100003
1
Condenser Assy
0116398001
1
Clapboard Assy
0123315301
1
Coping
01255006P
1
Supporting Board(Condenser)
01795010
1
30
Motor Support Sub-Assy
01705025
1
31
Fan Motor
1501403402
1
32
Left Side Plate
01305043P
1
33
Axial Flow Fan
10335014
1
34
Left Handle
26235401
1
35
Connecting Cable
/
/
36
Electric Box Assy
10000100020
1
37
Electric Box
20113015
1
38
Radiator
/
/
39
Main Board
30138000311
1
Above data is subject to change without notice.
Installation and Maintenance
39
Service Manual
MULTI24HP230V1BO
40
Installation and Maintenance
Service Manual
NO.
1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
21
22
23
24
25
26
27
28
29
30
31
32
33
34
35
36
37
38
39
40
41
42
43
44
45
Description
Product code
Front Grill
Cabinet
Left Handle
Front Side Plate
Electrical Heater (Chassis)
Chassis Sub-assy
Gas-liquid Separator
Compressor and Fittings
Electric Heater(Compressor)
Tube Connector Sub-assy
4-Way Valve Assy
Connection Pipe
Magnet Coil
Electronic Expansion Valve assy
Valve Support Assy
Cut off Valve
Cut off Valve
Right Side Plate
Wiring Cover Sub-assy
Handle Assy
Electric Expand Valve Fitting
Electric Expand Valve Fitting
Electric Expand Valve Fitting
Temperature Sensor
Temperature Sensor
Temperature Sensor
Wiring Clamp
Temperature Sensor
Rear Grill
Condenser Assy
(OHFWULF%R[)LUHSURR¿QJ
Clapboard Sub-Assy
Motor Support Sub-Assy
Top Cover Sub-Assy
Fan Motor
Condenser Support Plate
Axial Flow Fan
Left Side Plate
Connecting Cable
Electric Box Assy
Terminal Board
Connection Support
Electric Box
Main Board
Electric Box Cover Sub-Assy
Part Code
MULTI24HP230V1BO
CB228W04200
01473050
0143500401P
26235401
01305086P
7651000411
02803280P
07223048
0010524501G
7651873215
03003900001
03015200001
03509700042
4300040045
0713395301
0713395401
071302391
07130239
0131410000901P
01264100034
02204100008
4300008402
4300008401
43000084
3900030901
3900007306
3900007305
26115004
39000073
01574100003
0116398001
01413426
01233190
01705025
01255007
1501403402
01175092
10335014
01305043P
4002054026
10000100020
42010178
01703211
20113015
30138000311
02603217
Qty
1
1
1
1
1
1
1
3
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Above data is subject to change without notice.
Installation and Maintenance
41
Service Manual
11. Removal Procedure
Warning: Be sure to wait for a minimum of 20 minutes after turning off all
power supplies and discharge the refrigerant completely before removal.
WHD(18)ND3EO
Steps
Procedure
1.Remove big handle and wire connection cover
Before disassembly
5HPRYHWKHVFUHZV¿[LQJELJKDQGOHDQGULJKWVLGH
plate to remove the big handle.
big handle
5HPRYHWKHVFUHZV¿[LQJZLUHFRQQHFWLRQFRYHU
and right side plate to remove the wire connection
cover.
wire connection cover
42
Installation and Maintenance
Service Manual
Steps
Procedure
2.Remove top cover
top cover
5HPRYHWKHVFUHZV¿[LQJWRSFRYHUSDQHODQGOHIW
right side plate, to remove top cover.
3.Remove grille
5HPRYHWKHVFUHZV¿[LQJJULOOHDQGSDQHOWRUHPRYH
the grille on the panel.
grille
4.Remove panel
5HPRYHWKHVFUHZV¿[LQJSDQHOFKDVVLVDQGPRWRU
support, to remove the panel.
panel
Installation and Maintenance
43
Service Manual
Steps
Procedure
5.Remove right side plate
5HPRYHWKHVFUHZV¿[LQJULJKWVLGHSODWHYDOYH
support and guard grille, to remove the right side
plate.
right side plate
6.Remove guard grille
5HPRYHWKHVFUHZV¿[LQJJXDUGJULOOHDQGOHIWVLGH
plate to remove guard grille.
guard grille
7.Remove left side plate
5HPRYHWKHVFUHZV¿[LQJFKDVVLVDQGFRQGHQVHU
support, to remove the left side plate.
left side plate
44
Installation and Maintenance
Service Manual
Steps
Procedure
8.Remove condenser support
5HPRYHWKHVFUHZV¿[LQJVXSSRUWDQGFKDVVLVWR
remove the condenser support.
condenser support
9.Remove axial fan blade
5HPRYHWKHVFUHZQXWV¿[LQJIDQEODGHZLWKVSDQQHU
to remove the fan blade.
axial fan blade
10.Remove motor and motor support sub-assy
5HPRYHWKHWDSSLQJVFUHZV¿[LQJPRWRUSXOORXWWKH
pin of leading wire for motor and remove the screws
¿[LQJPRWRUVXSSRUWDQGFKDVVLVWRUHPRYHWKHPRWRU
and motor support sub-assy.
motor
motor support sub-assy
Installation and Maintenance
45
Service Manual
Steps
Procedure
11.Remove electric box sub-assy
electric box sub-assy
5HPRYHWKHWDSSLQJVFUHZV¿[LQJLVRODWLRQVKHHW
loosen the wire binds, pull out the terminal, lift to
remove the electric box sub-assy.
12.Remove PFC electrical inductance
5HPRYHWKHVFUHZV¿[LQJ3)&HOHFWULFDOLQGXFWDQFH
and isolation sheet, to remove the PFC electrical
inductance.
PFC electrical inductance
13.Remove four-way valve sub-assy
four-way valve
sub-assy
Welding cut the welding point jointing the four-way
valve with blowtorch to remove the four-way valve
sub-assy. (Note: please make sure there’s no
refrigerant in the unit before remove any tube or
compressor)
46
Installation and Maintenance
Service Manual
Steps
Procedure
14.Remove suction pipe sub-assy
Welding cut the welding point jointing the suction
pipe sub-assy, compressor and liquid receiver, to
remove the suction pipe sub-assy.
suction pipe sub-assy
15.Remove liquid receiver
5HPRYHWKHVFUHZV¿[LQJLVRODWLRQVKHHWDQGOLTXLG
receiver and lift to remove the liquid receiver.
liquid receiver
16.Remove the isolation sheet assy
Remove the screws fixing isolation sheet and
condenser side plate, to remove the isolation sheet
assy.
isolation sheet assy
Installation and Maintenance
47
Service Manual
Steps
Procedure
17.Remove compressor
compressor
5HPRYHWKHVFUHZQXWV¿[LQJFRPSUHVVRUIRRWVDQG
chassis with spanner, as well as the foot cushion, to
remove the compressor.
18.Remove valve support assy
valve support assy
5HPRYHWKHVFUHZV¿[LQJYDOYHVXSSRUWDVV\DQG
chassis sub-assy, to remove the valve support assy.
19.Remove EXV assy
Welding cut the welding point jointing EXV sub-assy
and refrigerant collection pipe, to remove the EXV
assy. (Note: fully pack the big valve with wet cloth
when welding cutting, to avoid high temperature
damage of valve)
EXV assy
48
Installation and Maintenance
Service Manual
MULTI24HP230V1BO
Steps
Procedure
1. Remove valve cover and top panel
1
Twist off the screws used for fixing and valve
cover , pull valve cover up ward to remove it.
2
Remove the 3 screws connecting the top
top panel
panel with the front panel and the right side
plate, and then remove the top panel.
2. Remove grille,front side plate and panel.
1
Remove the 2 screws connecting the grille
grille
and the panel, and then remove the grille.
2
Remove the 1 screw connecting the front side
plate and the panel,and then remove the front
side plate.
Installation and Maintenance
front side plate
49
Service Manual
3
Remove the 5 screws connecting the panel
with the chassis and the motor support,
and then remove the panel.
panel
3. Remove right side plate and left side plate
right side plate
1
Remove the screws connecting the right
side plate with the chassis, the valve
support and the electric box, and then
remove the right side plate assy.
left side plate
2
Remove the screws connecting the left
side plate and the chassis, and then
remove the left side plate assy.
50
Installation and Maintenance
Service Manual
4. Remove fan motor and axial flow blade
1
Remove the nuts fixing the blade and then
axial flow blade
remove the axial flow blade.
fan motor fixing frame
2
Remove the 4 tapping screws fixing the
motor; disconnect the leading wire insert of
the motor and then remove the motor.
Remove the 2 tapping screws fixing the
motor support and then pull the motor
support upwards to remove it.
fan motor
5. Remove electric box
electric box
Remove the screws fixing the electric box
sub-assy; loosen the wire bundle; pull out
the wiring terminals and then pull the
electric box upwards to remove it.
Installation and Maintenance
51
Service Manual
6.Remove soundproof sponge and 4-way valv e assy
1
soundproof sponge
Since the piping ports on the soundproof sponge are
torn easily, remove the soundproof sponge carefully
4-way valv e assy
2
Discharge the refrigerant completely;unsolder
the pipelines connecting the compressor and
the condenser assy,and then remove the 4-way
valve assy.
Connection Pipe
7. Remove Isolation sheet
Remove the 3 screws fixing the isolation sheet
and then remove the Isolation sheet.
52
Isolation sheet
Installation and Maintenance
Service Manual
8. Remove Cut off Valve and Valve Support
Remove the 2 bolts fixing the valve subassemblies.
Unsolder the welding joint connecting the gas valve
and the return air pipe. Remove the gas valve.
(Note: When unsoldering the soldering joint, wrap the
gas valve with wet cloth completely to avoid damage
to the valve caused by high temperature.)
Unsolder the welding joint connecting the liquid valve
and the connecting pipe.Remove the liquid valve.
Valve Support
Cut off Valve
Remove screws fixing valve support and then remove
the valve support; remove the screw fixing the
condenser and then pull the condenser upwards to
remove it.
9. Remove compressor
Remove the 3 foot nuts fixing the compressor
and then remove the compressor.
10.Remove support
1
Remove the screws connecting the support
and condenser assy,and thenremove the support.
Installation and Maintenance
support
53
Service Manual
condenser sub-assy
11.Remove condenser sub-assy
Remove the chassis sub-assy and condenser
sub-assy.
chassis sub-assy
54
Installation and Maintenance
Service Manual
Appendix:
Appendix 1: Reference Sheet of Celsius and Fahrenheit
Conversion formula for Fahrenheit degree and Celsius degree: Tf=Tcx1.8+32
Set temperature
Fahrenheit
display
Fahrenheit
Celsius˄ć˅
temperature
˄̧˅
˄̧˅
61
60.8
16
62/63
62.6
17
64/65
64.4
18
66/67
66.2
19
68
68
20
Fahrenheit
display
Fahrenheit
Celsius˄ć˅
temperature
˄̧˅
˄̧˅
69/70
69.8
21
71/72
71.6
22
73/74
73.4
23
75/76
75.2
24
77
77
25
Fahrenheit
display
temperature
˄̧˅
78/79
80/81
82/83
84/85
86
Fahrenheit
display
Fahrenheit
Celsius˄ć˅
temperature ˄̧˅
˄̧˅
55/56
55.4
13
57/58
57.2
14
59/60
59
15
61/62
60.8
16
63
62.6
17
64/65
64.4
18
66/67
66.2
19
68/69
68
20
70/71
69.8
21
72
71.6
22
73/74
73.4
23
75/76
75.2
24
77/78
77
25
Fahrenheit
display
Fahrenheit
Celsius˄ć˅
temperature
˄̧˅
˄̧˅
79/80
78.8
26
81
80.6
27
82/83
82.4
28
84/85
84.2
29
86/87
86
30
88/89
87.8
31
90
89.6
32
91/92
91.4
33
93/94
93.2
34
95/96
95
35
97/98
96.8
36
99
98.6
37
Fahrenheit
Celsius˄ć˅
˄̧˅
78.8
80.6
82.4
84.2
86
26
27
28
29
30
Ambient temperature
Fahrenheit
display
Fahrenheit
Celsius˄ć˅
temperature
˄̧˅
˄̧˅
32/33
32
0
34/35
33.8
1
36
35.6
2
37/38
37.4
3
39/40
39.2
4
41/42
41
5
43/44
42.8
6
45
44.6
7
46/47
46.4
8
48/49
48.2
9
50/51
50
10
52/53
51.8
11
54
53.6
12
$SSHQGL[&RQ¿JXUDWLRQRI&RQQHFWLRQ3LSH
1.Standard length of connection pipe
ƔIWIWIW
2.Min. length of connection pipe is 9.84ft.
3.Max. length of connection pipe and max. high difference.
4.The additional refrigerant oil and refrigerant charging required after
prolonging connection pipe
Ɣ$IWHU WKH OHQJWK RI FRQQHFWLRQ SLSH LV SURORQJHG IRU IW DW WKH
basis of standard length, you should add 5ml of refrigerant oil for each
additional 16.4ft of connection pipe.
Ɣ7KHFDOFXODWLRQPHWKRGRIDGGLWLRQDOUHIULJHUDQWFKDUJLQJDPRXQWRQ
the basis of liquid pipe):
Max length of
connection pipe
5000 Btu/h(1465 W)
49.2 ft
7000 Btu/h(2051 W)
49.2 ft
9000 Btu/h(2637 W)
49.2 ft
12000 Btu/h(3516 W)
65.6 ft
18000 Btu/h(5274 W)
82.0 ft
24000 Btu/h(7032 W)
82.0 ft
28000 Btu/h(8204 W)
98.4 ft
36000 Btu/h(10548 W)
98.4 ft
42000 Btu/h(12306 W)
98.4 ft
48000 Btu/h(14064 W)
98.4 ft
Cooling capacity
Max height
difference
16.4 ft
16.4 ft
32.8 ft
32.8 ft
32.8 ft
32.8 ft
32.8 ft
65.6 ft
65.6 ft
65.6 ft
Ɣ :KHQ WKH OHQJWK RI FRQQHFWLRQ SLSH LV DERYH IW DGG UHIULJHUDQW DFFRUGLQJ WR WKH SURORQJHG OHQJWK RI OLTXLG SLSH7KH
additional refrigerant charging amount per meter is different according to the diameter of liquid pipe. See the following sheet.
Ɣ$GGLWLRQDOUHIULJHUDQWFKDUJLQJDPRXQW SURORQJHGOHQJWKRIOLTXLGSLSH;DGGLWLRQDOUHIULJHUDQWFKDUJLQJDPRXQWSHUPHWHU
Additional refrigerant charging amount for R22, R407C, R410A and R134a
Diameter of connection pipe
Outdoor unit throttle
Liquid pipe(inch)
Gas pipe(inch)
Cooling only(oz/ft) Cooling and heating(oz/ft)
Ɏ
ɎRUɎ
0.53
0.71
ɎRUɎ
ɎRUɎ
0.53
0.71
Ɏ
ɎRUɎ
1.06
4.23
Ɏ
ɎRUɎ
2.12
4.23
Ɏ
/
8.82
8.11
Ɏ
/
12.34
12.34
Installation and Maintenance
55
Service Manual
Appendix 3: Pipe Expanding Method
Pipe
Note:
Pipe cutter
,PSURSHU SLSH H[SDQGLQJ LV WKH PDLQ FDXVH RI UHIULJHUDQW OHDNDJH3OHDVH
expand the pipe according to the following steps:
Leaning
Uneven
Burr
A:Cut the pip
Ɣ&RQ¿UPWKHSLSHOHQJWKDFFRUGLQJWRWKHGLVWDQFHRILQGRRUXQLWDQGRXWGRRUXQLW
Ɣ&XWWKHUHTXLUHGSLSHZLWKSLSHFXWWHU
Pipe
B:Remove the burrs
Ɣ5HPRYHWKHEXUUVZLWKVKDSHUDQGSUHYHQWWKHEXUUVIURPJHWWLQJLQWRWKHSLSH
Shaper
Downwards
C:Put on suitable insulating pipe
Union pipe
D:Put on the union nut
Ɣ5HPRYHWKHXQLRQQXWRQWKHLQGRRUFRQQHFWLRQSLSHDQGRXWGRRUYDOYHLQVWDOO
Pipe
the union nut on the pipe.
E:Expand the port
Ɣ([SDQGWKHSRUWZLWKH[SDQGHU
Note:
Expander
Hard
mold
Ɣ$LVGLIIHUHQWDFFRUGLQJWRWKHGLDPHWHUSOHDVHUHIHUWRWKHVKHHWEHORZ
Outer
diameter(inch)
Ɏ
Ɏ´
Ɏ´
Ɏ´
A(inch)
Max
0.051
0.063
0.071
0.095
Pipe
Min
0.028
0.039
0.039
0.087
F:Inspection
Ɣ&KHFNWKHTXDOLW\RIH[SDQGLQJSRUW,IWKHUHLVDQ\EOHPLVKH[SDQGWKH
port again according to the steps above.
Smooth surface
Improper expanding
leaning
damaged
surface
crack
uneven
thickness
The length is equal
56
Installation and Maintenance
Service Manual
Appendix 4: List of Resistance for Temperature Sensor
Resistance Table of Ambient Temperature Sensor for Indoor and Outdoor (15K)
Temp(oC)
5HVLVWDQFHNȍ
Temp(oC)
5HVLVWDQFHNȍ
Temp(oC)
5HVLVWDQFHNȍ
-19
138.1
20
18.75
59
3.848
98
1.071
-18
128.6
-17
121.6
21
17.93
60
3.711
99
1.039
22
17.14
61
3.579
100
1.009
-16
115
23
16.39
62
3.454
101
0.98
-15
108.7
24
15.68
63
3.333
102
0.952
-14
102.9
25
15
64
3.217
103
0.925
-13
97.4
26
14.36
65
3.105
104
0.898
-12
92.22
27
13.74
66
2.998
105
0.873
-11
87.35
28
13.16
67
2.896
106
0.848
-10
82.75
29
12.6
68
2.797
107
0.825
-9
78.43
30
12.07
69
2.702
108
0.802
-8
74.35
31
11.57
70
2.611
109
0.779
-7
70.5
32
11.09
71
2.523
110
0.758
-6
66.88
33
10.63
72
2.439
111
0.737
-5
63.46
34
10.2
73
2.358
112
0.717
-4
60.23
35
9.779
74
2.28
113
0.697
-3
57.18
36
9.382
75
2.206
114
0.678
-2
54.31
37
9.003
76
2.133
115
0.66
-1
51.59
38
8.642
77
2.064
116
0.642
0
49.02
39
8.297
78
1.997
117
0.625
1
46.6
40
7.967
79
1.933
118
0.608
2
44.31
41
7.653
80
1.871
119
0.592
3
42.14
42
7.352
81
1.811
120
0.577
4
40.09
43
7.065
82
1.754
121
0.561
5
38.15
44
6.791
83
1.699
122
0.547
6
36.32
45
6.529
84
1.645
123
0.532
7
34.58
46
6.278
85
1.594
124
0.519
8
32.94
47
6.038
86
1.544
125
0.505
9
31.38
48
5.809
87
1.497
126
0.492
10
29.9
49
5.589
88
1.451
127
0.48
11
28.51
50
5.379
89
1.408
128
0.467
12
27.18
51
5.197
90
1.363
129
0.456
13
25.92
52
4.986
91
1.322
130
0.444
14
24.73
53
4.802
92
1.282
131
0.433
15
23.6
54
4.625
93
1.244
132
0.422
16
22.53
55
4.456
94
1.207
133
0.412
17
21.51
56
4.294
95
1.171
134
0.401
18
20.54
57
4.139
96
1.136
135
0.391
19
19.63
58
3.99
97
1.103
136
0.382
Installation and Maintenance
Temp(oC) 5HVLVWDQFHNȍ
57
Service Manual
Resistance Table of Tube Temperature Sensors for Indoor and Outdoor (20K)
Temp(oC) 5HVLVWDQFHNȍ
58
Temp(oC) 5HVLVWDQFHNȍ
Temp(oC)
5HVLVWDQFHNȍ
Temp(oC)
5HVLVWDQFHNȍ
-19
181.4
20
25.01
59
5.13
98
1.427
-18
171.4
21
23.9
60
4.948
99
1.386
-17
162.1
22
22.85
61
4.773
100
1.346
-16
153.3
23
21.85
62
4.605
101
1.307
-15
145
24
20.9
63
4.443
102
1.269
-14
137.2
25
20
64
4.289
103
1.233
-13
129.9
26
19.14
65
4.14
104
1.198
-12
123
27
18.13
66
3.998
105
1.164
-11
116.5
28
17.55
67
3.861
106
1.131
-10
110.3
29
16.8
68
3.729
107
1.099
-9
104.6
30
16.1
69
3.603
108
1.069
-8
99.13
31
15.43
70
3.481
109
1.039
-7
94
32
14.79
71
3.364
110
1.01
-6
89.17
33
14.18
72
3.252
111
0.983
-5
84.61
34
13.59
73
3.144
112
0.956
-4
80.31
35
13.04
74
3.04
113
0.93
-3
76.24
36
12.51
75
2.94
114
0.904
-2
72.41
37
12
76
2.844
115
0.88
-1
68.79
38
11.52
77
2.752
116
0.856
0
65.37
39
11.06
78
2.663
117
0.833
1
62.13
40
10.62
79
2.577
118
0.811
2
59.08
41
10.2
80
2.495
119
0.77
3
56.19
42
9.803
81
2.415
120
0.769
4
53.46
43
9.42
82
2.339
121
0.746
5
50.87
44
9.054
83
2.265
122
0.729
6
48.42
45
8.705
84
2.194
123
0.71
7
46.11
46
8.37
85
2.125
124
0.692
8
43.92
47
8.051
86
2.059
125
0.674
9
41.84
48
7.745
87
1.996
126
0.658
10
39.87
49
7.453
88
1.934
127
0.64
11
38.01
50
7.173
89
1.875
128
0.623
12
36.24
51
6.905
90
1.818
129
0.607
13
34.57
52
6.648
91
1.736
130
0.592
14
32.98
53
6.403
92
1.71
131
0.577
15
31.47
54
6.167
93
1.658
132
0.563
16
30.04
55
5.942
94
1.609
133
0.549
17
28.68
56
5.726
95
1.561
134
0.535
18
27.39
57
5.519
96
1.515
135
0.521
19
26.17
58
5.32
97
1.47
136
0.509
Installation and Maintenance
Service Manual
Resistance Table of Discharge Temperature Sensor for Outdoor(50K)
Temp(oC)
5HVLVWDQFHNȍ
Temp(oC)
5HVLVWDQFHNȍ
Temp(oC)
5HVLVWDQFHNȍ
-29
853.5
10
98
49
18.34
88
4.75
-28
799.8
11
93.42
50
17.65
89
4.61
-27
750
12
-26
703.8
13
89.07
51
16.99
90
4.47
84.95
52
16.36
91
4.33
-25
660.8
14
81.05
53
15.75
92
4.20
-24
-23
620.8
15
77.35
54
15.17
93
4.08
580.6
16
73.83
55
14.62
94
3.96
-22
548.9
17
70.5
56
14.09
95
3.84
-21
516.6
18
67.34
57
13.58
96
3.73
-20
486.5
19
64.33
58
13.09
97
3.62
-19
458.3
20
61.48
59
12.62
98
3.51
-18
432
21
58.77
60
12.17
99
3.41
-17
407.4
22
56.19
61
11.74
100
3.32
-16
384.5
23
53.74
62
11.32
101
3.22
-15
362.9
24
51.41
63
10.93
102
3.13
-14
342.8
25
49.19
64
10.54
103
3.04
-13
323.9
26
47.08
65
10.18
104
2.96
-12
306.2
27
45.07
66
9.83
105
2.87
-11
289.6
28
43.16
67
9.49
106
2.79
-10
274
29
41.34
68
9.17
107
2.72
-9
259.3
30
39.61
69
8.85
108
2.64
-8
245.6
31
37.96
70
8.56
109
2.57
-7
232.6
32
36.38
71
8.27
110
2.50
-6
220.5
33
34.88
72
7.99
111
2.43
-5
209
34
33.45
73
7.73
112
2.37
-4
198.3
35
32.09
74
7.47
113
2.30
-3
199.1
36
30.79
75
7.22
114
2.24
-2
178.5
37
29.54
76
7.00
115
2.18
-1
169.5
38
28.36
77
6.76
116
2.12
0
161
39
27.23
78
6.54
117
2.07
1
153
40
26.15
79
6.33
118
2.02
2
145.4
41
25.11
80
6.13
119
1.96
3
138.3
42
24.13
81
5.93
120
1.91
4
131.5
43
23.19
82
5.75
121
1.86
5
125.1
44
22.29
83
5.57
122
1.82
6
119.1
45
21.43
84
5.39
123
1.77
7
113.4
46
20.6
85
5.22
124
1.73
8
108
47
19.81
86
5.06
125
1.68
9
102.8
48
19.06
87
4.90
126
1.64
Installation and Maintenance
Temp(oC) 5HVLVWDQFHNȍ
59
JF00302123
GREE ELECTRIC APPLIANCES,INC.OF ZHUHAI
Add: West Jinji Rd, Qianshan, Zhuhai, Guangdong, China 519070
Tel: (+86-756) 8522218
Fax: (+86-756) 8669426
Email: gree@gree.com.cn
Http://www.gree.com
HONG KONG GREE ELECTRIC APPLIANCES SALES LIMITED
Add: Unit 2612,26/F.,Miramar Tower 132 Nathan Road,TST,Kowloon,HK
Tel: (852) 31658898
Fax: (852) 31651029
Download PDF
Similar pages