BW Technologies
Product Catalogue
.
w
m
o
c
.
a
y
r
A
E
S
H
w
w
For Order:
Call +9821-55425307
www.HSEArya.com
www.HSEArya.com
BW Technologies
BW Technologies is the leader in innovative gas
monitoring instrumentation. Showcasing a full line of
portable, fixed and stand-alone equipment, BW utilizes
advanced micro-controllers and sensing technology to
design and produce the smallest, most user-friendly and
cost-effective instruments in the gas detection industry.
An ISO 9001 company, BW provides safety solutions for
the monitoring of a range of toxic gases, combustibles
and oxygen hazards.
BW is committed to providing industry with only the
highest quality gas detection instruments to protect
human life and safeguard property.
m
o
c
.
a
y
r
A
E
S
H
BW Technologies offers a full line of protection.
Portable Gas Detectors
- Single gas, disposable (maintenance-free) detectors
- Single gas instruments with plug-in, replaceable
components
- Multi-gas instruments
Fixed 4-20mA and Digital (RS-485 / MODBUS)
Transmitters and Systems
- Combustible, toxic and oxygen systems
- Disposable (maintenance-free) monitors
- AC/DC controllers
Stand Alone Gas Detection Systems
- Wireless, solar-capable, multi-point systems
- Dual-point, solar-capable systems
- AC/DC transportable systems
.
w
HVAC Instruments and Systems
- Combustion analyzers
- Fixed transmitters
- Carbon monoxide meters
w
w
Vulcain Alarme Inc.
The Vulcain division of BW Technologies designs and
manufactures instruments used in parking garages,
office towers, schools and other commercial applications.
Founded in 1968, Vulcain has a strong network of
distribution agents and representatives that readily
complement BW's existing distribution channels.
www.HSEArya.com
Industry Leader
Serving Industry Worldwide
BW Technologies aims to become the leading supplier
of gas detection equipment for the protection of
personnel and facilities around the world.
BW Technologies spans the globe with a growing
network of sales, service and distribution centers on
six continents. BW Technologies is headquartered in
Calgary, Alberta, Canada, with manufacturing, service
and stocking centers located in the USA, in the UK and
in Canada.
ada.
m
o
c
.
a
y
r
A
E
S
H
Local sales and service support is provided by
authorized distribution channels in over 50 countries.
BW Technologies has more than 30 regional
management offices that provide technical product
support and training throughout the world.
At BW, we believe customers deserve personal
attention and prompt service. To meet our customers'
needs and exceed their expectations, BW provides
same-day shipment of standard product through our
three stocking centers.
Leader in Gas Detection
w
w
.
w
Intuitive operation is a hallmark of BW instruments. Our
feature-rich detectors are designed for ease of use with
field-proven sensor technology.
•
•
•
•
•
Large, status-at-a-glance displays
Intelligent, automatic calibration—simply
apply gas (the instrument checks that the
calibration gas applied meets
expected parameters)
Unique, full function self-test verifies the
integrity of all internal components
onents
Advanced programmin
programming techniques for
user-friendly operational features and low
training costs
Datalogging—use office standard programs
(Excel, Access, etc.) to store, manage and
display your data
Lower Maintenance Costs
• Easy sensor replacement and
field calibration
• Zero-maintenance portable and
fixed instruments
• Portable gas detectors use flexible power
sources. Convenient local availability
reduces operating costs.
• Local servicing available through
authorized dealers.
www.HSEArya.com
Price Leader
BW has set a new benchmark in the cost of instrument
ownership. Modern electronic and industrial design
provides a superior safety instrument at a lower
manufacturing cost-a benefit that is passed on to you,
the customer.
Leader in Customer Care
Dedicated to providing ongoing customer satisfaction,
BW Technologies is reaching forward in quality,
performance and reliability to ensure trust in personal
safety. Third party certifications, classifications and
markings provide your global passport to
hazardous locations.
•
•
m
o
c
.
a
y
r
A
E
S
H
ISO9001:2000 Quality System Certified
CSA, UL, Cenelec, ATEX, Standards
Australia, South African Bureau of
Standards, American Bureau of Shipping,
and others
Durable and Reliable
• Impact-resistant construction of all portable
monitors with advanced industrial design
• On-board RFI protection provides the most
complete radio interference protection in
industry today
• High-performance microprocessor-based
operation for increased accuracy, reliability
and power
.
w
Warranty Protection
We stand behind the reliability and durability of our
products with a comprehensive BW warranty.
w
w
•
•
Two year sensor warranty on portable, fixed*
and stand-alone sensors
Two year warranty on portable detectors,
fixed equipment and stand-alone systems
www.HSEArya.com
Portables
BW Technologies
From maintenance-free singlegas to intelligent multi-gas, we
offer a full spectrum of portable
monitoring instruments.
With advanced sensor
technology and the latest in RFI
shielding, BW portables provide
unequalled protection from
toxic gases, combustibles
and oxygen hazards.
m
o
c
.
a
y
r
A
E
S
H
w
w
.
w
For further information:
Website: www.HSEArya.com
Tel: +9821-55425307
Email: info@HSEArya.com
Telegram ID: @HSEArya_PPE
Instagram ID: @HSEAryaPPE
www.HSEArya.com
The BW Portable Advantage
Technology
Just as mobile phones and computers have become smaller, smarter
and more affordable, BW has brought the same technological advances
to gas detection instrumentation. Cutting-edge technology in sensors,
microprocessors, programming features and fiber optics result in a more
compact and easier to use safety instrument—at a lower cost.
Full Function Self-Test
BW Technologies’ unique, full function self-test automatically checks battery,
circuitry and sensor integrity. Our instruments are engineered with selfdi
diagnostic
ti capabilities
biliti th
thatt verify
if each
h sensor’’s response to
t gas.
m
o
c
.
a
y
r
A
E
S
H
Automatic Calibration
During auto-cal and auto-span procedures, BW instruments advise when to
apply gas—no setting adjustments are required. The instrument also checks
that the concentration (ppm or %) meets expected criteria. GasAlertClip,
GasAlert100, Toxyclip and Toxyclip2 do not
require calibration.
Affordability
Sophisticated, feature-rich safety instruments provide
superior performance and reliability. Instruments with
similar features typically cost up to 50% more than
BW portable detectors. Prices quoted include
instruments, sensor(s), batteries, pumps, chargers,
sampling hoses, filters, etc., (if applicable). No hidden
extras. Portables are delivered ready for use.
.
w
Durability
BW portables feature advanced industrial design for
the rugged conditions of modern industry.
w
w
Low Maintenance
State-of-the-art sensor and micro-electronics significantly
reduce and often eliminate the need for user maintenance.
www.HSEArya.com
m
o
c
.
a
y
r
A
E
S
H
w
w
.
w
Website: www.HSEArya.com
Tel: +9821-55425307
Email: info@HSEArya.com
Telegram ID: @HSEArya_PPE
Instagram ID: @HSEAryaPPE
www.HSEArya.com
GasAlert100
SPECIFICATIONS
H2S or CO
100 Day Disposable
Gas Detectors
DETECTOR:
Model:
Operational life1:
Sensor range:
Low alarm level2:
High alarm level2:
Operating temperature:
The GasAlert100 is a practical,
cost-effective solution to short-term
work projects. The GasAlert100
provides 100 days of continuous,
maintenance-free operation from
the day of activation. Operated by
an advanced microcontroller and
electrochemical sensor, GasAlert100
is equipped with two levels of alarm
and a continuous, alphanumeric
confidence LCD.
Simply press the START/TEST button
and the GasAlert100 is ready for use.
The life remaining is displayed in
days and then hours. The full function
self-test verifies sensor, circuit and
battery integrity and audible/visual
alarms. Alarm setpoints are displayed
on command.
The rugged, compact GasAlert100 is
designed with the most advanced RFI
protection available in industry today.
Simply clip the instrument to your
lapel, pocket, belt or hard hat for
unequalled protection.
Calibration:
Continuously on:
One-button control:
Full function self-test:
Sensor:
INDICATORS AND ALARMS
Visual gas alarm:
Audible gas alarm:
Failure alarm:
Self-test pass:
Other:
Gas monitored:
Life remaining:
Two alarm levels:
Peak alarm levels:
Alarm setpoints:
Self-test status:
TESTS
Full function self-test:
Battery:
GENERAL SPECIFICATIONS:
Humidity:
EMI/RFI:
Battery:
Size:
Weight:
1Given
For further information:
Website: www.HSEArya.com
Tel: +9821-55425307
Email: info@HSEArya.com
Telegram ID: @HSEArya_PPE
Instagram ID: @HSEAryaPPE
Corporate Headquarters
2840 - 2 Avenue S.E.
Calgary, AB, Canada T2A 7X9
Fax: +1-403-273-3708
E-mail: info@bwtnet.com
www.gasmonitors.com
BW1023-01-01-00-8.25x11-5240-3
Alphanumeric status panel LCD advises:
H2S or CO
Continuously displayed in days and then hours
LOW alarm / HIGH alarm
Records and displays peak alarm exposure, and time elapsed (up to 24 hrs.)
High and low (displayed on demand in ppm)
Advises to “TEST” and that self-test was passed “”
On demand, as often as once every 20 hours and on activation
Every two hours (auto)
Impact-resistant ABS enclosure
5% to 95% RH (non-condensing)
Complies with EMC Directive 89/336/EEC
Lithium, non-replaceable
1.0 x 1.45 x 2.3 inches / 26 x 37 x 58 mm
1 oz. / 30 g
100 days from activation plus 1 year shelf life
3-5 minutes of alarm per day in normal operation
special alarm settings available
2Customer
DUE TO ONGOING RESEARCH AND PRODUCT IMPROVEMENT, SPECIFICATIONS ARE SUBJECT TO CHANGE WITHOUT NOTICE.
RATINGS AND CERTIFICATIONS:
.
w
w
w
Flashing, wide-angled alarm lens with dual red LEDs plus ALARM LCD readout
Pulsing siren 95 dB at 1 ft./0.3 m
Yes (audible/visual)
Yes (audible/visual)
End of life (audible/visual)
m
o
c
.
a
y
r
A
E
S
H
CONTINUOUS LCD DISPLAY:
WARRANTY:
Website: www.HSEArya.com
Tel: +9821-55425307
Email: info@HSEArya.com
Telegram ID: @HSEArya_PPE
Instagram ID: @HSEAryaPPE
Disposable, zero-maintenance gas detector
GasAlert100 H2S
GasAlert100 CO
100 days
100 days
0-100 ppm
0-300 ppm
10 ppm
35 ppm
15 ppm
200 ppm
-22 to +113 °F
+5 to +113 °F
-30 to +45 °C
-15 to +45 °C
Not required
Yes
Activation and self-test
Verifies sensor, circuitry and battery integrity and audible/visual alarms
Electrochemical cell (temperature compensated)
Class I, Div. 1, Groups A, B, C, D
Class I, Zone 0, Gr. IIC
(Intrinsic safety)
ATEX: CE g II 1 G
EX Approval: EEx ia IIC
CE: European Conformity
FULL FUNCTION DAILY SELF-TEST
ADVANCED MICROCONTROLLER
OPERATION
TWO LEVELS OF GAS ALARM
95 dB AUDIBLE ALARM
BRIGHT, WIDE-ANGLED VISUAL
ALARM BAR
Interactive Product
Demo CD-ROM
SUPERIOR RFI PROTECTION
RUGGED ENCLOSURE
Full Information STATUS Panel
Displays life remaining
in days and hours
Locally distributed by:
Advises alarm level
encountered (LOW/HIGH)
Display automatically
advises self-test is due
Displays alarm
setpoints in ppm
www.HSEArya.com
GasAlertClip Extreme
H2S, SO2, CO, or O2
2 Year Disposable Gas Detector
s
Protect Yourself
m
o
c
.
a
y
r
A
E
S
X
H
.
w
w
ACTUAL SIZE
Two years of protection with zero maintenance costs
Continuous, alphanumeric, status LCD shows detector
life remaining, alarm setpoints and advises self-test status
Rugged, IP-66/67 highly water-resistant design
Built-in concussion-proof boot
Records and displays the peak alarm encountered and the
time elapsed since the exposure occurred
Automatic event logging records 10 most recent alarm
events that can be downloaded via infrared port
Two alarm levels (Low / High)
Provides typical 95 dB tone and bright, quad-LED
indication on alarm
Internal vibrator alarm
Small size (1.1 x 2.0 x 3.2 in. / 28 x 50 x 81 mm) and
lightweight (2.7 oz. / 76 g)
Maintenance free—no sensor or battery replacement, no
calibration, no downtime
Full-function self-test of audible/visual alarms, plus
integrity of sensor, battery and circuitry
Continuously ON—one-button activation, test and data
transmission
Comes complete with rugged, stainless-steel alligator belt
clip and test cap
Instructions in local languages included
Optional hard hat clips available
w
Extreme protection!
Extreme durability!
Extreme value!
j ATEX
g
Plus
Others
Ordering Information
2 Year GasAlertClip Extreme Detectors with Event Logging
GA24XT-H
GA24XT-M
GA24XT-S
GA24XT-X
H2S detector
CO detector
SO2 detector
O2 detector
Accessories
GA-TS02
GA-HC-1
GA-AG-1
GA-CL-1
GA-NS1
GA-USB1
GPR-PRINTER
GA-TC-1
GasAlertClip automatic test station
Hard hat clip (for use with alligator clips GA-AG-1
and GA-AG-3)
Alligator clip (non-conductive)
Belt Clip (stainless steel)
Neck strap w/ safety release
Infrared USB adaptor kit (includes EDM Excel
datamanagement software)
Thermal cordless printer
Test cap and hose
Website: www.HSEArya.com
Tel: +9821-55425307
Email: info@HSEArya.com
www.gasmonitors.com
Email: info@bwtnet.com
www.HSEArya.com
GasAlertClip Extreme
SPECIFICATIONS
H2S, SO2 , CO, or O2
DETECTOR:
2-Year Gas Detection
with Event Logging
Simply press the START/TEST button and
the GasAlertClip Extreme is ready to use,
providing two years of continuous,
maintenance-free operation from the day
of activation.
Zero-maintenance detector
Gas monitored
H2S
CO
SO2
O2
Sensor range
0-100 ppm
0-300 ppm
0-100 ppm
0-30.0 % by vol.
19.5%
Low alarm level1
10 ppm
35 ppm
5 ppm
High alarm level1
15 ppm
200 ppm
10 ppm
Operating temperature
o
2
o
-40 to +122 F
-40 to +50oC
-22 to +122 F
-30 to +50oC
Calibration
The GasAlertClip Extreme is highly waterresistant, with an IP-66 / 67 housing fully
immersible to a depth of one full meter.
The GasAlertClip-Extreme housing
includes a built-in concussion-proof boot,
and a heavy-duty, stainless steel, alligator
style belt-clip. A large easy-to-read LCD
shows detector life remaining, alarm
setpoints, peak alarm exposures, and
other information.
1
Stored data can be transmitted directly
by IR link to a cordless thermal printer
for immediate printout, or to a personal
computer by means of an IR adapter
connected to the computer’s USB port.
The GasAlertClip Extreme is equipped
with two alarm setpoints used to activate a
high output 95 dB (typical) audible alarm,
a bright, wide-angled quad LED visual
alarm, and a built-in vibrator alarm.
.
w
w
s
w
For further information:
1-888-749-8878
America
1-800-663-4164
Canada
+44 (0) 1869 233004 Europe
+971-4-8871766
Middle East
+61-7-3818-8244
Australia
+852-2974-1783
China
+65-687-39813
South East Asia
+1-403-248-9226
Other Countries
Corporate Headquarters
2840 - 2 Avenue S.E.
Calgary, AB, Canada T2A 7X9
Phone: +1-403-248-9226
Fax: +1-403-273-3708
E-mail: info@bwtnet.com
www.gasmonitors.com
BW1067-01-01-01-8.25x11-7/17/2003-5472-0
-4 to +122oF
-20 to +50oC
-22 to +122 F
-30 to +50oC
Not required
Customized alarm settings available at no extra charge
GENERAL SPECIFICATIONS:
Humidity:
EMI/RFI:
Ingress protection:
Battery:
Continuously On:
One-button control:
Full Functional self-test:
Sensor:
Operational Life:
2
Self-calibrating
Internal vibrator operates to -15 oC / +5 oF
Rugged composite material with integral concussion-proof boot
5% to 95% RH (non-condensing)
Complies with EMC Directive 89/336/EEC
IP 66/67
Lithium, non-replaceable
Yes
Activation, self-test and alarm event data transmission
Verifies integrity of sensor, circuitry , battery and audible/visual alarms
Electrochemical cell (temperature compensated)
Two years
m
o
c
.
a
y
r
A
E
S
H
The detector life remaining is displayed in
months, days, then hours. A full-function
self-test verifies sensor, circuitry and
battery integrity, as well as function of the
audible, visual and vibrator alarms.
Simply clip the GasAlertClip Extreme to
your lapel, pocket, belt or hard-hat for
unequaled, cost-effective protection.
23.5%
o
INDICATORS AND ALARMS:
Visual alarm:
Audible alarm:
Vibrator alarm:
Failure alarm:
Self-test pass:
Other:
CONTINUOUS LCD DISPLAY:
Life remaining:
Two alarm levels:
Peak alarm exposure:
Alarm setpoints:
Self-test status:
Flashing, wide-angled alarm lens with quad red LEDs, plus ALARM LCD readout
Pulsing, high-output siren at 95 dB (typical) at 1 ft. (0.3 m)
Internal
Yes (audible/visual/vibration)
Yes (audible/visual/vibration)
End of life (audible/visual/vibration)
Status display
Continuously displayed in months, then days, then hours
LOW alarm / HIGH alarm
Records and displays peak alarm exposure, and time elapsed (up to 24 hrs.)
High and low (displayed on demand in ppm or %)
Advises to “TEST” and that self-test was passed “u”
TESTS:
Full function self-test:
Battery:
EVENT LOGGING:
Event Information:
Transmission method:
ON-demand, as often as once every 20 hours and on activation
Every two hours (auto)
Records and transmits up to 10 gas alarm events
Gas type, peak exposure level (ppm or %); alarm duration in minutes and seconds;
time elapsed since the alarm occurred in days, hours and minutes, life remaining,
self-tests, cumulative alarm time
Via infrared port to thermal printer or to USB PC adapter
PHYSICAL SIZE:
Size:
Weight:
1.1 x 2.0 x 3.2 inches / 28 x 50 x 81 mm
2.7 oz. / 76 g
WARRANTY:
2 years from activation, plus 1-year shelf life (given 3-5 minutes of alarm per day in
normal operation
DUE TO ONGOING RESEARCH AND PRODUCT IMPROVEMENT, SPECIFICATIONS ARE SUBJECT TO CHANGE WITHOUT NOTICE.
RATINGS AND CERTIFICATIONS:
UL: jClass I, Div. 1, Gr. A, B, C, D
Class I, Zone 0, Gr. IIC
•
FULL FUNCTION SELF-TEST
•
ADVANCED MICROCONTROLLER OPERATION
•
TWO LEVELS OF GAS ALARM
•
HIGH OUTPUT AUDIBLE ALARM
•
BRIGHT, WIDE-ANGLED VISUAL ALARM
•
INFRARED DATA PORT
•
SUPERIOR RFI PROTECTION
•
RUGGED ENCLOSURE
ATEX: CE g II 2 G
EX Approval: EEx ia IIC T4
CE: European Conformity
FULL-FUNCTION AUTOMATIC
TEST STATION
INFRARED USB ADAPTER
INFRARED PRINTER
Full information STATUS display
Life remaining in
months, days and hours
Locally distributed by:
Advises alarm level
encountered (LOW/HIGH)
Records and displays peak
alarm exposure in past 24 hrs.
Displays alarm
setpoints in ppm or %
www.HSEArya.com
GasAlertClip
H2S, CO, SO2 or O2
2 Year Disposable Gas Detectors
Protect Yourself
Two years of protection with zero maintenance costs
Continuous, alphanumeric LCD shows detector life remaining,
alarm setpoints and advises self-test status
m
o
c
.
a
y
r
A
E
S
H
Records and displays the peak alarm encountered and the
time since the exposure occurred
Records and transmits gas alarm events encountered and the
time elapsed since the event occurred
Two alarm levels (Low / High)
Provides
90 dB tone and bright LED indication on alarm
Internal vibrator alarm
Small size (1.1 x 2.0 x 3.2 inches / 28 x 50 x 81 mm) and
lightweight (2.6 oz. / 73 g)
Maintenance free—no sensor or battery replacement, no
calibration, no downtime
Full function self-test of: audible/visual alarms plus integrity of
sensor, battery and circuitry
Continuously on—one button activation, test and data transmission
Comes complete with pocket/belt clip and test cap
Instructions in local languages included
Optional alligator and hard hat clips available
.
w
w
w
NOW with
event logging
GasAlertClip with infrared port now
records and transmits event data.
j ATEX
and
others
Ordering Information
2 Year GasAlertClip detectors with event logging and internal vibrator
GA24A-H-EL
H2S detector
GA24A-M-EL
CO detector
GA24A-S-EL
SO2 detector
GA24A-X-EL
O2 detector
Note: Models above are available with special alarm setpoints at no extra charge
Accessories
GA-TS02
GPR-PRINTER
GPR-PP-K4
GA24-BALERT
GA-HC-1
GA-AG-1
GA-AG-2
GA-TC-1
GACLIP-CD2
GasAlertClip automatic test station
Thermal cordless printer
Thermal printer paper (kit of 3)
Concussion-proof boot with alligator clip
Hard hat clip
Alligator clip (non-conductive)
Alligator clip (high-tension metal)
Test cap and hose
Training CD
Website: www.HSEArya.com
Email: info@HSEArya.com
www.gasmonitors.com
Email: info@bwtnet.com
www.HSEArya.com
SPECIFICATIONS
GasAlertClip
DETECTOR:
Gas monitored:
Sensor range:
Low alarm level1:
High alarm level1:
Operating Temperature2:
H2S, SO2, CO or O2
2 Year Gas Detectors
with Event Logging
The GasAlertClip provides two years of
continuous maintenance-free operation
from the day of activation. Operated by
an advanced microcontroller and
electrochemical sensor, the
GasAlertClip is equipped with two levels
of alarm, a full feature LCD status panel
and high output audible/visual alarms.
Calibration:
1
Visual gas alarm:
Audible gas alarm:
Vibrator alarm:
Failure alarm:
Self-test pass:
Other:
Life remaining:
Two alarm levels:
Peak alarm exposure:
Alarm setpoints:
Self-test status:
Flashing, wide-angled alarm lens with dual red LEDs plus ALARM LCD readout
Pulsing siren 90 dB at 1 ft. / 0.3 m
Internal
Yes (audible/visual)
Yes (audible/visual)
Low battery and end of life (audible/visual)
Alphanumeric status panel LCD advises:
Continuously displayed in months, then days, then hours
LOW alarm / HIGH alarm
Records and displays peak alarm exposure, and time elapsed (up to 24 hrs.)
High and low (displayed on demand in ppm or %)
Advises to “TEST” and that self-test was passed “”
TESTS
Full function self-test:
Battery:
On-demand, as often as once every 20 hours and on activation
Every two hours (auto)
CONTINUOUS LCD DISPLAY:
EVENT LOGGING:
Event information:
Transmission method:
GENERAL SPECIFICATIONS:
The rugged, compact GasAlertClip is
designed with the most advanced RFI
protection available in industry today.
Simply clip the instrument to your lapel,
pocket, belt or hard hat for unequaled
cost effective protection.
.
w
E-mail: info@bwtnet.com
www.gasmonitors.com
BW1007-01-01-00-8.25x11-5121-6
Two years3
Yes
Activation, self-test and alarm event data transmission
Verifies integrity of sensor, circuitry and battery; audible/visual alarms
Electrochemical cell (temperature compensated)
m
o
c
.
a
y
r
A
E
S
H
Generate a permanent record of gas
alarm events encountered. Transmit
stored event data to a cordless printer.
Corporate Headquarters
2840 - 2 Avenue S.E.
Calgary, AB, Canada T2A 7X9
Fax: +1-403-273-3708
SO2
0 - 100 ppm
5 ppm
10 ppm
-22 to +122 °F
-30 to +50 °C
INDICATORS AND ALARMS
Alarm setpoints, peak alarm and the
time elapsed since the peak alarm
occurred are displayed on command.
For further information:
1-888-749-8878 USA
1-800-663-4164 Canada
+44 (0) 1869 233004 Europe
+971-4-8871766 Middle East
+61-7-3818-8244 Australia
+1-403-248-9226 other countries
O2
0 - 30.0% by vol.
19.5 %
23.5 %
-4 to +122 °F
-20 to +50 °C
Self-calibrating
2
Internal vibrating option operates to -15 °C / +5 °F
CO
0 - 300 ppm
35 ppm
200 ppm
-22 to +122°F
-30 to +50°C
Not required
Special alarm settings available at no extra charge
Operational life:
Continuously on:
One-button control:
Full function self-test:
Sensor:
Simply press the START/TEST button
and the GasAlertClip is ready for use.
The life remaining is displayed in
months, then days and then hours. The
full function self-test verifies sensor,
circuit and battery integrity
and audible/visual alarms.
w
w
Disposable, zero-maintenance gas detector
H2S
0 - 100 ppm
10 ppm
15 ppm
-40 to +122 °F
-40 to +50 °C
Humidity:
EMI/RFI:
Battery:
Size:
Weight:
WARRANTY:
3
Records and transmits up to 10 gas alarm events
Gas type, peak exposure level (ppm or %); alarm duration in minutes and
seconds; time elapsed since the alarm occurred in days, hours and minutes
Via infrared port to thermal printer
Impact-resistant ABS enclosure
5% to 95% RH (non-condensing)
Complies with EMC Directive 89/336/EEC
Lithium, non-replaceable
1.1 x 2.0 x 3.2 inches / 28 x 50 x 81 mm
2.6 oz. / 73 g
2 years from activation plus 1 year shelf-life
Given 3-5 minutes of alarm per day in normal operation
DUE TO ONGOING RESEARCH AND PRODUCT IMPROVEMENT, SPECIFICATIONS ARE SUBJECT TO CHANGE WITHOUT NOTICE.
j Class I, Div. 1, Gr. A, B, C, D
(Intrinsic safety) Class I, Zone 0, Gr. IIC
ABS
RATINGS AND CERTIFICATIONS:
ATEX: CE g II 2 G
EX Approval: EEx ia IIC
CE: European Conformity
FULL FUNCTION SELF-TEST
ADVANCED MICROCONTROLLER
OPERATION
TWO LEVELS OF GAS ALARM
INFRARED PRINTER
HIGH OUTPUT AUDIBLE ALARM
BRIGHT, WIDE-ANGLED VISUAL
ALARM LENS
INFRARED DATA PORT
SUPERIOR RFI PROTECTION
RUGGED ENCLOSURE
FULL FUNCTION
AUTOMATIC TEST STATION
Full Information STATUS Panel
O2
max %
Life remaining in
months, days and hours
Locally distributed by:
Advises alarm level
encountered (LOW/HIGH)
Records and displays peak
alarm exposure in past 24 hrs.
Displays alarm
setpoints in ppm or %
www.HSEArya.com
GasAlert
H2S, CO, SO2, CI2, HCN, NO2, NH3, PH3, or O2
Single-Gas Detectors
s
Protect Yourself
Continuous LCD shows real-time gas concentration with
backlight in low light (auto); in alarm (auto) and on demand
Small size (1.1 x 2.0 x 3.75 in. / 28 x 50 x 95 mm) and
lightweight (2.9 oz. / 83 g)
m
o
c
.
a
y
r
A
E
S
X
H
Provides 90 dB tone and bright LED indication on alarm
3-year battery life (9,000 hours)
Available with internal vibrating alarm
Equipped with plug-in, replaceable sensor
Simple auto-zero and calibration procedure
Peak value displayed on command (in ppm or % LEL)
LOW, HIGH, TWA and STEL alarms with adjustable setpoints
TWA (time weighted average) values are recorded and
displayed to evaluate the cumulative exposure danger and to
aid regulatory compliance
Classified intrinsically safe by UL to U.S. and Canadian
standards; Cenelec certified; certified in Australia
Full function self-test of: sensor, battery, circuitry
integrity and audible/visual alarms
Pocket/belt clip, test cap and hose, battery, and instructions
in local languages included
.
w
ACTUAL SIZE
le for
b
a
l
i
Ava
Now and PH 3
NH 3
w
w
j ATEX
g
Plus
Others
Ordering Information
GasAlert Detectors
(Standard)
(with Internal Vibrator Alarm)
GAA-H
H2S
GA-H
H 2S
GA-M
CO
GAA-M
CO
GA-S
SO2
GAA-S
SO2
GA-C
CI2
GAA-C
CI2
GA-Z
HCN
GAA-Z
HCN
GAA-D
NO2
GA-D
NO2
GA-A
NH3
GAA-A
NH3
GA-P
PH3
GAA-P
PH3
GA-2X
O2
GAA-2X
O2
Note: For factory password protect option, add suffix: “-5”
Accessories and spares
GA-HC-1
Hard hat clip
GA-AG-1
Alligator clip
GA-BALERT Concussion-proof boot
GA-VIB3
Remote vibrator arm
GA-HL-R3
Remote audible/visual alarm
GA-SS
Sensor screen (kit of 10)
GALERT-CD1 Training CD
GALERT-VID Training Video (VHS)
GALERT-VID2 Training Video (PAL)
Replacement Sensors
PS-RC10
PS-RH04S
H2S
PS-RM04
CO
PS-RD04
PS-RS04
SO2
PS-RZ10
CI2
NO2
HCN
SR-A04
SR-X10
SR-PO4
www.gasmonitors.com
Email: info@bwtnet.com
Website: www.HSEArya.com
NH3
O2
PH3
www.HSEArya.com
SPECIFICATIONS
GasAlert
DETECTOR:
H2S, CO, SO2, CI2, HCN,
NO2, NH3, PH3 or O2
GasAlert for:
Single-gas detector
Measuring
Range
Single-Gas Detector
Alarm Setpoints1 (Factory defaults are
shown. Alarm levels are field-adjustable.)
TWA Alarm STEL Alarm Low Alarm High Alarm
GasAlert provides extraordinary cost
of ownership advantages. These
include automated calibration,
3-year lithium battery (available
in local stores) and simple, onebutton control. Each of these
features lowers your training and
maintenance costs. Operated by an
advanced microcontroller and an
electrochemical sensor, the GasAlert
is equipped with high output audible/
visual alarms.
.
w
w
s
w
For further information:
1-888-749-8878 America
1-800-663-4164 Canada
+44 (0) 1869 233004 Europe
+971-4-8871766 Middle East
+61-7-3818-8244 Australia
+1-403-248-9226 Other Countries
Corporate Headquarters
2840 - 2 Avenue S.E.
Calgary, AB, Canada T2A 7X9
Phone: +1-403-248-9226
Fax: +1-403-273-3708
E-mail: info@bwtnet.com
www.gasmonitors.com
BW1005-01-01-00-8.25x11-5000-7
0-100 ppm
10 ppm
15 ppm
10 ppm
15 ppm
Sulfur Dioxide (SO2)
Hydrogen Cyanide (HCN)
0-100 ppm
0-30.0 ppm
2 ppm
4.7 ppm
5 ppm
10.0 ppm
2 ppm
4.7 ppm
5 ppm
10.0 ppm
Carbon Monoxide (CO)
0-999 ppm
35 ppm
200 ppm
35 ppm
200 ppm
Chlorine (CI2)
0-50.0 ppm
0.5 ppm
1.0 ppm
0.5 ppm
1.0 ppm
Nitrogen Dioxide (NO2)
0-99.9 ppm
2.0 ppm
5.0 ppm
2.0 ppm
5.0 ppm
Ammonia (NH3)
Oxygen (%by vol.) (O2)
0-100 ppm
0-30.0%
25 ppm
N/A
35 ppm
N/A
25 ppm
19.5 %
50 ppm
23.5%
Phosophine (PH3)
0-5.0 ppm
0.3 ppm
1.0 ppm
1.0 ppm
2.0 ppm
-40 to +50 °C
-40 to +122 °F
-30 to +50 °C
-22 to +122 °F
-20 to +50 °C
-4 to +122 °F
m
o
c
.
a
y
r
A
E
S
H
The bright, large LCD shows
real-time gas concentrations and the
instrument’s status at all times. The
full function self-test verifies sensor,
circuitry and battery integrity and
activates the audible/visual alarms
each time you turn the instrument
on. The detector clearly advises the
gas hazard present—Low, High,
TWA and STEL gas alarm. Recorded
TWA, STEL and Peak exposures can
be displayed on demand.
The compact, rugged GasAlert is
designed with the most advanced
RFI protection available today.
Delivered ready for use, simply clip
the instrument to your pocket, belt or
hard hat for unequalled protection.
Hydrogen Sulfide (H2S)
Operating
Temperature
Auto zero:
Calibration:
Backlight:
Full function self-test:
Sensor:
INDICATORS AND ALARMS:
Visual alarm:
Audible alarm:
Confidence beep:
Other:
Optional internal vibrator:
CONTINUOUS LCD DISPLAY:
Gas ppm or %:
TWA and STEL ppm or %:
Peak ppm or %:
Setpoints:
TESTS:
Full function self-test:
Battery:
GENERAL SPECIFICATIONS:
Humidity:
EMI/RFI:
Battery type:
Battery life:
Size:
Weight:
1
Yes
Automatic
Low light (auto); alarm condition (auto); on demand
Verifies integrity of sensor, circuitry and battery; audible/visual alarms
Plug-in, electrochemical cell (temperature compensated)
Clearly advises alarm levels both visually and audibly
Flashing, wide-angled alarm lens with dual red LEDs, plus alarm LCD readout
High-output, pulsing 90 dB at 1 ft. / 0.3 m (typically)
Every 5 seconds (field-selectable)
Low battery; off warning; sensor fail
Vibrates in sync with audible and visual alarms
Alphanumeric gas readout and status display advises:
Continuously displays gas concentration present
Records and displays on demand
Records and displays peak (maximum) exposure to gas on demand
Displayed on activation (auto) and on demand in ppm or %
Full function self-test on activation (auto)
Continuous (auto)
Impact-resistant ABS enclosure
5% to 95% RH (non-condensing) (15% to 90% non-condensing for PH3 and NH3)
Complies with EMC Directive 89/336/EEC
3-volt lithium (camera battery available locally)
3 years (9,000 hours)
1.1 x 2.0 x 3.75 inches / 28 x 50 x 95 mm
2.9 oz. / 83 g
WARRANTY: 2 years including sensor
The HIGH Alarm and STEL Alarm have the same highest alarm priority. The LOW Alarm overrides the TWA Alarm.
DUE TO ONGOING RESEARCH AND PRODUCT IMPROVEMENT, SPECIFICATIONS ARE SUBJECT TO CHANGE WITHOUT NOTICE.
RATINGS AND CERTIFICATIONS:
(Intrinsic safety)
UL: jClass I, Div. 1, Gr. A, B, C, D
Class I, Zone 0, Gr. IIC
4
1
ATEX: CE g II 2 G
EX Approval: EEx ia d IIC
CE: European Conformity
Australia: AUS Ex ia IIC
1 LARGE, ALPHANUMERIC DISPLAY
2 ADVANCED, MICROCONTROLLER-BASED
OPERATION
3 ELECTROCHEMICAL SENSOR
4 BRIGHT, WIDE-ANGLED, VISUAL
ALARM BAR
5
5 HIGH-OUTPUT, 90 dB AUDIBLE ALARM
3
6 AUTO ZERO
7 AUTO BACKLIGHT
8 LOW, HIGH AND TWA ALARMS
Training CD-ROM
9 RUGGED, COMPACT, LIGHTWEIGHT
9
Full information status panel with easy prompts:
Advises alarm
level encountered
(LOW/HIGH/TWA/STEL)
Auto zero and
Locally distributed by:
easy prompted
calibration
Records and displays
Peak (Max) exposure
LOW battery
www.HSEArya.com
GasAlert LEL
Combustible Gas and Vapors
Combustible Gas Detector
0-100% LEL
s
Protect Yourself
Continuous LCD shows real-time gas concentration with
backlight in low light (auto); in alarm (auto) and on demand
Small size (1.5 x 2.0 x 3.75 in / 38.5 x 50 x 95 mm) and
m
o
c
.
a
y
r
A
E
S
X
H
lightweight (4.6 oz. /131 g)
Provides 90 dB tone and bright LED indication on alarm
Available with internal vibrating alarm
Simple, automatic calibration procedure
Peak value displayed on command in % LEL
LOW and HIGH alarms with adjustable setpoints
Over Limit alarm and sensor protection
User field options include: Pass Code Protection, Latching
High Alarm and Confidence Beep
Equipped with a plug-in replaceable sensor
Powered by a integral rechargeable lithium ion battery
Intrinsically safe to U.S., European and Canadian standards
Full function self-test of: sensor, battery and circuitry
integrity; and audible/visual alarms
Pocket/belt clip, test cap and hose, battery, charger and
instructions in local languages included
.
w
ACTUAL SIZE
w
w
j ATEX
g
Plus
Others
ISO 9001
Ordering Information
GA-W
GasAlert LEL 0-100% LEL detector
GAA-W
GasAlert LEL detector with internal vibrator alarm
Note: Add suffix for delivery with 220 VAC charger:
Europe: -EU
United Kingdom: -UK
Australia: -AU
Accessories and Spares
GA-HC-1
Hard hat clip
GA-AG-1
Alligator clip (non-conductive ABS)
GA-AG-2
Alligator clip (high-tension metal)
GA-BALERT2
Shock resistant boot
GA-NS-1
Neckstrap
GA-SPAK
SamplerPak motorized sampling pump kit
CG2-J-2.5-34
Methane calibration gas cylinder (34 L)
CG2-R-1.0-34
Propane calibration gas cylinder (34 L)
CG2-K-0.75-34
Pentane calibration gas cylinder (34 L)
D4-RW90
Replacement LEL (0-100%) sensor
GA-CO2
Charger with 110 VAC mains plug
GA-W-CD1
Training CD
Note: Add suffix for delivery with 220 VAC charger:
Europe: -EU
United Kingdom: -UK
Australia: -AU
Website: www.HSEArya.com
Tel: +9821-55425307
Email: info@HSEArya.com
www.gasmonitors.com
Email: info@bwtnet.com
www.HSEArya.com
SPECIFICATIONS
GasAlert LEL
DETECTOR:
0-100% LEL
Single-gas detector
Measuring
Range
GasAlert LEL:
Single-Gas Detector
Combustible Gases/Vapors:
GasAlert LEL provides extraordinary
cost of ownership advantages. These
include automated calibration, and
simple one-button control. Each of
these features lowers your training
and maintenance costs. GasAlert
LEL is operated by an advanced
microcontroller and is equipped with
a plug-in, poison resistant catalytic
bead sensor and high output audible/
visual alarms.
Auto zero:
Calibration:
Backlight:
Full function self-test:
Sensor:
IINDICATORS AND ALARMS:
Visual alarm:
Audible alarm:
Over limit alarm:
User field options:
Confidence beep:
Other:
Optional internal vibrator:
CONTINUOUS LCD DISPLAY:
Gas %:
Peak %:
Setpoints:
TESTS:
Full function self-test:
Battery:
GENERAL SPECIFICATIONS:
Operating temperature
Humidity:
EMI/RFI:
Battery Type:
Battery Life:
Size:
Weight:
WARRANTY:
The bright, large LCD shows
real-time gas concentrations and the
instrument’s status at all times. The
full function self-test verifies sensor,
circuitry and battery integrity and
activates the audible/visual alarms
each time you turn the instrument on.
The detector clearly advises the gas
hazard present—Low and High gas
alarms. Recorded Peak exposures
can be displayed on demand.
1
For further information:
Website: www.HSEArya.com
Tel: +9821-55425307
Email: info@HSEArya.com
Telegram ID: @HSEArya_PPE
Instagram ID: @HSEAryaPPE
E-mail: info@bwtnet.com
www.gasmonitors.com
BW1005-01-01-00-8.25x11-5006-3
High Level
20% LEL
Over Range
100% LEL
Yes
Automatic
Low light (auto); alarm condition (auto); on demand
Verifies integrity of sensor, circuitry and battery; audible/visual alarms
Catalytic bead. Poison resistant (equipped with filters to eliminate the poisoning
effects of silicone vapors and sulfur compounds).
Clearly advises alarm levels both visually and audibly
Wide-angled alarm lens, plus alarm LCD readout
High-output, pulsing 90 dB at 1 ft. / 0.3m
Latching alarm at 100% LEL
Pass Code Protection, Latching High Alarm and Confidence Beep
Every 5 seconds (field-selectable)
Low battery; off warning; sensor fail
Vibrates in sync with audible and visual alarms
Alphanumeric gas readout and status display advises:
Continuously displays gas concentration present
Records and displays peak (maximum) exposure to gas on demand
Displayed on activation (auto) and on demand in %
Full function self-test on activation (auto)
Continuous (auto)
Shock-resistant ABS enclosure
-25 to -45 °C / -13 to +114 °F
5% to 95% RH (non-condensing)
Complies with EMC Directive 89/336/EEC
Rechargeable integral lithium ion
Up to 14 hours per charge; 500 to 600 charges
1.5 x 2.0 x 3.75 inches / 38.5 x 50 x 95 mm
4.3 oz. / 131 g
2 years
DUE TO ONGOING RESEARCH AND PRODUCT IMPROVEMENT, SPECIFICATIONS ARE SUBJECT TO CHANGE WITHOUT NOTICE.
RATINGS AND CERTIFICATIONS:
(Intrinsic safety)
UL: Class I, Div. 1, Gr. A, B, C, D
Class I, Zone 0, Gr. IIC
BAM: EN 50054, EN 50057
ATEX: CE g II 2 G
EX Approval: EEx ia d IIC
CE: European Confirmity
4
1 LARGE, ALPHANUMERIC DISPLAY
1
2 ADVANCED MICROCONTROLLER-BASED
OPERATION
3 CATALYTIC SENSOR
9
5
4 BRIGHT, WIDE-ANGLED VISUAL
ALARM LENS
5 HIGH-OUTPUT 90 dB AUDIBLE ALARM
6 AUTO ZERO, AUTO CALIBRATION
3
10
7 AUTO BACKLIGHT
8 LOW, HIGH AND OVER RANGE ALARMS
9 ALARM ACKNOWLEDGE FEATURE
Full Information STATUS Panel with easy prompts:
Advises Alarm
Level encountered
(LOW/HIGH)
Auto zero and
Locally distributed by:
Corporate Headquarters
2840 - 2 Avenue S.E.
Calgary, AB, Canada T2A 7X9
Phone: +1-403-248-9226
Fax: +1-403-273-3708
10% LEL
1
Factory defaults are shown. Alarm levels are field adjustable.
.
w
w
s
w
Low Level
m
o
c
.
a
y
r
A
E
S
H
The Over Limit alarm is latching and
must be acknowledged by the user to
shut it OFF. User field options include
Pass Code Protection, Latching High
Alarm and Confidence Beep.
The compact, rugged GasAlert LEL
is designed with the most advanced
RFI protection available today.
Delivered ready for use, simply clip
the instrument to your pocket or belt
for unequalled protection.
0-100%LEL
Alarms
1
easy prompted
calibration
10 RUGGED, COMPACT, LIGHTWEIGHT
Records and displays
Peak (Max) exposure
LOW battery
www.HSEArya.com
Introducing
GasAlertMicro
H2S, CO, O2 and Combustibles
Multi-Gas Detector
m
o
c
.
a
y
r
A
E
S
H
w
w
.
w
www.HSEArya.com
onitors.com
@bwtnet.com
www.HSEArya.com
GasAlertMicro
Multi-Gas Detector
Just as cell phones and palm pilots have become smaller, smarter and more affordable, BW Technologies has used
the same principles to bring portable gas detection into the 21st century. GasAlertMicro, the new safety leader, is
designed with cutting-edge technology, ensuring field-friendly operation and a lower cost of ownership.
The GasAlertMicro multi-gas detector monitors for 2, 3 or 4 hazardous gases simultaneously and continuously—
combustibles, oxygen (deficiency/enrichment), hydrogen sulfide and carbon monoxide.
m
o
c
.
a
y
r
A
E
S
H
Smaller
Triple Alarm System
Dual visual alarm bars
High-output 95 dB audible
Internal vibrator alarm for high
noise areas
weighs only 7.4 oz. / 211 g and
fits in the palm on your hand
High-performance
plug-in sensors
Peak Values on Command
Tougher
Equipped with integral concussionproof boot for use in the most rugged
environments
records and displays exposures
encountered:
TWA (time-weighted average)
STEL (short-term exposure levels)
Maximum Gas Exposures
Backlight Auto and On Demand
Single pushbutton operation
.
w
Advanced micro-controller
operation
Large High Contrast LCD
w
w
shows real-time gas concentrations
simultaneously and continuously
Power Choices
Low light—auto
Alarm condition—auto
On demand
Field Select to Measure
combustible gas
0–100% LEL or
0–5.0% methane
ACTUAL SIZE
Datalogger Models include
32 MB flash MMC data storage card
AA alkaline disposable cells standard ( 18 hours)
Optional rechargeable NiMH batteries ( 16 hours)
available at local stores
UNOBTRUSIVE AND CONVENIENT
Simply press to release the lock
and slide open the battery drawer
for easy field replacement.
Take the Work Out of Datalogging
With automatic data storage no training is
required for operation or data retrieval.
Data is stored on a digital flash MultiMediaCard (32 MB
standard). A warning advises if the card is not present.
Wraparound memory ensures recent data is always saved.
Data storage capacity is extraordinary. Store over 4 months
of data given a 5 second recording interval and a 32 MB
card. Set the recording interval anywhere from 1 second
to 127 seconds per record, as desired.
Using the GasAlertMicro free E.D.M.
(Excel Datalog Manager) simplifies data
management. Create reports, sort, format
and graph data automatically. View history,
calculate exposures and archive easily.
www.HSEArya.com
- Larger, User Friendly LCD The high-definition alphanumeric display shows all current
conditions and advises when automatic functions take place.
Never fear in the dark—the backlight illuminates automatically in
low light conditions and in all alarm conditions.
STATUS at a Glance: Information and guidance is
provided quickly and clearly.
Alarm Advise Alarm icons light to advise
the alarm level and type: instant LOW,
instant HIGH, STEL (short-term exposure
level) and TWA (time-weighted average).
- Auto ON Functions Ensuring the instrument is ready for use,
GasAlertMicro tests all features and functions each
time it is turned on. Sensors and circuitry integrity
are also tested. Current alarm setpoints are
displayed, the oxygen sensor is calibrated and
all display elements and alarms are activated.
Datalogger models display the time and date. You
are also advised when the next calibration is due.
Automatic Calibration Auto zero the
sensors at any time. Calibrate one or all
four sensors, simply apply gas when the
flashing Auto Span icon lights.
Power Continually tested, the low battery
alarm advises when power is low.
m
o
c
.
a
y
r
A
E
S
H
Pass Code Protection for calibration and
alarm setpoints and calibration due date.
- Automatic Sensor Calibration -
Auto zero the sensors, at any time, without calibration gas.
Calibrate one or all four sensors automatically, simply apply
gas. GasAlertMicro tests the gas applied. If the gas does not
meet expected parameters, GasAlertMicro exits calibration
mode, preventing improper calibration. All previous data is
retained.
- Additional Features and Functions -
Four levels of alarm: instant LOW, instant HIGH,
TWA and STEL.
Low Battery Warning provides a 30 minute alert.
GasAlertMicro cannot be accidentally shut OFF.
Automatic shutdown prevents unsafe usage.
- User Field Options -
Defective or missing sensor alarm.
GasAlertMicro provides the flexibility you require.
Confidence Beep
Pass Code Protection—restricts access
to user options menu, calibration, alarm
setpoint and calibration due functions.
Safe Display Mode
Latched Gas Alarms—sound until
acknowledged.
Combustibles Selection—select to measure
0-100% LEL or methane 0-5.0% v/v.
Set Calibration Due Date
.
w
DATALOGGER MODELS
Real-time Clock/Calendar—Set time and date.
Sampling Interval—Set from 1 to 127 seconds.
w
w
Rechargeable
Power
- Tough, Durable Construction -
The compact, lightweight GasAlertMicro fits in the palm of your
hand. Water and dust resistant, the GasAlertMicro is designed
to withstand a 6 ft. / 2 m drop test, allowing it to perform in the
most adverse environments.
- More for Less -
GasAlertMicro provides the most advanced safety protection
and the best value in a multi-gas detector on the market today.
- Affordable -
User friendly operation results in lower training, operating and
maintenance costs. Coupled with the low purchase price,
this advantage makes the GasAlertMicro the most affordable
industrial multi-gas detector.
Accessories, Options and Spares — the right tool is available for the job
Support
Materials
Calibration
Equipment
Confined
Space Kits
SamplerPak Kits
Training CD
Sampling
Options
VAC and VDC
Vehicle Kits
Over Limit alarm and Multi-gas alarm protection.
Datalogger
Accessories
Quad Gas Kits
Cylinders
Bump Test Gas
User Manuals in
local languages
Aspirator Pump
10 ft. / 3 m Hose
64/128 MB MMC
The Sampler
motorized pump
Card Readers
Confined Space Kits
with Sampler
www.HSEArya.com
GasAlertMicro
H2S, CO, O2
and Combustibles
SPECIFICATIONS
Detector:
Multi-Gas Detector
Auto zero:
Calibration:
Backlight:
Sensors:
Field options:
RATINGS AND CERTIFICATIONS:
(Intrinsic safety)
ALARMS INDICATORS:
Classified to US and Canadian
Standards by CSA:
Class I, Div. 1, Groups A, B, C, D
Class I, Zone 0, Gr. IIC
Visual alarms:
Audible alarm:
Vibrator alarm:
Combustible Gas Performance
Certified to:
ANSI/ISA-S12.13
CSA C22.2 No.152
ALARM LEVELS/TYPES:
2, 3 or 4-gas detectors
Yes
Automatic
Low light (auto); alarm conditions (auto) and on demand
Plug-in electrochemical cells (H2S/CO TWIN TOX, O2); catalytic bead (LEL)
Confidence beep, pass code protection, latching alarms, calibration due date,
"SAFE" display function, combustibles selection, sensor enable/disable.
-DL2 models only: set real-time clock and calendar, sampling rate
Clearly advises alarm levels both audibly and visually
Two flashing alarm bars visible from all angles
LCD advises gas present and alarm level encountered
High output, variable pulsed dual beepers 95 dB at 1 ft. / 0.3 m
Pulses warning in all gas alarm conditions and status alarms
All gases: Instant Low; Instant High
Toxic Gases (H2S and/or CO): TWA (time-weighted average) and
STEL (short-term exposure level).
Low battery and missing sensor alarms
m
o
c
.
a
y
r
A
E
S
H
Other alarms:
LCD DISPLAY:
Gases monitored:
TWA and STEL ppm:
Peak ppm, %LEL or % v/v:
Setpoints:
ATEX Certified
ABS
Large, continuous, alphanumeric gas readout and status display
H2S (0-100 ppm range); CO (0-500 ppm range); O2, (0-25% v/v range);
combustibles (0-100% LEL or 0-5.0% v/v methane)
Records STEL and TWA exposures and displays readings on demand
Records peak exposure to gas and displays on demand
Displayed on activation (auto)
TESTS
Full function self-test:
Australian approval pending
Battery:
GENERAL SPECIFICATIONS:
Operating temperature:
Humidity:
EMI/RFI:
Battery run time:
Size:
Weight:
WARRANTY:
DATALOGGER OPTION:
Data recorded:
Sampling rate:
.
w
w
w
For further information:
Website: www.HSEArya.com
Tel: +9821-55425307
Email: info@HSEArya.com
Telegram ID: @HSEArya_PPE
Instagram ID: @HSEAryaPPE
Corporate Headquarters
Tel: +1-403-248-9226
Fax: +1-403-273-3708
2840 - 2 Avenue S.E.
Calgary, AB, Canada T2A 7X9
Storage capacity:
Memory type:
Software Required:
On activation (auto) verifies: sensor and circuitry integrity and
activates audible/visual/vibrator alarms
Continuous (auto)
Rugged, composite material with integral concussion-proof boot
-4 to +122 °F / -20 to +50 °C
5% to 95% RH (non-condensing)
Complies with EMC Directive 89/336/EEC
16 to 18 hours on two AA alkaline batteries
14 to 16 hours on two NiMH rechargeable batteries
2.4 x 4 x 1.3 inches / 6 x 10 x 3.3 cm
7.4 oz. / 211 g
Full 2-year warranty including all sensors
User downloadable datalogger
All events and occurrences
Field-settable sampling intervals from 1 to 127 seconds
(factory set at 5 second sampling intervals)
500,000 records (4.4 months given sample rate of 5 seconds and 32 MB MMC)
Wraparound memory ensures most recent data is saved
Standard office spreadsheet programs (Excel™, Access etc.)
DUE TO ONGOING RESEARCH AND PRODUCT IMPROVEMENT, SPECIFICATIONS ARE SUBJECT TO CHANGE WITHOUT NOTICE.
Ordering Information: GasAlertMicro is delivered—ready for use—with:
sensors, two AA alkaline batteries, stainless steel alligator belt clip, calibration cap with hose and instructions.
Gas Detector in Safety Yellow
GAMIC-4
4-gas: H2S, CO, O2, LEL
GAMIC-3H
3-gas: H2S, O2, LEL
GAMIC-3M
3-gas: CO, O2, LEL
GAMIC-3S
3-gas: SO2, O2, LEL
GAMIC-2
2-gas: O2, LEL
GAMIC-2HW
2-gas: H2S, LEL
Also available in black
Detectors with User Downloadable Datalogger
Includes 32 MB MMC Flash memory card and free
software. Add suffix "-DL2 "
Value Added Confined Space Kits
In addition to the above, kits include a hard-sided
carrying case, 10 ft. / 3 m sampling hose, 4-port charger,
4 NiMH batteries, 34 liter calibration gas cylinder
and regulator.
with The Sampler motorized sampling pump
GAMIC-4-CK-SP with 4-gas detector
GAMIC-4-CK2-SP with 4-gas datalogging detector
with the manual aspirator sampling pump
GAMIC-4-CK
with 4-gas detector
GAMIC-4-CK2
with 4-gas datalogging detector
Locally Distributed By:
GasAlertMicro SamplerPak
Includes standard accessories and the SamplerPak.
The SamplerPak includes the Sampler (external motorized
sampling pump), sampling hoses, sampling tubes and
a carrying case.
GAMIC-4-SK
with 4-gas detector
GAMIC-4-SKC with 4-gas detector and charger kit
Accessories
GAMIC-C01-K
Four NiMH rechargeable batteries
with 4-port charger kit
D4-AS01
Aspirator pump with 10 ft. / 3 m hose
GA-SPAK
Sampler motorized sampling pump kit
MMC64
64 MB MultiMediaCard (MMC)
CR-MMC-USB1 MMC reader (USB port)
GAMIC-CD1
Training video on CD-ROM
Calibration Equipment
CG-Q58
Quad calibration gas 58 L
CG-Q34
Quad calibration gas 34 L
CG-BUMP1
Alarm test gas 11 L
CK-Q58
Calibration kit with 58 L gas
CK-Q34
Calibration kit with 34 L gas
www.HSEArya.com
GASALERTMAX
H2S, CO, O2 and %LEL
Multi-Gas Detector
m
o
c
.
a
y
r
A
E
S
H
w
w
.
w
AC
TU
AL
SIZ
E
n g X ATEX
Plus
Others
ISO 9001
www.gasmonitors.com
Email: info@bwtnet.com
www.HSEArya.com
www.HSEArya.com
GASALERTMAX
Multi-Gas Detector
BW Technologies’ GasAlertMax multi-gas detector with optional datalogging monitors for 2, 3, or 4 hazardous gases
simultaneously and continuously: combustibles, oxygen (deficiency/enrichment), carbon monoxide and hydrogen sulfide.
The GasAlertMax is the new benchmark in gas detection, setting the standards for ease of use, reliability and effective
protection, using forefront microcontroller and sensor technology.
Wide-angled
visual alarm bar,
visible from all angles
m
o
c
.
a
y
r
A
E
S
H
Plug-in
sampling pump
and sensor
Rugged
ergonomically designed enclosure
Backlight Auto and On Demand
Low light conditions - auto
Alarm condition - auto
On demand
Large, high-contrast LCD
shows real-time gas concentrations
for H2S, CO, O2 and %LEL
Peak values on command
records and displays exposures
encountered
TWA (Time Weighted Average)
Maximum gas exposures
Advanced
microcontroller-based operation
.
w
Single pushbutton operation
w
w
Datalogger options
two versions to choose from
Black Box
User-downloadable
High-Output
95 dB audible alarm
New technology provides the
best RFI protection available today
Compact
weighs only 15.4 oz. (369 g)
including the battery
Power
BLACK & DECKER VERSAPAK™
rechargeable battery available worldwide
CONVENIENCE and SAFETY:
The VERSAPAK™ battery is
easy to replace and provides
up to 14 hours of operation.
ACTUAL SIZE
UNOBTRUSIVE and SIMPLE:
Plug-in sampling pump and
sensors housed in a separate
compartment are easily
changed in the field.
www.HSEArya.com
The compact, lightweight GasAlertMax fits in the palm of your
hand. The intuitive detector is designed with automatic features and
functions.
- Larger, User-Friendly LCD GasAlertMax is equipped with a high-definition LCD. The display
shows all current conditions and advises the user when automatic
functions are taking place. The alphanumeric LCD keeps you advised
of any gas hazard present. The backlight illuminates automatically
in low light conditions and in all alarm conditions. The backlight also
activates on demand.
- Audible/Visual Gas Alarms Audible (95 dB) alarms and visual alarms activate, ensuring
maximum protection. Visual alarms feature the unique wideangled alarm bar and flashing screen icons that advise alarm
level and type (LOW - TWA - HIGH - Multiple Gas). The LCD
gas icon flashes to advises which gas hazard is present.
Status at a Glance: Information and guidance is
provided clearly and quickly by the GasAlertMax:
Alarm Advice: The alarm icons will
light to advise the gas level and alarm
type encountered: LOW, HIGH or TWA
gas alarms.
A TWA alarm overrides a LOW alarm,
and a HIGH alarm overrides a TWA
alarm.
Battery Level: The battery condition is
continuously tested and displayed.
Datalogging Advice: The data card
icon lights if the data card is present
and functioning.
m
o
c
.
a
y
r
A
E
S
H
In Low Alarm, the audible
alarm sounds in a slow
repeating pattern and the
visual alarm LEDs flash in
sync.
Auto Pump Re-Calibration: Sampling
pump calibration is automatic.
- Additional Features and Functions Two (2) levels of alarm for each gas sensed.
TWA (Time Weighted
Average) and High Alarm
conditions feature urgent,
rapid audible/visual patterns.
Alarm levels are field-settable.
Low battery warning provides a 30-minute alert.
GasAlertMax cannot be accidentally shut off.
Missing sensor alarm advises which sensor is missing.
LEL sensor over range alarm protection.
Gas alarms take priority over all other alarms.
2-year warranty on all sensors.
- Auto ON Functions -
GasAlertMax tests all features and functions each time it is turned on,
ensuring the instrument is ready for use.
The sensors, battery and data card are tested.
The oxygen sensor is calibrated
automatically.
Current alarm setpoints are displayed.
All display elements, the backlight
and audible/visual alarms are
activated.
Current time, day and date are
displayed on user-downloadable
datalogger models (-DL2).
.
w
w
w
- Automatic Sensor Calibration -
Auto zero the sensors, at any time, without
calibration gas. Calibrate one or all four
sensors automatically. Simply apply gas when
the flashing Auto Span icon lights.
GasAlertMax tests the calibration gas applied.
If the calibration gas does not meet expected
parameters, the instrument exits Calibration
Mode to prevent improper calibration. All the
previous calibration data is retained.
- Lower Capital, Training, Maintenance Costs -
As we all know, cell phones, computers and palm pilots
have become smaller, smarter and more affordable. BW
Technologies has introduced the same technological advances
into the GasAlertMax. Cutting-edge technology in sensors,
microcontrollers, program features and fiber optics result in a
more compact, affordable and easy-to-use safety instrument.
- User Field Options -
Select any or all of the following:
Confidence Beep - the detector beeps
every 5 seconds when selected on start-up.
Pass Code Protection - restricts
access to calibration and alarm
setpoints functions.
Latched Gas Alarms - Audible/
Visual Alarms will continue to sound
until the alarm is acknowledged.
Change Time and Date - change the time and date on
user-downloadable detectors (-DL2) in the field if required.
- Field Upgrade - High-Efficiency Sampling Pump GasAlertMax is equipped with a high-efficiency, motorized sampling
pump. The rotary vane design provides the benefits of a small turbine
- greater reliability with less friction - and the pump is not pressure
sensitive. The detector will automatically advise if the pump or
sampling hose is blocked.
If requirements change, 2 and 3-gas detectors can be
upgraded in the field to a 3 and/or 4-gas detector by adding a
sensor.
www.HSEArya.com
The right tool is available for the job.
Confined Space Kits
Kits include: GasAlertMax, charger, VERSAPAK™
batteries, plus concussion-proof carrying boot
10 ft. (3 m) sampling hose, calibration hose, filter kit,
34 liter calibration gas cylinder, and regulator in a hardsided carrying case with instructions in local languages.
GAMAX3-4-CK
GAMAX3-3H-CK
GAMAX3-2-CK
4-gas detector: H2S, CO, O2, LEL
3-gas detector: H2S, O2, LEL
2-gas detector: O2, LEL
With a Black Box Datalogger Detector
Change suffix:
“-CK” to “-CK1”
With a User Downloadable Datalogger Detector
Change suffix:
“-CK” to “-CK2”
To include a 230 VAC charger specify version.
Add suffix:
“-UK” (United Kingdom); “-EU” (Europe);
“-AU” (Australia); “-NZ” (New Zealand);
“-OR” (Other Countries)
m
o
c
.
a
y
r
A
E
S
H
Carrying Cases
Hands-free operation with durable cases to
suit your work environment.
GA-HMAX
Holster with belt loop
Concussion-proof boots
GA-BMAX
Boot with alligator belt clip
GA-BMAX-3
Boot with neck strap
GA-BMAX-4
Boot with neck and waist straps
Remote Sampling Accessories
Sampling hoses and probes are equipped with a quick
connect for easy field use.
D4-PROB1
D4-PROB3
External Alarms
The external vibrator alarm provides warning in high
noise areas.
D4-VIB3
D4-HL-R3
w
w
.
w
Batteries and Fast Chargers
2-port 12 volt vehicle charger
110 VAC charger
230 VAC charger c/w UK plug
“-EU” (Europe); “-AU” (Australia)
NiMH Battery
NiCd Battery
Both datalogger versions are equipped with a
MMC “Flash” memory card.
MMC32
CR-MMC-USB1
CR-MMC-FD1
GAMAX-EDM1
Calibration Gases and Kits
Remote vibrator alarm
Remote audible/visual alarm
GasAlertMax includes 2 VERSAPAK™ Batteries and
a 2-port BLACK & DECKER VAC charger
.
A vehicle charger is available.
V-CHRG1
D4-VP130
D4-VP130-UK
Mains plugs for:
D4-VP110
D4-VP100
Datalogger Options
1 ft. (0.3 m) sampling probe
3 ft. (1 m) sampling probe
32 MB MultiMediaCard (MMC)
USB card reader
Floppy disk card reader for use with
all computers (PCs /Laptops)
Excel Data Management (E.D.M.) program
Quality test gases are made to the highest accuracy
and traceability to N.I.S.T. standards.
BW kits and gas cylinders are available in 2 and
4-gas mixtures. “Bump” test gas comes with the
balloon adaptor.
www.HSEArya.com
The New Era in Datalogging
GasAlertMax datalogging detectors combine advanced
features and functions with ease of use, incorporating the
new Flash MultiMediaCard technology that is used in digital
cameras and MP3 players.
Wrap-around memory ensures the latest
information is always available
Automatic operation
High-density Flash MultiMediaCards
Two datalogging versions to choose from:
Black Box Datalogger
In event of an occurence or incident, event information and
historical data is retrieved by an authorized factory service
center.
New Datalogger Technology Advantages
Extraordinary Capacity: Over 4 months of
logged data (recorded at 5-second intervals) for all
4 sensors using the standard 32 MB high-density
Flash MultiMediaCard (included). Information
storage is scalable (up to one year) based on
logging intervals and card capacity
(64 MB cards available).
All Events and Occurrences are recorded. All
information including: sensor readings, alarm
setpoints, all alarm conditions, TWA and Peak
exposures, calibrations, pump operation, event
flags, instrument status and serial number with
time and date are recorded.
m
o
c
.
a
y
r
A
E
S
H
Operation is invisible, requiring no user intervention
Tamperproof
Continuous datalogging while the instrument is operating
Data card icon on the LCD confirms the datalogger is
operating and functioning normally
User Friendly: With automatic storage, no
training is required for operation or data retrieval.
User-Downloadable Datalogger
Data management is easier than ever before with
GasAlertMax3-DL2 user-downloadable models.
Off-the-shelf card readers provide convenient and fiexible
data transfer to desktop or laptop computers (Windows
95 or higher)
Simple MultiMediaCard
Installation.
Use standard office database or spreadsheet software
(Excel, Access etc.) to view the data
Seamless downloading in the field or office using USB
port, or floppy disk reader
Downloading and Data Analysis Made Easy with E.D.M.
Use BW Technologies’ free E.D.M. (Excel™ Datalog
Manager) to take the work out of data management.
.
w
Create reports automatically
Sort, format and graph data automatically
View history
Calculate exposures
Real-time trending
Archive easily
w
w
Browse and click in E.D.M. to
select worksheets, report types
and styles, color-coding, data
filtering and automatic charting.
www.HSEArya.com
SPECIFICATIONS
GasAlertMax
DETECTOR:
H2S, CO, O2 and LEL
Multi-Gas Detector with
Internal Sampling Pump
Gas:
RATINGS AND CERTIFICATIONS:
(Intrinsic safety)
Classified the US and Canadian
Standards by CSA:
Class I, Div. 1, Groups A, B, C, D
Class I, Zone 0, Gr. IIC
132 oC ambient 50 oC
CE Declared for European Conformity
Australia
Combustible Gas Performance
Certified to:
ANSI/ISA-S12.13
CSA C22.2 No. 152
CO
O2 (% by vol.)
0 - 100 ppm
0 - 500 ppm
0 - 30.0%
0 - 100% LEL
1
Low Alarm Level :
10 ppm
35 ppm
19.5%
10%
1
TWA alarm level :
10 ppm
35 ppm
N/A
N/A
1
High alarm level :
15 ppm
200 ppm
23.5%
20%
Auto Zero:
Calibration:
Backlight:
Full function self-test:
Sensor:
Sampling pump:
User field options:
Yes
Automatic
Low light (auto) alarm conditions (auto) and on demand
Verifies: integrity of sensor, battery and circuitry; audible/visual alarms
Plug-in, electrochemical cells (H2S/CO TWIN TOX, O2); catalytic bead (LEL)
250 ml/min
Confidence Beep, Pass Code Protection, Latching Alarms, Sensor Disable.
-DL2 models only: field-settable real-time clock and calender
INDICATORS AND ALARMS:
Clearly advises alarm levels both visually and audibly
Flashing, wide-angled alarm lens with dual red LEDs plus alarm LCD readout
High-output, variable, pulsing siren 95 dB at 1 ft. (0.3 m)
Low battery, Off warning, Sensor fail, Multiple gas hazard, Data card fail
Accepts vibrating alarm, remote audible/visual alarm (110 dB) or earphone
Visual gas alarm:
Audible gas alarm:
Other:
Remote jack:
LCD DISPLAY:
Gases monitored:
Gas ppm or %:
TWA ppm or %:
Peak ppm or %:
Setpoints:
TESTS:
Self-test:
Battery:
EMI/RFI:
Complies with EMC Directive 89/336/EEC
GENERAL SPECIFICATIONS:
Operating temperature:
Humidity:
Battery:
Battery life:
Size:
Weight:
WARRANTY:
DATALOGGER OPTIONS:
Data recorded:
Sampling rate:
Storage:
.
w
For Further Information:
1-888-749-8878 USA
1-800-663-4164 Canada
+44 (0) 1869-233004 Europe
+(971) 4 8871766 Middle East
+1-403-248-9226 Other Countries
Corporate Headquarters
2840 - 2 Avenue S.E.
Calgary, AB, Canada T2A 7X9
Fax: +1-403-273-3708
E-mail: info@bwtnet.com
www.gasmonitors.com
BW1009-01-01-00-8.25x11-123-2
Combustibles
H2S
Measuring Range:
m
o
c
.
a
y
r
A
E
S
H
ATEX Certified:
EEx ia d IIC ATEX g II 2G
184 oC ambient 50 oC
w
w
2, 3 and 4-gas detectors
Continuous, alphanumeric gas readout and status display
H2S, CO, O2 and LEL
Simultaneously and continuously displays gas concentrations present
Records and displays TWA exposure(s) on demand
Records and displays peak exposure to gas and on demand
Displayed on activation (auto) and on demand in ppm or %
Full function self-test on activation (auto)
Continuous (auto)
Shock-resistant ABS enclosure
-20 to +50°C (-4 to +122°F)
5% to 95% RH (non-condensing)
TM
One 3.6 volt Black & Decker VersaPak rechargeable cell
NiMH up to 12 hours operation; NiCd up to 8 hours operation
1.6 x 3.0 x 5.9 inches (40 x 75 x 150 mm)
15.4 oz. (396 g)
2 years including sensors
All events and occurrences
One reading every 5 seconds (standard)
Over 4 months (based on a normal workweek). Scalable up to one year.
32 MB Flash MMC (MultiMediaCard) standard
1Alarm levels are field-settable. Factory defaults are shown are for US and Canada. Defaults will vary by country and region.
HIGH alarm takes precedence over TWA alarm. TWA alarm takes precedence over LOW alarm.
DUE TO ONGOING RESEARCH AND PRODUCT IMPROVEMENT, SPECIFICATIONS ARE SUBJECT TO CHANGE WITHOUT NOTICE.
Ordering Information: GasAlertMax is delivered complete, ready for use with
sensors, internal sampling pump, datalogger, BLACK & DECKER 110 VAC 2-port charger, two VERSAPAK™
batteries, 10 ft. (3 m) sampling hose, carrying holster, cal hose, filter kit and instructions in local languages.
Gas Detectors (Standard)
GAMAX3-4
4-gas: H2S, CO, O2, LEL
GAMAX3-3H
3-gas: H2S, O2, LEL
GAMAX3-2
2-gas: O2, LEL
Gas Detectors with Black Box Datalogger
GAMAX3-4-DL1
4-gas detector
GAMAX3-3H-DL1
3-gas detector
GAMAX3-2-DL1
2-gas detector
Gas Detectors with User Downloadable Datalogger
Comes c/w free software and 32 MB MMC Card
GAMAX3-4-DL2
4-gas detector
GAMAX3-3H-DL2
3-gas detector
GAMAX3-2-DL2
2-gas detector
Add suffix for delivery with 230 VAC charger
Add suffix:
-EU (European version)
-UK (United Kingdom version)
-AU (Australian version)
-NZ (New Zealand version)
-OR (Other Regions)
Add suffix:
-A (to omit VAC charger and batteries)
Locally Distributed By:
Calibration Equipment
Kits come complete with regulator, cal hose in carrying case
For 4 and 3-gas detectors (LEL, O2, H2S, CO)
CK-Q34
4-gas kit with 34L cylinder
CK-Q58
4-gas kit with 58L cylinder
CG-Q34
Quad gas 34L cylinder
CG-Q58
Quad gas 58L cylinder
CG-BUMP1 Alarm test gas 11L
REG-0.5
0.5 LPM Regulator included in kits
For 2-gas detectors (%LEL, O2)
CK-T34
2-gas kit with 34L cylinder
CG-T34
2-gas 34L cylinder
REG2-0.5
Regulator included in 2-gas kits
Sensor Replacements
D4-RW90
Combustible (0-100% LEL)
SR-X10
Oxygen (O2)
D4-RHM04
TWIN TOX (CO, H2S)
PS-RH04S
H2S (-3H versions)
www.HSEArya.com
Value Added
Confined Space Kit
GasAlertMicro
s
Protect Yourself
The presence of hazardous atmosphere is a major threat
to workers in confined spaces. Precautions are required
to protect workers from flammable or toxic atmospheric
hazards and oxygen depletion/enrichment conditions.
m
o
c
.
a
y
r
A
E
S
n
H
The GasAlertMicro Confined Space Kit includes
everything you need to safely enter a confined space.
GasAlertMicro multi-gas detector
The Sampler motorized sampling pump or manual
aspirator pump
10 ft. / 3.3 m sampling hose
4-port charger kit with rechargeable NiMH batteries
Quad calibration gas (34 L) and regulator
Calibration hose
Support CD-ROM with instruction manuals,
quick reference cards, training video, and
datalogging software
Hard-sided carrying case with removable
shoulder strap
.
w
w
w
Motorized Sampling
Pump Kit
Ordering Information
Confined Space Kits with the Sampler external
motorized sampling pump
GAMIC-4-CK-SP
GAMIC-4-CK2-SP
Confined Space Kit with 4-gas detector
Confined Space Kit with 4-gas detector
and user downloadable datalogger
Confined Space Kits with manual aspirator
pump
GAMIC-4-CK
GAMIC-4-CK2
Add suffix for delivery in:
Confined Space Kit with 4-gas detector
Confined Space Kit with 4-gas detector
and user downloadable datalogger
Europe: -EU
United Kingdom: -UK
For further information:
1-888-749-8878 America
1-800-663-4164 Canada
+44 (0) 1869 233004 Europe
+971-4-8871766 Middle East
+61-7-3818-8244 Australia
+1-403-248-9226 Other Countries
Fax: +1-403-273-3708
Manual Aspirator Kit
www.gasmonitors.com
Email: info@bwtnet.com
www.HSEArya.com
Australia: -AU
www.HSEArya.com
s
Value Added
Confined Space Kit
GasAlertMax
Protect Yourself
The presence of a hazardous atmosphere is a major threat
to workers in confined spaces. Precautions are required
to protect workers from flammable or toxic atmospheric
hazards and oxygen depletion or enrichment conditions.
m
o
c
.
a
y
r
A
E
S
H nX
The GasAlertMax Confined Space Kit includes
everything you need to safely enter a confined space.
GasAlertMax multi-gas detector with built-in
motorized sampling pump
10 ft. / 3.3 m sampling hose with quick connector
Concussion-proof boot
Black & Decker fast charger (holds two batteries)
Two VERSAPAKTM rechargeable NiHM batteries
Quad calibration gas (34 L) and regulator
Calibration hose with quick connect
Support CD-ROM with instruction manuals,
quick reference cards, training video, and
datalogging software
Hard-sided carrying case with removable
shoulder strap
.
w
w
w
g ATEX
Ordering Information
GAMAX3-4-CK
GAMAX3-4-CK1
GAMAX3-4-CK2
Confined Space Kit with 4-gas detector
Confined Space Kit with 4-gas detector
with Black Box Datalogger
Confined Space Kit with 4-gas detector
with User Downloadable Datalogger
Add suffix for delivery in: Europe: -EU
United Kingdom: -UK
Australia: -AU
Accessories Available
GA-VIB3
Remote Vibrator Alarm
GA-HL-R3
Remote Audible/Visual Alarm
GA-BMAX
Concussion-proof boot with alligator clip
GAMAX-CD1
GasAlertMax training CD-ROM
D4-PROB3
3 ft. / 1 m sampling probe
CG-Q34
Quad calibration gas cylinder (34 L)
CG-Q58
Quad calibration gas cylinder (58 L)
CG-BUMP1
Quad Bump test gas aerosol (11 L)
For further information:
1-888-749-8878 America
1-800-663-4164 Canada
+44 (0) 1869 233004 Europe
+971-4-8871766 Middle East
+61-7-3818-8244 Australia
+1-403-248-9226 Other Countries
Fax: +1-403-273-3708
BW1002-01-01-00-8.25x11-5002-2
Plus
Others
www.gasmonitors.com
Email: info@bwtnet.com
www.HSEArya.com
www.HSEArya.com
Preliminary Datasheet
MicroDock
Automated Instrument Docking Station
s
Cost-Effective Instrument Management
The MicroDock calibration, test and record storage system provides
automated calibration and bump-testing for the GasAlertMicro multigas detector. Expandable to include up to 10 docking modules, the
MicroDock is the world’s most advanced, compact and affordable
automatic calibration and testing system for the ultimate confined
space gas detector.
m
o
c
.
a
y
r
A
E
S
H
Fully automatic “hands-free” calibration and functional bump test
Automatically verifies performance of audible and visual alarms
Stores and updates calibration records in both the GasAlertMicro
and the MicroDock
No computer required
Entirely self-contained
Fully portable
Operates via line power or set of four C-cell batteries
Add additional self-contained docking modules to system via
simple, plug-in connections—no external pressure transducers
or gas lines necessary
Expandable to include up to 10 GasAlertMicro docking modules
Simplify record keeping
Verify proper performance
.
w
tic!
a
m
o
aut
y
l
l
u
F
le!
b
a
t
r
o
ully p
le!
b
a
d
ffor
a
y
l
l
Fu
w
w
Reduce maintenance costs
Ordering Information
Basic One-Module MicroDock System
Includes base station, one GasAlertMicro docking module
(installed), 110 VAC line power adapter, 32 MB
MultiMediaCard (installed), Excel Datalog Manager software,
USB connector cable, fresh air inlet filter, four C-cell alkaline
batteries, two 2 ft./0.6 m calibration gas hoses, two gas
cylinder inlet fittings and instructions.
GAMIC-DOCK-1
Portable MicroDock System Kit
Includes Basic MicroDock System components, plus 34 L
quad calibration gas cylinder, demand flow regulator, all in a
convenient hard-sided carrying case.
GAMIC-DOCK-2
Accessories/Options
GAMIC-MOD
GasAlertMicro Docking Module
REG-DF-1
Demand Flow Regulator
GasAlertMicro
www.gasmonitors.com
Email: info@bwtnet.com
www.HSEArya.com
www.HSEArya.com
MicroDock
SPECIFICATIONS
Automated Calibration/Bump
Test Station for GasAlertMicro
GENERAL SPECIFICATIONS
INSTRUMENT:
Automated calibration/bump-test station for GasAlertMicro multi-gas detector
The new MicroDock station
is a cost-effective way to manage
calibration and bump-testing
of the GasAlertMicro multi-gas
detector. Fully portable and
easily expandable, the MicroDock
requires no computer and provides
simultaneous management
of up to 10 GasAlertMicro
docking modules.
Microcontroller:
SPI 12C interface
4 analog inputs
USB interface
Power Supply: 6V wall adapter or C-cell batteries
Real-time Clock: Provides time and date stamp for “last calbration” data
MultiMediaCard: 4-signal SPI interface, capable of multiple data rates
External Port/USB Interface: Provides communication between master module and host
Pump: DC motor, micro-diaphragm; 6V PCB mount
Flow Rate: 600 mL/min
Flow Sensor: Verifies flow of test-gas/air supply
Calibration Gas Cylinder Inputs: 2 inlets plus purge (standard)
4 inlets plus purge (maximum)
Automatic Tests: Functional bump, calibration, audible alarm, visual alarm
Configuration Recognition: Automatic (instrument and sensor)
Alarm/Calibration Parmeters: User-settable
Calibration Gas Connections: Built-in (base station)
Solenoid: Built-in (docking modules)
Data Storage: Automatic (instrument and base station)
m
o
c
.
a
y
r
A
E
S
H
Costs and time requirements
for routine maintenance are
reduced through the MicroDock’s
sophisticated automatic calibration
and test procedures. Instrument
records are stored for easy
retrieval in the MicroDock and
each individual GasAlertMicro.
Minimize expenses and maximize
productivity with the MicroDock.
LED INDICATORS:
Yellow - TEST
Green - PASS
Red - FAIL
SWITCHES:
COMMUNICATIONS METHOD:
Bump-test intitation
Calibration initiation
Infrared (two-way)
SENSORS:
PHYSICAL
Size:
WARRANTY:
Audio
Optical
8.3 x 10.4 x 3.2 in. / 21.2 x 26.3 x 8.2 cm (base station plus one docking module)
2 years
DUE TO ONGOING RESEARCH AND PRODUCT IMPROVEMENT, SPECIFICATIONS ARE SUBJECT TO CHANGE WITHOUT NOTICE.
.
w
w
w
Test, pass and fail LED indicators
Large, alphanumeric status LCD
Fully automatic, “hands-free” management
Built-in pump for gas delivery
Easy expansion for multiple networks
Completely modular
Locally distributed by:
BW1066-01-01-00-8.25x11-5396-0
www.HSEArya.com
SamplerPak
External Motorized Sampling Pump Kit
s
Reliability Plus Flexibility
The BW Sampler is a motorized sampling pump that provides
remote sample draws for many applications, including pre-entry
and/or continuous confined space work.
m
o
c
.
a
y
r
n
A
E
S
H
Compact (7.4 x 1.3 x 2.1 in. / 18.8 x 3.35 x 5.4 cm)
and lightweight (6.2 oz. / 175 g)
Compatible with most BW single-gas and multi-gas detectors,
including GasAlert and GasAlertMicro
Pump constantly monitors itself for proper performance
Low flow alarm, battery alarm and system fault alarm with
audible/visual warnings
Unique, manual flow-block test verifies proper performance
Up to 30 hours of continuous operation on a single set of
AA alkaline or rechargeable NiMH batteries
Built-in water trap and particulate filters
Optional extra-long probes and sampling hoses available
ISO 9001
.
w
Value-added SamplerPaks include
detector and additional accessories
w
w
Ordering Information
GA-SPAK
SamplerPak
Complete with: the Sampler motorized sampling pump,
two rigid sample tubes with barbed fitting (small: 4.65 in. / 11.8 cm;
medium: 10.25 in. / 26 cm), flexible sampling hose
(10 ft. / 3 m) with airstone water/particulate filter, connector hose
(3 ft. / 0.9 m), two AA alkaline batteries, two extra particulate
filters, instructions and a hard-sided, foam-lined carrying case
Value-added SamplerPak Kits - include SamplerPak, gas detector and
other accessories.
GAMIC-4-SK
GasAlertMicro SamplerPak
GA-(x)-SK
GasAlert and GasAlertLEL SamplerPaks
Note: Additional kits available on request.
Accessories
GAMIC-C01-K
GAMIC-V-CHRG1
Four NiMH rechargeable batteries
with 4-port charger
Four NiMH rechargeable batteries
with 4-port vehicle charger
Note: Add suffix for delivery with 220 VAC charger:
Europe: -EU United Kingdom: -UK
M1806
SP-T1-2
Australia: -AU
Sampling hose (order per foot)
Sampling probe (2 ft. / 61 cm)
Note: Longer sampling probes available upon request.
GasAlertMicro SamplerPak
Spares and Replacements
GA-SP01
Sampler - replacement motorized sampling pump
SP-T2-S
Small sample tube (4.65 in. / 11.8 cm)
SP-T2-M
Medium sample tube (10.25 in. / 26 cm)
D4-PF-1
Airstone water/particulate filter replacement
SP-PF-1
Sampler particulate filter replacements, kit of 5
www.gasmonitors.com
Email: info@bwtnet.com
www.HSEArya.com
www.HSEArya.com
SPECIFICATIONS
SamplerPak
Sample flow rate:
Sample distance:
Sample delay time:
Outlet connection:
Inlet connection:
Motorized Sampling Pump Kit
The Sampler motorized sampling
pump provides a continuous draw
from remote locations up to 50
ft. / 15.5 m away. The Sampler
is compatible with BW singlegas detectors as well as the
GasAlertMicro and the BW Defender
multi-gas confined space monitors.
300 ml/min (typical)
50 ft. / 15.5 m
3 seconds per 1 ft. / 0.3 m
1/8 in. / 0.32 cm barbed fitting for flexible sampling hose
Flexible sampling hose: 1/8 in. / 0.32 cm
Rigid sample tube: 1/4 in. / 0.63 cm O.D.
The intrinsically safe, the Sampler
operates continuously once
activated. Built-in low flow alarms
and a unique self-test feature ensure
peak performance. The robust and
ergonomic design makes “pick hole”
sampling simple to accomplish,
with easily interchangeable sample
probes and hoses.
DISPLAY:
Visual alarm:
Audible alarm:
Warning conditions:
3 high-intensity LEDs
90 dB at 1 ft. / 0.3 m
Low flow, low battery, system fault
GENERAL SPECIFICATIONS:
Operating temperature:
Operating humidity:
Battery:
Battery life:
Size:
Weight:
-4 to 122 oF / -20 to +50 oC
5% to 95% relative humidity (non-condensing)
2 AA alkaline batteries; or 2 AA NiMH rechargeable batteries
30 hours
7.4 x 1.3 x 2.1 in. / 18.8 x 3.35 x 2.1 cm
6.2 oz. / 175 g
m
o
c
.
a
y
r
A
E
S
H
WARRANTY:
2 years
DUE TO ONGOING RESEARCH AND PRODUCT IMPROVEMENT, SPECIFICATIONS ARE SUBJECT TO CHANGE WITHOUT NOTICE.
n Class I, Div. 1, Groups A, B, C and D
RATINGS AND CERTIFICATIONS:
Class I, Zone 0, Group IIC
The value-added SamplerPaks
include a gas detector, the Sampler,
all standard accessories and a hardsided, foam-lined carrying case.
Value-added SamplerPaks are
available with a range of additional
accessories, from battery chargers
to Confined Space Kits.
10
11
9
7
1
2
3
4
5
6
7
8
9
10
11
12
5
8
3
6
4
1
2
.
w
w
s
w
For further information:
Website: www.HSEArya.com
Tel: +9821-55425307
Email: info@HSEArya.com
Telegram ID: @HSEArya_PPE
Instagram ID: @HSEAryaPPE
Corporate Headquarters
2840 - 2 Avenue S.E.
Calgary, AB, Canada T2A 7X9
Tel: +1-403-248-9226
Fax: +1-403-273-3708
E-mail: info@bwtnet.com
www.gasmonitors.com
BW1060-01-01-00-8.25x11-5303-0
ATEX: CE 0539 g II 2 G (in progress)
EX Approval: EEx ia IIC (in progress)
X: European Conformity (in progress)
Sample tube (medium)
Sample tube (small)
Flow-block trigger for self-test
Water trap
Drain plug
Activation button
LEDs
Audible alarm
Cowl
Tube fitting (outlet)
Filter plug
Sampling hose
12
GasAlertMicro SamplerPak (GAMIC-4-SK)
GasAlert LEL SamplerPak (GA-W-SK)
Additional value-added kits are available in a variety of combinations.
Locally distributed by:
www.HSEArya.com
s
Automatic Full-Function
Test Stations
Safe and Economical
BW Technologies Gas Detectors (GasAlert100, GasAlertClip,
GasAlert, and GasAlert LEL) are the most advanced portables
in the world.
The only way to verify that any gas detector will respond to
gas is to test it with gas—a sensor may become plugged with
dirt or debris, and gas will not enter. All detectors should be
periodically tested with gas.
m
o
c
.
a
y
r
A
E
S
H
Automatic full-function Test Stations are an economical
solution for companies that use a large number of gas detectors.
Designed specifically for testing numerous units, Test Stations
eliminate the risk of exposing personnel to toxic test-gas by
providing a fast, safe and easy method of testing a detector’s
response to gas.
Detector fully tested in 10-30 seconds
Easy and fully automatic
PASS/FAIL advice on each test
Test Stations verify all functions:
– Sensor response to gas
– Speed of response
– Visual LED alarm activation
– Audible alarm activation
Economical use of test-gas
w
w
.
w
Test Stations come complete with regulator, reinforced
Teflon test-hose, AC wall-mount adaptor and 9-volt battery
Over 350 units tested on one 9-volt battery
Ordering Information
GA-TS04
GA-TS02
GA-TS03
GasAlert100 test station (for H2S, CO)
GasAlertClip test station (for H2S, CO, O2)
GasAlert & GasAlert LEL test station
(for single gas detectors)
* Order gas separately
* For Test Stations with other mains plugs (230 VAC), add suffix:
“-UK” (UK/Ireland mains plug)
“-EU” (Continental Europe mains plug)
“-AU” (Australia mains plug)
Accessories
Test-Gas Cylinders—Order Gas Separately
G0042-H25
25 ppm H2S, balance nitrogen (58 L)
G0041-M100
100 ppm CO, balance nitrogen (130 L)
G0043-N2
100% nitrogen for oxygen units (103 L)
For additonal gases and/or concentrations please contact BW Technologies
www.gasmonitors.com
Email: info@bwtnet.com
www.HSEArya.com
www.HSEArya.com
SPECIFICATIONS
Automatic Full-Function
TEST STATIONS:
Self-test:
Test sequence verifies:
Test Stations
For zero-maintenance and
single gas detectors
Test time:
Safe and Automatic
Test Ststions are engineered for easeof-use—simply insert the detector into
the test well and press the red button.
The station first verifies that the detector
is installed, then tests the sensor
response time, speed of response, alarm
LED operation and the audible alarm
activation. Watch the color coded PASS/
FAIL advice LEDs as the test quickly
progresses. If all tests are successful, the
green PASS light activates to confirm the
detector is ready for use.
DISPLAY INDICATORS:
Test activated:
PASS/FAIL advice:
CONTROLS
Pushbutton:
Power ON/OFF:
Test-gas flow:
REGULATOR:
Testing ON LED flashes RED throughout test
Six color coded LEDs
Five LEDs advise each test result. Green = PASS; Red = FAIL
1. Visual Alarm 2. Audible Alarm 3. Sensor Response 4. Pass 5. Fail
Activates test sequence
Automatic
Automatic ON/OFF (solenoid-controlled)
Vertical-type constant flow with pressure gauge (included)
m
o
c
.
a
y
r
A
E
S
H
Convenient and Economical
When a test is initiated, the solenoid
automatically releases test gas to the
detector. The flow of gas shuts off
automatically when the test is complete,
preventing any waste of test gas and
protecting personnel from exposure
to the gas. The AC adaptor allows
an unlimited number of units to be tested
without the need for battery replacement.
Test Stations can be conveniently hung
on a wall to be a conspicuous reminder
for individuals to test their detectors
before entering a potentially hazardous
area.
The BW Test Station makes a
significant contribution towards
safety in the work environment.
Tests operation of BW zero-maintenance and single gas detectors
Station verifies own operational status
1. Sensor response to gas
2. Response time meets specifications
3. Visual alarm activation
4. Audible alarm activation
5. General PASS/FAIL
Less then 30 seconds per unit
POWER:
AC:
DC:
PHYSICAL
Size:
Weight:
Test-well:
Cylinder holder:
Enclosure:
WARRANTY:
110 to 230 AC or DC (9-volt battery is included)
110 AC or 230 AC wall-mount adaptor is included
Over 350 units tested on one 9-volt battery
m
18.5 x 8 x 2.5 in. / 47 x 20 x 6 cm
2.85 lb. / 1.3 kg
Model GA-TS04: Holds GasAlert100
Model GA-TS02: Holds GasAlertClip
Model GA-TS03: Holds GasAlert and GasAlert LEL
Fits standard size gas cylinders with two straps
Rugged, composite materials
Equipped with back slots to wall-mount the test station if desired
2 years non-prorated
DUE TO ONGOING RESEARCH AND PRODUCT IMPROVEMENT, SPECIFICATIONS ARE SUBJECT TO CHANGE WITHOUT NOTICE.
.
w
w
w
For further information:
Website: www.HSEArya.com
Tel: +9821-55425307
Email: info@HSEArya.com
Telegram ID: @HSEArya_PPE
Instagram ID: @HSEAryaPPE
Corporate Headquarters
2840 - 2 Avenue S.E.
Calgary, AB, Canada T2A 7X9
Tel: +1-403-248-9226
Fax: +1-403-273-3708
E-mail: info@bwtnet.com
www.gasmonitors.com
BW1003-01-01-00-8.25x11-5003-2
SIMPLE AND EASY
Simply insert the detector into the test-well and press the red button. Quality
test-gases are available for all BW Technologies gas detection instruments.
Locally distributed by:
www.HSEArya.com
GasProbe IAQ
T°, RH, CO, CO2
Air Quality Monitor
s
Versatile IAQ Monitoring
Engineered for enviroments that require reliable, multi-parameter
monitoring, the GasProbe IAQ is industry’s most versatile
portable instrument. Ergonomically designed and user-friendly, the
GasProbe IAQ delivers peak performance that’s second to none.
m
o
c
.
a
y
r
A
E
S
H
Simultaneous monitoring of up to four parameters:
carbon monoxide (CO), carbon dioxide, (CO2),
relative humidity (RH) and temperature (To)
Datalogging models available with minimum 77 days of
datalogging capacity
Download data to your computer via infrared port
Field-proven sensing technology
Compact and lightweight
Audible, visual and vibrating alarms
Comprehensive display of data
Simple automatic calibration procedure
Peak readings on demand: STEL and TWA
Menu-driven operation
Full array of accessories, including datalogging software in
deluxe and standard versions
w
w
.
w
Plug-in AC power adapter, CO and CO2 sensors, lithium
battery and instructions included
Ordering Information
GasProbe IAQ Air Quality Monitor
IAQ-4
To, RH, CO2, CO
IAQ-3
To, RH, CO2
IAQ-2
CO2, CO
IAQ-1
CO2
Datalogging Versions
Comes with standard software.
IAQ-4-DL To, RH, CO2, CO
IAQ-3-DL To, RH, CO2
IAQ-2-DL CO2, CO
IAQ-1-DL CO2
Accessories and Spares
IAQ-DLX Deluxe datalogging software
IAQ-CC1 Hard-sided carrying case
IAQ-BC1 Desktop battery charger
IAQ-IC
USB/IRDA interface cable
IAQ-PA-1 Power adaptor
IAQ-BAT Lithium ion battery
www.gasmonitors.com
Email: info@bwtnet.com
www.HSEArya.com
www.HSEArya.com
GasProbe IAQ
SPECIFICATIONS
T°, RH, CO, CO2
DETECTOR:
Gas Detected
Air Quality Monitor
The GasProbe IAQ simultaneously
and continuously monitors up to four
parameters: carbon monoxide (CO),
carbon dioxide (CO2), relative humidity
(RH), and temperature (To). Instantaneous
readings are displayed on a large,
alphanumeric LCD.
3%
CO2
0-5,000 ppm or 0-10,000 ppm (user selectable)
3%
32 oF-104 oF
0 oC-40 oC
0.2 oF
0.1 oC
0-95%
2%
Relative humidity
GENERAL SPECIFICATIONS:
Power Supply:
Runtime:
Sensing Technologies:
Humidity Range:
Operating Temperature:
Tests:
Vibrating lithium ion battery
16 hours fully charged
Electrochemical (CO)
Infrared (CO2)
RTD (Temperature)
Capacitive polymer (relative humidity)
0-95% non-condensing
-20 to 50 °C / -4 to 122 °F Toxic
Self-test of sensors, battery and memory (on startup)
Unit continually monitors battery
m
o
c
.
a
y
r
A
E
S
H
A minimum 77-day datalogging capacity is
complemented by user-friendly Windowsbased data management software, which
provides direct access to the GasProbe
IAQ and enables data downloading with a
few clicks of a mouse.
Once the data is downloaded, the data
management software analyzes the
information and compiles it in an easy-toread format. All vital statistics are sorted
by date and time. The deluxe software
enables interactive graphing and trending
through powerful charting tools.
With a full line of accessories to add
even more versatility, the GasProbe
IAQ is an ideal tool for indoor air
quality management.
SAMPLING METHOD:
LCD DISPLAY:
Alarm Setpoints:
TWA and STEL:
INDICATORS AND ALARMS:
Audible Alarm:
Visual Alarm:
Vibrator Alarm:
Other:
DATALOGGING:
PHYSICAL:
Size:
Weight:
Diffusion (standard)
Parameter displayed, unit of measurement, data transfer status,
gas concentration, memory capacity, battery status
Fully adjustable for CO
Displayed on demand
85 dB at 4 in./10 cm
Three LED alarms
Internal
Low battery warning
Two special alarms for CO
Stores real-time information and values
Internal memory: 4 MB (2.5 million total samples)
1.6 x 6.6 x 3.4 in. / 4.0 x 16.5 x 18.5 cm
14.65 oz. / 415 g
WARRANTY: 1 year, including sensors
DUE TO ONGOING RESEARCH AND PRODUCT IMPROVEMENT, SPECIFICATIONS ARE SUBJECT TO CHANGE WITHOUT
NOTICE.
.
w
1 LARGE, ALPHANUMERIC DISPLAY
2 BRIGHT, WIDE-ANGLED, VISUAL ALARM BAR
3 HIGH-OUTPUT, 85 dB AUDIBLE ALARM
4 RUGGED, COMPACT, LIGHTWEIGHT
2
5 PROGRAMMING KEYS
1
4
For further information:
Website: www.HSEArya.com
Tel: +9821-55425307
Email: info@HSEArya.com
Telegram ID: @HSEArya_PPE
Instagram ID: @HSEAryaPPE
5
3
Corporate Headquarters
2840 - 2 Avenue S.E.
Calgary, AB, Canada T2A 7X9
Phone: +1-403-248-9226
Fax: +1-403-273-3708
Accuracy
0-250 ppm or 0-500 ppm (user selectable)
Temperature
Compact and lightweight, the GasProbe
IAQ is loaded with practical features.
A real-time clock calculates and records
STEL and TWA readings. Additional
features include audible, visual and
vibrator alarms, one-button calibration
and peak reading memory.
w
s
w
Four-parameter monitor Range
CO
Locally distributed by:
DELUXE SOFTWARE
www.HSEArya.com
GasProbe CO
Carbon Monoxide Meter
s
Measure CO Levels
LCD displays CO levels from 0-1,000 ppm
The higher the concentration of CO, the faster the
beeper sounds
LCD backlight activates automatically in
lowlight conditions
Automatic sensor zeroing and self-test sequence
upon startup
Stores and displays the maximum CO levels
encountered (MAXHOLD)
CO level beeper can be silenced if desired
Automatic power-off after 20 minutes extends battery life
Simple, automatic calibration procedure
Easy-to-replace 9 VDC battery (battery life 500 hours)
Stabilized electrochemical CO specific sensor
Typical three year sensor life, one year calibration cycle
Manuals available in local languages
One-button
operation
m
o
c
.
a
y
r
A
E
S
X
H
One year warranty including sensors
w
w
.
w
ISO 9001
Ordering Information
CO-PROBE
Handheld Carbon Monoxide Meter
Accessories and Spares
CO-CASE1
Carrying Case
GA-SPAK
Motorized Sampling Pump Kit
CO-AK1
Manual Aspirator Kit
SR-M2FL
Carbon Monoxide (CO) Sensor
Website: www.HSEArya.com
Tel: +9821-55425307
Email: info@HSEArya.com
Telegram ID: @HSEArya_PPE
Instagram ID: @HSEAryaPPE
www.gasmonitors.com
Email: info@bwtnet.com
www.HSEArya.com
GasProbe CO
SPECIFICATIONS
Carbon Monoxide Meter
Compact and lightweight, the
GasProbe CO provides fast, accurate
sampling of CO concentrations from 0
to 1,000 parts per million (ppm).
Operating Temperature:
Operating Humidity:
Gas Sensors:
Measuring Range:
Indicators:
BATTERY:
Battery life:
GasProbe CO is ideal for technicians,
fire department personnel and other
professionals who need to measure
CO levels where accumulation of
combustion gas is possible, such as
industrial environments, commercial
buildings, or residential dwellings.
DISPLAY:
Backlight:
Records/Displays:
SELF-TESTS:
PHYSICAL:
Size:
Weight:
GasProbe CO Carbon Monoxide Meter
32 to 122 °F / 0 to 50 °C
0% to 99% RH (non-condensing)
Electrochemical (carbon monoxide)
0-1,000 ppm
Beeper tone and ppm readout
Standard 9-volt
500 hours typical
Status-at-a-glance alphanumeric LCD
Automatically turns on in low light conditions
Maximum CO exposure encountered on demand
On activation (auto): verifies sensor integrity and battery
Continuous: battery operation is continuously monitored
Shock resistant ABS enclosure
1.75 x 2.0 x 7.0 inches / 45 x 50 x 180 mm
5.2 oz. / 147 g including battery
m
o
c
.
a
y
r
A
E
S
H
Additional Features:
LCD Display: Large, continuous,
alphanumeric display advises in ppm
Audible Indicator:
The beeper functions much like the
clicking of a Geiger counter:
•
The higher the concentration
of CO, the faster the beeper
sounds.
•
Above 200 ppm, the beeper
sounds continuously. The
frequency of the tone increases
with the concentration of CO.
WARRANTY:
1 year including sensors (typical sensor life 3 years)
DUE TO ONGOING RESEARCH AND PRODUCT IMPROVEMENT, SPECIFICATIONS ARE SUBJECT TO CHANGE WITHOUT NOTICE.
1
2
1 LARGE, HIGH-CONTRAST LCD
2 AUTO BACKLIGHT IN LOW LIGHT CONDITIONS
3 SIMPLE CONTROLS
4 ADVANCED MICROCONTROLLER BASED OPERATION
5 9 VDC BATTERY
3
6 COMPACT AND LIGHTWEIGHT
4
Accessories Available
.
w
w
s
w
For further information:
Website: www.HSEArya.com
Tel: +9821-55425307
Email: info@HSEArya.com
Telegram ID: @HSEArya_PPE
Instagram ID: @HSEAryaPPE
Corporate Headquarters
2840 - 2 Avenue S.E.
Calgary, AB, Canada T2A 7X9
Phone: +1-403-248-9226
Fax: +1-403-273-3708
E-mail: info@bwtnet.com
www.gasmonitors.com
BW1010-01-01-00-8.25x11-5126-3
Manual Aspirator Kit
6
Wrist Strap
5
Locally distributed by:
www.HSEArya.com
GasProbe
CO, O2, CO2, CO/CO2, in. WC/mbar, °F/°C
Combustion Gas Analyzer
s
FIVE in ONE
m
o
c
.
a
y
r
A
E
S
H
.
w
w
w
The NEW low-cost handheld GASPROBE is five
instruments in one:
1. Combustion Gas Analyzer
2. Gas Appliance Tester
3. Ambient Air Monitor
4. Draft Measurement Device
5. Temperature Thermometer
Real-time digital readings of O2, CO, CO2,
CO/CO2 Ratio and Stack Air Temperatures
Calculation of combustion efficiency for five fuels (Natural
Gas, LPG, Light Oil, Heavy Oil, Solids)
Small, compact and lightweight—a true handheld
15 hours (typical) continuous use on one Black & Decker
VersaPak™ NiCd rechargeable battery
Large, multi-parameter display
Automatic, continuous backlight in low light conditions
Download data via infrared printer at the touch of a button
Datalogging of readings for later recall with time and date
Measurement of ambient CO and oxygen levels in air
Electrochemical sensors
Automatic calibration of O2 sensor, sampling pump and
pressure sensor each time the instrument is turned on
External water trap/filter in combination with internal
pump filter prolongs instrument life
Simple, intuitive operation
Two year warranty including sensors
Deluxe Kit includes
cordless infrared printer
and surface probe
ISO 9001
Ordering Information
GPROB-SK1 GasProbe Analyzer Kit Standard Kit includes:
-GasProbe Combustion Gas Analyzer
-Flue Gas Temperature and Sample Probe
-Draft/Differential Pressure Probe
-2-Port Black & Decker AC charger
-2 NiCd VersaPak™ batteries
-Pump filters (kit of 5)
-Convenient hard-sided carrying case
Note: For delivery with 220 VAC charger add suffix:
Europe: -EU United Kingdom: -UK Australia –AU
GPROB-DK1 The Deluxe Kit includes all of the above plus:
-Infrared HP Handheld Cordless Printer
-Surface/Air/Water Temperature Probe
-Concussion-proof boot
-2 rolls of printer paper
Accessories and Spares
GA-B2MAX Concussion-proof boot
D4-VP100
VersaPak NiCd rechargeable battery
GA-VP110
VersaPak NiMH rechargeable battery
V-CHRG1
2-port, 12 volt, vehicle charger
D4-VP130
Two port, 110 VAC charger
GA-PFMAX Pump filters (kit of 5)
www.gasmonitors.com
Email: info@bwtnet.com
www.HSEArya.com
www.HSEArya.com
GASPROBECombustion
SPECIFICATIONS
Operating Specifications:
Gas Analyzer
Oxygen:
GasProbe provides extraordinary
cost of ownership advantages.
These include a choice of
economically priced professional
kits (Standard or Deluxe), long-life
VersaPak™ battery power (available
in local stores) and user-friendly
operation.
Carbon Monoxide:
1 ppm
0.1 %
CO/CO2 Ratio:
0 - 0.9999
0.0001
Combustion Efficiency:
0 - 99.9%
0.1 %
Flue Gas Temperature Probe:
41 - 1,832 °F / 5 °C - 1,000 °C
1 °F / °C
Draft/Differential Pressure:
0 - 40.1 in. WC, (0-100 mbar)
0.004 in. WC, (0.1 mbar)
41 - 482 °F, (5-250 °C)
1 °F / °C
Operating humidity:
Gas sensors:
Fuel types:
OPERATING MODES:
5% to 95% RH (non-condensing)
Electrochemical (oxygen and carbon monoxide)
Five fuel types, field-selectable
Natural Gas, LPG, Light Oil, Heavy Oil, and Solid Fuel (Bituminous Coal)
Combustion Gas Analyzer Mode or Ambient Air Monitoring Mode
m
o
c
.
a
y
r
A
E
S
H
BATTERY:
Battery life:
Charger input voltage:
Alarm Indicators:
Visual: Flashing wide-angled
alarm bar plus alarm LCD
Audible: Variable pulsed 70 dB
Alarms: Over Limit alarm (protects
sensor); low battery and
sensor fail
One 3.6 volt Black & Decker VersaPak™ rechargeable cell
NiCd 15 hours typical (3 hour charge time)
Black & Decker 2-port charger: 115 AC 50/60 Hz
DISPLAY:
Backlight:
Status-at-a-glance alphanumeric LCD
Low light (continuous auto) and/or all alarm conditions (auto)
SELF-TEST:
On activation (auto): verifies sensor integrity, battery and sampling pump
Continuous: Battery and sampling pump
PHYSICAL:
Size:
Weight:
TEMPERATURE/EFFICENCY:
Sensor:
Insertion lengths:
Construction:
WARRANTY:
Two Operating Modes:
Combustion Gas Anaylzer Mode
Ambient Air Safety Mode with factory
set low and high alarm levels for
carbon monoxide and oxygen
Shock-resistant ABS enclosure
1.6 x 3.0 x 5.9 inches / 40 x 75 x 150 mm
13.1 oz / 375 g including battery
Dual temperature and sampling probe
K-type thermocouple
Temperature probe: 10 in. / 26 cm; sampling hose: 58.5 in. / 150 cm
Stainless steel shaft and rubber hose with pistol grip
2 years including sensors
DUE TO ONGOING RESEARCH AND PRODUCT IMPROVEMENT, SPECIFICATIONS ARE SUBJECT TO CHANGE WITHOUT NOTICE.
1 LARGER, HIGH-CONTRAST LCD
2 AUTO BACKLIGHT IN LOW-LIGHT CONDITIONS
.
w
w
s
w
0.1 %
0 - 2,000 ppm
Surface/Air/Water Probe:
Sampling Pump: Internal, pulsefree rotary vane pump (250 ml/min.)
LCD Display: Large continuous
alphanumberic display advises:
ppm, % of gas; temperature and
draft readings, as well as, time and
date
Resolution
0 - 25.0%
0 - 13.5%
Carbon Dioxide (calculated):
Additional Features:
GasProbe Combustion Gas Analyzer
Measuring Range
3 SIMPLE CONTROLS
1
4 ADVANCED MICROPROCESSOR
5 VersaPak™ RECHARGEABLE BATTERY
6 COMPACT AND LIGHTWEIGHT HANDHELD
2
3
6
For further information:
Website: www.HSEArya.com
Tel: +9821-55425307
Email: info@HSEArya.com
Telegram ID: @HSEArya_PPE
Instagram ID: @HSEAryaPPE
Corporate Headquarters
2840 - 2 Avenue S.E.
Calgary, AB, Canada T2A 7X9
Phone: +1-403-248-9226
Fax: +1-403-273-3708
E-mail: info@bwtnet.com
www.gasmonitors.com
BW1005-01-01-00-8.25x11-5000-5
Deluxe Kit includes
cordless infrared
printer and
surface probe
5
Temperature/Sample Dual Probe
K-type thermocouple
With pistol grip
Locally distributed by:
Pressure Hose (Optional)
3 ft. (1 m)
teflon hose
Surface Temp. Probe (Optional)
K-type thermocouple
www.HSEArya.com
Fixed Systems
BW Technologies
m
o
c
.
a
y
r
A
E
S
H
w
w
.
w
For further information:
:HEVLWHZZZ+6($U\DFRP
7HO
(PDLOLQIR#+6($U\DFRP
7HOHJUDP,'#+6($U\DB33(
,QVWDJUDP,'#+6($U\D33(
www.HSEArya.com
The BW Fixed Equipment Advantage
Technologies and Products
BW fixed products incorporate advanced sensor technologies:
• Point IR
• Catalytic bead
• Electrochemical
All transmitters come complete with sensors. The right monitor type is available
for your application:
• Explosion-proof
• Intrinsically safe design
• General purpose
• Zero-maintenance
• Stand-alone/solar powered
• Analog or digital outputs (4-20 mA, MODBUS, etc.)
• Local alarm capability
• Systems integration
m
o
c
.
a
y
r
A
E
S
H
We design and manufacture four primary fixed product lines:
• Combustible gas monitors
• H2S gas monitors
• Toxic gas monitors
• Oxygen gas monitors
Advanced Self-Diagnostics
Internal fault diagnostics result in easier troubleshooting and lower
maintenance costs.
.
w
Versatility
BW systems, controllers and transmitters are designed with built-in flexibility for
immediate needs and future requirements. Ease of installation and use are
hallmarks of our fixed equipment.
w
w
Customer Support
BW is committed to providing ongoing customer support through our sales and
service departments. We work with our customers every step of the way to
ensure total satisfaction.
www.HSEArya.com
CR-4000
“The Independent”
Four Channel Gas Detection Controller
s
Loop Powered
m
o
c
.
a
y
r
n
A
E
S
H
Provides 24 VDC
power to the gas
sensing transmitter
Fixed Gas Monitoring Systems
.
w
FEATURES:
For continuous monitoring and control of toxic gases, combustible
gases and oxygen hazards, the CR-4000 is designed for installation and
operational simplicity.
Individual, continuous, alphanumeric “status” LCD for each
channel
w
w
Slim profile: depth only 2.4 inches/(6.35 cm)
Easy installation - simply hang on the wall, connect the power
(AC or DC) and gas transmitters
Local 85 dB audible alarm
Field programmable alarm levels on each channel
Simple operation
Ordering Information
CR-4000
4-20 mA AC/DC Controller with common relays
(fault, low and high alarm)
CR4-R1000
4-20 mA AC/DC Controller with common relays
plus discrete relays, low and high,
on Channel 1
CR4-R1200
4-20 mA AC/DC Controller with common relays
plus discrete relays, low and high,
on Channels 1 & 2
CR4-R1230
4-20 mA AC/DC Controller with common relays
plus discrete relays, low and high,
on Channels 1,2 & 3
CR4-R1234
4-20 mA AC/DC Controller with common relays
plus discrete relays, low and high,
on Channels 1,2,3 & 4
Note: Discrete relays 10 amp SPDT discrete low and high
alarm relays
Mix, match or change the gases monitored
Three standard common, 10 amp SPDT relays. Low, High and
Fault general Alarms
Up to eight additional discrete relays - two per channel for LOW
and HIGH alarms. Each channel is programmable for energized/
de-energized, latching/non-latching and audible ON/OFF
Multi-functional external RESET. Can be used to reset or cancel
all latched alarms; displays Peak (maximum) gas detected on each
channel and tests all audible/visual alarms
Accepts 4-20 mA signal input from any 4-20 mA gas transmitter
Accessories and Options
CR4-BAT1
Battery Back-up (110/220 VAC or 24 VDC)
CR-ALH05
External Audible/Visual Alarm
Compatible with BW 4-20 mA Gas Transmitters
GasPoint
CD-420
GasPoint IR
ToxyPoint
I.S. Plant Rat
RRJ Monitors
www.gasmonitors.com
Email: info@bwtnet.com
www.HSEArya.com
www.HSEArya.com
SPECIFICATIONS
CR-4000
POWER:
Four Channel Gas
Detection Controller
AC Input:
DC Input:
Backup:
ENVIRONMENTAL
Simply select the pre-programmed
channel switch for:
Gas type
Sensor range
Alarm level
Standard Common Relays (included)
High alarm, Low alarm and Fault
Operating Temperature:
Relative Humidity:
Enclosure Rating:
Records and Displays Peak (Max)
gas detected by each channel on
demand.
Auto Fuses protect all circuits.
Fuses reset automatically when the
circuit power returns to normal. No fuse
replacement required.
ALARMS:
Audible:
Accessories and Options
Relays (up to eight)
Two (2) factory installed 10 amp
SPDT relays per channel. The Low
Alarm/High Alarm independent discrete
relays are user adjustable for power
and assignment, including normally
energized/de-energized, latching/nonlatching, zoning (Park) and audible
alarm activation.
Battery Backup
The two (2) 1.2 amp hr., 12 volt
batteries can be installed at any time
in the field.
Select from the BW family of 4-20 mA
gas transmitters:
• GasPoint • CD-420
• I.S. Plant Rat • RRJ
Gas Detection Measuring Ranges
Backlit LCDs:
LED Indicators:
www.gasmonitors.com
BW1023-01-01-00-8.25x11-5115-1
SPDT relays; 10 amp @ 110 VAC/24 VDC, 8 amp @ 230 VAC
Standard: One (1) common low gas alarm, de-energized, non-latching
One (1) common high gas alarm, de-energized, latching
One (1) common fault alarm, normally energized, non-latching
Optional: Two (2) per channel; one (1) low gas and one (1) high gas alarm
Field selectable: energized/de-energized; latching/non-latching;
zoning (Park) function and audible alarm ON/OFF
Four (4) independent 3 digit alphanumeric status displays
Field selectable readouts for: %LEL, ppm and/or O2 % v/v.
Alarms: Three (3) - “LOW” (red), “HIGH” (red), “FAULT” (amber)
Power: Two (2) “ON” AC icon (green), DC icon (green)
Gas: Concentration icons-ppm, %LEL , %O2,
CONTROLS:
Two (2) large pushbuttons: Alarm Reset/Acknowledge, Peak Exposures,
Lamp Test (audible/visual alarm test)
Alarm setpoints: simple up/down buttons
WARRANTY:
Two (2) years non-prorated
DUE TO ONGOING RESEARCH AND PRODUCT IMPROVEMENT, SPECIFICATIONS ARE SUBJECT TO CHANGE WITHOUT NOTICE.
RATINGS AND CERTIFICATIONS:
(INTRINSCALLY SAFE W/ BARRIER)
For further information:
1-888-749-8878 USA
1-800-663-4164 Canada
+44 (0) 1869 233004 Europe
+971-4-8871766 Middle East
+61-7-3818-8244 Australia
+1-403-248-9226 Other Countries
E-mail: info@bwtnet.com
Two set points—user programmable—with simple rotary switch
85 dB buzzer
DISPLAY PANEL
.
w
Corporate Headquarters
2840 - 2 Avenue S.E.
Calgary, AB, Canada T2A 7X9
Phone: +1-403-248-9226
Fax: +1-403-273-3708
2.4 x 13 x 9.5 inches/6 x 33 x 24 cm
4.85 lb./2.2 kg
Enameled steel RFI/EMI protected
Screw type terminal blocks
Seven (7) each 3/4 inch/22 mm NPT ports
Wall mounted—equipped with hanging slots and hinged door
m
o
c
.
a
y
r
A
E
S
H
OUTPUTS:
Alarm Relays:
w
s
w
-4 to +122°F/-20 to +50°C
5 to 99% non-condensing
Nema 12
PHYSICAL
Dimension (dxwxh):
Weight:
Enclosure:
Wire Terminations:
Wiring Ports:
Mounting:
Special Features
Combustibles: 0-100% LEL
O2: 0-25% v/v
H2S: 0-20, 0-50, 0-100, 0-500 ppm
CO: 0-50, 0-100, 0-200, 0-500, 0-1000 ppm
SO2: 0-10, 0-20, 0-50, 0-100 ppm
NH3: 0-50, 0-100 ppm
Cl2: 0-5.0, 0-10.0, 0-100 ppm
HCN: 0-20.0, 0-50.0, 0-100 ppm
NO: 0-50, 0-100 ppm
NO2: 0-10.0 ppm
Field selectable for AC (115 and 230 VAC) or DC (24 VDC)
110 VAC 50-60 Hz standard; 220 VAC 50-60 Hz
24 VDC (18 to 28 VDC)
Optional battery backup 24 VDC supply. Approx. 3 hours in normal operation
Locally distributed by:
CSA USA
International Electrical Code: IEC No. 1010
U.S. Standard: ANSI/ISA S82.01
Canadian Standard Electrical Code: C22.2 No. 1010
C
www.HSEArya.com
RRJ-4000
Stainless Steel
Four Channel Gas Detection Controller
Optional remote
alarm bar available
m
o
c
.
a
y
r
A
E
S
H
.
w
Features and Benefits
For continuous monitoring and control of toxics, combustibles
and oxygen hazards, the stainless steel RRJ-4000 is built for
outdoor or indoor installation in the most rugged environments.
Compatible with any 4-20 mA gas transmitter, the RRJ-4000
controller is designed for simple set-up and operation, reliable
performance and minimal cost of ownership.
w
w
Easy installation, simple operation
Rugged, stainless steel construction—truly field tough (NEMA 4X)
AC/DC power input, solar capable
Battery back-up included
Multi-functional external reset—can be used to reset or cancel all
latched alarms, displays peak (maximum) gas detected on each
channel and tests all audible/visual alarms
Individual continuous alphanumeric status LCD for each channel
ISO 9001
Fixed Gas Monitoring System
Ordering Information
Includes two 3/4 in. (19 mm) conduit fittings and installation plus
operating manual.
RRJ-4000
AC/DC 4-20 mA stainless steel controller
Options
RRJ-ALH05
RRJ-SC010-K
RRJ-SC###-K
Dual audible/visual alarm bar
10 ft. (3 m) plug-in factory sensor cables
Other lengths up to 1,000 ft. (305 m)
order in 10 ft. (3 m) increments
Compatible with all BW 4-20 mA gas transmitters
GasPoint
CD-420
GasPoint IR
RRJ Series sensor/transmitters
I.S. Plant Rat
ToxyPoint sensor/transmitters
Four 10 amp SPDT common relays included. Three gas alarm
relays (Low, High and High/High) and one fault relay
Simple setup of alarm levels and measuring ranges with no tools
or meters required
Local audible alarm included
Mix, match or change the gas monitored at any time
The controller accepts any 4-20 mA gas transmitter
www.gasmonitors.com
Email: info@bwtnet.com
www.HSEArya.com
www.HSEArya.com
RRJ-4000
SPECIFICATIONS
Four Channel Gas
Detection Controller
POWER:
AC input:
DC input:
Battery backup:
Each channel is equipped with three
preprogrammed selection switches
for easy setup or change. Select:
Gas type
Measuring range
Alarm levels
Latching gas alarm relays
Audible activation
Remote visual alarm activation
Relative humidity:
Operating temperature:
Enclosure rating:
PHYSICAL:
Dimensions (d x w x h):
Weight:
Wire terminations:
Wiring ports:
Channel setup switches:
AUDIBLE ALARM:
ALARM RELAY OUTPUTS:
Gas alarms:
Fault alarm:
LCDs:
Backlight:
LED indicators:
Options
MULTI-FUNCTION CONTROLS:
OPTIONAL REMOTE ALARM BAR:
Transportable system available
Audible:
Visual:
Physical:
Select from the BW family of
4-20 mA gas transmitters:
.
w
w
w
For further information:
1-888-749-8878 USA
1-800-663-4164 Canada
+44 (0) 1869 233004 Europe
+971-4-8871766 Middle East
+61-7-3818-8244 Australia
+1-403-248-9226 Other Countries
Corporate Headquarters
2840 - 2 Avenue S.E.
Calgary, AB, Canada T2A 7X9
Fax: +1-403-273-3708
E-mail: info@bwtnet.com
www.gasmonitors.com
BW1024-01-01-00-8.25x11-5248-1
Stainless steel w/ carrying handles, predrilled mounting flanges, RFI/EMI protected
3.75 x 15.75 x 9.5 in. / 9.5 x 40.0 x 24.1 cm
17.8 lb/8.1 kg
Screw-type terminal blocks
Six (0.875 in./19 mm) accept conduit or compression fittings
Three preprogrammed switches per channel. Select: gas type, measuring range,
alarm levels, latching feature for gas alarm relays, audible alarm activation and
activation of optional remote audible/visual alarm bar
85 dB (activation field selectable on each channel)
Four SPDT relays; 10 amp @ 110 VAC/24 VDC, 8 amp @ 230 VAC
Three: Low, High and High/High common, de-energized relays;
gas relays are field selectable for alarm level and latching or non-latching
One normally energized and non-latching common relay
DISPLAY PANEL
Auto Fuses
Fuses reset automatically when the
circuit power returns to normal. No
fuse replacement required.
GasPoint, GasPoint IR, CD-420,
I.S. Plant Rat, ToxyPoint, RRJ Serties
5 to 99% non-condensing
VDC: -40 to +122°F/-40 to +50°C; VAC and battery backup: -4 to +122°F/-20 to +50°C
NEMA 4X
m
o
c
.
a
y
r
A
E
S
H
Records and Displays
Records peak (maximum) gas
concentrations detected by each
channel and displays peak
concentration on demand.
Solar Capable
Contact BW Technologies
Field selectable for AC or DC
110 VAC 50-60 Hz or 230 VAC 50-60 Hz
16-24 VDC, minimum 3 amp output current
12 VDC supply; hours of operation dependent on transmitter current draw
ENVIRONMENTAL
Special Features
Dual audible/visual
alarm with remote capability
Four channel AC/DC 4-20 mA controller
Four independent 3-digit alphanumeric gas concentration display and status
indicators; field selectable for % LEL, ppm and/or O2 % v/v
In VAC operation
Gas alarms: Three: LOW (red), HIGH (red), HIGH/HIGH (red) per channel
Fault alarm: Common amber LED
Gas type:
Combustibles (% LEL), toxic (ppm), or oxygen (% by volume)
Power:
Two "ON" AC icon (green), DC icon (green)
Gas:
Concentration icons—ppm, % LEL and other
Security key lock switch (three positions):
ON/OFF; lamp test; calibration and
alarm setpoints
Pushbutton switch: Alarm acknowledge (reset); audible mute;
displays peak (maximum) exposures and alarm setpoints
Stainless steel enclosure with variable angle mounting predrilled flanges; mounts
remotely or directly on RRJ controller
101 dB siren High, High/High and Fault alarm; field selectable for each channel
60,000 candlepower strobe (all alarm conditions); field selectable for each channel
Size:
4.5 x 8.3 x 6.5 in./11.4 x 21.1 x 16.5 cm
Weight: 4.0 lb/1.8 kg
Standard cable length: 5 ft./1.5 m included, longer lengths available
DUE TO ONGOING RESEARCH AND PRODUCT IMPROVEMENT, SPECIFICATIONS ARE SUBJECT TO CHANGE WITHOUT NOTICE.
Mou
unting
flang
ges with
carryying handles
Label areas
View ppm, % O2
or % LEL readouts
Gas concentration
displayed
0
NEL
LER
Access peak
(max) exposures
on demand
igh
Low High HighH
Power
Supply
2
%LEL
Transmitter
not installed
fault
85 dB
audible
Pushbutton
reset switch
Security key-lock
switch
Low, High, High/Hig
gh
and Fault LED indic
indicators
Six access ports accept
compression fittings
or conduit
Locally distributed by:
AC/DC power
indicators
www.HSEArya.com
GasPoint
H2S, CO, NH3, HCN, NO2, SO2, O2, Cl2
Combustibles (Catalytic 0-100% LEL) or
Combustibles (IR 0-100% LEL)
Gas Transmitter with Internal Alarm Relays
s
m
o
c
.
a
y
r
n
A
E
S
H
One Transmitter
with interchangeable
electrochemical, infrared
and catalytic plug-in sensors
Fixed Gas Monitoring Systems
.
w
FEATURES:
The GasPoint transmitter provides a 4-20 mA output signal that can be
connected to any control system (DCS, PLC, etc.). With advanced sensor
technology and microcontroller based operation, the GasPoint provides
continuous monitoring of hazardous gases.
The GasPoint transmitter can accept any GasPoint sensor type:
electrochemical, catalytic or IR (infrared). All plug-in sensor assemblies
are field-interchangeable.
w
w
Full function sensor integrity test (auto) continuously advises gas
sensing ability and life ended
Non-intrusive, one-person calibration with auto zero and
auto span
Equipped with three 5-amp relay contacts—two gas alarm relays
(low/high) and fault alarm. Field-selectable normally energized/
de-energized and latching/non-latching alarm relay functions.
Two backlit alphanumeric LCDs advise all environmental and gas
hazard conditions as well as instrument and sensor status
Remote toxic/oxygen sensors can be installed over 3,900 ft./ 1,100 m
away; combustible sensors over 1,550 ft./475 m.
Kit can be installed at any time.
Alarm setpoints displayed on demand—simply press the
external button
Field programmable alarm levels
Backlight (auto) in low light conditions and alarm
Extensive fault diagnostics
2-way digital communication using MODBUS module
Ordering Information
GP-WD
GP-IR-WD
GP-HD
GP-MD
GP-AD
GP-ZD
GP-DD
GP-SD
GP-XD
GP-CD
Gas Transmitter with Combustible Catalytic Sensor
Gas Transmitter with Combustible Infrared Sensor
Gas Transmitter with H2S Sensor
Gas Transmitter with CO Sensor
Gas Transmitter with NH3 Sensor
Gas Transmitter with HCN Sensor
Gas Transmitter with NO2 Sensor
Gas Transmitter with SO2 Sensor
Gas Transmitter with O2 Sensor
Gas Transmitter with Cl2 Sensor
Accessories and Spares
GP-POWER1 120-240 VAC Power Supply
GP-MBUS3
2-wire MODBUS Communication Expansion Module
GP-MBUS3-4
4-wire MODBUS Communication Expansion Module
GP-SEP
Sensor Separation Kit
GP-1
Gas Transmitter
SS-RW02
Combustible Catalytic Sensor Assembly
IR-RW03
Combustible IR Sensor Assembly
GP-SSPB
Stainless Steel Process Baffle
GP-SSCAL4
Stainless Steel GasPoint Splash Guard
GP-DUC-K1
Duct Mount Adaptor
Replacement Sensor Assemblies
SS-RM02.....CO
SS-RH02.....H2S
SS-RZ02.....HCN
SS-RD02.....NO2
SS-RS02.....SO2
SS-RX02.....O2
www.gasmonitors.com
Email: info@bwtnet.com
www.HSEArya.com
SS-RA02.....NH3
SS-RS02.....NO2
SS-RC02.....Cl2
www.HSEArya.com
SPECIFICATIONS
GasPoint
MONITOR:
Power Input:
Output Current:
LEL, H2S, CO, NH3, HCN,
NO2, SO2, Cl2 or O2
4-20 mA Gas Transmitter
Power Consumption:
Display advises:
Gas type monitored
Continuous (%LEL, %v/v or ppm)
readout of gas concentration
Alarm level and type encountered
- LOW/HIGH or FAULT
When sensor has failed its
automatic daily self-test
“Sensor Replacement” and
“Sensor Expired” indications
When to apply gas during
calibration
SENSORS:
Detection Type:
Self-Test::
Relative Humidity:
Drift:
Gas Monitoring
Specifications
Detectable
LCD
Accuracy Increment
No junction box connection required.
Daily sensor integrity test (auto)
monitors sensor operation, length
of time sensor has been in service
and advises when sensor requires
replacement.
GasPoint allows you to set or change
calibration time and gas alarm
setpoints in the field.
Select or modify the measuring range
using a simple dipswitch.
.
w
For further information:
1-888-749-8878 USA
1-800-663-4164 Canada
+44 (0) 1869 233004 Europe
+971-4-8871766 Middle East
+61-7-3818-8244 Australia
+1-403-248-9226 Other Countries
Corporate Headquarters
2840 - 2 Avenue S.E.
Calgary, AB, Canada T2A 7X9
Ph: +1-403-248-9226
Fax: +1-403-273-3708
E-mail: info@bwtnet.com
www.gasmonitors.com
BW1005-01-01-00-8.25x11-5006-3
Units
Programmed Measuring Ranges
Combustibles - Catalytic
1%
1
-40 to +90°C / -40 to +194°F
%LEL
0-100
Combustibles - Infrared
1%
1
-40 to +70°C / -40 to +150°F
%LEL
0-100
H 2S
0.25 ppm
1
-40 to +50°C / -40 to +122°F
ppm
CO
1 ppm
1
-20 to +50°C / -4 to +122°F
ppm
0-50, 0-100, 0-500, 0-1,000
NH3
1 ppm
1
-10 to +50°C / +14 to +122°F
ppm
0-200, 0-50, 0-500, 0-1,000
HCN
0.1 ppm
0.1
-20 to +50°C / -4 to +122°F
ppm
0-20.0, 0-50.0, 0-100
NO2
0.1 ppm
0.1
-20 to +50°C / -4 to +122°F
ppm
SO2
O2
1 ppm
0.1%
1
0.1
-20 to +50°C / -4 to +122°F
-20 to +50°C / -4 to +122°F
ppm
%v/v
Cl2*
0.1 ppm
0.1
-20 to +50°C / -4 to +122°F
ppm
0-20, 0-50, 0-100, 0-500
0-50.0, 0-10.0, 0-20.0, 0-99.9
0-100, 0-50, 0-20, 0-10
0-30.0%
0-5.0, 0-10.0, 0-100.0
*Note: Cl2 not rated for Class I, Div. 1
CALIBRATION:
Non-intrusive, via pushbutton
Auto zero and auto span
Two backlit liquid crystal displays
LCD 1 3-digit continuous readout of the gas present (ppm, % LEL or %v/v)
LCD 2 Alphanumeric diagnostic status display
Two setpoints: user-selectable
Three SPDT relays; 5 amps at 250 VAC
LOW/HIGH: Field selectable for normally energized/de-energized and latching/
non-latching
FAULT: Normally energized and non-latching
Relay contacts not considered. (For ranges with relays see manual.)
DISPLAYS:
Alarm Setpoints:
RELAY CONTACTS:
TRANSMISSION RANGES:
Conductor Size
CONTROLS:
PHYSICAL:
w
s
w
Temperature Range
m
o
c
.
a
y
r
A
E
S
H
Special Features
Change gases monitored in the field
at any time. The GasPoint Transmitter
will recognize the sensor installed and
test and reset itself to that sensor type.
The optional plug-in MODBUS
expansion module provides an
addressable communications
interface (1-247).
3-wire, 4-20 mA gas transmitter with advanced microcontroller-based circuitry
12 to 32 volts DC
Normal Operation:
Isolated linear 4-20 mA output
Calibration Mode:
Steady 3 mA (auto reset to normal operation)
Fault Mode:
2 mA signal (and less)
Toxic Versions:
40 mA at 24 VDC
Combustible Version: 100 mA at 24 VDC
Relays:
50 mA per relay at 24 VDC
Plug-in, smart sensors
Combustible gases: catalytic or IR; Toxic gases and Oxygen: electrochemical
Automatic daily self-test of sensor integrity and sensor life
5 to 95% RH non-condensing
Zero: <5% per year; Span: <10% per year
Transmitter:
Sensor:
WARRANTY:
Toxic/Oxygen Sensors
Combustible Sensors
22 AWG
0.64 mm
6,712 ft.
2,045 m
3,356 ft
1,022 m
20 AWG
0.75 mm
10,953 ft.
3,253 m
5,336 ft.
1,626 m
18 AWG
1.0 mm
16,953 ft.
5,167 m
8,476 ft.
2,583 m
Calibration: Non-intrusive via external pushbuttonM
Alarm Setpoints: Simple up/down pushbuttons with LCD readout of setpoints
Size: 6.8 x 7 x 4.3 inches / 17 x 17.8 x 10.8 cm (approx.)
Weight: 4.85 lb. / 2.2 kg (approx.)
Nema 4, explosion-proof, anodized aluminum enclosure with mounting flanges
Stainless steel enclosure
Instrument: 2 years non-prorated; Sensor: 2 years full replacement warranty
DUE TO ONGOING RESEARCH AND PRODUCT IMPROVEMENT, SPECIFICATIONS ARE SUBJECT TO CHANGE WITHOUT NOTICE.
RATINGS AND CERTIFICATIONS:
n
Class I, Div. 1, Groups B, C, D
Explosion-proof: ANSI/ISA: UL 1203; CSA: C22.2 No 30
Combustible Performance Standards: ANSI/ISA: ISA-S12.13; CSA: C22.2 No 152
1 Large, backlit LCD readout
of gas concentration
2 Alphanumeric LCD
showing transmitter
STATUS and diagnostics
3 Non-intrusive calibration
via simple pushbutton
4 Interchangeable sensor
types: LEL (catalytic
or IR), toxic gas or
oxygen with common
transmitter assembly
5 Three relays: two
gas alarm relays,
one fault relay
Locally distributed by:
3
1
2
4
www.HSEArya.com
s
I.S. Plant Rat
Intrinsically Safe
Toxic/O2 4-20 mA 2-Wire Gas Transmitters
m
o
c
.
a
y
r
n
A
E
S
H
Fixed Gas Monitoring Systems
.
w
FEATURES:
The I.S. Plant Rat Transmitter provides continuous monitoring for oxygen
or toxic gas hazards in ambient air. Leading the field in accuracy and
speed of response, I.S. Plant Rat is engineered to provide the ultimate in
flexibility and low maintenance.
w
w
Modular engineered design provides the ultimate in flexibility. In the
field you can easily change the gas monitored and/or the measuring
range, and add a sensor separation kit or a duct mount kit.
Encapsulated, plug-in, electronic modules protect against corrosive
environments, moisture invasion and tampering
Direct linear 4-20 mA output for industry standard compatibility
Wide supply voltage range: 12 to 35 volts
Backlit LCD readout (standard)
Eliminate the requirement for hot work permits. I.S. Plant Rat uses
low power technology therefore is not capable of igniting in an
explosive atmosphere when it forms part of an intrinsically safe
installation.
Exterior hinged door for non-intrusive calibration
Calibrate Mode simplifies system start-up and calibration.
I.S. Plant Rat features a timed automatic reset to normal operation
that ensures system integrity.
Ordering Information
Transmitter with Sensor, Digital Display and Measuring
Range Module
ISPR2-DX(#) O2
ISPR2-DE(#)
C2H4O
ISPR2-DH(#) H2S
ISPR2-DY(#)
H2
ISPR2-DM(#) CO
ISPR2-DZ(#)
HCN
ISPR2-DS(#) SO2
ISPR2-DL(#)
HCl
ISPR2-DA(#) NH3
ISPR2 DN(#)
NO
ISPR2 DD(#)
NO2
ISPR2-DC(#) Cl2
ISPR2-DV(#) ClO2
Note: # = Measuring Range. To specify see table on back page.
Accessories and Options
UA-SEP-K2
UA-DUC-K2
UA-SEP-F5
SG-CAL-1
PB-CAL-1
FRM-1
FRM-AC
E0519K
Sensor Separation Kit
Sensor Duct Mount Kit
Flue Vessel Mount Sensor Separation Unit
Splash Guard/Remote Calibration Cup
Process Baffle/Remote Calibration Cup
VDC Field Relay Module
VAC (110-230) Field Relay Module
I.S. Barrier (MTL 787)
Replacement Sensors
PS-RX01
O2
PS-RH01
H 2S
PS-RM01
CO
PS-RS01
SO2
PS-RA01
NH3
PS-RC01
PS-RV01
PS-RE01
PS-RY01
PS-RL01
Cl2
ClO2
C2H4O
H2
HCl
PS-RZ01
PS-RN01
PS-RD01
Low operating, maintenance and installation costs
www.gasmonitors.com
Email: info@bwtnet.com
www.HSEArya.com
HCN
NO
NO2
www.HSEArya.com
SPECIFICATIONS
I.S. Plant Rat
TRANSMITTER:
Power Input:
Output Current:
Calibrate Mode:
Fault Mode:
Current Draw:
4-20mA 2-Wire Gas Transmitter
The I.S. Plant Rat is powered by a 2-wire
loop, providing a direct linear output for
industry-standard compatibility.
SENSOR:
Humidity:
Operating Temperature:
The I.S. Plant Rat’s intrinsically safe
design provides the ultimate in flexibility.
Encapsulated electronics provide
protection against moisture invasion
and corrosive environments. The rugged
housing is a composite material that
provides RFI/EMI protection.
Drift:
Calibration:
LCD
Increments
Units
#=1
#=2
0.1%
0.1%
%v/v
0-25.0%
0-30.0%
H 2S
0.25 ppm
1 ppm
ppm
0-100
0-50
CO
1 ppm
1 ppm
ppm
0-500
0-1000
SO2
0.5 ppm
1 ppm
ppm
0-100
0-50
NH3
0.5 ppm
1 ppm
ppm
0-50
0-100
Cl2
0.1 ppm
0.1 ppm*
ppm
0-5.0
0-10.0
O2
Plug-in electrochemical cell m
5 to 95% RH non-condensing
-25 to +35 °C / -13 to +86 °F - NH3
-40 to +40 °C / -40 to +104 °F - H2S
-20 to +40 °C / -4 to +104 °F - Other toxics and O2
Zero drift: nominal; span drift: <10% per year
Non-intrusive; with auto calibrate mode
Detectable
Accuracy
Gas Monitoring
Specifications
Plug-in sensor and modular plug-in
electronics make it a simple operation to:
2-wire, 4-20 mA intrinsically safe transmitter
12 to 35 volts DC; loop resistance 650 ohms (max) at 24 VDC
Normal operation: linear 4-20mA
Steady 4 mA, automatic reset to normal operation
3.5 mA signal
35 mA (max)
Standard Measuring Ranges Available
#=3
#=4
#=5
0-500
0-20
0-30
0-100
0-50
0-200
0-20
0-10
#=6
m
o
c
.
a
y
r
A
E
S
H
Change the gas monitored
Change the measuring range
Add a sensor separation kit
Add a duct mount kit
The I.S. Plant Rat features non-intrusive,
one person calibration. Simply open the
hinged door to activate calibration mode
(auto).
False system alarms are eliminated
during setup and calibration.
The transmitter resets to normal operation
automatically to ensure system integrity.
ClO2
C2H4O
H2
0-600
0-150
0-100
0.01 ppm
0.01 ppm
ppm
0-5.00
0-1.00
0.1 ppm
0.1 ppm*
ppm
0-10.0
0-20.0
0-100
1 ppm
1 ppm
ppm
0-100
0-200
0-800
HCl
0.1 ppm
0.1 ppm*
ppm
0-10.0
0-20.0
0-100
HCN
0.1 ppm
0.1 ppm*
ppm
0-20.0
0-50.0
0-100
NO
0.5 ppm
1 ppm
ppm
0-50
0-100
NO2
0.1 ppm
0.1 ppm
ppm
0-10.0
0-20.0
* NOTE: LCD Increments vary according to the measuring range specified on these units
Sensors, including oxygen and hydrogen
sulfide, are warranted for two years.
With greater accuracy, a faster speed of
response and a stable zero, the I.S. Plant
Rat provides increased reliability and
early hazard warning.
DISPLAY:
PHYSICAL:
Weight:
Hinged Door:
Enclosure:
WARRANTY:
.
w
w
s
w
E-mail: info@bwtnet.com
www.gasmonitors.com
BW1005-01-01-00-8.25x11-5127-2
Size: 4.7 x 4.7 x 3 in. / 12 x 12 x 7.5 cm
1.65 lb. / 750 g
Secures calibration access
Rugged, Nema 4, RFI/EMI shielded composite material 2-part case with
2 cable ports
Instrument: 2 year non-prorated warranty (NH3 sensor: 1 year)
Sensors: 2 year full replacement warranty (NH3 sensor: 1 year)
Life expectancy: Toxics > 3 years; O2 > 2 years; NH3 >1 year
DUE TO ONGOING RESEARCH AND PRODUCT IMPROVEMENT, SPECIFICATIONS ARE SUBJECT TO CHANGE WITHOUT NOTICE.
RATINGS AND CERTIFICATIONS:
(Intrinsically safe with barrier)
For further information:
1-888-749-8878 USA
1-800-663-4164 Canada
+44 (0) 1869 233004 Europe
+971-4-8871766 Middle East
+61-7-3818-8244 Australia
+1-403-248-9226 Other Countries
Corporate Headquarters
2840 - 2 Avenue S.E.
Calgary, AB, Canada T2A 7X9
Phone: +1-403-248-9226
Fax: +1-403-273-3708
Large, backlit LCD readout
n
to both U.S. and Canadian standards
Class I, Div. 1, Gr. A, B, C, D
Class II, Div. 2, Gr. E, F, G
7
Locally distributed by:
1 Inhibited output during calibration
prevents false system alarms
2 Non-intrusive, one-person calibration
3 Intrinsically safe: sensor and
electronic modules can be
changed or serviced under power
4 Faster speed of response
ensures early, reliable detection
and warning
5 Backlit display
6 Hinged door protects calibration
7 Low maintenance and
installation costs
www.HSEArya.com
CD-420
CO, NH3, CI2, H2S, NO2, SO2, HCN, or O2
4-20 mA 2-Wire Gas Transmitter
s
m
o
c
.
a
y
r
X
n
A
E
S
H
plus
others
Fixed Gas Monitoring Systems
.
w
FEATURES:
The CD-420 4-20 mA, 2-wire transmitter provides continuous monitoring
for toxic and oxygen gas hazards in ambient air. Engineered with BW fieldproven industrial sensing and instrument technology, the CD-420 is virtually
maintenance free.
Reduced operating, maintenance and installation costs
w
w
Accurate, reliable performance that eliminates false alarms
Modular, plug-in encapsulated components and plug-in sensor
Linear 4-20 mA output with a wide supply voltage range (12 to 35V)
Electrochemical sensor
Micropower analog technology, draws only 20 mA in operation
Ordering Information
Transmitter c/w Sensor and Measuring Range Module Selected
CD-420-3M(#) CO “–3M models “
CD-420-3H(#) H2S
CD-420-3A(#) NH3
CD-420-3C(#) Cl2
CD-420-3S(#) SO2
CD-420-3D(#) NO2
CD-420-Z(#) HCN
CD-420-X(#) O2
CD-420-M(#) CO
Note: # = Measuring Range. To specify see table on back page.
For other gases contact BW Technologies.
Hinged operations door
Accessories and Spares
Power ON LED
CD-SEP-K3
UA-DUC-K2
FRM-1
FRM-AC
PS-RM01
PS-RH01
PS-RA01
PS-RC01
If a system fault occurs or the sensor is degrading, the CD-420 will
transmit a signal to the controller.
Change the measuring range or gas sensed in the field (all models except
CD-420-3M# carbon monoxide models)
2 year, non-prorated instrument and sensor warranty
Sensor Separation Kit
Remote Duct Mount Kit
VDC Field Relay Module
VAC (110-230) Field Relay Module
CO sensor
PS-RS01 SO2 sensor
H2S sensor
PS-RD01 NO2 sensor
PS-RZ01 HCN sensor
NH3 sensor
Cl2 sensor
PS-RX01 O2 sensor
www.gasmonitors.com
Email: info@bwtnet.com
www.HSEArya.com
www.HSEArya.com
CD-420
SPECIFICATIONS
TRANSMITTER:
4-20 mA 2-Wire Gas Transmitter
Supply Voltage:
Loop Resistance (max):
The CD-420 Transmitter is shipped
factory tested and calibrated, ready
for immediate installation.
Current Consumption:
Signal Range (18 AWG):
Gas detection equipment is
only as good as its sensor. BW
electrochemical sensors provide:
2-wire, 4-20 mA Industrial Micropower Transmitters
CD-320-3M Models
Status Indicator (internal):
Reliable protection
Accurate performance
Long life
Normal Operation:
Power Off:
Sensor Fault:
Overrange:
Auxilliary Outputs (2):
Standard Models
10-28V
12-35V
650 ohms at 28 VDC;
50 ohms at 10 VDC
650 ohms at 24 VDC
20 mA (max)
20 mA
31,300 ft / 9,600 m
LED Indicator
31,300 ft / 9,600 m
Current Output
Power ON
LED Off
Slow flashes
—
—
Indicators
4-20 mA
0 mA
U 2 mA
24 mA
250 mA at VDC
Power ON
LED Off
—
—
—
Daily Sensor Self Test:
Advanced micropower electronic
technology delivers superior
performance, eliminating false
alarms and providing a linear output
for direct compatibility with existing
control systems.
With a faster response time,
the CD-420 provides reliable
early hazard warnings at an
affordable price.
.
w
w
s
w
4-20 mA
0 mA
3.5 mA
24 mA
—
N/A
m
o
c
.
a
y
r
A
E
S
H
In the event of power outages,
troublesome start-up alarms are
eliminated. The CD-420 resets
automatically back into the system
loop, ensuring system integrity.
Note: CD-420-3M models for
CO are equipped with two
250 mA auxiliary outputs. Output 1
is activated by low alarm. Output 2
is activated by high alarm, sensor
expired advice, system fault or
sensor fault alarms.
Current Output
SENSOR:
Drift:
Humidity:
Operating Temperature:
Gas Monitoring
Specifications
Plug-in, industrial gas specific, electrochemical cell
Zero drift: nominal; Span drift: <10% of reading per year
5 to 95% RH non-condensing
NH3: -25 to +35°C / -13 to +86°F
H2S: -40 to +50°C / -40 to +122°F
Other toxics and O2: 20 to +50°C / -4 to +122°F
Detectable
Accuracy
Standard Measuring Ranges Available
Units
#=1
#=2
#=3
#=4
CO (-3M)
1 ppm
ppm
0-500
0-1000
0-100
CO
1 ppm
ppm
0-500
0-1000
0-100
NH3
0.5 ppm
ppm
0-50
0-100
0-350
Cl2
0.1 ppm
ppm
0-5.0
0-10.0
0-100
0-500
0-20
0-2.0
H2S
1 ppm
ppm
0-100
0-50
NO2
0.1 ppm
ppm
0-10.0
0-20.0
SO2
1 ppm
ppm
0-50
0-20
0-10.0
HCN
0.1 ppm
ppm
0-20.0
0-50.0
0-100
0.1 %
%v/v
0-25.0%
0-30 %
O2
FEATURES:
PHYSICAL
WARRANTY:
Sensors:
Life Expectancy:
#=5
#=6
0-200
0-50
0-200
0-600
0-150
0-30
Power-up delay: eliminates start-up alarms m
Auto reset: automatically resets back in system loop after power failures
and/or brownouts
Rugged, RFI/EMI shielded enclosure with 2 cable ports
Size: 6.1 x 5 x 2.3 in. / 15.25 x 12.5 x 5.75 cm; weight: 1.65 lb. / 750 g
2 year non-prorated warranty (NH3 sensor: 1 year)
2 year full replacement warranty (NH3 sensor: 1 year)
Toxics > 3 years; O2 > 2 years
DUE TO ONGOING RESEARCH AND PRODUCT IMPROVEMENT, SPECIFICATIONS ARE SUBJECT TO CHANGE WITHOUT NOTICE.
RATINGS AND CERTIFICATIONS:
Standard Models:
CSA to both U.S. and Canadian
Standards General Purpose
CD-420-3M Models:
CSA to both U.S. and Canadian Standards:
General Purpose
Certified to IEC STandard: No. 61010-1
CE: Conforms to European Union directives
Enclosure: Type IP46 (NEMA 4 equivalent)
For further information:
Website: www.HSEArya.com
Tel: +9821-55425307
Email: info@HSEArya.com
Telegram ID: @HSEArya_PPE
Instagram ID: @HSEAryaPPE
Corporate Headquarters
2840 - 2 Avenue S.E.
Calgary, AB, Canada T2A 7X9
Fax: +1-403-273-3708
E-mail: info@bwtnet.com
www.gasmonitors.com
BW1005-01-01-00-8.25x11-5006-3
1
2
3
4
5
6
7
8
Locally distributed by:
Eliminate false alarms
Electrochemical sensor
Power ON LED
Direct linear output
Secure hinged door access
Lower operating costs
Measuring range module
Rugged, modular design
www.HSEArya.com
s
RRJ Series
H2S or Combustible Gases
Zero-Maintenance Gas Transmitters
m
o
c
.
a
y
r
n
A
E
S
H
An Industry First
Maintenance-free 4-20 mA
Gas Transmitter
4-20 mA Transmitter with Sensor
.
w
FEATURES:
The rugged, zero-maintenance RRJ Series Transmitters for H2S or
combustible gases come complete with sensor and provide a 4-20 mA
signal that is compatible with any 4-20 mA control system (DCS, PLC,
BW RRJ-4000 and CR-4000 controllers, etc.).
w
w
Eliminate maintenance—no calibration required, no sensor
replacement required, no downtime
Rugged, durable, polyurethane encapsulated transmitter
with sensor
Quick disconnect with military-style plug-in wiring connector
during installation and decommissioning
2 year operational life
Daily, automatic, full-function self-test of sensor and circuitry
integrity
LED red visual alarm
Ordering Information
Zero-maintenance, 2-year, 4-20 mA transmitter with sensor, and
field-replaceable sensor screen
RRJ-RH04
RRJ-RW04
2-wire Hydrogen Sulfide (0-100 ppm)
3-wire Combustible (0-100% LEL)
Accessories and Options
RRJ-SC010-K 10 ft. / 3 m plug-in factory built sensor cables
RRJ-SC###-K Other lengths up to 1,000 ft. / 305 m in
10 ft. / 3 m increments
RRJ-FW1-K
Field wiring plug-in connector kit
RRJ-PT1-K
Pigtail connector
RRJ-FIL-K5
Sensor screen replacements (kit of 5)
Compatible with all 4-20 mA Controllers
and the following BW Controllers:
RRJ-4000
4 Channel AC/DC Stainless Steel Controller
CR-4000
4 Channel AC/DC Controller
Electrochemical sensor (H2S) or
Catalytic bead sensor (combustible gases)
Wide supply voltage range—10 to 28 VDC for industry-standard
compatibility
Low initial cost—competitively priced
www.gasmonitors.com
Email: info@bwtnet.com
www.HSEArya.com
www.HSEArya.com
SPECIFICATIONS
RRJ Transmitters
with Sensor
H2S or Combustibles
Transmitter with Sensor:
Supply Voltage:
Supply Current:
EMI/RFI:
TRANSMISSION RANGE:
SENSORS:
BW Technologies introduces the first
zero-maintenance, 4-20 mA
transmitters on the market.
BW Technologies has applied cuttingedge science developed for the
world’s most advanced disposable gas
detector—the GasAlertClip—to the
RRJ Series
of transmitters.
Gases Monitored
H 2S
Combustibles
Humidity:
Calibration:
FULL FUNCTION SELF-TEST:
Verifies:
Daily Automatic Self-Test
The full function self-test is a unique
safety advantage that verifies circuitry
integrity and checks the sensor’s
response to gas.
VISUAL ALARM:
STATUS ADVISE:
Corporate Headquarters
2840 - 2 Avenue S.E.
Calgary, AB, Canada T2A 7X9
Tel: +1-403-248-9226
Fax: +1-403-273-3708
E-mail: info@bwtnet.com
www.gasmonitors.com
BW1019-01-01-00-8.25x11-5131-4
-40 to + 122°F; -40 to + 50°C
2-wire
Catalytic
0-100% LEL
-40 to + 122°F; -40 to + 50°C
3-wire
Temperature Range
Cable
5 to 90% non-condensing
Factory calibrated. Not required for operational life.
Daily (auto) and each time power is applied (auto)
Sensor integrity and circuitry integrity
Red light emitting diode (LED)
Advise Signals
LED Indicator
Current Output*
Normal Operation
ON
4-20 mA
Over Range Alarm
ON
21 mA
Life Ending Warning
Slow flashes (1 per 2 seconds)
2 mA
4-20 mA
Operational Life Ended
OFF
2 mA
Power OFF
OFF
0 mA
*Current Output: Signal to control system (DDC, PLC, etc.)
ALARM OUTPUTS:
PHYSICAL:
Connector:
OPERATING LIFE:
Warranty:
Two are available if required; rated 250 mA @ 24 VDC
Two factory specified alarm levels (LOW and HIGH)
Rugged polyurethane encapsulated enclosure
Size: 2.65 x 2.3 x 3.25 in. / 6.73 x 5.84 x 8.25 cm
Weight: approx. 6.2 oz. / 175 g
Plug-in, military-style, 6-pin connector
Accepts field wiring kit, pigtail assembly or optional BW plug-in remote
RRJ sensor cables
2 years
2 years including sensors
DUE TO ONGOING RESEARCH AND PRODUCT IMPROVEMENT, SPECIFICATIONS ARE SUBJECT TO CHANGE WITHOUT NOTICE.
RATINGS AND CERTIFICATIONS:
(INTRINSCALLY SAFE WITH BARRIER)
n
to both U.S. and Canadian Standards
Class I, Div. 1, Gr. A, B, C, D
Class I, Zone 0, Gr. IIB
1
5
3
4
For further information:
Website: www.HSEArya.com
Tel: +9821-55425307
Email: info@HSEArya.com
Telegram ID: @HSEArya_PPE
Instagram ID: @HSEAryaPPE
Electrochemical
Measuring
Range
0-100 ppm
Sensor Type
Fault: Self-Test Fail Fast flashes (1 per 0.5 seconds)
.
w
w
s
w
1,000 feet / 305 m with 22 AWG / 0.64 mm cable
m
o
c
.
a
y
r
A
E
S
H
Operational Life
The operational life is two years in
normal use. The life counter is activated
when power is applied and runs
continuously while the transmitter is
operating. If power is interrupted, the
counter stops and will resume counting
when power is restored.
Life-Ended Warning and Alarm
One month prior to the end of the
transmitter’s operational life, the LED
will begin a slow flash warning. When
the 2 year operational life is over,
the monitor will send a 2 mA signal
to the controller advising that
the monitor is now disabled and
requires replacement.
4-20 mA gas transmitter with advanced microprocessor-based circuitry
10 VDC (min.) to 28 VDC (max.)
H2S: 50 mA; Combustibles: 100 mA
Complies with EMC Directive 89/336/EEC
2
Locally distributed by:
1
Rugged, encapsulated
enclosure with predrilled
mounting flanges—only
the sensor is exposed
2
LED alarm indicator
3
Sensor (behind sensor screen)
4
Washable, replaceable second
sensor screen
5
Plug-in field wiring connector
www.HSEArya.com
Alarm Rat
Single Point AC or DC Gas Alarm
Stand-Alone Monitor for Toxic and Oxygen Hazards
s
FEATURES:
The Alarm Rat is the complete, stand-alone single-point
monitor alarm system that’s delivered ready for use. Full
flexibility is built-in, change the gas sensed or the measuring
range at any time. Equipped with four relays to control and
activate remote alarms and other field interfaces.
m
o
c
.
a
y
r
A
E
S
H
Three alarm levels and power failure alarm
Four 15 amp SPDT normally energized relays
101 dB siren and LED alarms
Modular engineered design provides the ultimate in
flexibility. In the field, change the gas monitored and/or
the measuring range, add a sensor separation kit or duct
mount kit
AC and DC compatible, 4-20 mA output option
Failsafe calibration reset
Accurate, reliable performance
Exterior hinged door for non-intrusive calibration
Lower operating, maintenance and installation costs
Fixed Gas Monitoring Systems
w
w
.
w
Self Contained Simply Connect Power
Ordering Information
Monitor with Sensor, Digital Display, Relays, Audible/Visual
Alarms
AR-PRX(#)-2D
AR-PRH(#)-2D
AR-PRM(#)-2D
AR-PRS(#)-2D
AR-PRA(#)-2D
AR-PRC(#)-2D
AR-PRV(#)-2D
O2
H2S
CO
SO2
NH3
Cl2
ClO2
AR-PRE(#)-2D
AR-PRY(#)-2D
AR-PRZ(#)-2D
AR-PRL(#)-2D
AR-PRN(#)-2D
AR-PRD(#)-2D
C2H4O
H2
HCN
HCl
NO
NO2
Note: # = Measuring Range. To specify see table on back page.
Accessories and Options
UA-SEP-K2
Sensor Separation Kit
UA-DUC-K2
Sensor Duct Mount Kit
UA-SEP-F5(x#) Flue Vessel Mount Sensor Separation Unit
SG-CAL-1
Splash Guard/Remote Calibration Cup
PB-CAL-1
Process Baffle/Remote Calibration Cup
Replacement Sensors
PS-RX01....O2 PS-RC01 ...Cl2
PS-RZ01 ....HCN
PS-RH01 ...H2S PS-RV01 ...ClO2
PS-RN01....NO
PS-RM01 ...CO PS-RE01 ...C2H4O PS-RD01....NO2
PS-RS01....SO2 PS-RY01 ...H2
PS-RA01....NH3 PS-RL01....HCl
www.gasmonitors.com
Email: info@bwtnet.com
www.HSEArya.com
www.HSEArya.com
SPECIFICATIONS
Alarm Rat
MONITOR:
Stand-Alone Gas Monitor
The Alarm Rat, with all the features builtin, is delivered ready for use. Designed
for easy operation, no special knowledge
is required, simply plug in power.
Power Input:
SENSOR:
Plug-in, gas specific, electrochemical cell
Humidity:
5 to 95% RH non-condensing
Operating Temperature:
Drift:
With three alarm levels, you will be
immediately warned of a gas hazard by
the built-in visual and audible alarms.
Simple slide switches are used to set
alarm levels.
Gas Monitoring
Specifications
LCD
Increments
Units
0.1 %
0.1%
%v/v 0-25.0% 0-30.0%
Hydrogen Sulfide
0.25 ppm
1 ppm
ppm
0-100
Carbon Monoxide
0.5 ppm
1 ppm
ppm
0-500
Sulfur Dioxide
0.5 ppm
1 ppm
ppm
0-100
Ammonia
Chlorine
.
w
www.gasmonitors.com
BW1022-01-01-00-8.25x11-5217-2
0-50
#=3
#=4
#=5
#=6
0-500 0-20 0-30
0-1000 0-100 0-50 0-200 0-600
0.5 ppm
1 ppm
ppm
0-50
0-20 0-10
0-50
0-100
0-10.0 0-100
0.1 ppm
0.1 ppm*
ppm
0-5.0
0.01 ppm
ppm
0-5.00
0-1.00
Ethylene Oxide
0.1 ppm
0.1 ppm*
ppm
0-10.0
0-20.0 0-100
1 ppm
1 ppm
ppm
0-100
0-200 0-800
Hydrogen Chloride
0.1 ppm
0.1 ppm*
ppm
0-10.0
0-20.0 0-100
Hydrogen Cyanide
0.1 ppm
0.1 ppm*
ppm
0-20.0
0-50.0 0-100
Nitric Oxide
0.5 ppm
1 ppm
ppm
0-50
0-100
0.1 ppm
0.1 ppm
ppm
0-10.0
0-20.0
Hydrogen
* NOTE:
DISPLAY:
ALARM:
0-150
LCD Increments may vary according to the Measuring Range specified
Large 3.5 digit backlit LCD readout module
Visual:
Audible:
Three (3) user settable alarm Levels (Low, Mid, High)
Four (4) LEDs, color-coded (Power/ON: Low, Mid, High alarms)
High output fast pulsed siren 101 dB @ 3 ft. (1 m)
RELAYS:
Four 15 amp SPDT normally energized (3-Gas Alarms, 1-Fault)
Enclosure:
Options:
E-mail: info@bwtnet.com
#=2
0.01 ppm
PHYSICAL:
Corporate Headquarters
2840 - 2 Avenue S.E.
Calgary, AB, Canada T2A 7X9
Phone: +1-403-248-9226
Fax: +1-403-273-3708
#=1
Chlorine Dioxide
Nitrogen Dioxide
All sensors, including oxygen, have a
two year warranty. With greater accuracy
and a faster speed of response, the BW
sensor provides increased reliability and
early warning.
For further information:
1-888-749-8878 America
1-800-663-4164 Canada
+44 (0) 1869 233004 Europe
+971-4-8871766 Middle East
+61-7-3818-8244 Australia
+1-403-248-9226 Other Countries
Standard Measuring Ranges Available
m
o
c
.
a
y
r
A
E
S
H
The plug-in sensor and modular
electronics make it simple to:
Change the gas monitored
Change the measuring range
Add a Sensor Separation Kit
w
s
w
-25 to +30°C (-13 to +86°F) - Ammonia
-40 to +50°C (-40 to +122°F) - Hydrogen Sulfide
-20 to +50°C (-4 to +122°F) - Oxygen and other Toxics
Zero: Nominal Span: <5% per year
Detectable
Accuracy
Oxygen
Dangerous levels of gas and/or a power
failure activate four 15 amp, SPDT relays.
These relays trigger remote alarms,
control functions or other field interfaces.
Stand Alone Single Point Hazardous Gas Alarm
115 VAC and 24 VDC compatible (230 VAC optional)
WARRANTY:
Size: 9.5 x 4.7 x 3 inches (24 x 12 x 7.5 cm)
Weight: 3.25 lbs. (1.5 kg)
Rugged, RFI/EMI shielded enclosure c/w 3 cable ports
4-20 mA output, Splash Guards, Process Baffles
Remote: Standard Sensor Separation Kit, Duct Mount Kit, Flue Vessel Mount
2 Year non-prorated warranty
DUE TO ONGOING RESEARCH AND PRODUCT IMPROVEMENT, SPECIFICATIONS ARE SUBJECT TO CHANGE WITHOUT NOTICE.
DESIGNED FOR:
Ordinary Locations
1 Four 15 AMP SPDT relays
2 101dB siren and large LED visual
alarms
3 Three gas alarm levels and
power failure alarm
4 Plug-in sensor and electronic
modules increase flexibility
5 Easy installation and lower
maintenance costs
6 Backlit large LCD display
5
2
3
1
6
The Complete Monitor
-delivered ready to use
-simply connect power
Locally distributed by:
www.HSEArya.com
Stand-Alone
Systems
BW Technologies
With applications ranging from
deserts to the Arctic, BW's
stand-alone systems feature
real-time data transmission
between remotely located
detector, sensor and base
controller up to 4.5 miles / 7.25
km away. The easy-to-install
systems come complete with
zero-maintenance, intrinsically
safe classified sensors and
provide continuous monitoring
for toxic gases, combustibles
and oxygen hazards—at an
affordable price.
m
o
c
.
a
y
r
A
E
S
H
w
w
.
w
For further information:
:HEVLWHZZZ+6($U\DFRP
7HO
(PDLOLQIR#+6($U\DFRP
7HOHJUDP,'#+6($U\DB33(
,QVWDJUDP,'#+6($U\D33(
www.HSEArya.com
The BW Stand-Alone Advantage
Performance
BW’s performance standards lead the industry. Our wireless systems operate
in extreme environments, have low drift rates and are virtually unaffected by
humidity. Long-life poison-resistant electrochemical and catalytic sensors
ensure accurate, reliable performance.
Flexibility
Industry requires a flexible approach to gas monitoring. You require an
application-specific monitoring system that has the versatility to evolve and
grow as your requirements change. A building block approach has been used
in the design of all BW gas detection systems. Our systems can be easily
reconfigured as your needs change and grow.
m
o
c
.
a
y
r
A
E
S
H
Cost Effectiveness
BW stand-alone systems provide an efficient solution to gas monitoring needs.
Rapid response time, high circuit stability and simplicity of use ensure
confidence and reduce maintenance costs. Our battery-powered, solar-capable
systems operate independently, allowing fast and easy installation, removal
and relocation.
Power
Variable power sources ensure continuous monitoring capabilities and provide
flexible protection on any site. A full range of power options are available:
• Battery
• Solar
• 110, 230 VAC
• 24 VDC direct
w
w
.
w
www.HSEArya.com
s
STAND ALONE GAS DETECTION SYSTEM
Information Library
Service and Repair
Training Services
RIG RAT III WIRELESS MULTI-POINT SYSTEMS
m
o
c
.
a
y
r
A
E
S
H
System Overview
Wireless System................................ 2
Non-Wireless System........................ 7
Gas Detector - Features / Specifications (Datasheet) .......... 9
Detector Elements ........................................................ 10
RIG RAT III DETECTOR
PLUG-IN REMOTE ACCESSORIES AND OPTIONS
Sensors
Audible/Visual
MOB
Relays
Dataloggers
Power
Mounting Kits
w
w
.
w
Combustible .................................... 11
Toxic and Oxygen............................ 12
Remote Detector Alarms ................. 14
Multiple Option Box ......................... 16
Solenoid Driver................................ 17
Single & Dual AC/DC Relays .......... 18
........................................................ 20
Independent Power Choices
Solar/Line/Bench Chargers ............. 21
Tripods and Wall Mounting Kits....... 25
RIG RAT III CONTROLLER AND SYSTEM
OPTIONS
Controllers - 4 Detector (1-8 Sensors) ............................ 26
Remote Plug-In Controller Options
Audible/Visual Alarms ..................................................... 28
Wireless Technology ....................................................... 29
Order Information Condensed Version......................... 31
www.HSEArya.com
s
SYSTEM OVERVIEW
RIG RAT III - WIRELESS SYSTEM
Order No: RR-3000
BW Technologies has taken state-of-the-art detection to another level with the new Rig Rat III stand-alone system. Selfpowered and solar-capable, the Rig Rat III provides wireless monitoring for toxic gases, combustibles and oxygen hazards—with maximum efficiency.
Meeting Industry’s Needs
Performance
Building Block Approach
Industry requires a flexible approach to
gas monitoring. Each site and application
is different and constantly undergoing
change.
BW has set rigorous performance
standards that lead the industry. The
Rig Rat III Wireless System is virtually
unaffected by humidity, operates in
extreme environments and has a low
drift rate. Long-life, poison-resistant
electrochemical and catalytic sensors
ensure accurate, reliable performance.
The power-efficient units use less
than 1% of the power required by
conventional equipment.
A building block approach has been used in the
design of all BW gas detection systems. Rig
Rat III systems have the versatility to evolve and
grow as your requirements change.
m
o
c
.
a
y
r
A
E
S
H
Modular Design
BW has designed the Rig Rat III System
so that all components are modular.
Compatible plug-in components let you
customize the total system and each
individual detection point. The system
can be easily reconfigured as your needs
change and grow. Two plug-in Option Ports
are provided per Detector.
.
w
Audible and Visual Alarms
w
w
A full range of plug-in audible and visual
alarms, as well as receiving alarms for both
Detectors and Controllers are available
to customize an installation to the specific
requirements of your site.
Hazardous Gas Measurement: Monitor
Combustibles, Oxygen and/or Toxic gases.
Change the gas monitored at any time.
Sensors may be remotely placed up to 250
ft (75 meters) away from the Detector.
2
Cost Effectiveness
Instantaneous communication of sensor
readings and system status information between
the Controller and remotely located Detectors
and other system elements is by means of realtime radio frequency (RF) link. Use of real-time
RF communication to link system elements
eliminates the need for expensive hard-wired
connection. Rapid response time, high circuit
stability and user simplicity ensure confidence
as well as reduced maintenance costs. The
battery powered, solar capable Detector
operates independently, allowing fast and easy
installation, removal and relocation.
Power
A full range of Power Options are available from:
Battery
Solar
110, 230 VAC
24 VDC direct
Giving you complete flexibility to provide
monitoring protection on any type of site.
www.HSEArya.com
s
RIG RAT III
WIRELESS INTEGRATED MULTI-POINT
HAZARDOUS GAS DETECTION SYSTEM
The Rig Rat III is suited to dozens of industrial applications, including drilling rigs, HAZMAT and perimeter monitoring.
Modular, plug-in ports allow quick installation of all components and field interfaces, so system requirements are easily accommodated as they evolve. Remote sensors, alarms and relays can be added at will. This flexibility extends to
power options —select independent battery, solar or line power at any time.
m
o
c
.
a
y
r
A
E
S
H
Signal Transmission
The Rig Rat III Controller is in constant two-way communication with all remotely located system elements. Radio transmission
.
w
signals from Detectors to a Central Controller and Receiving Alarms allow you the flexibility to place or move your detection points as
required, and eliminate the need for expensive hard-wired connection. Rig Rat III Controllers include outputs that allow readings and
alarm state information to be directly communicated to site telemetry PLC or DTS systems.
Relays
Plug-in relays for Controllers and Detectors control and trigger site-specific field interfaces and alarms.
w
w
Other Options
Dataloggers, Repeater Stations and Solenoid Drivers, etc. are available for you to customize the system for specific applications.
*
Remote rechargable
Receiver Strobe(s) receives
Detector’s transmission and
flashes Alarm condition.
Detector in Alarm or Test
transmits an Alarm signal.
3
Controller receives Detector
transmissions and triggers
Controller Transmitter.
*check factory for availability
www.HSEArya.com
s
RIG RAT III APPLICATION PHOTOS
WIRELESS AND NON-WIRELESS SYSTEM
VERSATILITY - Systems can be readily installed, expanded or modified
without disturbing the workplace.
FLEXIBILITY - Independent compatible sensors, Detectors, Controllers,
alarms, and relays can be easily added or removed to customize the
system in response to on-going change.
REDUCED COSTS - Dramatically lower installation and maintenance
costs.
m
o
c
.
a
y
r
A
E
S
H
.
w
w
w
Facility Monitoring: Rig Rat III provides complete
flexibility. Operate via line, battery, or solar power.
Communication via wireless RF link. Components can be
permanently installed or system can be portable, for easy
relocation or deployment.
Residential Monitoring: This system provides permanent monitoring in a
1.8 mile / 3 km radius around the plant.
4
www.HSEArya.com
s
RIG RAT III
CONTINUOUS CONFINED SPACE ENTRY
Compressor Building
m
o
c
.
a
y
r
A
E
S
H
w
w
.
w
5
www.HSEArya.com
s
RIG RAT III
REMOTE SENSORS
Intrinsically Safe
REMOTE MONITORING
COST EFFICIENT
Oxygen and Toxic sensors can be remotely placed up to 250 feet
or 75 meters (combustible sensors up to 100 feet or 33 meters)
away from the Detector for optimum results when monitoring
Hazardous gases.
All gas detection instruments require periodic verification of proper
performance. BW’s sensors have a lower drift rate of +/- 1% per
month which is considerably less that other competitor’s sensors
on the market. The result is major cost savings over the long term
in maintenance and operation.
The Detector can then be conveniently placed for accessibility.
m
o
c
.
a
y
r
A
E
S
H
.
w
Sensor Mounted Under Pipeline
w
w
RELIABILITY and ACCURACY
We brought together the world’s foremost sensing and
microelectronics technology for your safety and piece of mind. Our
field-proven sensors offer unsurpassed excellence in accuracy,
speed and stability. BW’s sensors will not “go to sleep”, are poison
resistant, and will not fail to recognize the presence of gas. BW’s
sensors offer the reliability and accuracy demanded in today’s
marketplace, and for the protection of your working environment.
Remote Sensor mounted on wall.
UNPRECEDENTED FLEXIBILITY
All remote Rig Rat III Combustible, Oxygen, and Toxic Sensors
are fully compatible with BW Detectors. The full range of sensors
are completely interchangeable, allowing you the option to select
and change the gas being monitored as your site requirements
change. Equipped with quick connectors, you simply plug in a new
sensor unit and calibrate the Detector to the new gas.
6
www.HSEArya.com
s
SYSTEM OVERVIEW
RIG RAT III NON-WIRELESS SYSTEM
Order no. RR-3000S
Rig Rat III systems are available in wireless and non-wireless versions.
PERFORMANCE
BW has set rigorous performance standards that lead the industry.
The Rig Rat III has a low drift rate, wide temperature operating
range and is virtually unaffected by humidity. The field proven Rig
Rat III provides the reliability and accuracy demanded by industry
today. The power efficient units use less than 1 % of the power
required by conventional equipment.
GENERAL
The Rig Rat III Non-Wireless is a self-contained Stand Alone Gas
Monitoring System that provides continuous single or multi-point
protection for a full range of toxic, oxygen and combustible hazardous
gases.
m
o
c
.
a
y
r
A
E
S
H
The intrinsically safe c-CSA-us classified Rig Rat III uses advanced
electronic and sensing technology to provide instantaneous detection
and warning.
MODULAR DESIGN
The modular stainless steel Rig Rat III is designed for the most
rugged environments. Compatible plug-in components let you
customize each individual detection point. The system can be
easily reconfigured as your needs change and grow.
1) STAND ALONE SYSTEM
Rig Rat III Non-Wireless systems are ideal for single or dual point,
independent and/or remote location installation. The system’s
stability and power independence permit long term unattended
operation. Solar powered for year round maintenance-free
operation, the system provides continuous monitoring at sites
where conventional power is unavailable or cost prohibitive.
VERSATILE
w
w
.
w
The Rig Rat III is designed to provide the utmost in versatility and
flexibility. The Rig Rat III includes a built-in backup power supply,
audible and visual alarms, two sensor ports for remote sensors,
as well as solar and line power connections. The Rig Rat III is a
complete Stand Alone system.
Two option ports and a charger port are provided to expand the
capabilities of the system with off-the-shelf components.
Each point can be easily configured as requirements change. Not
dependant on line power, it provides reliable, high performance
monitoring in remote locations.
COST EFFECTIVE
The system is virtually maintenance-free. Rapid response
time, high circuit stability and user simplicity ensure confidence.
The battery powered, solar capable and independent Rig Rat
III is easily maintained by field personnel. Zero-maintenance
combustible sensors generally do not require calibration over their
entire 2-year operational life. All that is necessary to verify proper
performance is a simple functional “bump test.”
7
www.HSEArya.com
s
RIG RAT III NON WIRELESS
STAND-ALONE INDEPENDENT GAS MONITORING SYSTEM
The Rig Rat III non wireless gas detection system is a:
Audible & Visual Alarms
1) PORTABLE SYSTEM:
The Rig Rat III has built-in audible and visual
alarms. A wide variety of remote audible and visual
alarms equipped with quick connects are available
to alert personnel as they approach the area.
The system is designed for portability. Completely self-contained with built-in
alarms, the Rig Rat III takes under 5 minutes to set-up. All gas specific sensors are
compatible, permitting the system to be used for a wide variety of applications.
m
o
c
.
a
y
r
A
E
S
H
Sensing Capability
The Rig Rat III Detector is fully compatible with
all 16 available gases monitored by the remote
sensing units, providing the flexibility to easily
change the hazardous gas(es) being monitored.
Each Detector is equipped with two sensor ports,
for connection with any two remotely located
sensors. The Remote Sensor Units and sensing
cables (up to 250 ft. or 75 m long) are RFI/EMI
protected.
2) SERVICE VEHICLE MOBILE MONITORING SYSTEM:
The Rig Rat III provides continuous protection for personnel at sites they are servicing.
Two sensors (one located in the cab and the second on a 250 ft. (75 m) cable roll),
powered by 24 VDC direct from the truck, the Rig Rat III is an ideal mobile monitor.
w
w
.
w
Power Flexibility
Independent of line power, your gas monitoring
system will still be operating in the event of a
power failure or brownout. A full range of power
choices are available to provide monitoring
protection in any locale or on any type of site.
Battery operated
Solar charged for maintenance-free operation
Line 110, 230 VAC
12 or 24 VDC direct
Other Equipment
Plug-in relays control and trigger site specific field
interfaces and alarms.
3) MULTI-POINT STAND-ALONE MONITORING SYSTEM:
The alarm outputs of the Rig Rat III Detector can be tied directly into existing site
telemetry, PLC or DIS systems. The Rig Rat III design allows the easy integration of
independently solar powered portable or permanently installed Detectors into existing
overall site monitoring systems.
8
www.HSEArya.com
RIG RAT III
Wireless Multi-Point Gas Detection System
NEW!
The Stand-Alone Solution
m
o
c
.
a
The rugged Rig Rat III detection system provides
multi-point monitoring for toxic gases, combustibles
and oxygen hazards. Self-powered and solar-capable,
the Rig Rat III features unequalled versatility, with
an extensive range of field configurations. With realtime, two-way data transmission and remote sensing
capabilities, the Rig Rat III represents the new
generation of stand-alone system technology.
y
r
A
E
S
H
Self-contained and intrinsically
safe, the Rig Rat III is the ultimate
in stand-alone detection.
Now with real-time
data transmission
w
w
.
w
n
s
www.gasmonitors.com
Email: info@bwtnet.com
www.HSEArya.com
www.HSEArya.com
RIG RAT III
Wireless Multi Point Gas Detector
with Sensors
Rig Rat III is completely modular in design, with plug-in ports for all system components and field interfaces: remote sensors, remote
alarms, relays, solar power, etc. Microprocessor-based operation and advanced sensor technology ensure reliability and performance.
Cost-effectiveness is a hallmark of the Rig Rat III. Trenching and cabling costs are eliminated through wireless, two-way digital RF data
transmission. Maintenance-free combustible sensors reduce the need for costly upkeep requirements.
Simple push-button
interface for automatic
calibration and setup choices
Signal Transmission:
m
o
c
.
a
Digital, 2.4 GHz, license-free ISM band
radio frequency (RF) transceiver provides
two-way, real-time communication with the
controller located up to 1.8 mi. / 3 km away.
Encoded digital signal is RFI protected.
Security Keylock:
y
r
A
E
S
H
Rugged and Durable:
Stainless steel enclosure
with mounting flanges and
carrying handle.
Flashing Visual Alarms:
Bright alarm light advises alarm
levels, type and sensors affected.
Two Sensor Ports:
Install one or two sensors
as needed.
.
w
Plug-in Sensor Cables:
Place sensor at the optimal
location, up to 250 ft. / 76 m
away from the detector.
w
w
New Zero-maintenance Sensor:
Intrinsically safe combustible sensor
(0-100 % LEL). No calibration or sensor
replacement required, no downtime.
Plug-in Remote Sensors:
Intrinsically safe, stainless steel toxic
gas and oxygen sensors.
Eliminate Power and Signal Lines
Cut installation costs by up to 75% by removing
the need for trenching, cabling and wiring conduit.
Protects access to operations bay.
Alphanumeric Display:
Two continuous LCD gas readouts show
local real-time concentrations present in
ppm, % LEL and/or O2 % by volume.
Audible Alarm:
Built-in 85 dB alarm.
Power Port:
Battery powered, solar and
line-capable.
Two Option Ports: Plug-in ports accept
remote alarms, relays, etc.
www.HSEArya.com
Alarm Status
Detector Configuration
The large LCD keeps you advised of any gas
hazard present. The intelligent LCD readouts
provide instant diagnostic information.
The detector can be equipped with one or two remote gas sensor
heads in any gas combination desired. A simple rotary switch is used
to choose the sensor type and the measuring range for the sensor
head. Alarm setpoints can be field-assigned to desired levels.
In the event of an alarm condition:
!
!
!
Alarm signal is transmitted
!
!
!
The audible alarm pulses
Security, Durability, Simplicity
Housed in a rugged, corrosion-resistant, 14 gauge stainless steel
enclosure, the tamper-proof, external hinged door is secured with a
key lock and high-tension latch, which protects the control bay. The
inner control door is equipped with slip hinges for easy access to
the setup and service bay. All electronics are sealed in weatherproof
enclosures - only the sensor is exposed to the environment.
The RED alarm LED flashes
DANGER icon lights
and flashes
Alarm port option(s) trigger
Flexibility and Versatility - Building Block Approach
The LCD readouts show the
concentration of gas(es) present
Modular Rig Rat III Systems are readily installed, modified and
expanded without disturbing the worksite.
m
o
c
.
a
Low or High Gas Alarm
A LOW alarm condition triggers:
!
!
!
Alarm signal transmission to the controller
Alarm port options
Built-in audible 85 dB alarm
Users can field-select, if desired, the above functions to activate during
HIGH alarm only instead of during LOW alarm.
The LOW ALARM or HIGH ALARM gas icon will light, advising alarm
level and sensor affected. The field functions will activate on the alarm
level selected. Current alarm setpoints can be viewed at any time.
y
r
A
E
S
H
Sensor Integrity Alarm
The integrity alarm is triggered if a sensor is
missing or a sensor cable is damaged. In addition
to the above alarm notification, sensor 1 or sensor
2 FAIL icon will light to advise which sensor or
cable is affected.
Low Battery Alarm
The battery level is continuously displayed. The
longest bar indicates a fully charged battery. If
battery power drops below usable levels a low
battery alarm will activate the above alarm signals,
the Arrow will be under the shortest bar and the
Battery Bar will flash.
Facility Monitoring
Any size of system is
possible. A system can
be readily expanded
and changed as site
requirements evolve.
Transmitter Status
Perimeter Monitoring
Rig Rat III provides a
cost-effective solution to
perimeter monitoring on
large sites.
.
w
The Rig Rat III controller is in constant two-way communication with all
remotely located system elements. The radio transmitter (XMTR) icon is
continuously displayed to indicate system communication status.
w
w
Q
R
In the event of an alarm condition, the digitally
coded signal is transmitted to the appropriate
controller channel (and/or receiver alarm). The
XMTR icon changes and flashes to advise
transmission mode.
P
If the transmitter has been turned OFF to prevent false
alarms during calibration or service, the DISABLED icon will
appear below the XMTR icon. The disable button is located
in the operation bay.
In the event that communication is lost between the detector and
controller, or other system elements, the appropriate alarms will be
activated both at the controller and the remotely located detectors.
Radio Signal - The Practical Solution
For optimal signal transmission and reception,
a variety of antennas are available.
Portable Monitoring
Field proven on mobile
worksites and by disaster
response teams, Rig Rat
III is the only truly portable,
independent, multi-point
system in the world.
Applications
Some common applications
include:
Drilling Rigs
Service Rigs
Offshore Platforms
Refineries
Petrochemical Plants
Gas Plants
Perimeter Monitoring
Plant Turnarounds/Shutdowns
Pipelines
Tank Farms
Wellheads and Pump Jacks
Pulp and Paper Mills
Hazardous Waste Sites
Sewage Treatment Facilities
Loading Docks
Ammonia Plants
Nuclear Plants
Emergency Response Teams
Fire/HAZMAT
www.HSEArya.com
RIG RAT III
Wireless Independent Receiver Controllers
with Remote Plug-in Options
The Rig Rat III stainless steel controllers are the central communication center
for the Rig Rat III gas detection system. The standard Rig Rat III controller allows
the simultaneous display of readings and alarm state messages for up to eight
remotely located sensors. The system uses a built-in digital 2.4 GHz, licensefree ISM band (RF) transceiver, which allows two-way real-time communication
with system elements located up to 1.8 miles (3 km) away. The controller is in
constant communication with system elements. Detectors transmit a discretely
coded radio signal to the controller, advising the detector of a gas alarm or
integrity alarm condition.
Signal Transmission:
2.4 GHz digital, spread-spectrum, ISM
band RF transceiver with 1.8 mile (3 km)
transmission radius
m
o
c
.
a
Antennas:
Wide selection of antennas
and antenna cable connectors
Rugged and Durable:
Rugged, stainless steel enclosure
Channel Activation:
y
r
A
E
S
H
Alphanumeric
Display: Real-time
readings for all detectors and
sensors.
Channel alarm LCD indicator
flashes and latches to
indicate alarm condition.
.
w
Each channel receives
unique digitally coded alarm
signals from the detector.
w
w
System Reset:
Individual enable/disable
channel control switches
Audible:
Built-in audible (85 dB) and visual
alarms
Security Locks:
Heavy duty stainless steel
latches.
Security ON/OFF Keylock:
Protects access to operations bay
Alarm acknowledge reset button
Power Port:
Two Option Ports:
Two plug-in option ports accept
external audible/visual alarms and
relays to control site interfaces.
Status LED:
Advises power status:
Green - A/C
Red - Battery
Operate controller via line power, or connect
to external emergency power supply.
Battery backup with auto recharge.
Multi-Point Systems:
The system can be expanded to include up to several hundred individual
monitoring points. Larger systems require more than one controller.
www.HSEArya.com
Increased Flexibility
Remote Plug-In Accessories and Options
A wide range of rugged, versatile, plug-in options enable you to configure a system
to meet your specific monitoring needs. Add, change or move system components
as requirements evolve.
Remote Sensors
Select cable length:
up to 250 ft. / 76 m
Maintenance-free Toxics/Oxygen
Combustible
Power Choices
Independent
battery power
Solar-capable:
5, 10, 20 or 30 watt
24 VDC Direct
120/230 VAC
line chargers
Rig Rat III provides continuous monitoring
for combustibles (0-100 %LEL), oxygen
hazards and toxic gases.
Remote Sensors
Mix, match or change the gas type and/or
measuring range. Install one or two sensors as
desired. Configuration is simple with plug-in, rugged
sensor units and simple rotary switch to change
type of sensor and range. The detector is equipped
with 10 ft. / 3.3 m plug-in remote cables (standard).
Remote Sensor Cables
Toxics and oxygen: 250 ft. / 76 m
Combustibles: 100 ft. / 30 m
Optional cables of up to 250 ft. / 76 m are available.
m
o
c
.
a
Continuous Power
Audible/Visual Alarms
Controller
Alarm Bar
Detector
High-output
audible
160,000
101 dB siren
60,000
candlepower candlepower
112 dB bullhorn
Solar: Plug-in, stainless steel, solar panels allow
continuous operation in remote and isolated
locations. Available in 5, 10 and 20 watt versions to
accomodate system power requirements.
Line Power: 12 or 24 VDC direct or 110/230 VAC
trickle chargers power each detector at an adjacent
power supply, with short cable runs.
y
r
A
E
S
H
Independent Battery: Detector will operate on
battery for up to 30 days depending on sensors
and transmission interval.
Audible/Visual Alarms
10 Amp AC/DC Relays
Controller
Remote, plug-in audible/visual alarms alert
personnel that there is an alarm condition on site.
Alarms are powered by the controller or detector.
Detector
Relays
Discrete alarm relay
Explosion-proof
Weatherproof
.
w
w
w
Wall mount
Plug-in, 10-amp SPDT AC/DC single and dual
relays trigger site-specific interfaces and
are powered by the controller or detector.
Solenoid Driver
Other
Solenoid Driver
Datalogger
Activates process or fluid control systems, if required.
Datalogger
Data collected is expressed in % LEL, ppm or % by
volume, as required. IBM compatible.
Note: The detector is equipped with two option
ports. A 4-port MOB (multiple option box) is
available for the inclusion of additional interfaces.
Mounting Kits
Tripod and wall mount kits are available to simplify
installation. Tripod kits accept 5, 10 and 20 watt
solar panels.
Mounting Kits
Tripod mount
www.HSEArya.com
Rig Rat III
SPECIFICATIONS
Multi-Point Wireless
Gas Detection System
Gases Monitored: Change the gas
SYSTEM:
Signal Transmission:
Modular Multi-Point Wireless Gas Detection System
2.4 GHz licence free, ISM band spread-spectrum RF transceiver.
User-settable discrete codes.
Up to 1.8 mi. / 3 km, depending upon antenna configuration
Distance:
monitored and/or the measuring range at any time.
•
Combustible Gases/Vapors
•
Oxygen
Toxics: Hydrogen Sulfide
•
Carbon Monoxide
Sulfur Dioxide
Ammonia
Chlorine
Chlorine Dioxide
Ethanol
Ethylene Oxide
Hydrogen
Hydrogen Chloride
Hydrogen Cyanide
Nitric Oxide
Nitrogen Dioxide
Ozone
GAS DETECTOR:
Independent Rig Rat III detector with radio transceiver
12 volt, 3.4 amp hr. rechargeable battery
Up to 30 days, without active recharge (dependent on sensors)
Via solar power; line (24 VDC direct, 110/230 VAC) or bench chargers
Clearly advises alarm levels both audibly and visually
Large, red flashing light
LCD: alarm level present, sensor affected and alarm type
Oscillating 85 dB at 3 ft. / 1 m (typical)
Two per sensor (LOW, HIGH) with field-settable setpoints
Fault advises missing sensor, damaged cable and/or low battery alarm
Two continuous, alphanumeric gas readouts and status displays:
Simultaneously and continuously displays gas concentration(s) present
Transmitter status, battery level, sensor fault, alarm level setpoints
Three:
1. Power ON/OFF
2. Transmitter (XMTR) DISABLE
3. Transmission TEST
Two sensor ports; two option ports; charger port; TNC antenna port
Keylock access to control panel
14 gauge stainless steel, Nema 4, RFI/EMI shielded
5% to 95% RH (non-condensing)
8.46 x 11.26 x 4.53 in. / 21.49 x 28.6 x 11.51 cm
11 lbs. 6 oz. / 5.15 kg
Power:
Battery Life:
Recharge:
ALARMS:
Visual Alarms:
Power Independence:
Audible Alarm:
Gas Alarm Levels:
Other Alarms:
LCD DISPLAYS:
Gas ppm or %:
Status Indicators Advise:
CONTROLS:
The following
sensor configuration lists the duration of the
internal, rechargeable battery life (per charge):
•
2 toxic sensors: Up to 30 days
•
1 toxic, 1 LEL: Up to 5 days
•
2 LEL sensors: Up to 3 days
m
o
c
.
a
PORTS:
SECURITY:
GENERAL SPECIFICATIONS:
Humidity:
Size:
Weight:
GAS SENSORS:
Order Information
RR-3000: Rig Rat III Gas Detector (standard)
comes complete with one or two 10 ft. / 3 m
sensor cables as required, plus one antenna.
Longer sensor cables and different antennas
available.
RR-3000S: Rig Rat III Non-Wireless Gas Detector
comes complete with all standard Rig Rat III
components, except antenna and transceiver.
RR-3C04: Rig Rat III 4-Channel Controllers are
capable of simultaneous display and annunciation
of up to 8 remotely located sensors.
.
w
s
w
w
www.HSEArya.com
For further information:
1-888-749-8878 USA
1-800-663-4164 Canada
+44 (0) 1869 233004 Europe
+971-4-8871766 Middle East
+61-7-3818-8244 Australia
+1-403-248-9226 Other Countries
Type:
Powered:
Humidity:
Temperature Range:
Physical:
Warranty:
Combustibles (encapsulated)
LCD
Increments
1 % LEL
Units
%
Standard Measuring Ranges Available
#=1
#=2
#=3
#=4
1 ppm
ppm
0-100
0-50
0-500
0-20
Sulfur Dioxide
1 ppm
ppm
0-100
0-50
0-20
0-10
Ammonia
1 ppm
ppm
0-50
0-100
Carbon Monoxide
1 ppm
ppm
0-500
0-1000
0-100
0.1 ppm
ppm
0-5.0
0-10.0
0-100
Oxygen
0.1%
%v/v
0-25.0%
0-30.0%
CONTROLLERS:
Signal Input:
Power:
Battery Backup:
ALARMS:
INDICATORS:
CONTROLS:
PORTS:
Humidity:
Enclosure:
Physical:
E-mail: info@bwtnet.com
Locally distributed by:
0-30
0-50
0-200
Contact BW Technologies
Standard controller (RR-3C04) for up to 4 Rig Rat III detectors
Discretely coded radio signals from each detector
110 VAC; 230 VAC (selectable)
Two 12 VDC rechargeable batteries (normal operation: up to 4 hrs.)
Visual: LCD displays alarm level present, sensor affected and alarm type
Audible: 85 dB at 3 ft. / 1 m (typical)
LEDs (four / channel): 3 alarm indicator, 1 channel enable
One ON/OFF switch; one ENABLE/DISABLE switch per channel and one
momentary reset/test switch
Antenna port: TNC (reverse polarity)
Alarm bar port: 12VDC output per channel
External relay port: alarm specific relay option
Common relay port: low, high and fault (latching configurable)
5% to 95% RH (non-condensing)
Self-contained 14 gauge stainless steel with mounting flanges
14.95 x 11.16 x 5.15 in. / 37.97 x 28.35 x 13.08 cm; weight 19 lb. / 8.7 kg
DUE TO ONGOING RESEARCH AND PRODUCT IMPROVEMENT, SPECIFICATIONS ARE SUBJECT TO CHANGE WITHOUT NOTICE.
n
#=6
0-150
Chlorine
Other Gases
#=5
0-100
Hydrogen Sulfide
RATINGS AND CERTIFICATIONS:
(INTRINSICALLY SAFE WITH BARRIER)
BW1062-01-01-00-8.5x11-5379-2
2 years, including all sensors (except NH3 and PH3- 1 year)
Gas Monitoring Specif cations
Corporate Headquarters
2840 - 2 Avenue S.E.
Calgary, AB, Canada T2A 7X9
Phone: +1-403-248-9226
Fax: +1-403-273-3708
www.gasmonitors.com
Remote interchangeable plug-in units
Combustibles: catalytic bead; toxics and oxygen: electrochemical
By the detector
5% to 95% RH (non-condensing)
Combustibles: -40 to +50 °C / -40 to +122 °F
Hydrogen Sulfide: -40 to +50 °C / -40 to +122 °F
Ammonia: -25 to +35 °C / -13 to +95 °F
Other toxics and oxygen: -20 to +50 °C / -4 to +122 °F
Toxic/O2: stainless steel, Nema 4
Combustible: maintenance-free, encapsulated, Nema 4
y
r
A
E
S
H
For full system order information and system
configuration, contact BW Technologies.
RR-3000 Gas Detector: Class I, Div. 1, Groups C, D
Class II, Div. 1, Group G
Sensors (Toxics, Oxygen and LEL): Class I, Div. 1, Groups C, D
Class II, Div. 1, Group G
0-600
www.HSEArya.com
s
RIG RAT III
DETECTOR COMPONENTS AND ELEMENTS
DETECTOR ELEMENTS
RR 3000 Wireless Detector
RR 3000 S Non-Wireless Detector
Rig Rat III wireless Detectors maintain constant,
two-way communication via real-time RF link with
the system Controller. Discrete readings for each
remotely located sensor, as well as alarm state
and system status information are constantly
updated on a real-time basis. Accurate, rugged
and corrosion resistant, the monitors are
designed for continuous, virtually maintenancefree operation.
m
o
c
.
a
y
r
A
E
S
H
Rig Rat III Detectors
DETECTOR COMPONENTS
1. Carrying Handle
8.
2. Mounting Bracket
9.
3. Antenna Port*
10.
4. Security Keylock
11.
5. External Latch
12.
6. Audible Alarm
13.
7. Charger Port
Gas Label Bars
Alarm Ports (two)
LCD Display Panel
Sensor Ports (two)
Visual Alarm Light
External Hinged Door
.
w
w
w
Rig Rat III Detectors include a newly enhanced
push-button operation interface. All normal
field operation and test procedures, including
calibration, alarm adjustment, and transmitter
test function, are made by means of easy to use
push-button controls.
Detectors may be equipped with one or
two remote gas Sensor Heads in any gas
combination desired. A rotary dial switch inside
the Detector configures the Detector and LCD
to the full measuring range of the Sensor Head.
Alarms set points are set in the field to the
desired levels.
The concentration present is simultaneously and
continuously displayed for each sensor locally at
the Detector on Sensor 1 LCD and Sensor 2 LCD.
OPERATIONS BAY
1. Power push-button
2. #6-32x1/4” Phillips Screw SS
3. Transmitter (XMTR)
ON/Disabled Push-button*
4. OK push-button
5. Low Alarm setpoint/decrement
value push button
6. High Alarm setpoint/increment
value push-button*
7. Transmitter (XMTR) Test
Push-button
8. Service bay hinged door
*is not used on RR 3000S non-wireless version of Detector
9
www.HSEArya.com
s
RIG RAT III
COMBUSTIBLE REMOTE SENSORS
Model SAII-L3W1
DESCRIPTION
The new maintenance-free Rig Rat III fully encapsulated
combustible (LEL) gas sensor provides continuous monitoring
of environments where combustible gases and vapors may be
present. The SAII-L3W1 Gas Sensing Unit may be used to detect
all of the combustible gases likely to be encountered.
The intrinsically safe, catalytic sensor transmits an electronic signal
to the Detector providing a readout of the %LEL gas present. In the
event of an alarm condition, local alarms, relays etc. are activated.
m
o
c
.
a
y
r
A
E
n
S
H
The remote combustible sensor is linked to the Detector with
RFI shielded cable. The Combustible Sensor can be placed at
the optimum monitoring point and the Detector itself can then be
conveniently placed for accessibility. The combustible sensor can
be located up to 100 ft (30 m) away from the Rig Rat III Detector.
The Unit comes complete with a calibration cup. Splash Guards,
Process Baffles and Remote Calibration Cups are available. (See
section 4.)
INTERCHANGEABLE GAS SENSING UNITS: The Combustible,
Toxic and Oxygen sensing units are interchangeable. Simply
unplug one sensor unit and plug in another sensor and configure
the rotary dial switch inside the Rig Rat III Detector.
COMPATIBILITY: The SAII-L3W1 0 - 100% LEL Remote Sensor
is designed for use with:
Rig Rat III
Remote plug-in sensor cables (UC2-S(###) — up to 100 ft. / 30 m.)
LEL SENSOR EFFECT ON BATTERY POWER: The LEL
sensor requires more operating power than toxic or oxygen units.
Therefore, dependent on the total draw on the Detector (i.e. alarms
relays etc.), special consideration must be given to solar powered
installations. The 10 watt (min.) solar panel is required to power a
Detector equipped with LEL sensor(s).
.
w
Features
Faster response to full alarm
Reliable, accurate monitoring
Plug-in Sensing Units are equipped with a rugged
weatherproof mil-style connector
Plug-in Combustible Sensor assembly for easy replacement
Remote Combustible Sensor units can be installed up to
100 ft. / 30 m from the Detector for LEL
Change the gas monitored at any time
Highly poison resistant sensor
Intrinsically safe
Maintenance-free
Detector battery life is trickle charged by solar or line power:
One (1) LEL sensor (SAII-L3W1) - battery life up to 4.7 days
Two (2) LEL sensors (SAII-L3W1) - battery life up to 2.4 days
w
w
Relative Sensitivity Chart of Combustible Gases/Vapors
Combustible sensor on exposure to various gases/vapors at the same
%LEL concentration. Relative to Methane Signal (Methane = 100 %)
Gas/Vapor
(%) Relative
Sensitivity
Gas/Vapor
(%) Relative
Sensitivity
SPECIFICATIONS
SAII-L3W1
Methane
100
Carbon monoxide
110
Powered By:
The Detector
Propane
65
Acetone
75
Current Draw:
25 mA typical at 12 volts
n-Butane
60
Methyl ethyl ketone
60
Sensor Type:
Catalytic
n-Pentane
50
Toluene
60
Gases Detected:
0-100% Combustible Gases/Vapors
n-Hexane
50
Ethyl acetate
65
Measuring Range:
0-100% LEL
n-Heptane
50
Hydrogen
100
Response Time:
n-Octane
50
Ammonia
145
6 sec. at T50 (max.); typically 2 seconds
Temp. Range:
-40 to +194°F (-40 to +90°C )
Methanol
115
Cyclohexane
65
Mounting Flanges:
Two (2) - predrilled for mounting
Ethanol
85
Leaded petrol
60
Port:
One 6-pin plug-in port for sensor cable
iso-Propyl Alcohol
70
Unleaded petrol
60
Enclosure:
Nema 4, Explosion-proof
NOTE 1: Each sensitivity has been rounded to the nearest 5%
NOTE 2: For gases not listed contact BW
CSA APPROVED:
Class I, Div. 1, Groups C & D
Class II, Div. 1, Group G Nema 4
Dimensions:
6.75 x 3.5 x 3.25 in. (17.1 x 8.9 x 8.3 cm )
Weight:
3.3 lbs (1.5 kg)
NOTE: Operating Specifications see page 3.33
WARRANTY: 2 Years incl. Sensor
10
www.HSEArya.com
s
RIG RAT III
TOXIC AND OXYGEN REMOTE SENSORS
Order No: SA-L2(x)(#)
DESCRIPTION
BW Technologies offers a wide variety of technologically
advanced, low maintenance remote sensors for the measurement
specific toxic gases, vapors, and hazardous conditions. The plugin remote toxic and oxygen sensors provide reliable continuous
monitoring to protect personnel and facilities.
The gas specific, stabilized, electrochemical sensor, housed in a
stainless steel enclosure, transmits an electronic signal to the Rig
Rat III Detector, activating local alarms, relays and field interfaces
in the event of an alarm condition.
m
o
c
.
a
y
r
A
E
S
H
The Remote Sensor is linked to the Detector with RF shielded
cable that plugs directly into the Detector and Remote Sensors.
Remote oxygen and toxic sensors can be placed up to 250 feet
(75 meters) from the Detector at the optimum monitoring point.
The Detector can then be conveniently placed for accessibility.
A Detector equipped with two toxic and/or oxygen sensors will
operate up to 28 days on its internal, backup battery.
Splash guards, process baffles and remote calibration cups are
available (see Page 3.47).
INTERCHANGEABLE GAS SENSING UNITS: All LEL, oxygen
and toxic Sensors can be interchanged. Simply unplug one gas
specific unit and plug in another.
MEASURING RANGES: Change the measuring range at any
time in the field. A simple to use rotary dial switch inside the
Detector is used to configure the Detector and LCD with the
selected sensor type range.
Features
COMPATIBILITY: All toxic and oxygen remote sensors
(SA-L2x#) are compatible with:
Rig Rat III
Faster response to full alarm.
Gas specific stabilized electrochemical cells.
Rugged weatherproof Stainless Steel enclosures.
.
w
Remote plug-in Sensor cables (UC2-S(###)
GASES MONITORED:
Oxygen
Hydrogen Sulfide
Carbon Monoxide
Sulfur Dioxide
Ammonia
Chlorine
Ethanol
Ozone
w
w
All sensors are equipped with a rugged weatherproof plug-in
pin, military-style quick connector.
Change the gas monitored at any time.
Hydrogen
Hydrogen Chloride
Hydrogen Cyanide
Nitric Oxide
Nitrogen Dioxide
Chlorine Dioxide
Ethylene Oxide
Change the measuring range at any time.
Remote sensor units can be installed up to 250 feet
(76 m) from the Detector.
Cannot “go to sleep” and are poison resistant.
Low maintenance.
Maintenance
The electrochemical sensor is sealed in a weatherproof, 16 gauge,
stainless-steel housing that is fully protected from the elements. Only
periodic calibration is required to ensure optimum performance.
SPECIFICATIONS
CSA APPROVED:
Class I, Div. 1, Groups C & D
Class II, Div. 1, Group G Nema 4
WARRANTY: 2 Years incl. Sensor*
Powered By:
Current Draw:
Sensor Type:
Mounting Flanges:
Port: (Plug-in)
Enclosure:
Dimensions:
Weight:
The Detector
2 mA at 12 volts
Electrochemical
Two (2) - predrilled for mounting
One (1) 6-pin, female, accepts sensor cable
16 gauge stainless steel, Nema 4
4.5 x 3.5 x 3.1 inches
(11.5 x 9.1 x 8.0 cm)
1.9 lbs. (0.8 kg)
(expected sensor life 3-5 yrs)
*ammonia sensors warrantied for 1 year from date of purchase
NOTE: Operating Specifications see opposite page.
11
www.HSEArya.com
s
RIG RAT III
REMOTE SENSORS: LEL, TOXIC & OXYGEN
GAS SPECIFIC OPERATING SPECIFICATIONS
The Detector provides continuous monitoring of the environment. The gas monitored and the measuring range are readily changed, at any
time. The Rig Rat III Remote Sensor is relatively unaffected by temperature, humidity or pressure variations. All BW sensors are temperature
compensated ensuring optimum performance. Stable performance and low drift rate ensure low maintenance, trouble free operation. The Rig Rat
III Remote Sensors offer unsurpassed accuracy, speed, and stability.
OPERATING SPECIFICATIONS
Specification
Gas Monitored
Response (seconds @ T50)
Operating Temp.
Range
°C
°F
Gas Monitored
%LEL
O2 % by V.
H2S ppm
6*
<2%
<6
m
o
c
.
a
y
r
A
E
S
H
SO2 ppm
Cl2 ppm
NH3 ppm
HCN ppm
HCl ppm
H2 ppm
NO2 ppm
H2S ppm
<5
<4
<8
<19**
<9
<15
<4
<8
<6
-40 to +90-40 -20 to +50-4 to -40 to +50-40 to -20 to +50-4 to
to +194
+122
+122
+122
Operating Humidity
Long Term Drift
ZERO:
(% signal loss/mth) SPAN:
CO ppm
High Gain
-20 to +50-4 to -20 to +50-4 to -25 to +30-13 -20 to +50-4 -20 to +50-4 to -20 to +50-4 to -20 to +50-4 to -40 to +50-40 to
+122
+122
to +86
to +122
+122
+122
+122
+122
15 — 90% non-condensing
Nominal<1
Nominal<1
Nominal<2
Repeatability % of signal
1%
0.1%
1
LCD Increments
1%
0.1%
1 ppm
Nominal<2
Nominal<2
Nominal<2
Nominal<2 Nominal<2
Nominal<2
Nominal<2
Nominal<2
Nominal<2
1
1
2
10
2
2
2
2
1
1 ppm
1 ppm
0.1 ppm
1 ppm
0.01 ppm
0.1 ppm
1 ppm
0.1 ppm
1 ppm
* LEL Response Typically < 2 sec. ** NH3 Response Typically < 15 sec.
MEASURING RANGES AVAILABLE and BW GAS CODES
BW Gas
CODE
Units
LEL
W
% LEL
0-100%
Oxygen (O2)
X
% by vol.
0-25%
0-30%
Hydrogen Sulfide (H2S)
H
ppm
0 to 100
0 to 50
Carbon Monoxide (CO)
M
Sulfur Dioxide (SO2)
S
Chlorine Dioxide (ClO2)
V
Chlorine (Cl2)
C
Ammonia (NH3)
A
Hydrogen Cyanide (HCN)
Z
Hydrogen Chloride (HCl)
Gas
1
Measuring Ranges Available (#)
2
3
4
5
.
w
NOTE:
6
1. For Physical Specifications and Current
Draw see pages 3.31 and 3.32.
2. Contact BW Technologies for specifications
for additional measurable gases.
0 to 500
0 to 20
0 to 30
0 to 100
0 to 50
0 to 200
0 to 20
0 to 10
ppm
0 to 500
0 to 1000
ppm
0 to 100
0 to 50
ppm
0 to 5.0
0 to 1.00
ppm
0 to 5.0
0 to 10.0
0 to 100
ppm
0 to 50
0 to 100
0 to 350
ppm
0 to 20.0
0 to 50.0
0 to 100
L
ppm
0 to 10.0
0 to 20.0
0 to 100
Hydrogen (H2) (ppm)
Y
ppm
0 to 100
0 to 200
0 to 800
Nitrogen Dioxide (NO2)
D
ppm
0 to 10.0
0 to 20.0
Hydrogen Sulfide (H2S)
HG
ppm
0 to 50
0 to 20
Nitric Oxide (NO)
N
ppm
0 to 50
0 to 100
Ethanol (C2H6O)
B
ppm
0 to 500
0 to 1000
0 to 250
SENSOR UNITS:
SA-L2(x)(#)
Ethylene Oxide (C2H4O )
E
ppm
0 to 10.0
0 to 20.0
0 to 10.0
REPLACEMENT TOXIC AND
OXYGEN SENSORS:
PS-R(x)01
Ozone (O3)
G
ppm
0 to 1.00
0 to 2.00
High Gain
w
w
0 to 600
BW GAS CODES: (x) = GAS CODE
The gas monitored is indicated in each Order
Number for Sensor Units, measuring range
modules, and replacement sensors.
MEASURING RANGE: (#) = MEASURING RANGE
0 to 600
0 to 150
Each sensor is available in a number of
measuring ranges. Select from the table above
and specify the measuring range required in the
model number. The measuring range can be
changed at any time by means of a rotary dial
switch located in the Detector. If the measuring
range you require is not listed, contact BW for
availability.
Order Info:
MEASURING RANGE CHANGE KIT: PL(X)S-50-(#)-2K
COMBUSTIBLE SENSOR UNIT:
12
SAII-L3W1
www.HSEArya.com
s
RIG RAT III
REMOTE VISUAL ALARMS
Order No: UR-L600, UR-LR60
DESCRIPTION
Rugged, weatherproof Remote Strobe Alarms provide a flashing,
visual warning when an alarm condition exists. Simply plug the
Alarm Light into one of the Rig Rat III Detector’s option ports or
the multiple option box (UR-J950). The strobe will trigger a visual
alarm on high or low (field selected by the user). Each Visual
Alarm is equipped with a standard 10 ft (3m) cable (longer lengths
available), plug-in connector and mounting flanges. The Remote
Strobes are compatible with all Stand-Alone Detectors.
60,000 Candle power
URL-600
m
o
c
.
a
y
r
A
E
S
H
UR-L600: The cost-effective 60,000 candle power strobe is
powered by two 6 volt, field-replaceable, lantern batteries. The
lens is protected by a wire cage.
Approved by CSA to U.S.A. and
Canadian Standards c-CSA-us:
Class I, Div. 1, Groups C & D
Class II, Div. 1, Group G
160,000 Candle power
UR-LR60
UR-LR60 RECHARGEABLE: The 160,000 candle power strobe
is powered by two 12 volt rechargeable batteries. The UR-LR60
battery is continuously maintained by the Detector except during
an alarm condition. A 5 watt solar panel (SP-U300-S) can be used
to provide year-round, maintenance-free operation. Install in a
non-hazardous area as per CSA installation instructions.
.
w
w
w
SPECIFICATIONS
Alarm Output:
Lens:
UR-L600
UR-HR60
60, 000 candle power
160,000 candle power
Impact resistant poly carbonate
Impact resistant poly carbonate
Red ( amber, clear or blue available)
Red ( amber, clear or blue available)
Power:
Two (2) 6 volt dry cell replaceable lantern
batteries, available locally
Two - 12 volt 3.2 amphr. rechargeable batteries
Solar capable
Current draw:
N/A (self powered)
500 mA at 12 VDC
Color (Standard)
Temperature Range:
-40 to +140 ºF (-40 to +60 ºC)
-40 to +140 ºF (-40 to +60 ºC)
Operating humidity:
0 - 99% non-condensing
0 - 99% non-condensing
Enclosure:
14 gauge steel (weatherproof) Nema 4
Fiberglass (weatherproof) Nema 4
Cable length:
10 feet (3m)
10 feet (1m)
Plug-in connector:
6-pin male mil style
6-pin male mil style
Charger port:
Not applicable
5-pin, female
Dimensions (H x W x D):
9.5 x 7.25 x 3.88 in (24 x 19.75 x 10
cm)
18 x 10 x 6 in. (45.7 x 25.5 x 15 cm)
Weight:
7.2 lbs. (3.3 kg) approx
12 lbs. (5.44 kg) approx
WARRANTY: 2 Years Non-prorated
13
www.HSEArya.com
s
RIG RAT III
REMOTE AUDIBLE ALARMS
Order No: UR-H700, UR-HR70, UR-HR60
DESCRIPTION
High output, weatherproof Remote Audible Alarms provide an audible
warning when an alarm condition exists. Simply plug into one of the
Detector’s option ports or the multiple option box (UR-J950). The
siren will trigger an audible alarm on high or low (field selected by the
user).
UR-H700
101 dB Siren
Each Remote Audible Alarm is equipped with a standard cable (longer
lengths are available) complete with plug-in connector. Pre-drilled
mounting flanges simplify installation. The Remote Audible Alarms
are compatible with all Stand-Alone Detectors.
m
o
c
.
a
y
r
A
E
S
H
UR-H700: The fast pulsed, high intensity 101 dB siren is powered
by the Detector (no additional power source is required). The low
current requirements of the siren ensure only a minimal current drain
on the Detector’s batteries.
UR-HR70: The rechargeable version of the UR-H700 is equipped
with one 12 volt 3A battery and a charger port.
UR-HR60 (-T1): The 112 dB dual tone, steady yelp, rechargeable
bullhorn is powered by two 12 volt batteries. It can operate up to
six hours in continuous alarm. The UR-HR60 draws power from the
Detector to recharge itself. It cannot draw power from the Detector
during an alarm condition, thus protecting the Detector’s battery from
being drained.
.
w
w
w
SPECIFICATIONS
Alarm output:
Power:
Current draw:
UR-H700 (-T1)
UR-HR60
112 dB Bullhorn
UR-HR60 (-T1)
101 dB at 3 ft (1m) fast pulsed siren
112 dB at 10 ft (3m) (steady-yelp) bullhorn
12 VDC (supplied by Detector)
Two - 12 volt 3.2 amphr. rechargeable batteries
Solar capable
18 mA at 12 VDC
1.6 amps at 12 VDC
Temperature range:
-40 to +140 ºF (-40 to +60 ºC)
-40 to +140 ºF (-40 to +60 ºC)
Operating humidity:
0 - 99% non-condensing
0 - 99% non-condensing
Enclosure:
14 gauge steel (weatherproof) Nema 4
Fiberglass (weatherproof) Nema 4
Cable length:
3 feet (1 m)
10 feet (1m)
Plug-in connector:
6-pin male mil style
6-pin male mil style
Charger port:
Not applicable
5-pin, female
Dimensions (L x W x D):
6 x 6 x 7 in. (15 x 15 x 17 cm)
18 x 10 x 6 in. (45.7 x 25.5 x 15 cm)
Weight:
6.5 lbs. (3 kg) approx
16 lbs. (7.25 kg) approx
WARRANTY: 2 Years Non-prorated
14
www.HSEArya.com
s
RIG RAT III
AUDIBLE AND MOB OPTIONS
Order No: UR-B600
REMOTE 85 dB AUDIBLE ALARM
The intrinsically safe UR-B600 85 dB alarm, plugs directly into a
Detector’s Option Port. It does not generate RFI/EMI interference
and has nominal low current drain.
APPROVALS:
UL:
Class I, Div. 1, Groups C & D
Class II, Div. 1, Groups E, F & G
CSA:
Class I, Div. 1, Groups C & D
Class II, Div. 1, Groups G
m
o
c
.
a
y
r
A
E
S
H
SPECIFICATIONS:
Audible Alarm:
85 dB at 3 feet (1 m)
Powered By:
12 VDC (supplied by the Detector)
Current Draw:
5 mA
Temp. Range:
-40 to +80°C (-40 to +187°F)
Cable Length:
5 ft. (1.5 m) Standard
Connector:
One (1) 6-pin MIL-style, male
Enclosure:
Nema 4, 14 gauge Stainless Steel
Dimensions:
3.5 x 4.5 x 3.5 in. (9 x 11.5 x 9 cm)
Weight:1.75 lb. (0.8 kg)
WARRANTY: 2 Years Non-prorated
MULTIPLE OPTION BOX
Order No: UR-J950
The intrinsically safe UR-J950 Multiple Option Port is equipped
with 4 plug-in ports and a plug-in connector. Add option ports to
your Detector easily. The UR-J950 plugs directly into one of the
Detector’s two option ports. The
UR-J950 adds four ports.
Certain restrictions apply depending on the zone and the number
and type of devices. The UR-J950 should be connected according
to the BW manual and local electrical regulations to maintain its
rating.
w
w
.
w
APPROVALS:
UL:
Class I, Div. 1, Groups C & D
Class II, Div. 1, Groups E, F & G
CSA:
Class I, Div. 1, Groups C & D
Class II, Div. 1, Groups G
SPECIFICATIONS:
Output:
Powered By:
Temp. Range:
Humidity:
Connector:
Output Receptacles:
Cable Length:
Enclosure:
Dimensions:
Weight:2.2 lbs. (1 kg)
12 VDC
12 VDC (supplied by the Detector)
-40 to +80°C (-40 to +187°F)
0 - 99% non-condensing
One 6-pin MIL-style quick connect male
Four (4) 6-pin MIL-style female
5 ft. (5 m)
Nema 4, 14 gauge Stainless Steel
5.7 x 4.5 x 4.25 in. (14 x 11.5 x 10.5 cm)
WARRANTY: 2 Years Non-prorated
15
www.HSEArya.com
s
RIG RAT III
SOLENOID DRIVER
Order No: UA-ST24 (-T1)
DESCRIPTION
The UA-ST24 solenoid driver, complete with 24 volt rechargeable
power supply, is designed to activate solenoids which in turn activate
process or fluid control systems. The UA-ST24 can be configured to
activate on High or Low alarm either by Sensor #1, or Sensor #2 on a
dual sensor unit.
The UA-ST24 is equipped with two 3.2 amp hour, 12 volt,
rechargeable batteries that automatically switch to run in series when
an alarm condition occurs, providing 24 volts of power to drive the
solenoid.
m
o
c
.
a
y
r
A
E
S
H
The batteries run in parallel while charging and are charged by the
Rig Rat III Detector. The solenoid driver will only accept a charge
from the Detector while the Detector is being charged (by a solar
panel for example). It will not draw from the Detector during an alarm
condition. The UA-ST24 may be charged directly by solar or line
power.
The UA-ST24 plugs directly into the Detector’s option port or into the
multiple option box (UR-J950), and is equipped with an access port
c/w compression fitting to connect the solenoid.
COMPATIBLE
With all:
Rig Rat III Detectors
and all:
ASCO solenoids or their equivalent
Two- or three-way solenoids with either normally open or closed or
universal operation as needed. Requires electrical standard voltage
of 24 volts or less with a current draw not exceeding 400 mA.
.
w
SOLENOID SPECIFICATIONS
w
w
Powered by:
Trickle charged:
Output to solenoid:
Two 12 volt 3.2 amphr. Rechargeable batteries. Solar capable
By the Detector 12 VDC
24 VDC at up to 400 milliamps
Current draw:
Not to exceed 400 mA
Temperature range:
-40 to +140°F (-40 to +60°C)
Enclosure
Fiberglass (weatherproof) Nema 4
Dimensions (L x W x D):
12 x 10 x 6 in. (30.5 x 25.5 x 15 cm)
Weight:
14 lbs. ( 6.35 Kg)
Plug-in connector:
6 pin, male, MIL-style c/w 3 ft. shielded cable
Ports: access
One 1/2” N.P.T. conduit opening with compression fitting
Charger
5 pin, female, MIL-style with cover
WARRANTY: 2 Years Non-prorated
16
www.HSEArya.com
s
RIG RAT III
AC/DC DETECTOR RELAYS
Rat III, Shack Rat II Detectors
Plug-in single and dual Rig Rat III Detector relays control and
trigger site-specific field interfaces and alarms customizing each
RELAY SYSTEM INTERCONNECTION DIAGRAM
detection point to your requirements. Choose between explosionproof, weatherproof enclosures, or relay cards.
Note: For Controller Relays see page 3.14
Time-Out Function
m
o
c
.
a
y
r
A
E
S
H
The optional Time-Out function triggers a field interface or alarm
*
for a set period of time and then shuts off. The relay resets itself
automatically to trigger the interface again on the next occurrence
of an alarm condition, (Low and/or High and Fault). The Time-Out
function is field settable, (1 to 5 minutes).
ALARM FUNCTION (TRIGGERING)
CONFIGURATIONS FOR STANDARD RELAYS
The Table below outlines the triggering functions for the standard
single and dual relays when used with Rig Rat III Detectors. For other
triggering functions and custom relays contact BW.
Note: If LOW alarm is selected the relay will remain triggered in
the event of a HIGH alarm condition.
Two Sensors
Installed
Relay Type
One Sensor Installed
SINGLE
RELAY
Integrity alarm triggered.
Select Low or High
alarm.
Not Applicable
DUAL
RELAY
Relay 1: Integrity alarm
triggered.
Select Low or High
alarm.
Sensor 2: Select
Low or High alarm.
Integrity alarm
triggered.
Relay 2: Triggers High
and Integrity alarm.
Sensor 2: Select
Low or High alarm.
Integrity alarm
triggered.
.
w
w
w
Order Info:
AC/DC 10 AMP DETECTOR RELAYS
Model Number Configuration
UD-RWS0
Single Relay in weatherproof enclosure
UD-RWD0
Dual Relay in weatherproof enclosure
UD-RES0
Single Relay in explosion-proof enclosure
UD-RED0
Dual Relay in explosion-proof enclosure
UD-RCS0
Single Relay Card (no enclosure) with plug-in cable
UD-RCD0
Dual Relay Card (no enclosure) with plug-in cable
17
www.HSEArya.com
s
RIG RAT III
10 AMP SINGLE and DUAL SPDT AC/DC RELAYS
for Rig Rat III, Shack Rat II and SRII Analyzer
DESCRIPTION
Rig Rat III Relays increase the flexibility of your gas monitoring
system, customizing detector interfaces to your needs. Relays are
powered by the Rig Rat III Detector. AC/DC compatible 10 Amp
relays in weatherproof or explosion proof enclosures can be used to
activate and control Rig Rat III alarms and options or site specific field
interfaces (control systems, ESD’s, fire protection, etc.).
UD-RW(x#)
WEATHERPROOF RELAY
m
o
c
.
a
y
r
A
E
S
H
INSTALLATION: The Rig Rat III relays plug directly into a Detector
Option Port or the Multiple Option Box (UR-J950). The Relay comes
with a 1/2” n.p.t. conduit access to wire it to the interface. When the
relay is used with a line powered interface, we suggest that a certified
electrician perform the installation.
UD-RW(x#)
Rugged, weatherproof relay for use in general purpose areas.
UD-RE(x#)
UD-RE(x#)
EXPLOSION-PROOF RELAY
Explosion-proof enclosure
Approved by CSA to meet Explosion-proof criteria for:
Class I, Div. 1, Group C,D
.
w
SPECIFICATIONS
Enclosure:
Wiring access
Cable length:
w
w
Plug-in connector:
UD-RW(x#)
UD-RE(x#)
14 gauge steel (weatherproof) Nema 4
Explosion –proof Nema 4
1/2 inch n.p.t.
Accepts 1/2 inch conduit (7 thread)
5 feet (1.5 m)
5 feet (1.5m)
6-pin male Mil Style
6-pin male Mil style
Dimensions (L x W x D):
6 x 6 x 4 in. (15 x 15 x 11 cm)
4.75 x 7 x 4.5 in. (12 x 18 x 11.5 cm)
Weight:
3 lbs. (1.4 kg) approx
8 lbs. (3.7 kg) approx
Operating:
Type:
10 SPDT non latching relay
Contact rating per relay:
10 A at 130 VAC; 8A at 220 VAC; 8A at 24 VDC
Outputs per relay
Three (3): 1 Normally open, 1 normally closed and
Coil current draw per relay
Power:
1 common 10 amp contacts
33.3 mA @ 12 VDC
12 VDC (supplied by Detector)
Temperature range:
-40 to +140 ºF (-40 to +60 ºC)
Operating humidity:
0 - 99% non-condensing
WARRANTY: 2 Years Non-prorated
18
www.HSEArya.com
s
RIG RAT III
DATALOGGER
Order Numbers
Datalogger: RS-DAT7-11
Software: UAII-DATS2
DESCRIPTION
The BW Datalogger is a worry free, cost effective answer to data
collection. Designed to work in tough industrial environments,
the rugged NEMA 4 weatherproof Datalogger has no moving
parts. With no buttons or switches, your information is safe from
tampering. The Datalogger plugs into a Detector Option Port.
Order datalogger, software and RS232 Port Cable separately.
DATALOGGERS:
m
o
c
.
a
y
r
A
E
S
H
GAS RS-DAT7-II
Used with any Detector to collect data on the hazardous gas(es)
present from each sensor. The data collected will be expressed in
ppm or % as required.
Note: For other models contact BW Technologies
DATALOGGER TRENDREADER
SOFTWARE:
UAII-DATS2
The data analysis software is easy to set up and operate.
Connection to PC is via RS-232 compatible serial port interface
cable.
The data will be expressed on screen in whatever measuring units
required (i.e. PPM, %, miles per hour and/or direction 0 to 360
degrees). The datalogger automatically assigns a time and date
stamp to each reading.
Minimum Requirements
The Trendreader software requires a 386 PC or higher including:
• Windows 3.1 running in enhanced mode, 95, 98 or NT
• 2 MB of Hard Drive Space
• 2 MB of RAM memory
• A 3 1/2” floppy drive
Datalogger software allows easy generation of historical data
reports and detailed time-based graphs, as well as transfer of
stored information to other software applications. The software
includes easy to use analytical tools that facilitate detailed
evaluation of gas exposure incidents and time history records.
.
w
RS232 PORT CABLE:
•
•
UA-DATC2
SPECIFICATIONS
One IC-101 interface cable that connects the datalogger to
the computer serial port. (RS232 compatible).
w
w
Memory Size:
32 KB capable of storing 32,768 readings
Sampling Methods: Continuous (first in, first out)
Stop when full
Rates of Sampling: User programmable intervals between
Every 8 sec.to once every 5 days
Accuracy:
+/- 1 % of Full Scale
Power Requirements:
Battery:
3.6 volt lithium, 1 Amp Hour
Battery Life:
Ten Years (factory replaceable)
Current Draw: <5 mA on the Detector
Temperature:
-40 to +160 °F (-40 to +70 °C)
Relative Humidity: 0 - 95 % non-condensing
Enclosure:
Rugged Nema 4 RFI/EMI shielded
composite case c/w mounting brackets
Connector:
One (1) 6-pin MIL male c/w 5 ft cable
Size:
6.2 x 3 x 5 in. (15.5 x 7.6 x 12.7 cm)
Weight:
26 oz (740 grams) approximate
Includes one 25 to 9 pin adapter (in case your computer has a
25 pin serial port).
WARRANTY: 2 Years Non-prorated
19
www.HSEArya.com
s
RIG RAT III
POWER FOR STAND ALONE DETECTORS AND RECHARGEABLE OPTIONS
Modular Power Choices Provide
Complete Flexibility
Low Power Technology
Rig Rat III Stand Alone systems require less than 1% of the electrical power used by
conventional hard-wired monitoring systems. Complete versatility in power options
allows you to provide continuous monitoring no matter what your application is, or
where your job site is located.
Independent Battery
m
o
c
.
a
y
r
A
E
S
H
Unprecedented Flexibility
The unique BW Stand Alone systems offer complete flexibility. They provide
continuous monitoring in plants and refineries. They are ideally suited for perimeter
monitoring, pipelines, offshore sites, compressor stations, etc. They are used for
mobile monitoring by the service trucking industry and at temporary work sites.
Battery or solar-powered units are also being used in residential areas, independent
sites and remote locations - whenever gas monitoring may be needed.
Solar Power
Assured Continuous Protection
Battery powered Detectors and Controllers with battery back-up assure you of
continuous protection in the event of a line power interruption.
Cost Effective
Stand Alone Detectors significantly reduce operating and installation costs. Detectors
can be easily added or relocated without any modifications to the work site or your
power grid.
Independent Battery Power
STAND ALONE DETECTORS will operate off of their own internal battery when
equipped as follows:
.
w
2 Toxic Gas Sensors
1 Toxic and 1 Combustible Gas Sensor
2 Combustible Gas Sensors
Solar Power
w
w
Up to 28 days operation
Up to 5 days operation
Up to 3 days operation
Line Power: 24 VDC Direct
110 VAC 50 to 60 Hz
230 VAC 50 to 60 Hz
230 VAC 50 to 60 Hz
BW’s solar panel trickle chargers provide continuous, maintenance-free gas
monitoring. They allow a Detector to operate continuously year-round as a completely
stand alone system. Solar panels are a cost-effective, practical energy alternative.
Line Power 24 VDC Direct, 110/ 230 VAC Line Chargers
Stand Alone systems can be run off 110 and 230 VAC and are directly compatible with
24 VDC allowing you to line-power each unit at adjacent power sources with only short
cable runs.
Charger Order Info:
Solar:
Charger Compatibility
Rig Rat III
All BW Rechargeable Options: Audible and Visual Alarms, Repeater Stations,
Solenoid Driver, etc.
20
5 Watt Charger
SP-U300-S
10 Watt Charger
SP-U310-S
20 Watt Charger
SP-U320-S
30 Watt Charger
SP-U330
Line Trickle Chargers:
24 VDC Direct Line
UC-SCAB2
110 or 230 VAC Explosion-proof
UR-TC10
110 or 230 VAC Weatherproof
UR-S600
Single Bench Charger (110/ 230 VAC) UR-C-300
Quad Bench Charger (110 VAC/ 230 VAC)
UR-C404
www.HSEArya.com
s
RIG RAT III
SOLAR PANEL CHARGERS for All Stand-Alone Detectors and
All BW Rechargeable Options
Rig Rat III solar panel charging systems eliminate the need for
expensive hard-wired power line connections. Rig Rat III Detectors
can be located anywhere―no matter how remote from the
nearest power source. Solar panel powered Rig Rat III detection
systems are totally flexible. Rig Rat III systems can be expanded,
reconfigured or moved without the need for expensive wiring,
cabling, or other installation modifications.
The 5, 10, 20 and 30 Watt Solar Trickle Chargers provide assured
cost-effective protection in a wide variety of applications (solar
powered detectors, rechargeable alarms, etc.). BW’s wireless,
stand alone, solar powered systems are field proven in thousands
of installed detection systems over the last 14 years.
m
o
c
.
a
y
r
A
E
S
H
INSTALLATION
Solar Chargers operate most effectively when they receive direct
sunlight. Mount the bottom plate at the highest convenient location.
The custom mounting frame rotates to the correct angle for your
degree of latitude. When the unit is aligned, the panel plugs directly
into rechargeable detectors or options charger port. Performance
of this or any solar electric module is dependent on local
conditions. Maximum performance requires measurement of local
solar irradiance and proper orientation of the panel (i.e. positioned
within 5° of South and an optimal tilt angle).
MAINTENANCE
The Solar Chargers maintenance requirements are minimal. The
solar panel is designed so that water will not sit on the glass.
Simply clean with water and a soft cloth or sponge when required.
.
w
SOLAR PANEL MOUNTING DIAGRAMS
w
w
Set to optimal
Tilt Angle
(dependent on
latitude).
Approximately
180° Rotation
Position within 5° of
True South
20 Watt
5 and 10 Watt
21
www.HSEArya.com
s
RIG RAT III
5, 10, 20 AND 30 WATT SOLAR PANEL CHARGES
Order No: SP-U300-S (5W); SP-U310-S (10W); SP-U320-S (20W); SP-U330 (3W)
All Detectors and Rechargeable Options
Solar panels are solid state generators with a DC current output requiring
only sunlight as an energy source. The Solar Panels function as trickle
chargers that keep the Detector battery and rechargeable option’s
battery(s) topped up. Clean, renewable and virtually maintenance-free,
solar panels provide practical and dependable power. They are a costeffective answer for continuous monitoring in many field applications.
The rugged and weatherproof solar charger rotates on every axis for
easy installation and optimum positioning.
m
o
c
.
a
y
r
A
E
S
H
Sufficient power is available to charge batteries efficiently in virtually any
climate for a maintenance-free installation of any size or location. BW
solar panels will maintain a continuous charge even in cloudy weather.
APPLICATIONS
BW solar chargers are compatible with all BW rechargeable Detectors,
and rechargeable options that are equipped with a 12 volt rechargeable
battery.
NOTE - Combustible Sensors: Detectors equipped with combustible
sensors require at least a 10 W panel for continuous long term operation.
A 5 W panel is normally sufficient for Detectors equipped with one or
two toxic or oxygen sensors. Add up the current draw from all devices
powered by the Detector to determine which solar panel to specify.
Solar Characteristics:
SP-U300-S, SP-U310-S, SP-U320 and SP-U330 solar panels meet or
exceed:
Complete environmental requirements of JPL specification No.
5101-61 (Block V)
.
w
Wind loading exceeding 125 mph (201 km/h)
Impact of one-inch hail at terminal velocity
(52 mph (82 km/h)) without breakage
Laboratory tested for wide range of operating conditions (-40 to
+194°F (-40 to +90°C) and (0-85% humidity)
w
w
SPECIFICATIONS
SP-U300-S (5 watt)
SP-U310-S (10 watt)*
SP-U320-S (20 watt)*
SP-U330 (30 watt)
Solar Panel Rated at:
5 watts DC
10 watts DC
20 watts DC
30 watts DC
Power Output:
5 watts @ 35A
10 watts @ 58A
20 watts @ 1.38A
30 watts @ 1.75A
Current @ Peak power: 0.27 A
0.58 A
1.38 A
1.75 A
Voltage @ Peak power: 16.8 V
17.1 V
17.1 V
17.1 V
Enclosure:
14 gauge stainless steel
14 gauge stainless steel
14 gauge stainless steel
14 gauge steel powder-coated
Size: (W x H x D) inches:
14 x 16 x 4
14 x 16 x 4
13.25 x 27.5 x 6.2
20 x 30 x 8
35.5 x 40.5 x 10
35.5 x 40.5 x 10
33.7 x 69 x 15.7
52 x 76.5 x 20
8 lbs. (3.6 kg)
10 lbs. (4 kg)
17 lbs. (7.94 kg)
19 lbs. (8.6 kg)
cm:
Weight:
General:
Temperature Range:
-50 to +194 ºF (-45.6 to +90 ºC)
*CSA Approval, Class I, Div I Group C,D
Ratings given at Industry Standard Conditions:
1000 W/m2 irradiance, 25°C cell temperature and solar spectral irradiance per ASTM E 892.
Conditions will vary at each latitude and location.
WARRANTY: 2 Years Non-prorated
22
www.HSEArya.com
s
RIG RAT III
TRICKLE AC/DC LINE AND BENCH CHARGERS
All Stand Alone Detectors, and Rechargeable Options
General: All BW rechargeable units are self-regulating.
BW Line and Bench Chargers are 110 VAC (230 VAC available) powered. Fuses
protect the circuitry against power fluctuations or short circuits.
24 VDC Direct
UR-S600
UC-SCAB2
AC Trickle Charger
All Rig Rat III and Shack Rat II Detectors and rechargeable units can be charged 24
VDC direct. The UC-SCAB2 interface cable is equipped with a 5-pin, male connector
that plugs directly into the Detector.
m
o
c
.
a
y
r
A
E
S
H
AC Line Trickle Chargers
Line Trickle Chargers continuously trickle charge BW Detectors and all BW
rechargeable options. Line Chargers may also be used to recharge units that have
lost their charge. Install according to local electrical and safety codes for hazardous
areas and the BW manual. Installation should be performed by a certified electrician
when connecting line power in hazardous areas.
Weatherproof AC Line Charger
AC Trickle Charger
UR-S600
Explosion-Proof AC Line Charger
UL, CSA and FM:
UR-TC10
UR-TC10
Class I, Div. 1& 2, Group D
Class II, Div. 1 & 2, Groups E, F, G
Class III
UR-C300
Single Bench Charger
UR-C300
Bench Charger
The compact single bench charger comes equipped with an “ON” LED indicator. It is an
excellent back-up on sites with one or more BW rechargeable units. Two fuses protect
the circuitry against power fluctuations or short circuits. The in-line fuse is 500 mA for a
110 VAC charger and 250 mA for a 230 VAC unit. The on-board fuse is 3 amps.
Quad Bench Charger
UR-C404
The UR-C404 quad charger is equipped with four charging ports, an LED “ON”
indicator and four charging cables. Three fuses protect the circuitry against power
fluctuations or short circuits. The 110 VAC charger has two 3A fuses and one 1A fuse.
For a 230 VAC charger there are two 3A fuses and one 500 mA fuse.
.
w
SPECIFICATIONS
w
w
General:
Power Input:
Power output:
Temp. Range:
UR-C404
Bench Charger
AC Line Chargers
110 VAC (230 VAC available) 50 to 60 Hz
24 volts (rechargeable units are self regulating)
-40 to +140ºF (-40 to +60ºC)
UR-S600
Models:
Output Cable:
Bench Chargers
UR-TC10
1.5 feet (0.5 m)
5-pin male Mil-style
Cable Connector:
UR-C300
UR-C404
N/A
N/A
N/A
N/A
Line Access:
0.5 in. (1.3 cm) n.p.t.
0.5 in. (1.3 cm) n.p.t.
conduit 7 thread
N/A
N/A
Power Cord:
N/A
N/A
1.5 feet (0.5 m)
1.5 feet (0.5 m)
Charging Cables:
N/A
N/A
One (1) 5 ft. (1.5 m)
Four (4) 5 ft. (1.5 m)
Receptacles:
N/A
N/A
N/A
Four (4) 5-pin female
LED ON Indicators:
N/A
N/A
One (1)
Four (4)
Enclosure:
14 gauge steel
Explosion-proof
14 gauge steel
14 gauge steel
Size: (L x W x D)
8 x 6.25 x 4.5 in.20.3 x
15.9 x 11.4 cm
12 x 7 x 6.5 in.30.5 x
17.8 x 16.5 cm
5 x 5 x 4 in. 12.7 x 12.7 4.25 x 12 x 10 in. 10.8
x 10.2 cm
x 30.5 x 25.4 cm
Weight:
5 lbs. (2.3 kg)
14 lbs. (6.3 kg)
2 lbs. (0.9 kg)
WARRANTY: 2 Years Non-prorated
23
8 lbs. (3.6 kg)
www.HSEArya.com
s
RIG RAT III
MOUNTING KITS
for Detectors and Accessories
TRIPOD KITS
The tripod is ideal for independent installation. The durable construction
of steel and anodized aluminum make it usable in the most rugged
environments. Sensors mount directly on the extendable tripod legs. The
legs can be anchored to withstand high wind factors. Extensions may be
added to mount solar panels, alarms, etc.
Extendable legs
▲ Carrying Strap
Light weight
▲ Portable
Extension
Alarm Option
Accessories
Plate
Order No:
Model #
m
o
c
.
a
y
r
A
E
S
H
Description
Detector
TRIPOD1
Folding Field Tripod holds Detector and
Sensor(s)
TRIPOD2
Tripod holds Detector, Sensor(s) and 20 watt Solar Panel
TRIPOD3
Tripod holds Wind Detector Assembly (not shown)
TRI-EXT1
Tripod Extension pole c/w Tri-Plate2 accepts one option (5 or
10 watt Solar Panel and most other options)
TRI-PLATE2
Tripod Option Plate accepts 5 or 10 watt solar panel and
most accessories and options
TRI-PLATE3
Accepts rechargeable options
Wall-mount Kits are available for mounting on the sides of buildings. Black
tubular metal sections fit almost all building types. The Detector, Alarms,
Relays, Solar Panels, etc. mount on pre-drilled mounting plates. Cables for
the plug-in accessories run inside the square steel tube.
w
w
MK-U600
MK-PLATE2
MK-PLATE3
M2087
Note 1:
Note 2:
Description
Sensor
Lanyard/Stake
.
w
WALL-MOUNT KITS
Ground
Rod
Nut Plate
NOTE: 30 watt Solar Panels are only applicable to Wall
Mount Kits and custom Stand-Alone Stands.
Model #
Solar Panel
Standard Wall Mounting Kit holds Detector, Solar Panel,
and one Option. It includes M0989 x 2, and 1 each of the
following sections M0988, M2087, M2086, M0986 and
M1202.
Wall Mounting Kit Option Plate for second option (M0989)
Option Plate for rechargeable accessories (M2528—order
separately)
Elbow Kit for angled soffits
20 and 30 watt solar panels come c/w with a M1240
mounting plate.
Overall MK-U600 height is approximately 11 feet (3.35
m). For buildings requiring longer extension poles contact
factory for quote with measurements.
24
www.HSEArya.com
s
RIG RAT III
RIG RAT III CONTROLLER FOR INDEPENDENT WIRELESS SYSTEMS
DESCRIPTION
RIG RAT III stainless steel Controllers are designed as the
communication center for the wireless RIG RAT III gas detection
systems. Each Detector transmits a discretely coded radio signal
to the Controller, the Controller then advises you of any gas or
integrity alarm occurrence. The independent control channel
activates a visual LED alarm, as well as, remote discrete or general
alarms and field interfaces.
m
o
c
.
a
y
r
A
E
S
H
WIRELESS MONITORING - Cut costs - Increase flexibility.
ELIMINATE SIGNAL AND POWER LINES Real-time readings
for each remotely located sensor are individually received
and displayed on the Controller LCD displays. Controllers are
independently powered via 110 VAC; 220 VAC or 24 VDC.
Battery Back-Up: Rig Rat III Controllers are equipped with two
internal batteries to provide power in the event of a power failure.
Batteries recharge automatically once power has been restored.
Battery Power: Up to 4 hours
MULTI-POINT SYSTEMS: Multi-point systems can be expanded
to over 50 individual monitoring points with each Detector coded to
a separate discrete Controller channel. Larger systems use more
than one Controller.
USER FRIENDLY: The RIG RAT III Controller’s large LCD
displays provide information at a glance.
LED Power Indicator: The LED lights green when the Controller is
operated by a VAC source. If the AC power is interrupted it will change
from green to red to indicate battery back-up (DC) operation. On a
Controller that is powered continuously by a 24 VDC source, the
power LED will be red.
FEATURES
Wireless, coded radio signal linkage between Detectors/ Controller
2.4 GHz digital spread spectrum, ISM band, RF transceiver
Eliminates wiring cabling and dredging costs
.
w
LOCAL AUDIBLE ALARM: The optional 85 dB audible activates
when an alarm condition is met on any channel.
Alphanumeric Display
DATA ACQUISITION: Download alarm data into your central
computer system to integrate information systems.
Simple, straight forward, user-friendly operation
Signal transmission up to 1.8 miles / 3.0 km
Latching, highly visible, red LED visual alarms (each channel)
ALPHANUMERIC DISPLAY: Real-time readings for all Detectors
and sensors. Channel alarm LCD indicator flashes and latches to
indicate alarm condition. Each channel receives unique digitally
coded alarm signals from the Detector.
w
w
Simple Installation
RESET/TEST switch - alarm acknowledge reset switch
Individual Enable/Disable channel control switches
SECURITY ON/OFF KEY LOCK SWITCH: Security Key lock ON/
OFF switch provides security.
Integrity alarm triggers if there is a problem at the Detector
Computer compatible for tracking information
INDIVIDUAL CHANNEL CONTROL SWITCHES: Enable/
Disable switches provide individual channel control. The
switches turn off the channel’s output to the option ports,
“disabling” external devices during testing, calibration or an alarm
condition if desired.
WARRANTY: 2 Years Non-Prorated
TEST/RESET MOMENTARY SWITCH:
Alarm Acknowledge: Resets the latching visual and audible
alarms. Alarms cannot be reset if an alarm condition is still
present.
Test Function: Tests Controller alarms and external devices.
When the button is pressed, the red alarm LED’s on the control
panel will flash. Any external alarms or controls connected to the
option ports will also be tested.
25
www.HSEArya.com
s
RIG RAT III
4 CHANNEL CONTROLLER
Order No: RR-3C04
Antennas:
Signal Transmission:
Wide selection of antennas
and antenna cable connectors
2.4 GHz digital, spread-spectrum, ISM
band RF transceiver with 1.8 mile (3 km)
transmission radius
Rugged and Durable:
Rugged, stainless steel enclosure
Channel Activation:
m
o
c
.
a
y
r
A
E
S
H
Individual enable/disable channel
control switches
Alphanumeric
Display: Real-time
Audible:
readings for all Detectors
and sensors.
Channel alarm LCD indicator
flashes and latches to
indicate alarm condition.
Each channel receives
unique digitally coded alarm
signals from the Detector.
Built-in audible (85 dB) and visual
alarms
Security Locks:
Heavy duty stainless steel
latches.
Security ON/OFF Keylock
Protects access to operations bay
System Reset:
Alarm acknowledge reset button
Two Option Ports:
Two plug-in option ports accept
external audible/visual alarms and
relays to control site interfaces.
.
w
Power Port:
Status LED:
Advises power status:
Green - A/C
Red - Battery
Operate Controller via line power, or connect
to external emergency power supply.
Battery backup with auto recharge.
FIELD INTERFACES: Plug-in ports provide discrete and zoned
channel signal and 12 volt power outputs..
INSTALLATION: Controllers signal channels are factory coded prior to
shipping. The enclosures are 16 gauge stainless steel with built-in
OPTION PORTS: The option ports accept a variety of external
visual/audible alarms and relays to interface with telemetry systems,
emergency shut-down systems, exhaust fans.
mounting flanges. Simply mount the Controller to the wall and supply
power.
w
w
OPERATING SPECIFICATIONS:
POWER:
Input:
Battery Back-up:
Operation:
Power Output:
Signal Input:
Frequency:
Signal Range:
Antenna Port:
Signal Output:
INDICATORS:
ALARMS:
Visual:
Audible:
MAINTENANCE: Rig Rat III Controllers require no maintenance. All
option ports have protective caps to ensure their integrity when not in use.
Fuses protect the circuitry.
CONTROLS:
Power:
ON/OFF Keylock security switch
Channel Controls: 4 ENABLE/ DISABLE switches
Reset/Test:
Momentary switch
110 VAC/220 VAC; 24 VDC optional
Two (2) 12 VDC 2A hr. rechargeable batteries
Non-alarm - 48 hrs; Alarm - 10 hrs
12 volts DC to option ports
Discretely coded radio signal from gas Detector
2.4 GHz
Up to 1.8 miles (3.0 km)
UHF with protective cap
Discrete and Zoned channel alarm signals
OPTION PORTS:
TEMP. RANGE:
Female plug-ins with protective cap. 12 VDC output at
each pin w/ common ground
1 - for alarm relays
1 - for alarm bar
-5 to +140°C (-20 to +60°F)
Color-coded super-bright large LEDs ON/Power
interrupt; Alarm; Channel ON/Disabled
ANTENNA:
RR-AN8 Antenna
PHYSICAL::
LCD display
85 dB @ 3 ft (1m) Models SE-C04/C08
Power Cable:
4 Channel:
Self Contained 14 gauge Stainless Steel c/w
mounting flanges
8 ft. (2.5 m) c/w wall plug
Size: 14 x 12 x 4 in. (35.5 x 30.5 x 10 cm)
Weight: 19.1 lbs (8.7 kg)
Discrete Ports:
Signal Transmission:
RR-AN8 Antenna: Distance: Up to 1.8 miles (3.0 km)
26
www.HSEArya.com
s
RIG RAT III
INDEPENDENT WIRELESS SYSTEMS
Order No: SE-A200
m
o
c
.
a
y
r
A
E
S
H
FEATURES
The Alarm Bar provides a highly visible, color-coded discrete (4
Channel Controllers) visual alarm advise, as well as a general
audible alarm. The SE-A200 has a 112 dB siren horn and four
color-coded 160,000 candle power strobes. Over each strobe is a
protective steel bar. The dual tone steady-yelp siren pivots in a 45
degree arc for best positioning.
4 color-coded 160,000 candle power strobes
112 dB steady help siren
Rugged, industrial designed, stainless steel enclosures with
protective bars over each strobe
The SE-A200 is powered by the Rig Rat III Controller. The
Alarm Bar comes with a 33 foot (10 m) cable (other lengths are
available). The mil-style quick connect on the cable plugs directly
into the Controller’s 6-pin option port.
Equipped with a quick connect, the Alarm Bar plugs directly
into the Controller and is powered by the Controller
.
w
Virtually no maintenance required.
SPECIFICATIONS
Visual Alarms:
Lens:
Colors:
Flash Rate:
Operational Life:
Audible Alarm:
Type:
Horn:
Temp. Range:
Option Port:
Cable Length:
Connector:
Dimensions:
Weight:
Built-in mounting flanges
Option Port available to extend alarm coverage
Four (4) 160,000 candle power strobes
High impact resistant poly carbonate plastic
Clear, Amber, Red, Blue
50 to 120 per minute
In excess of 200 alarm hours
112 dB at 10 ft. (3 m)
Steady-yelp, dual tone bullhorn
Weatherproof, tough ABS plastic
-40 to +140°F (-40 to +60°C)
6-pin MIL-C-50155 (14S) male
33 ft. (10 m) standard, other lengths available
6-pin MIL-C-5015
30 x 5 x 8 in. (76 x 12.5 x 25 cm)
14.5 lbs. (6.5 kg)
w
w
WARRANTY: 2 Years Non-prorated
27
www.HSEArya.com
s
RIG RAT III
WIRELESS TECHNOLOGY
Applied to Gas Detection Systems
The Practical, and Economical Alternative
to Hard-wired Gas Detection Systems
m
o
c
.
a
y
r
A
E
S
H
Cut Installation Costs—Up to 75%
Proven Reliability
BW wireless systems have been in use at sites all over the world
for over 16 years. Originally designed for use in the rugged and
varying applications present in the oil and gas industry, systems
are now in use by a wide variety of industries, including pulp and
paper mills, waste treatment facilities, cargo docks, etc.
Eliminate signal and power lines. Signals are transmitted via
coded radio channels and each unit in a Rig Rat III system is
independently powered. Installation costs are cut up to 75% by
eliminating the costs of cabling, wiring, conduit and dredging.
Therefore there is no need to dig a trench, there is no need for
expensive, shielded, underground wire or even subcontracting for
a backhoe or operator. There is also no worry about cutting into
existing underground lines. Installation time is therefore reduced
proportionately.
Installation
Radios: Radios operate on the 2.4 GHz ISM band width. There is
nothing to be tuned up by the installer. All tuning is done and QC is
checked at the factory.
Rig Rat III system components, Detectors, sensors, Controllers,
remote alarms, relays etc. are all independent of system signals
and power lines.
Antennas and Extension Kits—to meet varied requirements:
A standard Antenna RR-AN5 is included with each Rig Rat III
Detector. An RR-AN8 high gain Antenna is required with each
Controller. Due to specific site conditions other RR-AN8 Antennas
may be required with the Detector. Antennas must be ordered
separately for receiving and transmitting alarm options and
repeater stations.
Wireless means no hardware headaches:
The Rig Rat III Systems are designed to use radio frequency
communications or wireless communication. BW continues to
pioneer many of today’s most advanced mid-range transmission
technologies. Our experience with mid-range wireless gas
detection systems is extensive and exclusive to BW Technologies.
At present, there is no product on the market that competes with
our wireless gas detection and wind multi-point systems.
The type of antenna that is required depends on many factors
that affect the range of reception. Radio reception varies from
site to site and within locations on the site. If possible, line-of-site
installations are optimum. Antenna extension cables are available
to mount the antenna more conveniently or to avoid dead signal
areas, obstructions, etc. BW recommends an on-site transmission
survey or that installation technicians have an assortment of
antennas and extension Kits available to during installation.
Factors effecting transmission include terrain, obstructions, line of
sight, quality of ground, radio activity in the area, and atmospheric
conditions.
.
w
Transmission Ranges—up to 1.8 miles / 3 km enables wide
application range.
The standard antenna RR-AN5 has a transmitting/reception
capability of up to 0.6 miles / 1 km depending on optimal antennae
and transmission-line-of-sight. RR-AN8 has a transmitting/
reception capability of up to 1.8 miles / 3 km. Distances can be
multiplied using repeater stations.
w
w
Flexibility
As part of a wireless system, the Rig Rat III can be used for indoor
(i.e. in plants) as well as outdoor applications, provided that the
receiving antenna is also indoors.
The independently powered Detectors are linked to the Controllers
by radio signal. Radio linkage allows for increased flexibility. The
entire system can be easily moved to a new work site or individual
system components (detectors, sensors, alarms relays etc.) can
be quickly and easily moved or changed without site modifications.
Systems are readily expanded as well.
Transmission test function—
provides peace of mind
The Detector test function “de-rates” the power of the transmitter by
more than 10%. This is to ensure that there is more than sufficient
power available in normal operation to transmit in all events. The
test function must be used to individually test each Detector during
installation.
Remote Locations and Independent Sites:
Rig Rat III Systems provide continuous perimeter monitoring of
hazardous gases. They can be located in remote locations where
line power and signal transmission is impractical.
Transmit to local area Controllers, receiving alarms, as well as, the
central Controller.
Rig Rat III Systems provide continuous protection for personnel
and site facilities and offer unmatched flexibility.
28
www.HSEArya.com
s
RIG RAT III
WIRELESS TECHNOLOGY
Applied to Gas Detection Systems
TRANSCEIVERS send coded signals and Detectors are equipped
with transceivers . Each Detector has its own distinct code that
activates a separate channel on the Controller. The Detector can also
communicate with a repeater station, a remote alarm simultaneously
if they are coded to receive the Detector’s discrete signal.
Discrete Signals: The Rig Rat III Detectors are each equipped with
two rotary dial switches which allow configurations from 64 codes to
choose.
Secure Access: Signal codes are protected from tampering. The
Detector’s outer door is equipped with a Security Key Lock allowing
only authorized site personal access to the operations and service
bay of the Detector.
m
o
c
.
a
y
r
A
E
S
H
Transmitter System Code Switch Setting: The transceiver is
located in the Detector service bay. Open the inner hinged operations
bay door and simply loosen the thumbscrew and slide the door open.
You will find the rotary dial switches (A and B). Turn the dial and
select the channel. Select 0-9, A-F on channel A or B.
Match the System’s Code of the Detector to the System Codes of the
Controller. System Codes can be changed whenever required (i.e.
moving, changing or adding equipment).
SPECIFICATIONS
Powered by:
The Rig Rat III
Carrier Frequency:
2.4 GHz
Channels:
4
System Codes: 64 available
Power Output:
4 Watts
.
w
Transmit Current:
250 mA
Frequency Tolerance:
+/- 0.005%
w
w
Modulation:
PM 100%
29
www.HSEArya.com
s
ORDERING INFORMATION
FOR COMMON STAND-ALONE EQUIPMENT AND ACCESSORIES
ORDERING INFORMATION - Short List of Common Stand Alone Equipment & Accessories
Detectors
Controllers
RR-3000
Rig Rat III Gas Detector wireless version
RR-3C04
RR-3000S
Rig Rat III Gas Detector non-wireless version
4 Channel Controller - for use with RR3000
Relays
Remote Sensor Units
UD-RWS(0)
m
o
c
.
a
y
r
A
E
S
H
SA-L2H#
Hydrogen Sulfide (H2 S)
SA-L2W1
Combustible (0-100% LEL)
SA-L2X#
Oxygen Deficiency (O2 )
SA-L2M#
Carbon Monoxide (CO)
SA-L2S#
Sulfur Dioxide (SO2 )
SA-L2C#
Chlorine (Cl2 )
SA-L2A#
Ammonia (NH3)
Detector-Single Relay (weatherproof)
UD-RWD(0)
Detector-Dual Relay (weatherproof)
UD-RES(0)
Detector-Single Relay (explosion-proof)
UD-RED(0)
Detector-Dual Relay (explosion-proof)
UC-RWS0
Controller-Single Relay
UC-RWD0
Controller-Dual Relays
Other
SA-L2V#
Chlorine Dioxide (ClO2)-Stainless steel enclosure
RS-DAT7-II
Datalogger
SA-L2Z#
Hydrogen Cyanide (HCN)
UA-ST24
Solenoid Driver
SA-L2D#
Nitrogen Dioxide (NO2)
TRIPOD1
Tripod Kit (for units with 5/10 Watt Solar Panel)
SA-L2N#
Nitric Oxide (NO)
SA-L2L#
Hydrogen Chloride (HCl)
SA-L2B#
Ethanol (C2H5OH)
SA-L2E#
Ethylene Oxide (C2H4O)
SA-L2Y#
Hydrogen (H2)
SA-L2G#
Ozone (O3)
SP-U300-S
5 W Solar Panel
SP-U310-S
10 W Solar Panel
SP-U320-S
20 W Solar Panel
w
w
SP-U330
30 W Solar Panel
UR-C300
Tripod Kit (for units with 20 Watt Solar Panel)
Wall-Mount Kit
Replacement
Sensors
.
w
Chargers
TRIPOD2
MK-U600
PS-RH01
Hydrogen Sulfide (H2 S)
PS-RX01
Oxygen (O2 )
PS-RM01
Carbon Monoxide (CO) (H2 Filtered)
PS-RS01
Sulfur Dioxide (SO2 )
PS-RC01
Chlorine (Cl2 )
PS-RA01
Ammonia (NH3)
PS-RV01
Chlorine Dioxide (ClO2)
PS-RZ01
Hydrogen Cyanide (HCN)
Single Bench Charger (one cable)
PS-RD01
Nitrogen Dioxide (NO2)
UR-C404
Quad Bench Charger (four cables)
PS-RN01
Nitric Oxide (NO)
UC-SCAB2
Interface for 24 VDC direct operation
PS-RL01
Hydrogen Chloride (HCl)
UR-S600
Weatherproof Line Trickle Charger
PS-RB01
Ethanol (C2H6O)
Remote Alarms
UR-L600
Detector -Strobe (60,000 Candle power)
UR-LR60
Detector-Strobe (Rechargeable, 160,000
Candle power)
UR-H700
Detector-Siren (101 dB)
UR-HR60
Detector-Bullhorn (Rechargeable, 112 dB)
SE-A200
Controller-4 Channel Alarm Bar
CR-H600
Controller-Siren (12 dB)
CR-L160
Controller-Strobe (60,000 Candle power)
PS-RE01
Ethylene Oxide (C2H4O)
PS-RA01
Hydrogen (H2)
PS-RA01
Ozone (O3)
For a complete list of products and instrument configurations please contact BW Technologies.
* Check with BW Technologies for availability of remote alarms and relays
30
www.HSEArya.com
A division of
BW Technologies
Vulcain
Vulcain is a leading
manufacturer of portable and
fixed gas detection systems
for commercial and industrial
markets. With a full range of
products for a variety of
applications, Vulcain
provides cost-effective air
quality solutions.
m
o
c
.
a
y
r
A
E
S
H
.
w
w
w
For further information:
Division of BW Technologies
:HEVLWHZZZ+6($U\DFRP
7HO
(PDLOLQIR#+6($U\DFRP
7HOHJUDP,'#+6($U\DB33(
,QVWDJUDP,'#+6($U\D33(
www.HSEArya.com
The Vulcain Advantage
Technology
Each year, Vulcain produces thousands of gas detection networks and a broad
array of stand-alone gas monitors to meet a diverse and expanding worldwide
demand. An expert team at our main facility combines creative engineering
ideas with cutting-edge technology to produce outstanding products. The
diversity and quality of our product range is a direct reflection of our concerted
R&D efforts.
Customer Support
Vulcain supports its customers through an extensive network of sales agents
and regional support centres located throughout North America. Our sales and
service specialists are continuously trained and updated on all products and
technologies, thus ensuring prompt and effective customer service.
m
o
c
.
a
y
r
A
E
S
H
Individual Solutions
Vulcain’s highly trained application engineers work closely with end users to
develop customized applications for gas detection needs. Whether you require
a fully engineered gas detection network or a more modest detection solution,
Vulcain offers an extensive selection of products and services.
If you have any technical questions or require any special product
modifications or unique applications, Vulcain’s team of technical support staff is
always available to assist you.
w
w
.
w
www.HSEArya.com
Gas Detection Controller
VA201C
Division of BW Technologies
Vulcain Inc., a company that prides itself on
innovation and product excellence, is pleased to
offer a gas detection system of exceptional
quality. The product of many years of extensive
research, makes the VA201 Detection System
extremely flexible compared to its competitors.
m
o
c
.
a
y
r
A
E
S
H
The VA201C controller can manage 32 gas
transmitters and 32 relay modules, through two
RS-485 channels, up to 2000 feet of distance
from the controller.
.
w
w
w
• Visual indicators and audible alarm
• 2 or 3 alarm levels
• Programmable time delays
• Failure indicator
• Optional LCD display and keypad
• Up to 32 transmitters and relay modules
• Up to 4 actions per alarm level per transmitter
• No moving parts
• Trouble-free operation
• Quick self-test and warm-up
• RS-232C transmission port
Ordering Information
VA201C
Controller
Options:
n
AC
3L
RS-232
4XC
C/Guard
LCD display and keypad
3 Alarm Levels
RS-232 output
Nema 4 enclosure
Metal guard
ISO 9002
Protecting your health and your environment.
www.HSEArya.com
VA201C
VA201C SPECIFICATIONS
Gas Detection Controller
Ease of installation
VISUAL INDICATORS:
Normal Operation:
Alarm Level 1:
Alarm Level2:
Failure Indication:
The VA201C controller
minimizes installation costs by
using an addressable RS-485
communication protocol. Only
two pairs of wires are required to
connect all the gas transmitters
and relay modules to one of the
controller’s two channels. With a
total of 32 gas transmitters and 32
relay modules that can be linked to
one controller, the VA201 Detection
System represents the most
affordable protection for your gas
monitoring requirements.
User Interface:
Data Output:
Distance Between
Controller and Transmitter:
Relay Output Rating:
Alarm Levels:
Audible Alarm:
Time Delays:
Outputs:
Operating Humidity Range:
Operating Temperature Range:
Green LED
Red LED
Red LED
Yellow LED
Alphanumeric display and keypad
RS-232 (ASCII)
Up to 2000 feet (600m)
5A, 30Vdc or 250 Vac (resistive load)
2 with high and low set points
3 (optional)
65 dBA at 3 feet (1 metre)
0-99 minutes before and after an alarm
3 DPDT relays (2 alarms and 1 fault or 3 alarms)
0-95% RH, non-condensing
32 °F to 100 °F (0 °C to 40 °C)
m
o
c
.
a
y
r
A
E
S
H
GENERAL SPECIFICATIONS
Size:
Weight:
Power Requirement:
8.5 x 11 x 2.0 inches
22.2 x 26.1 x 5 cm
3.5 lbs. (1.58 Kg)
17-27 Vac, 24-38 Vdc, 250 mA
Certified to UL and CSA standards
The VA201T series and the
VA301D are fully compatible with
the VA201C controller
DUE TO ON-GOING RESEARCH AND PRODUCT IMPROVEMENT, SPECIFICATIONS ARE SUBJECT TO CHANGE WITHOUT NOTICE.
The VSQNA provides an efficient interface between
the gas transmitters and controller.
.
w
Division of BW Technologies
w
w
For further information:
The VA301D and VA201T series are
compatible for most commercial and
industrial applications. These transmitters
can also work in a stand-alone mode with
4-20mA output and feature a range of
other capabilities.
:HEVLWHZZZ+6($U\DFRP
7HO
(PDLOLQIR#+6($U\DFRP
7HOHJUDP,'#+6($U\DB33(
,QVWDJUDP,'#+6($U\D33(
VA201T
In addition to the three relays already included in
the controller, other outputs are also available
with the VA201R relay module.
Locally Distributed by:
www.HSEArya.com
Toxic and Flammable
GasTransmitters
VA201T Series
Division of BW Technologies
Vulcain Inc., a world leader in gas detection for
over three decades, has designed the VA201T
series to meet or exceed safety requirements in a
variety of commercial and industrial applications.
These transmitters can work in a network mode
with our VA201C controller through their RS-485
link, or can be used in a stand-alone
configuration offering 4-20mA and alarm
relay outputs.
m
o
c
.
a
y
r
A
E
S
H
Vulcain’s sensors’ inherent reliability and stability
characteristics have accounted for the universal
acceptance within a broad spectrum of
commercial and industrial applications.
Catalytic gas sensors are used to detect
hundreds of different flammable gases and
vapor concentrations. Toxic gases are detected
through electrochemical cells, while fuel cells are
used for oxygen detection. Moreover, a second
generation of semi-conductor sensors provides
a highly effective solution for a range of different
applications.
.
w
w
w
•
•
•
•
•
•
•
•
•
•
Proven sensing technology
10-step LED display
Stand-alone or network configuration
Optional 4-20 mA and relay output
Optional audible alarm and LCD display
One-man remote calibration
Field-proven protection
Innovative and compact case design
Easy installation and operation
Full compatibility with VA-201C
Ordering Information
VA201TQ1-xxx*
VA201TQ2-xxx*
VA420TQ1-xxx*
*gas to be detected
Gas transmitter with Q1-type sensor
Gas transmitter with Q2-type sensor
Two wire gas transmitter
Options:
ISO 9002
A
R
C
D
RS
Audible alarm
Relay output
4-20 mA output
LCD display
Remote sensor
DT
4X
ECLAB
TM/Guard
LTA
Duct type
Nema 4 (N/A for Q2)
Splash guard
Metal guard
Low temp. assembly
Protecting your health and your environment.
VA201T Series
Toxic and Flammable
Gas Transmitters
SENSING TECHNOLOGY
Q1-type Sensor:
Q2-type Sensor:
DISPLAY
Visual Indicators:
VA420T Two-Wire
4-20 mA Configuration
Relay Output Rating:
†
Audible Alarm:
Outputs:
Operating Humidity Range:
Operating Temperature Range:
GENERAL SPECIFICATIONS
Size:
Weight:
Power Requirement:
Gas Detected
.
w
TORONTO
344 Edgeley Boulevard, Unit 13
Vaughan, ONT
L4K 4B7
Tel: 1-905-660-6544
Fax: 1-905-660-7362
MONTREAL
4005 Matte boulevard
Brossard, QC
J4Y 2P4
Tel:
Fax:
1-800-563-2967
1-450-632-9938
E-mail: sales@vulcaininc.com
www.vulcaininc.com
8.4 in.(H) x 5.3 in.(W) x 2.25 in.(D)
(21.3 cm x 13.4 cm x 5.7 cm)
0.86 lbs. (0,350Kg)
17-27 Vac, 24-38 Vdc, 250 mA
Detection Range
Accuracy
Q1-type sensor
Q2-type sensor
Q1-type sensor
Q2-type sensor
CO
0-50 ppm
0-100 ppm
0-250 ppm(std)
0-500 ppm
0-250 ppm
3%
5%
NO2
0-10 ppm
-
3%
-
H2
0-2.5%
0-100% LEL
3%
5%
CL2
0-15 ppm
-
3%
-
0-100% LEL
0-100% LEL
3%
5%
0-100 ppm
-
5%
-
-
0-2000 ppm
*N/A R123
-
10%
0-50 ppm
-
3%
-
Refrigerants
w
w
5A, 30Vdc or 250 Vac (resistive load)
65 dBA at 3 feet (1 metre)
RS-485, *4-20mA, *Alarm relay
0 - 95% RH, non-condensing
32°F to 100°F (0°C to 40°C)
Low temperature range available 4°F (-20°C)
See options on previous page.
NH3
Tel: 1-800-563-2967
Fax: 1-888-976-2967
Green LED
Certified to UL and CSA standards
†
Combustibles
USA
1971 Western Avenue
Unit 1122, Albany, NY
USA 12203
10-step LED, LCD
Failure Indication : Yellow LED
m
o
c
.
a
y
r
A
E
S
H
Offering comparable
characteristics as the VA201T
series except for the LED
indicators and the available
options, the VA-420T ensures
substantial saving on the
installation cost.
For further information:
Electrochemical (toxic)
Catalytic combustion (combustibles)
Diffusion fuel cell (oxygen)
Solid-state
Electrochemical (Carbon Monoxide)
(Available in network configuration only)
Normal Operation:
A two-wire version of the VA201T
series is available for most toxic
gases detected by our
Q1-type sensor. When the unit is
powered, it enables the
4-20 mA analogic loop to vary in
proportion with the level of
gas detected.
Division of BW Technologies
www.HSEArya.com
VA201T SPECIFICATIONS
H2S
0-25%
-
3%
-
SO2
0-10 ppm
-
3%
-
ETO
0-20 ppm
-
3%
-
HCN
0-50 ppm
-
3%
-
O2
DUE TO ON-GOING RESEARCH AND PRODUCT IMPROVEMENT, SPECIFICATIONS ARE SUBJECT TO CHANGE WITHOUT NOTICE.
1 Sensor
2 Unit status
3 Multimeter ports
4 Calibration port
1 Sensor
2 10 LED 1-10 (1=10%)
3 Unit status
4 Multimeter ports
5 Calibration port
2
2
3
5
1
VA201T
Locally Distributed by:
4
1
3
4
VA420T
www.HSEArya.com
Explosion Proof Toxic and
Combustible Gas Transmitters
VA301D Series
Division of BW Technologies
Combining state of the art technology with a
rugged explosion-proof housing, the VA301D
analyzes a wide variety of both toxic and
combustible gases to high levels of precision.
Engineered to rigorous specifications, the unit is
specifically designed to provide enhanced
performance and reliability in the most adverse
industrial conditions.
m
o
c
.
a
y
r
A
E
S
H
Smart sensing technology
Inherent smart sensing technology permits the
VA301D’s transmitter module to instantly
recognize and adjust to a range of targeted
gases. In addition, depending on the unit’s
configuration, an internal clock measures the
elapsed time that the sensor has been in use.
Other routines allow for the rating of the
time remaining before calibration and the
performing of built-in zero adjustment—features
that virtually eliminate downtime.
•
•
•
•
•
•
•
•
•
•
.
w
w
w
Integrated LCD
Secured Non-intrusive calibration
Proven sensing technology
Optional Modbus communication
Fail safe contact closures
Optional dual alarm levels
Optional remote sensing
4-20mA analog output
Explosion-proof housing
Calibration port makes for easy
maintenance
Ordering Information
VA301Dxxx*
*gas to be detected
Gas transmitter with Q1-type Sensor
Options:
O
F
M
SD
PC
Fail safe alarm relay output Alr 1 & Alr 2
Fail safe alarm relay output Alr 2 & Fault
Modbus
Remote sensing
Calibration port
ISO 9002
Protecting your health and your environment.
VA301D
Explosion Proof
Toxic and
Combustible Gas
Transmitters
SENSING TECHNOLOGY
SENSING TECHNOLOGIES:
The VA301D is housed in
a rugged, explosion-proof
enclosure specially designed for
operation in hazardous locations.
An integrated sensor guard
protects the sensor from dust or
dirt, keeping reading as accurate
as possible.
GENERAL SPECIFICATIONS
POWER REQUIREMENTS:
SIZE:
m
o
c
.
a
y
r
A
E
S
H
WEIGHT:
Certified to UL and CSA standards
Class 1 Div 1 Groups B, C, D
See options on previous page.
Gas Detected
CO
NO2
H2
.
w
w
w
TORONTO
344 Edgeley Boulevard, Unit 13
Vaughan, ONT
L4K 4B7
Tel: 1-905-660-6544
Fax: 1-905-660-7362
MONTREAL
4005 Matte boulevard
Brossard, QC
J4Y 2P4
1-800-563-2967
1-450-632-9938
E-mail: sales@vulcaininc.com
3%
0-10 ppm
3%
0-2.5% LEL
3%
3%
3%
NH3
0-100 ppm
5%
H 2S
0-50 ppm
3%
0-25%
3%
O2
For further information:
Accuracy
0-250 ppm
0-15 ppm
Combustibles
Division of BW Technologies
Detection Range
0-100% LEL
CL2
www.vulcaininc.com
17-27 Vac, 24-38 Vdc, 250 mA
6.5 in (H) x 4.8 in (W) x 3.9 in (D)
17 cm x 12 cm x 10 cm
3.5 lbs (1.6 Kg)
†
To optimize environmental
control, the VA301D is fully
compatible and can be used in
conjunction with the Vulcain
VA201C contoller
Tel:
Fax:
Green LED
Red LED
Yellow LED
5A, 30 Vdc or 250 Vac (resistive load)
RS-485, †Modbus, 4-20 mA or †2 SPDT
fail safe relays
0 - 95% RH, Non-condensing
-40°F to 100°F (-40°C to 40°C) Toxic
-40°F to 112°F (-40°C to 50°C) Combustibles
OPERATING HUMIDITY RANGE:
OPERATING TEMPERATURE RANGE:
Superior Versatility
Tel: 1-800-563-2967
Fax: 1-888-976-2967
Electrochemical (toxic)
Catalytic combustion (combustibles)
Diffusion fuel cell (oxygen)
Alpha numeric LCD display
DISPLAY:
VISUAL INDICATORS:
Normal Operation:
ALARMS:
FAULT:
RELAY OUTPUT RATING:
OUTPUTS:
Durable Design
USA
1971 Western Avenue
Unit 1122, Albany, NY
USA 12203
www.HSEArya.com
VA301D SPECIFICATIONS
SO2
0-10 ppm
3%
ETO
0-10 ppm
3%
HCN
0-50 ppm
3%
HCL
0-50 ppm
3%
DUE TO ON-GOING RESEARCH AND PRODUCT IMPROVEMENT, SPECIFICATIONS ARE SUBJECT TO CHANGE WITHOUT NOTICE.
4
2
1 Smart sensor
2 Menu key
3 Visual indicators
4 LCD display
2
3
4
3
1
1
VA301D
Locally Distributed by:
VA201C
1 Programming keypad
2 Visual indicators
3 LCD display
4 Key locked enclosure
www.HSEArya.com
Infrared Refrigerant
Gas Transmitter
VA201TQ1
Division of BW Technologies
Firmly committed to continuous product
innovation, and subsequent to major investments
in its research facilities, Vulcain has developed a
highly reliable refrigerant gas transmitter which
represents one of the most important technological
advances of the past decade.
m
o
c
.
a
y
r
A
E
S
H
Featuring its proven infrared sensor and the
latest digital filter technology, Vulcain’s VA201TQ1
transmitter is a microprocessor-based device using
complex mathematical algorithms and
state-of-the-art low-noise components to offer
remarkably accurate readings of the lowest gas
concentrations, ensuring maximum safety and
environmental protection.
.
w
w
w
•
•
•
•
•
•
•
•
•
•
•
•
Specific refrigerant monitoring
Proven infrared technology
Built-in microprocessor
Stand-alone or network operation
Optional relay
4-20 mA and 0-10 Vdc outputs
Temperature compensation
Easy calibration
Trouble-free operation
No moving parts
Superior cost-effectiveness
Optional LCD display
Ordering Information
VA201TQ1-xxx*
Refrigerant gas transmitter
*gas to be detected
Options:
ISO 9002
DY
RY
REF/Guard
LCD display
Relay output
Metal Guard
Protecting your health and your environment.
VA201TQ1
www.HSEArya.com
VA201TQ1 SPECIFICATIONS
Infrared Refrigerant
Gas Transmitter
Gases Detected:
Sensing Technology:
Measurement Range:
Resolution:
Response Time:
Cold to Start:
Outputs:
Display:
Relay Output Rating:
Power Requirement:
Operating Temperature Range:
Operating Humidity Range:
Enclosure:
Size:
R-11, R-12, R-22, R-123, R-125,
and R-134a (mixes also available)
Vulcain infrared sensor
0-1000 ppm
1 ppm
30 sec. (100% of variation)
5 minutes
DPDT relay
RS-485
0-10 Vdc
4-20 mA
4-digit LCD
5A, 30 Vdc or 250 Vac (resistive load)
17-27 Vac, 24-38 Vdc, 250 mA
32°F to 100°F (0°C to 40°C)
0 - 95% RH, non-condensing
Metal Nema 2
10 in.(H) x 9 in.(W) x 2.5 in.(D)
( 25 cm x 22.5 cm x 6.3 cm )
5.17 lbs.
( 2.35 Kg )
m
o
c
.
a
y
r
A
E
S
H
Weight:
The VA201T series is fully compatible with the VA201C controller
VA201C TECHNICAL SPECIFICATIONS
User Interface :
Visual Indicators :
Alarm Level 1:
Alarm Level 2:
Failure:
Power Requirement :
Audible Alarm :
Number of Sensing points :
Number of Outputs :
Relay Output Rating :
Alarm Levels :
Time Delays :
Data Output :
Distance Between Controller:
and Transmitter:
Size :
Weight:
.
w
Division of BW Technologies
w
w
For further information:
Alphanumeric display and keypad
Normal operation: Green LED
Red LED
Red LED
Yellow LED
17-27 Vac, 24-38 Vdc, 200 mA
65 dBA at 3 feet (1 metre)
Up to 32 transmitters
3 DPDT relays
5A, 30 Vdc or 250 Vac (resistive load)
2 with high and low set points
3 (optional)
0-99 minutes before and after an alarm
RS-232C
Up to 2000 feet (600 meters)
8.5 in.(H) x 11 in.(W) x 2 in.(D)
( 22 cm x 26 cm x 5 cm )
3.5 lbs.
( 1.58 Kg )
DUE TO ON-GOING RESEARCH AND PRODUCT IMPROVEMENT, SPECIFICATIONS ARE SUBJECT TO CHANGE WITHOUT NOTICE.
2
1 Infrared sensor
2 Key locked
enclosure
:HEVLWHZZZ+6($U\DFRP
7HO
(PDLOLQIR#+6($U\DFRP
7HOHJUDP,'#+6($U\DB33(
,QVWDJUDP,'#+6($U\D33(
1 Programming keypad
2 Visual indicators
3 LCD display
4 Key locked enclosure
3
2
4
1
1
VA201TQ1 transmitter
3
VA201C controller
www.HSEArya.com
Infrared CO2 Gas Monitor
90DM3A
Division of BW Technologies
With an unparalleled reputation for product
innovation, reliability and excellence, Vulcain Inc.
is once again setting industry standards with the
latest generation Infrared CO2 Gas Monitor
- the 90DM3A.
m
o
c
.
a
y
r
A
E
S
H
The product of the most rigorous research and
industrial design, the 90DM3A, incorporates
Vulcain’s unique infrared sensing technology and
state of the art microprocessor controlled digital
transmission into a CO2 gas monitor, offering a
level of precision and efficiency second to none.
• Proven infrared technology
• Specific CO2 monitoring
• Built-in microprocessor
• Optional relay contact closure (fail safe)
• 4-20mA or 0-5 Vdc or 0-10 Vdc output
• Temperature compensation
• Trouble-free operation
• No moving parts
• Menu driven easy calibration
• Optional 0-2% or 0-5% detection range
.
w
w
w
Ordering Information
90DM3A
90DM3ADT
90DM3ASM
CO2 Transmitter with 4-20 mA,
or 0-5 Vcd or 0-10 Vdc output
Unit with a housing for
duct-mount applications
Unit with a housing for
surface-mount applications
Options:
ISO 9002
D3
O3
2
5
VU
MU
LCD Display for surface mount applications
Fail safe relay output
0-2% detection range
0-5% detection range
Vulbus communication
Modbus communication
Protecting your health and your environment.
90DM3A
www.HSEArya.com
90DM3A SPECIFICATIONS
Infrared CO2
Gas Monitor
Gas Detected:
Detection Range:
Accuracy:
Response Time:
Sensor Life Expectancy:
Relay Output Rating:
*Display:
Outputs:
Mounting Made Unique
and Easy
To provide maximum versatility, the
90DM3A is available with two different
housing configurations, making it ideally
suited to virtually any commercial or
industrial gas detection application. Both
enclosures are made of ABS plastic,
offering maximum durability.
Operating Humidity Range:
Operating Temperature Range:
GENERAL SPECIFICATIONS
Size:
Weight:
Designed to accurately detect the
presence of CO2 in air-handling
systems, the DT Model represents a
radical innovation in housing design.
Unlike other units on the market today,
the enclosure is totally airtight, more
compact, and extremely lightweight,
with a convenient mounting bracket to
improve installation. All in all, its superior
operational and cost efficiency make
the DT Model the only choice for largerscale CO2 detection applications.
Power Requirement:
CO2
0-2000 ppm, *0-2% or *0-5%
+/- 3%
35 sec. (for 90% of the reading)
> 10 years
5A, 30 Vdc or 250 Vac (resistive load)
LCD
4-20 mA or 0-5 Vdc or 0-10 Vdc
*1 SPDT Relay
0-95% RH, Non-condensing
32°F to 100°F (0°C to 40°C)
5.25 x 3.5 x 2 inches/
11.5 x 7.5 x 4.4 cm
SM: 0.55 lbs. (0.20 kg)
DT: 0.66 lbs. (0.30 kg)
17-27 Vac or 24-38 Vdc, 200 mA
The SM Model is a wall-mounted unit
with a compact and an aesthetically
pleasing design which blends perfectly
and discretely with any room decor.
Easily installed directly onto drywall or
other surfaces, the SM Model allows for
superior gas circulation and airflow.
m
o
c
.
a
y
r
A
E
S
H
Certified to UL and CSA standards
Exclusive 5-Year Limited Warranty
Thanks to its exceptionally high-grade components and strict quality control,
Vulcain’s 90DM3A CO2 Gas Monitor comes with an exclusive 5-year
warranty covering all parts and labor for the full length of the guarantee.
Built to last and outperform competitive units, the 90DM3A is the first product
of its kind to come with such a comprehensive warranty, ultimately decreasing the
expense of owning the equipment through significantly less downtime and major
operating and maintenance cost savings.
DUE TO ON-GOING RESEARCH AND PRODUCT IMPROVEMENT, SPECIFICATIONS ARE SUBJECT TO CHANGE WITHOUT NOTICE.
.
w
Division of BW Technologies
w
w
For further information:
:HEVLWHZZZ+6($U\DFRP
7HO
(PDLOLQIR#+6($U\DFRP
7HOHJUDP,'#+6($U\DB33(
,QVWDJUDP,'#+6($U\D33(
2
3
1
Locally Distributed by:
1 Optional LCD display
2 Air inlet for surface
Mount housing
3 Duct mount housing
www.HSEArya.com
4-20 mA 2-Wire Gas Transmitters
Carbon Monoxide
ToxyPoint
Division of BW Technologies
BENEFITS:
Eliminate Maintenance
The ToxyPoint 2-wire transmitter provides continuous monitoring for carbon monoxide in ambient
air. Engineered with field-proven industrial sensing and instrument technology, the ToxyPoint is
maintenance-free.
m
o
c
.
a
y
r
A
E
S
H
• No calibration, no sensor replacement,
.
w
w
w
no downtime
• Low initial cost—competitively priced
• Lower electrical and heating bills with highly
accurate electrochemical industrial
sensor
• Security and reliability. Automatic full function
sensor integrity test performed daily and
on activation.
• Improved air quality (IAQ) with accurate, reliable
detection of carbon monoxide
• Easy, fast installation. The 2-wire monitor fits
into a standard, single-outlet electrical box.
• 2-wire, loop-powered. No extra transformer
required. Power consumption only 50 mA.
• Unobtrusive design with rugged sintered
stainless steel sensor screen.
• Industrial technology now available to the
commercial market
• 3 year operational life; 2 year warranty
Ordering Information
TP1-M:
3 year 4-20 mA Gas Transmitter with
CO sensor and ToxyPoint mounting plate
Fits into standard, single-outlet (1 gang) electrical box.
Specify special alarm setpoints, if required, at time of order.
Compatible with any
4-20 mA Control System (DDC, PLC, etc.)
n
ISO 9001
Protecting your health and your environment.
ToxyPoint
www.HSEArya.com
SPECIFICATIONS
2-wire, 4-20 mA CO gas transmitter with advanced microcontroller based circuitry
10 to 28 VDC; (24 VDC nominal)
50 mA
Maximum: 24 mA @ 24 VDC Nominal: 4 mA @ 24 VDC
Alarm Outputs O/P1 and O/P2: 0.25 A (Max) @ 24 VDC supply
EMI/RFI: Complies with EMC Directive 89/336/EEC
MONITOR:
Supply Voltage:
Power Supply:
Power Consumption:
Carbon Monoxide
Three Year Disposable
Zero-Maintenance
4-20 mA Gas Transmitter
Monitor
ToxyPoint is designed to reduce the overall
cost of ownership with a lower initial
investment, eliminating maintenance costs
and minimizing building electrical operating
costs. Designed to meet the same high
standards as the BW portable gas detectors
and fixed systems, ToxyPoint delivers
accurate, reliable protection from carbon
monoxide.
Operational
LifeN.1
Measuring
Range
Temperature
Range
3 years
0-500 ppm
0 to +40°C
+32 to +104°F
ToxyPoint CO
Alarm Levels N.2
LOW
HIGH
35 ppm
200
ppm
Zero-maintenance Electrochemical
15 to 90% non-condensing
Not Required
Two (2) trigger field interface(s) (slave relay, fan, strobe, etc.) rated 250 mA at 24 VDC
Two (2) factory set (customer specified) gas alarms: LOW (O/P1); HIGH (O/P2)
Activates both Low and High alarm outputs
Signal output to control System (DDC, PLC etc):
Normal Operation: 4-20 mA linear signal
Self-Test Fail: 2 mA signal
Sensor Expired: 2 mA signal
Over Range Gas Alarm: 24 mA signal (maximum)
Power Off: 0 mA signal
LED INDICATOR ADVICE: Power ON: On
No Power: Off
Self-Test Fail: Fast flash (1 flash every 0.5 seconds)
Life ending warning: Slow flash (1 flash every 2 seconds)
(Provides one month warning prior to expiry date)
Operational life ended: Off
SELF-TEST: On activation (Auto) and Daily (Auto)
Verifies: Sensor Integrity and operation
SENSOR:
Humidity:
Calibration:
ALARM OUTPUTS:
Gas Alarms:
Fault Alarm:
CURRENT OUTPUT:
m
o
c
.
a
y
r
A
E
S
H
ToxyPoint provides an alternative
to high-maintenance, solid-state sensors
and standard electrochemical monitors,
which require constant and often expensive
maintenance.
Carbon monoxide detector (0-500 ppm)
Wide supply voltage range: 10 to 28
VDC, and a linear 4-20 mA output
Two factory set alarm levels:
Low and High (customer specified)
Two alarm outputs
No extra transformer required
Special Feature
The full function sensor integrity test
is a unique safety advantage of BW
Technologies equipment. The automatic daily
self-test verifies sensor operation and advises
the control system if the sensor is defective.
TRANSMISSION RANGES:
2– Wire Conductor Size:
Distance
22 AWG
0.64 mm
6,712 ft.
2,045 m
20 AWG
0.75 mm
10,953 ft.
3,253 m
18 AWG
1.0 mm
16,953 ft.
5,167 m
1.36 x 1.75 x 2.56 in. (3.5 x 4.5 x 6.5 cm)
PHYSICAL: Size:
Weight: 1.34 oz. (38 g)
Cover: ToxyPoint aluminum cover mounting plate fits standard single outlet electrical box
Wire Terminations: Screw type terminals
WARRANTY: Two (2) year (3 year operational life)
.
w
Division of BW Technologies
w
w
For further information:
Spec
N.1
One year shelf life before activation
N.2
Customer special alarm settings available at time of order
DUE TO ON-GOING RESEARCH AND PRODUCT IMPROVEMENT, SPECIFICATIONS ARE SUBJECT TO CHANGE WITHOUT NOTICE.
RATINGS AND CERTIFICATIONS:
cCSAus Ordinary locations
International Electrical Code: IEC No. 61010
U.S. Standard: ANSI/ISA S82.01
Canadian Standard Electrical Code: C22.2 No. 1010
:HEVLWHZZZ+6($U\DFRP
7HO
(PDLOLQIR#+6($U\DFRP
7HOHJUDP,'#+6($U\DB33(
,QVWDJUDP,'#+6($U\D33(
1
5
2
3
1 Zero-maintenance
2 Electrochemical CO sensor
3 Sintered screen protects
sensor from damage
4 Red LED status indicator
5 Mounting plate fits single
outlet electrical box
6 Simple installation
Locally Distributed by:
4
6
www.HSEArya.com
Stand-Alone Gas Monitor
VA201M Series
Division of BW Technologies
The product of years of research and innovative
technological development, Vulcain’s VA201M
series is an advanced microprocessor-based
system featuring a high quality stand-alone
controller, a unique high-tech enclosure, and
all the necessary characteristics to provide
continuous, effective and fully integrated
monitoring of toxic and combustible gases.
.
w
m
o
c
.
a
y
r
A
E
S
H
w
w
• Two alarm levels
• 10-step LED display
• 2 high/low DPDT alarm relays
• Audible/visual alarms
• Programmable time delays
• Quick self-test and warm-up
• Calibration status warning
• Innovative and attractive case design
• Simple installation and operation
• Easy field verification
• Remote sensor configuration available
• Cost-effective
Ordering Information
VA201MQ1-xxx*
VA201MQ2-xxx*
*gas to be detected
Complete gas monitor with Q1-type sensor
Complete gas monitor with Q2-type sensor
Options:
D
RS
DT
4X
LCD display
Remote sensor
Duct type
Nema 4 (N/A for Q2)
ECLAB
Splash guard
TM/Guard Metal guard
LTA
Low temperature assembly
n
ISO 9002
Protecting your health and your environment.
VA201M Series
www.HSEArya.com
VA201M SPECIFICATIONS
Stand-Alone Gas
Monitor
SENSING TECHNOLOGY
Q1-type Sensor:
Electrochemical (toxic)
Catalytic combustion (combustibles)
Diffusion fuel cell (oxygen)
Solid-state
Electrochemical (Carbon Monoxide)
Q2-type Sensor:
Innovative Architecture
10-step LED, *LCD
Failure Indication : Yellow LED
Green LED
DISPLAY
Visual Indicators:
Normal Operation:
The result of extensive
experimentation and the most
rigorous testing, the
VA201M’s highly advanced
enclosure is designed to provide
maximum effectiveness and
durability. As such, all contours
and surfaces have been carefully
conceived and constructed to allow
optimal gas flow and ensure total
precision in detection.
Relay Output Rating:
Alarm Levels:
Time Delays:
Audible Alarm:
Outputs:
Operating Humidity Range:
Operating Temperature Range:
5A, 30Vdc or 250 Vac (resistive load)
High and Low
0, 1, 5 or 10 minutes
65 dBA at 3 feet (1 metre)
2 DPDT relays
0 - 95% RH, Non-condensing
32 °F to 100 °F (0 °C to 40 °C)
Low temperature range available -4 °F (-20 °C)
m
o
c
.
a
y
r
A
E
S
H
GENERAL SPECIFICATIONS
Size:
8.4 x 5.3 x 2.25 inches
21.3 cm x 13.4 cm x 5.7 cm
0.86 lbs. (0.350Kg)
Weight:
Power Requirement:
17-27 Vac, 24-38 Vdc, 250 mA
Certified to UL and CSA standards
Gas Detected
Q1-type sensor
Q2-type sensor
CO
0-50 ppm
0-100 ppm
0-250 ppm(std)
0-500 ppm
0-250 ppm
3%
5%
NO2
0-10 ppm
-
3%
-
H2
0-2.5%
0-100% LEL
3%
5%
CL2
0-15 ppm
-
3%
-
0-100% LEL
0-100% LEL
3%
5%
0-100 ppm
-
5%
-
-
0-2000 ppm
*N/A R123
-
10%
NH3
Refrigerants
.
w
w
w
For further information:
Accuracy
Q2-type sensor
Combustibles
Division of BW Technologies
Detection Range
Q1-type sensor
H2S
O2
0-50 ppm
-
3%
-
0-25%
-
3%
-
SO2
0-10 ppm
-
3%
-
ETO
0-20 ppm
-
3%
-
HCN
0-50 ppm
-
3%
-
HCL
0-50 ppm
-
3%
-
DUE TO ON-GOING RESEARCH AND PRODUCT IMPROVEMENT, SPECIFICATIONS ARE SUBJECT TO CHANGE WITHOUT NOTICE.
:HEVLWHZZZ+6($U\DFRP
7HO
(PDLOLQIR#+6($U\DFRP
7HOHJUDP,'#+6($U\DB33(
,QVWDJUDP,'#+6($U\D33(
1 Sensor
2 10 LED 1-10 (1=10%)
3 Unit status
4 Multimeter ports
5 Calibration port
2
3
1
5
VA-201M
Locally Distributed by:
4
www.HSEArya.com
Multi-Point Sample Draw
Gas Monitor
Division of BW Technologies
VASQN8X Series
The new generation of VASQN Series combines
Vulcain’s long proven sensing capability along
state of the art pumping technology with constant
high accuracy and full reliability sample draw gas
detector system.
m
o
c
.
a
y
r
A
E
S
H
The VASQN8X offers notably accurate monitoring
of the presence of a wide variety of refrigerants,
or other toxic and explosive gases, in a surveillance area of up to 8 different zones. A low maintenance diaphragm pump draws ambient
air to the sensor from a maximum distance
of 1000 feet. A high performance sequencer
synchronizes the mechanics and the electronics
so that the levels of detectable gases are
properly registered for each of the 8 zones. The
unit is fully operational from the box, making
for simple hassle free installation. The new
generation of VASQN8X provides an excellent
cost-effectiveness centralized solution.
.
w
w
w
• Wide area of coverage
• 3 alarm relays
• Audible alarm
• LCD display
• LED status indicators
• Integrated flow loss surveillance
• 1 to 8 sample points
• Early low level warning alarm
• Proven sensing technology
• Up to 2 gases
Ordering Information
VASQN8XG1-G2*
*X: Number of zones
G1: First Target Gas
G2: Second Target Gas
Advanced Multi-Point Gas Monitor
ISO 9002
Protecting your health and your environment.
VASQN8X
www.HSEArya.com
VASQN8X SPECIFICATIONS
Multi-Point Gas Draw
Gas Monitor
Each VASQN8X is equipped with
a built-in noise immune RS-485
communication network providing the
ability to transmit long distances with
the VA201C controller. The VA201C
accommodates up to 2 VASQN8X.
Features of the VA201C controller
include:
VISUAL INDICATORS:
Normal Operation:
Alarm Level 1:
Alarm Level 2:
Failure Indication:
Aspirated Zone:
.
w
w
w
For further information:
5A, 30 Vdc or 250 Vac (resistive load)
110 dBA at 3 feet (1 meter)
3
Up to 8, including 1/8” polymer tubing
3 DPDT relays
(3 alarms level or 2 alarm levels and Fault)
RS-485
0 - 95% RH, Non-condensing
32°F to 100°F (0°C to 40°C)
1000 Feet (335 meter)
m
o
c
.
a
y
r
A
E
S
H
The VASQN8X Series, with its
unsurpassed network expandability,
offers a cost-effective centralized
solution.
Division of BW Technologies
Green LED
Red LED
Red LED
Yellow LED
Green LED
Relay Output Rating:
Audible Alarm:
Alarm Levels:
Number of Sample Points:
Outputs:
• Capacity to monitor 32 transmitters
and 32 relay modules
• Visual Indicators and audible alarm
• Multiple alarm levels
• Programmable time delays
• LCD display
• RS-232C transmission port
.
Refrigerant (infrared)
Electrochemical (toxic)
Catalytic combustion (combustibles)
Diffusion fuel cell (oxygen)
SENSING TECHNOLOGY:
Operating Humidity Range:
Operating Temperature Range:
Maximum Sampling Distance:
GENERAL SPECIFICATIONS
Size:
19 x 11.75 x 4.5 inches
48.3 x 30 x 11.4 cm
22.4 lbs. (10.17 Kg)
Weight:
Power Requirement:
120 Vac, 2A
Certified to UL and CSA standards
Gas Detected
Detection Range
Sensitivity
Accuracy
0-1000 ppm
4ppm
3%
CO
0-50 ppm
0-100 ppm
0-250 ppm(std)
0-500 ppm
1 ppm
3%
NO2
0-10 ppm
0.04 ppm
3%
R11, R12, R22,
R123, R125,
R134A
H2
0-2.5% LEL
0.4%
3%
CL2
0-15 ppm
0.06 ppm
3%
0-100% LEL
0.4%
3%
NH3
0-100 ppm
0.4 ppm
5%
H 2S
0-50 ppm
0.2 ppm
3%
0-25%
0.1%
3%
SO2
0-10 ppm
0.04 ppm
3%
HCN
0-50 ppm
0.2 ppm
3%
Combustibles
O2
DUE TO ON-GOING RESEARCH AND PRODUCT IMPROVEMENT, SPECIFICATIONS ARE SUBJECT TO CHANGE WITHOUT NOTICE.
6
:HEVLWHZZZ+6($U\DFRP
7HO
(PDLOLQIR#+6($U\DFRP
7HOHJUDP,'#+6($U\DB33(
,QVWDJUDP,'#+6($U\D33(
4
5
3
1
2
7
Locally Distributed by:
1 Air inlet port
2 Sampling port LED
3 Programming keys
4 Visual indicators
5 LCD display
6 Audible alarm
7 Key locked enclosure
VA301D
Explosion Proof
Toxic and
Combustible Gas
Transmitters
SENSING TECHNOLOGY
SENSING TECHNOLOGIES:
The VA301D is housed in
a rugged, explosion-proof
enclosure specially designed for
operation in hazardous locations.
An integrated sensor guard
protects the sensor from dust or
dirt, keeping reading as accurate
as possible.
GENERAL SPECIFICATIONS
POWER REQUIREMENTS:
SIZE:
m
o
c
.
a
y
r
A
E
S
H
WEIGHT:
Certified to UL and CSA standards
Class 1 Div 1 Groups B, C, D
See options on previous page.
Gas Detected
CO
NO2
H2
:HEVLWHZZZ+6($U\DFRP
7HO
(PDLOLQIR#+6($U\DFRP
7HOHJUDP,'#+6($U\DB33(
,QVWDJUDP,'#+6($U\D33(
.
w
Division of BW Technologies
For further information:
w
w
TORONTO
344 Edgeley Boulevard, Unit 13
Vaughan, ONT
L4K 4B7
Tel: 1-905-660-6544
Fax: 1-905-660-7362
MONTREAL
4005 Matte boulevard
Brossard, QC
J4Y 2P4
1-800-563-2967
1-450-632-9938
E-mail: sales@vulcaininc.com
Accuracy
0-250 ppm
3%
0-10 ppm
3%
0-2.5% LEL
3%
0-15 ppm
3%
3%
NH3
0-100 ppm
5%
H 2S
0-50 ppm
3%
0-25%
3%
Combustibles
For further information:
Detection Range
0-100% LEL
CL2
www.vulcaininc.com
17-27 Vac, 24-38 Vdc, 250 mA
6.5 in (H) x 4.8 in (W) x 3.9 in (D)
17 cm x 12 cm x 10 cm
3.5 lbs (1.6 Kg)
†
To optimize environmental
control, the VA301D is fully
compatible and can be used in
conjunction with the Vulcain
VA201C contoller
Tel:
Fax:
Green LED
Red LED
Yellow LED
5A, 30 Vdc or 250 Vac (resistive load)
RS-485, †Modbus, 4-20 mA or †2 SPDT
fail safe relays
0 - 95% RH, Non-condensing
-40°F to 100°F (-40°C to 40°C) Toxic
-40°F to 112°F (-40°C to 50°C) Combustibles
OPERATING HUMIDITY RANGE:
OPERATING TEMPERATURE RANGE:
Superior Versatility
Tel: 1-800-563-2967
Fax: 1-888-976-2967
Electrochemical (toxic)
Catalytic combustion (combustibles)
Diffusion fuel cell (oxygen)
Alpha numeric LCD display
DISPLAY:
VISUAL INDICATORS:
Normal Operation:
ALARMS:
FAULT:
RELAY OUTPUT RATING:
OUTPUTS:
Durable Design
USA
1971 Western Avenue
Unit 1122, Albany, NY
USA 12203
www.HSEArya.com
VA301D SPECIFICATIONS
O2
SO2
0-10 ppm
3%
ETO
0-10 ppm
3%
HCN
0-50 ppm
3%
HCL
0-50 ppm
3%
DUE TO ON-GOING RESEARCH AND PRODUCT IMPROVEMENT, SPECIFICATIONS ARE SUBJECT TO CHANGE WITHOUT NOTICE.
4
2
1 Smart sensor
2 Menu key
3 Visual indicators
4 LCD display
2
3
4
3
1
1
VA301D
Locally Distributed by:
VA201C
1 Programming keypad
2 Visual indicators
3 LCD display
4 Key locked enclosure
Network
Accessories
www.HSEArya.com
VA420I SPECIFICATIONS
POWER REQUIREMENTS:
NUMBER OF INPUTS:
NUMBER OF OUTPUTS:
HUMIDITY RANGE:
OPERATING TEMPERATURE:
DIMENSIONS:
WEIGHT:
MAXIMUM DISTANCE BETWEEN
CONTROLLER AND CONVERTER:
17-27 Vac, 24-38 Vdc
One RS-485
8 dedicated 4-20 mA outputs
1 min/max or average for up to 16 different transmitters
0-95% RH, non condensing
-40 oF to 185 oF / -40 oC to 85 oC
8.4 x 8.6 x 2.5 inches / 21.3 x 13.4 x 5.7 cm
3.5 lbs / 1.58 kg
up to 2000 feet
ORDERING INFORMATION
Description:
Part Number:
Digital Converter
VA420I
VA201R SPECIFICATIONS
m
o
c
.
a
y
r
A
E
S
H
POWER REQUIREMENTS:
NUMBER OF OUTPUTS:
RATING:
VISUAL INDICATOR:
MAXIMUM DISTANCE BETWEEN
CONTROLLER AND CONVERTER:
HUMIDITY RANGE:
OPERATING TEMPERATURE:
DIMENSIONS:
WEIGHT:
17-27 Vac, 24-38 Vdc
2, 4 or 8DPDT relays
5 amps, 30 Vdc or 250 Vac (resistive load)
1 status LED next to each relay
up to 2000 feet
0-95% RH, non condensing
-40 oF to 185 oF / -40 oC to 85 oC
8.4 x 8.6 x 2.5 inches / 21.3 x 13.4 x 5.7 cm
3.5 lbs / 1.58 kg
ORDERING INFORMATION
Description:
Part Number:
Relay Module
VA201R-X= number of relays (2,4,8)
VASQNA SPECIFICATIONS
POWER REQUIREMENTS:
NUMBER OF OUTPUTS:
RATING:
HUMIDITY RANGE:
OPERATING TEMPERATURE:
AUDIBLE ALARM:
NUMBER OF ZONES:
DIMENSIONS:
WEIGHT:
.
w
Division of BW Technologies
w
w
For further information:
17-27 Vac, 24-38 Vdc
3 DPDT relays (2 alarm, 1 fault)
5 amps, 30 Vdc or 250 Vac (resistive load)
0-95% RH, non condensing
32 oF to 100 oF / 0 oC to 40 oC
65 dBA at 3 feet
32
8.4 x 8.6 x 2.5 inches / 21.3 x 13.4 x 5.7 cm
3.5 lbs / 1.58 kg
ORDERING INFORMATION
Description:
Part Number:
:HEVLWHZZZ+6($U\DFRP
7HO
(PDLOLQIR#+6($U\DFRP
7HOHJUDP,'#+6($U\DB33(
,QVWDJUDP,'#+6($U\D33(
Locally Distributed by:
Annunciator
VASQNA
www.HSEArya.com
m
o
c
.
a
y
r
A
E
S
H
w
w
.
w
Website: www.HSEArya.com
Tel: +9821-55425307
Email: info@HSEArya.com
Telegram ID: @HSEArya_PPE
Instagram ID: @HSEAryaPPE
www.HSEArya.com
w
w
.
w
m
o
c
.
a
y
r
A
E
S
H
s
www.HSEArya.com
MISCELLANEOUS
Calibration Equipment
Information Library
Service and Repair
Training Services
m
o
c
.
a
y
r
A
E
S
H
CALIBRATION EQUIPMENT
INFORMATION LIBRARY
Properties, Applications of Common Gases
Reference Guide to Hazardous Locations
Approvals Agenies and Regulatory Bodies
Intrinsic Safety
Gases Lighter and Heavier than Air
Combustible Gases Explosive Limits
Technical Terms
SERVICE AND REPAIR
w
w
.
w
TRAINING SERVICES
s
www.HSEArya.com
CALIBRATION EQUIPMENT
All gas detection instrumentation on the market requires periodic calibration to accurately
measure gas. Calibration is only as accurate as the test gas used. BW Technologies
quality test gases are made to the highest accuracy and traceability to N.I.S.T. standards.
Non-refillable disposable cylinders are the convenient, cost-effective way to handle calibration
gas mixtures. Lightweight cylinders combine accuracy and ease of use. The standard
calibration gas concentrations are designed to provide proper calibration of BW instruments.
Other concentrations are available for BW monitors with specialized measuring ranges.
m
o
c
.
a
y
r
A
E
S
H
BW Technologies recommends routine calibration of all instruments.
Quad calibration gas is available in both 34 and 58 liter kits
and cylinders. The BW quad gas is designed for use with
BW multi-gas detectors - GasAlertMicro, GasAlertMax and
BW Defender2.
.
w
BW has a variety of single-gas calibration kits and cylinders
to meet your needs. Single-gas calibration cylinders are
available in 34, 58 and 103 liter sizes.
w
w
BW “bump” gas is available for both single and multi-gas
detectors in 11 liter aerosol cylinders. Regular “bump” testing
verifies a sensor’s response to gas.
www.HSEArya.com
CALIBRATION EQUIPMENT
COMBUSTIBLE GASES
LEL
Colorless explosive gases.
% LEL
0-100% LEL
Refineries and Petrochemical Plants
Natural Gas Limits
Pipeline Compressor Stations
Sewers
OXYGEN
O2
Colorless, odorless and tasteless gas. Life
threatening when atmosphere is deficient.
Supports combustion.
% v/v
19.5%
23.5%
Confined Spaces
Cargo Holds and Storage Tanks
Underground Vaults - Utilities/Telecom
Petrochemical Plants
HYDROGEN CYANIDE
deficiency
enrichment
NH3
Colorless toxic gas with a highly pungent odor.
Fertilizer Plants
Refrigeration Facilities and Cold Storages
Production of Explosives
Chemical and Pharmaceutical Industries
CARBON MONOXIDE
STEL:
TWA:
IDLH:
LEL:
50 ppm
25 ppm
300 ppm
15% of vol.
CO
Colorless, odorless, toxic gas absorbed by the
blood, displacing oxygen.
Parking Garages, Engine Test Facilities
Steel Mills
Coke Plants
Power Station (Boilerhouse)
CHLORINE
Colorless, toxic gas with a bitter almond odor
at 1 ppm.
STEL:
TWA:
TWA:
IDLH:
LEL:
200 ppm
35 ppm
30 ppm*
1,200 ppm
12.5% of vol.
Cl2
.
w
Manufacture of Nylon, Dyes, Fumigants
and Rubber
Production of Acrylic Plastics
Gold Plating
Precious Metal Mining Recovery
STEL:
TWA:
IDLH:
LEL:
HYDROGEN SULFIDE
H2S
Pulp and Paper Mills
Water Treatment and Chlorinization Plants
Swimming Pools
Nuclear Reactors
Oilfields and Refineries
Water Treatments Plants and
Sewer Maintenance
Pulp and Paper Mills and Tanneries
Steel Plants
STEL:
TWA:
IDLH:
LEL:
NITRIC OXIDE
NO
CHLORINE DIOXIDE
w
w
1 ppm
0.5 ppm
10 ppm
ClO2
Yellowish-red toxic gas. More reactive and severe
than chlorine.
Pulp and Paper Mills
Chemical Processing
HYDROGEN
STEL:
TWA:
Fertilizer Plants
Food and Fabric Bleaching
Agriculture-Silos (Organic decomposition)
Diesel Emissions – Garages
Refining and Treatment of Metals
Underground Vaults/Transformers
Battery Charging Stations
Semiconductor Plants
HYDROGEN CHLORIDE
LEL:
Manufacture of Rubber, Dyes, and Fertilizers
Pharmaceutical and Chemical Plants
Aluminum Finishing Plants
Pickling of Metals
NO2
Boilers and Furnaces
Diesel Emissions–Garages
Manufacture of Explosives, Rocket
Propellants and Dyes
Semiconductor Plants
STEL: 5 ppm
TWA: 3 ppm
IDLH: 20 ppm
SULFUR DIOXIDE
SO2
4% of vol.
Pulp and Paper Mills
Waste and Water Treatment Plants
Coal Fired Generation Stations
Refining of Light Lubricants and Kerosene
STEL: 5 ppm
TWA: 2 ppm
IDLH: 100 ppm
STEL and TWA
HCI
Colorless, toxic gas with a sharp, irritating odor
and acidic taste.
25 ppm
100 ppm
Colorless, toxic gas with strong suffocating
odor and an acidic taste.
Colorless, odorless, tasteless, explosive gas.
TWA:
IDLH:
Reddish-brown, toxic gas with a pungent odor.
0.3 ppm
0.1 ppm
H2
15 ppm
10 ppm
100 ppm
4.3% of vol.
Colorless, toxic gas with a pungent odor.
NITROGEN DIOXIDE
STEL:
TWA:
IDLH:
4.7 ppm
10 ppm
50 ppm
5.6% of vol.
Colorless, toxic gas with a rotten egg odor.
Greenish-yellow, toxic gas with an irritating odor.
HCN
m
o
c
.
a
y
r
A
E
S
H
AMMONIA
A QUICK REFERENCE
OF HAZARDOUS GASES
IN COMMON APPLICATIONS
STEL:
TWA:
*Carbon Monoxide (Europe and U.K.). TWA standard is 30 ppm.
5 ppm
1 ppm
STEL (short term exposure limit) represents the average gas
concentration a worker has been exposed to over a 15 minute period.
If this amount exceeds the stated limit, the worker must remove himself/
herself from the hazard for at least 1 hour before re-entry. STEL values
may only be exceeded 4 times during a normal work shift.
TWA (time weighted average) literally means the average amount
of gas a worker has been exposed to over a given period of time. The
period is usually an 8 hour normal work day. If the predetermined value
is exceeded, a worker may not re-enter the space for the balance of the
work day.
s
www.HSEArya.com
INFORMATION LIBRARY
Hazardous Locations
Area Classification - Division versus Zone
NEC & CEC
(North American)
IEC
Continuous Hazard
Division 1 or Zone 0
Zone 0
Intermittent Hazard
Division 1 or Zone 1
Zone 1
m
o
c
.
a
y
r
A
E
S
H
Hazard Under
Abnormal Conditions
Division 2 or Zone 2
Zone 2
Definitions and Comparisons
Class I
Locations in which flammable gases or vapors are or may be present in the air
in quantities sufficient to produce explosive atmospheres.
Comparisons of Classification Systems Between Division
Codes (North America) and IEC Zone Codes (Worldwide)
North American
Division Codes
Approval Agencies and Regulatory Bodies
.
w
ACGIH:
American Conference of Government
Industrial Hygienists
ABS:
American Bureau of Shipping
ASHRAE:
American Society of Heating, Refrigeration
and Air Conditioning Engineers
BAM:
CE:
CEC:
w
w
Federal Institute for Materials Research
and Testing (Germany)
European Conformity
Canadian Electrical Code
CENELEC:
European Committee for
Electrotechnical Standardization
CSA:
CSA - International
FM:
IEC:
MSHA:
IEC and North American
Zone Codes
Class I, Division 1:
Where ignitable concentrations can
exist under normal operating conditions;
may exist frequently because of repair,
maintenance or leakage; or may exist due
to breakdown of equipment in conjunction
with an electrical failure.
Class I, Zone 0:
Where ignitable concentrations are present
continuously or for long periods of time.
Class I, Division 2:
Where volatile flammable liquids are
stored, etc., in closed containers; where
ignitable concentrations are normally
prevented by positive pressure ventilation;
or adjacent to Class I, Division 1 locations.
Class I, Zone 2:
Where ignitable concentrations are not likely
to exist in normal operations or may exist
for a short time only; where volatile liquids
are stored, etc., in closed containers; where
ignitable concentrations are normally prevented
by positive pressure ventilation; or adjacent to
Class I, Zone 1 locations.
Class I, Zone 1:
Where ignitable concentrations are likely to exist
under normal operations; may exist frequently
because of repair, maintenance or leakage;
may exist due to breakdown of equipment in
conjunction with an electrical failure; or adjacent
to Class I, Zone 1 locations.
Factory Mutual Research Corporation
International Electrotechnical Commission
Mine Safety and Health Administration
NEC:
U.S. National Electrical Code
NIOSH:
National Institute for Occupational Safety
and Health
Gas
CEC/NEC Code
IEC Code
NRTL:
National Recognized Testing Laboratory
pointed by OSHA
Acetylene
Group A
Group IIC
OSHA:
Occupational Safety and Health Administration
Hydrogen
Group B
Group IIB + H2
SABS:
South African Bureau of Standards
Ethylene
Group C
Group IIB
SAA:
Standards Association Australia
Propane
Group D
Group IIA
UL:
Underwriters Laboratory
WHMIS:
Workplace Hazardous Materials
Coal Mines
Gaseous Mines
Group I
Gases and Vapors Classification
s
www.HSEArya.com
INFORMATION LIBRARY
XY
GA
S
/O
FL
AM
M
N
AB
GE
LE
AIR
OR
DU
ST
FIRE
TRIANGLE
SOURCE OF IGNITION
INTRINSIC SAFETY
COMBUSTIBLE GASES
Intrinsic Safety Defined
Under normal or abnormal conditions, intrinsically safe equipment and wiring shall
be incapable of releasing sufficient electrical or thermal energy to cause ignition of
a flammable or combustible material in air under prescribed test conditions.
How Does Intrinsic Safety Apply?
Intrinsic safety applies to the design of electrical equipment and wiring for hazardous
locations. The design/technique is based on limiting the electrical and thermal energy
to a level below that required to ignite any specific hazardous mixture.
Who Tests and Certifies Equipment for Intrinsic Safety?
Independent third party agencies test and certify equipment for intrinsic safety.
Independent testing ensures that your equipment is designed intrinsically safe and
meets all required safety standards.
UL (Underwriters Laboratories), FM ( Factory Mutual Corporation), CSA (Canadian
Standards Association), Cenelec (European Committee for Electrotechnical
Standardization), ABS (American Bureau of Shipping), SAS ( Standards Association
of Australia) are all third party agencies.
m
o
c
.
a
y
r
A
E
S
H
A Short List of
GASES LIGHTER AND HEAVIER THAN AIR
Density <1.0 = Lighter than Air
Air = 1
Lighter than air
Density
Approximately
equal to air
Acetylene
0.9
Ethane
Ammonia
0.8
Nitric Oxide
Carbon Monoxide
0.97
Ethylene
0.97
Hydrogen
0.1
.
w
w
w
Hydrogen Cyanide
Methane
0.9
0.6
If fuel, oxygen (usually air) and a source of
ignition are present in the right mixture, a serious
explosion or fire will be the result.
Density >1.0 = Heavier than Air
Density
Heavier than air
Density
1.0
Acetone
2.0
1.0
Benzene
2.6
Butane
2.0
Carbon Dioxide
1.5
Chlorine
2.5
Ethanol
1.6
Ethyl Acetate
3.0
Ethylene Oxide
1.5
Gasoline (100
Octane)
3-4.0
Hexane
3.0
Hydrogen Chloride
1.3
Hydrogen Sulfide
1.2
Methyl Mercaptan
1.66
Nitrogen Dioxide
1.6
Oxygen
1.1
Pentane
2.5
Propane
1.6
Sulfur Dioxide
2.2
Toluene
3.1
Turpentine
4.7
Xylene
3.7
The three elements are known as the Fire
Triangle. As the ratio of fuel to oxygen changes,
the atmosphere passes through three ranges:
1) Lean
2) Explosive
3) Rich
In the lean range below the Lower Explosive
Limit (LEL), there is not enough fuel (gas) to
burn.
In the rich range above the Upper Explosive
Limit (UEL), there is too much fuel (gas) and not
enough oxygen to burn.
A gas is combustible only between its LEL
and UEL. The range between these two points
includes all concentrations in which a flash
will occur or a flame will travel if the mixture
is ignited.
Different gases require a different percent by
volume concentration to reach 100% LEL. The
monitoring range of most instruments is 0-100%
LEL. Some models measure percent by volume
of a particular gas.
LEL and UEL of
Some Combustible Gases
LEL = Lower Explosive Limit
UEL = Upper Explosive Limit
Gas
Acetone
Acetylene
Benzene
Butane
N-Butyl Acetate
Ethane
Ethanol
Ethylene Oxide
Gasoline
(100 octane)
Heptane
Hexane
Hydrogen
Isopropyl Alcohol
Methane
Methyl Ethyl Ketone
Pentane
Propane
Propylene Oxide
Styrene
Toluene
Xylene
LEL
UEL
(% of volume)
(% of volume)
2.5
2.5
1.2
1.6
1.7
3.0
3.3
3.0
1.4
12.8
100.0
7.8
8.4
7.6
12.5
19.0
100.0
7.6
1.05
1.1
4.0
2.0
5.0
1.4
1.5
2.1
2.3
0.9
1.1
0.9
6.7
7.5
75.0
12.0
15.00
11.4
7.8
9.5
36.0
6.8
7.1
6.7
s
www.HSEArya.com
INFORMATION LIBRARY
Note: The glossary terms are used in the context of gas detection and gas detection only. There may exist alternative meanings to some of the terms listed; however, the
terms listed have been delineated according to an electrical engineer’s perspective.
Accessory equipment: Items such as alarms, relays,
etc., not part of a detector or system but activated
by it.
Accuracy: The preciseness of a reading in relation to
the actual concentration.
Acknowledge: The temporary silencing of audible
alarm signal, while the condition causing alarm is
being corrected.
Alarm: Visual or audible signal triggered by the
exceeding of a preset gas concentration.
Automatically reset: The return of a system to normal
operation after gas alarm diminishes below a set
level, no manual setting of relays is required.
Calibrate: Adjusting the gain or span of an instrument
to indicate the actual concentration of a gas present.
Catalytic: A method of measuring gases using a
sensing element responsive to combustible gases.
Combustible: Capable of being ignited with resultant
burning or explosion.
Concentration: The amount of gas present in a
defined space, expressed in percent of total volume,
parts per million (ppm), or percent of the lower
explosive limit (LEL).
Continuous: Uninterrupted in time; without
cessation. Usually used with temperature
and humidity specifications.
.
w
EMI: Electromagnetic interference (also known as radio
frequency interference or RFI).
Electrochemical: Method of measuring gases
using a sensing element responsive to oxygen
and toxic gases.
Explosive gas: Any combustible gas capable of
being ignited and burned under certain conditions
of quantity and/or confinement; normally used as a
synonym for flammable gas.
Explosion-proof: An enclosure designed to contain an
explosion and prevent its propagation to the outside
atmosphere; usually implies the use of a heavy
metal enclosure.
w
w
Flammable: Capable of being ignited and burned;
commonly used as a synonym for combustible.
Flammable range: The range of a concentration in air
or oxygen of a flammable gas between the LEL and
the UEL within which it can be ignited and burned
with the propagation of a flame.
Flash point: The lowest temperature at which a liquid
(and certain solids) will give off an ignitable vapor.
General purpose area: All areas where explosionproof or intrinsically safe construction is not required.
Halogenated: Usually applied to hydrocarbons that are
combined with halogens, such as fluorine, bromine,
chlorine, etc.
Hazardous area: An area where combustible gases
are actually present or likely to be. Generally such
areas are classified as hazardous and are the
opposite of general purpose areas. (See National
Electrical Code, Article 500.)
Hydrocarbons: Any gas compound principally formed
of hydrogen and carbon. Common examples are
natural gas, methane and gasoline vapor.
Poisoning: The term applied to catalytic-type sensors
for their contamination by certain chemical elements
or compounds, principally silicones and tetraethyl lead
(TEL). A reduction or complete loss of sensitivity can
result from contamination.
ppm: Parts per million. A measure of gas concentration
used for very small quantities. A measurment of 1% by
volume equals 10,000 ppm.
Propagation: The spread of flame through a flammable
mixture from a source of ignition.
Purge: The flushing or pressurizing of an instrument
with air or an inert gas, such as nitrogen, to remove
all other gases or to maintain a constant pressure
higher than atmospheric, thus precluding entry of
external atmosphere.
m
o
c
.
a
y
r
A
E
S
H
Background: Gases, other than those intended
to be measured, that are present in a space
or environment.
Density: The weight of a volume of a gas compared to
the weight of equal volume of dry air; properly known
as specific density.
Diffusion detection: Detection method utilizing the
normal movement of gases around a detector
exposed directly in a space; no mechanical means
bring gas into sensor contact.
Diffusion rate: The time required for a given
gas to mix and spread with no mechanical
or convection help.
Drift: The gradual change in a readout caused by aging
of some components, variations in power, warm up
characteristics, etc.
IDLH: Immediately dangerous to life and health. The
maximum concentration of gas (in ppm) from which
a worker could escape within 30 minutes without
experiencing any escape-impairing or irreversible
health effects.
Ignition temperature: A term generally used to mean
the lowest temperature that will cause gas to ignite
and burn; not a precise term; subject to several
variables.
Inert gas: Gases that will not burn, will support
combustion (oxygen) and are not toxic, such as
nitrogen, helium and argon.
Inflammable: Capable of being ignited and burning;
synonym for flammable and combustible.
Interference: Gases, other than the gas to be
measured, that are present in a mixture and
affect readout (on a meter, etc.).
Intermittent: Alternately stopping (ceasing)
and beginning again; used with humidity and
temperature specifications.
Intrinsically safe: An instrument designed and
constructed to practically preclude the possibility
of igniting a combustible mixture. (See National
Electrical Code, Article 500-1 for complete definition
and NFPA Bulletin 493 for details).
IR: Infrared. A type of radiation within certain
wavelength ranges used to detect hazardous gases.
Isolated contacts: A term usually applying to relays (or
switches) supplied with no instrument power to them
and available to the user for switching power circuits
of his or her choice.
Lag time: Time to transport a gas sample to the
measuring element, as in a sample-draw system.
LEL: Lower explosive limit. Denotes the minimum
concentration of combustible gas that will ignite and
burn (propagate a flame). Synonymous with LFL
(lower flammable limit).
Linear: Generally used to mean a readout (meter
indication, for example) in which all divisions are
equal; a signal whose output follows a straight
arithmetic line.
Loop resistance: The total resistance of everything
connected to the detector: power wires, controller,
etc.
mA: Milliamp. A unit of electric current expressed
in amperes.
Manual reset: Return of a system to normal operation
by a positive action of the operator - usually the
pushing of a reset button. The opposite of automatic
reset.
Modbus: A communications protocol used for
collecting/distributing small amounts of data over
networks in industrial environments. A multi-drop,
master/slave, token passing protocol often used over
low speed RS485, 422, 232 connections.
Monitor: Implies the continuous surveillance of an area
or facility for the presence of hazardous gas, rather
than intermittent or random sampling.
Noise: Electrical or electronic interference with the
signal of interest.
Non-incendive: Equipment and wiring that will
not ignite an explosive under normal operating
conditions; less stringent than intrinsically safe and
considered adequate for Division 2 locations. (See
Electric Code, Article 500-1.)
Output: The signal produced by a sensor or other
component of a system and available for further use.
Oxygen deficient: A mixture of gases containing too
little oxygen to adequately support life; set by OSHA
at 19.5% by volume.
Oxygen enriched: A mixture having an oxygen
concentration greater than that of air; normally more
than 21% oxygen.
PEL: Permissible exposure limit. Level of gas (in ppm) a
worker can be exposed to 8 hours per day/40 hours
per week for the rest of his or her life with no long
term health effects.
Rx: Radio frequency receiver.
Readout: The indication by an instrument of the
conditions prevailing at the sensor.
Relative response: The response of a sensor to a
particular gas or mixture relative to a known response
to some other specific gas; usually expressed as a
decimal ratio and applied to the readout as a multiplier.
Relay: A small, electrically activated switching device with
one or more sets of contacts.
Repeatability: The characteristic of a system to always
produce the same readout under the same conditions.
Response time: The time required to obtain a useful
indication after the sensor is exposed to the gas of
interest; frequently confused with lag time.
RFI: Radio frequency interference; usually caused by
certain emissions from radio equipment and causing
false signals and incorrect readouts in some gas
detection instruments.
Sample: Denotes the portion of a gas mixture
introduced to the sensor on an instrument.
Sensor: Any device that responds to a gas and
produces an output of sufficient strength to
measure a concentration or activate a signal.
Setpoint: Used primarily to describe the gas
concentration at which an alarm will be activated
or triggered.
Shielded: A wire or group of wires insulated from and
protected by a metallic covering; may be a metal braid
or a foil.
Signal: Any visual or audible indication of the conditions
at the sensor.
Span: Calibration adjustment to set the linearity of an
instrument against a known sample.
Specific gravity: The ratio of the weight of a solid or
liquid to an equal volume of water.
STEL: Short term exposure limit. Usually a 15 minute
time weighted average exposure that should not
be exceeded.
Time constant: The time required for a signal which
changes unevenly with time to reach 63.2% of its
final value.
TLV: Threshold limit value; a measure of toxicity
expressed in ppm or milligrams per cubic meter and
based on any discernible physiological symptoms over
a given time period.
Transmitter: A component that passes a signal onto a
signal wire or cable. Also an RF transmitter.
TWA/TLV: Time weighted average; exposure
concentration to a toxic gas for a conventional 8 hour
workday (PEL) or 10 hour (REL) workday.
UEL/UFL: Upper explosive limit: The maximum
concentration at which a gas will explode.
VAC: Voltage, alternating current.
VDC: Voltage, direct current.
Warmup time: The time required for the components of
an instrument to reach equilibrium and produce
a reliable signal after activation.
Warning: A signal denoting that a gas is present
but not in a critical concentration.
XMTR: Radio frequency transmitter for wireless telemetry;
also referred to as an RF transmitter. Xmtr equals Tx.
www.HSEArya.com
s
SERVICE AND REPAIR
TRAINING SERVICES
SERVICE and REPAIR
TRAINING SERVICES
BW Technologies designs, manufactures and sells the most
advanced gas monitoring equipment on the market.
BW Technologies’ commitment to quality adheres to the
strictest standards in the industry. We take pride in the
instruments we sell and are dedicated to long-term support
of you, our customer, and your BW gas detection instrument.
The BW Technologies Training Services offers valuable
information to our customers. Some of the key topics
covered are:
Are you utilizing your instruments to their fullest capacity?
Learn the features and capabilities of each instrument in
our product line.
Do you know how to replace sensors/batteries and
properly calibrate your instruments? Extend the life of
your instrument.
How do electrochemical sensors work?
What are the applications of electrochemical, catalytic
and infrared sensors and their differences?
What you should know about toxic gases?
How proper maintenance makes your instruments easier
to use and more cost-efficient.
How to use your BW gas detection equipment more
effectively.
What are the current regulations regarding confined
space entry and how do these apply to gas detection?
m
o
c
.
a
y
r
A
E
S
H
What BW Technologies Repair Service Does for You
Have your monitors and detectors serviced by the
people who know them best - BW Technologies
Service Staff
Turnaround averages 1 to 3 days - the shortest time in
the industry. In an emergency we repair your instrument
the same day it is received - no extra charges apply.
Every instrument receives a certificate of calibration
upon completion of repair. The instrument is labeled
with the date of calibration. This verifies that you are
diligently maintaining your instruments in the event of
safety audit.
Only BW Technologies can assure that your original
intrinsic safety approvals are not voided.
All repairs are personally signed by the technician
performing the work. BW Technologies technicians are
continuously trained with changes to products.
BW Technologies uses only NIST traceable calibration
gas to assure accuracy of your instruments.
Repaired components are warranted for one full year.
Labor is warranted for six months.
No surprises when you receive the invoice - with no-risk
estimates. BW Technologies will honor the estimate with
no additional charges.
Hands-on Training: Use our instruments or bring your
own for hands-on instruction on proper instrument use and
maintenance. Hands-on training will lead you to a better
awareness of the dangers associated with hazardous gas
atmospheres and help you to use and maintain your gas
detection instruments effectively.
.
w
w
w
Thank you for using
BW TECHNOLOGIES
gas detection instruments.
BW TECHNOLOGIES
is dedicated to providing ongoing customer satisfaction.
www.HSEArya.com
w
w
.
w
m
o
c
.
a
y
r
A
E
S
H
6HQVRUV
7HFKQLFDO'LVFXVVLRQ3DSHUV
.
w
m
o
c
.
a
y
r
A
E
S
H
w
w
:HEVLWHZZZ+6($U\DFRP
7HO
(PDLOLQIR#+6($U\DFRP
7HOHJUDP,'#+6($U\DB33(
,QVWDJUDP,'#+6($U\D33(
(OHFWURFKHPLFDO2[\JHQ6HQVRUV
+\GURJHQ6XOILGH'HWHFWLRQ
(OHFWURFKHPLFDOYV6ROLG6WDWH
6HPLFRQGXFWRU6HQVRUV
(OHFWURFDWDO\WLF&RPEXVWLEOH6HQVRUV
(OHFWURFKHPLFDO³7ZLQ7R[´6HQVRUV
w
w
.
w
m
o
c
.
a
y
r
A
E
S
H
www.HSEArya.com
(/(&752&+(0,&$/2;<*(16(16256
7HFKQLFDO'LVFXVVLRQ
7
KHR[\JHQVHQVRUVXVHGLQ%:LQVWUXPHQWV
DUH RI WKH VHOISRZHUHG GLIIXVLRQOLPLWHG
PHWDODLU EDWWHU\ W\SH 7KH\ DUH FRPSULVHG
RI DQ DQRGH DQ HOHFWURO\WH DQG DQ DLU
FDWKRGHDVVKRZQLQ)LJXUH
2[\JHQ VHQVRUV DUH FXUUHQW JHQHUDWRUV DQG WKH
FXUUHQW LV SURSRUWLRQDO WR WKH UDWH RI R[\JHQ
FRQVXPSWLRQ )DUDGD\¶V /DZ 7KLV FXUUHQW FDQ EH
PHDVXUHGE\FRQQHFWLQJDUHVLVWRUDFURVVWKHRXWSXW
WHUPLQDOVWRSURGXFHDYROWDJHVLJQDO,IWKHSDVVDJH
RIR[\JHQLQWRWKHVHQVRULVSXUHO\GLIIXVLRQOLPLWHG
WKHVLJQDOLVDPHDVXUHRIR[\JHQFRQFHQWUDWLRQ
&DSLOODU\SRUH VHQVRUV DUH PLQLPDOO\ LQIOXHQFHG E\
FKDQJHV LQ DWPRVSKHULF SUHVVXUH $OWKRXJK UDSLGO\
FKDQJLQJ SUHVVXUH OHDGV WR D FKDQJH LQ VHQVRU
RXWSXW RQFH WKH GLIIXVLRQ EDUULHU FDSLOODU\ KDV
VWDELOL]HGDWWKHQHZSUHVVXUHWKHRXWSXWZLOOUHWXUQ
WR WKH SUHYLRXV OHYHO %HFDXVH WKH YROXPH RI
DWPRVSKHUH FRQWDLQHG LQ WKH GLIIXVLRQ EDUULHU
FDSLOODU\ LV YHU\ VPDOO VWDELOL]DWLRQ DW WKH QHZ
SUHVVXUH LV XVXDOO\ DFKLHYHG ZLWKLQ WR VHFRQGV 7KLV HIIHFW FDQ EH VHHQ FOHDUO\ ZKHQ D
SURSHUO\ FDOLEUDWHG FDSLOODU\SRUH R[\JHQ VHQVRU LV
WDNHQRQERDUGDFRPPHUFLDOMHW,QLWLDOO\WKHVHQVRU
UHDGV$VWKHMHWWDNHVRIIDQGEHJLQVWRJDLQ
DOWLWXGH WKH S2 GURSV FDXVLQJ D GURS LQ R[\JHQ
VHQVRU UHDGLQJV :KHQ WKH MHW UHDFKHV FUXLVLQJ
DOWLWXGH DFWXDOO\ ZKHQ FDELQ SUHVVXUH LV VWDELOL]HG
DW QRUPDO RSHUDWLRQDO OHYHOVWKH UHDGLQJV UHWXUQ WR
$VWKHMHWEHJLQVLWVGHVFHQWSULRUWRODQGLQJ
S2 LQFUHDVHV FDXVLQJ D ULVH LQ UHDGLQJV $V VRRQ
DVWKHVHQVRULVEDFNDWJURXQGOHYHODQGWKHFDELQ
LV RQFH DJDLQ GHSUHVVXUL]HG UHDGLQJV ZLOO UHWXUQ
WR
m
o
c
.
a
y
r
A
E
S
H
$W WKH FDWKRGH R[\JHQ LV UHGXFHG WR K\GUR[\O LRQV
DFFRUGLQJWRWKHHTXDWLRQ
2 +2H 2+
7KHK\GUR[\OLRQVLQWXUQR[LGL]HWKHPHWDODQRGH
DVIROORZV
3E2+ 3E2+2H
2YHUDOOWKHFHOOUHDFWLRQPD\EHUHSUHVHQWHGDV
3E2 3E2
.
w
w
w
&DSLOODU\SRUH R[\JHQ VHQVRUV VXFK DV WKH RQHV
XVHG LQ %: LQVWUXPHQWV XWLOL]H D QDUURZ GLDPHWHU
WXEHWKURXJKZKLFKR[\JHQGLIIXVHVLQWRWKHVHQVRU
2[\JHQ LV GUDZQ LQWR WKH VHQVRU E\ FDSLOODU\ DFWLRQ
LQPXFKWKHVDPHZD\WKDWZDWHURUIOXLGLVGUDZQXS
LQWRWKHILEHUVRIDSDSHUWRZHO
2[\JHQ
'LIIXVLRQEDUULHU
&DWKRGH
/RDG
5HVLVWRU
(OHFWURO\WH
H
)LJXUH&DSLOODU\SRUHR[\JHQVHQVRU
$QRGH
www.HSEArya.com
+<'52*(168/),'('(7(&7,21
(OHFWURFKHPLFDOYV6ROLG6WDWH6HPLFRQGXFWRU6HQVRUV
7HFKQLFDO'LVFXVVLRQ
+
\GURJHQ VXOILGH +6 LV RQH RI WKH PRVW
FRPPRQFKHPLFDOVXVHGRUHQFRXQWHUHGE\
LQGXVWU\ :HOO RYHU ZRUNHUV LQ
1RUWK $PHULFD DUH H[SRVHG RU SRWHQWLDOO\
H[SRVHGWRWKLVIODPPDEOHDQGKLJKO\SRLVRQRXVJDV
HYHU\ \HDU +\GURJHQ VXOILGH LV DOVR NQRZQ IRU LWV
FRUURVLYH HIIHFWV SDUWLFXODUO\ RQ VHQVLWLYH
HOHFWURQLFHTXLSPHQW
+\GURJHQ VXOILGH LV D FRPPRQ KD]DUG LQ D ZLGH
UDQJHRILQGXVWULHVLQFOXGLQJRLODQGJDVGULOOLQJDQG
SURGXFWLRQ RLO UHILQLQJ SHWURFKHPLFDO SURFHVVLQJ
JDVWUDQVPLVVLRQDQGVWRUDJHFKHPLFDOSURFHVVLQJ
ZDVWHZDWHU WUHDWPHQW SXOS DQG SDSHU SURGXFWLRQ
DQGPLQLQJ
7R DYRLG WKH KD]DUGV DVVRFLDWHG ZLWK SRVVLEOH
SHUVRQQHO H[SRVXUH +26 VHQVRUV DUH SURYLGHG E\
LQGXVWU\ LQ SRUWDEOH DQG IL[HG GHWHFWLRQ V\VWHPV WR
JLYH DQ HDUO\ DQG UHOLDEOH ZDUQLQJ WKDW +6 LV
SUHVHQW LQ DPELHQW DLU 7KLV SDSHU GLVFXVVHV WZR
+26 GHWHFWLRQ WHFKQLTXHV HOHFWURFKHPLFDO VHQVRUV
DQGVROLGVWDWHVHQVRUV
7R IXOO\ DSSUHFLDWH WKH UHODWLYH PHULWV RI HDFK RI
WKHVHGHWHFWLRQWHFKQLTXHVLWLVLPSRUWDQWWRKDYHD
EDVLF XQGHUVWDQGLQJ RI HDFK WHFKQLTXH¶V SULQFLSOH
RIRSHUDWLRQ
7KHVROLGVWDWHVHPLFRQGXFWRUFRQVLVWVRIIRXUPDLQ
SDUWV WKH VXEVWUDWH D FHUDPLF ZDIHU RQ ZKLFK WKH
RWKHU SDUWV DUH EXLOW WKH KHDWHU WR PDLQWDLQ SURSHU
RSHUDWLQJWHPSHUDWXUHWKHLQWHUGLJLWDWHGWUDFNZKLFK
FRQWDLQV WKH HOHFWURGHV IRU VHQVLQJ SXUSRVHV DQG
WKHVHPLFRQGXFWRUOD\HU²XVXDOO\DPHWDOR[LGHILOP
VXFKDVWXQJVWHQR[LGHRUWLQR[LGH
1RUPDOO\ WKH VHPLFRQGXFWRU OD\HU KDV D ORZ
HOHFWULFDOFRQGXFWLYLW\EXWLQWKHSUHVHQFHRI+6D
VXUIDFH UHDFWLRQ RFFXUV ZKLFK UHOHDVHV HOHFWURQV
ZLWKLQ WKH VHPLFRQGXFWRU OD\HU GURSSLQJ LWV
UHVLVWDQFH 7KLV IDOO LQ UHVLVWDQFH LV UHJLVWHUHG
YLD D VHQVRU VLJQDO RXWSXW FKDQJH LQ +6
JDVFRQFHQWUDWLRQ
(OHFWURFKHPLFDO VHQVRUVDUHFODVVLILHG DV IXHOFHOOV
7KH\ PD\ KDYH HLWKHU WZR RU WKUHH HOHFWURGHV ,Q
WKHWKUHHHOHFWURGHFHOOVWKHWKLUGHOHFWURGHDFWVDV
D UHIHUHQFH 7KH SULQFLSOH RI RSHUDWLRQ LV WKH VDPH
IRUHDFKW\SH
,Q HOHFWURFKHPLFDO VHQVRUV +6 HQWHUV WKH FHOO
WKURXJK D GLIIXVLRQ EDUULHU DQG JDVSHUPHDEOH
PHPEUDQH $ UHDFWLRQ WDNHV SODFH DW WKH ZRUNLQJ
HOHFWURGH DQRGH UHOHDVLQJ HOHFWURQV WKDW IORZ WR
WKH FRXQWHU HOHFWURGH FDWKRGH ZKHUH D FRXQWHU
UHDFWLRQ RFFXUV 7KHVH UHDFWLRQV PD\ RU PD\ QRW
.
w
$QRGH+6+2+62+H
&DWKRGH2+H+2
m
o
c
.
a
y
r
A
E
S
H
3ULQFLSOHVRI2SHUDWLRQ
w
w
FRQVXPH WKH HOHFWURO\WH ,W UHDFWV DV IROORZV
VHHDOVR)LJXUH
7KLV IORZ RI HOHFWURQV LV UHJLVWHUHG DV D
FRQFHQWUDWLRQ YDOXH ZKLFK LV FRPPRQO\ GLVSOD\HG
RQ D ORFDO /&' RU /(' WUDQVPLWWHU UHDGRXW²
D FRPSDQLRQ FRQWURO PRGXOH RU 3/&'&6
FRQWUROV\VWHP
5HVSRQVH&KDUDFWHULVWLFV
)LJXUHVDQGVKRZVDPSOHVUHVSRQVHFXUYHVIRU
VROLG VWDWH DQG HOHFWURFKHPLFDO VHQVRUV
UHVSHFWLYHO\ 6ROLG VWDWH VHQVRUV DUH W\SLFDOO\
ORJDULWKPLF LQ UHVSRQVH ZKLOH HOHFWURFKHPLFDO
VHQVRUVH[KLELWDOLQHDUUHVSRQVHFXUYH
7KH QRUPDO UHVLVWDQFH QR +6 SUHVHQW RI D VROLG
VWDWH VHQVRU FDQ EH DV KLJK DV PHJ RKPV 7KH
UHVLVWDQFH QHHGV WR GHFUHDVH WR DERXW . RKPV
EHIRUH WKH LQVWUXPHQW ZLOO PRYH RII WKH PHWHU ]HUR
SRLQW )XOO VFDOH GHIOHFWLRQ SSP +6 LV
DSSUR[LPDWHO\WR.RKPV
7KHORJDULWKPLFUHVSRQVHRIDVROLGVWDWHVHQVRUFDQ
OHDG WR VLJQLILFDQW SUREOHPV 2QH SUREOHP LV WKDW
HLWKHU D OLQHDUL]HG FLUFXLWRUD QRQOLQHDU VFDOHPXVW
EH LPSOHPHQWHG LQ WKH FRQWURO FLUFXLWU\ $QRWKHU
LQFRQYHQLHQFH LV WKH QHHG WR H[SRVH WKH VHQVRU WR
WZRGLIIHUHQWFRQFHQWUDWLRQVRIJDVGXULQJFDOLEUDWLRQ
IRU³ORZVSDQ´DQG³KLJKVSDQ´DGMXVWPHQWDVWKHUH
LVQRWUXH]HURSRLQWRQWKHORJDULWKPLFFXUYH
$Q DGGLWLRQDO SUREOHP LV WKH LQKHUHQW LQVWDELOLW\ RI
WKHVHPLFRQGXFWRUOD\HUZKLFKUHVXOWVLQDFKDQJLQJ
EDVHOLQH UHVLVWDQFH 7KH UHVXOWV DUH EDUHO\
QRWLFHDEOHDWWKH]HURHQGRIWKHVFDOHZKHUHODUJH
UHVLVWDQFH FKDQJHV UHSUHVHQW VPDOO FRQFHQWUDWLRQ
FKDQJHV KRZHYHU WKH UHVXOWV DUH VLJQLILFDQW DW WKH
KLJK HQG RI WKH VFDOH ZKHUH VPDOO UHVLVWDQFH
FKDQJHV UHSUHVHQW ODUJH FRQFHQWUDWLRQ FKDQJHV ,Q
HOHFWURFKHPLFDO VHQVRUV WKH QXPEHU RI HOHFWURQV
UHOHDVHG LQ WKH FKHPLFDO UHDFWLRQ LV OLQHDUO\
GHSHQGHQW RQ JDV FRQFHQWUDWLRQ $ VLJQLILFDQW
IHDWXUH LV WKH JDV GLIIXVLRQ FRQWUROOHG RSHUDWLRQ RI
WKH ZRUNLQJ HOHFWURGH 7KH GHVLJQ RI WKLV EDUULHU
DOORZV RQO\ D VPDOO TXDQWLW\ RI VDPSOH DWPRVSKHUH
WR UHDFK WKH HOHFWURGH $V D UHVXOW RQO\ D VPDOO
IUDFWLRQRIWKHDFWLYHHOHFWURO\WHLVUHDFWHGOHDYLQJD
ODUJH TXDQWLW\ ³LQ UHVHUYH´ IRU KLJKHU FRQFHQWUDWLRQV
RI +6 &HOO RXWSXW UHPDLQVOLQHDUDWFRQFHQWUDWLRQV
RISSPDQGDERYH
www.HSEArya.com
+<'52*(168/),'('(7(&7,21
(OHFWURFKHPLFDOYV6ROLG6WDWH6HPLFRQGXFWRU6HQVRUV
7HFKQLFDO'LVFXVVLRQFRQW¶G
7KHFXUUHQWVJHQHUDWHGE\WKHR[LGDWLRQUHDFWLRQDUH
TXLWH ORZ²W\SLFDOO\ µ$SSP +6 +RZHYHU WKH
LQWULQVLFDOO\ ORZ EDFNJURXQG FXUUHQW DQG ORZ QRLVH
RXWSXW RI WKH FHOO UHVXOWV LQ H[FHOOHQW UHSHDWDEOH
VHQVLWLYLW\WR+6
m
o
c
.
a
y
r
A
E
S
H
([WHUQDO,QIOXHQFHVRQ5HVSRQVH
6HQVRU UHVSRQVH PD\ DOVR EH LQIOXHQFHG E\ D
YDULHW\ RI HQYLURQPHQWDO FRQGLWLRQV 6ROLG VWDWH
VHPLFRQGXFWRU DQG HOHFWURFKHPLFDO GHWHFWRUV YDU\
TXLWH GLIIHUHQWO\ LQ KRZ WKH\ DUH DIIHFWHG E\ WKHVH
RIWHQXQFRQWUROODEOHHQYLURQPHQWDOIDFWRUV
/DFN RI +6 ([SRVXUH ± $ FRPPRQ WUDLW RI VROLG
VWDWHVHPLFRQGXFWRUVHQVRUVLVWKHLUWHQGHQF\WR³JR
WRVOHHS´ZKHQH[SRVHGWR+6IUHHDLUIRUSURORQJHG
SHULRGV RI WLPH 7KLV HIIHFW LV JHQHUDOO\ FDXVHG E\
WKHORFDOL]LQJRIHOHFWURQVZLWKLQWKHPHWDOR[LGHILOP
ZKLFK GULYHV WKH ]HUR UHVLVWDQFH LQWR WKH KLJK PHJ
RKP UDQJH 7KLV QRUPDOO\ KLJK ]HUR UHVLVWDQFH
SUHYHQWV D TXLFN RU UHSHDWDEOH UHVSRQVH 0RVW
HOHFWURFKHPLFDO FHOOV KDYH DQ DEVROXWH ]HUR ZKLFK
HOLPLQDWHVWKH³JRLQJWRVOHHS´V\QGURPH
5DLQ DQG +XPLGLW\ ± 7KH PHWDO R[LGH ILOP RQ D
VROLG VWDWH VHPLFRQGXFWRU VHQVRU LV YXOQHUDEOH WR
FKDQJHV FDXVHG E\ H[SRVXUH WR ZDWHU $ JUDGXDO
FRQYHUVLRQ RI WKH ILOP WR D PHWDO K\GUR[\O VWDWH
RFFXUV ZKLFK HYHQWXDOO\ GHDGHQV WKH VHQVRU¶V
VHQVLWLYLW\WR+6
(YHQ EULHI H[SRVXUHV WR ZDWHU WKURXJK UDLQ RU
ZDVKGRZQ ZLOO FDXVH VXUIDFH FKDQJHV WKDW SUHYHQW
DEVRUSWLRQ RI K\GURJHQ VXOILGH UHFDOLEUDWLRQ RI WKH
VHQVRU LV DGYLVDEOH DIWHU H[SRVXUH WR PRLVWXUH 7R
PLQLPL]HVXVFHSWLELOLW\ WRPRLVWXUH GDPDJH VXUIDFH
WHPSHUDWXUH VKRXOG EH JUHDWHU WKDQ °& 7KLV LV
RIWHQDFFRPSOLVKHGZLWKDEXLOWLQKHDWHU
&KDQJHV LQ KXPLGLW\ RU GLUHFW H[SRVXUH WR PRLVWXUH
KDYH OLWWOH HIIHFW RQ WKH HOHFWURFKHPLFDO FHOOV $OO
UHDFWLRQVWDNHSODFHDWWKHZRUNLQJHOHFWURGHZKHUH
PRLVWXUH LV FRQWLQXDOO\ SUHVHQW 7KH HOHFWURO\WH
UHVHUYRLUKDVVXIILFLHQWRYHUFDSDFLW\WRDOORZWKHFHOO
WRDFFRPPRGDWHDOOEXWWKHPRVWSURORQJHGSHULRGV
RIYHU\KLJKRUYHU\ORZKXPLGLW\7KHFHOOKDVEHHQ
WHVWHGIRUWKUHHPRQWKVDWDUHODWLYHKXPLGLW\RI
ZLWKRXW LOO HIIHFWV ,Q DGGLWLRQ RQFH WKH 5+ ZDV
LQFUHDVHGWKHFHOOUHDEVRUEHGDOOORVWPRLVWXUH
.
w
w
w
YDULDWLRQV LQ FKLS PDQXIDFWXULQJ DQG WKH SURFHVV RI
PHWDOR[LGHGHSRVLWLRQ$VHQVRURSHUDWLQJWRRFROG
ZLOOUHVSRQGYHU\VORZO\DVHQVRURSHUDWLQJWRRKRW
ZLOOUHVSRQGYHU\TXLFNO\EXWZLOODOVRGHPRQVWUDWHD
WHQGHQF\ WRZDUG QRQUHSHDWDELOLW\ +RZHYHU RQO\ D
IHZPDQXIDFWXUHUVDGGUHVVWKHFULWLFDOLPSRUWDQFHRI
WKLV LVVXH E\ WKHUPRVWDWLFDOO\ FRQWUROOLQJ WKH KHDWHU
WRSUHYHQWVXUIDFHWHPSHUDWXUHIOXFWXDWLRQV
7KH WHPSHUDWXUH HIIHFWV RQ WKH VHQVLWLYLW\ RI WKH
HOHFWURFKHPLFDO VHQVRU DUH SUHGLFWDEOH DQG
UHSHDWDEOHIURPFHOOWRFHOO)URPƒ&WRƒ&WKH
VSDQ FKDQJHV E\ OHVV WKDQ “ RI WKH UHDGLQJ
JLYHQDWƒ&)URPƒ&WR±ƒ&WKHUHFDQEHD
IXUWKHUIDOORIRIWKHUHDGLQJ
7KH]HURVKLIWVE\OHVVWKDQSSPIRUDWHPSHUDWXUH
FKDQJHIURPƒ&WRƒ&%HORZƒ&EDVHOLQH
VKLIWVDUHQHJOLJLEOH7KHHOHFWURO\WHGRHVQRWIUHH]H
DW±ƒ&
7HPSHUDWXUH±0DLQWDLQLQJDFRQVWDQWFKLSVXUIDFH
WHPSHUDWXUH LV LPSRUWDQW WR NHHSLQJ WKH UHVSRQVH
WLPH DQG VWDELOLW\ RI VROLG VWDWH VHQVRUV ZLWKLQ
DFFHSWDEOHOLPLWV)RUWKLVUHDVRQKHDWHUVDUHRIWHQ
EXLOWLQWRWKHVHQVRUVXUIDFH
(TXDOO\ LPSRUWDQW LV WKH QHHG WR VHW HDFKLQGLYLGXDO
VHQVRU¶VRSHUDWLRQDOWHPSHUDWXUHWRFRPSHQVDWHIRU
2SHUDWLQJ&RQVLGHUDWLRQV
7KHUHDUHFHUWDLQRSHUDWLRQDOFRVWVDIIHFWHGZLWKDQ\
JDV PRQLWRULQJ V\VWHP &DOLEUDWLRQ DQG SRZHU
FRQVXPSWLRQDUHWZRRIWKHPDMRUIDFWRUVWKDWVKRXOG
EHFRQVLGHUHGLQWKHVHOHFWLRQSURFHVV
&DOLEUDWLRQ±,QJHQHUDOWKHPDQXIDFWXUHUVRIVROLG
VWDWH VHQVRUV UHFRPPHQG PRQWKO\ RU WKUHHPRQWK
FDOLEUDWLRQ LQWHUYDOV +RZHYHU PDQ\ FRPSDQLHV
KDYH DGRSWHG D GDLO\ FDOLEUDWLRQ VFKHGXOH IRU WKHVH
V\VWHPV 7KLV LV GXH SULPDULO\ WR WKH ODFN RI
UHSHDWDELOLW\ FDXVHG E\ WKH VHQVRU¶V YXOQHUDELOLW\ WR
VXUIDFH FKDQJHV ,Q DGGLWLRQ DQG DV SUHYLRXVO\
PHQWLRQHGFDOLEUDWLRQ DW WZRRU PRUH FRQFHQWUDWLRQ
OHYHOV LV UHTXLUHG WR DVVXUH SURSHU UHVSRQVH DOO
DORQJ WKH ORJDULWKPLF UHVSRQVH FXUYH WKLV PXOWL
FRQFHQWUDWLRQ FDOLEUDWLRQ SURFHVV RIWHQ UHTXLUHV
PLQXWHVRUPRUHSHUVHQVRU
7KH OLQHDU QDWXUH RI WKH HOHFWURFKHPLFDO VHQVRU
DORQJ ZLWK LWV DEVROXWH ]HUR DQG H[FHOOHQW
UHSHDWDELOLW\ DOORZV VLQJOH SRLQW FDOLEUDWLRQ DW XS WR
VL[PRQWKLQWHUYDOV
5HSURGXFHDELOLW\ EHWZHHQ HOHFWURFKHPLFDO FHOOV LV
RXWVWDQGLQJ 'LUHFW UHSODFHPHQW ZLWKRXW FDOLEUDWLRQ
ZLOO SURGXFH D UHVSRQVH ZLWKLQ RI WKH RULJLQDO
ZLWK FDOLEUDWLRQ WKH UHVSRQVH ZLOO EH ZLWKLQ RI
WKHRULJLQDO
3RZHU &RQVXPSWLRQ ± 7KH VHQVRU KHDWHU DQG
DVVRFLDWHG FLUFXLWU\ LV D PDMRU SRZHU GUDZ LQ VROLG
VWDWH VHPLFRQGXFWRU V\VWHPV 7KLV FDQ EH PDMRU
GUDZEDFNLQDSSOLFDWLRQVIRUSRUWDEOHPRQLWRUVRUIRU
IL[HG V\VWHPV QHHGLQJ VRODU SRZHU RU EDWWHU\
EDFNXS 3RZHU FRQVXPSWLRQ IRU V\VWHPV XVLQJ WKH
HOHFWURFKHPLFDOVHQVRULVVLJQLILFDQWO\UHGXFHG
www.HSEArya.com
+<'52*(168/),'('(7(&7,21
(OHFWURFKHPLFDOYV6ROLG6WDWH6HPLFRQGXFWRU6HQVRUV
7HFKQLFDO'LVFXVVLRQFRQW¶G
6XPPDU\
7KHUH DUH LQKHUHQW ZHDNQHVVHV LQ WKH GHVLJQ DQG
UHVSRQVH RI VHPLFRQGXFWRU VHQVRUV 7HPSHUDWXUH
KXPLGLW\ DQG RWKHU DPELHQW FRQGLWLRQV FDQ
VLJQLILFDQWO\ DIIHFW GHWHFWLRQ DQG PHDVXUHPHQW
SHUIRUPDQFH7KHLUORJDULWKPLFQDWXUHDQGWHQGHQF\
WR ³JR WR VOHHS´ QHFHVVLWDWH IUHTXHQW FDOLEUDWLRQ
)LQDOO\SRZHUFRQVXPSWLRQPD\EHVXEVWDQWLDO
(OHFWURFKHPLFDO GHYLFHV DUH EHWWHU VXLWHG WR WKH
UHDOLWLHV RI PRGHUQ +6 PRQLWRULQJ DSSOLFDWLRQV
7KH\ FDQ ZLWKVWDQG HQYLURQPHQWDO H[WUHPHV ZLWK
OLWWOH RU QR ORVV RI GHWHFWLRQ DFFXUDF\ UHTXLUH OHVV
IUHTXHQW FDOLEUDWLRQ DQG KDYH VLJQLILFDQWO\ ORZHU
RSHUDWLQJFRVWV
:KLOH HDFK DSSOLFDWLRQ VKRXOG EH MXGJHG RQ
LWV PHULWV HOHFWURFKHPLFDO FHOOV JHQHUDOO\ SURYH
PRUH UHOLDEOH RIIHU JUHDWHU RSHUDWRU FRQILGHQFH
DQG SURYLGH PD[LPXP SHUIRUPDQFH LQ HDUO\
ZDUQLQJ GHWHFWLRQ RI KD]DUGRXV FRQFHQWUDWLRQV RI
K\GURJHQVXOILGH
m
o
c
.
a
y
r
A
E
S
H
'LIIXVLRQ%DUULHU
2ULQJ6HDO
6HQVLQJ(OHFWURGH
5HIHUHQFH(OHFWURGH
&RXQWHU(OHFWURGHV
.
w
w
w
(OHFWURO\WH5HVHUYRLU
)LJXUH(OHFWURFKHPLFDOVHQVRU
:RUNLQJ(OHFWURGH5HDFWLRQ
+6+2+62+H
&RXQWHULQJ(OHFWURGH5HDFWLRQ
+2+2
PLFUR$PSVSHUSSP+6
www.HSEArya.com
+<'52*(168/),'('(7(&7,21
(OHFWURFKHPLFDOYV6ROLG6WDWH6HPLFRQGXFWRU6HQVRUV
7HFKQLFDO'LVFXVVLRQFRQW¶G
m
o
c
.
a
y
r
A
E
S
H
)LJXUH6DPSOHVROLGVWDWHVHQVRUUHVSRQVHFXUYHVLPSOLILHG
.
w
w
w
)LJXUH6DPSOHHOHFWURFKHPLFDOVHQVRUUHVSRQVHFXUYHVLPSOLILHG
www.HSEArya.com
(/(&752&$7$/<7,&&20%867,%/(6(16256
7HFKQLFDO'LVFXVVLRQ
&
RPEXVWLEOH JDVHV DQG YDSRUV PD\ EH
LJQLWHG DQG SURSDJDWH IODPH RQO\ EHWZHHQ
WKH OLPLWV RI IODPPDELOLW\ NQRZQ DV WKH
/RZHU([SORVLYH/LPLW/(/DQGWKH8SSHU
([SORVLYH /LPLW 8(/ 0L[WXUHV RI FRPEXVWLEOH
JDVHV LQ DLU EHORZ WKH /(/ DUH WRR OHDQ WR SHUPLW
SURSDJDWLRQRIIODPHZKLOHPL[WXUHVDERYHWKH8(/
DUHWRRULFKWRSHUPLWFRPEXVWLRQGXHWRWKHODFNRI
R[\JHQ 7KH /(/ DQG WKH 8(/ DUH XVXDOO\
H[SUHVVHG DV SHUFHQWDJHV E\ YROXPH RI
FRPEXVWLEOHJDVLQDLU7KHVHYDOXHVGLIIHUIURPJDV
WR JDV ,Q SUDFWLFH YDOXHV RI /(/ DQG 8(/ DUH
HVWDEOLVKHG HPSLULFDOO\ DQG GLIIHUHQW DXWKRULWLHV
KDYH HVWDEOLVKHG GLIIHUHQW YDOXHV IRU WKH
VDPHJDVHV
:KLOH VRPH LQGXVWULDO JDV DODUP V\VWHPV DUH
UHTXLUHG WR LQGLFDWH DODUPV DW SUHVHW OHYHOV DERYH
WKH OLPLWV RI IODPPDELOLW\ HJ DV IRU XVH ZLWK
PHWKDQHGUDLQDJHV\VWHPVLQFRDOPLQHVPRVWDUH
UHTXLUHGWRLQGLFDWHDODUPVDWSUHVHWOHYHOVEHORZWKH
/(/7KHJDVGHWHFWLRQWHFKQRORJ\DGRSWHGLQHDFK
FDVH LV GLIIHUHQW²WKHUPDO FRQGXFWLYLW\ RU LQIUDUHG
GHWHFWRUV DUH FRPPRQO\ XVHG IRU WKH GHWHFWLRQ RI
KLJK FRQFHQWUDWLRQV DERYH WKH /(/ DQG HOHFWUR
FDWDO\WLF GHWHFWRUV EHLQJ YHU\ ZLGHO\ XVHG IRU WKH
GHWHFWLRQ RI FRQFHQWUDWLRQV EHORZ WKH /(/ 7KLV
SDSHU LV FRQFHUQHG RQO\ ZLWK WKH ODWWHU 7KH
SULQFLSOHVRIRSHUDWLRQDQGVRPHSUDFWLFDOH[DPSOHV
DUHGHVFULEHG
3ULQFLSOHRI2SHUDWLRQ
.
w
m
o
c
.
a
y
r
A
E
S
H
'HVSLWHDJUHDWGHDORIUHVHDUFKDQGGHYHORSPHQWLQ
WKH ILHOGRIJDV GHWHFWLRQGXULQJ WKH SDVWGHFDGH RU
VR LQGXVWU\ KDV \HW WR GHYLVH D PRUH FRVWHIIHFWLYH
IRUPRIDVHOHFWLYHFRPEXVWLEOHJDVGHWHFWRUIRUXVH
DW VXE/(/ OHYHOV WKDQ WKDW RI WKH ORQJ HVWDEOLVKHG
HOHFWURFDWDO\WLFGHWHFWRU6XFKGHWHFWRUVKDYHEHHQ
LQ ZLGHVSUHDG XVH IRU PRUH WKH \HDUV²LQ
SRUWDEOH WUDQVSRUWDEOH DQG IL[HG PXOWLSRLQW JDV
DODUPV $OWKRXJK PDQ\ GHVLJQ LPSURYHPHQWV KDYH
EHHQPDGHWRGHWHFWRUVRIWKLVW\SHRYHUWKH\HDUV
LQHVVHQFHWKHEDVLFFRQFHSWKDVQRWFKDQJHG
7KH SULQFLSOH RI RSHUDWLRQ GHSHQGV XSRQ WKH
R[LGDWLRQ RI FRPEXVWLEOH JDVHV RQ DQ HOHFWULFDOO\
KHDWHG FDWDO\WLF ³ILODPHQW´ RWKHUZLVH NQRZQ DV WKH
³VHQVLWLYH´ ³DFWLYH´ RU ³GHWHFWRU´ HOHPHQW ZKLFK
FDXVHVWKHWHPSHUDWXUHRIWKLVILODPHQWWRULVHVRDV
WRHOHFWULFDOO\XQEDODQFHD:KHDWVWRQHEULGJHFLUFXLW
RIZKLFKLWIRUPVDSDUWVHH)LJXUH7KLVVHQVLWLYH
ILODPHQW PD\ WDNH WKH IRUP RI D VLPSOH OHQJWK RI
SODWLQXP ZLUH RU LW PD\ EH LQ WKH IRUP RI D FRLO RI
SODWLQXP ZLUH FRDWHG ZLWK D VXLWDEOH QREOH PHWDO
R[LGH HJ SDOODGLXP WKRULD RQ DQ DOXPLQD EDVH
7KH ODWWHU FRQILJXUDWLRQ LV GHVLJQHG WR HQKDQFH WKH
FDWDO\WLF DFWLYLW\ DW ORZHU ILODPHQW WHPSHUDWXUHV DQG
VR WR H[WHQG WKH OLIH RI WKH ILODPHQW $ VHFRQG
w
w
ILODPHQW PDGH LQDFWLYH WR JDV E\ VHDOLQJ RU
³SRLVRQLQJ´ EXW HOHFWULFDOO\ PDWFKHG ZLWK WKH
VHQVLWLYH ILODPHQW LV FRQQHFWHG HOHFWULFDOO\ ZLWK WKH
ODWWHU DV SDUW RI WKH :KHDWVWRQH EULGJH DQG LV
ORFDWHGDGMDFHQWWRLWLQWKHGHWHFWRUKRXVLQJVRDVWR
SURYLGH FRPSHQVDWLRQ IRU WKH HIIHFWV RI DPELHQW
WHPSHUDWXUH YDULDWLRQV XSRQ WKH VHQVLWLYH ILODPHQW
7KLVVHFRQGILODPHQWLVNQRZQDVWKH³QRQVHQVLWLYH´
RU³FRPSHQVDWRU´HOHPHQW
:KHQVXFKDJDVGHWHFWRULVH[SRVHGWRLQFUHDVLQJ
FRQFHQWUDWLRQV RI D FRPEXVWLEOH JDV LQ DLU LWV
UHVSRQVH DV PHDVXUH HOHFWULFDOO\ DFURVV WKH
: KHDWVWRQH EULGJH W\SLFDOO\ LQFUHDVHV
DSSUR[LPDWHO\ OLQHDUO\ WKURXJK WKH /(/ SHDNLQJ DW
DURXQG WKH VWRLFKLRPHWULF PL[WXUH DQG WKHQ IDOOV WR
]HUR ZKHQ WKH FRPEXVWLEOH JDV FRQFHQWUDWLRQ
UHDFKHVE\YROXPHVHH)LJXUH)URPWKLV
LW ZLOO EH HYLGHQW WKDW WKH JDV GHWHFWRU LV FRKHUHQW
RQO\ ZLWK WKH /(/ UDQJH DQG WKDW DQRPDORXV
UHVSRQVH FDQ RFFXU DW JDV FRQFHQWUDWLRQV JUHDWHU
WKDQ WKH VWRLFKLRPHWULF PL[WXUH 7KLV GHILQHV LWV
OLPLWDWLRQRIPHDVXUHPHQWDOWKRXJKLWLVSRVVLEOHWR
GHYLVH D PHDQV RI SUHYHQWLQJ DQRPDORXV UHDGLQJV
RI WKH JDV GHWHFWLRQ V\VWHP DW FRQFHQWUDWLRQV LQ
H[FHVVRIWKH/(/
'HWHFWLRQ(OHPHQWV
7KH GHWHFWLRQ HOHPHQWV PD\ WDNH YDULRXV IRUPV
DFFRUGLQJWRWKHRULJLQRIWKHLUGHVLJQ7KHVLPSOHVW
IRUPLVWKHSODWLQXPZLUHILODPHQWVWLOOXVHGLQVRPH
JDV GHWHFWLRQ LQVWUXPHQWV +RZHYHU WKLV KDV
WKH GLVDGYDQWDJH RI UHTXLULQJ D KLJK
RSHUDWLQJ WHPSHUDWXUH IRU HIILFLHQW FRPEXVWLRQ
PHWKDQH ± ƒ& UHVXOWLQJ LQ VKRUW OLIH WR IDLOXUH
GXHWRHYDSRUDWLRQRIWKHSODWLQXPZLUH
7KH WZR SDUWLFXODU IRUPV RI GHWHFWLRQ FRQVLGHUHG LQ
WKLV SDSHU DUH WKH ³ILODPHQW´ DQG WKH ³EHDG´ (DFK
KDVXQLTXHFKDUDFWHULVWLFV
7KH ILODPHQW FRQILJXUDWLRQ LV JHQHUDOO\ DV VKRZQ LQ
)LJXUH ,W LV FRPSULVHG RI D VLOLFD ILEHU WXEXODU
IRUPHUXSRQZKLFKLVVSLUDOO\ZRXQGDOHQJWKRIILQH
JDXJHSODWLQXPZLUH7KHVSDFHVEHWZHHQWKHWXUQV
RI WKH ZLUH DUH FULWLFDO WR WKH SHUIRUPDQFH RI WKH
GHWHFWRU 7KH VHQVLWLYH DFWLYH ILODPHQW LV FRDWHG
ZLWK RQH RI VHYHUDO DOWHUQDWLYH SDOODGLXPSODWLQXP
WKRULD FDWDO\VWV HDFK GHVLJQHG WR JLYH WKH EHVW
SRVVLEOH UHODWLYH UHVSRQVH WR D SDUWLFXODU UDQJH RI
JDVHV 7KH QRQVHQVLWLYH ILODPHQW LV PDGH
FKHPLFDOO\ LQHUW WR JDV RU LV VHDOHG ZLWK IRU
H[DPSOHJODVV7KHVHQVLWLYHILODPHQWLVHOHFWULFDOO\
VHOIKHDWHG WR D WHPSHUDWXUH EHWZHHQ ƒ& DQG
ƒ& DFFRUGLQJ WR WKH JDVHV WR EH GHWHFWHG
%RWK ILODPHQWV DUH PRXQWHG LQ FHUDPLF RU VLPLODU
IUDPHV WR VXLW WKH YDULRXV GHVLJQV RI JDV
GHWHFWLRQLQVWUXPHQWV
www.HSEArya.com
(/(&752&$7$/<7,&&20%867,%/(6(16256
7HFKQLFDO'LVFXVVLRQFRQW¶G
7KH ³EHDG´ VHH )LJXUH WDNHV WKH IRUP RI D
FHUDPLFSHOOHWVXSSRUWHGRQDSODWLQXPZLUHFRLODQG
RULQWKHFDVHRIWKHVHQVLWLYHHOHPHQWFRDWHGZLWKD
SDOODGLXP WKRULD RU RWKHUFDWDO\VW RULQ WKHFDVH RI
WKH QRQVHQVLWLYH HOHPHQW GHDFWLYDWHG ZLWK
SRWDVVLXP K\GUR[LGH JODVV RU VLPLODU PDWHULDO 7KLV
JODVV RU FHUDPLF SHOOHW ZRUNV WR PLQLPL]H FRLO ZLUH
HYDSRUDWLRQ DV ZHOO DV WR SURYLGH PHFKDQLFDO
VXSSRUW 7KH VHQVLWLYH HOHPHQW LV QRUPDOO\
HOHFWULFDOO\ VHOIKHDWHG WR EHWZHHQ ƒ& DQG
ƒ&IRUPHWKDQHDQGRWKHUJDVHV
0XFK KDV EHHQ VDLG RI WKH HIIHFWV RI ³SRLVRQV´ RU
³LQKLELWRUV´ RQ HOHFWURFDWDO\WLF EHDGV 7KH PRVW
FRPPRQ SRLVRQV DUH VLOLFRQV VXOILGHV SKRVSKDWHV
DQGOHDGV7KHVHPDWHULDOVH[KLELWDQDIILQLW\IRUWKH
FDWDO\VW DQG WHQG WR FRDW WKH VHQVRU EHDG ZKLFK
SUHYHQWVWKHJDVEHLQJPRQLWRUHGIURPUHDFKLQJWKH
VHQVLQJ HOHPHQW ,Q VRPH FDVHV WKH HIIHFW LV VR
GUDPDWLF WKDW VRPH VHQVRUV KDYH EHHQ UHQGHUHG
XVHOHVVLQDPDWWHURIDIHZGD\V
7KLVSUREOHPKDVEHHQUHVROYHGE\XVLQJDPHWKRG
WR DSSO\ D VSRQJHOLNH FRDWLQJ DURXQG WKH JODVV
EHDG DQG DSSO\LQJ WKH FDWDO\VW WKURXJKRXW WKH
SRURXV FRDWLQJ 7KLV JUHDWO\ LQFUHDVHV FDWDO\WLF
VXUIDFH DUHD WKHUHE\ LQFUHDVLQJ WKH DPRXQW RI
SRLVRQ WKDW FDQ EH WROHUDWHG DQG H[WHQGLQJ
VHQVRUOLIH
m
o
c
.
a
y
r
A
E
S
H
8VXDOO\WKHEHDGLVPXFKVPDOOHUWKDQWKHILODPHQW
DQG LW RSHUDWHV DW ORZHU LQSXW SRZHU ZLWK
FRUUHVSRQGLQJO\ ORZHU RXWSXW VHQVLWLYLW\ XVXDOO\
VWDWHG LQ WHUPV RI PLOOLYROWV EULGJH RXWSXW SHU
SHUFHQW/(/RUSHUFHQWYROXPHRIJDVLQWKHDLU
.
w
w
w
)LJXUH%DVLFJDVGHWHFWLRQFLUFXLW
7KH:KHDWVWRQH%ULGJH
)LJXUH7\SLFDOUHVSRQVHFKDUDFWHULVWLFEHDG
)LJXUH7KHILODPHQWVHQVLWLYH
)LJXUH7KHEHDGVHQVLWLYH
www.HSEArya.com
(/(&752&+(0,&$/³7:,172;´6(16256
7HFKQLFDO'LVFXVVLRQ
7
KH ³7ZLQ 7R[´ JDV VHQVRU XVHG LQ %:
7HFKQRORJLHV %: 'HIHQGHU PXOWLJDV
GHWHFWLRQLQVWUXPHQWVLVDXQLTXHDSSURDFK
IRU VHQVLQJ KD]DUGRXV OHYHOV RI K\GURJHQ
VXOILGH+6DQGFDUERQPRQR[LGH&2JDV
7KHJDVVHQVLQJUHDFWLRQVDUHVKRZQDWWKHERWWRP
VHFWLRQRI)LJXUH7KHNH\DGYDQWDJHVDUHWKDW
7KH³7ZLQ7R[´LVEDVLFDOO\WZRJDVVHQVRUVLQRQH
,WXWLOL]HVWR[LFJDVVHQVLQJWHFKQRORJ\WKDWKDVEHHQ
ILHOGSURYHQRYHUWKHODVWGHFDGHDQGLVWKHSUHVHQW
VWDQGDUGIRUWKHGHWHFWLRQRIKD]DUGRXVJDVHVLQWKH
LQGXVWULDO K\JLHQH LQGXVWU\ SDUWLFXODUO\ WKRVH IRXQG
LQ WKH RLO DQG JDV PXQLFLSDO SXOS DQG SDSHU ILUH
KD]PDW VHFWRUV DQG RWKHU FRQILQHG VSDFH HQWU\
DSSOLFDWLRQV
7KH%:7HFKQRORJLHV³7ZLQ7R[´KDVWZRVHSDUDWH
FKDPEHUV ZLWKLQ WKH VLQJOH VHQVRU SDFNDJH ZKLFK
SURYLGH LQGHSHQGHQW JDV VHQVLQJ DQG UHVXOWLQJ
VLJQDORXWSXWVIRU+26DQG&27KLVDOORZVWKH³7ZLQ
7R[´ WR EHJDV VSHFLILF WR HLWKHU +26 RU &2 RUERWK
VLPXOWDQHRXVO\ )LJXUH $ JUDSKLFDOO\ LOOXVWUDWHV WKH
LQQHUZRUNLQJVRIWKHVHQVRU1RWHWKDWWKHUHDUHWZR
OD\HUHG DQG LQGHSHQGHQW VHQVLQJ FKDPEHUV HDFK
FRQWDLQLQJ D VHQVLQJ HOHFWURGH 6 6 7KH ILUVW
VHQVLQJ HOHFWURGH FKDPEHU 6 ZLOO UHDFW RQO\ WR
+26 JDV PROHFXOHV DQG WKH VHFRQG VHQVLQJ
HOHFWURGHFKDPEHU6UHDFWVZLWK&2%RWK6DQG
6 VHQVLQJ HOHFWURGHV VKDUH D UHIHUHQFH HOHFWURGH
DQGWKHFRPPRQHOHFWURO\WHVROXWLRQUHVHUYRLU
SRZHU FRQVXPSWLRQ LV PLQLPDO
EHFDXVH WKH DFWXDO VHQVLQJ FKHPLFDO
UHDFWLRQ FUHDWHV WKH EDVH VHQVLQJ
VLJQDO²HDFK PROHFXOH RI + 6
SURGXFHV HOHFWURQV RI VLJQDO WKH
VHQVLQJ FLUFXLWU\ LV QRUPDOO\
TXLHVFHQWDQG
VHQVRU VLJQDO RXWSXW LV OLQHDU WR WKH
H[SRVHGJDVFRQFHQWUDWLRQ
m
o
c
.
a
y
r
A
E
S
H
WKH ZRUNLQJ HOHFWURGH UHDFWLRQ
UHJHQHUDWHVWKHH[DFWDPRXQWRIZDWHU
+2 WKDW ZDV XVHG RQ WKH VHQVLQJ
HOHFWURGH WR UHDFW ZLWK WKH WDUJHW JDV
+6RU&2LWUHILOOVLWVHOI
7KH³7ZLQ7R[´VHQVRUVKRXOGQRWEHFRQIXVHGZLWK
WKH 'XDO 7R[ W\SH VHQVRU ZKLFK LV VLPSO\ D QRQ
ILOWHUHG &2 HOHFWURFKHPLFDO FHOO WKDW ZLOO
LQGLVFULPLQDWHO\ GHWHFW +26 DQGRU &2 EDVHG RQ LWV
FURVVLQWHUIHULQJ UHVSRQVH 8QOLNH WKH %:
7HFKQRORJLHV ³7ZLQ 7R[´ WKH 'XDO 7R[ W\SH VHQVRU
FRQWDLQVRQO\RQHVHQVLQJHOHFWURGHFKDPEHUJLYHV
RQO\ RQH JDV VHQVLQJ VLJQDO RXWSXW DQG FDQQRW
GLVWLQJXLVKEHWZHHQ+26DQG&2
+6&2*DV,QSXWE\QRUPDOGLIIXVLRQ
.
w
w
w
2ULQJ6HDO&DSLOODU\%DUULHU
+66HQVLQJ(OHFWURGH6
&26HQVLQJ(OHFWURGH6
5HIHUHQFH(OHFWURGH
&RXQWHU(OHFWURGHV
(OHFWURO\WH5HVHUYRLU
)LJXUH(OHFWURFKHPLFDO³7ZLQ7R[´6HQVRU
+66HQVLQJ(OHFWURGH5HDFWLRQ+6+2+62+H
+6&RXQWHU(OHFWURGH5HDFWLRQ+ 2+2
&26HQVLQJ(OHFWURGH5HDFWLRQ&2+2&2+H
&2&RXQWHU(OHFWURGH5HDFWLRQò2++2
Download PDF
Similar pages