Radio Remote Control
M880
User’s Manual
CONTENTS
CONTENTS ............................................................................................................................................................ 2
INTRODUCTION................................................................................................................................................... 4
1.
IDENTIFICATION DATA ......................................................................................................................... 5
1.1.
DOCUMENTATION .......................................................................................................................................... 7
2.
CONVENTIONS USED IN THIS MANUAL ............................................................................................ 7
3.
CAUTION .................................................................................................................................................... 7
3.1.
3.2.
RISK ANALYSIS ................................................................................................................................................ 7
APPLICATIONS ................................................................................................................................................ 7
4.
SIGNIFICANCE OF THE SYMBOLS IN LABELS ................................................................................. 8
5.
FCC-REGULATORY INFORMATION (2,4 GHZ RADIO MODULE) ................................................... 8
6.
PREVENTIVE MAINTENANCE .............................................................................................................. 9
6.1.
6.2.
ROUTINE MAINTENANCE TO BE CARRIED OUT BY THE OPERATOR....................................................................... 9
MAINTENANCE AND INTERNAL CHECKS ............................................................................................................ 9
7.
INSTALLING THE RADIO REMOTE CONTROL ................................................................................ 10
7.1.
7.2.
7.3.
7.4.
7.5.
7.6.
7.7.
7.8.
7.9.
7.10.
7.11.
7.12.
7.13.
7.14.
7.15.
7.16.
7.17.
7.18.
7.19.
7.20.
7.21.
7.22.
7.23.
7.24.
7.25.
7.26.
RECEIVING UNIT DIMENSIONS AND DRILLING DIAGRAM .................................................................................. 11
CONNECTING THE RECEIVER ......................................................................................................................... 12
INSTALLING THE EXTERNAL ANTENNA ............................................................................................................ 13
STOP (E-STOP).......................................................................................................................................... 14
SAFETY ENABLE (S-ENABLE) ................................................................................................................. 14
BASIC FUNCTIONS BOARD PCB201 (DC) / PCB231 (AC) (SERVICE CARD) .................................................... 16
CONNECTION DIAGRAMS OF H RECEIVERS ..................................................................................................... 16
HDC (PCB200) RECEIVER WITH ANALOG OUTPUT CARDS AND DATA FEEDBACK CARD ................................... 17
HAC (PCB230) RECEIVER WITH ANALOG OUTPUT CARDS AND DATA FEEDBACK CARDS .................................. 18
POWER SUPPLY CONNECTIONS OF HDC AND HAC RECEIVERS ....................................................................... 19
ANALOG COMMAND BOARD (PCB261) .......................................................................................................... 20
LOGIC BOARD (PCB260).............................................................................................................................. 21
DATA FEEDBACK CARD (PCB262) ................................................................................................................ 22
RELAY CARDS ............................................................................................................................................... 23
BOARDS WITH SOLID STATE RELAYS (MOSFET) ............................................................................................. 25
POTENTIOMETER CARD (M880DT2) ............................................................................................................. 26
CONNECTION DIAGRAMS FOR L RECEIVERS.................................................................................................... 27
M880 LDC VERSION (PCB100) ................................................................................................................... 27
M880 LAC VERSION (PCB130) ................................................................................................................... 28
RELAY BOARD FOR M880 LAC AND M880 LDC RECEIVERS ........................................................................... 29
OTHER COMMAND BOARDS FOR M880 LDC .................................................................................................. 30
CONNECTION DIAGRAMS FOR M RECEIVERS .................................................................................................. 31
M880 MAC VERSION (PCB300) .................................................................................................................. 31
SERIAL DATA TRANSMISSION .......................................................................................................................... 32
USER SERIAL (RS232/RS485) ....................................................................................................................... 32
SERIAL CONNECTION CABLE .......................................................................................................................... 32
8.
USING THE RADIO REMOTE CONTROL ........................................................................................... 33
8.1.
8.2.
8.3.
8.4.
8.5.
8.6.
8.7.
8.8.
8.9.
SAFETY RULES .............................................................................................................................................. 33
POWERING AND STARTING THE RADIO REMOTE CONTROL ............................................................................... 33
THE STOP FUNCTION .................................................................................................................................. 33
TURNING OFF THE REMOTE CONTROL............................................................................................................ 34
AUTO POWER-OFF (TIME-OUT) ..................................................................................................................... 34
TRANSMITTER INDICATOR LEDS.................................................................................................................... 34
TRANSMITTING UNIT POWER SUPPLY.............................................................................................................. 36
BATTERY STATUS OF CHARGE ........................................................................................................................ 36
CHANGING AND CHARGING THE BATTERY ...................................................................................................... 36
9.
CHANGING THE OPERATING FREQUENCY .................................................................................... 37
9.1.
9.2.
INITIAL CONDITIONS FOR THE FREQUENCY CHANGE ....................................................................................... 37
FREQUENCY CHANGE PROCEDURE ................................................................................................................ 37
0$//(1GRF[
9.3.
9.4.
AVAILABLE FREQUENCIES (433-434 MHZ RADIO MODULE) ........................................................................... 38
AVAILABLE FREQUENCIES (2,4 GHZ RADIO MODULE) .................................................................................... 39
10.
DSC (DYNAMIC SPEED CONTROL) OPTION .................................................................................... 39
11.
TROUBLESHOOTING ............................................................................................................................ 40
11.1. MALFUNCTIONS IN THE TRANSMITTER’S STOP CIRCUIT ................................................................................. 41
11.2. PASSIVE EMERGENCY ................................................................................................................................... 41
11.3. TECHNICAL ASSISTANCE ............................................................................................................................... 41
12.
TECHNICAL SPECIFICATIONS ........................................................................................................... 42
12.1. CE RADIO MODULE (433-434 MHZ) ............................................................................................................ 42
12.2. CE, FCC, IC, ARIB RADIO MODULE (2,4 GHZ) ............................................................................................ 42
12.3. TRANSMITTER ............................................................................................................................................... 43
12.4. M880 HDC / M880 HAC RECEIVERS ........................................................................................................... 45
12.5. M880 LDC / M880 LAC RECEIVERS ............................................................................................................ 47
12.6. M880 MAC RECEIVERS ................................................................................................................................ 49
12.7. CB3600-AC, CB3600-DC BATTERY CHARGER FOR THOR2, ZEUS2, ARES2 AND KRON TRANSMITTERS ..... 50
12.8. CB36NIMH BATTERY CHARGER FOR THOR2, ZEUS2, ARES2 AND KRON TRANSMITTERS .......................... 51
12.9. CB36NIMH G4 - BATTERY CHARGER M880 G4L AND M880 G4S TRANSMITTERS.......................................... 52
12.10. CB37LION BATTERY CHARGER FOR WAVE2 TRANSMITTERS ......................................................................... 53
13.
RADIO REMOTE CONTROL SPARE PARTS LIST ............................................................................. 54
13.1.
13.2.
13.3.
13.4.
13.5.
13.6.
TRANSMITTING UNITS AND BATTERY CHARGER ............................................................................................... 54
HDC RECEIVER ........................................................................................................................................... 54
HAC RECEIVER ............................................................................................................................................ 54
LDC RECEIVER ............................................................................................................................................ 54
LAC RECEIVER ............................................................................................................................................ 54
MAC RECEIVER ........................................................................................................................................... 55
14.
DISPOSAL (EU ZONE)............................................................................................................................ 55
15.
ANNEXES ................................................................................................................................................. 55
0$//(1GRF[
INTRODUCTION
$IWHUDGHFDGHRIVXFFHVVDQGRIVDWLVIDFWLRQIRU,0(7FXVWRPHUVWKH0VHULHVSDVVHVWKHEDWRQ
WRWKHQHZ0IDPLO\,0(7GHVLJQVDQGPDQXIDFWXUHVLQGXVWULDOVDIHW\UDGLRUHPRWHFRQWUROVVLQFH
7KH 0 VHULHV IHDWXUHV DGYDQFHG UDGLR UHPRWH FRQWUROV ZLWK QHZ WHFKQLFDO IHDWXUHV WKDW IDFLOLWDWH
XVHE\JLYLQJJUHDWIOH[LELOLW\WRWKHXVHU
7KH,0(7UDQJHRIVROXWLRQVLVYDVWEXWLWFRQWLQXHV
WRHYROYHGHSHQGLQJRQWKHWHFKQRORJ\WUHQGVRIWKH
PRGHUQZRUOG,QIDFWLWLVVXUSULVLQJKRZWRGD\QHZ
DSSOLFDWLRQV LQ HYHU\ LPDJLQDEOH ILHOG RI SURGXFWLRQ
VHH WKH OLJKW $Q\ H[LVWLQJ PDFKLQHU\ RU RI QHZ
FRQFHSWLRQ FRXOG KDYH WKH QHHG RQ WKH XVHU VLGH
WRPDNHLWUDGLRUHPRWHFRQWUROODEOH
7UDQVPLWWHUV
7KHDGYDQWDJHVRIWKHXVHRIWKHUHPRWHFRQWURODUHVDIHW\ILUVWDQG
IRUHPRVWWRSUHYHQWWKHSRWHQWLDOULVNVRIMREFRPIRUWDQGQRWOHDVW
WKHH[FHOOHQWFRVWEHQHILWUDWLR
&RQVLGHUDPRQJRWKHUWKLQJVWKHEHVWSRLQWRIYLHZDQGWKHPRELOLW\
ZKLFK JLYHV WKH UDGLR FRQWURO ,0(7 KDV GHYHORSHG RYHU WKH \HDUV
UHOLDEOH UHPRWH FRQWUROV ZKLFK DOORZ WKH RSHUDWRU WR KDYH D WRWDO
FRQWURORIWKHZRUNVLWXDWLRQ)XUWKHUPRUH,0(7UDGLRUHPRWHFRQWUROV
WDNHLQWRDFFRXQWWKHHUJRQRPLFVWKHVL]HDQGWKHZHLJKWWRHQVXUH
WKDWWKHXVHUFDQZRUNLQDFRPIRUWDEOHDQGVDIHZD\
/5HFHLYHU
,0(7UDGLRUHPRWHFRQWUROVFDQEHXVHGLQYDULRXVDSSOLFDWLRQVLQWKH
ILHOGVRIPRELOHPDFKLQHVDQGWKHLQGXVWU\$SSOLFDWLRQVYDU\IURPWKH
VLPSOHVW ZLWK WKH IHZ GLJLWDO 212)) FRQWUROV WR WKH PRVW FRPSOH[
ZLWK PDQ\ PL[HG FRPPDQGV GLJLWDO DQG DQDORJ SOXV GDWDIHHGEDFN
7KH\SHUIHFWO\LQWHUIDFHWKHPVHOYHVRIFRXUVHZLWKPRGHUQLQGXVWULDO
DXWRPDWLRQ V\VWHPV DQG 3/&V ZLWK WKH &$1RSHQ DQG &$1EXV
SURWRFROVHWF
,0(7 UDGLRUHPRWH FRQWUROV KDYHDQ HDVLO\ LQWHUSUHWDEOH LGHQWLILFDWLRQ
FRGHWRDOORZWKHLULPPHGLDWHUHFRJQLWLRQ
7KH KRXVLQJV DUH PDGH RI LPSDFW UHVLVWDQW SODVWLF WR ZLWKVWDQG WKH
WRXJKHVW FRQGLWLRQV RI XVH NHHSLQJ LQWDFW LQ WLPH WKH UHOLDELOLW\ DQG
IXQFWLRQDOLW\
5HFKDUJHDEOH EDWWHULHV DUH KHUPHWLF DQG UHPRYDEOH DQG HQVXUH
FRQWLQXRXV RSHUDWLRQ IRU ORQJ VKLIWV RU HYHQ XQGHU VHYHUH ZHDWKHU
FRQGLWLRQV
+5HFHLYHU
7KH 0 VHULHV IHDWXUHV DQ DXWRPDWLF IUHTXHQF\ FKDQJH DOVR 7KLV
SURSHUW\ DOORZV WR SRVLWLRQ RQHVHOI RQ IUHH FKDQQHOV WKXV DYRLGLQJ
LQWHUIHUHQFHZLWKRWKHUGHYLFHVLQWKHYLFLQLW\7KHRSHUDWRUFDQGHFLGH
LQDQ\FDVHWRVHWWKHWUDQVPLVVLRQRQDIL[HGFKDQQHODVLWLVIRUWKH
0VHULHV
(DFKWUDQVPLWWHULVGHVLJQHGDQGPDQXIDFWXUHGLQFRPSOLDQFHZLWKWKH
GLUHFWLYHVDQGWKHVHFWRULDO(XURSHDQVWDQGDUGVDQGPHHWVWKHKLJKHVW
VDIHW\ OHYHOV VXFK DV WKH 3/H IRU WKH 6723 FLUFXLW 7KH UDGLR
WUDQVPLVVLRQ LV FRQWLQXRXV DQG HQFRGHG ZKHUH
HDFK UHFHLYHU UHFRJQL]HV
RQO\ WKRVH FRPPDQGV FRPLQJ IURP LWV PDWFKHG 05HFHLYHU
WUDQVPLWWHU WKXV DYRLGLQJ
XQZDQWHG DFWLYDWLRQV E\ RWKHU WUDQVPLWWHUV LQ WKH
DUHD
0$//(1GRF[
1. Identification data
5(&(,9(581,7,'
$
M880
%%
XXXXX
VV
&&&
X
Y
W
Z
5(&(,9(52XWSXW7<3(
7<3(
02'8/$581,7
+
,17(*5$7('81,7
/
',15$,/81,7
0
81,7
&
810$18)$&785('&$6(RU
',15$,/
1
&$%/(*/$1'6
3
5(&(66('08/7,32/$53/8*
287387
,
5(&(,9(5:,5,1*
127&$%/('
1
32:(56833/<
$/7(51$7,1*&855(17
$&
',5(&7&855(17
'&
,17(51$/:,5,1*
,
&$%/(SOXJRXWSXW
6
([WHUQDOZLULQJZLWK
3
',1
352-(&75()(5(1&(180%(5
11111
5;9$5,$17180%(5
5HFHLYLQJ$QWHQQD
,17(51$/
,
6
(;7(51$/217+(%2;
:+,3
:,5,1*&$%/,1*
(;7(51$/:,7+&$%/(
2
9$5,$17
2SHUDWLQJ)UHTXHQF\
0$//(1GRF[
:LUHG
)
0+](XURSD
(
*+]:RUOG:LGH
:
75$160,77(581,7,'
M880
7\SH
6XE
3URMHFW
'LVSOD\
7\SH
9DULDQW
7;
2SHUDWLQJ
)UHTXHQF\
7+25
=(86
.521
$5(6
:$9(
*/
*6
02',1
0
%
2SHUDWLQJIUHTXHQF\
8SWRVLQJOHD[LVMR\VWLFNV
8SWRGXDOD[LVMR\VWLFNV
:LUHG
)
0+]
(XURSD
(
*+]:RUOG
:LGH
:
;
8SWRVLQJOHDQGGXDOD[LV
MR\VWLFNV
1-
1RMR\VWLFNV
/
3XVKEXWWRQWUDQVPLWWHUZLWKRU
:$9(RQO\ EXWWRQV6WDUW6WRS
3XVKEXWWRQWUDQVPLWWHUZLWKRU
6
:$9(RQO\ EXWWRQV6WDUW6WRS
7UDQVPLWWHUZLWKVHOHFWRUV
(
$5(6RQO\ EXWWRQVDQGSRWHQWLRPHWHUV
IURPWRZLWK6723EXWWRQ
&
7UDQVPLWWHUZLWKVHOHFWRUV
$5(6RQO\ EXWWRQVDQGSRWHQWLRPHWHUV
IURPWR12B6723EXWWRQ
QQ
QQQQQ
<HV
'
1RWPRXQWHG
1
1RQH
7;9DULDQWQXPEHU
3URMHFWUHIHUHQFHQXPEHU
0$//(1GRF[
1.1. Documentation
$OO,0(7UDGLRUHPRWHFRQWUROVDUHDFFRPSDQLHGE\WKHIROORZLQJGRFXPHQWV
x
8VHU¶V0DQXDOWKHDQQH[HVDUHDQLQWHJUDOSDUWRIWKHPDQXDO
x
:DUUDQW\&HUWLILFDWH
,IDQ\GRFXPHQWLVPLVVLQJSOHDVHFRQWDFW,0(7DQGSURYLGHWKHXQLW¶VVHULDOQXPEHU
2. CONVENTIONS USED IN THIS MANUAL
Warning:
7KLVV\PEROLQGLFDWHVLQVWUXFWLRQVWREHVWULFWO\IROORZHGIRUWKHUDGLRUHPRWHFRQWUROWR
ZRUNSURSHUO\
Danger:
7KLVV\PEROLQGLFDWHVLPSRUWDQWLQIRUPDWLRQDLPLQJWRSUHYHQWGDQJHURXVVLWXDWLRQVZKHQ
XVLQJWKHUDGLRUHPRWHFRQWURO
Note: 7KLVV\PEROLQGLFDWHVXVHIXOVXJJHVWLRQVIRUWKHSURSHUXVHRIWKHUDGLRUHPRWHFRQWURO
3. CAUTION
5($' 7+( ,16758&7,216 &$5()8//< %()25( ,167$//,1* 7+( 5$',2 5(027(
&21752/ )$,/85( 72 $33/< $1< 2) 7+( 352&('85(6 '(6&5,%(' ,1 7+,6 0$18$/
0$</($'72,1-85,(6723(5621625'$0$*(6723523(57<
12 3$57 2) 7+( 5$',2 5(027( &21752/ 6+28/' %( 86(' $6 $ 63$5( 3$57 )25
27+(55$',25(027(&21752/6
)ROORZWKHORFDOODZVRQVDIHW\DQGZRUNSODFHDFFLGHQWSUHYHQWLRQ$OOWKHUHJXODWLRQVRQXVLQJUDGLR
UHPRWHFRQWUROVIRULQGXVWULDOPDFKLQHU\0867%(2%6(59('$7$//7,0(6
,0(7DVVXPHVQRUHVSRQVLELOLW\IRUWKHXQODZIXOXVHRIWKHUDGLRUHPRWHFRQWURO
3.1. Risk analysis
,W LV QHFHVVDU\ WR HYDOXDWH WKH ULVNV LQ RUGHU WR HVWDEOLVK WKH VDIHW\ DQG KHDOWK VDIHJXDUG UHTXLVLWHV
FRQFHUQLQJ WKH PDFKLQH XVLQJ WKH UDGLR UHPRWH FRQWURO $ ULVN DQDO\VLV PXVW EH FDUULHG RXW ZKHQ
GHFLGLQJ ZKHWKHU DQ DSSOLFDWLRQ FDQ EH UDGLR FRQWUROOHG RU QRW ,W VKRXOG EH FDUULHG RXW E\ TXDOLILHG
SHUVRQQHOWKHLQVWDOOHUZKRDVVXPHVDOOWKHUHOHYDQWUHVSRQVLELOLWLHV
,0(7DVVXPHVQRUHVSRQVLELOLW\IRUIDLOXUHWRFDUU\RXWDSURSHUULVNDQDO\VLV
$QHYHQWXDOORVVRIFRPPXQLFDWLRQEHWZHHQWKHWUDQVPLWWHUDQGWKHUHFHLYHUFDXVHGE\GLVWXUEDQFHV
RU HOHFWURPDJQHWLF LQWHUIHUHQFHV VKDOO DXWRPDWLFDOO\ EORFN WKH UDGLR FRPPDQG FODXVH (1
WKXVLPSO\LQJDUHVWDUWRIWKHPDFKLQH7KLVFDVXDOVKXWGRZQVKRXOGEHIRUHVHHQLQWKHULVN
DQDO\VLV
3.2. Applications
7KH PRVW FRPPRQ UDGLR UHPRWH FRQWURO DSSOLFDWLRQV UHJDUG OLIWLQJ RU FDUU\LQJ HTXLSPHQW VXFK DV
WRZHU FUDQHV EULGJH FUDQHV WUXFN FUDQHV DQG FRQFUHWH SXPSV 2WKHU DSSOLFDWLRQV DUH SRVVLEOH
SURYLGHGWKHIROORZLQJFRQGLWLRQVDUHREVHUYHG
'RQRWXVHWKHUDGLRUHPRWHFRQWUROLQHQYLURQPHQWDORUHOHFWULFDOFRQGLWLRQVRWKHUWKDQWKRVHVSHFLILHG
LQ&KDSWHU'RQRWXVHWKHUDGLRUHPRWHFRQWUROLQHQYLURQPHQWVWKDWDUHUHTXLUHGWREHH[SORVLRQ
SURRI
0$//(1GRF[
4. SIGNIFICANCE OF THE SYMBOLS IN LABELS
&ODVV,,HTXLSPHQW
7RLGHQWLI\HTXLSPHQWPHHWLQJWKHVDIHW\UHTXLUHPHQWV
VSHFLILHGIRU&ODVV,,HTXLSPHQWDFFRUGLQJWR,(&
'DQJHURXVYROWDJH
7RLQGLFDWHKD]DUGVDULVLQJIURPGDQJHURXVYROWDJHV
'LUHFWFXUUHQW
7RLQGLFDWHRQWKHUDWLQJSODWHWKDWWKHHTXLSPHQWLV
VXLWDEOHIRUGLUHFWFXUUHQWWRLGHQWLI\UHOHYDQWWHUPLQDOV
$OWHUQDWLQJFXUUHQW
7RLQGLFDWHRQWKHUDWLQJSODWHWKDWWKHHTXLSPHQWLV
VXLWDEOHIRUDOWHUQDWLQJFXUUHQWWRLGHQWLI\UHOHYDQW
WHUPLQDOV
'RQ¶WXVHKLJKSUHVVXUHZDWHU
7RLQGLFDWHQRWWRFOHDQXVLQJKLJKSUHVVXUHZDWHUMHWV
,QKRXVHXVH
7RLQGLFDWH,QGRRUXVHRQO\
5. FCC-Regulatory Information (2,4 GHz radio module)
7KLVHTXLSPHQWKDVEHHQWHVWHGDQGIRXQGWRFRPSO\ZLWKWKHOLPLWVIRUDGLJLWDOGHYLFHSXUVXDQWWR
3DUWRIWKH)&&5XOHV7KHVHOLPLWVDUHGHVLJQHGWRSURYLGHUHDVRQDEOHSURWHFWLRQDJDLQVWKDUPIXO
LQWHUIHUHQFH LQ D UHVLGHQWLDO LQVWDOODWLRQ 7KLV HTXLSPHQW JHQHUDWHV XVHV DQG FDQ UDGLDWH UDGLR
IUHTXHQF\HQHUJ\DQGLIQRWLQVWDOOHGDQGXVHGLQDFFRUGDQFHZLWKWKHLQVWUXFWLRQVPD\FDXVHKDUPIXO
LQWHUIHUHQFHWRUDGLRFRPPXQLFDWLRQV+RZHYHUWKHUHLVQRJXDUDQWHHWKDWLQWHUIHUHQFHZLOOQRWRFFXU
LQ D SDUWLFXODU LQVWDOODWLRQ ,I WKLV HTXLSPHQW GRHV FDXVH KDUPIXO LQWHUIHUHQFH WR UDGLR RU WHOHYLVLRQ
UHFHSWLRQZKLFKFDQEHGHWHUPLQHGE\WXUQLQJWKHHTXLSPHQWRIIDQGRQWKHXVHULVHQFRXUDJHGWRWU\
WRFRUUHFWWKHLQWHUIHUHQFHE\RQHRUPRUHRIWKHIROORZLQJPHDVXUHV
Ȉ5HRULHQWRUUHORFDWHWKHUHFHLYLQJDQWHQQD
Ȉ,QFUHDVHWKHVHSDUDWLRQEHWZHHQWKHHTXLSPHQWDQGUHFHLYHU
Ȉ&RQQHFWWKHHTXLSPHQWLQWRDQRXWOHWRQDFLUFXLWGLIIHUHQWIURPWKDWWRZKLFKWKHUHFHLYHULV
FRQQHFWHG
Ȉ&RQVXOWWKHGHDOHURUDQH[SHULHQFHGUDGLR79WHFKQLFLDQIRUKHOS
7KLVGHYLFHFRPSOLHVZLWK3DUWRIWKH)&&5XOHVDQGZLWK566RI,QGXVWU\&DQDGD
2SHUDWLRQLVVXEMHFWWRWKHIROORZLQJWZRFRQGLWLRQV
WKLVGHYLFHPD\QRWFDXVHKDUPIXOLQWHUIHUHQFHDQG
WKLVGHYLFHPXVWDFFHSWDQ\LQWHUIHUHQFHUHFHLYHGLQFOXGLQJLQWHUIHUHQFHWKDWPD\
FDXVHXQGHVLUHGRSHUDWLRQ
:$51,1*
&KDQJHV RUPRGLILFDWLRQV PDGH WR WKLV HTXLSPHQW QRWH[SUHVVO\ DSSURYHG E\ ,0(7 PD\ YRLG
WKH)&&DXWKRUL]DWLRQWRRSHUDWHWKLVHTXLSPHQW
5)(;32685(127,&(
7KHUDGLDWHGRXWSXWSRZHURIWKLVGHYLFHLVEHORZWKH)&&UDGLRIUHTXHQF\H[SRVXUHOLPLWV
1HYHUWKHOHVV WKH WUDQVPLWWHUV VKDOO EH XVHG LQ VXFK D PDQQHU WKDW WKH SRWHQWLDO IRU KXPDQ FRQWDFW
GXULQJQRUPDORSHUDWLRQLVPLQLPL]HG
%DVHGRQHYDOXDWLRQRIHLWKHUWKH6SHFLILF$EVRUSWLRQ5DWH6$5DFFRUGLQJWRWKHVWDQGDUG)&&.'%
'WKH,QGXVWU\&DQDGD566DQG(1(1XVLQJWKHWUDQVPLWWHUZLWKLWV
FDUU\LQJEHOWJXDUDQWHHVWKHFRPSOLDQFHZLWK5)H[SRVXUHERXQGDULHV
0$//(1GRF[
,Q RUGHU WR DYRLG WKH SRVVLELOLW\ RI H[FHHGLQJ WKH )&& UDGLR IUHTXHQF\ H[SRVXUH OLPLWV KXPDQ
SUR[LPLW\WRWKHUHFHLYHUVZLWKLQWHJUDWHGDQWHQQDRUIURPLWVH[WHUQDODQWHQQDVKDOOQRWEHOHVVWKDQ
FPLQFKHVGXULQJQRUPDORSHUDWLRQ
6. PREVENTIVE MAINTENANCE
%HIRUH SHUIRUPLQJ DQ\ PDLQWHQDQFH RSHUDWLRQ WXUQ RII WKH SRZHU WR ERWK WKH UHFHLYLQJ XQLW
DQGWKHPDFKLQHDQGUHPRYHWKHEDWWHU\IURPWKHWUDQVPLWWHU
x 'RQRWH[SRVHWRKHDWVRXUFHV
x $YRLGSURORQJHGH[SRVXUHWRGLUHFWVXQOLJKW
x 'RQRWZDVKWKHGHYLFHZLWKZDWHUXQGHUSUHVVXUHRUGLSLWLQZDWHU
x $YRLGFRQWDFWZLWKRLORUVROYHQWV
x ,I WKH GHYLFH KDV EHHQ RSHQHG IRU DQ\ UHDVRQ PDNH VXUH DOO WKH VHDOV DQG JDVNHWV DUH LQ SODFH
ZKHQFORVLQJ
x :KHQFOHDQLQJLWGRQRWXVHDOFRKRORUVROYHQWVDVWKH\PLJKWGDPDJHWKHFRPSRQHQWVDQGWKH
KRXVLQJ
6.1. Routine maintenance to be carried out by the operator
3HULRGLFDOO\ FOHDQ WKH RXWVLGH RI WKH UHFHLYLQJ DQG WUDQVPLWWLQJ XQLWV 'LUW GHSRVLWV FRXOG KLQGHU WKH
IXQFWLRQLQJRIEXWWRQVWRJJOHVZLWFKHVDQGPDQLSXODWRUV
$SSO\VSHFLDOFDUHWRWKH6723EXWWRQE\NHHSLQJLWFOHDQDQGPDNLQJVXUHLWZRUNVHIIRUWOHVV
5HPRYHDQ\WUDFHVRIUXVWIURPWKHEDWWHU\FRQWDFWV
&KHFNWKHFDVLQJDQGWKHFRPSRQHQWVIRUFUDFNVRUDSSDUHQWGDPDJHV
$OOUXEEHUSDUWVEXWWRQVVHDOVDQGJDVNHWVVKRXOGVKRZQRVLJQRIWHDULQJ
'DPDJHG FRPSRQHQWV VKRXOG EH LPPHGLDWHO\ UHSODFHG WR SUHYHQW KXPLGLW\ RU GLUW IURP SHQHWUDWLQJ
DQGMHRSDUGL]LQJWKHVDIHRSHUDWLRQRIWKHUDGLRUHPRWHFRQWURO
6.2. Maintenance and internal checks
$IWHUHYHU\\HDURIXVHZHUHFRPPHQGFDUU\LQJRXWDJHQHUDOLQVSHFWLRQRIWKHUDGLRUHPRWHFRQWURO
WREHSHUIRUPHGE\TXDOLILHGSHUVRQQHO
2SHQWKHKRXVLQJVRIWKHWUDQVPLWWLQJDQGUHFHLYLQJXQLWVDQGPDNHVXUH
x WKDWWKHJDVNHWVDUHLQJRRGVKDSH
x WKDWWKHFDEOHFODPSVDUHHIILFLHQW
x WKDWWKHFRQQHFWLRQWHUPLQDOVFUHZVDQGWKHFRQQHFWRUFRXSOLQJVDUHWLJKW
x WKDWWKHHOHFWURQLFERDUGVDUHVHFXUHO\IDVWHQHG
x WKDWWKHIDVWHQLQJVFUHZVRIDOOFRPSRQHQWVDUHWLJKW
$OWKRXJK ,3 XQLWV DUH KHUPHWLFDOO\ VHDOHG GXVW DQG KXPLGLW\ PD\ DFFXPXODWH RYHU WLPH ZKHQ
ZRUNLQJLQSDUWLFXODUFRQGLWLRQV&DUHIXOO\UHPRYHDQ\IRUHLJQPDWWHU
:KHQFORVLQJWKHWUDQVPLWWLQJXQLWDSSO\VSHFLDOFDUHWRWKHFDVLQJ¶VVHDOLQJLQRUGHUWRSUHYHQWWKH
LQILOWUDWLRQRIKXPLGLW\
3RZHURQWKHGHYLFHEHLQJFDUHIXOQRWWRWRXFKDQ\OLYHSDUWV LQWKHUHFHLYLQJXQLWDQGSHUIRUPWKH
IROORZLQJWHVWV
x &KHFNWKHIXQFWLRQLQJRIDOOWKHFRQWUROV
x 9HULI\ WKDW WKH 6723 FLUFXLW LQWHUYHQHV FRUUHFWO\ %\ SUHVVLQJ WKH 6723 EXWWRQ GXULQJ RSHUDWLRQ
WKHUHOD\FRQWDFWV$DQG%RIWKH(6723FLUFXLWPXVWRSHQ
x $Q\EURNHQSDUWVPXVWEHUHSODFHGZLWKRULJLQDOVSDUHSDUWVLQRUGHUWRNHHSWKHFKDUDFWHULVWLFVRI
WKHUDGLRUHPRWHFRQWUROXQFKDQJHG6HHWKHOLVWRISDUWVWKDWFDQEHUHSODFHGLQ&KDSWHU
0$//(1GRF[
7. INSTALLING THE RADIO REMOTE CONTROL
:HUHFRPPHQGIROORZLQJWKHLQVWUXFWLRQVEHORZLQRUGHUWRVHWXSDSURSHUO\RSHUDWLQJUDGLRUHPRWH
FRQWUROV\VWHP
7KHUDGLRUHPRWHFRQWUROVKRXOGEHLQVWDOOHGE\TXDOLILHGSHUVRQQHORQO\
,QVWDOOWKHUHFHLYLQJXQLWRULWVDQWHQQDLQFDVHRIYHUVLRQVZLWKDQH[WHUQDODQWHQQDLQWKHOLQH
RIVLJKWRIWKHWUDQVPLWWLQJXQLWZLWK
QR HOHFWURPDJQHWLF VKLHOGLQJ 7R
LPSURYH WKH RSHUDWLQJ UDQJH ZKHQ
WKH DQWHQQD LV LQWHJUDWHG GR QRW
LQVWDOO WKH XQLW RQ PHWDO VXUIDFHV LI
SRVVLEOH
ANTENNA
RF
67
6( 7
7
6(
(
5
(
7
67
5(
5 (6 (
5 (6
7
6(
23
3
2
67
67
6( 7
5(
23
23
RF
7
'R QRW E\SDVV WKH PDFKLQH¶V VDIHW\
V\VWHPV IROORZ WKH PDQXIDFWXUHU¶V
LQVWUXFWLRQV
5
(
'RQRWLQVWDOOWKHUHFHLYLQJXQLWWRRKLJK
DERYH WKH JURXQG y PHWUHV $W
WKHVHKHLJKWVWKHXQLWPD\UHFHLYHORFDO
UDGLR VLJQDOV WKDW FRXOG GLVWXUE
WUDQVFHLYLQJRSHUDWLRQV
ANTENNA
RECOMMENDED
7R SUHYHQW ZDWHU LQILOWUDWLRQV LQVWDOO WKH UHFHLYLQJ XQLW
YHUWLFDOO\ ZLWK WKH FDEOH FODPSV DQG DQ\ RWKHU FRQQHFWLRQV DW
WKHERWWRPDVVKRZQLQWKHILJXUH
1RQDWWHQXDWLQJREVWDFOH
3DUWLDOO\DWWHQXDWLQJ
REVWDFOH
6KLHOGLQJREVWDFOH
,QFDVHRIVWURQJPHFKDQLFDOYLEUDWLRQVSODFHDUXEEHUVKRFNDEVRUEHUEHWZHHQWKHPDFKLQHDQGWKH
UHFHLYHUGDPSHUV
0$//(1GRF[
7.1. Receiving unit dimensions and drilling diagram
0/$&DQG0/'&YHUVLRQV
0+$&DQG0+'&YHUVLRQV
00$&YHUVLRQ
0$//(1GRF[
7.2. Connecting the receiver
'RQRWSHUIRUPDQ\RSHUDWLRQXQWLOWKHHTXLSPHQWLVSRZHUHGRII
7KHSRZHUVXSSO\IRUWKHUDGLRUHPRWHFRQWUROVKRXOGEHORFDWHGGRZQVWUHDPIURPWKHPDFKLQH¶VPDLQ
VZLWFK
&RQQHFWLQJLWGLUHFWO\WRWKHPDLQVGLVWULEXWLRQQHWZRUNLVSURKLELWHG7KHPDLQVGLVFRQQHFWLQJ
VZLWFK PXVW EH HTXLSSHGZLWKD GHYLFH WR SUHYHQW XQDXWKRUL]HGFORVLQJSDGORFN ,WPXVW EH
HDVLO\ DFFHVVLEOH DQG EH DWWDFKHG RXWVLGH RI WKH HTXLSPHQW 7KH GLVWDQFH EHWZHHQ FRQWDFWV
PXVWEHRIDWOHDVWPP
7KH FRQQHFWLRQ EHWZHHQ WKH UHFHLYLQJ XQLW DQG WKH PDFKLQH VKRXOG DOZD\V EH 5(029$%/( ,I WKH
FRQQHFWLRQLVPDGHGLUHFWO\RQWKHWHUPLQDOERDUGLQVLGHWKHPDFKLQHDPXOWLSRODUFRQQHFWRUVKRXOG
EHXVHGVRWKDWWKHUHFHLYHUFDQEHGLVFRQQHFWHGDQGWKHRULJLQDOZLUHGFRQWUROVUHVWRUHGDWDQ\WLPH
&RQGXFWRUVDQGFDEOHVVKDOOEHVHOHFWHGVRDVWREHVXLWDEOHIRUWKHH[LVWLQJRSHUDWLQJFRQGLWLRQVIRU
H[DPSOH YROWDJH FXUUHQW SURWHFWLRQ DJDLQVW HOHFWULF VKRFN JURXSLQJ RI FDEOHV DV ZHOO DV H[WHUQDO
LQIOXHQFHVIRUH[DPSOHDPELHQWWHPSHUDWXUHSUHVHQFHRIZDWHURUFRUURVLYHVXEVWDQFHVPHFKDQLFDO
VWUHVVHVLQFOXGLQJVWUHVVHVGXULQJLQVWDOODWLRQDQGILUHKD]DUGV:KHQFDEOHVDUHLQVWDOOHGRQKRLVWLQJ
PDFKLQHVXVHGLQWKHRSHQDLURXWVLGHEXLOGLQJVRURWKHUSURWHFWLYHVWUXFWXUHVWKH\VKDOOEHVXLWDEOH
IRU RXWGRRU XVH IRU H[DPSOH 89UHVLVWDQW DGHTXDWH WHPSHUDWXUH UDQJH RU EH DSSURSULDWHO\
SURWHFWHG
7KH ZLUH FRQQHFWLRQV EHWZHHQ WKH UHFHLYLQJ XQLW DQG WKH PDFKLQH VKRXOG UHVSHFW WKH 6WDQGDUG
(1DQGPXVWEHVWUDQGHG7KHZLUHVPXVWKDYHDFURVVVHFWLRQRIDWOHDVWPPDQGOHVV
WKDQPPDQGEHVHOIH[WLQJXLVKLQJ,IWKHHTXLSPHQWLVXVHGZLWKDPELHQWWHPSHUDWXUHRIƒ&WKH
PD[LPXPFRQGXFWRURSHUDWLQJWHPSHUDWXUHPXVWEHJUHDWHUWKDQƒ&
8VHIHUUXOHVIRUFRQGXFWRUHQGVLISRVVLEOHDQGPDNHVXUHWKDWWKHWHUPLQDOVDUHIDVWHQHGWLJKWO\
&RQVXOWWKHWUDQVPLWWLQJXQLWFRQWUROGLDJUDP$QQH[7DQGWKHUHFHLYLQJXQLWZLULQJGLDJUDP$QQH[
5WRLGHQWLI\WKHHTXLYDOHQWDFWXDWRUVLQERWKXQLWV
,Q WKH +'& YHUVLRQ WKH UHFHLYHU LV DOVR LQWHQGHG WR EH HOHFWULFDOO\ SRZHUHG DW D YROWDJH RI 9$&
+] &RQQHFW LW WR DQ H[WHUQDO VRXUFH ZKHUH WKH GHGLFDWHG 9$& RXWSXW LV VHSDUDWHG IURP
GDQJHURXVYROWDJHSDUWVE\GRXEOHRUUHLQIRUFHGLQVXODWLRQ
,Q DOO UHFHLYHU YHUVLRQV WKH ORDGV FRQQHFWHG WR WKHUHOD\ ERDUGPXVW KDYH DSURWHFWLRQ DJDLQVW RYHU
FXUUHQWVDQGRYHUORDGV
,QWKH+'&YHUVLRQWKHUHFHLYHULVLQWHQGHGWREHHOHFWULFDOO\SRZHUHGLQWKHYROWDJHUDQJHWR
9GF &RQQHFW LW WR DQ H[WHUQDO VRXUFH ZKHUH WKH GHGLFDWHG 9GF RXWSXW LV SURWHFWHG DJDLQVW
RYHUYROWDJHDQGVKRUWFLUFXLW7KH9GFGHGLFDWHGRXWSXWH[WHUQDOVRXUFHPXVWEHFRQQHFWHGWR
WKHPDLQWHUPLQDOHDUWKSURWHFWLRQRUVHSDUDWHGIURPWKHSULPDU\FLUFXLWE\PHDQVRIDPHWDOVFUHHQ
FRQQHFWHGWRWKHPDLQWHUPLQDORIWKHHDUWKSURWHFWLRQ
:KHQ WKH UHFHLYHU W\SH +'& LV SURYLGHG ZLWK D PHWDOOLF FRQQHFWRU PRXQWHG RQ WKH HQFORVXUH WKH
GHYLFH VKDOO EH SODFHG LQ D VHUYLFH DFFHVV DUHD QRW DFFHVVLEOH WR WKH RSHUDWRU EXW RQO\ E\ WKH
VHUYLFHVWDII(17RXFKWHPSHUDWXUHOLPLWVRIPHWDOVDWƒ&
%HVXUHWRQRWHWKHVXSSO\YROWDJHZKHQFRQQHFWLQJWKHUHFHLYLQJXQLW
,QYHUVLRQV+$&DQG/$&WKHIXVHFXUUHQWPXVWEHDGMXVWHGWRWKHVXSSO\YROWDJH
$IWHU LQVWDOOLQJ WHVW WKH UDGLR UHPRWH FRQWURO DQG WKH PDFKLQH WR PDNH VXUH WKH\ ZRUN DV
H[SHFWHG ,Q DGGLWLRQ LWLV YHU\ LPSRUWDQW WR PDNH VXUH WKDWWKH 6723FLUFXLWZRUNV SURSHUO\
3UHVVLQJWKH6723EXWWRQGXULQJQRUPDORSHUDWLRQVKRXOGRSHQWKHFRQWDFWVRIUHOD\V$DQG%
LQWKH(6723FLUFXLW
/DVWO\ILOORXWWKHVKHHWVKRZLQJWKHFRQQHFWLRQGLDJUDPEHWZHHQWKHUHFHLYLQJXQLWDQGWKHPDFKLQH
DQGZULWHGRZQWKHGDWHRILQVWDOODWLRQLQWKHGRFXPHQW'(&/$5$7,212)&21)250,7<
0$//(1GRF[
7.3. Installing the external antenna
$ SURSHUO\ LQVWDOOHG DQWHQQD LV HVVHQWLDO IRU D JRRG RSHUDWLQJ UDQJH,QVWDOO WKH DQWHQQD RXWVLGH DW WKH
KLJKHVWDQGPRVWYLVLEOHSRLQWDQGIDUIURPPHWDOVWUXFWXUHV8VHDWXQHGDQWHQQDRQO\DQGFRQQHFWLWWR
WKHUHFHLYHUXVLQJDORZORVVFRD[LDOFDEOHLPSHGDQFH:2QO\XVHWKHDQWHQQDVVXSSOLHGE\,0(7
RWKHUW\SHVRIDQWHQQDPXVWEHDSSURYHGLQFRQIRUPLW\WRWKHVWDQGDUG(76,(1(76,(1
08/;K
0+]
0+]
0+]
0$//(1GRF[
7.4. STOP (E-STOP)
&RQQHFW WKH FRQWDFW RI WKH (6723 FLUFXLW VR WKDW LW FRPPDQGV WKH FRLO RI WKH PDFKLQH¶V PDLQ OLQH
FRQWDFWRUDQGUHPHPEHUWKDWWKHPD[LPXPDOORZDEOHFXUUHQWLV$ZLWKUHVLVWLYHORDG
$WWHQWLRQ,QRUGHUWRPDLQWDLQWKHVDIHW\FDWHJRU\3/H&DWHJRU\DFFRUGLQJWR,62
WKH6723FLUFXLWUHOD\VPXVWEHFRQQHFWHGLQVHULHVVWDQGDUG,0(7SUHZLULQJFRQILJXUDWLRQ
RUHOVHLQ$&DSSOLFDWLRQVLQGLYLGXDOO\FRQQHFWHGLQVHULHVWRWKHSKDVHOLQHDQGQHXWUDO21/<
IRU WKH PDLQV SRZHU LQWHUUXSWLRQ 6HH ([DPSOH ,Q VHULHV WR WKH 6723 UHOD\ FRQWDFWV WKHUH
PXVWDOZD\VEHD$IXVH
7.5. SAFETY ENABLE (S-ENABLE)
7KH 6DIHW\ (QDEOH LV DQ DGGLWLRQDO VDIHW\ IXQFWLRQ ,W FRQVLVWV RI D UHOD\ LQ WKH UHFHLYHU WKDW LV
PRQLWRUHG E\ WKH 5; ORJLF DQG WKDW FDQ EH DVVRFLDWHG ZLWK WKH FRPPDQGV VHQW E\ WKH WUDQVPLWWHU
ZKLFKLQFDVHRISUREOHPVDXWRPDWLFDOO\VWRSVWKHUHFHLYHUDVVKRZQE\WKH/('VVWDWXV
([DPSOH LQ VHULHV ZLWK FRQWURO FRPPDQGV 7KH 6DIHW\ (QDEOH LQWURGXFHV D UHGXQGDQF\ ZKLFK
DFWLYDWHVWKHVDIHW\IXQFWLRQLQFDVHWKHFRQWUROFRPPDQGUHOD\VIDLOWRRSHQ
([DPSOH RSHUDWLQJ WKH E\SDVV YDOYH 7KH 6DIHW\ (QDEOH FDQ FRPPDQG WKH GUDLQ YDOYH LQ D
K\GUDXOLFPDFKLQHVXFKWKDWWKHPDFKLQHLVSRZHUHGRQO\ZKHQDFRQWUROFRPPDQGLVJLYHQ
7KH6DIHW\(QDEOHPXVWQRWEHDVVRFLDWHGZLWKVWDEOHVHOHFWLRQFRPPDQGV
7KH ULVN DQDO\VLV DQG VDIHW\ FODVV DUH EDVHG RQ VWDQGDUG ,62 7DNH JRRG QRWLFH RI WKH
PD[LPXPFXUUHQWVDOORZHGRQWKHUHOD\FRQWDFWVVHH&KDS
([DPSOH:LULQJRIVDIHW\(1$%/(UHOD\IRUJHQHULFDSSOLFDWLRQV$0$;ORDG
0$//(1GRF[
([DPSOH:LULQJRI6723UHOD\VIRUVSHFLDODSSOLFDWLRQ
([DPSOH:LULQJRIWKH6DIHW\(1$%/(UHOD\IRUK\GUDXOLF'&DSSOLFDWLRQV
0$//(1GRF[
7.6. Basic functions board PCB201 (DC) / PCB231 (AC) (Service card)
7KHWDEOHEHORZVKRZVWKHEDVLFIXQFWLRQVDYDLODEOHRQWKHVHUYLFHERDUG
Relay
Function
TIMEDRELAY
The relay is activated for 5 seconds from the moment
the radio remote control is switched off or has entered
in passive emergency mode.
The T-RELAY can be activated at switch-off or with a
2-second delay.
The relay is activated only by an unstable command
from a toggle switch, button or joystick
When Connected in series the function introduces a
redundancy that can be used to increase function
safety
The two relays are activated when the radio remote
control is switched onwith the START button (STOP
RELAY with PLe cat. 4 ISO13849-1) and stay active
until a STOP command intervenes (pressing the
STOP button or passive emergency)
SAFETYENABLE
E-STOP
HORN
Horn control relay
START
START control relay
Typical Uses
x
x
x
x
Remarks
Delayed STOP of
combustion engine
Engine deceleration
Enables the drain valve
Common enabling of control
commands
Relays constantly
monitored by uP.
x
Relays constantly
Powers the main contactor
in the machine’s control box monitored by uP
x
Common power supply for
control commands
x
Machine power supply
Warns of potentially hazardous
it can be associated
situations
to the first START
Powers the machine’s control box
and enables the machine Start
function
7KH6$)(7<(1$%/(RQWKHUHOD\ERDUGFDQEHDFWLYDWHGRQO\E\WKHRQHVSUHVHQWRQWKHERDUG
LWVHOI
7.7. Connection diagrams of H receivers
7KHUHFHLYLQJXQLWYHUVLRQ+LVSURYLGHGZLWKVORWVZKHUHFRQWUROUHOD\FDUGVDQDORJRXWSXWFDUGV
DQGDGDWDIHHGEDFNFDUGFDQEHLQVHUWHG7KHEDVLFIXQFWLRQVFRQWUROVLQWKHWDEOHDERYHDUHORFDWHG
LQWKH6(59,&(ERDUG
7KHEDVLFUHFHLYHUFRQILJXUDWLRQLQFOXGHVWKHSRZHUVXSSO\ERDUGZLWKWKHUHOD\FDUGRQ6/27%WKH
ORJLFFDUGRQ6/275;DQGWKH6(59,&(FDUGRQWKH6(59,&(VORW
$FFRUGLQJWRWKHSURMHFWVSHFLILFDWLRQV\RXPD\KDYH
x 5(/$<FDUGV6$)(7<DQG
x 026)(7FDUGV6$)(7<RU
x $QDORJRXWSXWFDUG
x 'DWDIHHGEDFNFDUG3&%WREHLQVHUWHGLQVORW$
7KHFRQILJXUDWLRQ+$&GRHVQRWDOORZIRUWKHXVHRIUHOD\FDUGVGXHWRWKHSUHVHQFHRIWKH$&
WUDQVIRUPHU
0$//(1GRF[
7.8. HDC (PCB200) receiver with analog output cards and data feedback card
92XW
9LQ
9LQ
92XW
92XW
9LQ
9LQ
92XW
92XW
92XW
&
&
12
9LQ
9LQ
92XW
92XW
9LQ
92XW
9LQ
92XW
9LQ
92XW
9LQ
92XW
9LQ
9LQ
92XW
92XW
9LQ
9LQ
92XW
&
1&
12
&
1&
12
&
1&
12
&
1&
12
&
1&
12
&
1&
12
&
1&
12
&
1&
12
&
1&
12
&
1&
12
&
12
&
12
&
12
92XW
$&+
9LQ
9LQ
6$)(7<
(1$%/(
$&+
$&+
$&+
92XW
92XW
9LQ
9LQ
92XW
92XW
$&+
$&+
$&+
$&+
9LQ
9LQ
&
1&
12
&
1&
12
&
1&
12
&
1&
12
&
1&
12
&
1&
12
&
1&
12
&
1&
12
&
1&
12
&
1&
12
&
12
&
12
&
12
(UURU%
6WRS%
(UURU$
6WRS$
5)%XV\
32:(5
:RUNLQJ
&
1&
12
&
1&
12
&
1&
12
&
1&
12
&
1&
12
&
1&
12
7,0('
5(/$<
+251
67$57
6$)(7<
(1$%/(
(6723$
0$//(1GRF[
7.9. HAC (PCB230) receiver with analog output cards and data feedback cards
$&+
$&+
&
1&
12
&
1&
12
&
1&
12
&
1&
12
&
1&
12
&
1&
12
&
1&
12
&
1&
12
&
1&
12
&
1&
12
&
1&
12
&
1&
12
&
1&
12
&
1&
12
&
1&
12
&
1&
12
&
1&
12
&
1&
12
&
1&
12
&
1&
12
6$)(7<
(1$%/(
$&+
$&+
$&+
$&+
$&+
$&+
&
1&
12
&
1&
12
&
1&
12
&
1&
12
&
1&
12
&
1&
12
&
1&
12
&
1&
12
&
1&
12
&
1&
12
&
1&
12
&
1&
12
&
1&
12
&
1&
12
&
1&
12
&
1&
12
&
1&
12
&
1&
12
&
1&
12
(UURU%
6WRS%
(UURU$
6WRS$
5)%XV\
32:(5
:RUNLQJ
&
1&
12
&
1&
12
&
1&
12
&
1&
12
&
1&
12
&
1&
12
7,0('
6723
+251
67$57
6$)(7<
(1$%/(
(6723$
0$//(1GRF[
7.10. Power supply connections of HDC and HAC receivers
92XW
9LQ
9LQ
92XW
92XW
12
&
1&
12
&
12
&
12
&
12
9LQ
92XW
&
&
12
12
&
1&
12
&
12
&
12
&
12
+251
&
1&
12
&
1&
12
&
1&
12
&
1&
12
67$57
6$)(7<
(1$%/(
(6723$
12
&
1&
12
1&
12
&
1&
12
&
1&
12
12
&
1&
12
+251
&
1&
12
&
1&
12
&
1&
12
&
1&
12
67$57
6$)(7<
(1$%/(
(6723$
0$//(1GRF[
7.11. Analog command board (PCB261)
7KLVERDUGFDQFRQWUROSURSRUWLRQDORXWSXWV3:0YROWDJHDQGFXUUHQWE\LQVHUWLQJWKHDSSURSULDWH
,0(7FRPPDQGPRGXOHV
&RPPDQGPRGXOHV
0&P$P$FXUUHQWRSHUDWHGFRQWURO
0&3:0FXUUHQWRSHUDWHGFRQWURO
09YROWDJHRSHUDWHGFRQWURO
7KH IUHTXHQF\ YDOXH RI WKH 3:0 RVFLOODWRU FDQ EH VHW E\ DGMXVWLQJ WKH 5 WULPPHU DQG VKRUWLQJ
VROGHUMXPSHUV77RU7-WHVWSRLQWLVXVHGIRUIUHTXHQF\PHDVXUHPHQW
0$//(1GRF[
7.12. Logic board (PCB260)
7KHORJLFERDUGUHFHLYHVDQGGHFRGHVWKHFRPPDQGVFRPLQJIURPWKHWUDQVPLWWLQJXQLW7KHERDUGLV
SUHVHWIRUDQRSWLRQDOVHULDOFRQQHFWLRQZLWKWKHWUDQVPLWWLQJXQLWIRUGDWDUHFHSWLRQYLDFDEOH
(UURU%
*HQHUDOO\2))ZKHQIODVKLQJLWUHSRUWVX%HUURUFRGHV
6WRS%
5('ZKLOHX%LV67233('*5((1ZKLOHX%LV:25.,1*
(UURU$
*HQHUDOO\2))ZKHQIODVKLQJLWUHSRUWVX$HUURUFRGHV
6WRS$
5('ZKLOHX$LV67233('*5((1ZKLOHX$LV:25.,1*
5)%XV\
:+,7(21ZKLOHWKHUDGLR/,1.LVSUHVHQW
32:(5
*5((13RZHUVXSSO\ODPS
:RUNLQJ
%/8(21LI93:56833/<LVDFWLYH
',36:,7&+6:
6HH†6HWWDEOHRXWSXWFRQILJXUDWLRQVE\PHDQVRIGLSVZLWFKHV
0$//(1GRF[
7.13.
Data feedback card (PCB262)
7KHGDWDIHHGEDFNFDUGLVXVHGZKHQLWLVQHFHVVDU\WRFROOHFWGDWDIURPWKHDSSOLFDWLRQDQGVHQGLW
YLDUDGLRWRWKHGLVSOD\RIWKHWUDQVPLWWLQJXQLW'DWDFROOHFWLRQFDQEHGRQHE\PHDQVRIGLJLWDO
LQSXWV2372&283/('DQGDQDORJLQSXWVYROWDJHRUFXUUHQWFRQILJXUDEOH7KHFDUGIHDWXUHVDOVR
D&$1%86FRQQHFWLRQDQGDVHULDOOLQHVWDQGDUG56RU56
1RWH
x
7KHFKRLFHEHWZHHQ56RU56LVGRQHGXULQJWKHFDUG¶VPRXQWLQJSKDVH
x
7KHYROWDJHFXUUHQWDQDORJUHDGLQJLVVHOHFWHGE\WKHVROGHUMXPSHUV77DQG77
x
RKP=LQRIFXUUHQWDQDORJLQSXWWKHVRXUFHPXVWEHDEOHWRVXSSO\DWOHDVW9WRWKH
LQOHWRIWKHFDUG7KHWULPPHUV55DUHXVHGIRUDILQHDGMXVWPHQW
x
7KH',36:,7&+6:LVVHWDFFRUGLQJWRWKHFXVWRPHU¶VLQVWUXFWLRQV
7HUPLQDO
'HVFULSWLRQ
&$1+&$1/
2XWSXWVIRU&$1%86FRQQHFWLRQ
''
'LJLWDOLQSXWVRSWRFRXSOHG9=LQ!N
&20
&RPPRQUHIHUHQFHJURXQGIRUGLJLWDOLQSXWV&20UHODWHGWR'
'&20UHODWHGWR''
$',1$',1
$QDORJLQSXWVELW9,1BPD[9
9
$X[LOLDU\SRZHUVXSSO\,PD[ P$
*1'
*URXQGUHIHUHQFHIRUDQDORJVLJQDOV
9&&
3RZHUVXSSO\
&855(17*$,1$',1$',1
6HWXSWULPPHUIRU$'$'DQDORJLQSXWV
56
6HULDOFRPPXQLFDWLRQSRUW
0$//(1GRF[
7.14. Relay cards
2Q WKH + UHFHLYHU GLIIHUHQW FDUGV FDQ EH PRXQWHG RQ WKH IUHH VORWV GHSHQGLQJ RQ WKH XVHU¶V
UHTXLUHPHQWV
5(/6UHOD\'&PRGHOZLWK16$)(7<(1$%/(UHOD\3&%
UHOD\FDUG1&12FRQWDFWVZLWK16$)(7<(1$%/(UHOD\$RQERDUG
5(/UHOD\'&PRGHO3&%
UHOD\ FDUG 1& DQG 12 FRQWDFWV ,I D VDIHW\ FRPPDQG LV QHHGHG IRU WKHVH RXWSXWV XVH WKH
6(59,&(¶V6$)(7<(1$%/(UHOD\
0$//(1GRF[
5(/UHOD\'&PRGHO3&%
UHOD\FDUG
x
UHOD\V1&12FRQWDFWV
x
12UHOD\V,IDVDIHW\FRPPDQGLVQHHGHGIRUWKHVHRXWSXWVXVHWKH6(59,&(¶V6$)(7<
(1$%/(UHOD\
5(/$&UHOD\$&PRGHO3&%
UHOD\FDUG
x
UHOD\ ERDUG 1&12 FRQWDFWV 8VH WKH 6$)(7< (1$%/( UHOD\ RQ WKH VHUYLFH ERDUG LI
FRQWUROLVUHTXLUHG
0$//(1GRF[
7.15. Boards with solid state relays (MOSFET)
0266026)(7ZLWK16$)(7<(1$%/(UHOD\RQERDUG3&%
026)(7ERDUGZLWK6$)(7<(1$%/(UHOD\RQERDUG
x
026)(712RXWSXW
x
RQERDUG6$)(7<(1$%/(UHOD\12FRQWDFW
0266026)(7ERDUG3&%
x
026)(712ERDUG
1RWH,IVDIHW\FRQWUROLVQHHGHGXVHWKH6(59,&(¶V6$)(7<(1$%/(UHOD\
0$//(1GRF[
02660RVIHWERDUG3&%
x
026)(7ERDUGZLWKRXW16$)(7<(1$%/(UHOD\$RQERDUG
1RWH,IVDIHW\FRQWUROLVQHHGHGXVHWKH6(59,&(¶V6$)(7<(1$%/(UHOD\
7.16.
Potentiometer card (M880DT2)
8VHG IRU FRQWUROOLQJ WRZHU FUDQHV 7KH SRWHQWLRPHWHU FDUG OHWV \RX VHW WKH RSHUDWLQJ VSHHGV
LQGHSHQGHQWO\
Regolazione
I velocita'
,,
,,,
9 ,9
Regolazione
II velocita'
,
Regolazione Regolazione
IV velocita' III velocita'
B A Com
0$//(1GRF[
7.17. Connection diagrams for L receivers
7KH/UHFHLYLQJXQLWVDUHHTXLSSHGZLWKDVORWWKDWFDQEHXVHGIRU
x FDUGZLWKUHOD\RXWSXWVIRU$&RU'&YHUVLRQVRUDOWHUQDWLYHO\
x FDUGZLWK026)(7RXWSXWVFDUGZLWKDQDORJRXWSXWVIRU'&YHUVLRQVRQO\
7KHVDIHW\HQDEOHUHOD\DQGWKHEDVLFIXQFWLRQVDUHORFDWHGGLUHFWO\RQWKHPRWKHUERDUGDVVKRZQ
LQWKHWDEOHLQ&KDS
7.18.
2SWLRQVRQ
GHPDQG
6(5,$/
&211(&7,21
&$%/( M880 LDC Version (PCB100)
6<0%2/
'(6&5,37,21
9'&,1
3RZHUVXSSO\LQSXW
*1'
)
)
6$)(7<(1$%/(
(6723$
(6723%
)))
67$57
+251
7,0('±5(/$<
&$1+
&$1/
''
$,1$,1
-
*URXQGFRQQHFWLRQ
3RZHU6XSSO\IXVH7$/9
3URWHFWLRQIXVH9'&7$/9
6DIHW\(QDEOHUHOD\
(6723$UHOD\
(6723%UHOD\
3URWHFWLRQIXVHV(6723DQG6$)(7<B(1$%/(7$/9
2XWSXWUHOD\12
2XWSXWUHOD\121&+251FRPPDQG
121&UHOD\
&$1+/LQH
&$1//LQH
'LJLWDO,QSXWV9
$QDORJ,QSXWV9'&
56'$7$
-
-
-*1'
56'$7$±
$X[LOLDU\SRZHUVXSSO\9'&,PD[ P$
*URXQGFRQQHFWLRQ
0$//(1GRF[
7.19.
2SWLRQVRQ
UHTXHVW
6(5,$/
&211(&7,21
&$%/(
M880 LAC Version (PCB130)
6,0%2/
'(6&5,37,21
9$&
3RZHUVXSSO\LQSXW
*1'
)
)
6$)(7<(1$%/(
(6723$
(6723%
)))
67$57
+251
7,0('5(/$<
&$1+
&$1/
''
$,1$,1
-
*URXQGFRQQHFWLRQ
3RZHU6XSSO\IXVH7$/9
3URWHFWLRQIXVH9'&7$/9
6DIHW\(QDEOHUHOD\
(6723$UHOD\
(6723%UHOD\
3URWHFWLRQIXVHV(6723DQG6$)(7<B(1$%/(7$/9
2XWSXWUHOD\12
2XWSXWUHOD\121&+251FRPPDQG
121&UHOD\
&$1+/LQH
&$1//LQH
'LJLWDO,QSXWV9
$QDORJ,QSXWV9'&
56'$7$
-
-
-*1'
56'$7$±
$X[LOLDU\SRZHUVXSSO\9'&,PD[ P$
*URXQGFRQQHFWLRQ
0$//(1GRF[
7.20.
Relay board for M880 LAC and M880 LDC receivers
1UHOD\VERDUGIRU/$&UHFHLYHU3&%
7KH UHOD\V & DQG & FDQ EH FRQILJXUHG DV
+251DQGEOLQNHUE\FORVLQJWKHMXPSHUV
1UHOD\VERDUGIR/'&UHFHLYHU3&%
0$//(1GRF[
1UHOD\VERDUGIRU/'&UHFHLYHU
$
$
%
$
%
$
%
$
%
$
%
$
%
$
7.21.
Other command boards for M880 LDC
1212))026)(7Q$1$/2*2873&%
1212))026)(73&%
1$1$/2*2873&%
+]
1+02725'5,9(53&%
+]
+]
6(7)5(4
)5(47HVW3RLQW
0RGXOLGLFRPDQGR
0&
0&3:0
096(5,(6
$1$/2*&$5'
$1$/2*&$5'
$1$/2*&$5'
*$,15(*
*$,15(*
9RXW0$;5(*
9RXW0,15(*
0&FRPDQGRLQFRUUHQWHP$P$
0&FRPDQGRLQFRUUHQWH3:0
09FRPDQGRLQWHQVLRQH
0$//(1GRF[
7.22. Connection diagrams for M receivers
7KH0UHFHLYLQJDUH',1UDLOPRXQWDEOHXQLWVHTXLSSHGZLWK
x UHOD\RXWSXWVIRU$&RU'&YHUVLRQV
x DQDORJLQSXWVDQDORJRXWSXWVGLJLWDOLQSXWV&$1EXV5656OLQH
x VDIHW\UHOD\V
7.23. M880 MAC Version (PCB300)
2SWLRQV
RQ
GHPDQG
6<0%2/
'(6&5,37,21
99'&9$&
3RZHUVXSSO\LQSXW
*1'
)
6(1$%/(
(6723$
(6723%
))
67$57+251
''
$,1$,1
$'$'
*URXQGFRQQHFWLRQ
3RZHU6XSSO\IXVH7$/9
6DIHW\(QDEOHUHOD\SURWHFWHGZLWK)IXVH
(6723$UHOD\SURWHFWHGZLWK)IXVH
(6723%UHOD\
3URWHFWLRQIXVHV(6723DQG6$)(7<B(1$%/(7$/9
6HUYLFHUHOD\V12&/$;621VHWWDEOHRQ&
'LJLWDO,QSXWV9
$QDORJGLJLWDO,QSXWV9
$QDORJ2XWSXW9WRWR9P$
9FF9GF9FF
5HOD\FRQWDFWV121&12
6HUYLFH5HOD\
9ROWDJHUHIHUHQFH
56'$7$56'$7$RU56/,1(
&$1EXVOLQHV
'DWDZLUHLQWHUIDFHEHWZHHQWUDQVPLWWHUDQGUHFHLYHU
$X[LOLDU\SRZHUVXSSO\9'&,PD[ P$IRUWKHWUDQVPLWWHU
$$%%&&
/$03
95()9
6(5,$/
5656
&211(&7 &$1+&$1/
,21
),/2B&20B;
&$%/(
$/,0B),/2&20
0$//(1GRF[
7.24. Serial data transmission
7KHUDGLRUHPRWHFRQWUROLVSUHVHWIRURSWLRQDOVHULDOGDWDWUDQVPLVVLRQDQGDFTXLVLWLRQ7KHFRQQHFWLRQ
EHWZHHQWKHUDGLRUHPRWHFRQWURODQGWKHXVHU¶VHTXLSPHQWLVGRQHZLWKDPORQJVHULDOFDEOHIRU
VWDQGDUG56DQGD%DXG5DWHRIVSV)RUOHQJWKVRYHUPPRYHRQWRVWDQGDUG56
7.25. User serial (RS232/RS485)
7KLV FRQQHFWLRQ LV XVHG LQ FXVWRPL]HG DSSOLFDWLRQV WR UHFHLYH GDWD IURP DQ H[WHUQDO GHYLFH DQG WR
VHQGGDWDWRWKHWUDQVPLWWHU¶VGLVSOD\
7KHIROORZLQJPHVVDJHVFDQEHVHQW
x 0HVVDJHVVWRUHGLQWKHDSSOLFDWLRQ¶VPHPRU\
7KH PHVVDJHV PXVW EH VHQW WR WKH 56 FRQQHFWLRQ LQ GDWD SDFNHWV IROORZLQJ WKH VHULDO SURWRFRO
VKRZQEHORZ7KHDSSOLFDWLRQPXVWVHQGWRWKHGDWDIHHGEDFNFDUGWKHVLQJOHFKDUDFWHUVWKDWPDNHXS
WKHPHVVDJHWREHVKRZQRQWKHGLVSOD\RIWKHWUDQVPLWWLQJXQLW
[
326
FK
FK1
[G
;25
2UGLQH GL LQYLR
%<7(
[
326
&K«&K1
[G
'HVFULSWLRQ
$YDULDEOHLQGLFDWLQJWKHVWDUWRIWKHPHVVDJH
3RVLWLRQRIWKHPHVVDJH¶VVWDUWLQJSRLQWRQWKHGLVSOD\
*HQHULFLWKFKDUDFWHUVHQWWRWKHGLVSOD\WH[WRIPHVVDJH
$YDULDEOHLQGLFDWLQJWKHHQGRIWKHPHVVDJH7KHYDULDEOHLVDKH[DGHFLPDOYDOXH
GLIIHUHQWIURPDQ\$6&,,FKDUDFWHUWKDWFDQEHVKRZQRQWKHGLVSOD\
;25RIDOOWKHSUHFHGLQJE\WHVVWDUWLQJIURP[SDULW\FKHFN
;25
x 0HVVDJHVVWRUHGLQWKHGDWDIHHGEDFNFDUG¶VPHPRU\
,QWKLVFDVHWKHDSSOLFDWLRQVHQGVDQ1FRGHWRWKHGDWDIHHGEDFNFDUGUHJDUGLQJWKHPHVVDJH1WR
EHVHQWDQGVKRZQRQWKHGLVSOD\RIWKHWUDQVPLWWLQJXQLW
[
326
1
[G
;25
2UGLQH GL LQYLR
%<7(
[
326
1
[G
;25
7.26.
'HVFULSWLRQ
$YDULDEOHLQGLFDWLQJWKHVWDUWRIWKHPHVVDJH
3RVLWLRQRIWKHPHVVDJH¶VVWDUWLQJSRLQWRQWKHGLVSOD\
1XPEHURIWKHPHVVDJHVWRUHGLQWKHFDUGGDWDIHHGEDFNFDUG
$ YDULDEOH LQGLFDWLQJ WKH HQG RI WKH PHVVDJH 7KH YDULDEOH LV D KH[DGHFLPDO YDOXH
GLIIHUHQWIURPDQ\$6&,,FKDUDFWHUWKDWFDQEHVKRZQRQWKHGLVSOD\
;25RIDOOWKHSUHFHGLQJE\WHVVWDUWLQJIURP[SDULW\FKHFN
Serial connection cable
0D[
P
0$//(1GRF[
7KLV RSWLRQ LV XVHG WR H[FKDQJH FRPPDQGV DQG GDWD YLD FDEOH EHWZHHQ WKH WUDQVPLWWHU DQG WKH
UHFHLYHU 7KH VHULDO FRQQHFWLRQ FDEOH H[FOXGHV WKH UDGLR IUHTXHQF\ WUDQVPLVVLRQ DQG WKH UHFHLYHU
SURYLGHVWKHSRZHUIRUWKHWUDQVPLWWHU7RUHVWRUHUDGLRRSHUDWLRQGLVFRQQHFWWKHFDEOHIURPRQHRIWKH
WZRVLGHVDQGWXUQRQWKHUDGLRUHPRWHFRQWUROE\SXVKLQJWKH67$57EXWWRQ
8. USING THE RADIO REMOTE CONTROL
8VHRIWKHUDGLRUHPRWHFRQWUROIROORZLQJWKHVDIHW\SUHFDXWLRQVEHORZWRHQVXUHVDIHW\DWZRUN
8.1. Safety rules
7KHUDGLRUHPRWHFRQWUROVKRXOGEHXVHGRQO\E\FRPSHWHQWSHUVRQQHOZLWKDWKRURXJKXQGHUVWDQGLQJ
RI WKH UHPRWH FRQWURO DQG RI WKH FRQWUROOHG PDFKLQH $OO WKH SHUVRQV XVLQJ WKH UDGLR UHPRWH FRQWURO
VKRXOGEHDGHTXDWHO\LQVWUXFWHG
'R QRW WXUQRQ WKH WUDQVPLWWLQJ XQLW LI WKH FRQWUROOHG PDFKLQH LV QRW FRPSOHWHO\ YLVLEOH ,I WKH
WUDQVPLWWLQJXQLWLVXVHGLQDFORVHGDUHDRUIDUIURPWKHUHFHLYLQJXQLWWKHRSHUDWRUPD\QRWEHIXOO\
DZDUHRIDOOWKHFRQWUROOHGPDFKLQHPRYHPHQWV7KLVFDQOHDGWRKD]DUGRXVVLWXDWLRQV
:KHQHYHUZRUNLVVXVSHQGHGHYHQIRUVKRUWSHULRGVWXUQRII
WKH FRQWURO XQLW DQG UHPRYH WKH EDWWHU\ SDFN IURP WKH
WUDQVPLWWHU WR SUHYHQW XQDXWKRUL]HG XVH 7KH ,0(7 EDWWHU\
KDVWKHVDPHIXQFWLRQDVWKHDFFHVVNH\,IQHFHVVDU\WKH
LQVWDOOHUKDVDOVRWKHRSWLRQRIHQDEOLQJWKHDFFHVVFRGH
8.2. Powering and starting the radio remote control
,QLWLDOFRQGLWLRQV
x 7UDQVPLWWLQJXQLWRII
x /RDG D FKDUJHG EDWWHU\ LQ WKH WUDQVPLWWHU H[FHSW IRU 0
',1XQLWV
x 0DNH VXUH WKH PXVKURRPKHDG 6723 EXWWRQ LV QRW
SUHVVHG DQG WKDW QR FRPPDQG LV LQ WKH ZRUNLQJ
SRVLWLRQ
x 3RZHURQWKHPDFKLQHDQGWKHUHFHLYLQJXQLW
x :DLW VHFRQGV IRU WKH UHFHLYHU WR FDUU\ RXW WKH VDIHW\
FKHFN ,I WKH FKHFN LV VXFFHVVIXO WKH UHG ³3DVVLYH
(PHUJHQF\ 6WRS $ DQG %´ /('V DQG WKH JUHHQ 3RZHU
6XSSO\/('ZLOOVWD\RQ
x
7XUQRQ WKH WUDQVPLWWHU ZLWK 67$57 DQG ZDLW IRU
WKHOLQNEHWZHHQWKHWUDQVPLWWHUDQGWKHUHFHLYHUWR
VHW *5((1 DQG %/8( /('V EOLQNLQJ RQ WKH 7;
ZKLOHWKH:+,7(5)%XV\/('LVOLWRQWKH5;
:KHQHYHUWKHDFFHVVFRGHRSWLRQLVHQDEOHGWKHJUHHQ/('DFWLYDWHVFRQWLQXRXVO\
SURFHGHDVIROORZV
0RYH WKH MR\VWLFN RU WKH VHOHFWRU &)[ IRU DV PDQ\ WLPHV DV WKH ILUVW GLJLW RI WKH
DFFHVVFRGH
&RQILUPWKHGLJLWE\SUHVVLQJ67$57
5HSHDWWKHVHTXHQFHIRUWKHUHVWRIWKHFRGHGLJLWV
x 3UHVVWKH6WDUWEXWWRQIRURQHVHFRQG7KH*5((1OLJKW7;DQGWKH%/8(OLJKW5;WXUQ
RQDQGUHPDLQVWHDG\PHDQLQJWKHXQLWLVZRUNLQJSURSHUO\2QWKHUHFHLYHUWKH5('6723
$ DQG 6723 % /('V ZLOO WXUQ WR *5((1 DQG WKH ³:RUNLQJ´ %/8( /(' ZLOO WXUQ RQ 7KH
UDGLRUHPRWHFRQWUROLVQRZUHDG\WRH[HFXWHWKHGHVLUHGFRPPDQGV
8.3. The STOP function
3UHVVWKHUHGPXVKURRPEXWWRQ7KLVZLOORSHQWKH6723FLUFXLWRQWKHUHFHLYLQJ
XQLWDQGGLVDEOHDOOWKHFRPPDQGV7RUHVWRUHRSHUDWLRQVUHVHWWKH6723EXWWRQ
,62DQGSUHVV67$57
0$//(1GRF[
8.4. Turning off the remote control
7KHUHDUHWKUHHZD\VWRWXUQWKHUHPRWHFRQWURORII
x
x
x
3UHVVWKHUHGPXVKURRPEXWWRQDIWHUVHFRQGVWKHUHPRWHFRQWUROZLOOWXUQRII
:KHQSUHVHQWWXUQWKHNH\ORFNVZLWFKFRXQWHUFORFNZLVH
5HPRYHWKHEDWWHU\
7KHWUDQVPLWWHUZLOOWXUQRIIWKHVDIHW\FLUFXLWVZLOORSHQDQGDOODFWLYHFRPPDQGVZLOOEHGLVDEOHG
7KHWUDQVPLWWLQJXQLWDOVRWXUQVRIIZKHQWKHEDWWHU\UXQVGRZQFRPSOHWHO\
8.5. $XWRSRZHURII7LPHRXW
2QUHTXHVWWKHDXWRSRZHURIIWLPHFDQEHVHWWRDPD[LPXPRIPLQXWHVLQRQHPLQXWHVWHSV
7KH0',1PRXQWHGWUDQVPLWWLQJXQLWWXUQVRIIDXWRPDWLFDOO\DIWHUKRXUVRIFRQWLQXRXVGXW\LQ
RUGHU WR DXWRPDWLFDOO\ ORRN IRU PDOIXQFWLRQV LQ WKH VDIHW\ V\VWHPV LQ DFFRUGDQFH ZLWK 6WDQGDUG ,62
8SRQH[SOLFLWUHTXHVWIURPFXVWRPHUVDQGXQGHUWKHLURZQUHVSRQVLELOLW\WKHDXWRSRZHURIIIXQFWLRQ
RQ',1XQLWVFDQEHH[FOXGHG,QWKLVFDVHWKH6723FLUFXLWLVGRZQJUDGHGWRFDWHJRU\RU3/G
8.6. Transmitter indicator LEDs
7KH WUDQVPLWWHU LV LVVXHG ZLWK /('V WKDW SURYLGH WKH IROORZLQJ
LQIRUPDWLRQ
x
2SHUDWLQJVWDWXV
x
2SHUDWLQJPDOIXQFWLRQV
x
7\SHRIPDOIXQFWLRQ
x
%DWWHU\H[KDXVWHG
,QGLFDWLRQ
Transmitting Unit
TX LED Status ( GREEN )
Off
Transmitter off or damaged (see § 8)
On
Radio link established between receiver and transmitter
Blinking
Radio link established. Not running:(Stop)
Multi-functional indicator
Led Status (YELLOW)
Battery out of charge
Two close blinks followed by 20s pause
Joystick setup
21FRQWLQXRXVO\
o
7HVWSKDVH
o
6HWWLQJRI0LQLPXP
6LQJOHEOLQNIROORZHGE\DSDXVH
o
6HWWLQJRI0D[LPXP
'RXEOHEOLQNIROORZHGE\DSDXVH
o
6HWWLQJRIWKH,QYHUVH
%OLQNVFRQWLQXRXVO\
Morse code
(UURULQGLFDWLRQRQWUDQVPLWWHU
RX Led Status (BLUE)
Off
Receiver is off or defective
Blinking
Radio link established
On
Receiver is operating
0$//(1GRF[
7KHUHFHLYHULVHTXLSSHGZKLWK/('VWKDWVLJQDO
x
2SHUDWLRQVWDWXV
x
0DOIXQFWLRQV
x
'LDJQRVWLFIXQFWLRQVDQGW\SHRIIDXOWV
x
3RZHUVXSSOLHVVWDWXV
x
/LQNVWDWXV
Receiving Unit
LED
Indication
Error B
(Red/Green LED)
1RUPDOO\2))GXULQJUXQQLQJPRGH
Stop B
(Red/Green LED)
Green while running.
Error A
(Red/Green LED)
Stop A
(Red/Green LED)
RF Busy
(White LED)
Power Supply
(Green LED)
Working
(Blue LED)
5HG*UHHQHUURUVHTXHQFHZKLOH&KDQQHO%LVLQIDXOWVWDWXV
Red: system B channel is in STOP status.
1RUPDOO\2))GXULQJUXQQLQJPRGH
5HG*UHHQHUURUVHTXHQFHZKLOH&KDQQHO$LVLQIDXOW6WDWXV
Green while running. Red: system’s channel A is in STOP status.
ON if the link between remote control and receiver is established. Its intensity is
proportional to the received signal’s intensity. If cable connected, the RF Busy LED
blinks at a fixed rate.
On if POWER is ON .
ON if radio link between receiver and remote control is established and the necessary
power supply is present for the correct functioning.
'XULQJ WKH VHWXS RI WKH MR\VWLFNV (UURU $ DQG (UURU % /('V KDYH WKH LGHQWLFDO VHTXHQFH DV WKH
WUDQVPLWWHUXQLW¶V\HOORZ/('
Joystick setup:
Led ErrorA e ErrorB (COLOUR)
ON steady (GREEN)
x
7HVWSKDVH
x
6HWWLQJRIWKH0LQLPXP
Single blink followed by a long pause (RED)
x
6HWWLQJRIWKH0D[LPXP
Double blink followed by a short pause (RED)
x
6HWWLQJRIWKH,QYHUVLRQ
Continuous blink (RED)
TX error indication (RED)
MORSE CODE
0$//(1GRF[
8.7. Transmitting unit power supply
5DGLR UHPRWH FRQWUROV ZLWK SRUWDEOH WUDQVPLWWHUV DUH VXSSOLHG ZLWK WZR UHFKDUJHDEOH 1L0K EDWWHULHV
DQGDGHGLFDWHGEDWWHU\FKDUJHU
8.8. Battery status of charge
7KH EDWWHU\¶V VWDWXV RI FKDUJH LV VKRZQ E\ WKH <(//2: /('
RQWKHWUDQVPLWWLQJXQLW
$<(//2:/('2))PHDQVWKHEDWWHU\LVFKDUJHG
$ IODVKLQJ <(//2: /(' PHDQV WKH EDWWHU\ LV ORZ 7XUQ RII WKH WUDQVPLWWLQJ XQLW DQG FKDQJH WKH
EDWWHU\7KH/('EHJLQVWRIODVKZKHQWKHEDWWHU\KDVSRZHUOHIWIRUDSSUR[LPDWHO\WRPLQXWHV
1RWH7KH\HOORZ/('IODVKHVZLWKWKHVSHFLILFVHTXHQFHVGXULQJVSHFLDOVHWXSSURFHGXUHVDQGLQWKH
FDVHRIV\VWHPIDLOXUH
$ORZEDWWHU\FKDUJHFDQDOVREHLQGLFDWHGE\DQLQWHUPLWWHQWDFRXVWLFZDUQLQJE\FRQQHFWLQJDKRUQWR
WKH FRUUHVSRQGLQJ UHOD\ RXWSXW RQ WKH UHFHLYHU ZKLFK LQ WKLV FDVH FORVHV IRU VHFRQG HYHU\ VHFRQGV
8.9. Changing and charging the battery
6KXWRIIWKHWUDQVPLWWHUXQLWUHPRYHEDWWHU\IURPLWVKRXVLQJDQGLQVHUWLWLQWRWKHEDWWHU\FKDUJHU
,QRUGHUWRJXDUDQWHHEHWWHUEDWWHU\GXUDWLRQDQGHIILFLHQF\LWLVEHVWWRXVHWKHFKDUJHXQWLOLWGUDLQV
FRPSOHWHO\
7KHEDWWHU\FKDUJHUPXVWEHSRZHUHGE\DFRQYHQWLRQDOYROWDJHOLQHZLWKRXWVLJQLILFDQWIOXFWXDWLRQVLQ
RUGHUWRQRWDIIHFWWKHVPDUWFKDUJLQJSURFHVVPDQDJHGE\WKHPLFURFRQWUROOHU
7KHEDWWHU\FKDUJHUV&%1,0+&%$&H&%'& IRU1L0+FHOOV DUHHTXLSSHGZLWKDJUHHQ
/(' WKDW LQGLFDWHV WKDW SRZHU LV SUHVHQW DQG D \HOORZ /(' WKDW IODVKHV WLPHV ZKHQ WKH EDWWHU\ LV
LQVHUWHGSUHFKDUJHDQGUHPDLQVRQXQWLOFKDUJLQJLVFRPSOHWH
7KHEDWWHU\FKDUJHULVFDSDEOHRIGHWHFWLQJUHVLGXDOFKDUJHDQGEDWWHU\FDSDFLW\7KHDYHUDJHFKDUJH
WLPHIRUDEDWWHU\WKDWKDVEHHQSURSHUO\GLVFKDUJHGLVKRXUVGHSHQGLQJRQWKHUHVLGXDOFKDUJH
DQGFHOOFDSDFLW\7KHFKDUJHF\FOHHQGVZKHQWKH\HOORZ/('VKXWVRII
,WLVSRVVLEOHWKDWZKLOHFKDUJLQJDEDWWHU\WKDWZDVFRPSOHWHO\HPSW\WKHIODVKLQJ\HOORZ/('SKDVH
SUHFKDUJHODVWVVHYHUDOPLQXWHV
,I WKH IODVKLQJ SHUVLVWV FOHDQ WKH JROGHQ EDWWHU\ FRQWDFWV XVLQJ D VRIW FORWK ,I WKLV SUREOHP
FRQWLQXHVUHSODFHWKHEDWWHU\ZLWKDQHZRQH
,WLVEHVWQRWWRLQWHUUXSWWKHFKDUJLQJE\UHPRYLQJWKHEDWWHU\IURPWKHKRXVLQJRUE\VKXWWLQJRIIWKH
EDWWHU\FKDUJHUZKLOHWKH\HOORZVLJQDO/('LVVWLOORQ
,QRUGHUWRH[WHQGEDWWHU\OLIHF\FOHVLISRVVLEOHDYRLGFKDUJLQJEDWWHULHVWKDWDUHDOUHDG\FRPSOHWHO\
RUSDUWLDOO\FKDUJHG
7KHEDWWHU\FKDUJHULVGHVLJQHGIRULQGRRUXVHGRQRWH[SRVHLWWRWKHHOHPHQWV7RSUHVHUYHEDWWHU\
OLIH UHFKDUJH WKH EDWWHU\ LQ D GU\ SODFH DQG DW D WHPSHUDWXUH EHWZHHQ ƒ& DQG ƒ& YDOXHV
UHFRPPHQGHGE\1L0+FHOOVPDQXIDFWXUHUV
7KHEDWWHU\FKDUJHUV&%/,21IRU/LSRDQG/LLRQFHOOV DUHHTXLSSHGZLWKDJUHHQ/('WKDWLQGLFDWHV
WKDWSRZHUSUHVHQWDQGDEOXH/('WKDWDIWHULQVHUWHGWKHEDWWHU\LIWKHYROWDJHUHVLGXDOLVEHORZRI
9UHPDLQRQXQWLOFKDUJLQJLVFRPSOHWH
7KHEDWWHU\FKDUJHULVFDSDEOHRIGHWHFWLQJUHVLGXDOFKDUJHDQGEDWWHU\FDSDFLW\7KHDYHUDJHFKDUJH
WLPH IRU D EDWWHU\ WKDW KDV EHHQ SURSHUO\ GLVFKDUJHG LV DERXW KRXUV GHSHQGLQJ RQ WKH UHVLGXDO
FKDUJHDQGFHOOFDSDFLW\7KHFKDUJHF\FOHHQGVZKHQWKHEOXH/('VKXWVRII
7KHEDWWHU\FKDUJHULVGHVLJQHGIRULQGRRUXVHGRQRWH[SRVHLWWRWKHHOHPHQWV7RSUHVHUYHEDWWHU\
OLIH UHFKDUJH WKH EDWWHU\ LQ D GU\ SODFH DQG DW D WHPSHUDWXUH EHWZHHQ ƒ& DQG ƒ& YDOXHV
UHFRPPHQGHGE\/LSRDQG/LLRQFHOOVPDQXIDFWXUHUV
:DUQLQJ([SORVLRQKD]DUGLIQRQFRPSDWLEOHEDWWHULHVDUHXVHG8VH,0(7EDWWHULHVRQO\6HH
&KDSIRULQIRUPDWLRQRQWKHGLVSRVDORIH[KDXVWHGEDWWHULHV
0$//(1GRF[
9. CHANGING THE OPERATING FREQUENCY
,I DQ\ VSHFLILF VHWWLQJ KDV QRW EHHQ PDGH WKH UDGLR VHOHFWV D IUHTXHQF\ FKDQQHO DVVLJQHG E\ $)$
PRGH $XWRPDWLF )UHTXHQF\ $JLOLW\ 7KLV PRGH DOORZV WKH UDGLR FKDQQHO FKDQJH DV D UHVXOW RI
GLVWXUEDQFHV GHWHFWHG GXH WR RWKHU UDGLR GHYLFHV RSHUDWLQJ RQ WKH VDPH IUHTXHQF\ 7KHUH PD\ EH
FDVHVLQZKLFKLWLVSUHIHUDEOHWRGLVDEOHWKH$)$PRGHE\RSHUDWLQJRQDIL[HGFKDQQHOVHOHFWHGE\
WKHRSHUDWRUGRLQJWKHSURFHGXUHGHVFULEHGEHORZ,Q$)$PRGHWKHUHFHLYHUFRQWLQXRXVO\PRQLWRUV
WKHIUHTXHQF\EDQGLQZKLFKLWRSHUDWHVDQGLIWKHWUDQVPLVVLRQFKDQQHOEHFRPHVWRRGLVWXUEHGWKH
V\VWHPGHFLGHVWR³PRYH´WRWKHEHVWDYDLODEOHFKDQQHO
7RYHULI\WKHSUHVHQFHRIGLVWXUEDQFHVVLPSO\WXUQRIIWKHWUDQVPLWWHUDQGFKHFNWKH³5)/LQN´/('RQ
WKHUHFHLYHULILWVWD\VRQLWPHDQVWKDWRWKHUGHYLFHVDUHXVLQJWKHVDPHIUHTXHQF\,IGLVWXUEDQFHV
RFFXUGXULQJRSHUDWLRQWKHUHFHLYHU/('V³(UURUB$´DQG(UURUB%´ZLOOWXUQRIIWRHDFKUHFHSWLRQHUURU
GHWHFWHG
5HFHSWLRQHUURUVODVWLQJPRUHWKDQSDVVLYHHPHUJHQF\SUHVHW
IURPWRVHFRQGVZLOOSXWWKHUHFHLYHURQSDVVLYHHPHUJHQF\
VHH§ 9.1. Initial conditions for the frequency change
0DNHVXUHWKHWUDQVPLWWHUEDWWHU\LVFKDUJHGPDNHVXUHWKH
UHFHLYHULVSRZHUHGDQGEULQJWKHWUDQVPLWWHUDVFORVHDVSRVVLEOH
WRWKHUHFHLYHU
9.2. Frequency change procedure
x
7XUQRQWKHUDGLRUHPRWHFRQWUROWKXVHVWDEOLVKLQJWKH
UDGLROLQNWKHJUHHQDQGEOXH/('VRQWKH7;VLGHDUH
EOLQNLQJDQGWKH5)OLQN/('RQWKH5;VLGHLV213UHVV
WKHWZRIUHTXHQF\FKDQJHFRQWUROV&)DWWKHVDPHWLPH
VHH$QQH[7IRULGHQWLILFDWLRQDQGSUHVVDQGUHOHDVHWKH
67$57EXWWRQ 7KH\HOORZ/('RQWKHWUDQVPLWWHUZLOO
IODVKDWVSHULRGVDQGD%8==(5WRQHZLOOVRXQG
x
5HOHDVHWKHWZRFRQWUROV&)WKHV\VWHPWXUQVWR$)$
PRGHDXWRPDWLFDOO\
6HOHFW ³DXWRPDWLF´ 0RGH 3UHVV WKH 67$57 EXWWRQ RU WR
DERUW WKH RSHUDWLRQ GLVFRQQHFW WKH EDWWHU\ SDFN RU LI SUHVHQW
URWDWHWKHNH\VHOHFWRU
6HOHFW ³PDQXDO´ PRGH 7R VHW RQH RI WKH SRVVLEOH
FKDQQHOV XVH &)[ FRPPDQG IRU WKH WHQV DQG &)[
3
3
3
3
FRPPDQG IRU WKH XQLWV 3UHVV WKH 67$57 EXWWRQ WR PHPRUL]H
WKH VHW FKDQQHO 7R DERUW WKH RSHUDWLRQ GLVFRQQHFW WKH EDWWHU\
SDFN RU LI SUHVHQW URWDWH WKH NH\ VHOHFWRU FRXQWHU FORFNZLVH
0HPRUL]LQJDFKDQQHOH[FHHGLQJRUFKDQQHOLI5)SRZHULV
OLPLWHG WR P: RU LI WKH UDGLR PRGXOH LV *+] PDNHV WKH
V\VWHPUHVWDUWLQDXWRPDWLFPRGH
$W WKH HQG RI HLWKHU SURFHGXUH ZDLW IRU DERXW VHFRQGV WKH
WUDQVPLWWHU DQG WKH UHFHLYHU VWRUH WKH GDWD RI WKH QHZ PRGH 2Q
WKH UHFHLYHU VLGH \RX ZLOO VHH WKH (5525B$ DQG (5525B%
\HOORZ /('V IODVK EULHIO\ WKLV PHDQV WKH IUHTXHQF\ FKDQJH
SURFHGXUHLVEHLQJH[HFXWHG
3UHVV67$57 WREHJLQWKHVHTXHQFHRIFRPPDQGV,ILWGRHVQRW
RFFXULWPHDQVWKHSURFHGXUHZDVQRWFRUUHFWO\H[HFXWHG7XUQRII
DOOGHYLFHVDQGUHSHDWWKHHQWLUHSURFHGXUHIURPWKHEHJLQQLQJ
127(
:LWKWKH0+]UDGLRPRGXOHZKHQSRZHULVVHWWRP:WKHIUHTXHQF\EDQGDQGWKH
FKDQQHOV SDVV DXWRPDWLFDOO\ IURP WR EDQG ·0+] WR FKDQQHOV EDQG
·0+]
7KHSRZHUOHYHOFKRLFHRUP:LVPDGHE\TXDOLILHGWHFKQLFLDQVGXULQJWKHUDGLRUHPRWHFRQWURO
LQVWDOODWLRQ
0$//(1GRF[
9.3. Available frequencies (433-434 MHz radio module)
CHANNEL
Available FrequenciesFKDQQHOVDWP:FKDQQHOVDWP:
(5&5(&
FREQUENCY
CHANNEL
FREQUENCY
CHANNEL
FREQUENCY
0+]
0+]
0+]
0+]
0+]
0+]
0+]
0+]
0+]
0+]
0+]
0+]
0+]
0+]
0+]
0+]
0+]
0+]
0+]
0+]
0+]
0+]
0+]
0+]
0+]
0+]
0+]
0+]
0+]
0+]
0+]
0+]
0+]
0+]
0+]
0+]
0+]
0+]
0+]
0+]
0+]
0+]
0+]
0+]
0+]
0+]
0+]
0+]
0+]
0+]
0+]
0+]
0+]
0+]
0+]
0+]
0+]
0+]
0+]
0+]
0+]
0+]
0+]
0+]
0+]
0+]
0+]
0+]
0+]
,0(7 UDGLR UHPRWH FRQWUROV FRPSO\ ZLWK WKH VSHFLILFDWLRQV RI (5& 5HFRPPHQGDWLRQ $QQH[
%DQG))7KHQDWLRQDODXWKRULWLHVIRUWHOHFRPPXQLFDWLRQVPD\LPSRVHIXUWKHUUHVWULFWLRQVRUUHTXLUH
XVHSHUPLWVLQWKHVLQJOHFRXQWULHV$OOPHPEHUVWDWHVDOORZWKHLUIUHHXVH
:HUHFRPPHQGWKDW\RXEHFRPHDFTXDLQWHGZLWKWKHORFDOODZVEHIRUHXVLQJWKHUDGLRUHPRWHFRQWURO
0RUHLQIRUPDWLRQFDQEHIRXQGRQWKHIROORZLQJZHEVLWHKWWSZZZHURGRFGEGN
0$//(1GRF[
9.4. Available frequencies (2,4 GHz radio module)
Available FrequenciesFKDQQHOV'666
(5&5(&
IMET CHANNEL
ERC 70-03 CHANNEL
FREQUENCY
0+]
0+]
0+]
0+]
0+]
0+]
0+]
0+]
0+]
0+]
0+]
0+]
0+]
0+]
0+]
0+]
,0(7UDGLRUHPRWHFRQWUROVFRPSO\ZLWKWKHVSHFLILFDWLRQVUDFFRPDQGD]LRQH(5&5(&$QQH[
%DQG , $QQH[ 6XEEDQG D 7KH QDWLRQDO DXWKRULWLHV IRU WHOHFRPPXQLFDWLRQV PD\ LPSRVH IXUWKHU
UHVWULFWLRQVRUUHTXLUHXVHSHUPLWVLQWKHVLQJOHFRXQWULHV$OOPHPEHUVWDWHVDOORZWKHLUIUHHXVH
:HUHFRPPHQGWKDW\RXEHFRPHDFTXDLQWHGZLWKWKHORFDOODZVEHIRUHXVLQJWKHUDGLRUHPRWHFRQWURO
0RUHLQIRUPDWLRQFDQEHIRXQGRQWKHIROORZLQJZHEVLWHKWWSZZZHURGRFGEGN
10.
DSC (Dynamic Speed Control) Option
:KHQ WKH WUDQVPLWWLQJ XQLW KDV WKH WZR WRJJOH VZLWFKHV
UHSUHVHQWHGLQWKHLPDJHKHUHRQWKHULJKWWKH'6&IXQFWLRQFDQ
EHXVHG
8QGHU QRUPDO RSHUDWLQJ FRQGLWLRQV ZKHUH WKH VQDLO UHGXFHG
VSHHG IXQFWLRQ LV DFWLYH LW PD\ EH QHFHVVDU\ WR WHPSRUDULO\
FRUUHFW DQDORJ RXWSXW FDOLEUDWLRQ YDOXHV ZLWKRXW KDYLQJ WR HQWHU
WKHSURJUDPPLQJSKDVH
)RUWKLVUHDVRQXVLQJDVHFRQGXQVWDEOHSRVLWLRQWRJJOHVZLWFK
WRJJOH VZLWFK LW LV SRVVLEOH WR FKDQJH UHGXFHG VSHHG OHYHOV
IRU HDFK MR\VWLFN LQ UHDO WLPH LQ RUGHU WR DGDSW WKH DSSOLFDWLRQ
V UHVSRQVH WR WKH ORDG DQG SUHFLVLRQ
QHHGVUHTXLUHGDWWKHPRPHQW
:LWK WKH '6& UHGXFHG VSHHG OLPLWV PD\ YDU\ ZLWKLQ WKH PLQLPXP DQG PD[LPXP OLPLWV VHW LQ WKH
KDUHPRGH
'6&LQFUHDVHVWKHUHGXFHGVSHHGOLPLWDVORQJDVWKHMR\VWLFNLVDWWKHHQGRILWVVWURNH
'6&GHFUHDVHVWKHUHGXFHGVSHHGOLPLW,QWKLVFDVHMR\VWLFNSRVLWLRQLVQRQLQIOXHQWLDO
&RUUHFWLRQV FDUULHG RXW ZLWK WKH '6& UHPDLQ YDOLG XQWLO WKH UHFHLYHU LV WXUQHG RII 7XUQLQJ RQO\ WKH
WUDQVPLWWLQJXQLWRIIDQGRQZLOOQRWHUDVHWKHFRUUHFWLRQVFDUULHGRXWZLWKWKH'6&7KHQH[WWLPHLWLV
WXUQHGRQWKHV\VWHPORDGVIURPLWVPHPRU\WKHQRUPDOOLPLWVWKDWKDGEHHQSUHYLRXVO\SURJUDPPHG
7KH VXFFHVVLRQ RI 6723 DQG 5811,1* SKDVHV LVVXHG E\ WKH WUDQVPLWWHU ZLOO QRW FRPSURPLVH WKH
FRUUHFWLRQVPDGHZLWK'6&
0$//(1GRF[
'XULQJWKHSURJUDPPLQJRUWHVWSKDVHWKH'6&IXQFWLRQLVQRWDFWLYH
7KH'6&IXQFWLRQLVH[FOXGHGE\WKHDFWLYDWLRQRIWKH6QDLO6PRGH
11.
TROUBLESHOOTING
7KLVFKDSWHUFRQWDLQVDGYLFHRQKDQGOLQJUDGLRUHPRWHFRQWUROPDOIXQFWLRQV
)LUVWRIDOOPDNHVXUHWKDWWKHSUREOHPDFWXDOO\GHSHQGVRQWKHUHPRWHFRQWURO7RGRVRRSHUDWHWKH
PDFKLQHXVLQJWKHZLUHGUHPRWHFRQWUROLQVWHDGRIWKHUDGLRUHPRWHFRQWURO7KHWHVWLVYDOLGSURYLGHG
WKDWWKHVDPHFRQWUROVDUHWHVWHGDQGWKDWWKHUDGLRUHPRWHFRQWURODQGWKHZLUHGUHPRWHFRQWUROXVH
WKHVDPHFRQQHFWRU
$Q\ WDPSHULQJ RI WKH UDGLR UHPRWH FRQWURO RU LWV FRPSRQHQWV ZLOO DXWRPDWLFDOO\ YRLG WKH
PDQXIDFWXUHU¶VZDUUDQW\
$OO UHSDLUV VKRXOG EH SHUIRUPHG E\ TXDOLILHG DXWKRUL]HG SHUVRQQHO DQG IROORZ WKH PDQXIDFWXUHU¶V
LQVWUXFWLRQV
8VHRULJLQDOVSDUHSDUWVZKHQPDNLQJUHSODFHPHQWVLQRUGHUWR SUHVHUYHWKHRULJLQDOIHDWXUHVRIWKH
UDGLRUHPRWHFRQWUROVHHWKHOLVWRIUHSODFHDEOHSDUWVLQ&KDS
3UREOHP
/LPLWHGRSHUDWLQJUDQJH
&HUWDLQIXQFWLRQVSHUIRUPLPSURSHUO\
3UREOHP
7UDQVPLWWLQJXQLWGRHVQRWWXUQRQ
5DGLR5HPRWH&RQWURO
3RVVLEOH5HPHGLHV
x &KHFNWKHDQWHQQDDQGPRYHLWWRDQHZORFDWLRQ
LIQHFHVVDU\VHH&KDS
x &KHFNWKH'DWD(UURU(&$DQG(&B%/('VDQG
LIWKHV\VWHPLVQRWLQ$)$PRGHFKDQJHWKH
IUHTXHQF\VHH&KDS
x 6HH$QQH[HV7DQG5
7UDQVPLWWLQJ8QLW
3RVVLEOH5HPHGLHV
x
&KHFNEDWWHU\FKDUJH
x
0DNHVXUHQRFRPPDQGVDUHLQWKHZRUNLQJ
SRVLWLRQZKHQ\RXSUHVV67$57
x 0DNHVXUHWKH6723EXWWRQLVQRWSUHVVHG
$WVWDUWXSWKH/('OLJKWVXSRQO\ZKLOH\RXSUHVVWKH x &KHFNWKHFRQWDFWVLQWKH6723EXWWRQ
6WDUWEXWWRQ
5HFHLYLQJ8QLW
3UREOHP
3RVVLEOH5HPHGLHV
5HFHLYHUGRHVQRWWXUQRQ
x &KHFNWKHSURWHFWLRQIXVHV
x &KHFNWKHSRZHUFDEOHV
5HFHLYHU WXUQV RQ EXW GRHV QRW DFWLYDWH WKH x 2QWKHUHFHLYHUFKHFNWKHIXVHLQVHULHVZLWKWKH
DSSOLFDWLRQDQGWKHJUHHQ/('VDUHRQ
6723UHOD\DQGWKHFRQWUROUHOD\
x &KHFN WKH ZLULQJ EHWZHHQ WKH UHFHLYHU DQG WKH
DSSOLFDWLRQ
5HFHLYHU WXUQV RQ EXW GRHV QRW DFWLYDWH WKH x &KHFNWKHUDGLRUHPRWHFRQWURO¶VRSHUDWLQJUDQJH
DSSOLFDWLRQDQGWKHUHG/('VDUHRQ
x 0DNH VXUH WKH GHYLFH LV QRW LQ SDVVLYH
HPHUJHQF\LIVRFKDQJHWKHIUHTXHQF\
&HUWDLQFRPPDQGVDUHQRWH[HFXWHG
x &KHFN WKH ZLULQJ EHWZHHQ WKH UHFHLYHU DQG WKH
DSSOLFDWLRQ
%DWWHU\&KDUJHU XQLW
3UREOHP
3RVVLEOH5HPHGLHV
7KHJUHHQ/('GRHVQRWWXUQRQ
x &KHFNWKHSRZHUFDEOH
x &KHFNWKHEDWWHU\IXVH
&KDUJLQJODVWVRQO\DIHZPLQXWHV
x %DWWHU\LVDOUHDG\FKDUJHG
x &OHDQWKHFRQWDFWVZLWKDKXPLGFORWK
%DWWHU\ FKDUJHU UHPDLQV LQ SUHFKDUJLQJ SKDVH x %DWWHU\KDVFRPSOHWHGLWVOLIHF\FOH
LQGHILQLWHO\
x &OHDQWKHFRQWDFWVZLWKDKXPLGFORWK
0$//(1GRF[
11.1. Malfunctions in the transmitter’s STOP circuit
2QFH\RX¶YHSUHVVHG67$57 LQFDVHDPDOIXQFWLRQLQWKH6723FLUFXLWLVGHWHFWHGWKHWUDQVPLWWLQJ
XQLWVWRSVJLYLQJWKHPXVKURRPSXVKEXWWRQHUURUFRGH3OHDVHWHVWWKHUDGLRUHPRWHFRQWUROWRYHULI\
WKHIXQFWLRQLQJRIWKH6723FLUFXLW
,IDIWHUKDYLQJUHVWRUHGWKH6723EXWWRQDQGSUHVVHG67$57DJDLQWKH/('IODVKHVDQGGLVSOD\VWKH
HUURUPHVVDJH³6723FLUFXLWIDXOW´SOHDVHFRQWDFWDQDXWKRUL]HGVHUYLFHFHQWHU
11.2. Passive Emergency
3DVVLYH HPHUJHQF\ LV D VDIHW\ VWDWXV WKDW WKH V\VWHP DVVXPHV DXWRPDWLFDOO\ ZKHQ LW DXWRQRPRXVO\
GHWHFWV D PDOIXQFWLRQ FODXVH (1 7KH PRVW FRPPRQ FDXVH LV WKH ORVV RI 5)
FRQQHFWLRQEHWZHHQWKHUHFHLYHUDQGWKHWUDQVPLWWHUIRUDWLPHSUHYLRXVO\VHWIURPWRVHFRQGV
GHSHQGLQJRQWKHDQDO\VLVULVNVGXHWR
x
6WURQJ GLVWXUEDQFHV RQ WKH WUDQVPLVVLRQ FKDQQHO RU D VLJQLILFDQW DWWHQXDWLRQ RI WKH 5) VLJQDO
FDXVHGE\DQREVWDFOH
x
([FHVVLYHGLVWDQFHEHWZHHQWUDQVPLWWHUDQGUHFHLYHURXWRIUDQJH
7KHUHFHLYHUHQWHUVWKHSDVVLYHHPHUJHQF\PRGHRQLWVRZQRSHQVWKH(6723FLUFXLWDQGGLVDEOHV
DOOWKHFRPPDQGV,Q$)$PRGHWKHUDGLRUHPRWHFRQWUROVHDUFKHVDIUHH5)FKDQQHOZLWKZKLFKWR
HVWDEOLVKDYDOLGOLQNZLWKLQWKHSUHGHWHUPLQHGWLPHRXWIURPWRVHFRQGV
11.3. Technical Assistance
,Q FDVH RI PDOIXQFWLRQV LQ WKH UDGLR UHPRWH FRQWURO WKDW DUH QRW DGGUHVVHG LQ WKLV PDQXDO FRQWDFW
H[FOXVLYHO\D6HUYLFH&HQWHUDXWKRUL]HGE\WKHPDQXIDFWXUHU
&DOOWKHFORVHVWFHQWHURUWKHGHDOHUZKHUHWKHGHYLFHZDVSXUFKDVHGDQGSURYLGHFOHDUO\WKHIROORZLQJ
LQIRUPDWLRQ
x 7KHUDGLRUHPRWHFRQWUROPRGHO
x 6HULDOQXPEHU
x 'HIHFWHQFRXQWHUHG
x 'DWHRISXUFKDVH
x 'HVFULSWLRQ DQG KLVWRU\ RI WKH SUREOHP VWDWXV RI WKH
UHFHLYHUDQGWUDQVPLWWHU/('VGXULQJPDOIXQFWLRQ
.HHSWKLVPDQXDODQGWKHZDUUDQW\FHUWLILFDWHILOOHGRXWLQHYHU\SDUWLQDVDIHSODFH
0$//(1GRF[
12.
TECHNICAL SPECIFICATIONS
12.1. CE Radio module (433-434 MHz)
Manufacturer
Operating frequency
Modulation
Receiver sensitivity
F. offset block or desensitization +/- ( 50-1000 KHz)
F. offset block or desensitization +/- (2 MHz)
F. offset block or desensitization +/- (10 MHz)
Channeling
Emission designation
Number of programmable channels
RF emission power
Range
Channel selection
IMET S.r.l.
I.S.M. Band 433.075 Ǧ434.775 MHz (1)
GMSK Dev. 3 KHz
0.22 uV 12 dB Sinad
-40 dBm
-25 dBm (Limit >= -69 dBm clause 9.4
ETSI EN 300-220-1)
-10 dBm (Limit >= -44 dBm clause 9.4
ETSI EN 300-220-1)
25 KHz (Half Duplex)
25K0F1D ( 25.0kHz FSK RADIOTELEG.&
DATA TRANSMISSION)
30 / 69
<10 mW / < 1mW
~100 m (@10mW)
1) Automatic Mode AFA
(Automatic Frequency Agility)
2) Fixed channel Set by operator
Channeling
Transmission mode
Baud Rate on channel
Hamming distance
Error control
Error non-detection probability
Available pairing addresses
Operating temperature range of L type receivers
Operating temperature range of H type receivers
Operating temperature range of transmitters
Storage temperature range
Marking
25K0F1D ( 25.0kHz FSK RADIOTELEG.&
DATA TRANSMISSION)
Half duplex (telegrams)
6150 Baud
•8
32 bit CRC
<1.832 x 10-11 (T.B.V.)
131072
-25°C to +60 °C (-13°F to +140°F )
-25°C to +70 °C (-13°F to +158°F )
-25°C to +55 °C (-13°F to +131°F )
-40°C to +85°C (-40°F to +185 °F)
CE
NOTE(1)
ISM Band stands for Industrial, Scientific and Medical Band
12.2. CE, FCC, IC, ARIB radio module (2,4 GHz)
Frequency band Operating frequency
Modulation
MAC protocol
Emission designation
Number of programmable channels
RF emission power
Range
Channel selection
Channeling
Modality of data transmission
Distanza di Hamming
Hamming distance
Error control
Error non-detection probability
Available pairing addresses
Operating temperature range of L type receivers
I.S.M. Band 2400-2483.5 MHz
2405- 2480 MHz
O-QPSK
IEEE 802.15.4
2M21F1D
16 (DSSS)
<100 mW
~100 m (@100 mW
By the operator
5 MHz
Half duplex (telegrammi)
•8
•8
32 bit CRC
<1.832 x 10-11 (T.B.V.)
131072
-25°C to +60 °C (-13°F to +140°F )
0$//(1GRF[
Operating temperature range of H type receivers
Operating temperature range of transmitters
Storage temperature range
Marking
-25°C to +70 °C (-13°F to +158°F )
-25°C to +55 °C (-13°F to +131°F )
-40°C to +85°C (-40°F to +185 °F)
CE, FCC, IC, ARIB
NOTE(1)
ISM Band stands for Industrial, Scientific and Medical Band
12.3. Transmitter
Radio module specs.see § 11.1
Standard commands
Security KEY
CE Radio module
START,HORN,STOP(1)
Commands sequence that allow the
startup of remote control unit (could be
disabled)
Integrated
Radio/Computer(2)
Antenna
Configuration and diagnostic interface
Safety categories ISO13849-1
a) STOP circuit PLe Cat. 4
,62DUFKLWHFWXUHwith
a 5A fuse protection
b) JOYSTICK commands
up to PLd Cat. 3
,62DUFKLWHFWXUH
c) Toggle sw. and push btn commands
up to PLc Cat. 2
,62DUFKLWHFWXUH
d) Toggle sw. and push btn commands
up to PLc Cat. 1
,62DUFKLWHFWXUH
Status indicator and error LEDs
Green: power on
Yellow: diagnostic
Blue: LINK Status
56
Max (3)
16
Max (4)
56
Max (5)
16 (19) Max (5)
16 (6) (ISO 13849-1:2006 6.2.6
architecture)
Commands / Outputs
Numbers of panel indicators
Number of ON/OFF commands
Number of analog commands
Max Number of UMFS commands up to PL d, Cat. 3
Display
Graphic backlight LCD
a) 102x64 pixels monochromatic
b) 128x64 pixels monochromatic
c) 160x64 pixels monochromatic
d) QVGA 3,5” color TFT (optional)
Beeper
Backlit panel
Serial Lines
internal Buzzer
optional
RS232 o RS485
CAN
Wired control cable
Lean-angle control
OPTIONS
0$//(1GRF[
Dead man function
Safety-ring
IR
Proxy
THOR2, ZEUS2, KRON, ARES2, G4L, G4S
Power supply
DEVRUSWLRQ
Battery
Battery autonomy
Low Battery notification time
Operating temperature range
Storage temperature range
3,6 VDC
<160 mA
Ni-MH 3,6V
~22 ore (@ 20°C)
15 minutes
-25°C to +55 °C (-13°F to +131°F )
-40°C to +85°C (-40°F to +185 °F)
Transmitters housing material
Transmitters housing material G4L
Casing protection degree
UL94 HB
GFK
IP65
Dimensions without LCD display
Dimensions with LCD display
Weight (battery included)
Dimensions without LCD display
Dimensions with LCD display
Weight (battery included)
Dimensions without LCD display
Weight (battery included)
Dimensions
Weight (battery included)ARES2 E /C
M880 THOR2 295x180x160 mm L.W.H.)
M880 THOR2 295x250x165 mm L.W.H.)
M880 THOR2 aJPD[
M880 ZEUS2 205x150x150 mm (L.W.H.)
M880 ZEUS2 205x205x150 mm (L.W.H.)
M880 ZEUS2 aJPD[
M880 KRON 180x107x160 mm (L.W.H.)
M880 KRON aJPD[
M880 ARES2 [[PP PP(L.W.H.)
M880 ARES2 E/C aJPD[
M880 G4L [[PP(L.W.H.)
M880 G4L aJ
M880 G4S 265x185x165 mm (L.W.H.)
M880 G4S aJ
Dimensions
Weight (battery included)
Dimensions
Weight (battery included)
WAVE2
Power supply
DEVRUSWLRQ
Battery
Battery autonomy
Low Battery notification time
Operating temperature range
Storage temperature range
Transmitters housing material
Casing protection degree
Dimensions WAVE2 S6/S8
Weight (battery included)
3,7 VDC
80 mA (300 mA with back light on)
Li-Ion 3,7V
~25 ore (@ 20°C)
15 minutes
-25°C to +55 °C (-13°F to +131°F )
-40°C to +85°C (-40°F to +185 °F)
UL94 HB
IP65
[[mm :'+
M880 WAVE2 S6/S8 aJPD[
[[PP:'+
M880 WAVE2 S6/S8 aJPD[
Dimensions WAVE2 L10/L12
Weight (battery included)
Note:
(1 )
Emergency stop mushroom-head pushbutton with turn to reset
(2 )
The installer using IMET equipment:
Can make a copy of data stored in the remote radio control
0$//(1GRF[
Can examine the radio control history for errors/faults sequence, operating hours and other
functions described in the equipment manual
Can do the setup of analog commands from a PC (minimum, maximum, speed ramps) and of
function commands (interlocks, latching commands, etc.)
(3 )
Our system is highly flexible in that it allows multiple input configurations, which can satisfy customer
requirements: in case of need, an analog input can convert to a digital one and, a digital input can be used as a
digital output (e.g. a LED).
(4)
Every LED counts as a digital input. It is possible to increase that number using a special board.
(5 )
Safety categories ISO13849-1 :
Some configuration examples:
55 ON/OFF commands, 0 analog commands, 0 LED
48 (@ PLc Cat. 1), 7 (@ PLb Cat. b)
(16 JOYSTICK, 16 Digital x JOYSTICK), 7 auxiliary
16 (@PLd,Cat. 3), 7 auxiliary (@ PLb Cat b)
16 analog inputs, 16 digital inputs, 7 auxiliary:
16AN+16DIG (@PLc Cat1), 7 auxiliary (@PLb Cat b)
(6 )
UMFS= Unintended Movement From Standstill
12.4. M880 HDC / M880 HAC receivers
Radio module specs: see §12.1 and §12.2
Antenna
Receiver turn-on time delay
START time delay
Command response time
Active Emergency intervention time
Passive Emergency intervention time
Internal/External
<2,5 s
< 120ms
<120 ms
<120 ms
500ms ” t ” 2000 ms (1)
Passive BACKPLANE system with on board POWER_SUPPLY. Besides the control logic board and
the service card, up to 7 modular boards can be inserted customized configuration.
For each receiver:
1 LOGIC Board
1 SERVICE Board
1 USER Board (16 optoisolated digital inputs, 8 analog inputs, 1 CAN,
1 RS232 or RS485)
1 Reduced Board (max 6 RELAYS)
5 slots for General Purpose boards (DAC, RELS, REL10, REL13)
If a greater number of inputs/outputs is needed, a second (SLAVE) unit can be used. The Slave,
deprived of logic and service cards, offers extra room for additional I/O cards. The only
drawback/limitation is that, the SAFETY function is implemented by the MASTER system’s SAFETY
ENABLE relay (not existing a feedback signal).
Number of SAFETY ENABLE RELAYS (N.O.)
STOP RELAYs (N.C. & N.O)
TIMED STOP RELAY
HORN Outputs
Feedback:
Serial (Display data on LCD)
Digital (ON/OFF commands)
Configuration interface (2)
Radio link to computer
Diagnostics(2)
8 (ISO 13849-1:2006 6.2.6 architecture)
(1 relay on SERVICE board plus 7 relays
on cards)
2 (ISO 13849-1:2006 6.2.7 architecture )
1
1
>100 Bytes /s
128 Max
x
x
Analog Input (3)
0$//(1GRF[
On board Status LED or Display
Laptop or desktop controlled by
proprietary IMET equipment
12-bit :
Voltage (0..10VDC),
Current (4/20mA, 0/20mA)
0/24 VDC optoisolated
Digital
Outputs:(4)
ON/OFF 128 max:
x Relay (AC e DC);
x MOSFET (DC)
ANALOG 32 max:
x Proportional (PWM)
x Analog (current)
x Analog (voltage)
Serial communication interfaces:
RS232 or RS485 (115200 Baud max)
CAN_Bus (ID 11-29 bit)
CANOpen (ID 11-29 bit)
Other types on request
Power supply (AC type)
45-240Vac, max 1.1A@45Vac, 45VA
Power supply (AC/DC type )
11-30Vdc, max 4A@12Vdc, 44W /
24 Vac (50-60 Hz), max 2,8A , 68VA
Operating temperature range
Storage temperature range
Housing material
Casing protection degree
Dimensions
Weight (standard configuration)
Mounting brackets minimum load (6)
-25°C to +70°C (-13°F to +158 °F)
-40°C to +85°C (-40°F to +185 °F)
UL94 V0 5VA, UL 746C (f1)
IP66
205x130x280 mm (L.W.H.)
# 3,5 Kg
t120N
NOTE (1): In referring to EN 60204-32 clause 9.2.7.3, in base to the analyzing risks the installer or the manufacturer of the
machine can be set, or ask to be set by specific IMET interface, passive emergency time from 500 to 2000ms.
NOTE (2): Both, the receiver and the diagnosis configurations can be made with an IMET-dedicated interface by radio link. This
technique is useful in all those cases when the receiver is not easily accessible, or when you do not want to open the case to
access the data port.
NOTA (3): Inputs are managed by the user card SUH. The technical data can be found on the SUH’s data sheet.
NOTE (4): Electrical features of COMMANDS. The number shown is the one managed by the logic board; the real number could
be limited by physical constraints (i.e. on the mother board it is not possible to mount 4 DAC board for 32 analog outputs)
NOTE (5): For versions that do not contemplate the presence of the DAC board, it is possible to have a supply voltage having an
extended range
NOTE (6): See section 4.2.10 of the Directive IEC 60950-1 2007-02 Wall or Ceiling Mounted Equipment.
2XWSXWW\SH
6(59,&(UHOD\
ERDUG
3&%3&%
5(/$&ERDUG
3&%
5(/'&ERDUG
3&%
5(/6'&ERDUG
3&%
5(/'&ERDUG
3&%
0266ERDUG
3&%
0266ERDUG
3&%
&RPPDQG
W\SH
6723UHOD\
6DIHW\UHOD\
5HOD\
5HOD\
RIRXWSXWV
$&VSHFLILFDWLRQV
'&VSHFLILFDWLRQV
12
12
1&12
1&12
$9$&
$9$&
$9$&
$9$&
$9'&
$9'&
$9'&
5HOD\
1&12
$9'&
5HOD\
6DIHW\UHOD\
5HOD\
$9$&
026)(7
6DIHW\UHOD\
1&12
12
12
1&12
12
026)(7
$9'&
$9'&
$9'&
$9/ RU
$9/ P+
$9'&
$9/ RU
$9/ P+
0$//(1GRF[
0266ERDUG
3&%
$QDORJFXUUHQW
ERDUG3:0
'$&&3&%
$QDORJFXUUHQW
ERDUG'$&&
3&%
$QDORJYROWDJH
ERDUG'$&9
3&%
026)(7
$QDORJ
SURSRUWLRQDO
$QDORJ
SURSRUWLRQDO
$QDORJ
SURSRUWLRQDO
$9/ RU
$9/ P+
y$
) y+]
) y+]
) y+]
yP$
yP$
9FF
9GFy9FF
9FFPD[ 9GF
9GFWR9GFWR
9GF
12.5. M880 LDC / M880 LAC receivers
Radio module specs: see §12.1 and §12.2
For the notes (1) and (2) see the previous paragraph
Antenna
Receiver power_up delay
Start command delay
Command response time
Active Stop time
Passive Stop time
SAFETY ENABLE (N.O.) relay(s)
STOP RELAYs (N.C. and N.O)
TIMED RELAY
HORN output
Feedback :
Serial : LCD data
Digital: ON/OFF commands
Internal/External
<2,5 s
<120 ms
<120 ms
<120 ms
500ms ” t ” 2000 ms (1)
1 (ISO 13849-1:2006 6.2.6 architecture)
2 (ISO 13849-1:2006 6.2.7 architecture)
1
1
>100 Bytes /s
128 Max
Configuration interface (2)
Radio-Computer link
Diagnostics(2)
By means of Status LED / Display or a
personal computer using specific IMET
equipment
Analog inputs (12bit resolution)
4: Voltage (0..10VDC) ,
Current (4/20mA,0/20mA)
Digital inputs
8: 0/24 VDC optoisolated
Outputs:
Max. number of control relays
Max. number of control relays (N.C./N.O.)
Max. number of service relays (NO)
Max. number of DC command drivers (M880 L-DC only)
Max. number of analog outputs (M880 L-DC only)
20
4
14
3
20
8
(with relay boards mod. RLC)
(with boards mod. RDC)
(START, CLAXON and T-RELAY)
(MOSFET)
Proportional (PWM),
Analog current and/or
Analog voltage
Serial communication interfaces:
RS232 (max 115200 Baud)
CAN_Bus (ID 11-29 bit) (1Mbit/s max)
CANOpen (ID 11-29 bit) (1Mbit/s max)
Power supply voltage (M880 LDC)
Absorbed power
0$//(1GRF[
11 - 30 Vdc
22W Max
Maximum absorption
# 2A max @ 11Vdc
Power supply voltage (M880 LAC)
Absorbed power
Maximum absorption
24-55 Vac / 100-240 Vac (50-60 Hz)
30 VA Max
# 1.2A Max @ 24Vac
Operating temperature range
Storage temperature range
Housing material
Casing protection degree
Dimensions
Weight (standard configuration)
Mounting brackets minimum load
2XWSXWW\SH
&RPPDQG
W\SH
6723UHOD\
M880 LDC mother
board (PCB100)
6DIHW\
HQDEOHUHOD\
5HOD\
6723UHOD\
M880 LAC mother
(PCB130)
6DIHW\
HQDEOHUHOD\
5HOD\
5HOD\
Relay board for
LAC receiver
(PCB131)
5HOD\
Relay board for
LDC receiver
(PCB101)
5HOD\
Relays board for
LDC receiver
026)(7
ON/OFF MOSFET
for LDC receiver
(PCB102)
+EULGJH
H motor driver per
PRWRUGULYHU
LDC receiver
(PCB110)
026)(7
ON/OFF MOSFET +
$QDORJ
ANALOG OUT for
SURSRUWLRQDO
LDC receiver
(PCB104)
$QDORJFXUUHQW
ERDUG
3:0$''&
(PCB103)
$QDORJFXUUHQW
ERDUG$''&
(PCB103)
$QDORJYROWDJH
ERDUG$''9
(PCB103)
-25°C to +60°C (-13°F to +140 °F)
-40°C to +85°C (-40°F to +185 °F)
UL94 V0 5VA, UL 746C (f1)
IP66
140x65x230 mm (L.W.H.)
# 1,700 Kg
t100N
RIRXWSXWV
$&VSHFLILFDWLRQV
'&VSHFLILFDWLRQV
12
12
1&12
$9$&
$9$&
$9$&
$9'&
$9'&
$9'&
12
12
1&12
$9$&
$9$&
$9$&
$9'&
$9'&
$9'&
12
1&12
12
1&12
12
$9$&
$9'&
$9'&
$9/ RU
$9/ P+
$9
$QDORJ
SURSRUWLRQDO
$QDORJ
SURSRUWLRQDO
$9/ $9/ P+
$
) +]
) +]
) +]
$
) +]
) +]
) +]
P$
P$
$QDORJ
SURSRUWLRQDO
9FF
9GF9FF
9FFPD[ 9GF
9GFWR9GFWR
9GF
0$//(1GRF[
12.6. M880 MAC receivers
Radio module specs: see §12.1 and §12.2
For the notes (1) and (2) see the previous paragraph
Antenna
Receiver power_up delay
Start command delay
Command response time
Active Stop time
Passive Stop time
Internal/External
<2,5 s
<120 ms
<120 ms
<120 ms
500ms ” t ” 2000 ms (1)
SAFETY ENABLE (N.O.) relay(s)
STOP RELAYs (N.C. and N.O)
HORN output
Lamp output
1 (ISO 13849-1:2006 6.2.6 architecture)
2 (ISO 13849-1:2006 6.2.7 architecture)
1
1
Feedback :
Serial : LCD data
Digital: ON/OFF commands
>100 Bytes /s
128 Max
Configuration interface (2)
Radio-Computer link
Diagnostics(2)
By means of Status LED / Display or a
personal computer using specific IMET
equipment
Analog inputs (12bit resolution)
4
Voltage (0-10VDC) ,
Current (4-20mA, 0-20mA)
Digital inputs
8
0-24 VDC optoisolated
Outputs:
Max. number of control relays
Max. number of service relays (NO)
Max. number of analog outputs
22 (18 N.O. and 4 N.C./N.O.)
2 (START, LAMP)
4 Analog current (NOT PWM )and/or
Analog voltage
Serial communication interfaces:
RS232/RS485 (115200 Baud max)
CAN_Bus (ID 11-29 bit) (1Mbit/s max)
CANOpen (ID 11-29 bit) (1Mbit/s max)
Power supply voltage
Absorbed power
Maximum absorption
12-30 Vdc / 24 Vac (50-60 Hz)
22W Max
# 2A max @ 11Vdc
Operating temperature range
Storage temperature range
Housing material
Casing protection degree
Dimensions
Weight (standard configuration)
Mounting brackets minimum load
-25°C to +70°C (-13°F to +158 °F)
-40°C to +85°C (-40°F to +185 °F)
ABS
IP20
[[PP(L.D.H)
# 0,91 Kg
t50N
0$//(1GRF[
2XWSXWW\SH
RIRXWSXWV
$&VSHFLILFDWLRQV
'&VSHFLILFDWLRQV
MAC mother board
(PCB300)
&RPPDQG
W\SH
6723UHOD\
6DIHW\
HQDEOHUHOD\
12
12
$9$&
$9$&
$9'&
$9'&
MAC mother board
(PCB300)
&RPPDQG
5HOD\V
12
1&12
$9$&
$9$&
$9'&
MAC mother board
(PCB300)
67$57UHOD\
/$03UHOD\
12
$9$&
$9$&
$9'&
$QDORJFXUUHQW
ERDUG$''&
(PCB301)
$QDORJYROWDJH
ERDUG$''9
(PCB301)
$QDORJ
SURSRUWLRQDO
P$
P$
$QDORJ
SURSRUWLRQDO
9FF
9GF9FF
9FFPD[ 9GF
9GFWR9GFWR
9GF
12.7. CB3600-AC, CB3600-DC battery charger for THOR2, ZEUS2, ARES2 and KRON
transmitters
x
x
x
x
x
x
x
x
x
x
x
x
x
Power supply voltage
Power demand
Charging current
IMET battery
Max charging time
Type of charge
Casing protection degree
Operating temperature during charge
Storage temperature (charger off and without battery)
Housing material
Dimensions
Weight
Weight including 230V AC transformer (optional)
12-32V DC (85-230V AC optional)
35mA AC/250mA DC (during charge)
# 650mA
Ni-MH 3.6V 1.7 A/h
3 hours
PVD
IP30
0°C to +35°C (+32°F to +95 °F)
-40°C to +85°C (-40°F to +185 °F)
UL94 V0
75x49x156 mm (L.W.H.)
250 g
491 g
0$//(1GRF[
12.8. CB36NIMH Battery charger for THOR2, ZEUS2, ARES2 and KRON transmitters
' PP
Power supply voltage
Power demand
Charging current
IMET battery (BE3600)
Max. charging time
Type of charge
Operating temperature during charge
Storage temperature (charger off and without battery)
Housing material
Casing protection degree
Dimensions
Weight
12-24 Vdc (min 11Vdc – max 30Vdc)
400mA max DC (during charge)
# 900mA
Ni-MH 3.6V 2.2 Ah
2.45 hours
PVD
0°C to +35°C (+32°F to +95 °F)
-40°C to +85°C (-40°F to +185 °F)
UL94 V0, UL746C (f1)
IP20
80x30x120 mm (L.W.H.)
250g
Note: A Battery Charger kit comes with an external EU power plug (US, UK or AUS on request). On
request, a power cord for the cigarette lighter-type plug can be supplied
/('
0$//(1GRF[
12.9. CB36NIMH G4 - Battery charger M880 G4L and M880 G4S transmitters
Power supply voltage
Power demand
Charging current
IMET battery (BE3600)
Max. charging time
Type of charge
Operating temperature during charge
Storage temperature (charger off and without battery)
Housing material
Casing protection degree
Dimensions
Weight
12-24 Vdc (min 11Vdc – max 30Vdc)
400mA max DC (during charge)
# 900mA
Ni-MH 3.6V 2.1 Ah
2.35 hours
PVD
0°C to +35°C (+32°F to +95 °F)
-40°C to +85°C (-40°F to +185 °F)
UL94 V0, UL746C (f1)
IP20
120x40x137 mm (L.W.H.)
344g
Note: A Battery Charger kit comes with an external EU power plug (US, UK or AUS on request). On
request, a power cord for the cigarette lighter-type plug can be supplied
/('
0$//(1GRF[
12.10. CB37LION battery charger for WAVE2 transmitters
D
' PP
Power supply voltage
Power demand
Charging current
IMET battery (BE3700)
Max. charging time
Type of charge
Operating temperature during charge
Storage temperature (charger off and without battery)
Case material
Casing protection degree
Dimensions
Weight (power supply not included)
12-24 Vdc (min 11Vdc – max 30Vdc)
0.3A 3.3 W (during charge)
# 540mA
Lipo 3.7V 2.0 Ah
2.45 hours
TTDM (JEITA range)
0°C to +45°C (+32°F to +113 °F)
-40°C to +85°C (-40°F to +185 °F)
UL94 V0, UL746C (f1)
IP20
70x25x130 mm (L.W.H.)
110g
Note: A Battery Charger kit comes with an external EU power plug (option US, UK or AUS on
request). As option, a 6-feet AUTO POWER CORD can be delivered.
/('
0$//(1GRF[
13.
RADIO REMOTE CONTROL SPARE PARTS LIST
13.1.
Transmitting units and battery charger
Description
Item code
Battery charger CB3600-AC 230 Vac with italian plug
Battery charger CB3600-AC 230 Vac with Shuko plug(CEE 7/4)
Battery charger CB3600-DC 12 - 32 Vdc
Battery 3.6V 1.7 A/h Ni-MH
F1 fuse 5x20 T 50mA L250V for CB3600-AC
F1 fuse 5x20 T 1,25 A L250V for CB3600-DC
Battery charger CB36NIMH ARES2, KRON, ZEUS2 and THOR2
Batt. BE3600 NiMH 2.2Ah for M880 ARES2, KRON, ZEUS2 and THOR2
Battery charger CB37LION for WAVE2
Battery BE3700 Lipo 2.00 Ah for M880 WAVE2
CR016
CR017
CR018
AS060
FS031
FS002
CR040
AS083
CR039
AS087
Battery charger CB36NIMH G4
Batt. BE3600G4 NiMH 2.1Ah for M880 G4 L/S
CR041
AS088
13.2.
HDC Receiver
Description
F1 fuse 5x20 T 5A L250V
F1 fuse 5x20 T 6,3A L250V
F1 fuse 5x20 T 5A L250V
F2 fuse 5x20 T 5A L250V
F3 fuse 5x20 T 5A L250V
F1 fuse5X20 T 6,3A
13.3.
F1 fuse 5X20 T 1,6A
F1 fuse 5x20 T 6,3A L250V
F1 fuse 5x20 T 5A L250V
F2 fuse 5x20 T 5A L250V
F3 fuse 5x20 T 5A L250V
Description
RX H DC(PCB200)
RELS(PCB203)
SERVDC(PCB201)
SERVDC(PCB201)
SERVDC(PCB201)
MOSFET(PCB206)
Item code
Remarks
FS045
FS006
FS005
FS005
FS005
RX H AC(PCB230)
RELS(PCB232)
SERVDC(PCB231)
SERVDC(PCB231)
SERVDC(PCB231)
Item code
Remarks
FS041
FS005
FS005
FS005
RX L DC(PCB100)
RX L DC(PCB100)
RX L DC(PCB100)
RX L DC(PCB100)
Item code
Remarks
FS045
FS005
FS005
FS005
RX L AC(PCB130)
RX L AC(PCB130)
RX L AC(PCB130)
RX L AC(PCB130)
LAC Receiver
Description
F1 fuse 5x20 T 1.6A L250V
F2 fuse 5x20 T 5A L250V
F3 fuse 5x20 T 5A L250V
F4 fuse 5x20 T 5A L250V
FS005
FS006
FS005
FS005
FS005
FS006
LDC Receiver
F1 fuse 5x20 T 4A L250V
F2 fuse 5x20 T 5A L250V
F3 fuse 5x20 T 5A L250V
F4 fuse 5x20 T 5A L250V
13.5.
Remarks
HAC Receiver
Description
13.4.
Item code
0$//(1GRF[
13.6.
MAC Receiver
Description
F1 fuse 5x20 T 5A L250V
F2 fuse 5x20 T 5A L250V
F3 fuse 5x20 T 1.25A L250V
14.
Item code
Remarks
FS005
FS005
FS002
RX DIN (PCB301)
RX DIN (PCB301)
RX DIN (PCB301)
DISPOSAL (EU zone)
2QFH QR ORQJHU LQ XVH WKH UDGLR UHPRWH FRQWURO VKRXOG EH KDQGHG RYHU WR WKH ORFDO ZDVWH GLVSRVDO
VHUYLFH
7KH V\PERO RI WKH FURVVHGRXW ZDVWH FRQWDLQHU RQ WKH GHYLFH PHDQV WKDW LW PXVW EH
KDQGOHG VHSDUDWHO\ IURP QRUPDO ZDVWH 7KH RZQHU LV UHVSRQVLEOH IRU KDQGLQJ RYHU
VFUDSSHGHTXLSPHQWWRWKHGHVLJQDWHGSRLQWVRIFROOHFWLRQIRUWKHUHF\FOLQJRIHOHFWULFRU
HOHFWURQLFZDVWHPDWHULDO
:DVWHVHSDUDWLRQFRQWULEXWHVWRSURWHFWLQJWKHHQYLURQPHQWDQGIDFLOLWDWHVUHF\FOLQJ
([KDXVWHGEDWWHULHVVKRXOGEHGLVSRVHGRIDWWKHVSHFLILFSRLQWVRIFROOHFWLRQDVUHTXLUHGE\ODZ
,OOHJDOGLVSRVDORIWKHSURGXFWLVSXQLVKHGLQ,WDO\E\WKHSHQDOWLHVLQGLFDWHGLQWKH/HJLVODWLYH'HFUHH
QR$UWDQGVXEVLPSOHPHQWLQJWKH(XURSHDQ'LUHFWLYH&(
15. ANNEXES
7KLV PDQXDO LV FRPSOHWHG E\ WKH IROORZLQJ DQQH[HV LQGLFDWLQJ VSHFLILF LQIRUPDWLRQ RQ WKH SURMHFW
QXPEHUE\ZKLFKWKHUDGLRUHPRWHFRQWUROLVLGHQWLILHG
$QQH[7
$UUDQJHPHQWDQGHOHFWULFV\PEROVRIWKHDFWXDWRUVLQWKHWUDQVPLWWLQJXQLW
$QQH[5
:LULQJGLDJUDPRIWKHRXWSXWVLQWKHUHFHLYLQJXQLW
2WKHUDQQH[HV
6SHFLDOIXQFWLRQV
0$//(1GRF[
Download PDF
Similar pages