Large Belt Drive HKV Series

Submittal Data
Large Belt Drive HKV Series
Large Commercial Vertical Packaged
Heat Pump with R-410A
HKV 084-300
60Hz - HFC-410A
Design Guide - Large HKV
Design Guide - Large HKV
Large Belt Drive
HKV Series
Submittal Data
Models HKV084 - 300
60Hz - HFC-410A
English Language/I-P Units
SUBMITTAL DATA - I-P UNITS
Unit Designation:
Job Name:
Architect:
Engineer:
Contractor:
PERFORMANCE DATA
Cooling Capacity:
Btuh
EER:
Heating Capacity:
Btuh
COP:
Ambient Air Temp:
°F
Entering Water Temp (Clg):
°F
Entering Air Temp (Clg):
°F
Entering Water Temp (Htg):
°F
Entering Air Temp (Htg):
°F
Airflow:
CFM
Fan Speed or Motor/RPM/Turns:
Operating Weight:
(lb)
ELECTRICAL DATA
Power Supply:
Volts
PhaseHz
Minimum Circuit Ampacity:
MARS works continually to improve its products. As a result, the design and specifications of each product at
the time of order may be changed without notice and may not be as described herein. Please contact MARS
Customer Service Department for specific information on the current design and specifications. Statements and
other information contained herein are not express warranties and do not form the basis of any bargain between
the parties, but are merely MARS opinion or commendation of its products. The latest version of this document is
available at www.heatcontroller.com.
Maximum Overcurrent Protection:
Large Belt Drive
HKV Series
Submittal Data
Models HKV084 - 300
60Hz - HFC-410A
English Language/S-I Units
SUBMITTAL DATA - S-I UNITS
Unit Designation:
Job Name:
Architect:
Engineer:
Contractor:
PERFORMANCE DATA
Cooling Capacity:
kW
EER:
Heating Capacity:
kW
COP:
Ambient Air Temp:
°C
Entering Water Temp (Clg):
°C
Entering Air Temp (Clg):
°C
Entering Water Temp (Htg):
°C
Entering Air Temp (Htg):
°C
Airflow:
l/s
Fan Speed or Motor/RPM/Turns:
Operating Weight:
(kg)
ELECTRICAL DATA
Power Supply:
Volts
PhaseHz
Minimum Circuit Ampacity:
MARS works continually to improve its products. As a result, the design and specifications of each product at
the time of order may be changed without notice and may not be as described herein. Please contact MARS
Customer Service Department for specific information on the current design and specifications. Statements and
other information contained herein are not express warranties and do not form the basis of any bargain between
the parties, but are merely MARS opinion or commendation of its products. The latest version of this document is
available at www.heatcontroller.com.
Maximum Overcurrent Protection:
Design Guide - Large HKV
Table of Contents
*Page Number
Unit Features. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1
Selection Procedure . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2
HK Series Nomenclature. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4
Performance Data – AHRI/ASHRAE/ISO 13256-1. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5
Performance Data – Selection Notes . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6
Performance Data – HKV084 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 7
Performance Data – HKV096 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 8
Performance Data – HKV120 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 9
Performance Data – HKV150 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 10
Performance Data – HKV168 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 11
Performance Data – HKV192 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12
Performance Data – HKV240 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 13
Performance Data – HKV300 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 14
HK Performance Data Correction Tables . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 15
Antifreeze Correction and Water Pressure Drop Adder for Option Tables. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 16
Blower Performance Data – HKV084 - Standard Unit. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 17
Blower Performance Data – HKV096 - Standard Unit . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 18
Blower Performance Data – HKV120 - Standard Unit . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 19
Blower Performance Data – HKV150 - Standard Unit. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 21
Blower Performance Data – HKV168 - Standard Unit . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 23
Blower Performance Data – HKV192 - Standard Unit . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 24
Blower Performance Data – HKV240 - Standard Unit . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 25
Blower Performance Data – HKV300 - Standard Unit . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 27
HK Physical Data. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 29
HKV084-150 Dimensional Data. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 30
HKV168-300 Dimensional Data. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 31
HK Electrical Data – Standard. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 32
HK Electrical Data – Dual Point Power. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 33
HK Electrical Data Standard with Internal Pump . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 34
HK Electrical Data – Dual Point Power with Pump . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 35
HK Series Wiring Diagram Matrix. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 36
Typical Wiring Diagram - Three Phase HKV084-150 with CXM Controller. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 37
Typical Wiring Diagram - Three Phase HKV084-150 with DXM. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 38
Engineering Specifications . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 39
Revision History. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 46
Design Guide - Large HKV
Unit Features
THE LARGE HK) SERIES
UNIT FEATURES
The award winning Large (HK) Series raises the bar for
Water-Source Heat Pump efficiencies, features, and
application flexibility. Not only does the (HK) exceed
ASHRAE 90.1 efficiencies, but it also uses EarthPure®
HFC-410A zero ozone depletion refrigerant, making it an
extremely environmentally-friendly option. (HK) Series is
eligible for additional LEED® (Leadership in Energy and
Environmental Design) points because of the “green”
technology design.
Vertical sizes 084 (7 tons, 24.6 kW), 096 (8 tons), 120
(10 tons), 150 (12.5 tons), 168 (14 tons), 192 (16
tons), 240 (20 tons), 300 (25 tons, 87.9 kW)
Unit configuration can be ordered with, or converted to
front or back return and top, front, or back discharge.
Field conversion uses all existing parts including
panels and belts
Electrical box can be field converted to be on front or
back of unit
Electric power can enter from any side of unit
Water and drain can be connected to either side
Dual refrigeration circuits (HKV168, 192, 240, 300)
Exceeds ASHRAE 90.1 efficiencies
TXV metering device
Extended range 20 to 120°F (-6.7 to 48.9°C operation)
Microprocessor controls standard (optional DXM and/or
DDC controls)
LonWorks, BACnet, Modbus and Johnson N2
compatibility options for DDC controls
Unit Performance Sentinel performance
monitoring system
Belt drive blowers with high efficiency motors and
multiple pulley adjustment
1", 2", or 4" (25, 50, or 100 mm) Full Filter Frame with
bottom access
Available in sizes 7 tons (24.6 kW) through 25 tons (87.9
kW) with multiple cabinet configurations, the Large
(HK) Series offers a wide range of units for most any
installation. The Large Series has an extended range
refrigerant circuit, capable of ground loop (geothermal)
applications (may require optional extended range
insulation), ground water (geothermal) applications, as
well as water loop (boiler-tower) applications. Standard
features are many. Microprocessor controls, galvanized
steel cabinet, epoxy powder coat painted front access
panel, galvanized steel with epoxy powder coat painted
drain pan and TXV refrigerant metering device are just
some of the features of the flexible Large Series.
MARS’s exclusive double isolation compressor mounting
system makes the Large Series one of the quietest units
on the market. Compressors are mounted on specially
engineered sound-tested EPDM grommets to a heavy
gauge mounting plate, which is further isolated from
the cabinet base with rubber grommets for maximized
vibration and sound attenuation. The easy access
control box and large access panels make installing and
maintaining the unit easier than other water-source heat
pumps currently in production.
OPTIONS INCLUDE
Hot gas bypass
Dual point power
Coated air coil
Internal motorized valve
Internal secondary pump
UltraQuiet
Extended range insulation
Cupro-nickel water coil
Stainless steel drain pan
ClimaDry® II
Electrical disconnect
Options such as coated air coil, DDC controls, and
dual point power allow customized design solutions.
Optional blower motor/sheave drive packages expand
the operating range and help overcome some of
the challenges associated with ductwork for retrofit
installations. A cupro-nickel water-coil and sound
absorbing UltraQuiet package are options that make a
great unit even better.
The Large (HK) Series Water-Source Heat Pumps
are designed to meet the challenges of today’s HVAC
demands with one of the most innovative products
available on the market.
1
Submittal Data - Large HKV
Selection Procedure
Reference Calculations
Heating
Cooling
HE
LWT = EWT GPM x 500
LAT = EAT +
HR
LWT = EWT +
GPM x 500
HC
CFM x1.08
LC = TC - SC
SC
CFM x1.08
LAT (DB) = EAT (DB) -
S/T =
SC
TC
Legend and Glossary of Abbreviations
HWC
FPT
KW
LAT
LC
LWT
MBTUH
S/T
SC
TC
WB
WPD
BTUH = BTU( British Thermal Unit) per hour
CFM = airflow, cubic feet/minute
COP = coefficient of performance = BTUH output/BTUH input
DB = dry bulb temperature (°F)
EAT = entering air temperature, Fahrenheit (dry bulb/wet bulb)
EER = energy efficiency ratio = BTUH output/Watt input
MPT = male pipe thread
ESP = external static pressure (inches w.g.)
EWT = entering water temperature
GPM = water flow in U.S. gallons/minute
HE = total heat of extraction, BTUH
HC = air heating capacity, BTUH
HR = total heat of rejection, BTUH
= hot water generator (desuperheater) capacity, Mbtuh
= female pipe thread
= total power unit input, kilowatts
= leaving air temperature, °F
= latent cooling capacity, BTUH
= leaving water temperature, °F
= 1000 BTU per hour
= sensible to total cooling ratio
= sensible cooling capacity, BTUH
= total cooling capacity, BTUH
= wet bulb temperature (°F)
= waterside pressure drop (psi & ft. of hd.)
Conversion
Table - (English)
to convert
(English) to S-I (Metric)
To convert Inch-Pound
to SIinch-pound
(Metric)
Air Flow
Water Flow
Ext Static Pressure
Water Pressure Drop
Airflow (L/s) = CFM x 0.472
Water Flow (L/s) = gpm x 0.0631
ESP (Pa) = ESP (in of wg) x 249
PD (kPa) = PD (ft of hd) x 2.99
Entering Air Correction Tables
Cooling Corrections
Ent Air
WB ϒF
Total Clg
Cap
70
75
80
80.6
60
0.852
0.828
0.980
1.097
65
0.974
0.595
0.808
1.004
66.2
1.000
0.539
0.767
67
1.004
0.501
0.740
70
1.034
0.636
75
Heating Corrections
Sens Clg Cap Multiplier - Entering DB ϒF
1.069
0.996
0.878
0.998
0.979
*
*
1.000
1.000
1.233
1.276
1.002
1.010
1.220
1.005
1.029
75
0.980
1.037
0.960
1.058
80
0.967
1.063
0.934
*
*
1.017
1.194
*
0.967
1.000
1.152
0.939
0.955
1.124
0.810
0.844
1.016
1.136
0.973
1.127
1.010
60
1.059
0.947
1.100
65
1.019
0.981
1.032
68
1.000
1.000
1.000
70
0.995
1.010
0.989
Entering air corrections should be multiplied directly to unit performance data to derive performance at entering air condition other
than ARI/ISO/ASHRAE 13256-1
ARI/ISO/ASHRAE 13256-1 uses entering air conditions of Clg- 80.6ϒF DB/66.2ϒF WB and Htg- 68ϒF DB/59ϒF WB shown in bold
Discontinued Standards ARI 320, 325, and 330 used entering air conditions of Clg- 80ϒF DB/67ϒF WB and Htg- 70ϒF DB
Air Flow Correction Table
Airflow
Heat of
Ext
*
1.129
0.826
Power
*
95
0.612
Htg Cap
Heat of
Rej
90
0.514
Ent Air
DB ϒF
Power
85
Cooling
Heating
CFM Per Ton
of Clg
% of
Nominal
Total Cap
Sens Cap
Power
Heat of Rej
Htg Cap
Power
Heat of Ext
300
75%
1.019
0.902
0.964
1.007
0.957
1.061
0.922
325
81%
1.013
0.928
0.976
1.003
0.968
1.040
0.946
350
88%
1.007
0.953
0.988
1.000
0.979
1.020
0.970
375
94%
1.004
0.977
0.994
1.000
0.989
1.010
0.985
400
100%
1.000
1.000
1.000
1.000
1.000
1.000
1.000
425
106%
0.998
1.023
1.006
1.000
1.011
0.997
1.015
450
113%
0.997
1.047
1.012
1.000
1.021
0.994
1.030
400 CFM per ton of cooling capacity is nominal rated airflow for all models (bold print)
Use multipliers directly with unit data for correcting unit performance at other airflows than nominal
2
Submittal Data - Large HKV
Selection Procedure
Step 1 Determine the actual heating and cooling loads at the
desired dry bulb and wet bulb conditions.
Example Equipment Selection For Cooling
Step 1 Load Determination:
Step 2 Obtain the following design parameters: Entering water
temperature, water flow rate in GPM, air flow in CFM,
water flow pressure drop and design wet and dry bulb
temperatures. Air flow CFM should be between 300 and
450 CFM per ton. Unit water pressure drop should be
kept as close as possible to each other to make water
balancing easier. Go to the appropriate tables and find
the proper indicated water flow and water temperature.
Assume you have determined that the appropriate cooling load
at the desired dry bulb 80°F and wet bulb 65°F conditions is as
follows:
Total Cooling.................................................78,500 BTUH
Sensible Cooling...........................................63,800 BTUH
Entering Air Temp............80°F Dry Bulb / 65°F Wet Bulb
Step 3Select a unit based on total and sensible cooling
conditions. Select a unit which is closest to the actual
cooling load.
Step 2 Design Conditions:
Similarly, you have also obtained the following design
parameters:
Step 4 Use data from performance tables at the design water
flow and water temperature. Read the total and sensible
cooling capacities (Note: interpolation is permissible,
extrapolation is not).
Entering Water Temp (Cooling).................................90°F
Entering Water Temp (Heating).................................60°F
Water Flow (Based upon 12°F rise in temp.)....15.8 GPM
Air Flow..............................................................2,460 CFM
Step 5 Read the heating capacity. If it exceeds the design
criteria it is acceptable. It is quite normal for WaterSource Heat Pumps to be selected on cooling capacity
only since the heating output is usually greater than the
cooling capacity.
Step 3, 4 & 5 HP Selection:
After making your preliminary selection (HKV084), we enter the
data from tables at design water flow and water temperature
and read Total Cooling, Sens. Cooling and Heat of Rej.
capacities:
Step 6 Determine the correction factors associated with the
variable factors of dry bulb and wet bulb (page 14).
Corrected Total Cooling =
tabulated total cooling x wet bulb correction.
Corrected Sensible Cooling =
tabulated sensible cooling x wet/dry bulb correction.
Total Cooling..................................................80,453 BTUH
Sensible Cooling............................................60,370 BTUH
Heat of Rejection.........................................101,755 BTUH
Airflow................................................................2,800 CFM
Step 6, 7 & 8 Entering Air, Airflow and Antifreeze Corrections:
Step 7 Determine the correction factor associated with
antifreeze in system loop. If heating EWT is 50°F
or below you may have to use antifreeze. Calculate
leaving water temperature per performance data
selection notes (page 18). If antifreeze is required,
use correction table for correcting total and sensible
capacities.
Next, we determine our correction factors.
Airflow 2460 ÷ 2800 = 88% Step 8 Compare the corrected capacities to the load
requirements. Normally if the capacities are within 10%
of the loads, the equipment is acceptable. It is better
to undersize than oversize, as undersizing improves
humidity control, reduces sound levels and extends the
life of the equipment.
Table
Antifreeze - None
Ent Air Air Flow
Corrected
Corrected Total Cooling = 80,453 x .975 x .982 x 1 = 77,029
Corrected Sens Cooling = 60,370 x 1.096 x .940 x 1 = 62,195
Corrected Heat of Rejection = 101,775 x .979 x .974 = 97,028
Step 9 Water Temperature Rise Calculation & Assessment:
Rise = Heat of Rejection ÷ (GPM x 500)
Actual Temperature Rise 97,028 ÷ 7,900 = 12.3°F
When we compare the Corrected Total Cooling and Corrected
Sensible Cooling figures with our load requirements stated
in Step 1, we discover that our selection is within +/- 10%
of our sensible load requirement. Furthermore, we see that
our Corrected Total Cooling figure is slightly undersized as
recommended, when compared to the actual indicated load.
Step 9 When completed, calculate water temperature rise
and assess the selection. If the units selected are not
within 10% of the load calculations, then review what
effect changing the GPM, water temperature and/or air
flow and air temperature would have on the corrected
capacities. If the desired capacity cannot be achieved,
select the next larger or smaller unit and repeat the
procedure. Remember, when in doubt, undersize
slightly for best performance.
Alternate Step 7: If your EWT for heating is 40°F then system
requires antifreeze. If a solution of 15% Propylene Glycol is
required, then:
Corrected Total Cooling = 77,029 x .986 = 75,950
Corrected Sens Cooling = 62,195 x .986 = 61,324
3
Submittal Data - Large HKV
HK Series Nomenclature
1
2
HK
3
4 5 6
V
7
084
A
9
8
10
11
12
13 14
3 C 1 A C BT
MODEL TYPE
HK = HEAT CONTROLLER LARGE COMMERCIAL
AIR FLOW OPTIONS
CONFIGURATION
V = VERTICAL (NON PAINTED)
BF = BACK RETURN / FRONT SUPPLY
BT = BACK RETURN / TOP SUPPLY
FB = FRONT RETURN / BACK SUPPLY
FT = FRONT RETURN / TOP SUPPLY
YF = BACK RETURN / FRONT SUPPLY + SS DRAIN PAN
YT = BACK RETURN / TOP SUPPLY + SS DRAIN PAN
ZB = FRONT RETURN / BACK SUPPLY + SS DRAIN PAN
ZT = FRONT RETURN / TOP SUPPLY + SS DRAIN PAN
UNIT SIZE
084
096
120
150
168
192
240
300
HEAT EXCHANGER
MOTORIZED VALVE / PUMP OPTIONS
REVISION LEVEL
A = CURRENT REVISION FOR HKV
VOLTAGE
COPPER CUPRONICKEL
OPTION WATER COIL WATER COIL
3 = 208-230/60/3
4 = 460/60/3
5 = 575/60/3
A
YES
NO
NO
YES
C = CXM
D = DXM
L = CXM w/ LON
M = DXM w/ LON
N = CXM w/ MPC
P = DXM w/ MPC
J
N
U
T
YES
NO
NO
YES
A = CXM
B = DXM
E = CXM w/LON
K = DXM w/LON
R = CXM w/MPC
S = DXM w/MPC
Z
C
CONTROLS
{
w/
Disconnect
W
S
G
H
Y
1
A
B
2
C
RANGE
ULTRA QUIET 1” FILTER FRAME 2” FILTER FRAME 4” FILTER FRAME
NO
E
F
4
G
H
YES
NO
NO
YES
NO
YES
NO
YES
YES
NO
D
3
NO
YES
NO
YES
NO
NO
NO
YES
COATED MTRZD VALVE INTERNAL PUMP
AIR COIL ( WATER OUT )
( WATER IN )
NO
YES
YES
NO
NO
YES
YES
NO
NO
YES
YES
NO
NO
YES
YES
NO
NO
YES
YES
NO
NO
YES
YES
NO
BLOWER DRIVE PACKAGE
CABINET INSULATION / FILTER FRAME
OPTION
YES
NON COATED
AIR COIL
YES
NO
NO
YES
NO
YES
YES
NO
NO
NO
YES
NO
YES
NO
NO
YES
4
NO
YES
NO
NO
YES
A = STANDARD RPM & STANDARD MOTOR
B = LOW & RPM & STANDARD MOTOR
C = HIGH RPM & STANDARD MOTOR
D = STANDARD RPM & LARGE MOTOR (NOT AVAILABLE FOR 240)
E = HIGH RPM & LARGE MOTOR
Submittal Data - Large HKV
Performance Data – AHRI/ASHRAE/ISO 13256-1
ASHRAE/AHRI/ISO 13256-1. English (I-P) Units
Water Loop Heat Pump
Model
Cooling 86°F
Ground Water Heat Pump
Heating 68°F
Cooling 59°F
Capacity
Btuh
EER
Btuh/W
Capacity
Btuh
COP
HKV084
82,000
15.2
101,000
HKV096
94,000
15.0
118,000
HKV120
118,000
15.0
HKV150
150,000
HKV168
166,000
HKV192
Ground Loop Heat Pump
Heating 50°F
Cooling 77°F
Heating 32°F
Capacity
Btuh
EER
Btuh/W
Capacity
Btuh
COP
Capacity
Btuh
EER
Btuh/W
Capacity
Btuh
COP
4.8
87,500
21.0
83,500
4.3
83,000
16.5
65,500
3.6
4.7
102,500
20.5
96,500
4.2
97,500
16.5
76,500
3.6
144,000
5.0
133,000
21.0
118,000
4.2
120,000
16.5
93,000
3.7
14.0
186,000
4.7
170,000
20.0
155,000
4.2
156,000
15.8
122,000
3.6
15.5
204,020
4.9
177,000
21.4
169,000
4.4
168,000
16.8
132,500
3.7
190,000
15.3
238,360
4.8
207,000
20.9
195,000
4.3
197,000
16.8
155,000
3.7
HKV240
238,500
15.3
291,000
5.1
269,000
21.4
238,500
4.3
242,500
16.8
188,000
3.8
HKV300
300,000
14.0
372,000
4.7
340,000
20.0
310,000
4.2
312,000
15.8
244,000
3.6
Cooling capacities based upon 80.6°F DB, 66.2°F WB entering air temperature.
Heating capacities based upon 68°F DB, 59°F WB entering air temperature.
All ratings based upon operation at lower voltage of dual voltage rated models
All HKV084 ratings at 2800 CFM with sheave settings at 3.5 turns open.
All HKV096 ratings at 3200 CFM with sheave settings at 3.0 turns open.
All HKV120 ratings at 4000 CFM with sheave settings at 2.5 turns open.
ASHRAE/AHRI/ISO 13256-1. Metric (S-I) Units
Water Loop Heat Pump
Model
Cooling 30ºC
Ground Water Heat Pump
Heating 20ºC
Cooling 15ºC
Ground Loop Heat Pump
Heating 10ºC
COP
Capacity
kW
EER
W/W
Capacity
kW
29.60
4.8
25.65
6.2
34.58
4.7
30.04
6.0
42.20
5.0
38.98
4.1
54.51
4.7
48.65
4.5
59.80
HKV192
55.69
4.5
HKV240
69.90
HKV300
87.93
Cooling 25ºC
Heating 0ºC
COP
Capacity
kW
EER
W/W
Capacity
kW
COP
24.47
4.3
24.33
4.8
19.20
3.6
28.28
4.2
28.58
4.8
22.42
3.6
6.2
34.58
4.2
35.17
4.8
27.26
3.7
49.82
5.9
45.43
4.2
45.72
4.6
35.76
3.6
4.9
51.87
6.3
49.53
4.4
49.24
4.9
38.83
3.7
69.86
4.8
60.67
6.1
57.15
4.3
57.74
4.9
45.43
3.7
4.5
85.29
5.1
78.84
6.3
69.90
4.3
71.07
4.9
55.10
3.8
4.1
109.03
4.7
99.65
5.9
90.86
4.2
91.44
4.6
71.51
3.6
Capacity
kW
EER
W/W
Capacity
kW
HKV084
24.03
HKV096
27.55
4.5
4.4
HKV120
34.58
4.4
HKV150
43.96
HKV168
Cooling capacities based upon 27°C DB, 19°C WB entering air temperature.
Heating capacities based upon 20°C DB, 15°C WB entering air temperature.
All ratings based upon operation at lower voltage of dual voltage rated models.
All HKV084 ratings at 1321 l/s with sheave settings at 3.5 turns open.
All HKV096 ratings at 1510 l/s with sheave settings at 3.5 turns open.
All HKV120 ratings at 1888 l/s with sheave settings at 3.5 turns open.
5
Submittal Data - Large HKV
Performance Data – Selection Notes
For operation in the shaded area when water is used in lieu of an
antifreeze solution, the LWT (Leaving Water Temperature) must be
calculated. Flow must be maintained to a level such that the LWT
is maintained above 42°F [5.6°C]
when the JW3 jumper
is not
WPD
Cooling
- EAT 80/67°F
EWT
GPM
clipped (see example
below). Otherwise, appropriate levels
of a
Sens/Tot
°F
HR
PSI beFTused in
TCsystems
SC withRatio
proper antifreeze solution should
leavingkW
water temperatures
of
42ºF 6.0
[5.6°C]13.7
or below and Operation
the JW3 jumper
18
20
Not Recommended
should be clipped. This is due to the potential of the refrigerant
9
1.7
4.0
82.7
54.8
0.66
95.6
temperature being as low as 32°F [0°C] with 40°F [4.4°C] LWT, 3.79
which may lead
nuisance
the activation
of the 3.54
3.1 cutout
7.3due to
83.4
55.3
0.66
95.5
30 to a 14
Low Temperature Protection. JW3 should never be clipped for
18
5.4systems
12.5 without
83.7 antifreeze.
55.5
0.66
3.43
95.4
standard range equipment
or
Example:
40
EER
HC
kW
HE
LAT
COP
42.7
4.00
29.1
86.5
3.13
21.8
47.7
4.19
33.4
88.4
3.33
23.6
49.9
4.28
35.3
89.2
3.41
24.4
51.1
4.33
36.3
89.7
3.46
9
1.6
3.8
80.6
54.9
0.68
4.16
94.8
19.4
55.5
4.50
40.1
91.4
3.61
14
3.0
6.8
82.0
55.5
0.68
3.89
95.3
21.1
58.2
4.60
42.5
92.4
3.70
95.4
21.9
59.6
4.66
43.7
93.0
3.75
93.3
17.1
63.4
4.80
47.0
94.4
3.87
94.4
18.7
66.6
4.91
49.8
95.7
3.97
94.9
19.5
68.3
4.98
51.3
96.3
4.02
At 50°F EWT (Entering
1.5 gpm/ton,
a
18 Water
5.1 Temperature)
11.7
82.5 and55.6
0.67
3.76
3 ton unit has a HE of 22,500 Btuh. To calculate LWT, rearrange
9 follows:
1.3
3.0
77.8
53.4
0.69
4.55
the formula for HE as
50
Heating - EAT 70°F
14
2.5
5.8
79.9
54.5
0.68
4.28
HE = TD x GPM x 500, where HE = Heat of Extraction (Btuh);
18
4.2 (EWT
9.7- LWT)
80.7
55.0 = 0.68
TD = temperature difference
and GPM
U.S. 4.14
Gallons per Minute.
9
1.2
2.8
74.3
51.4
0.69
4.96
91.2
15.0
71.3
5.09
54.0
97.5
4.11
TD = HE / (GPM
14
60 x 500)
2.4
5.5
76.7
52.8
0.69
4.68
92.7
16.4
75.0
5.22
57.2
98.9
4.21
TD = 22,500 / (4.5 x18500)
4.0
9.2
77.9
53.5
0.69
4.54
93.4
17.2
77.0
5.29
58.9
99.7
4.26
9
1.2
2.7
70.3
49.2
0.70
5.37
88.7
13.1
79.3
5.37
61.0
100.6
4.33
14
2.3
5.3
73.0
50.7
0.69
5.10
90.4
14.3
83.4
5.51
64.6
102.2
4.43
18
3.8
8.8
74.3
51.4
0.69
4.96
91.2
15.0
85.6
5.59
66.5
103.0
4.49
LWT = 50 - 10 = 40°F
9
1.1
2.6
66.2
47.2
0.71
5.78
85.9
11.5
87.2
5.64
67.9
103.6
4.53
TD = 10°F
70
LWT = EWT - TD
In this example,
flow
will be68.9
required
or below
without91.6
antifreeze.
2 gpm/ton,
calculation
14
2.2 rate5.1
48.5for EWTs
0.70 at5.52
87.750°F12.5
5.79 At71.9
105.4 the4.64
80 a higher
above results in a TD of 7.5. LWT = 50 - 7.5 = 42.5°F, which is above 42°F EWT, and is acceptable for this application.
85
90
100
110
18
3.7
8.5
70.3
49.2
0.70
5.38
88.6
13.1
94.0
5.87
74.0
106.3
4.70
9
1.1
2.6
64.2
46.3
0.72
5.98
84.6
10.7
91.1
5.77
71.4
105.1
4.62
14
2.2
5.0
66.8
47.5
0.71
5.72
86.3
11.7
95.7
5.92
75.5
106.9
4.74
18
3.6
8.4
68.2
48.1
0.71
5.59
87.2
12.2
98.2
6.00
77.7
107.9
4.80
9
1.1
2.5
62.2
45.5
0.73
6.18
83.3
10.1
94.9
5.89
74.8
106.6
4.72
14
2.1
4.9
64.7
46.5
0.72
5.93
84.9
10.9
99.7
6.04
79.0
108.4
4.83
18
3.6
8.2
66.0
47.1
0.71
5.80
85.8
11.4
102.2
6.12
81.3
109.4
4.89
9
1.1
2.5
58.5
44.5
0.76
6.56
80.9
8.9
14
2.1
4.8
60.7
45.0
0.74
6.33
82.3
9.6
18
3.4
7.9
61.9
45.4
0.73
6.21
83.1
10.0
9
1.0
2.4
55.4
44.3
0.80
6.91
79.0
8.0
14
2.0
4.6
57.2
44.3
0.77
6.70
80.1
8.5
18
3.3
7.6
58.2
44.4
0.76
6.59
80.7
8.8
Operation Not Recommended
Interpolation is permissible; extrapolation is not.
All entering air conditions are 80°F DB and 67°F WB in cooling, and 70°F DB in heating. AHRI/ISO certified conditions are 80.6°F DB and
66.2°F WB in cooling and 68°F DB in heating.
Table does not reflect fan or pump power corrections for AHRI/ISO conditions.
All performance is based upon the lower voltage of dual voltage rated units.
Operation below 40°F EWT is based upon a 15% antifreeze solution.
Operation below 60°F EWT requires optional insulated water/refrigerant circuit.
See performance correction tables for operating conditions other than those listed above.
See Performance Data Selection Notes for operation in shaded areas.
6
Submittal Data - Large HKV
Performance Data – HKV084
2800 CFM Nominal Airflow Heating & Cooling
Performance capacities shown in thousands of Btuh
WATER/BRINE
Cooling - EAT 80/67°F
EWT
°F
FLOW
gpm
PD
psi
PD ft.
20
21.00
10.0
23.1
10.50
2.4
5.5
81.7
57.1
3.8
94.7
15.75
5.5
12.6
77.1
53.5
3.5
21.00
9.2
21.3
74.5
51.5
10.50
2.1
4.9
86.4
15.75
5.0
11.4
21.00
8.4
10.50
30
40
50
60
70
80
85
90
100
110
120
TC
SC
kW
HR
Heating - EAT 70°F
EER
HC
kW
HE
LAT
COP
58.0
5.3
39.7
86.7
3.2
21.4
63.2
5.5
44.5
89.9
3.4
89.1
22.0
65.8
5.6
46.9
90.8
3.5
3.4
86.0
22.1
67.3
5.6
48.2
91.2
3.5
61.0
4.3
101.1
20.2
72.6
5.7
53.0
93.2
3.7
84.0
58.8
4.0
97.6
21.0
76.0
5.8
56.1
94.3
3.8
19.5
82.3
57.5
3.9
95.5
21.3
77.9
5.9
57.9
95.0
3.9
2.0
4.5
88.0
62.8
4.7
104.1
18.7
82.7
6.0
62.2
96.4
4.0
15.75
4.6
10.7
87.3
61.8
4.4
102.4
19.7
87.0
6.1
66.1
97.8
4.2
21.00
7.9
18.4
86.5
61.1
4.3
101.2
20.1
89.4
6.2
68.3
98.6
4.2
10.50
1.3
3.1
87.0
62.8
5.1
104.5
17.0
93.3
6.3
71.8
100.2
4.3
15.75
3.6
8.3
87.6
62.7
4.8
104.1
18.1
98.2
6.4
76.3
101.8
4.5
21.00
6.5
14.9
87.6
62.4
4.7
103.7
18.6
100.9
6.5
78.8
102.7
4.6
10.50
1.2
2.8
84.8
62.2
5.6
103.8
15.2
103.7
6.6
81.3
103.9
4.6
15.75
3.4
7.8
86.4
62.7
5.3
104.4
16.4
109.2
6.7
86.2
105.7
4.8
21.00
6.2
14.2
87.0
62.8
5.1
104.5
17.0
112.1
6.8
88.9
106.7
4.8
10.50
1.1
2.6
81.9
61.0
6.1
102.6
13.5
113.8
6.9
90.4
107.2
4.9
15.75
3.1
7.3
84.2
61.9
5.7
103.7
14.7
119.4
7.0
95.5
109.1
5.0
21.00
5.8
13.5
85.2
62.3
5.6
104.2
15.3
122.2
7.1
98.0
110.0
5.0
10.50
1.1
2.5
79.9
60.1
6.3
101.5
12.7
118.4
7.0
94.6
108.7
5.0
15.75
3.1
7.2
82.3
61.1
6.0
102.8
13.8
123.8
7.2
99.4
110.5
5.1
21.00
5.7
13.3
83.4
61.5
5.8
103.3
14.4
126.5
7.2
101.8
111.4
5.1
10.50
1.1
2.4
77.8
59.3
6.6
100.3
11.8
123.0
7.1
98.7
110.3
5.1
15.75
3.0
7.0
80.5
60.4
6.2
101.8
12.9
128.2
7.3
103.3
112.0
5.2
21.00
5.7
13.1
81.7
60.9
6.1
102.4
13.5
130.7
7.4
105.5
112.8
5.2
10.50
1.0
2.3
73.5
57.5
7.2
98.2
10.2
15.75
2.9
6.8
76.2
58.6
6.8
99.5
11.2
21.00
5.5
12.8
77.6
59.2
6.6
100.2
11.7
10.50
0.9
2.1
69.2
55.8
8.0
96.4
8.7
15.75
2.8
6.5
71.8
56.8
7.5
97.4
9.6
21.00
5.4
12.4
73.2
57.4
7.3
98.0
10.1
10.50
0.9
2.0
65.3
54.6
8.8
95.5
7.4
15.75
2.7
6.3
67.6
55.3
8.3
95.9
8.1
21.00
5.2
12.1
68.8
55.7
8.0
96.3
8.6
Operation not recommended
Operation not recommended
Interpolation is permissible; extrapolation is not.
All entering air conditions are 80°F DB and 67°F WB in cooling, and 70°F DB in heating.
AHRI/ISO certified conditions are 80.6°F DB and 66.2°F WB in cooling and 68°F DB in heating.
Table does not reflect fan or pump power corrections for AHRI/ISO conditions.
All performance is based upon the lower voltage of dual voltage rated units.
Performance stated is at the rated power supply; performance may vary as the power supply varies from the rated.
Operation below 40°F EWT is based upon a 15% methanol antifreeze solution.
Operation below 60°F EWT requires optional insulated water/refrigerant circuit.
See performance correction tables for operating conditions other than those listed above.
See Performance Data Selection Notes for operation in the shaded areas.
For additional pressure drop of unit options, see table on page 19.
7
Submittal Data - Large HKV
Performance Data – HKV096
3200 CFM Nominal Airflow Heating & Cooling
Performance capacities shown in thousands of Btuh
WATER/BRINE
Cooling - EAT 80/67°F
EWT
°F
FLOW
gpm
PD
psi
PD ft.
20
24.0
14.1
32.6
12.0
3.8
8.7
89.1
62.2
3.9
102.5
18.0
8.0
18.6
79.1
54.9
3.2
24.0
13.0
29.9
73.7
51.1
12.0
3.4
7.8
99.8
18.0
7.2
16.7
24.0
11.8
12.0
30
40
50
60
70
80
85
90
100
110
120
TC
SC
kW
HR
Heating - EAT 70°F
EER
HC
kW
HE
LAT
COP
64.6
6.2
43.3
88.3
3.0
22.8
71.0
6.4
49.2
90.2
3.3
90.0
24.7
74.1
6.5
52.0
91.1
3.4
2.9
83.5
25.8
75.8
6.5
53.5
91.5
3.4
69.8
4.9
116.4
20.5
82.0
6.7
59.1
93.3
3.6
94.6
66.1
4.3
109.4
21.8
85.9
6.8
62.7
94.5
3.7
27.2
91.2
63.6
4.1
105.1
22.5
88.1
6.9
64.7
95.1
3.8
3.1
7.2
103.1
72.3
5.5
121.8
18.8
93.7
7.0
69.6
96.7
3.9
18.0
6.8
15.6
101.6
71.1
5.1
119.0
19.9
98.5
7.2
74.0
98.1
4.0
24.0
11.2
25.9
100.1
70.0
4.9
116.8
20.5
101.1
7.2
76.5
98.8
4.1
12.0
2.4
5.6
102.2
72.0
6.0
122.6
17.1
105.9
7.4
80.6
100.4
4.2
18.0
5.6
12.9
103.2
72.5
5.7
122.5
18.3
111.6
7.5
85.8
102.0
4.3
24.0
9.6
22.2
103.2
72.3
5.5
121.9
18.8
114.7
7.6
88.7
103.0
4.4
12.0
2.3
5.2
98.7
70.1
6.4
120.6
15.4
118.2
7.7
91.8
104.1
4.5
18.0
5.3
12.2
101.2
71.5
6.1
122.1
16.6
124.7
7.9
97.7
106.0
4.6
24.0
9.2
21.2
102.2
72.0
6.0
122.5
17.1
128.3
8.0
100.9
107.0
4.7
12.0
2.1
4.8
93.7
67.6
6.9
117.1
13.6
130.4
8.1
102.8
107.6
4.7
18.0
5.0
11.5
97.0
69.3
6.6
119.4
14.8
137.5
8.3
109.2
109.7
4.9
24.0
8.7
20.2
98.5
70.1
6.4
120.4
15.4
141.3
8.4
112.7
110.8
4.9
12.0
2.1
4.8
90.9
66.3
7.1
115.3
12.8
136.3
8.3
108.1
109.4
4.8
18.0
4.9
11.3
94.3
67.9
6.8
117.5
13.9
143.6
8.5
114.7
111.5
5.0
24.0
8.6
20.0
95.9
68.8
6.6
118.6
14.5
147.5
8.6
118.2
112.7
5.0
12.0
2.0
4.7
88.1
65.0
7.4
113.5
11.9
142.2
8.4
113.5
111.1
4.9
18.0
4.8
11.2
91.5
66.6
7.1
115.6
13.0
149.8
8.7
120.2
113.3
5.1
24.0
8.6
19.8
93.3
67.5
6.9
116.8
13.6
153.8
8.8
123.7
114.5
5.1
12.0
1.9
4.5
83.2
63.2
8.1
110.9
10.2
18.0
4.7
10.9
86.2
64.2
7.7
112.4
11.2
24.0
8.4
19.4
87.9
64.9
7.5
113.3
11.8
12.0
1.9
4.3
79.5
62.7
9.1
110.5
8.8
18.0
4.6
10.5
81.6
62.8
8.5
110.5
9.6
24.0
8.2
18.9
82.9
63.1
8.2
110.9
10.1
12.0
1.8
4.1
78.3
65.0
10.4
113.8
7.5
18.0
4.4
10.2
78.7
63.2
9.5
111.2
8.3
24.0
8.0
18.5
79.3
62.8
9.2
110.6
8.7
Operation not recommended
Operation not recommended
Interpolation is permissible; extrapolation is not.
All entering air conditions are 80°F DB and 67°F WB in cooling, and 70°F DB in heating.
AHRI/ISO certified conditions are 80.6°F DB and 66.2°F WB in cooling and 68°F DB in heating.
Table does not reflect fan or pump power corrections for AHRI/ISO conditions.
All performance is based upon the lower voltage of dual voltage rated units.
Performance stated is at the rated power supply; performance may vary as the power supply varies from the rated.
Operation below 40°F EWT is based upon a 15% methanol antifreeze solution.
Operation below 60°F EWT requires optional insulated water/refrigerant circuit.
See performance correction tables for operating conditions other than those listed above.
See Performance Data Selection Notes for operation in the shaded areas.
For additional pressure drop of unit options, see table on page 19.
8
Submittal Data - Large HKV
Performance Data – HKV120
4000 CFM Nominal Airflow Heating & Cooling
Performance capacities shown in thousands of Btuh
WATER/BRINE
Cooling - EAT 80/67°F
EWT
°F
FLOW
gpm
PD
psi
PD ft.
20
30.00
10.2
23.5
15.00
2.1
4.8
142.3
97.1
6.3
163.6
22.50
5.3
12.2
144.2
97.0
6.0
30.00
9.4
21.6
144.9
96.7
15.00
1.9
4.3
138.6
22.50
4.8
11.1
30.00
8.6
15.00
30
40
50
60
70
80
85
90
100
110
120
TC
SC
kW
HR
Heating - EAT 70°F
EER
HC
kW
HE
LAT
COP
82.040
7.73
55.660
88.6
3.1
22.8
88.8
7.9
61.9
90.2
3.3
164.7
24.1
92.1
7.9
65.0
90.9
3.4
5.9
164.9
24.7
93.9
8.0
66.7
91.4
3.4
96.0
6.6
161.3
20.8
100.9
8.1
73.1
93.0
3.6
141.5
96.9
6.3
163.2
22.3
105.4
8.2
77.3
94.0
3.7
19.8
142.7
97.1
6.2
163.9
23.0
107.8
8.3
79.5
94.6
3.8
1.7
4.0
133.9
94.0
7.1
158.1
18.8
114.4
8.5
85.6
96.0
4.0
22.50
4.4
10.1
137.5
95.6
6.8
160.6
20.3
120.0
8.6
90.8
97.3
4.1
30.00
8.1
18.8
139.1
96.2
6.6
161.7
21.0
123.1
8.6
93.7
98.1
4.2
15.00
1.3
3.0
128.4
91.4
7.6
154.4
16.8
129.7
8.8
99.7
99.6
4.3
22.50
3.7
8.6
132.4
93.3
7.3
157.1
18.2
136.4
8.9
106.0
101.1
4.5
30.00
7.0
16.2
134.3
94.2
7.1
158.5
19.0
140.2
9.0
109.5
102.0
4.6
15.00
1.2
2.7
122.1
88.2
8.2
150.2
14.8
145.5
9.1
114.4
103.2
4.7
22.50
3.5
8.1
126.4
90.3
7.8
153.1
16.2
153.4
9.3
121.7
105.0
4.8
30.00
6.7
15.4
128.5
91.3
7.6
154.5
16.9
157.7
9.4
125.7
106.0
4.9
15.00
1.1
2.4
115.4
85.0
9.0
145.9
12.9
160.5
9.4
128.2
106.6
5.0
22.50
3.3
7.6
119.6
87.0
8.5
148.5
14.1
169.1
9.6
136.2
108.6
5.1
30.00
6.4
14.7
121.8
88.1
8.2
149.9
14.8
173.8
9.8
140.5
109.7
5.2
15.00
1.1
2.4
111.9
83.5
9.4
143.8
12.0
169.9
9.7
136.8
109.0
5.1
22.50
3.2
7.4
116.2
85.5
8.9
146.4
13.2
174.6
9.5
142.0
110.6
5.4
30.00
6.3
14.4
118.3
86.5
8.6
147.7
13.8
177.2
9.5
144.8
111.4
5.5
15.00
1.0
2.3
108.5
81.9
9.8
141.7
11.1
179.4
10.0
145.3
111.4
5.3
22.50
3.2
7.4
112.7
83.9
9.2
144.2
12.2
180.0
9.4
147.8
112.5
5.6
30.00
6.2
14.3
114.9
84.9
9.0
145.5
12.8
180.5
9.2
149.1
113.1
5.8
15.00
0.9
2.2
102.1
79.3
10.7
138.5
9.6
22.50
3.1
7.2
106.1
80.9
10.1
140.5
10.5
30.00
6.0
13.9
108.2
81.8
9.8
141.6
11.0
15.00
0.9
2.0
96.1
77.2
11.7
136.1
8.2
22.50
3.0
6.9
99.7
78.4
11.1
137.5
9.0
30.00
5.8
13.4
101.7
79.1
10.8
138.4
9.5
15.00
0.8
1.9
90.6
76.0
12.9
134.7
7.0
22.50
2.9
6.7
93.8
76.6
12.2
135.4
7.7
30.00
5.6
13.0
95.5
77.0
11.8
135.9
8.1
Operation not recommended
Operation not recommended
Interpolation is permissible; extrapolation is not.
All entering air conditions are 80°F DB and 67°F WB in cooling, and 70°F DB in heating.
AHRI/ISO certified conditions are 80.6°F DB and 66.2°F WB in cooling and 68°F DB in heating.
Table does not reflect fan or pump power corrections for AHRI/ISO conditions.
All performance is based upon the lower voltage of dual voltage rated units.
Performance stated is at the rated power supply; performance may vary as the power supply varies from the rated.
Operation below 40°F EWT is based upon a 15% methanol antifreeze solution.
Operation below 60°F EWT requires optional insulated water/refrigerant circuit.
See performance correction tables for operating conditions other than those listed above.
See Performance Data Selection Notes for operation in the shaded areas.
For additional pressure drop of unit options, see table on page 19.
9
Submittal Data - Large HKV
Performance Data – HKV150
5000 CFM Nominal Airflow Heating & Cooling
Performance capacities shown in thousands of Btuh
WATER/BRINE
Cooling - EAT 80/67°F
EWT
°F
FLOW
gpm
PD
psi
PD ft.
20
38.0
12.0
27.6
19.0
2.7
6.3
175.0
131.8
8.3
203.4
28.0
6.2
14.3
173.8
138.0
7.9
38.0
11.0
25.4
172.3
141.6
19.0
2.3
5.4
173.5
28.0
5.6
12.8
38.0
10.0
19.0
30
40
50
60
70
80
85
90
100
110
120
TC
SC
kW
HR
Heating - EAT 70°F
EER
HC
kW
HE
LAT
COP
105.5
10.3
70.5
89.0
3.0
21.0
115.1
10.5
79.1
90.7
3.2
200.8
21.9
119.5
10.7
83.1
91.5
3.3
7.7
198.6
22.4
122.2
10.7
85.5
92.0
3.3
123.9
8.9
204.0
19.4
131.5
11.0
94.0
93.7
3.5
174.8
129.0
8.5
203.9
20.6
137.2
11.1
99.2
94.8
3.6
23.2
174.9
132.2
8.3
203.1
21.1
140.7
11.2
102.5
95.4
3.7
2.1
4.9
169.2
117.6
9.5
201.8
17.8
149.0
11.4
110.1
96.9
3.8
28.0
5.2
12.0
172.4
121.6
9.1
203.4
19.0
156.0
11.5
116.6
98.2
4.0
38.0
9.5
21.9
173.6
124.2
8.9
203.9
19.6
160.3
11.6
120.6
99.0
4.0
19.0
1.7
3.8
163.0
112.7
10.2
197.7
16.0
167.9
11.8
127.5
100.5
4.2
28.0
4.3
9.9
167.3
115.8
9.7
200.5
17.2
176.1
12.0
135.1
102.0
4.3
38.0
8.0
18.5
169.5
117.8
9.5
201.8
17.9
181.1
12.1
139.7
103.0
4.4
19.0
1.5
3.5
155.5
108.5
11.0
192.9
14.2
187.1
12.3
145.1
104.2
4.5
28.0
4.1
9.4
160.6
111.0
10.4
196.2
15.4
196.3
12.5
153.6
105.9
4.6
38.0
7.7
17.8
163.3
112.6
10.2
198.0
16.1
201.9
12.7
158.7
106.9
4.7
19.0
1.4
3.2
147.2
104.9
11.8
187.6
12.4
205.2
12.7
161.7
107.5
4.7
28.0
3.8
8.8
152.6
107.1
11.3
191.0
13.5
215.0
13.0
170.6
109.4
4.8
38.0
7.4
17.0
155.6
108.4
11.0
193.0
14.2
220.8
13.2
175.8
110.4
4.9
19.0
1.4
3.1
142.9
103.2
12.4
185.0
11.6
213.8
13.0
169.5
109.1
4.8
28.0
3.8
8.7
148.2
105.3
11.8
188.3
12.7
223.7
13.3
178.3
111.0
4.9
38.0
7.3
16.7
151.3
106.5
11.4
190.2
13.3
229.3
13.5
183.3
112.0
5.0
19.0
1.3
3.0
138.6
101.6
12.9
182.4
10.8
222.4
13.2
177.3
110.7
4.9
28.0
3.7
8.5
143.9
103.5
12.2
185.6
11.8
232.3
13.6
186.0
112.5
5.0
38.0
7.2
16.6
146.9
104.7
11.9
187.5
12.4
237.9
13.8
190.9
113.6
5.1
19.0
1.2
2.9
130.3
98.4
14.0
178.1
9.3
28.0
3.6
8.2
135.2
100.3
13.3
180.6
10.2
38.0
7.0
16.1
138.1
101.4
12.9
182.2
10.7
19.0
1.2
2.7
123.0
95.5
15.4
175.4
8.0
28.0
3.4
7.9
127.2
97.2
14.5
176.8
8.7
38.0
6.8
15.6
129.8
98.2
14.1
177.9
9.2
19.0
1.1
2.5
117.3
93.0
17.0
175.2
6.9
28.0
3.3
7.7
120.4
94.4
16.0
175.0
7.5
38.0
6.5
15.1
122.4
95.3
15.5
175.3
7.9
Operation not recommended
Operation not recommended
Interpolation is permissible; extrapolation is not.
All entering air conditions are 80°F DB and 67°F WB in cooling, and 70°F DB in heating.
AHRI/ISO certified conditions are 80.6°F DB and 66.2°F WB in cooling and 68°F DB in heating.
Table does not reflect fan or pump power corrections for AHRI/ISO conditions.
All performance is based upon the lower voltage of dual voltage rated units.
Performance stated is at the rated power supply; performance may vary as the power supply varies from the rated.
Operation below 40°F EWT is based upon a 15% methanol antifreeze solution.
Operation below 60°F EWT requires optional insulated water/refrigerant circuit.
See performance correction tables for operating conditions other than those listed above.
See Performance Data Selection Notes for operation in the shaded areas.
For additional pressure drop of unit options, see table on page 19.
10
Submittal Data - Large HKV
Performance Data – HKV168
5600 CFM Nominal (Rated) Airflow
Performance capacities shown in thousands of Btuh
WATER/BRINE
Cooling - EAT 80/67°F
EWT
°F
FLOW
gpm
PD
psi
PD ft.
20
42.0
11.3
26.0
21.0
2.7
6.2
163.5
114.1
7.6
189.5
31.5
6.1
14.2
154.3
107.0
7.0
42.0
10.4
24.0
149.0
103.1
21.0
2.4
5.5
172.9
31.5
5.6
12.9
42.0
9.5
21.0
30
40
50
60
70
80
85
90
100
110
120
TC
SC
kW
HR
Heating - EAT 70°F
EER
HC
kW
HE
LAT
COP
116.0
10.7
79.5
86.7
3.2
21.3
126.5
11.0
89.1
88.4
3.4
178.2
21.9
131.7
11.1
93.7
89.2
3.4
6.7
172.0
22.0
134.5
11.2
96.4
89.6
3.5
122.0
8.6
202.1
20.1
145.2
11.5
106.0
91.3
3.7
167.9
117.7
8.0
195.2
20.9
152.0
11.7
112.3
92.4
3.8
21.9
164.6
115.0
7.7
191.0
21.2
155.9
11.8
115.8
93.1
3.9
2.2
5.1
176.0
125.6
9.4
208.1
18.6
165.5
12.0
124.5
94.6
4.0
31.5
5.2
12.0
174.5
123.6
8.9
204.8
19.6
174.0
12.2
132.3
96.0
4.1
42.0
8.9
20.6
173.0
122.1
8.6
202.4
20.0
178.7
12.4
136.6
96.7
4.2
21.0
1.5
3.5
173.9
125.5
10.3
208.9
16.9
186.5
12.6
143.6
98.0
4.3
31.5
4.0
9.3
175.2
125.3
9.7
208.3
18.0
196.5
12.8
152.7
99.6
4.5
42.0
7.3
16.8
175.2
124.8
9.4
207.4
18.6
201.9
13.0
157.6
100.4
4.5
21.0
1.4
3.2
169.6
124.3
11.2
207.6
15.2
207.5
13.2
162.6
101.3
4.6
31.5
3.8
8.7
172.8
125.3
10.6
208.8
16.3
218.4
13.5
172.5
103.1
4.8
42.0
6.9
16.0
174.0
125.6
10.3
209.0
16.9
224.2
13.6
177.7
104.0
4.8
21.0
1.3
2.9
163.8
122.0
12.1
205.1
13.4
227.6
13.7
180.9
104.6
4.9
31.5
3.5
8.2
168.3
123.8
11.5
207.5
14.6
238.8
14.0
190.9
106.4
5.0
42.0
6.6
15.2
170.4
124.6
11.2
208.5
15.2
244.6
14.2
196.0
107.3
5.0
21.0
1.3
2.8
159.7
120.2
12.7
202.9
12.6
236.8
14.0
189.1
106.1
5.0
31.5
3.5
8.0
164.6
122.3
12.0
205.5
13.7
247.6
14.3
198.8
107.8
5.1
42.0
6.5
15.0
166.9
123.2
11.7
206.7
14.3
252.9
14.5
203.5
108.64
5.1
21.0
1.2
2.7
155.6
118.5
13.2
200.7
11.7
246.0
14.3
197.4
107.5
5.1
31.5
3.4
7.9
160.9
120.7
12.5
203.5
12.8
256.4
14.6
206.7
109.2
5.1
42.0
6.4
14.8
163.4
121.8
12.1
204.9
13.4
261.4
14.8
211.1
110.0
5.2
21.0
1.1
2.6
147.0
114.9
14.5
196.3
10.1
31.5
3.3
7.6
152.5
117.2
13.7
199.1
11.1
42.0
6.2
14.4
155.2
118.3
13.3
200.5
11.6
21.0
1.0
2.4
138.4
111.6
15.9
192.8
8.6
31.5
3.2
7.3
143.7
113.6
15.0
194.9
9.5
42.0
6.1
14.0
146.4
114.7
14.6
196.1
10.0
21.0
1.0
2.2
130.6
109.2
17.7
191.0
7.3
31.5
3.0
7.0
135.2
110.5
16.6
191.8
8.1
42.0
5.9
13.6
137.7
111.4
16.1
192.6
8.5
Operation not recommended
Interpolation is permissible; extrapolation is not.
All entering air conditions are 80°F DB and 67°F WB in cooling, and 70°F DB in heating.
AHRI/ISO certified conditions are 80.6°F DB and 66.2°F WB in cooling and 68°F DB in heating.
Table does not reflect fan or pump power corrections for AHRI/ISO conditions.
All performance is based upon the lower voltage of dual voltage rated units.
Performance stated is at the rated power supply; performance may vary as the power supply varies from the rated.
Operation below 40°F EWT is based upon a 15% methanol antifreeze solution.
Operation below 60°F EWT requires optional insulated water/refrigerant circuit.
See performance correction tables for operating conditions other than those listed above.
See Performance Data Selection Notes for operation in the shaded areas.
For additional pressure drop of unit options, see table on page 19.
11
Operation not recommended
Submittal Data - Large HKV
Performance Data – HKV192
6400 CFM Nominal Airflow Heating & Cooling
Performance capacities shown in thousands of Btuh
WATER/BRINE
Cooling - EAT 80/67°F
EWT
°F
FLOW
gpm
PD
psi
PD ft.
20
48.0
15.9
36.7
24.0
4.2
9.8
178.3
124.3
7.8
205.0
36.0
9.0
20.9
158.1
109.8
6.4
48.0
14.6
33.7
147.4
102.1
5.7
30
40
50
60
70
80
85
90
100
110
120
TC
SC
kW
HR
Heating - EAT 70°F
EER
HC
kW
HE
LAT
COP
129.2
12.5
86.6
86.4
3.0
22.8
142.1
12.8
98.5
88.3
3.2
180.0
24.7
148.2
13.0
104.0
89.1
3.3
166.9
25.8
151.5
13.0
107.0
89.6
3.4
Operation not recommended
24.0
3.8
8.7
199.6
139.6
9.7
232.7
20.5
164.0
13.4
118.3
91.4
3.6
36.0
8.1
18.8
189.3
132.1
8.7
218.9
21.8
171.9
13.6
125.4
92.5
3.7
48.0
13.3
30.6
182.5
127.2
8.1
210.2
22.5
176.2
13.7
129.3
93.1
3.7
24.0
3.5
8.1
206.1
144.7
11.0
243.6
18.7
187.3
14.1
139.3
94.7
3.9
36.0
7.6
17.6
203.2
142.3
10.2
238.0
19.9
196.9
14.3
148.1
96.1
4.0
48.0
12.6
29.1
200.2
140.0
9.8
233.5
20.4
202.3
14.5
152.9
96.8
4.1
24.0
2.7
6.3
204.4
144.1
11.9
245.1
17.0
211.7
14.8
161.3
98.1
4.2
36.0
6.3
14.5
206.5
144.9
11.3
245.0
18.2
223.1
15.1
171.7
99.7
4.4
48.0
10.8
24.9
206.4
144.7
11.0
243.8
18.7
229.4
15.2
177.4
100.6
4.4
24.0
2.6
5.9
197.4
140.3
12.8
241.1
15.3
236.5
15.5
183.6
101.6
4.5
36.0
6.0
13.8
202.5
143.0
12.2
244.2
16.4
249.5
15.8
195.4
103.4
4.6
48.0
10.3
23.8
204.4
143.9
11.9
245.1
17.0
256.6
16.0
201.8
104.4
4.7
24.0
2.4
5.5
187.4
135.1
13.7
234.3
13.6
260.7
16.2
205.6
105.0
4.8
36.0
5.6
13.0
194.0
138.5
13.1
238.7
14.7
275.0
16.6
218.4
107.0
4.9
48.0
9.8
22.7
197.0
140.1
12.8
240.8
15.3
282.7
16.8
225.3
108.1
5.0
24.0
2.4
5.4
181.8
132.6
14.3
230.6
12.7
272.6
16.5
216.2
106.7
4.9
36.0
5.6
12.8
188.5
135.9
13.6
235.0
13.8
287.2
17.0
229.4
108.8
5.0
48.0
9.7
22.4
191.8
137.5
13.3
237.2
14.4
295.1
17.2
236.4
109.9
5.1
24.0
2.3
5.3
176.3
130.1
14.8
226.9
11.8
284.4
16.9
226.9
108.4
5.0
36.0
5.5
12.6
183.1
133.3
14.1
231.2
12.9
299.5
17.3
240.3
110.5
5.1
48.0
9.6
22.3
186.6
135.0
13.8
233.5
13.5
307.5
17.6
247.4
111.6
5.2
24.0
2.2
5.1
166.4
126.3
16.3
221.9
10.2
36.0
5.3
12.2
172.4
128.5
15.3
224.8
11.2
48.0
9.4
21.8
175.8
129.9
14.9
226.7
11.7
24.0
2.1
4.9
159.0
125.4
18.1
220.9
8.7
36.0
5.1
11.9
163.2
125.6
16.9
220.9
9.6
48.0
9.2
21.3
165.8
126.2
16.4
221.7
10.1
24.0
2.0
4.7
156.6
130.1
20.8
227.6
7.5
36.0
5.0
11.5
157.4
126.4
19.1
222.4
8.2
48.0
9.0
20.8
158.7
125.6
18.3
221.3
8.6
Interpolation is permissible; extrapolation is not.
All entering air conditions are 80°F DB and 67°F WB in cooling, and 70°F DB in heating.
AHRI/ISO certified conditions are 80.6°F DB and 66.2°F WB in cooling and 68°F DB in heating.
Table does not reflect fan or pump power corrections for AHRI/ISO conditions.
All performance is based upon the lower voltage of dual voltage rated units.
Performance stated is at the rated power supply; performance may vary as the power supply varies from the rated.
Operation below 40°F EWT is based upon a 15% methanol antifreeze solution.
Operation below 60°F EWT requires optional insulated water/refrigerant circuit.
See performance correction tables for operating conditions other than those listed above.
See Performance Data Selection Notes for operation in the shaded areas.
For additional pressure drop of unit options, see table on page 19.
12
Operation not recommended
Submittal Data - Large HKV
Performance Data – HKV240
Performance capacities shown in thousands of Btuh
8000 CFM Nominal Airflow Heating & Cooling
WATER/BRINE
Cooling - EAT 80/67°F
Heating - EAT 70°F
EWT
°F
FLOW
gpm
PD
psi
PD ft.
20
60.0
11.4
26.4
30.0
2.4
5.4
284.5
194.1
12.5
327.2
22.8
45.0
5.9
13.7
288.5
194.0
12.0
329.4
60.0
10.5
24.3
289.9
193.3
11.7
30.0
2.1
4.9
277.2
192.1
45.0
5.4
12.5
283.0
60.0
9.7
22.3
30.0
1.9
45.0
30
40
50
60
70
80
85
90
100
110
120
TC
SC
kW
HR
EER
HC
kW
HE
LAT
COP
164.1
15.5
111.3
86.7
3.1
177.5
15.7
123.8
88.3
3.3
24.1
184.1
15.9
129.9
89.0
3.4
329.9
24.7
187.8
16.0
133.3
89.4
3.4
13.3
322.6
20.8
201.9
16.3
146.3
91.0
3.6
193.8
12.7
326.4
22.3
210.7
16.5
154.5
92.1
3.7
285.5
194.2
12.4
327.9
23.0
215.6
16.6
159.1
92.6
3.8
4.5
267.8
188.1
14.2
316.3
18.8
228.9
16.9
171.2
94.1
4.0
4.9
11.4
274.9
191.1
13.5
321.1
20.2
240.0
17.1
181.6
95.4
4.1
60.0
9.2
21.1
278.2
192.3
13.2
323.3
21.0
246.2
17.3
187.4
96.1
4.2
30.0
1.4
3.3
256.7
182.8
15.3
308.8
16.7
259.3
17.6
199.4
97.3
4.3
45.0
4.2
9.7
264.8
186.6
14.5
314.3
18.1
272.8
17.8
212.0
98.9
4.5
60.0
7.9
18.2
268.6
188.3
14.2
316.9
18.9
280.3
18.0
219.0
99.7
4.6
30.0
1.3
3.0
244.2
176.4
16.5
300.5
14.7
291.1
18.3
228.8
100.7
4.7
45.0
3.9
9.1
252.7
180.6
15.6
306.1
16.0
306.8
18.6
243.4
102.4
4.8
60.0
7.5
17.4
256.9
182.7
15.2
308.9
16.7
315.4
18.8
251.3
103.4
4.9
30.0
1.2
2.7
230.7
169.9
17.9
291.8
12.8
320.9
18.9
256.5
104.0
5.0
45.0
3.7
8.6
239.3
174.1
17.0
297.1
14.0
338.3
19.3
272.5
106.0
5.1
60.0
7.2
16.5
243.5
176.2
16.5
299.8
14.7
347.7
19.5
281.0
107.0
5.2
30.0
1.2
2.7
223.8
166.9
18.7
287.7
11.9
339.9
19.4
273.6
105.7
5.1
45.0
3.7
8.5
232.3
170.9
17.7
292.7
13.1
349.2
19.1
284.0
107.7
5.2
60.0
7.0
16.3
236.6
173.0
17.2
295.4
13.7
354.3
19.0
289.7
108.7
5.3
Operation not recommended
30.0
1.1
2.6
216.9
163.9
19.5
283.5
11.1
358.8
20.0
290.7
107.3
5.2
45.0
3.6
8.3
225.4
167.7
18.5
288.3
12.2
360.1
18.9
295.6
109.4
5.4
60.0
7.0
16.1
229.7
169.8
17.9
291.0
12.7
361.0
18.4
298.3
110.4
5.4
30.0
1.1
2.4
204.2
158.6
21.3
277.0
9.5
45.0
3.5
8.1
212.2
161.8
20.2
281.0
10.5
60.0
6.7
15.6
216.3
163.6
19.6
283.3
11.0
30.0
1.0
2.3
192.2
154.4
23.4
272.2
8.1
45.0
3.4
7.8
199.5
156.8
22.1
275.0
9.0
60.0
6.5
15.1
203.3
158.3
21.5
276.7
9.4
30.0
0.9
2.2
181.2
151.9
25.8
269.4
7.0
45.0
3.3
7.6
187.6
153.2
24.4
270.8
7.6
60.0
6.3
14.6
191.0
154.1
23.7
271.8
8.0
Interpolation is permissible; extrapolation is not.
All entering air conditions are 80°F DB and 67°F WB in cooling, and 70°F DB in heating.
AHRI/ISO certified conditions are 80.6°F DB and 66.2°F WB in cooling and 68°F DB in heating.
Table does not reflect fan or pump power corrections for AHRI/ISO conditions.
All performance is based upon the lower voltage of dual voltage rated units.
Performance stated is at the rated power supply; performance may vary as the power supply varies from the rated.
Operation below 40°F EWT is based upon a 15% methanol antifreeze solution.
Operation below 60°F EWT requires optional insulated water/refrigerant circuit.
See performance correction tables for operating conditions other than those listed above.
See Performance Data Selection Notes for operation in the shaded areas.
For additional pressure drop of unit options, see table on page 19.
13
Operation not recommended
Submittal Data - Large HKV
Performance Data – HKV300
10000 CFM Nominal (Rated) Airflow
Performance capacities shown in thousands of Btuh
WATER/BRINE
Cooling - EAT 80/67°F
EWT
°F
FLOW
gpm
PD
psi
PD ft.
20
76.0
13.5
31.2
38.0
3.1
7.1
350.0
263.5
16.7
406.9
56.0
7.0
16.1
347.6
276.0
15.9
76.0
12.4
28.7
344.6
283.3
38.0
2.6
6.1
347.1
56.0
6.3
14.5
76.0
11.3
38.0
30
40
50
60
70
80
85
90
100
110
120
TC
SC
kW
HR
Heating - EAT 70°F
EER
HC
kW
HE
LAT
COP
211.0
20.5
141.0
87.1
3.0
21.0
230.1
21.1
158.2
88.9
3.2
401.7
22.0
238.9
21.3
166.1
89.7
3.3
15.4
397.1
22.4
244.3
21.5
171.0
90.1
3.3
247.7
17.8
408.0
19.4
262.9
22.0
188.0
91.8
3.5
349.7
258.0
17.0
407.7
20.5
274.3
22.2
198.5
92.9
3.6
26.2
349.8
264.4
16.6
406.2
21.1
281.3
22.4
204.9
93.5
3.7
2.4
5.6
338.5
235.2
19.1
403.5
17.7
298.0
22.8
220.3
95.0
3.8
56.0
5.9
13.6
344.8
243.3
18.2
406.8
18.9
312.0
23.1
233.2
96.3
4.0
76.0
10.7
24.7
347.3
248.4
17.7
407.7
19.5
320.6
23.3
241.2
97.1
4.0
38.0
1.9
4.3
325.9
225.3
20.4
395.4
15.9
335.8
23.7
255.0
98.3
4.2
56.0
4.8
11.2
334.7
231.6
19.4
401.0
17.1
352.3
24.0
270.3
99.8
4.3
76.0
9.1
20.9
338.9
235.6
18.9
403.5
17.8
362.3
24.3
279.5
100.7
4.4
38.0
1.7
4.0
311.0
217.0
21.9
385.7
14.1
374.2
24.6
290.2
101.7
4.5
56.0
4.6
10.6
321.2
222.1
20.9
392.5
15.3
392.7
25.0
307.2
103.3
4.6
76.0
8.7
20.1
326.6
225.2
20.3
396.0
15.9
403.7
25.3
317.3
104.3
4.7
38.0
1.6
3.6
294.4
209.7
23.7
375.1
12.4
410.4
25.5
323.4
104.9
4.7
56.0
4.3
9.9
305.2
214.1
22.5
382.1
13.5
430.1
26.0
341.3
106.7
4.8
76.0
8.3
19.2
311.2
216.7
21.9
386.0
14.1
441.6
26.4
351.6
107.7
4.9
Operation not recommended
38.0
1.6
3.5
285.8
206.4
24.7
370.0
11.5
427.6
26.0
339.0
106.5
4.8
56.0
4.3
9.8
296.5
210.6
23.5
376.6
12.6
447.4
26.6
356.7
108.2
4.9
76.0
8.2
18.9
302.5
213.1
22.9
380.5
13.2
458.7
27.0
366.7
109.3
5.0
38.0
1.5
3.4
277.1
203.1
25.7
364.9
10.7
444.9
26.5
354.6
108.0
4.9
56.0
4.2
9.6
287.8
207.1
24.4
371.2
11.7
464.7
27.1
372.1
109.8
5.0
76.0
8.1
18.7
293.9
209.4
23.8
375.0
12.3
475.8
27.6
381.7
110.8
5.1
38.0
1.4
3.2
260.7
196.9
28.0
356.3
9.3
56.0
4.0
9.3
270.5
200.6
26.6
361.2
10.1
76.0
7.9
18.1
276.3
202.8
25.8
364.4
10.7
38.0
1.3
3.0
246.0
191.0
30.7
350.9
8.0
56.0
3.9
9.0
254.4
194.5
29.1
353.6
8.7
76.0
7.6
17.6
259.5
196.5
28.2
355.8
9.2
38.0
1.2
2.9
234.6
186.0
33.9
350.4
6.9
56.0
3.7
8.6
240.8
188.8
32.0
349.9
7.5
76.0
7.4
17.1
244.9
190.6
31.0
350.6
7.9
Interpolation is permissible; extrapolation is not.
All entering air conditions are 80°F DB and 67°F WB in cooling, and 70°F DB in heating.
AHRI/ISO certified conditions are 80.6°F DB and 66.2°F WB in cooling and 68°F DB in heating.
Table does not reflect fan or pump power corrections for AHRI/ISO conditions.
All performance is based upon the lower voltage of dual voltage rated units.
Performance stated is at the rated power supply; performance may vary as the power supply varies from the rated.
Operation below 40°F EWT is based upon a 15% methanol antifreeze solution.
Operation below 60°F EWT requires optional insulated water/refrigerant circuit.
See performance correction tables for operating conditions other than those listed above.
See Performance Data Selection Notes for operation in the shaded areas.
For additional pressure drop of unit options, see table on page 19.
14
Operation not recommended
Submittal Data - Large HKV
HK Performance Data Correction Tables
Air Flow Correction Table
Cooling
Percentage of
Rated Airflow
Heating
Total
Capacity
Sensible
Capacity
Power
Heat of
Rejection
Heating
Capacity
Power
Heat of
Extraction
75%
0.957
0.868
0.944
0.954
0.960
1.045
0.938
81%
0.970
0.901
0.957
0.967
0.971
1.027
0.956
88%
0.982
0.940
0.971
0.980
0.983
1.015
0.974
94%
0.991
0.970
0.985
0.990
0.991
1.007
0.987
100%
1.000
1.000
1.000
1.000
1.000
1.000
1.000
106%
1.002
1.025
1.013
1.004
1.006
0.999
1.009
113%
1.004
1.050
1.026
1.009
1.013
0.998
1.019
119%
1.008
1.073
1.042
1.015
1.021
0.997
1.028
125%
1.013
1.095
1.058
1.022
1.029
0.996
1.038
Entering Air Correction Table
Entering
Air DB°F
Heating
Capacity
Power
Heat of
Extraction
50
1.034
0.843
1.087
55
1.027
0.877
60
1.022
65
Sensible Cooling Capacity Multiplier Entering DB °F
Entering
Air WB°F
Total
Capacity
Power
Heat of
Rejection
65
70
75
80
80.6
85
90
95
1.068
55.0
0.953
0.909
*
*
*
*
*
*
0.916
1.051
*
0.988
0.960
60.0
0.954
0.760
0.810
1.076
1.209
1.233
*
1.010
0.957
1.025
65.0
0.975
0.644
0.872
1.089
1.115
1.238
*
*
0.991
0.962
*
*
0.995
68
1.004
0.982
1.010
66.2
0.988
0.594
0.818
1.036
1.064
1.198
0.979
*
*
0.998
70
1.000
1.000
1.000
0.990
67.0
1.000
0.568
75
0.991
1.045
0.976
70.0
1.045
80
0.982
1.101
0.948
75.0
1.122
0.782
1.000
1.027
1.164
1.350
1.421
1.000
1.000
0.647
0.864
0.889
1.034
1.295
1.421
1.009
1.037
0.638
0.658
0.806
1.076
1.294
1.025
1.103
* = Sensible capacity equals total capacity
AHRI/ISO/ASHRAE 13256-1 uses entering air conditions of Cooling - 80.6°F DB/66.2°F WB, 1
and Heating - 68°F DB/59°F WB entering air temperature
15
Submittal Data - Large HKV
Antifreeze Correction and Water Pressure Drop Adder for Option Tables
Antifreeze Type
Antifreeze
%
Water
Propylene Glycol
Methanol
Ethanol
Ethylene Glycol
Cooling
Heating
EWT 90°F
EWT 30°F
Total
Cap
Sens
Cap
Power
Htg
Cap
Power
0
1.000
1.000
1.000
1.000
1.000
1.000
5
0.995
0.995
1.003
0.989
0.997
1.070
15
0.986
0.986
1.009
0.968
0.990
1.210
25
0.978
0.978
1.014
0.947
0.983
1.360
5
0.997
0.997
1.002
0.989
0.997
1.070
15
0.990
0.990
1.007
0.968
0.990
1.160
25
0.982
0.982
1.012
0.949
0.984
1.220
5
0.998
0.998
1.002
0.981
0.994
1.140
15
0.994
0.994
1.005
0.944
0.983
1.300
25
0.986
0.986
1.009
0.917
0.974
1.360
5
0.998
0.998
1.002
0.993
0.998
1.040
15
0.994
0.994
1.004
0.980
0.994
1.120
25
0.988
0.988
1.008
0.966
0.990
1.200
Options Pressure Drop Table
Model
084
096
120
150
168
192
240
300
GPM
WPD
Corr. Fct.
EWT 30°F
Motorized Water Valve Option
CV
MOPD
PSI
FT
10.50
37
150
0.08
0.2
15.75
37
150
0.18
0.4
21.00
37
150
0.32
0.7
12.00
37
150
0.11
0.3
18.00
37
150
0.24
0.5
24.00
37
150
0.42
1.0
15.00
37
150
0.16
0.4
22.50
37
150
0.37
0.9
30.00
37
150
0.66
1.5
19.00
57
150
0.11
0.3
28.00
57
150
0.24
0.6
38.00
57
150
0.44
1.0
21.00
37
150
0.08
0.2
31.50
37
150
0.18
0.4
42.00
37
150
0.32
0.7
24.00
37
150
0.11
0.3
36.00
37
150
0.24
0.5
48.00
37
150
0.42
1.0
30.00
37
150
0.16
0.4
45.00
37
150
0.37
0.9
60.00
37
150
0.66
1.5
38.00
57
150
0.11
0.3
56.00
57
150
0.24
0.6
76.00
57
150
0.44
1.0
Operation in the shaded area is not recommended.
16
Submittal Data - Large HKV
Blower Performance Data – HKV084 - Standard Unit
All Data is Wet Coil
Airflow
(SCFM)
ESP
Airflow (cfm) at External Static Pressure (in. wg)
0.00
0.10
BHP
2100
Sheave/Mtr
RPM
Turns Open
2300
2900
1.40
1.50
0.59
0.64
0.69
0.74
0.79
0.84
B
B
B
A
A
A
A
A
A
C
C
C
C
C
410
457
499
537
577
612
647
678
710
737
764
791
815
838
4
3
2.5
1.5
6
5.5
4.5
4
3
Sheave/Mtr
0.54
A
0.59
A
0.64
A
0.69
C
0.74
C
0.79
C
0.84
C
0.9
C
RPM
424
467
507
548
584
621
653
684
716
743
772
797
821
847
Turns Open
4.5
3.5
4.5
5.5
5
4
3
2
1.5
6
5
4.5
3.5
3
BHP
Sheave/Mtr
0.29
B
0.34
B
0.39
B
0.44
A
0.49
A
0.54
A
0.59
A
0.64
A
0.69
A
0.74
C
0.79
C
0.84
C
0.89
C
0.94
C
RPM
435
476
518
555
590
627
659
692
721
751
777
803
829
853
Turns Open
4.5
3
4
5.5
4.5
3.5
2.5
2
1.5
5.5
5
4
3.5
2.5
Sheave/Mtr
0.29
B
0.34
B
0.39
B
0.44
A
0.49
A
0.54
A
0.59
A
0.64
A
0.69
A
0.74
A
0.79
C
0.84
C
0.89
C
0.94
C
0.99
C
RPM
403
446
485
527
563
600
633
665
697
726
756
783
811
835
858
5
4
3
6
5.5
4.5
3.5
2.5
1.5
1
5.5
4.5
4
3
2.5
Sheave/Mtr
0.31
B
0.34
B
0.39
B
0.44
A
0.49
A
0.54
A
0.59
A
0.64
A
0.74
A
0.79
A
0.84
C
0.89
C
0.94
C
0.99
C
1.04
E
RPM
411
452
495
532
567
604
636
670
700
729
759
786
813
838
864
5
4
2.5
6
5.5
4
3.5
2.5
1.5
1
5.5
4.5
3.5
3
2.5
Sheave/Mtr
0.34
B
0.43
B
0.48
B
0.53
A
0.58
A
0.63
A
0.68
A
0.73
A
0.78
A
0.83
A
0.88
C
0.93
C
1.03
E
1.08
E
1.13
E
RPM
420
460
500
536
570
606
638
671
701
729
759
786
814
839
865
Turns Open
4.5
3.5
2.5
6
5
4
3
2
1.5
1
5
4
4
3
2.5
BHP
Sheave/Mtr
0.38
B
0.43
B
0.48
B
0.53
A
0.59
A
0.64
A
0.69
A
0.74
A
0.79
A
0.84
A
0.89
C
0.94
C
1.04
E
1.09
E
1.14
E
RPM
423
463
504
539
576
609
641
674
703
734
762
788
816
841
867
Turns Open
4.5
3.5
2
5.5
5
4
3
2
1.5
1
5
4
4
3
2.5
BHP
Sheave/Mtr
0.39
B
0.44
B
0.49
B
0.54
A
0.64
A
0.69
A
0.74
A
0.79
A
0.84
A
0.89
C
0.94
C
1.04
E
1.09
E
1.12
E
1.22
E
RPM
431
474
510
545
581
613
647
677
706
737
764
793
818
843
869
Turns Open
4.5
3
2
5.5
5
4
3
2
1.5
5.5
1
4.5
4
3
2.5
BHP
0.44
0.49
0.54
0.59
0.64
0.74
0.79
0.84
0.89
0.94
1.04
1.09
1.14
1.19
1.24
Sheave/Mtr
RPM
B
B
B
A
A
A
A
A
A
C
E
E
E
E
E
440
481
517
551
586
618
651
681
710
740
767
795
821
845
872
4
3
2
5.5
4.5
3.5
2.5
1.5
1
5.5
5.5
4.5
3.5
3
2
Sheave/Mtr
0.43
B
0.49
B
0.54
B
0.59
A
0.64
A
0.69
A
0.74
A
0.84
A
0.89
A
0.94
A
1.04
D
1.09
E
1.14
E
1.19
E
1.24
E
1.29
E
RPM
412
455
492
526
563
595
628
658
687
718
745
774
800
826
852
876
5
3.5
2.5
6
5.5
4.5
3.5
2.5
1.5
1.5
1
5
4.5
3.5
3
2
Sheave/Mtr
0.44
B
0.53
B
0.59
B
0.64
A
0.69
A
0.74
A
0.84
A
0.89
A
0.94
A
0.99
A
1.04
D
1.14
E
1.19
E
1.24
E
1.34
E
1.39
E
RPM
421
459
499
533
569
600
633
663
691
722
749
777
803
828
854
878
Turns Open
4.5
3.5
2.5
6
5
4
3
2
1.5
1.5
1
5
4
3.5
2.5
2
BHP
Sheave/Mtr
0.49
B
0.54
B
0.64
B
0.69
A
0.74
A
0.84
A
0.89
A
0.94
A
0.99
A
1.04
D
1.14
E
1.19
E
1.24
E
1.34
E
1.39
E
1.44
E
RPM
441
478
513
549
581
614
644
672
703
730
759
785
810
837
861
887
4
3
2
5.5
5
4
3
2
1.5
1.5
5.5
4.5
4
3
2.5
2
Sheave/Mtr
0.54
B
0.64
B
0.69
A
0.74
A
0.83
A
0.89
A
0.94
A
0.99
A
1.04
D
1.14
D
1.23
E
1.29
E
1.34
E
1.44
E
1.49
E
RPM
456
495
529
561
595
625
656
685
712
741
767
795
820
844
870
Turns Open
3.5
2.5
6
5
4.5
3.5
2.5
2
1.5
1
5
4.5
3.5
3
2.5
BHP
Sheave/Mtr
0.63
B
0.69
B
0.74
A
0.79
A
0.84
A
0.94
A
0.99
A
1.04
D
1.14
1.5
1.19
D
1.24
E
1.34
E
1.44
E
1.49
E
RPM
471
506
539
574
604
633
664
692
721
747
773
800
825
851
3
2
5.5
5
4
3.5
2.5
2
1.5
1
5
4
3.5
2.5
Sheave/Mtr
0.64
B
0.74
A
0.79
A
0.84
A
0.94
A
0.99
A
1.04
D
1.14
D
1.23
D
1.29
E
1.34
E
1.44
E
1.49
E
RPM
486
520
555
586
615
647
674
704
730
756
784
808
835
Turns Open
2.5
6
5.5
4.5
4
3
2.5
1.5
1
5.5
4.5
4
3
BHP
Turns Open
BHP
3500
1.30
0.54
0.49
A
Turns Open
3400
1.20
0.49
5
BHP
3300
1.10
0.44
0.44
A
Turns Open
3200
1.00
0.41
6
BHP
3100
0.90
0.37
0.39
A
Turns Open
3000
0.80
0.34
4.5
BHP
2800
0.70
0.29
0.34
B
Turns Open
2700
0.60
0.24
3.5
BHP
2600
0.50
0.315
B
Turns Open
2500
0.40
5
BHP
2400
0.30
0.28
B
BHP
2200
0.20
A = Standard Static/Standard Motor, B = Low Static/Standard Motor, C = High Static/Standard Motor, D = Standard Static/Large Motor, E = High Static/Large Motor
Unit factory shipped with standard static sheave and drive at 2.5 turns open. Other speed require field selection.
For applications requiring higher static pressures, contact your local representative. Performance data does not include drive losses and is based on sea level conditions.
Do not operate in black regions. All airflow in rated at lowest Voltage if unit is dual Voltage rated, i.e. 208V for 208-230V units.
17
Submittal Data - Large HKV
Blower Performance Data – HKV096 - Standard Unit
All Data is Wet Coil
Airflow
(SCFM)
ESP
Airflow (cfm) at External Static Pressure (in. wg)
0.00
BHP
2400
Sheave/Mtr
RPM
Turns Open
BHP
2500
Sheave/Mtr
RPM
Turns Open
BHP
2600
2700
2800
2900
Sheave/Mtr
RPM
3400
3700
1.00
1.10
1.20
1.30
1.40
1.50
0.49
0.54
0.59
0.64
0.69
0.74
0.79
0.84
0.89
0.94
0.99
B
B
B
A
A
A
A
A
A
A
C
C
C
C
C
403
446
485
527
563
600
633
665
697
726
756
783
811
835
858
5
4
3
6
5.5
4.5
3.5
2.5
1.5
1
5.5
5
4
3.5
3
0.31
0.34
0.39
0.44
0.49
0.54
0.59
0.64
0.74
0.79
0.84
0.89
0.94
0.99
1.04
B
B
B
A
A
A
A
A
A
A
C
C
C
C
C
411
452
495
532
567
604
636
670
700
729
759
786
813
838
864
5
4
2.5
6
5.5
4
3.5
2.5
1.5
1
5.5
5
4
3
3
0.34
0.43
0.48
0.53
0.58
0.63
0.68
0.73
0.78
0.83
0.88
0.93
1.03
1.08
1.13
B
B
B
A
A
A
A
A
A
A
C
C
C
C
C
420
460
500
536
570
606
638
671
701
729
759
786
814
839
865
6
5
4
3
2
1.5
1
5
5
4
3
2.5
0.53
0.59
0.64
0.69
0.74
0.79
0.84
0.89
0.94
1.04
1.09
1.14
Sheave/Mtr
RPM
B
B
B
A
A
A
A
A
A
A
C
C
C
C
C
423
463
504
539
576
609
641
674
703
734
762
788
816
841
867
Turns Open
4.5
3.5
2
5.5
5
4
3
2
1.5
1
5
4.5
4
3
2.5
BHP
0.39
0.44
0.49
0.54
0.64
0.69
0.74
0.79
0.84
0.89
0.94
1.04
1.09
1.12
1.22
Sheave/Mtr
RPM
B
B
B
A
A
A
A
A
A
C
C
C
C
C
C
431
474
510
545
581
613
647
677
706
737
764
793
818
843
869
Turns Open
4.5
3
2
5.5
5
4
3
2
1.5
5.5
5
4.5
3.5
3
2.5
BHP
0.44
0.49
0.54
0.59
0.64
0.74
0.79
0.84
0.89
0.94
1.04
1.09
1.14
1.19
1.24
C
C
C
C
C
740
767
795
821
845
872
Sheave/Mtr
RPM
Sheave/Mtr
RPM
Sheave/Mtr
RPM
0.43
B
B
B
A
A
A
A
A
A
440
481
517
551
586
618
651
681
710
4
3
2
5.5
4.5
3.5
2.5
1.5
1
5.5
5
4.5
3.5
2.5
2.5
0.49
0.54
0.59
0.64
0.69
0.74
0.84
0.89
0.94
1.04
1.09
1.14
1.19
1.24
1.29
B
B
B
A
A
A
A
A
A
A
C
C
C
C
C
C
412
455
492
526
563
595
628
658
687
718
745
774
800
826
852
876
5
3.5
2.5
6
5.5
4.5
3.5
2.5
1.5
1.5
6
5
4
3.5
2.5
2
0.44
0.53
0.59
0.64
0.69
0.74
0.84
0.89
0.94
0.99
1.04
1.14
1.19
1.24
1.34
1.39
B
B
B
A
A
A
A
A
A
A
C
C
C
C
C
C
421
459
499
533
569
600
633
663
691
722
749
777
803
828
854
878
Turns Open
4.5
3.5
2.5
6
5
4
3
2
1.5
1.5
6
4.5
4
3
2.5
2
BHP
0.49
0.54
0.64
0.69
0.74
0.84
0.89
0.94
0.99
1.04
1.14
1.19
1.24
1.34
1.39
1.44
Sheave/Mtr
RPM
B
B
B
A
A
A
A
A
A
A
C
C
C
C
C
C
441
478
513
549
581
614
644
672
703
730
759
785
810
837
861
887
Turns Open
4
3
2
5.5
5
4
3
2
1.5
1.5
5.5
4.5
4
3
2.5
BHP
0.54
0.64
0.69
0.74
0.83
0.89
0.94
0.99
1.04
1.14
1.23
1.29
1.34
1.44
1.49
Sheave/Mtr
RPM
2
1.54
B
B
A
A
A
A
A
A
A
A
C
C
C
C
C
E
456
495
529
561
595
625
656
685
712
741
767
795
820
844
870
893
Turns Open
3.5
2.5
6
5
4.5
3.5
2.5
2
1.5
1
5
4.5
3.5
3
2
2
BHP
0.63
0.69
0.74
0.79
0.84
0.94
0.99
1.04
1.14
1.19
1.24
1.34
1.44
1.49
1.54
1.64
Sheave/Mtr
RPM
Sheave/Mtr
RPM
B
B
A
A
A
A
A
A
A
A
C
C
C
C
E
E
471
506
539
574
604
633
664
692
721
747
773
800
825
851
875
898
3
2
5.5
5
4
3.5
2.5
2
1.5
1
5
4
3.5
2.5
2.5
2
0.64
0.74
0.79
0.84
0.94
0.99
1.04
1.14
1.23
1.29
1.34
1.44
1.49
1.54
1.64
1.74
B
A
A
A
A
A
A
A
A
C
C
C
C
E
E
E
486
520
555
586
615
647
674
704
730
756
784
808
835
858
883
906
Turns Open
2.5
6
5.5
4.5
4
3
2.5
1.5
1
5.5
4.5
4
3
2.5
2.5
1.5
BHP
0.74
0.79
0.84
0.94
0.99
1.04
1.14
1.19
1.24
1.34
1.44
1.49
1.54
1.64
1.74
1.83
Sheave/Mtr
RPM
B
A
A
A
A
A
A
A
A
C
C
C
E
E
E
E
495
528
562
593
624
652
680
708
734
762
787
812
838
861
886
909
Turns Open
2.5
6
5
4.5
3.5
3
2
1.5
1
5.5
4.5
4
3
2.5
2.5
1.5
BHP
0.79
0.84
0.93
0.99
1.04
1.14
1.19
1.24
1.34
1.44
1.49
1.54
1.64
1.74
1.79
1.84
Sheave/Mtr
RPM
Sheave/Mtr
RPM
Turns Open
BHP
Sheave/Mtr
RPM
Turns Open
BHP
4000
0.90
0.44
2.5
Turns Open
3900
0.80
0.39
0.48
BHP
3800
0.70
0.34
3.5
Turns Open
3600
0.60
0.29
0.43
BHP
3500
0.50
4.5
Turns Open
3300
0.40
0.38
BHP
3200
0.30
Turns Open
BHP
3100
0.20
BHP
Turns Open
3000
0.10
Sheave/Mtr
B
A
A
A
A
A
A
A
A
C
C
E
E
E
E
E
506
541
572
605
633
661
690
716
744
769
793
820
843
868
891
913
2
5.5
5
4
3.5
3
2
1.5
1
5
4.5
3.5
3
2.5
2
1.5
0.84
0.89
0.94
1.04
1.13
1.19
1.24
1.34
1.43
1.49
1.54
1.64
1.73
1.79
1.84
1.94
B
A
A
A
A
A
A
A
C
C
E
E
E
E
E
E
515
549
580
611
640
667
696
721
749
773
798
823
847
872
894
918
1
2
5.5
4.5
4
3.5
2.5
1.5
1.5
5.5
5
4
3.5
3
2.5
2
0.89
0.94
1.04
1.09
1.14
1.24
1.34
1.39
1.44
1.54
1.64
1.69
1.74
1.84
1.94
A
A
A
A
A
A
A
A
C
E
E
E
E
E
E
525
556
586
617
645
674
701
726
753
778
804
827
850
875
897
2
6
5.5
4.5
4
3
2.5
1.5
1
5.5
5
4
3.5
2.5
2
0.94
1.04
1.09
1.14
1.24
1.34
1.44
1.49
1.54
1.64
1.74
1.79
1.84
1.94
A
A
A
A
A
A
A
A
E
E
E
E
E
E
RPM
539
569
601
629
659
685
711
738
763
789
812
835
860
882
Turns Open
5.5
5
4.5
3.5
3
2
1
1
5
4.5
3.5
3
2.5
2
A = Standard Static/Standard Motor, B = Low Static/Standard Motor, C = High Static/Standard Motor, D = Standard Static/Large Motor, E = High Static/Large Motor
Unit factory shipped with standard static sheave and drive at 2.5 turns open. Other speed require field selection.
For applications requiring higher static pressures, contact your local representative. Performance data does not include drive losses and is based on sea level conditions.
Do not operate in black regions. All airflow in rated at lowest Voltage if unit is dual Voltage rated, i.e. 208V for 208-230V units.
18
Submittal Data - Large HKV
Blower Performance Data – HKV120 - Standard Unit
All Data is Wet Coil
Airflow
(SCFM)
ESP
Airflow (cfm) at External Static Pressure (in. wg)
0.00
0.10
BHP
3000
Sheave/Mtr
RPM
Turns Open
BHP
3100
3200
0.54
Sheave/Mtr
RPM
3500
0.40
0.50
0.60
0.70
0.80
0.90
1.00
1.10
1.20
1.30
1.40
1.50
0.54
0.59
0.64
0.69
0.74
0.84
0.89
0.94
1.04
1.09
1.14
1.19
1.24
1.34
B
B
B
B
A
A
A
A
A
A
A
A
C
C
491
529
563
595
626
659
689
717
745
774
801
826
851
877
5
4
3
2
6
5
4
3.5
3
2
1.5
1
6
5.5
0.59
0.64
0.69
0.74
0.84
0.89
0.94
1.04
1.09
1.14
1.19
1.24
1.34
1.44
B
B
B
B
A
A
A
A
A
A
A
A
C
C
C
469
504
542
575
607
637
670
699
726
754
783
809
834
859
884
5.5
5
3.5
2.5
6
5.5
4.5
4
3.5
2.5
2
1.5
6
6
5
BHP
0.59
0.64
0.69
0.74
0.84
0.89
0.94
1.04
1.09
1.14
1.24
1.29
1.34
1.44
1.53
Sheave/Mtr
RPM
BHP
3400
0.30
Turns Open
Turns Open
3300
0.20
Sheave/Mtr
RPM
0.59
B
B
B
B
A
A
A
A
A
A
A
A
C
C
C
485
520
556
588
619
649
680
708
736
765
791
817
841
868
891
5
4.5
3
2
6
5
4.5
3.5
3
2.5
1.5
1
6
5.5
5
0.64
0.69
0.74
0.84
0.89
0.94
1.04
1.09
1.14
1.24
1.29
1.34
1.44
1.49
1.54
B
B
B
B
B
A
A
A
A
A
A
A
A
C
C
C
464
500
537
570
601
631
662
691
718
745
774
799
824
849
875
898
Turns Open
6
5
4
2.5
2
5.5
5
4
3.5
2.5
2
1.5
1
5.5
5
4.5
BHP
Sheave/Mtr
0.64
B
0.69
B
0.74
B
0.84
B
0.89
A
0.94
A
1.04
A
1.09
A
1.14
A
1.24
A
1.29
A
1.34
A
1.44
C
1.49
C
1.54
C
1.64
C
RPM
480
515
551
583
613
642
674
701
728
754
783
808
833
857
882
905
Turns Open
5.5
4.5
3.5
2.5
6
5.5
4.5
3.5
3
2.5
2
1
6
5.5
5
4.5
BHP
0.69
0.74
0.84
0.89
0.94
1.04
1.09
1.14
1.24
1.29
1.34
1.44
1.54
1.59
1.64
1.74
Sheave/Mtr
RPM
B
B
B
B
A
A
A
A
A
A
A
A
C
C
C
C
496
530
565
596
625
654
684
711
738
766
792
816
841
867
890
913
Turns Open
5
4
3
2
6
5
4
3.5
3
2.5
1.5
1
6
5.5
5
4
3600
BHP
Sheave/Mtr
RPM
Turns Open
0.74
B
511
4.5
0.84
B
544
3.5
0.89
B
578
2.5
0.94
A
608
6
1.04
A
637
5.5
1.09
A
668
4.5
1.14
A
695
4
1.24
A
722
3.5
1.34
A
748
2.5
1.39
A
776
2
1.44
A
800
1
1.54
C
825
6
1.59
C
849
6
1.64
C
874
5
1.74
C
897
4.5
1.84
C
920
4
3700
BHP
Sheave/Mtr
RPM
Turns Open
0.84
B
526
4
0.89
B
561
3
0.94
B
592
2
1.04
A
621
6
1.14
A
649
5
1.19
A
679
4.5
1.24
A
706
3.5
1.34
A
732
3
1.39
A
758
2.5
1.44
A
785
1.5
1.54
A
809
1
1.64
C
833
6
1.69
C
857
5.5
1.74
C
882
5
1.84
C
905
4.5
1.94
C
927
4
BHP
Sheave/Mtr
0.89
B
0.94
B
1.04
B
1.09
A
1.14
A
1.24
A
1.34
A
1.39
A
1.44
A
1.54
A
1.64
A
1.69
C
1.74
C
1.84
C
1.94
C
2.04
E
RPM
544
575
605
633
661
691
717
742
767
794
818
842
867
890
912
934
Turns Open
3.5
2.5
1.5
5.5
5
4
3.5
2.5
2
1.5
1
6
5.5
4.5
4
3.5
BHP
0.94
1.04
1.14
1.19
1.24
1.34
1.44
1.49
1.54
1.64
1.74
1.79
1.84
1.94
2.04
2.14
3800
3900
4000
4100
Sheave/Mtr
RPM
A
A
A
A
A
A
C
C
C
C
E
E
676
702
728
753
779
803
827
850
875
898
920
941
3
2
6
5
4.5
3.5
3
2.5
2
1
6
5.5
5
4.5
4
3.5
1.09
B
601
1.14
A
630
1.24
A
657
1.34
A
686
1.44
A
712
1.49
A
737
1.54
A
762
1.64
A
789
1.74
A
812
1.79
C
836
1.84
C
859
1.94
C
883
2.04
E
905
2.14
E
927
2.24
E
948
2
5.5
5
4
3.5
3
2
1.5
1
6
5.5
5
4.5
4
3.5
BHP
Sheave/Mtr
RPM
1.14
B
589
2
1.19
1.24
1.34
1.44
1.49
1.54
1.64
1.74
1.84
1.89
1.94
2.04
2.14
2.24
2.34
A
617
6
A
645
A
672
A
700
A
726
A
751
A
775
A
801
C
824
C
847
C
872
E
894
E
915
E
937
E
960
5
4.5
4
3
2.5
2
1
6
5.5
5
4.5
4
3.5
3
1.24
A
605
6
1.29
A
633
5.5
1.34
A
660
5
1.44
A
689
4
1.54
A
714
3.5
1.59
A
739
2.5
1.64
A
763
2.5
1.74
A
790
1.5
1.84
A
813
1
2
E
836
6
2.04
E
858
5.5
2.09
E
882
5.5
2.14
E
904
4.5
2.24
E
925
4
2.34
E
946
3.5
2.44
E
969
3
1.29
A
621
6
1.34
A
649
5
1.44
1.54
1.64
1.69
1.74
1.84
2
2.04
2.14
2.24
2.29
2.34
2.44
2.54
A
675
4.5
A
703
3.5
A
728
3
A
752
2.5
A
776
2
A
802
1
E
827
6
E
847
6
E
869
5.5
E
893
5
E
914
4.5
E
935
4
E
956
3
E
979
2.5
1.39
A
637
5.5
1.44
A
664
4.5
1.54
A
690
4
1.64
A
717
3.5
1.74
A
742
2.5
1.84
A
766
2
1.89
A
791
1.5
2
D
814
1
2.04
E
836
6
2.14
E
858
5.5
2.24
E
882
5
2.34
E
904
4.5
2.44
E
925
4
2.49
E
945
3.5
2.54
E
968
3
2.64
E
988
2.5
1.49
A
653
5
1.54
A
679
1.64
A
707
1.74
A
731
1.84
A
755
1.94
A
779
2.04
D
804
2.09
D
826
2.14
E
848
2.24
E
870
2.34
E
893
2.44
E
914
2.54
E
935
2.64
E
955
2.74
E
978
2.84
E
997
4.5
3.5
3
2
1.5
1.5
1
6
5.5
5
4.5
4
3.5
2.5
2
BHP
Sheave/Mtr
RPM
Sheave/Mtr
RPM
Turns Open
BHP
Sheave/Mtr
RPM
Turns Open
BHP
4500
A
646
1.04
B
572
2.5
BHP
4400
A
618
BHP
Sheave/Mtr
RPM
Turns Open
Turns Open
4300
B
589
Turns Open
Turns Open
4200
B
555
Sheave/Mtr
RPM
Turns Open
A = Standard Static/Standard Motor, B = Low Static/Standard Motor, C = High Static/Standard Motor, D = Standard Static/Large Motor, E = High Static/Large Motor
Unit factory shipped with standard static sheave and drive at 2.5 turns open. Other speed require field selection.
For applications requiring higher static pressures, contact your local representative. Performance data does not include drive losses and is based on sea level conditions. Do not operate in black regions. All
airflow in rated at lowest Voltage if unit is dual Voltage rated, i.e. 208V for 208-230V units.
Table Continued on Next Page
19
Submittal Data - Large HKV
Blower Performance Data – HKV120 - Standard Unit
Table Continued from Previous Page
All Data is Wet Coil
Airflow
(SCFM)
4600
4700
4800
4900
5000
ESP
Airflow (cfm) at External Static Pressure (in. wg)
0.00
0.10
0.20
0.30
0.40
0.50
0.60
0.70
0.80
0.90
1.00
1.10
1.20
1.30
1.40
1.50
BHP
Sheave/Mtr
RPM
Turns Open
1.59
A
668
4.5
1.64
A
694
4
1.74
A
721
3
1.84
A
745
2.5
1.94
A
768
2
2.04
D
791
1.5
2.14
D
816
1
2.24
E
838
6
2.34
E
860
5.5
2.39
E
883
5
2.44
E
904
4.5
2.54
E
925
4
2.64
E
945
3.5
2.74
E
967
3
2.84
E
987
2.5
2.94
E
1007
2
BHP
Sheave/Mtr
1.74
A
1.84
A
1.89
A
1.94
A
2.04
D
2.14
D
2.24
E
2.34
E
2.44
E
2.54
E
2.64
E
2.69
E
2.74
E
2.84
E
2.94
E
RPM
683
711
735
758
782
806
828
850
871
894
915
935
955
977
997
Turns Open
4
3.5
2.5
2
2
1
6
6
5.5
5
4.5
3.5
3.5
3
2
BHP
Sheave/Mtr
RPM
Turns Open
1.84
A
698
3.5
1.94
A
725
3
1.99
A
749
2.5
2.04
D
772
2
2.14
D
795
1.5
2.24
D
819
1
2.34
E
836
6
2.44
E
862
5.5
2.54
E
883
5
2.64
E
906
4.5
2.74
E
926
4
2.84
E
946
3.5
2.94
E
968
3
BHP
2.94
1.94
2.04
2.14
2.24
2.34
2.44
2.49
2.54
2.64
2.74
2.84
Sheave/Mtr
A
D
D
D
D
E
E
E
E
E
E
E
RPM
Turns Open
715
3
739
3
762
2.5
785
2
810
1
831
6
853
5.5
874
5.5
896
5
917
4
937
3.5
956
3
BHP
2.04
2.14
2.24
2.34
2.44
2.54
2.64
2.74
2.84
2.94
D
D
D
D
E
E
E
E
E
E
730
753
776
798
822
844
865
885
908
928
3
2.5
2
1.5
6
6
5.5
5
4.5
4
Sheave/Mtr
RPM
Turns Open
A = Standard Static/Standard Motor, B = Low Static/Standard Motor, C = High Static/Standard Motor, D = Standard Static/Large Motor, E = High Static/Large Motor
Unit factory shipped with standard static sheave and drive at 2.5 turns open. Other speed require field selection.
For applications requiring higher static pressures, contact your local representative. Performance data does not include drive losses and is based on sea level conditions. Do not operate
in black regions. All airflow in rated at lowest Voltage if unit is dual Voltage rated, i.e. 208V for 208-230V units.
20
Submittal Data - Large HKV
Blower Performance Data – HKV150 - Standard Unit
All Data is Wet Coil
Airflow
(SCFM)
ESP
Airflow (cfm) at External Static Pressure (in. wg)
0.00
0.10
0.20
0.30
0.40
BHP
3800
4300
4500
4600
1.00
1.10
1.20
1.30
1.40
1.50
1.34
1.44
1.54
1.64
1.74
1.84
1.94
B
B
A
A
A
A
A
A
A
A
688
4.5
718
3.5
746
6
774
5
802
4.5
829
4
855
3
879
2.5
905
2
931
1
1.04
1.14
1.19
1.24
1.34
1.44
1.54
1.64
1.74
1.84
1.94
2.03
B
B
B
B
A
A
A
A
A
A
A
A
639
669
702
729
757
785
811
838
862
887
913
938
Sheave/Mtr
RPM
6
5
4
3
5.5
5
4
3.5
3
2
1.5
1
1.14
1.19
1.24
1.34
1.44
1.54
1.64
1.69
1.74
1.84
1.94
2.04
Sheave/Mtr
B
B
B
A
A
A
A
A
A
A
A
C
RPM
Turns Open
651
5.5
683
4.5
710
4
739
6
767
5.5
794
4.5
821
4
845
3.5
870
2.5
895
2
920
1.5
945
6
1.09
1.14
1.24
1.34
1.44
1.54
1.64
1.69
1.74
1.84
1.94
2.04
2.14
B
B
B
B
A
A
A
A
A
A
A
A
C
631
661
692
722
750
778
804
831
854
879
904
928
951
Sheave/Mtr
RPM
Turns Open
6
5.5
4.5
3.5
515
5
4.5
3.5
3
2.5
1.5
1
6
BHP
Sheave/Mtr
1.14
B
1.24
B
1.34
B
1.44
B
1.54
A
1.59
A
1.64
A
1.74
A
1.84
A
1.94
A
2.04
A
2.14
A
2.24
C
RPM
958
640
673
703
733
761
788
812
838
863
888
912
934
Turns Open
6
5
4
3
5.5
4.5
4
3.5
3
2
1.5
1
5.5
BHP
Sheave/Mtr
RPM
Turns Open
1.24
B
653
5.5
1.34
B
685
4.5
1.44
B
715
3.5
1.54
A
744
6
1.59
A
771
5
1.64
A
796
4.5
1.74
A
822
4
1.84
A
847
3
1.94
A
872
2.5
2.04
A
896
2
2.14
A
919
1
2.24
C
942
6
2.34
C
966
5.5
2.44
BHP
4400
0.90
1.29
B
BHP
4200
0.80
1.24
659
5.5
Turns Open
4100
0.70
1.14
Sheave/Mtr
BHP
4000
0.60
1.04
RPM
Turns Open
BHP
3900
0.50
1.24
1.34
1.44
1.54
1.59
1.64
1.74
1.84
1.94
2.04
2.14
2.24
2.34
Sheave/Mtr
B
B
B
B
A
A
A
A
A
A
A
A
C
C
RPM
Turns Open
633
6
666
5
697
4
726
3
755
5.5
782
5
806
4
832
3.5
857
3
881
2.5
904
1.5
927
1
950
6
973
5.5
BHP
Sheave/Mtr
RPM
Turns Open
BHP
Sheave/Mtr
RPM
Turns Open
BHP
1.3
B
646
5.5
1.34
B
656
5.5
1.44
1.4
B
678
4.5
1.44
B
687
4.5
1.54
1.5
B
706
4
1.54
B
715
3.5
1.64
1.6
A
735
6
1.64
A
744
6
1.74
1.7
A
763
5.5
1.74
A
772
5
1.84
1.8
A
791
4.5
1.84
A
799
4.5
1.94
1.9
A
817
4
1.94
A
825
3.5
2.04
2
A
842
3.5
2.04
A
850
3
2.14
2.1
A
867
2.5
2.14
A
872
2.5
2.24
2.2
A
889
2
2.24
A
896
2
2.34
2.3
A
912
1.5
2.34
A
919
1
2.44
2.4
C
935
6
2.44
C
942
6
2.54
2.5
C
958
6
2.54
C
963
5.5
2.64
2.6
C
980
5
2.64
C
987
5
2.74
1.34
Sheave/Mtr
B
B
B
B
A
A
A
A
A
A
A
A
C
C
C
RPM
Turns Open
637
6
666
5
697
4
727
3
755
5.5
783
5
809
4
835
3.5
858
3
882
2
905
1.5
928
1
951
6
973
5.5
994
4.5
BHP
Sheave/Mtr
RPM
Turns Open
BHP
Sheave/Mtr
RPM
Turns Open
1.44
B
631
6
1.44
B
647
5.5
1.54
B
662
5
1.54
B
678
4.5
1.64
B
690
4
1.64
B
708
3.5
1.74
B
720
3.5
1.74
A
738
6
1.84
A
749
5.5
1.84
A
766
5
1.94
A
777
5
1.94
A
793
4.5
2.04
A
803
4.5
2.04
A
819
4
2.14
A
827
3.5
2.14
A
844
3.5
2.24
A
852
3
2.24
A
867
2.5
2.34
A
877
2.5
2.34
A
891
2
2.44
A
900
2
2.44
A
914
1.5
2.54
A
923
1
2.54
C
937
6
2.64
C
946
6
2.64
C
959
5.5
2.74
C
966
5.5
2.74
C
980
5
2.84
C
988
5
2.84
C
1001
4.5
2.94
C
1009
4.5
Turns Open
1.54
B
642
5.5
1.64
B
655
5.5
1.64
B
672
5
1.74
B
685
4.5
1.74
B
702
3.5
1.84
B
714
3.5
1.84
B
731
3
1.94
A
743
6
1.94
A
760
5.5
2.04
A
769
5
2.04
A
785
4.5
2.14
A
798
4.5
2.14
A
811
4
2.24
A
822
4
2.24
A
837
3.5
2.34
A
847
3
2.34
A
862
3
2.44
A
872
2.5
2.44
A
886
2
2.54
A
896
2
2.54
A
909
1.5
2.64
A
917
1.5
2.64
A
932
1
2.74
C
940
6
2.74
C
953
6
2.84
C
962
5.5
2.84
C
975
5
2.94
C
983
5
2.94
C
996
4.5
3.04
E
1005
5
3.04
E
1017
4.5
3.19
E
1025
4.5
5200
BHP
Sheave/Mtr
RPM
Turns Open
1.74
B
668
5
1.84
B
697
4
1.94
B
726
3
2.04
A
752
5.5
2.14
A
782
5
2.24
A
806
4
2.34
A
832
3.5
2.44
A
857
3
2.54
A
882
2
2.64
A
903
1.5
2.74
A
926
1
2.84
C
949
6
2.94
C
971
5.5
3.09
E
992
5
3.19
E
1013
4.5
3.29
E
1032
4
5300
BHP
Sheave/Mtr
RPM
Turns Open
1.84
B
680
4.5
1.94
B
709
3.5
2.04
A
737
6
2.14
A
763
5.5
2.24
A
790
4.5
2.34
A
817
4
2.44
A
842
3.5
2.54
A
867
2.5
2.64
A
889
2
2.74
A
912
1.5
2.84
C
935
6
2.94
C
957
3.09
E
979
5.5
3.19
E
1000
5
3.29
E
1021
4.5
3.39
E
1042
4
4700
4800
4900
5000
5100
BHP
Sheave/Mtr
RPM
Turns Open
BHP
Sheave/Mtr
RPM
A = Standard Static/Standard Motor, B = Low Static/Standard Motor, C = High Static/Standard Motor, D = Standard Static/Large Motor, E = High Static/Large Motor
Unit factory shipped with standard static sheave and drive at 2.5 turns open. Other speed require field selection.
For applications requiring higher static pressures, contact your local representative. Performance data does not include drive losses and is based on sea level conditions. Do not operate in black regions. All
airflow in rated at lowest Voltage if unit is dual Voltage rated, i.e. 208V for 208-230V units.
Table Continued on Next Page
21
Submittal Data - Large HKV
Blower Performance Data – HKV150 - Standard Unit
Table Continued from Previous Page
All Data is Wet Coil
Airflow
(SCFM)
ESP
Airflow (cfm) at External Static Pressure (in. wg)
0.00
0.10
0.20
0.30
0.40
0.50
0.60
0.70
0.80
0.90
1.00
1.10
1.20
1.30
1.40
1.50
5400
BHP
Sheave/Mtr
RPM
Turns Open
1.94
B
691
4
2.04
B
717
3.5
2.14
A
745
5.5
2.24
A
772
5
2.34
A
799
4.5
2.44
A
825
3.5
2.54
A
850
3
2.64
A
873
2.5
2.74
A
897
1.5
2.84
A
920
1
2.94
C
943
6
3.09
E
965
6
3.19
E
986
5
3.29
E
1006
4.5
3.39
E
1026
4
3.49
E
1047
3.5
5500
BHP
Sheave/Mtr
RPM
Turns Open
2.04
B
704
4
2.14
A
729
6
2.24
A
756
5.5
2.34
A
783
4.5
2.44
A
810
4
2.54
A
836
3.5
2.64
A
859
3
2.74
A
883
2
2.84
A
907
1.5
3.09
D
929
1
3.14
E
952
6
3.24
E
972
5.5
3.34
E
993
5
3.44
E
1014
4.5
3.54
E
1035
4
3.69
E
1055
3.5
5600
BHP
Sheave/Mtr
RPM
Turns Open
2.14
B
714
3.5
2.24
A
740
6
2.34
A
767
5
2.44
A
794
4.5
2.54
A
818
4
2.64
A
844
3
2.74
A
868
2.5
2.84
A
892
2
3.00
D
916
1.5
3.14
D
938
1
3.24
E
959
6
3.34
E
981
5.5
3.44
E
1002
4.5
3.54
E
1023
4
3.69
E
1043
3.5
3.79
E
1063
3
5700
BHP
Sheave/Mtr
RPM
Turns Open
2.24
B
726
3
2.34
A
752
5.5
2.44
A
779
5
2.54
A
803
4
2.64
A
829
3.5
2.74
A
854
3
2.89
A
878
2
3.04
D
902
2
3.14
D
925
1
3.24
E
948
6
3.34
E
970
5.5
3.44
E
990
5
3.59
E
1011
4.5
3.74
E
1031
4
3.84
E
1051
3.5
3.94
E
1071
3
BHP
Sheave/Mtr
2.34
A
2.44
A
2.54
A
2.64
A
2.74
A
2.84
A
3.00
D
3.14
D
3.24
D
3.34
E
3.44
E
3.59
E
3.74
E
3.84
E
3.94
E
4.04
E
RPM
1077
5800
738
763
788
813
839
864
888
911
934
955
977
998
1019
1039
1058
Turns Open
6
5
4.5
4
3.5
2.5
2
1.5
1
6
5.5
5
4.5
4
3.5
2.5
5900
BHP
Sheave/Mtr
RPM
Turns Open
2.44
A
750
5.5
2.54
A
775
5
2.64
A
799
4
2.74
A
824
3.5
2.89
A
849
3
3.04
D
874
2.5
3.14
D
898
2
3.24
D
921
1.5
3.34
E
944
6
3.49
E
964
5.5
3.64
E
986
5
3.74
E
1007
4.5
3.84
E
1027
4
3.94
E
1046
3.5
4.09
E
1068
3
4.19
E
1086
2.5
6000
BHP
Sheave/Mtr
RPM
Turns Open
2.54
A
758
5.5
2.64
A
783
4.5
2.74
A
808
4
2.89
A
833
3.5
3.04
D
858
3
3.14
D
880
2.5
3.24
D
904
1.5
3.34
D
927
1
3.49
E
950
6
3.64
E
972
5.5
3.74
E
993
5
3.84
E
1014
4.5
3.99
E
1033
4
4.14
E
1053
3.5
4.24
E
1073
3
4.34
E
1092
2.5
6100
BHP
Sheave/Mtr
RPM
Turns Open
2.64
A
769
5
2.74
A
794
4.5
2.89
A
819
3.5
3.04
D
843
3.5
3.14
D
866
2.5
3.24
D
890
2
3.34
D
913
1.5
3.49
D
936
1
3.64
E
958
6
3.74
E
980
5.5
3.84
E
1000
4.5
3.99
E
1021
4
4.14
E
1041
3.5
1.24
E
1061
3
4.34
E
1081
2.5
4.49
E
1099
2
6200
BHP
Sheave/Mtr
RPM
Turns Open
2.84
A
781
4.5
2.94
A
815
4
3.04
D
830
3.5
3.14
D
854
3
3.24
D
878
2.5
3.39
D
900
2
3.54
D
923
1
3.64
E
946
6
3.74
E
968
5.5
3.89
E
988
5
4.04
E
1009
4.5
4.14
E
1030
4
4.24
E
1050
3.5
4.39
E
1070
3
4.54
E
1089
2.5
4.64
E
1107
2
BHP
2.94
A
793
4.5
3.04
D
817
4
3.14
D
841
3.5
3.29
D
863
3
3.44
D
886
2
3.54
D
910
1.5
3.64
D
933
3.79
E
955
6
3.94
E
977
5.5
4.04
E
997
5
4.14
E
1018
4.5
4.29
E
1038
4
4.44
E
1058
3
4.54
E
1078
2.5
4.69
E
1097
2
4.84
E
1115
1.5
6300
Sheave/Mtr
RPM
Turns Open
A = Standard Static/Standard Motor, B = Low Static/Standard Motor, C = High Static/Standard Motor, D = Standard Static/Large Motor, E = High Static/Large Motor
Unit factory shipped with standard static sheave and drive at 2.5 turns open. Other speed require field selection.
For applications requiring higher static pressures, contact your local representative. Performance data does not include drive losses and is based on sea level conditions.
Do not operate in black regions. All airflow in rated at lowest Voltage if unit is dual Voltage rated, i.e. 208V for 208-230V units.
22
Submittal Data - Large HKV
Blower Performance Data – HKV168 - Standard Unit
All Data is Wet Coil
Airflow
(SCFM)
ESP
Airflow (cfm) at External Static Pressure (in. wg)
0.00
0.10
0.20
0.30
0.40
0.50
0.60
0.70
0.80
0.90
1.00
1.10
1.20
1.30
1.40
1.50
0.58
0.68
0.74
0.82
0.88
0.98
1.08
1.18
1.28
1.38
1.48
1.58
1.68
Sheave/Mtr
B
B
B
B
A
A
A
A
A
A
A
A
C
RPM
Turns Open
457
6
499
5
537
3.5
577
2.5
612
6
647
5.5
678
4.5
710
3.5
737
3
764
2
791
1.5
815
1
838
3
BHP
0.63
0.68
0.78
0.88
0.98
1.08
1.18
1.28
1.38
1.48
1.58
1.68
1.8
B
B
B
B
A
A
A
A
A
A
A
C
C
467
507
548
584
621
653
684
716
743
772
797
821
847
BHP
4200
4400
4600
Sheave/Mtr
RPM
Turns Open
5.5
4.5
3.5
2.5
6
5
4
3.5
2.5
2
1
3.5
3
BHP
0.68
0.78
0.88
0.98
1.08
1.18
1.28
1.38
1.48
1.58
1.68
1.78
1.88
Sheave/Mtr
B
B
B
B
A
A
A
A
A
A
A
C
C
RPM
Turns Open
476
5.5
518
4.5
555
3
590
2
627
5.5
659
5
692
4
721
3
751
2.5
777
1.5
803
1
829
3.5
853
2.5
0.68
0.78
0.88
0.98
1.08
1.18
1.28
1.38
1.48
1.58
1.68
1.78
1.88
1.98
B
B
B
B
B
A
A
A
A
A
A
C
C
C
446
485
527
563
600
633
665
697
726
756
783
811
835
858
BHP
4800
5000
Sheave/Mtr
RPM
Turns Open
6
5
4
3
1.5
5.5
4.5
4
3
2.5
1.5
4
3
2.5
BHP
Sheave/Mtr
0.68
B
0.78
B
0.88
B
0.98
B
1.08
B
1.18
A
1.28
A
1.48
A
1.58
A
1.68
A
1.78
A
1.88
C
1.98
C
2.08
E
RPM
452
495
532
567
604
636
670
700
729
759
786
813
838
864
6
5
4
2.5
1.5
5.5
4.5
3.5
3
2
1.5
4
3
2.5
0.86
0.96
1.06
1.16
1.26
1.36
1.46
1.56
1.66
1.76
1.86
2.06
2.16
2.26
Turns Open
BHP
Sheave/Mtr
B
B
B
B
A
A
A
A
A
A
A
E
E
E
RPM
Turns Open
460
6
500
4.5
536
3.5
570
2.5
606
6
638
5.5
671
4.5
701
3.5
729
2.5
759
2
786
1
814
4
839
3.5
865
2.5
5400
BHP
Sheave/Mtr
RPM
Turns Open
0.86
B
463
5.5
0.96
B
504
4.5
1.06
B
539
3.5
1.18
B
576
2.5
1.28
A
609
6
1.38
A
641
5
1.48
A
674
4.5
1.58
A
703
3.5
1.68
A
734
2.5
1.78
A
762
2
1.88
A
788
1
2.08
E
816
4
2.18
E
841
3.5
2.28
E
867
2.5
5600
BHP
Sheave/Mtr
RPM
Turns Open
0.88
B
474
5.5
0.98
B
510
4
1.08
B
545
3
1.28
B
581
2
1.38
A
613
6
1.48
A
647
5
1.58
A
677
4
1.68
A
706
3
1.78
A
737
2.5
1.88
A
764
1.5
2.08
D
793
1.5
2.18
E
818
4
2.24
E
843
3.5
2.44
E
869
2.5
5800
BHP
Sheave/Mtr
RPM
Turns Open
0.88
B
440
6
0.98
B
481
5
1.08
B
517
4
1.18
B
551
3
1.28
B
586
2
1.48
A
618
5.5
1.58
A
651
4.5
1.68
A
681
4
1.78
A
710
3
1.88
A
740
2
2.08
D
767
2
2.18
D
795
1.5
2.28
E
821
3.5
2.38
E
845
3
2.48
E
872
2
BHP
2.58
5200
0.98
1.08
1.18
1.28
1.38
1.48
1.68
1.78
1.88
2.08
2.18
2.28
2.38
2.48
Sheave/Mtr
B
B
B
B
B
A
A
A
A
D
D
D
E
E
E
RPM
Turns Open
455
6
492
5
526
3.5
563
2.5
595
1.5
628
5.5
658
4.5
687
3.5
718
3
745
2.5
774
2
800
1.5
826
3.5
852
3
876
2
6200
BHP
Sheave/Mtr
RPM
Turns Open
1.06
B
459
5.5
1.18
B
499
4.5
1.28
B
533
3.5
1.38
B
569
2.5
1.48
B
600
1.5
1.68
A
633
5.5
1.78
A
663
4
1.88
A
691
3.5
1.98
A
722
2.5
2.08
D
749
2.5
2.28
D
777
2
2.38
D
803
1
2.48
E
828
3.5
2.68
E
854
3
2.78
E
878
2
6400
BHP
Sheave/Mtr
RPM
Turns Open
0.98
B
441
6
1.08
B
478
5.5
1.28
B
513
4
1.38
B
549
3
1.48
B
581
2
1.68
A
614
6
1.78
A
644
5
1.88
A
672
4
1.98
A
703
3.5
2.08
D
730
3
2.28
D
759
2.5
2.38
D
785
1.5
2.48
D
810
1
2.68
E
837
3
2.78
E
861
2.5
2.88
E
887
2
6600
BHP
Sheave/Mtr
RPM
Turns Open
1.08
B
456
6
1.28
B
495
5
1.38
B
529
3.5
1.48
B
561
2.5
1.66
B
595
2
1.78
A
625
5.5
1.88
A
656
4.5
1.98
A
685
4
2.08
D
712
3.5
2.28
D
741
3
2.46
D
767
2
2.58
D
795
1.5
2.68
E
820
3.5
2.88
E
844
3
2.98
E
870
2.5
6800
BHP
Sheave/Mtr
RPM
Turns Open
1.26
B
471
5.5
1.38
B
506
4.5
1.48
B
539
3.5
1.58
B
574
2.5
1.68
A
604
6
1.88
A
633
5.5
1.98
A
664
4.5
2.08
D
692
4
2.28
D
721
3
2.38
D
747
2.5
2.48
D
773
2
2.68
D
800
1
2.88
E
825
3.5
2.98
E
851
2.5
7000
BHP
Sheave/Mtr
RPM
Turns Open
1.28
B
486
5
1.48
B
520
4
1.58
B
555
3
1.68
B
586
2
1.88
A
615
6
1.98
A
647
5
2.08
D
674
4.5
2.28
D
704
3.5
2.46
D
730
3
2.58
D
756
2.5
2.68
D
784
1.5
2.88
D
808
1
2.98
E
835
3
6000
A = Standard Static/Standard Motor, B = Low Static/Standard Motor, C = High Static/Standard Motor, D = Standard Static/Large Motor, E = High Static/Large Motor
Unit factory shipped with standard static sheave and drive at 2.5 turns open. Other speed require field selection.
For applications requiring higher static pressures, contact your local representative. Performance data does not include drive losses and is based on sea level conditions.
Do not operate in black regions. All airflow in rated at lowest Voltage if unit is dual Voltage rated, i.e. 208V for 208-230V units.
23
Submittal Data - Large HKV
Blower Performance Data – HKV192 - Standard Unit
All Data is Wet Coil
Airflow
(SCFM)
ESP
Airflow (cfm) at External Static Pressure (in. wg)
0.00
0.10
0.20
0.30
0.40
0.50
0.60
0.70
0.80
0.90
1.00
1.10
1.20
1.30
1.40
1.50
0.68
0.78
0.88
0.98
1.08
1.18
1.28
1.38
1.48
1.58
1.68
1.78
1.88
1.98
Sheave/Mtr
B
B
B
B
B
A
A
A
A
A
A
C
C
C
RPM
Turns Open
446
6
485
5
527
4
563
3
600
1.5
633
5.5
665
4.5
697
4
726
3
756
2.5
783
1.5
811
3.5
835
3
858
2.5
BHP
0.68
0.78
0.88
0.98
1.08
1.18
1.28
1.48
1.58
1.68
1.78
1.88
1.98
2.08
B
B
B
B
B
A
A
A
A
A
A
C
C
C
452
495
532
567
604
636
670
700
729
759
786
813
838
864
BHP
4800
5000
Sheave/Mtr
RPM
Turns Open
BHP
5200
5400
5600
6
5
4
2.5
1.5
5.5
4.5
3.5
3
2.5
1.5
3.5
3
2.5
0.86
0.96
1.06
1.16
1.26
1.36
1.46
1.56
1.66
1.76
1.86
2.06
2.16
2.26
Sheave/Mtr
B
B
B
B
B
A
A
A
A
A
A
C
C
C
RPM
Turns Open
460
6
500
5
536
3.5
570
2.5
606
1.5
638
5
671
4.5
701
3.5
729
3
759
2.5
786
1
814
4
839
3
865
2.5
BHP
0.86
0.96
1.06
1.18
1.28
1.38
1.48
1.58
1.68
1.78
1.88
2.08
2.18
2.28
B
B
B
B
A
A
A
A
A
A
A
C
C
C
463
504
539
576
609
641
674
703
734
762
788
816
841
867
Sheave/Mtr
RPM
Turns Open
5.5
4.5
3.5
2.5
6
5
4
3.5
2.5
2
1
4
3
2.5
BHP
Sheave/Mtr
0.88
B
0.98
B
1.08
B
1.28
B
1.38
A
1.48
A
1.58
A
1.68
A
1.78
A
1.88
A
2.08
A
2.18
C
2.24
C
2.44
C
RPM
474
510
545
581
613
647
677
706
737
764
793
818
843
869
Turns Open
5.5
4.5
3
2
6
5
4
3.5
2.5
2
1.5
4
3
2.5
5800
BHP
Sheave/Mtr
RPM
Turns Open
0.88
B
440
6
0.98
B
481
5
1.08
B
517
4
1.18
B
551
3
1.28
B
586
2
1.48
A
618
6
1.58
A
651
4.5
1.68
A
681
4
1.78
A
710
3
1.88
A
740
2.5
2.08
A
767
2
2.18
A
795
1.5
2.28
C
821
3.5
2.38
C
845
3
2.48
C
872
2.5
6000
BHP
Sheave/Mtr
RPM
Turns Open
0.98
B
455
6
1.08
B
492
5
1.18
B
526
4
1.28
B
563
2.5
1.38
B
595
1.5
1.48
A
628
5.5
1.68
A
658
4.5
1.78
A
687
3.5
1.88
A
718
3
2.08
A
745
2.5
2.18
A
774
2
2.28
A
800
1.5
2.38
C
826
3.5
2.48
C
852
3
2.58
C
876
2
6200
BHP
Sheave/Mtr
RPM
Turns Open
1.06
B
459
6
1.18
B
499
4.5
1.28
B
533
3.5
1.38
B
569
2.5
1.48
B
600
1.5
1.68
A
633
5.5
1.78
A
663
4.5
1.88
A
691
3.5
1.98
A
722
3
2.08
A
749
2
2.28
A
777
1.5
2.38
A
803
1
2.48
C
828
3.5
2.68
C
854
3
2.78
C
878
2
6400
BHP
Sheave/Mtr
RPM
Turns Open
0.98
B
441
6
1.08
B
478
5
1.28
B
513
4.5
1.38
B
549
3
1.48
B
581
2
1.68
A
614
6
1.78
A
644
5
1.88
A
672
4
1.98
A
703
3.5
2.08
A
730
2.5
2.28
A
759
2
2.38
A
785
1.5
2.48
A
810
1
2.68
C
837
3.5
2.78
C
861
2.5
2.88
C
887
2
BHP
3.08
1.08
1.28
1.38
1.48
1.66
1.78
1.88
1.98
2.08
2.28
2.46
2.58
2.68
2.88
2.98
Sheave/Mtr
B
B
B
B
B
A
A
A
A
A
A
A
C
C
C
E
RPM
Turns Open
456
6
495
5
529
4
561
3
595
2
625
6
656
4.5
685
4
712
3.5
741
2.5
767
2
795
1.5
820
3.5
844
3
870
2.5
893
2
6800
BHP
Sheave/Mtr
RPM
Turns Open
1.26
B
471
5.5
1.38
B
506
4.5
1.48
B
539
3.5
1.58
B
574
2.5
1.68
A
604
6
1.88
A
633
5.5
1.98
A
664
4.5
2.08
A
692
4
2.28
A
721
3
2.38
A
747
2.5
2.48
A
773
2
2.68
A
800
1.5
2.88
C
825
3.5
2.98
C
851
3
3.08
E
875
2
3.28
E
898
1.5
7000
BHP
Sheave/Mtr
RPM
Turns Open
1.28
B
486
5
1.48
B
520
4
1.58
B
555
3
1.68
B
586
2
1.88
A
615
6
1.98
A
647
5
2.08
A
674
4.5
2.28
A
704
3.5
2.46
A
730
3
2.58
A
756
2
2.68
A
784
1.5
2.88
C
808
3.5
2.98
C
835
3
3.08
E
858
2.5
3.28
E
883
2
3.48
E
906
1.5
BHP
Sheave/Mtr
RPM
1.48
B
495
1.58
B
528
1.68
B
562
1.88
B
593
1.98
A
624
2.08
A
652
2.28
A
680
2.38
A
708
2.48
A
734
2.68
A
762
2.88
A
787
2.98
C
812
3.08
E
838
3.28
E
861
3.48
E
886
3.66
E
909
6600
7200
7400
7600
7800
8000
Turns Open
4.5
4
2.5
1.5
6
5
4
3.5
3
2
1.5
4
3
2.5
2
1.5
BHP
Sheave/Mtr
RPM
1.58
B
506
1.68
B
541
1.86
B
572
1.98
A
605
2.08
A
633
2.28
A
661
2.38
A
690
2.48
A
716
2.68
A
744
2.88
A
769
2.98
A
793
3.08
E
820
3.28
E
843
3.48
E
868
3.58
E
891
3.68
E
913
Turns Open
4.5
3.5
2.5
6
5.5
4.5
4
3
2.5
2
1.5
4
3
2.5
1.5
1
BHP
Sheave/Mtr
RPM
Turns Open
BHP
Sheave/Mtr
RPM
Turns Open
1.68
B
515
4
1.78
B
525
4
1.78
B
549
3
1.88
B
556
2.5
1.88
B
580
2
2.08
B
586
2
2.08
A
611
6
2.18
A
617
5.5
2.26
A
640
5.5
2.28
A
645
5
2.38
A
667
4.5
2.48
A
674
4
2.48
A
696
3.5
2.68
A
701
3.5
2.68
A
721
3
2.78
A
726
3
2.86
A
749
2.5
2.88
A
753
2.5
2.98
A
773
2
3.08
D
778
1.5
3.08
D
798
1
3.28
D
804
1
3.28
E
823
3.5
3.38
E
827
3.5
3.46
E
847
3
3.48
E
850
2.5
3.58
E
872
2
3.68
E
875
2
3.68
E
894
1.5
3.88
E
897
1.5
3.88
E
918
1
4.08
E
921
1
BHP
Sheave/Mtr
RPM
1.88
B
539
2.08
B
569
2.18
B
601
2.28
A
629
2.48
A
659
2.68
A
685
2.88
A
711
2.98
A
738
3.08
D
763
3.28
D
789
3.48
E
812
3.58
E
835
3.68
E
860
3.88
E
882
4.08
E
906
4.28
E
927
Turns Open
3
2.5
1.5
5.5
4.5
4
3
2.5
2
1.5
4
3
2.5
2
1.5
1
A = Standard Static/Standard Motor, B = Low Static/Standard Motor, C = High Static/Standard Motor, D = Standard Static/Large Motor, E = High Static/Large Motor
Unit factory shipped with standard static sheave and drive at 2.5 turns open. Other speed require field selection.
For applications requiring higher static pressures, contact your local representative. Performance data does not include drive losses and is based on sea level conditions.
Do not operate in black regions. All airflow in rated at lowest Voltage if unit is dual Voltage rated, i.e. 208V for 208-230V units.
24
Submittal Data - Large HKV
Blower Performance Data – HKV240 - Standard Unit
All Data is Wet Coil
Airflow
(SCFM)
6000
6200
ESP
Airflow (cfm) at External Static Pressure (in. wg)
0.00
0.10
0.20
0.30
0.40
0.50
0.60
0.70
0.80
0.90
1.00
1.10
1.20
1.30
1.40
1.50
BHP
1.18
1.28
1.38
1.48
1.68
1.78
1.88
2.08
2.18
2.28
2.38
2.48
2.68
Sheave/Mtr
B
B
B
B
A
A
A
A
A
A
A
A
C
RPM
529
563
595
626
659
689
717
745
774
801
826
851
877
Turns Open
6
5
4
3
6
5
4.5
4
3.5
2.5
2
1
5.5
BHP
1.28
1.38
1.48
1.68
1.78
1.88
2.08
2.18
2.28
2.38
2.48
2.68
2.88
Sheave/Mtr
B
B
B
B
A
A
A
A
A
A
A
A
C
RPM
542
575
607
637
670
699
726
754
783
809
834
859
884
Turns Open
BHP
6400
6600
6800
1.28
7400
8000
8200
8400
8600
8800
5.5
5
4.5
3.5
3
2.5
1.5
1
5
1.88
2.08
2.18
2.28
2.48
2.58
2.68
2.88
3.06
B
B
B
B
A
A
A
A
A
A
A
A
C
C
556
588
619
649
680
708
736
765
791
817
841
868
891
Turns Open
6
5
4
3.5
6
5.5
4.5
4
3.5
2.5
2
1.5
5.5
5
BHP
1.38
1.48
1.68
1.78
1.88
2.08
2.18
2.28
2.48
2.58
2.68
2.88
2.98
3.08
Sheave/Mtr
B
B
B
B
A
A
A
A
A
A
A
A
C
C
RPM
537
570
601
631
662
691
718
745
774
799
824
849
875
898
Turns Open
5.5
4.5
4
3
5.5
5
4.5
3.5
3
2.5
2
1
5
4.5
BHP
1.48
1.68
1.78
1.88
2.08
2.18
2.28
2.48
2.58
2.68
2.88
2.98
3.08
3.28
Sheave/Mtr
B
B
B
B
A
A
A
A
A
A
A
A
C
C
RPM
551
583
613
642
674
701
728
754
783
808
833
857
882
905
1.48
5.5
4.5
3.5
2.5
5.5
5
4
3.5
3
2
1.5
1
5
4.5
1.68
1.78
1.88
2.08
2.18
2.28
2.48
2.58
2.68
2.88
3.08
3.18
3.28
3.48
Sheave/Mtr
B
B
B
B
A
A
A
A
A
A
A
A
C
C
C
RPM
530
565
596
625
654
684
711
738
766
792
816
841
867
890
913
Turns Open
6
5
4
3
6
5
4.5
4
3
2.5
2
1.5
5.5
4.5
4
BHP
1.68
1.78
1.88
2.08
2.18
2.28
2.48
2.68
2.78
2.88
3.08
3.18
3.28
3.48
3.68
Sheave/Mtr
B
B
B
B
A
A
A
A
A
A
A
A
C
C
C
RPM
544
578
608
637
668
695
722
748
776
800
825
849
874
897
920
Turns Open
5.5
4.5
3.5
2.5
5.5
5
4.5
3.5
3
2.5
1.5
1
5
4.5
4
BHP
1.78
1.88
2.08
2.28
2.38
2.48
2.68
2.78
2.88
3.08
3.28
3.38
3.48
3.68
3.88
Sheave/Mtr
B
B
B
B
A
A
A
A
A
A
A
C
C
C
C
RPM
561
592
621
649
679
706
732
758
785
809
833
857
882
905
927
BHP
7800
3
1.78
520
Turns Open
7600
3.5
1.68
RPM
BHP
7200
4.5
1.48
Sheave/Mtr
Turns Open
7000
5.5
1.38
1.78
5
4
3
2.5
5.5
4.5
4
3.5
2.5
2
1.5
5.5
5
4.5
3.5
1.88
2.08
2.18
2.28
2.48
2.68
2.78
2.88
3.08
3.28
3.38
3.48
3.68
3.88
4.08
Sheave/Mtr
B
B
B
B
A
A
A
A
A
A
A
A
C
C
C
C
RPM
544
575
605
633
661
691
717
742
767
794
818
842
867
890
912
934
Turns Open
5.5
4.5
3.5
3
5.5
5
4.5
4
3
2.5
2
1
5.5
5
4
3.5
BHP
1.88
2.08
2.28
2.38
2.48
2.68
2.88
2.98
3.08
3.28
3.48
3.58
3.68
3.88
4.08
4.28
Sheave/Mtr
B
B
B
A
A
A
A
A
A
A
A
A
C
C
C
C
RPM
555
589
618
646
676
702
728
753
779
803
827
850
875
898
920
941
Turns Open
5
4
3
6
5.5
4.5
4
3.5
3
2
1.5
1
5
4.5
4
3.5
BHP
2.08
2.18
2.28
2.48
2.68
2.88
2.98
3.08
3.28
3.48
3.58
3.68
3.88
4.08
4.28
4.48
Sheave/Mtr
B
B
B
A
A
A
A
A
A
A
A
C
C
C
C
C
RPM
572
601
630
657
686
712
737
762
789
812
836
859
883
905
927
948
Turns Open
4.5
3.5
3
5.5
5
4.5
4
3
2.5
2
1.5
5.5
5
4.5
4
3.5
BHP
2.28
2.38
2.48
2.68
2.88
2.98
3.08
3.28
3.48
3.68
3.78
3.88
4.08
4.28
4.48
4.68
Sheave/Mtr
B
B
B
A
A
A
A
A
A
A
A
C
C
C
C
C
RPM
589
617
645
672
700
726
751
775
801
824
847
872
894
915
937
960
Turns Open
4
3.5
2.5
5.5
4.5
4
3.5
3
2.5
1.5
1
5.5
5
4.5
4
3
BHP
2.48
2.58
2.68
2.88
3.08
3.18
3.28
3.48
3.68
4
4.08
4.18
4.28
4.48
4.68
4.88
Sheave/Mtr
B
B
A
A
A
A
A
A
A
A
A
C
C
C
C
C
RPM
605
633
660
689
714
739
763
790
813
836
858
882
904
925
946
969
Turns Open
3.5
3
5.5
5
4.5
4
3
2.5
2
1.5
1
5
4.5
4
3.5
3
BHP
2.58
2.68
2.88
3.08
3.28
3.38
3.48
3.68
4
4.08
4.28
4.48
4.58
4.68
4.88
5.08
Sheave/Mtr
B
A
A
A
A
A
A
A
A
A
C
C
C
C
C
E
RPM
621
649
675
703
728
752
776
802
827
847
869
893
914
935
956
979
Turns Open
3
6
5.5
4.5
4
3.5
3
2.5
2
1
5.5
5
4.5
4
3.5
2.5
BHP
2.78
2.88
3.08
3.28
3.48
3.68
3.78
4
4.08
4.28
4.48
4.68
4.88
4.98
5.08
5.28
Sheave/Mtr
B
A
A
A
A
A
A
A
A
A
C
C
C
C
E
E
RPM
637
664
690
717
742
766
791
814
836
858
882
904
925
945
968
988
Turns Open
2.5
5.5
5
4.5
3.5
3
2.5
2
1.5
1
5
4.5
4
3.5
3
2.5
A = Standard Static/Standard Motor, B = Low Static/Standard Motor, C = High Static/Standard Motor, D = Standard Static/Large Motor, E = High Static/Large Motor
Unit factory shipped with standard static sheave and drive at 2.5 turns open. Other speed require field selection.
For applications requiring higher static pressures, contact your local representative. Performance data does not include drive losses and is based on sea level conditions. Do not operate in black regions. All
airflow in rated at lowest Voltage if unit is dual Voltage rated, i.e. 208V for 208-230V units.
Table Continued on Next Page
25
Submittal Data - Large HKV
Blower Performance Data – HKV240 - Standard Unit
Table Continued from Previous Page
All Data is Wet Coil
Airflow
(SCFM)
9000
9200
9400
9600
9800
10000
ESP
Airflow (cfm) at External Static Pressure (in. wg)
0.00
0.10
0.20
0.30
0.40
0.50
0.60
0.70
0.80
0.90
1.00
1.10
1.20
1.30
1.40
1.50
BHP
2.98
3.08
3.28
3.48
3.68
3.88
4.08
4.18
4.28
4.48
4.68
4.88
5.08
5.28
5.48
5.68
Sheave/Mtr
A
A
A
A
A
A
A
A
A
C
C
C
E
E
E
E
RPM
653
679
707
731
755
779
804
826
848
870
893
914
935
955
978
997
Turns Open
6
5
4.5
4
3.5
3
2.5
2
1.5
5.5
5
4.5
4
3.5
2.5
2
BHP
3.18
3.28
3.48
3.68
3.88
4.08
4.28
4.48
4.68
4.78
4.88
5.08
5.28
5.48
5.68
5.88
Sheave/Mtr
A
A
A
A
A
A
A
A
A
C
C
E
E
E
E
E
RPM
668
694
721
745
768
791
816
838
860
883
904
925
945
967
987
1007
Turns Open
5.5
5
4
3.5
3
2.5
2
1.5
1
5
4.5
4
3.5
3
2.5
2
BHP
3.48
3.68
3.78
3.88
4.08
4.28
4.48
4.68
4.88
5.08
5.28
5.38
5.48
5.68
5.88
6.08
Sheave/Mtr
A
A
A
A
A
A
A
A
C
E
E
E
E
E
E
E
RPM
683
711
735
758
782
806
828
850
871
894
915
935
955
977
997
1016
Turns Open
5
4.5
4
3.5
3
2.5
2
1
5.5
5
4.5
4
3.5
3
2
2
BHP
3.68
3.88
3.98
4.08
4.28
4.48
4.68
4.88
5.08
5.28
5.48
5.68
5.88
6.08
6.28
6.48
Sheave/Mtr
A
A
A
A
A
A
A
A
E
E
E
E
E
E
E
E
RPM
698
725
749
772
795
819
836
862
883
906
926
946
968
987
1007
1025
Turns Open
4.5
4
3.5
3
2.5
2
1.5
1
5
4.5
4
3.5
3
2.5
2
1.5
BHP
3.88
4.08
4.28
4.48
4.68
4.88
4.98
5.08
5.28
5.48
5.68
5.88
6.08
6.28
6.48
6.68
Sheave/Mtr
A
A
A
A
A
A
A
E
E
E
E
E
E
E
E
E
RPM
715
739
762
785
810
831
853
874
896
917
937
956
978
997
1016
1035
Turns Open
4.5
4
3.5
3
2.5
1.5
1
5.5
4.5
4.5
3.5
3
3
2.5
2
1.5
BHP
4.08
4.28
4.48
4.68
4.88
5.08
5.28
5.48
5.68
5.88
6.08
6.28
6.48
6.68
6.78
6.88
Sheave/Mtr
A
A
A
A
A
E
E
E
E
E
E
E
E
E
E
E
RPM
730
753
776
798
822
844
865
885
908
928
948
967
988
1007
1026
1044
Turns Open
4
3.5
3
2.5
2
6
5.5
5
4.5
4
3.5
3
2.5
2
1.5
1
A = Standard Static/Standard Motor, B = Low Static/Standard Motor, C = High Static/Standard Motor, D = Standard Static/Large Motor, E = High Static/Large Motor
Unit factory shipped with standard static sheave and drive at 2.5 turns open. Other speed require field selection.
For applications requiring higher static pressures, contact your local representative. Performance data does not include drive losses and is based on sea level conditions. Do not operate in black regions. All
airflow in rated at lowest Voltage if unit is dual Voltage rated, i.e. 208V for 208-230V units.
26
Submittal Data - Large HKV
Blower Performance Data – HKV300 - Standard Unit
All Data is Wet Coil
Airflow
(SCFM)
ESP
Airflow (cfm) at External Static Pressure (in. wg)
0.00
0.10
0.20
0.30
0.40
0.50
0.60
0.70
0.80
0.90
1.00
1.10
1.20
1.30
1.40
1.50
2.08
2.28
2.48
2.58
2.68
2.88
3.08
3.28
3.48
3.68
3.88
Sheave/Mtr
B
B
B
B
A
A
A
A
A
A
A
RPM
Turns Open
659
5.5
688
4.5
718
3.5
746
3
774
6
802
5
829
4.5
855
3.5
879
3
905
2
931
1.5
2.08
2.28
2.38
2.48
2.68
2.88
3.08
3.28
3.48
3.68
3.88
4.06
B
B
B
B
B
A
A
A
A
A
A
A
639
669
702
729
757
785
811
838
862
887
913
938
BHP
7600
BHP
7800
8000
Sheave/Mtr
RPM
Turns Open
5.5
5
4
3
2.5
5.5
5
4
3.5
2.5
2
1
BHP
2.28
2.38
2.48
2.68
2.88
3.08
3.28
3.38
3.48
3.68
3.88
4.08
Sheave/Mtr
B
B
B
B
B
A
A
A
A
A
A
A
RPM
Turns Open
651
5.5
683
4.5
710
3.5
739
3
767
2
794
5.5
821
4.5
845
4
870
3
895
2.5
920
1.5
945
1
2.18
2.28
2.48
2.68
2.88
3.08
3.28
3.38
3.48
3.68
3.88
4.08
4.28
B
B
B
B
B
A
A
A
A
A
A
A
C
631
661
692
722
750
778
804
831
854
879
904
928
951
BHP
8200
8400
8600
Sheave/Mtr
RPM
Turns Open
6
5
4
3.5
2.5
6
5
4.5
3.5
3
2
1.5
3.5
BHP
Sheave/Mtr
2.28
B
2.48
B
2.68
B
2.88
B
3.08
B
3.18
A
3.28
A
3.48
A
3.68
A
3.88
A
4.08
A
4.28
A
4.48
C
958
RPM
640
673
703
733
761
788
812
838
863
888
912
934
Turns Open
5.5
5
4
3
2
5.5
5
4
3.5
2.5
2
1
3
BHP
Sheave/Mtr
RPM
2.48
B
653
2.68
B
685
2.88
B
715
3.08
B
744
3.18
A
771
3.28
A
796
3.48
A
822
3.68
A
847
3.88
A
872
4.08
A
896
4.28
A
919
4.48
A
942
4.68
C
966
5.5
4.5
3.5
2.5
6
5.5
4.5
4
3
2.5
1.5
1
3
8800
BHP
Sheave/Mtr
RPM
Turns Open
Turns Open
2.48
B
633
6
2.68
B
666
5
2.88
B
697
4
3.08
B
726
3
3.18
B
755
2.5
3.28
A
782
5.5
3.48
A
806
5
3.68
A
832
4
3.88
A
857
3.5
4.08
A
881
3
4.28
A
904
2
4.48
A
927
1.5
4.68
C
950
3.5
4.88
C
973
2.5
9000
BHP
Sheave/Mtr
RPM
Turns Open
2.6
B
646
5.5
2.8
B
678
4.5
3
B
706
3.5
3.2
B
735
3
3.4
B
763
2
3.6
A
791
5.5
3.8
A
817
4.5
4
A
842
4
4.2
A
867
3
4.4
A
889
2.5
4.6
A
912
2
4.8
A
935
1
5
C
958
3
5.2
E
980
2.5
9200
BHP
Sheave/Mtr
RPM
Turns Open
2.68
B
656
5.5
2.88
B
687
4.5
3.08
B
715
3.5
3.28
B
744
2.5
3.48
A
772
6
3.68
A
799
5
3.88
A
825
4.5
4.08
A
850
3.5
4.28
A
872
3
4.48
A
896
2.5
4.68
A
919
1.5
4.88
A
942
1
5.08
E
963
3
5.28
E
987
2.5
5.48
BHP
2.68
2.88
3.08
3.28
3.48
3.68
3.88
4.08
4.28
4.48
4.68
4.88
5.08
5.28
Sheave/Mtr
B
B
B
B
B
A
A
A
A
A
A
A
E
E
E
RPM
Turns Open
637
6
666
5
697
4
727
3
755
2.5
783
5.5
809
5
835
4
858
3.5
882
2.5
905
2
928
1.5
951
3.5
973
3
994
2
9600
BHP
Sheave/Mtr
RPM
Turns Open
2.88
B
647
5.5
3.08
B
678
4.5
3.28
B
708
3.5
3.48
B
738
3
3.68
A
766
6
3.88
A
793
5
4.08
A
819
4.5
4.28
A
844
4
4.48
A
867
3
4.68
A
891
2.5
4.88
A
914
2
5.08
D
937
1
5.28
E
959
3
5.48
E
980
2.5
5.68
E
1001
2
9800
BHP
Sheave/Mtr
RPM
Turns Open
2.88
B
631
6
3.08
B
662
5
3.28
B
690
4
3.48
B
720
3.5
3.68
B
749
2.5
3.88
A
777
5.5
4.08
A
803
5
4.28
A
827
4.5
4.48
A
852
3.5
4.68
A
877
2.5
4.88
A
900
2
5.08
D
923
1.5
5.28
E
946
3.5
5.48
E
966
3
5.68
E
988
2.5
5.88
E
1009
2
10000
BHP
Sheave/Mtr
RPM
Turns Open
3.08
B
642
5.5
3.28
B
672
4.5
3.48
B
702
4
3.68
B
731
3
3.88
B
760
2
4.08
A
785
5.5
4.28
A
811
4.5
4.48
A
837
4
4.68
A
862
3.5
4.88
A
886
2.5
5.08
D
909
2
5.28
D
932
1
5.48
E
953
3
5.68
E
975
2.5
5.88
E
996
2
6.08
E
1017
2
BHP
3.28
3.48
3.68
3.88
4.08
4.28
4.48
4.68
4.88
5.08
5.28
5.48
5.68
5.88
6.08
6.38
Sheave/Mtr
RPM
Turns Open
B
655
5
B
685
4.5
B
714
3.5
B
743
2.5
A
769
6
A
798
5
A
822
4.5
A
847
3.5
A
872
3
D
896
2.5
D
917
1.5
D
940
1
E
962
3
E
983
2.5
E
1005
2
E
1025
1.5
10400
BHP
Sheave/Mtr
RPM
Turns Open
3.48
B
668
5
3.68
B
697
4
3.88
B
726
3
4.08
B
752
2.5
4.28
A
782
5.5
4.48
A
806
5
4.68
A
832
4
4.88
A
857
3.5
5.08
D
882
2.5
5.28
D
903
2
5.48
E
926
1.5
5.68
E
949
3.5
5.88
E
971
3
6.18
E
992
2.5
6.38
E
1013
2
6.58
E
1032
1.5
10600
BHP
Sheave/Mtr
RPM
Turns Open
3.68
B
680
4.5
3.88
B
709
3.5
4.08
B
737
3
4.28
B
763
2
4.48
A
790
5.5
4.68
A
817
4.5
4.88
A
842
4
5.08
D
867
3
5.28
D
889
2.5
5.48
D
912
2
5.68
D
935
1
5.88
E
957
3
6.18
E
979
2.5
6.38
E
1000
2
6.58
E
1021
1.5
6.78
E
1042
1
9400
10200
A = Standard Static/Standard Motor, B = Low Static/Standard Motor, C = High Static/Standard Motor, D = Standard Static/Large Motor, E = High Static/Large Motor
Unit factory shipped with standard static sheave and drive at 2.5 turns open. Other speed require field selection.
For applications requiring higher static pressures, contact your local representative. Performance data does not include drive losses and is based on sea level conditions. Do not operate in black regions. All
airflow in rated at lowest Voltage if unit is dual Voltage rated, i.e. 208V for 208-230V units.
Table Continued on Next Page
27
Submittal Data - Large HKV
Blower Performance Data – HKV300 - Standard Unit
Table Continued from Previous Page
All Data is Wet Coil
Airflow
(SCFM)
ESP
Airflow (cfm) at External Static Pressure (in. wg)
0.00
0.10
0.20
0.30
0.40
0.50
0.60
0.70
0.80
0.90
1.00
1.10
1.20
1.30
1.40
1.50
10800
BHP
Sheave/Mtr
RPM
Turns Open
3.88
B
691
4.5
4.08
B
717
3.5
4.28
B
745
2.5
4.48
A
772
6
4.68
A
799
5
4.88
A
825
4.5
5.08
D
850
3.5
5.28
D
873
3
5.48
D
897
2
5.68
D
920
1.5
5.88
E
943
3.5
6.18
E
965
3
6.38
E
986
2.5
6.58
E
1006
2
6.78
E
1026
1.5
6.98
E
1047
1
11000
BHP
Sheave/Mtr
RPM
Turns Open
4.08
B
704
3.5
4.28
B
729
3
4.48
B
756
2
4.68
A
783
5.5
4.88
A
810
5
5.08
D
836
4
5.28
D
859
3
5.48
D
883
2.5
5.68
D
907
2
6.18
D
929
1.5
6.28
E
952
3.5
6.48
E
972
3
6.68
E
993
2.5
6.88
E
1014
2
7.08
E
1035
1
7.38
E
1055
0.5
11200
BHP
Sheave/Mtr
RPM
Turns Open
4.28
B
714
3.5
4.48
B
740
2.5
4.68
A
767
6
4.88
A
794
5.5
5.08
D
818
4.5
5.28
D
844
3.5
5.48
D
868
3
5.68
D
892
2.5
6.00
D
916
1.5
6.28
D
938
1
6.48
E
959
3
6.68
E
981
2.5
6.88
E
1002
2
7.08
E
1023
1.5
7.38
E
1043
1
11400
BHP
Sheave/Mtr
RPM
Turns Open
4.48
B
726
3
4.68
B
752
2
4.88
A
779
5.5
5.08
D
803
5
5.28
D
829
4.5
5.48
D
854
3.5
5.78
D
878
3
6.08
D
902
2
6.28
D
925
1.5
6.48
D
948
1
6.68
E
970
3
6.88
E
990
2.5
7.18
E
1011
2
7.48
E
1031
1.5
11600
BHP
Sheave/Mtr
RPM
Turns Open
4.68
B
738
2.5
4.88
A
763
6
5.08
D
788
5.5
5.28
D
813
4.5
5.48
D
839
4
5.68
D
864
3
6.00
D
888
2.5
6.28
D
911
2
6.48
D
934
1
6.68
E
955
3.5
6.88
E
977
2.5
7.18
E
998
2
7.48
E
1019
1.5
11800
BHP
Sheave/Mtr
RPM
Turns Open
4.88
B
750
2
5.08
D
775
5.5
5.28
D
799
5
5.48
D
824
4
5.78
D
849
3.5
6.08
D
874
3
6.28
D
898
2.5
6.48
D
921
2
6.68
D
944
1
6.98
E
964
3
7.28
E
986
2.5
7.48
E
1007
2
BHP
5.08
5.28
5.48
5.78
6.08
6.28
6.48
6.68
6.98
7.28
7.48
Sheave/Mtr
RPM
Turns Open
D
758
6
D
783
5.5
D
808
4.5
D
833
4
D
858
3.5
D
880
2.5
D
904
2
D
927
1.5
E
950
3.5
E
972
3
E
993
2.5
12200
BHP
Sheave/Mtr
RPM
Turns Open
5.28
D
769
6
5.48
D
794
5
5.78
D
819
4.5
6.08
D
843
4
6.28
D
866
3
6.48
D
890
2.5
6.68
D
913
2
6.98
D
936
1.5
7.28
E
958
3
7.48
E
980
2.5
12400
BHP
Sheave/Mtr
RPM
Turns Open
5.68
D
781
5.5
5.88
D
815
4.5
6.08
D
830
4.5
6.28
D
854
3.5
6.48
D
878
3
6.78
D
900
2
7.08
D
923
1.5
7.28
D
946
1
7.48
E
968
3
12600
BHP
Sheave/Mtr
RPM
Turns Open
5.88
D
793
5
6.08
D
817
4.5
6.28
D
841
4
6.58
D
863
3
6.88
D
886
2.5
7.08
D
910
2
7.28
D
933
1.5
12000
A = Standard Static/Standard Motor, B = Low Static/Standard Motor, C = High Static/Standard Motor, D = Standard Static/Large Motor, E = High Static/Large Motor
Unit factory shipped with standard static sheave and drive at 2.5 turns open. Other speed require field selection.
For applications requiring higher static pressures, contact your local representative. Performance data does not include drive losses and is based on sea level conditions.
Do not operate in black regions. All airflow in rated at lowest Voltage if unit is dual Voltage rated, i.e. 208V for 208-230V units.
28
Submittal Data - Large HKV
HK Physical Data
Model
084
096
Compressor Quantity
120
150
168
192
Scroll (1)
Factory Charge HFC-410 a (oz) [kg] per
circuit
240
300
Scroll (2)
140 [3.97]
156 [4.42]
224 [6.35]
248 [7.03]
140 [3.97]
156 [4.42]
224 [6.35]
248 [7.03]
Standard Motor (hp) [kW]
1.0 [.75]
1.5 [1.12]
2 [1.49]
3 [2.24]
2 [1.49]
3 [2.24]
5 [3.73]
5 [3.73]
Large Motor (hp) [kW]
1.5 [1.12]
2.0 [1.49]
3 [2.24]
5 [3.73]
3 [2.24]
5 [3.73]
7.5 [5.60]
7.5 [5.60]
Blower Motor
Blower Motor Quantity
1
Blower
No. of Blowers
1
Blower Wheel Size D x W (in) [cm]
2
15 x 11 [38.1 x 38.1]
15 x 15 [38.1 x 38.1]
15 x 11 [38.1 x 38.1]
15 x 15 [38.1 x 38.1]
Water Connection Size
FPT (in) [mm]
1-1/2" [38.1]
2" [50.8]
2-1/2" [63.5]
Coax Volume
Volume (US Gallons) [liters]
2.19 [8.28]
2.48 [9.37]
3.46 [13.11]
4.83 [18.29]
6.36 [24.08]
7.39 [27.98]
Condensate Connection Size
FPT (in) [mm]
1" [25.4]
Air Coil Data
Air Coil Dimensions H x W (in) [cm]
36 x 48 [91.4 x 121.9]
2 - 36 x 48 [91.4 x 121.9]
12 [1.11]
24 [2.22]
(QTY.4) 18 x 25 [45.74 x 63.5]
(QTY.8) 18 x 25 [45.74 x 63.5]
Air Coil Total Face Area (ft ) [m ]
2
2
Miscellaneous Data
Filter Standard - 1" [25.4mm]
Throwaway (qty) (in) [cm]
Weight - Operating (lbs) [kg]
880 [399]
930 [422]
960 [435]
1600 [725]
1665 [755]
1695 [769]
Weight - Packaged (lbs) [kg]
895 [406]
945 [429]
975 [442]
1630 [739]
1695 [769]
1725 [782]
All units have grommet compressor mountings, and 1/2" & 1-3/4" electrical knockouts.
For ClimaDry® option, add 125 lbs [57 kg] for 084-150 and 250 lbs [114 kg] for 168-300.
Unit Maximum Water Working Pressure
Options
Max Pressure PSIG [kPa]
Base Unit
300 [2,068]
Motorized Water Valve
300 [2,068]
Internal Secondary Pump or ClimaDry®
145 [999]
Use the lowest maximum pressure rating when multiple options are combined.
29
Submittal Data - Large HKV
HKV084-150 Dimensional Data
ALL CONFIGURATIONS REQUIRE SERVICE ACCESS AREA
DESCRIBED IN NOTES 7, 8, 9, AND 10.
7.6
F
D
7.6
AIR OUT
UPA
RETURN AIR
S
4
1
Q
R
3
CAP+MSP
P
AIR OUT
BLOWER
ROTATION
RETURN AIR
C
02
F
BSP
BSP
T
BSP
NRP
B
01
Control Box
U
NRP
3
2
L
CSP
4
Control Box
3
N
NRP
2
5
4
4
MK
3
5
K
CSP+CAP+MSP
A
L
M
1
NRP
NOTE 5
FRONT RETURN TOP DISCHARGE (FR/TD)
REAR RETURN TOP DISCHARGE (RR/TD)
NOTES:
LEGEND
1 Water Inlet (See Note 2)
2 Water Outlet (See Note 2)
3 Condensate Drain (See Note 3)
4 High Voltage Access (See Note 4)
5 Low Voltage Access (See Note 4)
BSP - Blower Service Panel
CAP - Control Access Panel
CSP - Compressor Access Panel
MSP - Motor Service Panel
NRP - Non Removable Panel
UPA - Upper Pulley Access
1.7
F
TLV084-120 TLV150
1-1/2” FPT
2” FPT
1-1/2” FPT
2” FPT
1” FPT
1-3/8” [3.49 CM]
7/8” [2.2 CM]
D
1. All dimensions in inches (cm)
2. Water inlet and water outlet connections are available on either side (left or right) of the
unit. Installer must plug water inlet/outlet not being connected to.
3. Condensate drain is available on either side (left or right) of unit. Drain hose and drain
connection will be tied inside the unit. Installer will untie the drain hose, form trap, and
connect to the condensate drain hole of installer’s choice.
4. Electrical access is available on either side (left or right) of unit and is also available in the
front on the left or right side of the unit.
5. Overall Depth - Add 3.12”(8 cm) for 1”(2.5 cm) or 2”(5 cm) Filter Frame; 5.12” for 4” Filter
Frame and for FD, RD additional 1.06”(2.7cm) for supply air duct flange.
6. Overall cabinet height dimension does not include duct flange when in top discharge
configuration.
7. While access to all removable panels may not be required, installer should take care to
comply with all building codes and allow adequate clearance for future field service.
8. Units require 3 feet(91 cm) clearance for water connections, CAP, CSP, MSP and BSP
service access.
9. Side service access must be 2 feet(9.4 cm) on any side that connections are made. If no
connections are made on a side then service access can be 6 inches(1.5 cm) minimum.
10. Filter removal is from bottom of frame, allow 2 feet(9.4 cm) access for servicing.
RETURN AIR
BSP
E
F
UPA
BSP
AIR OUT
AIR OUT
NRP
4
1
5
NRP
NRP
3
4
CAP+MSP
4
2
4
5
RETURN AIR
4
(See Notes 7 and 10)
Control Box
4
Control Box
3
4
CSP
4
NRP
Model
A
B
C
Discharge Connections
Duct Flange
D
E
Depth
Note 5
Width
Height
Note 6
Supply
Width
Supply
Depth
F
3
CSP+CAP+MSP
FRONT RETURN REAR DISCHARGE (FR/RD)
REAR RETURN FRONT DISCHARGE (RR/FD)
Overall Cabinet
5
1
SIDE
SERVICE ACCESS
(See Notes 7 and 9)
SERVICE ACCESS
3’ (91 CM)
FRONT AND BACK
(See Notes 7 and 8)
NRP
2
5
3
Water Connections
K
L
M
1
Water
Inlet
2
Water
Outlet
3
Condensate
Return Air Connections
Using Return Air Opening
Electrical Knockouts
N
O1
O2
P
Q
R
S
T
Return
Depth
Return
Height
U
V
084
-120
in.
cm.
34.0
86.4
53.1
134.9
79.0
200.7
17.5
44.5
17.6
44.6
17.8
45.1
31.0
78.7
3.0
7.6
27.0
68.6
25.6
65.1
31.0
78.7
38.0
96.4
34.6
87.7
1.0
2.5
3.0
7.6
48.0
121.9
32.4
82.2
44.6
113.3
2.7
6.9
150
in.
cm.
34.0
86.4
53.1
134.9
79.0
200.7
21.4
54.4
17.6
44.6
17.8
45.1
31.0
78.7
3.0
7.6
27.0
68.6
25.6
65.1
31.0
78.7
38.0
96.4
34.6
87.7
1.0
2.5
3.0
7.6
48.0
121.9
32.4
82.2
44.6
113.3
2.7
6.9
30
Submittal Data - Large HKV
HKV168-300 Dimensional Data
ALL CONFIGURATIONS REQUIRE SERVICE ACCESS AREA
DESCRIBED IN NOTES 7, 8, 9, AND 10.
V
7.6
F
D
7.6
D
AIR OUT
C
BSP
E
BSP
T
S
CAP
CSP
CSP+CAP
3
NRP
CSP
300
1.7
BSP
NOTE 5
NRP
RETURN
AIR
AIR OUT
4
1
5
3
4
NRP
AIR OUT
AIR OUT
RETURN
AIR
(See Notes 7 and 10)
Control Box
2
CSP
4
5
4
NRP
AIR OUT
2
4
NRP
F
BSP
RETURN AIR
MSP
CAP
5
RETURN AIR
3 Control Box
4
NRP
3
CSP+CAP
CSP
1
5
4
NRP
Service Access
Front and Back
(See Notes 7 and 8)
4
3
CSP+MSP
Side Service Access
(See Notes 7 and 9)
REAR RETURN FRONT DISCHARGE (RR/FD)
Overall Cabinet
A
K
D
NRP
Model
M
CSP+MSP
FRONT RETURN TOP DISCHARGE (FR/TD)
G
E
3
L
NOTES:
1. All dimensions in inches (cm)
2. Water inlet and water outlet connections are available on either side (left or right) of the unit.
Installer must plug water inlet/outlet not being connected to.
3. Condensate drain is available on either side (left or right) of unit. Drain hose and drain
connection will be tied inside the unit. Installer will untie the drain hose, form trap, and connect to
the condensate drain hole of installer’s choice.
4. Electrical access is available on either side (left or right) of unit and is also available in the front
on the left or right side of the unit.
5. Overall Depth - Add 3.12”(8 cm) for 1”(2.5 cm) or 2”(5 cm) Filter Frame; 5.12” for 4” Filter Frame
and for FD, RD additional 1.06”(2.7cm) for supply air duct flange.
6. Overall cabinet height dimension does not include duct flange when in top discharge
configuration.
7. While access to all removable panels may not be required, installer should take care to comply
with all building codes and allow adequate clearance for future field service.
8. Units require 3 feet(91 cm) clearance for water connections, CAP, CSP, MSP and BSP service
access.
9. Side service access must be 2 feet(9.4 cm) on any side that connections are made. If no
connections are made on a side then service access can be 6 inches(1.5 cm) minimum.
10. Filter removal is from bottom of frame, allow 2 feet(9.4 cm) access for servicing.
2 1/2” FPT
2” FPT
2 1/2” FPT
2” FPT
1” FPT
13/8” (3.49 cm)
7/8” (2.2 cm)
D
4
K
A
BSP - Blower Service Panel
CAP - Control Access Panel
CSP - Compressor Access Panel
MSP - Motor Service Panel
NRP - Non Removable Panel
UPA - Upper Pulley Access
F
5
4
NRP
M
L
168-240
1
N
REAR RETURN TOP DISCHARGE (RR/TD)
LEGEND
1. Water inlet (see note 2)
2. Water outlet (see note 2)
3. Condensate drain (see note 3)
4. High voltage access (see note 4)
5. Low voltage access (see note 4)
NRP
NRP
Control Box
2
RETURN AIR
3 Control Box
4
U
BLOWER
ROTATION
UPA
2
5
R
F
RETURN AIR
4
MSP
01
BSP
AIR OUT
RETURN AIR
1
3
P
AIR OUT
BSP
S
Q
02
AIR OUT
E
RETURN AIR
NRP
B
G
B
C
FRONT RETURN REAR DISCHARGE (FR/RD)
Discharge Connections
Duct Flange
D
E
Depth
Note 5
Width
Height
Note 6
Supply
Width
Supply
Depth
F
Water Connections
G
K
L
M
1
Water
Inlet
2
Water
Outlet
3
Condensate
Return Air Connections
Using Return Air Opening
Electrical Knockouts
N
O1
O2
P
Q
R
S
T
Return
Depth
Return
Height
U
V
168240
in.
cm.
34.0
86.4
106.7
270.9
79.0
200.7
17.5
44.5
17.6
44.6
17.8
45.1
31.3
79.4
31.0
78.7
3.0
7.6
27.0
68.6
25.6
65.1
31.0
78.7
38.0
96.4
34.6
87.8
1.0
2.5
3.0
7.6
48.0
121.9
32.4
82.2
44.6
113.3
2.7
6.9
300
in.
cm.
34.0
86.4
106.7
270.9
79.0
200.7
21.4
54.4
17.6
44.6
17.8
45.1
23.4
59.4
31.0
78.7
3.0
7.6
27.0
68.6
25.6
65.1
31.0
78.7
38.0
96.4
34.6
87.8
1.0
2.5
3.0
7.6
48.0
121.9
32.4
82.2
44.6
113.3
2.7
6.9
31
Submittal Data - Large HKV
HK Electrical Data – Standard
Model
HKV084
HKV096
HKV120
HKV150
HKV168
HKV192
HKV240
HKV300
Compressor
Voltage
Code
Voltage
Min/Max
Voltage
Blower Option
QTY
RLA
H
H
F
F
N
N
H
H
F
F
N
N
H
H
F
F
N
N
H
H
F
F
N
N
H
H
F
F
N
N
H
H
F
F
N
N
H
H
F
F
N
N
H
H
F
F
N
N
208-3-60
208-3-60
460-3-60
460-3-60
575-3-60
575-3-60
208-3-60
208-3-60
460-3-60
460-3-60
575-3-60
575-3-60
208-3-60
208-3-60
460-3-60
460-3-60
575-3-60
575-3-60
208-3-60
208-3-60
460-3-60
460-3-60
575-3-60
575-3-60
208-3-60
208-3-60
460-3-60
460-3-60
575-3-60
575-3-60
208-3-60
208-3-60
460-3-60
460-3-60
575-3-60
575-3-60
208-3-60
208-3-60
460-3-60
460-3-60
575-3-60
575-3-60
208-3-60
208-3-60
460-3-60
460-3-60
575-3-60
575-3-60
197/254
197/254
414/506
414/506
518/633
518/633
197/254
197/254
414/506
414/506
518/633
518/633
197/254
197/254
414/506
414/506
518/633
518/633
197/254
197/254
414/506
414/506
518/633
518/633
197/254
197/254
414/506
414/506
518/633
518/633
197/254
197/254
414/506
414/506
518/633
518/633
197/254
197/254
414/506
414/506
518/633
518/633
197/254
197/254
414/506
414/506
518/633
518/633
A, B, C
D, E
A, B, C
D, E
A, B, C
D, E
A, B, C
D, E
A, B, C
D, E
A, B, C
D, E
A, B, C
D, E
A, B, C
D, E
A, B, C
D, E
A, B, C
D, E
A, B, C
D, E
A, B, C
D, E
A, B, C
D, E
A, B, C
D, E
A, B, C
D, E
A, B, C
D, E
A, B, C
D, E
A, B, C
D, E
A, B, C
E
A, B, C
E
A, B, C
E
A, B, C
D, E
A, B, C
D, E
A, B, C
D, E
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
23.2
23.2
11.2
11.2
7.9
7.9
25.0
25.0
12.2
12.2
9.0
9.0
30.1
30.1
16.7
16.7
12.2
12.2
48.1
48.1
18.6
18.6
14.7
14.7
23.2
23.2
11.2
11.2
7.9
7.9
25.0
25.0
12.2
12.2
9.0
9.0
30.1
30.1
16.7
16.7
12.2
12.2
48.1
48.1
18.6
18.6
14.7
14.7
HACR circuit breaker in USA only
All fuses Class RK-5
LRA
Fan
Motor
FLA
Total
Unit
FLA
Min
Circuit
Amp
Max
Fuse/
HACR
164.0
164.0
75.0
75.0
54.0
54.0
164.0
164.0
100.0
100.0
78.0
78.0
225.0
225.0
114.0
114.0
80.0
80.0
245.0
245.0
125.0
125.0
100.0
100.0
164.0
164.0
75.0
75.0
54.0
54.0
164.0
164.0
100.0
100.0
78.0
78.0
225.0
225.0
114.0
114.0
80.0
80.0
245.0
245.0
125.0
125.0
100.0
100.0
4.0
5.0
2.0
2.4
1.4
1.9
5.0
6.2
2.4
3.1
1.9
2.3
6.2
9.2
3.1
4.3
2.3
3.4
9.2
14.1
4.3
7.0
3.4
5.2
6.2
9.2
3.1
4.3
2.3
3.4
9.2
14.1
4.3
7.0
3.4
5.2
14.1
21.7
7.0
10.0
5.2
7.7
14.1
21.7
7.0
10.0
5.2
7.7
27.2
28.2
13.2
13.6
9.3
9.8
30.0
31.2
14.6
15.3
10.9
11.3
36.3
39.3
19.8
21.0
14.5
15.6
57.3
62.2
22.9
25.6
18.1
19.9
52.6
55.6
25.5
26.7
18.1
19.2
59.2
64.1
28.7
31.4
21.4
23.2
74.3
81.9
40.4
43.4
29.6
32.1
110.3
117.9
44.2
47.2
34.6
37.1
33.0
34.0
16.0
16.4
11.3
11.8
36.3
37.5
17.6
18.4
13.1
13.6
43.8
46.8
24.0
25.2
17.5
18.6
69.3
74.2
27.6
30.3
21.8
23.6
58.4
61.4
28.3
29.5
20.1
21.2
65.4
70.3
31.8
34.5
23.6
25.5
81.8
89.4
44.6
47.6
32.6
35.1
122.3
129.9
48.9
51.9
38.3
40.8
50
50
25
25
15
15
60
60
25
30
20
20
70
70
40
40
25
30
110
110
45
45
35
35
80
80
35
40
25
25
90
90
40
45
30
30
110
110
60
60
40
45
150
175
60
70
50
50
Created: 3/26/09B
32
Submittal Data - Large HKV
HK Electrical Data – Dual Point Power
Compressor
Model
HKV084
HKV096
HKV120
HKV150
HKV168
HKV192
HKV240
HKV300
Voltage
Code
H
H
F
F
N
N
H
H
F
F
N
N
H
H
F
F
N
N
H
H
F
F
N
N
H
H
F
F
N
N
H
H
F
F
N
N
H
H
F
F
N
N
H
H
F
F
N
N
Emergency Power Supply
Voltage
Min/Max
Voltage
Blower Option
QTY
RLA
LRA
Total
Comp
FLA
Comp
MCA
Comp
Max Fuse/
HACR
Total
Unit
FLA
Min
Circuit
Amp
Max
Fuse/
HACR
208-3-60
208-3-60
460-3-60
460-3-60
575-3-60
575-3-60
208-3-60
208-3-60
460-3-60
460-3-60
575-3-60
575-3-60
208-3-60
208-3-60
460-3-60
460-3-60
575-3-60
575-3-60
208-3-60
208-3-60
460-3-60
460-3-60
575-3-60
575-3-60
208-3-60
208-3-60
460-3-60
460-3-60
575-3-60
575-3-60
208-3-60
208-3-60
460-3-60
460-3-60
575-3-60
575-3-60
208-3-60
208-3-60
460-3-60
460-3-60
575-3-60
575-3-60
208-3-60
208-3-60
460-3-60
460-3-60
575-3-60
575-3-60
197/254
197/254
414/506
414/506
518/633
518/633
197/254
197/254
414/506
414/506
518/633
518/633
197/254
197/254
414/506
414/506
518/633
518/633
197/254
197/254
414/506
414/506
518/633
518/633
197/254
197/254
414/506
414/506
518/633
518/633
197/254
197/254
414/506
414/506
518/633
518/633
197/254
197/254
414/506
414/506
518/633
518/633
197/254
197/254
414/506
414/506
518/633
518/633
A, B, C
D, E
A, B, C
D, E
A, B, C
D, E
A, B, C
D, E
A, B, C
D, E
A, B, C
D, E
A, B, C
D, E
A, B, C
D, E
A, B, C
D, E
A, B, C
D, E
A, B, C
D, E
A, B, C
D, E
A, B, C
D, E
A, B, C
D, E
A, B, C
D, E
A, B, C
D, E
A, B, C
D, E
A, B, C
D, E
A, B, C
E
A, B, C
E
A, B, C
E
A, B, C
D, E
A, B, C
D, E
A, B, C
D, E
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
23.2
23.2
11.2
11.2
7.9
7.9
25.0
25.0
12.2
12.2
9.0
9.0
30.1
30.1
16.7
16.7
12.2
12.2
48.1
48.1
18.6
18.6
14.7
14.7
23.2
23.2
11.2
11.2
7.9
7.9
25.0
25.0
12.2
12.2
9.0
9.0
30.1
30.1
16.7
16.7
12.2
12.2
48.1
48.1
18.6
18.6
14.7
14.7
164.0
164.0
75.0
75.0
54.0
54.0
164.0
164.0
100.0
100.0
78.0
78.0
225.0
225.0
114.0
114.0
80.0
80.0
245.0
245.0
125.0
125.0
100.0
100.0
164.0
164.0
75.0
75.0
54.0
54.0
164.0
164.0
100.0
100.0
78.0
78.0
225.0
225.0
114.0
114.0
80.0
80.0
245.0
245.0
125.0
125.0
100.0
100.0
23.2
23.2
11.2
11.2
7.9
7.9
25.0
25.0
12.2
12.2
9.0
9.0
30.1
30.1
16.7
16.7
12.2
12.2
48.1
48.1
18.6
18.6
14.7
14.7
46.4
46.4
22.4
22.4
15.8
15.8
50.0
50.0
24.4
24.4
18.0
18.0
60.2
60.2
33.4
33.4
24.4
24.4
96.2
96.2
37.2
37.2
29.4
29.4
29.0
29.0
38.0
38.0
9.9
9.9
31.3
31.3
15.3
15.3
11.3
11.3
37.6
37.6
20.9
20.9
15.3
15.3
60.1
60.1
23.3
23.3
18.4
18.4
52.2
52.2
25.2
25.2
17.8
17.8
56.3
56.3
27.4
27.4
20.3
20.3
67.7
67.7
37.6
37.6
27.4
27.4
108.2
108.2
41.9
41.9
33.1
33.1
50
50
25
25
15
15
50
50
25
25
20
20
60
60
35
35
25
25
100
100
40
40
30
30
70
70
35
35
25
25
80
80
35
35
25
25
90
90
50
50
35
35
150
150
60
60
45
45
4.0
5.0
2.0
2.4
1.4
1.9
5.0
6.2
2.4
3.1
1.9
2.3
6.2
9.2
3.1
4.3
2.3
3.4
9.2
14.1
4.3
7.0
3.4
5.2
6.2
9.2
3.1
4.3
2.3
3.4
9.2
14.1
4.3
7.0
3.4
5.2
14.1
21.7
7.0
10.0
5.2
7.7
14.1
21.7
7.0
10.0
5.2
7.7
5.0
6.3
2.5
3.0
1.8
2.4
6.3
7.8
3.0
3.9
2.4
2.9
7.8
11.5
3.9
5.4
2.9
4.3
11.5
17.6
5.4
8.8
4.3
6.5
7.8
11.5
3.9
5.4
2.9
4.3
11.5
17.6
5.4
8.8
4.3
6.5
17.6
27.1
8.8
12.5
6.5
9.6
17.6
27.1
8.8
12.5
6.5
9.6
15
15
15
15
15
15
15
15
15
15
15
15
15
20
15
15
15
15
20
30
15
15
15
15
15
20
15
15
15
15
20
30
15
15
15
15
30
45
15
20
15
15
30
45
15
20
15
15
HACR circuit breaker in USA only
All fuses Class RK-5
33
Submittal Data - Large HKV
HK Electrical Data Standard with Internal Pump
Model
HKV084
HKV096
HKV120
HKV150
HKV168
HKV192
HKV240
HKV300
Compressor
Voltage
Code
Voltage
Min/Max
Voltage
Blower
Option
QTY
RLA
H
H
F
F
N
N
H
H
F
F
N
N
H
H
F
F
N
N
H
H
F
F
N
N
H
H
F
F
N
N
H
H
F
F
N
N
H
H
F
F
N
N
H
H
F
F
N
N
208-3-60
208-3-60
460-3-60
460-3-60
575-3-60
575-3-60
208-3-60
208-3-60
460-3-60
460-3-60
575-3-60
575-3-60
208-3-60
208-3-60
460-3-60
460-3-60
575-3-60
575-3-60
208-3-60
208-3-60
460-3-60
460-3-60
575-3-60
575-3-60
208-3-60
208-3-60
460-3-60
460-3-60
575-3-60
575-3-60
208-3-60
208-3-60
460-3-60
460-3-60
575-3-60
575-3-60
208-3-60
208-3-60
460-3-60
460-3-60
575-3-60
575-3-60
208-3-60
208-3-60
460-3-60
460-3-60
575-3-60
575-3-60
197/254
197/254
414/506
414/506
518/633
518/633
197/254
197/254
414/506
414/506
518/633
518/633
197/254
197/254
414/506
414/506
518/633
518/633
197/254
197/254
414/506
414/506
518/633
518/633
197/254
197/254
414/506
414/506
518/633
518/633
197/254
197/254
414/506
414/506
518/633
518/633
197/254
197/254
414/506
414/506
518/633
518/633
197/254
197/254
414/506
414/506
518/633
518/633
A, B, C
D, E
A, B, C
D, E
A, B, C
D, E
A, B, C
D, E
A, B, C
D, E
A, B, C
D, E
A, B, C
D, E
A, B, C
D, E
A, B, C
E
A, B, C
D, E
A, B, C
D, E
A, B, C
D, E
A, B, C
D, E
A, B, C
D, E
A, B, C
D, E
A, B, C
D, E
A, B, C
D, E
A, B, C
D, E
A, B, C
E
A, B, C
E
A, B, C
E
A, B, C
D, E
A, B, C
D, E
A, B, C
D, E
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
23.2
23.2
11.2
11.2
7.9
7.9
25.0
25.0
12.2
12.2
9.0
9.0
30.1
30.1
16.7
16.7
12.2
12.2
48.1
48.1
18.6
18.6
14.7
14.7
23.2
23.2
11.2
11.2
7.9
7.9
25.0
25.0
12.2
12.2
9.0
9.0
30.1
30.1
16.7
16.7
12.2
12.2
48.1
48.1
18.6
18.6
14.7
14.7
LRA
Fan
Motor
FLA
QTY
164.0
164.0
75.0
75.0
54.0
54.0
164.0
164.0
100.0
100.0
78.0
78.0
225.0
225.0
114.0
114.0
80.0
80.0
245.0
245.0
125.0
125.0
100.0
100.0
164.0
164.0
75.0
75.0
54.0
54.0
164.0
164.0
100.0
100.0
78.0
78.0
225.0
225.0
114.0
114.0
80.0
80.0
245.0
245.0
125.0
125.0
100.0
100.0
4.0
5.0
2.0
2.4
1.4
1.9
5.0
6.2
2.4
3.1
1.9
2.3
6.2
9.2
3.1
4.3
2.3
3.4
9.2
14.1
4.3
7.0
3.4
5.2
6.2
9.2
3.1
4.3
2.3
3.4
9.2
14.1
4.3
7.0
3.4
5.2
14.1
21.7
7.0
10.0
5.2
7.7
14.1
21.7
7.0
10.0
5.2
7.7
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
HACR circuit breaker in USA only
All fuses Class RK-5
34
Pump
FLA
Total
Unit
FLA
Min
Circuit
Amp
Max Fuse /
HACR
1.10
1.10
0.55
0.55
0.44
0.44
1.96
1.96
0.98
0.98
0.78
0.78
1.96
1.96
0.98
0.98
0.78
0.78
1.96
1.96
0.98
0.98
0.78
0.78
1.10
1.10
0.55
0.55
0.44
0.44
1.96
1.96
0.98
0.98
0.78
0.78
1.96
1.96
0.98
0.98
0.78
0.78
1.96
1.96
0.98
0.98
0.78
0.78
28.3
29.3
13.8
14.1
9.7
10.2
32.0
33.2
15.6
16.3
11.7
12.1
38.3
41.3
20.8
22.0
15.3
16.4
59.3
64.2
23.9
26.6
18.9
20.7
54.8
57.8
26.6
27.8
19.0
20.1
63.1
68.0
30.7
33.4
23.0
24.8
78.2
85.8
42.4
45.4
31.2
33.7
114.2
121.8
46.2
49.2
36.2
38.7
34.1
35.1
16.5
17.0
11.7
12.2
38.2
39.4
18.6
19.3
13.9
14.3
45.8
48.8
25.0
26.2
18.3
19.4
71.3
76.2
28.5
31.2
22.6
24.4
60.6
63.6
29.4
30.6
21.0
22.1
69.4
74.3
33.7
36.4
25.2
27.0
85.7
93.3
46.5
49.5
34.2
36.7
126.2
133.8
50.8
53.8
39.8
42.3
50
50
25
25
15
20
60
60
30
30
20
20
70
70
40
40
30
30
110
110
45
45
35
35
80
80
40
40
25
25
90
90
45
45
30
35
110
110
60
60
45
45
150
175
60
70
50
50
Submittal Data - Large HKV
HK Electrical Data – Dual Point Power with Pump
Compressor
Model
HKV084
HKV096
HKV120
HKV150
HKV168
HKV192
HKV240
HKV300
Voltage
Code
H
H
F
F
N
N
H
H
F
F
N
N
H
H
F
F
N
N
H
H
F
F
N
N
H
H
F
F
N
N
H
H
F
F
N
N
H
H
F
F
N
N
H
H
F
F
N
N
Emergency Power Supply
Voltage
Min/Max
Voltage
Blower
Option
QTY
RLA
LRA
QTY
Pump
FLA
Total
FLA
MCA
Max
Fuse/
HACR
Fan
Motor
FLA
Fan
MCA
Fan Max
Fuse/
HACR
208-3-60
208-3-60
460-3-60
460-3-60
575-3-60
575-3-60
208-3-60
208-3-60
460-3-60
460-3-60
575-3-60
575-3-60
208-3-60
208-3-60
460-3-60
460-3-60
575-3-60
575-3-60
208-3-60
208-3-60
460-3-60
460-3-60
575-3-60
575-3-60
208-3-60
208-3-60
460-3-60
460-3-60
575-3-60
575-3-60
208-3-60
208-3-60
460-3-60
460-3-60
575-3-60
575-3-60
208-3-60
208-3-60
460-3-60
460-3-60
575-3-60
575-3-60
208-3-60
208-3-60
460-3-60
460-3-60
575-3-60
575-3-60
197/254
197/254
414/506
414/506
518/633
518/633
197/254
197/254
414/506
414/506
518/633
518/633
197/254
197/254
414/506
414/506
518/633
518/633
197/254
197/254
414/506
414/506
518/633
518/633
197/254
197/254
414/506
414/506
518/633
518/633
197/254
197/254
414/506
414/506
518/633
518/633
197/254
197/254
414/506
414/506
518/633
518/633
197/254
197/254
414/506
414/506
518/633
518/633
A, B, C
D, E
A, B, C
D, E
A, B, C
D, E
A, B, C
D, E
A, B, C
D, E
A, B, C
D, E
A, B, C
D, E
A, B, C
D, E
A, B, C
E
A, B, C
D, E
A, B, C
D, E
A, B, C
D, E
A, B, C
D, E
A, B, C
D, E
A, B, C
D, E
A, B, C
D, E
A, B, C
D, E
A, B, C
D, E
A, B, C
E
A, B, C
E
A, B, C
E
A, B, C
D, E
A, B, C
D, E
A, B, C
D, E
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
23.2
23.2
11.2
11.2
7.9
7.9
25.0
25.0
12.2
12.2
9.0
9.0
30.1
30.1
16.7
16.7
12.2
12.2
48.1
48.1
18.6
18.6
14.7
14.7
23.2
23.2
11.2
11.2
7.9
7.9
25.0
25.0
12.2
12.2
9.0
9.0
30.1
30.1
16.7
16.7
12.2
12.2
48.1
48.1
18.6
18.6
14.7
14.7
164.0
164.0
75.0
75.0
54.0
54.0
164.0
164.0
100.0
100.0
78.0
78.0
225.0
225.0
114.0
114.0
80.0
80.0
245.0
245.0
125.0
125.0
100.0
100.0
164.0
164.0
75.0
75.0
54.0
54.0
164.0
164.0
100.0
100.0
78.0
78.0
225.0
225.0
114.0
114.0
80.0
80.0
245.0
245.0
125.0
125.0
100.0
100.0
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
1.10
1.10
0.55
0.55
0.44
0.44
1.96
1.96
0.98
0.98
0.78
0.78
1.96
1.96
0.98
0.98
0.78
0.78
1.96
1.96
0.98
0.98
0.78
0.78
1.10
1.10
0.55
0.55
0.44
0.44
1.96
1.96
0.98
0.98
0.78
0.78
1.96
1.96
0.98
0.98
0.78
0.78
1.96
1.96
0.98
0.98
0.78
0.78
24.3
24.3
11.8
11.8
8.3
8.3
27.0
27.0
13.2
13.2
9.8
9.8
32.1
32.1
17.7
17.7
13.0
13.0
50.1
50.1
19.6
19.6
15.5
15.5
48.6
48.6
23.5
23.5
16.7
16.7
53.9
53.9
26.4
26.4
19.6
19.6
64.1
64.1
35.4
35.4
26.0
26.0
100.1
100.1
39.2
39.2
31.0
31.0
30.1
30.1
14.6
14.6
10.3
10.3
33.2
33.2
16.2
16.2
12.0
12.0
39.6
39.6
21.9
21.9
16.0
16.0
62.1
62.1
24.2
24.2
19.2
19.2
54.4
54.4
26.3
26.3
18.7
18.7
60.2
60.2
29.4
29.4
21.8
21.8
71.6
71.6
39.5
39.5
29.0
29.0
112.1
112.1
43.8
43.8
34.6
34.6
50
50
25
25
15
15
50
50
25
25
20
20
60
60
35
65
25
25
110
110
40
40
30
30
70
70
35
35
25
25
80
80
40
40
30
30
100
100
50
50
40
40
150
150
60
60
45
45
4.0
5.0
2.0
2.4
1.4
1.9
5.0
6.2
2.4
3.1
1.9
2.3
6.2
9.2
3.1
4.3
2.3
3.4
9.2
14.1
4.3
7.0
3.4
5.2
6.2
9.2
3.1
4.3
2.3
3.4
9.2
14.1
4.3
7.0
3.4
5.2
14.1
21.7
7.0
10.0
5.2
7.7
14.1
21.7
7.0
10.0
5.2
7.7
5.0
6.3
2.5
3.0
1.8
2.4
6.3
7.8
3.0
3.9
2.4
2.9
7.8
11.5
3.9
5.4
2.9
4.3
11.5
17.6
5.4
8.8
4.3
6.5
7.8
11.5
3.9
5.4
2.9
4.3
11.5
17.6
5.4
8.8
4.3
6.5
17.6
27.1
8.8
12.5
6.5
9.6
17.6
27.1
8.8
12.5
6.5
9.6
15
15
15
15
15
15
15
15
15
15
15
15
15
20
15
15
15
15
20
30
15
15
15
15
15
20
15
15
15
15
20
30
15
15
15
15
30
45
15
20
15
15
30
45
15
20
15
15
HACR circuit breaker in USA only
All fuses Class RK-5
35
Submittal Data - Large HKV
HK Series Wiring Diagram Matrix
Only representative diagrams of CXM and DXM Options are presented in this submittal.
All diagrams can be located online at MARS.com using the part numbers presented below.
Model
Wiring Diagram
Part Number
Electrical
Control
96B0113N01
CXM
96B0113N02
DXM
96B0113N03
DXM
Agency
HKV084-150
HKV084-150 with ClimaDry®
96B0113N07
HKV168-300
96B0113N08
HKV186-300 with ClimaDry®
HKV - All Auxillary Diagrams
CXM
208-230/60/3,
460/60/3,
575/60/3
DXM
96B0128N02
DXM
96B0149N01
CXM & LON
96B0149N02
DXM & LON
96B0149N03
CXM & MPC
96B0149N04
DXM & MPC
36
ETL
Submittal Data - Large HKV
Typical Wiring Diagram - Three Phase HKV084-150 with CXM Controller
HKV084-150 H, F, N CXM
37
Submittal Data - Large HKV
HKV084-150 H, F, N CXM
Typical Wiring Diagram - Three Phase HKV084-150 with DXM
38
Submittal Data - Large HKV
Large (HK) Series 60Hz
Engineering Specifications – Page 1
General:
Furnish and install MARS Large (HK) Water Source Heat Pumps, as indicated on the plans. Equipment shall be completely
assembled, piped, and internally wired. Capacities and characteristics as listed in the schedule and the specifications that follow.
Units shall be supplied completely factory built capable of operating over an entering water temperature range from 20° to 120°F
(-6.7° to 48.9°C) as standard. Equivalent units from other manufacturers may be proposed provided approval to bid is given 10
days prior to bid closing. All equipment listed in this section must be rated and certified in accordance with Air-Conditioning, Heating
and Refrigeration Institute/International Standards Organization (AHRI / ISO 13256-1). All equipment must be tested, investigated,
and determined to comply with the requirements of the standards for Heating and Cooling Equipment UL-1995 for the United
States and CAN/CSA-C22.2 NO.236 for Canada, by Intertek Testing Laboratories (ETL). The units shall have AHRI / ISO and ETLUS-C labels.
All units shall be fully quality tested by factory run testing under normal operating conditions as described herein. Quality control
system shall automatically perform via computer: triple leak check, pressure tests, evacuation and accurately charge system,
perform detailed heating and cooling mode tests, and quality cross check all operational and test conditions to pass/fail criteria.
Detailed report card will ship with each unit displaying status for critical tests and components. Note: If unit fails on any cross
check, it shall not be allowed to ship. Serial numbers will be recorded by factory and furnished to contractor on report
card for ease of unit warranty status. Units tested without water flow are not acceptable.
Basic Construction:
Vertical Units shall have one of the following air flow arrangements: Back Return/Top Discharge, Front Return/Top Discharge, Back
Return/Front Discharge, Front Return/Back Discharge as shown on the plans. Units can be field converted without requiring new
panels or belts. Units that cannot be field converted shall not be acceptable.
If units with these arrangements are not used, the contractor is responsible for any extra costs incurred by other trades. All units
must have a minimum of two access panels for serviceability of compressor compartment. Units having only one access panel to
compressor/heat exchangers/expansion device/refrigerant piping shall not be acceptable.
Compressor section interior surfaces shall be lined with 1/2 inch (12.7mm) thick, 1-1/2 lb/ft3 (24 kg/m3) acoustic type glass fiber
insulation. Air handling section interior surfaces shall be lined with 1/2 in (12.7mm) thick, 1-1/2 lb/ft3 (24 kg/m3) foil backed fiber
insulation for ease of cleaning. Insulation placement shall be designed in a manner that will eliminate any exposed edges to
prevent the introduction of glass fibers into the air stream. Units without foil-faced insulation in the air handling section will not be
accepted.
Vertical heat pumps shall be fabricated from heavy gauge galvanized steel with powder coat paint finish on access panels. The
color will be Pewter. Both sides of the panels shall be painted for added protection.
Standard insulation must meet NFPA Fire Hazard Classification requirements 25/50 per ASTM E84, UL 723, CAN/ULC S102-M88
and NFPA 90A requirements; air erosion and mold growth limits of UL-181; stringent fungal resistance test per ASTM-C1071 and
ASTM G21; and shall meet zero level bacteria growth per ASTM G22. Unit insulation must meet these stringent requirements or
unit(s) will not be accepted.
Vertical units to have discharge air duct collar and 1” (25.4mm) full filter frame with 1” (25.4mm) filters factory installed. If units with
these factory installed provisions are not used, the contractor is responsible for any extra costs to field install these provisions, and/
or the extra costs for his sub-contractor to install these provisions.
All units must have an insulated panel separating the fan compartment from the compressor compartment. Units with the
compressor in the air stream are not acceptable. Units shall have a factory installed 1 inch (25.4mm) wide filter frame with filter
removal from bottom side. Units shall have a 1 inch (25.4mm) thick throwaway type glass fiber filter. The contractor shall purchase
one spare set of filters and replace factory shipped filters on completion of start-up. Filters shall be standard sizes. If units utilize
non-standard filter sizes then the contractor shall provide 12 spare filters for each unit.
Cabinets shall have separate knockouts on front and sides for entrance of line voltage and low voltage control wiring. All factoryinstalled wiring passing through factory knockouts and openings shall be protected from sheet metal edges at openings by plastic
ferrules. Supply and return water connections shall be copper FPT fittings, connections on both sides (installer to choose side and
plug opposite) and shall be securely mounted flush to the cabinet side allowing for connection of a flexible hose without the use of
a back-up wrench. Water connections that protrude through the cabinet or require the use of a backup wrench shall not be allowed.
Water connections on only one side will not be accepted. All water connections and electrical knockouts must not interfere with the
serviceability of unit. Contractor shall be responsible for any extra costs involved in the installation of units that do not have this
feature. Contractor must ensure that units can be easily removed for servicing and coordinate locations of electrical conduit and
lights with the electrical contractor.
39
Submittal Data - Large HKV
Large (HK) Series 60Hz
Engineering Specifications – Page 2
Option: 2-inch (50.8mm) full filter frame with glass fiber throwaway filters on units.
Option: 4-inch (101.6 mm) full filter frame with Merv 8 Filter on units.
Option: UltraQuiet package shall consist of high technology sound attenuating material that is strategically applied to the
compressor and air handling compartment casings and fan scroll in addition to the standard ClimaQuiet system design,
to further dampen and attenuate sound transmissions. Compressor is mounted on specially engineered sound-tested
isolators.
Option: The unit shall be supplied with extended range Insulation option, which adds closed cell insulation to internal water lines,
and provides insulation on suction side refrigeration tubing including refrigerant to water heat exchanger.
Option: The unit shall be supplied with internally factory mounted two-way water valve for variable speed pumping requirements. A
factory-mounted or field-installed high pressure switch shall be installed in the water piping to disable compressor operation
in the event water pressures build due to water freezing in the piping system.
Option: The unit shall be supplied with internally mounted secondary pump for primary/secondary applications.
Fan and Motor Assembly:
All units shall have belt-driven single or dual centrifugal fans. Fan motor shall be permanently lubricated with thermal overload
protection. Units supplied without a permanently lubricated motor must provide external oilers for easy service. The fan and motor
assembly must be capable of overcoming the external static pressures as shown on the schedule. Airflow / Static pressure rating
of the unit shall be based on a wet coil and a clean filter in place. Ratings based on a dry coil and/or no air filter shall NOT be
acceptable.
Option: Various blower drive packages for selectable static pressure/airflow.
Refrigerant Circuit:
All units shall contain an EarthPure® (HFC-410A) sealed refrigerant circuit including a high efficiency scroll compressor designed
for heat pump operation, a thermostatic expansion valve for refrigerant metering, an enhanced corrugated aluminum lanced fin
and rifled copper tube refrigerant to air heat exchanger, reversing valve, coaxial (tube in tube) refrigerant to water heat exchanger,
and safety controls including a high pressure switch, low pressure switch (loss of charge), water coil low temperature sensor, and
air coil low temperature sensor. Access fittings shall be factory installed on high and low pressure refrigerant lines to facilitate field
service. Activation of any safety device shall prevent compressor operation via a microprocessor lockout circuit. The lockout circuit
shall be reset at the thermostat or at the optional disconnect switch. Units that cannot be reset at the thermostat shall not be
acceptable.
Hermetic compressors shall be internally sprung. The scroll compressors shall have a dual level vibration isolation system. The
compressor(s) will be mounted on specially engineered sound-tested EPDM vibration isolation grommets to a large heavy gauge
compressor mounting plate, which is then isolated from the cabinet base with grommets for maximized vibration attenuation.
Compressor shall have thermal overload protection. Compressor shall be located in an insulated compartment isolated from air
stream to minimize sound transmission.
Refrigerant to air heat exchangers shall utilize enhanced corrugated lanced aluminum fins and rifled copper tube construction
rated to withstand 625 PSIG (4309 kPa) refrigerant working pressure. Refrigerant to water heat exchangers shall be of copper
inner water tube and steel refrigerant outer tube design, rated to withstand 625 PSIG (4309 kPa) working refrigerant pressure.
The refrigerant to water heat exchanger shall be “electro-coated” with a low cure cathodic epoxy material a minimum of 0.4 mils
thick (0.4 – 1.5 mils range) on all surfaces. The black colored coating shall provide a minimum of 1000 hours salt spray protection
per ASTM B117-97 on all external steel and copper tubing. The material shall be formulated without the inclusion of any heavy
metals and shall exhibit a pencil hardness of 2H (ASTM D3363-92A), crosshatch adhesion of 4B-5B (ASTM D3359-95), and impact
resistance of 160 in-lbs (184 kg-cm) direct (ASTM D2794-93).
Refrigerant metering shall be accomplished by thermostatic expansion valve only. Expansion valves shall be a dual port balanced
type with external equalizer for optimum refrigerant metering. Units shall be designed and tested for operating ranges of entering
water temperatures from 20° to 120°F (-6.7° to 48.9°C). Reversing valve shall be four-way solenoid activated refrigerant valve,
which shall default to heating mode should the solenoid fail to function. If the reversing valve solenoid defaults to cooling mode, an
additional low temperature thermostat must be provided to prevent over-cooling an already cold room.
Option: The unit shall be supplied with cupro-nickel coaxial water to refrigerant heat exchanger.
40
Submittal Data - Large HKV
Large (HK) Series 60Hz
Engineering Specifications – Page 3
Option: The refrigerant to air heat exchanger shall be coated.
Drain Pan:
The drain pan shall be constructed of galvanized steel and have a powder coat paint application to further inhibit corrosion. This
corrosion protection system shall meet the stringent 1000 hour salt spray test per ASTM B117. If plastic type material is used, it
must be HDPE (High Density Polyethylene) to avoid thermal cycling shock stress failure over the lifetime of the unit. Drain pan
shall be fully insulated. Drain outlet shall be located at pan as to allow complete and unobstructed drainage of condensate. Drain
pan hose assembly can be connected to either side, drain outlet to be 1” FPT fitting. Choice of drain connection to only one side
will not be accepted. The unit as standard will be supplied with solid-state electronic condensate overflow protection. Mechanical
float switches will NOT be accepted.
Option: The unit shall be supplied with stainless steel drain pan.
Electrical:
A control box shall be located within the unit compressor compartment and shall contain a 75VA transformer with load side
circuit breaker protection, 24 volt activated, 2 or 3 pole compressor contactor, terminal block for thermostat wiring and solid-state
controller for complete unit operation. Reversing valve and fan motor wiring shall be routed through this electronic controller. Units
shall be name-plated for use with time delay fuses or HACR circuit breakers. Unit controls shall be 24 Volt and provide heating or
cooling as required by the remote thermostat/sensor. Two compressor units shall have a solid-state time delay relay and random
start to prevent both compressors from starting simultaneously.
Option: The unit shall be supplied with electrical disconnect.
Solid State Control System (CXM):
Units shall have a solid-state control system. Units utilizing electro-mechanical control shall not be acceptable. The control system
microprocessor board shall be specifically designed to protect against building electrical system noise contamination, EMI, and
RFI interference. The control system shall interface with a heat pump type thermostat. The control system shall have the following
features:
a.
b.
c.
d.
e.
f.
g.
h.
i.
Anti-short cycle time delay on compressor operation.
Random start on power up mode.
Low voltage protection.
High voltage protection.
Unit shutdown on high or low refrigerant pressures.
Unit shutdown on low water temperature.
Condensate overflow electronic protection.
Option to reset unit at thermostat or disconnect.
Automatic intelligent reset. Unit shall automatically reset the unit 5 minutes after trip if the fault has cleared. If a fault occurs 3
times sequentially without thermostat meeting temperature, then lockout requiring manual reset will occur.
j. Ability to defeat time delays for servicing.
k. Light emitting diode (LED) on circuit board to indicate high pressure, low pressure, low voltage, high voltage, low water/air
temperature cut out, condensate overflow, and control voltage status.
l. The low-pressure switch shall not be monitored for the first 120 seconds after a compressor start command to prevent nuisance
safety trips.
m. 24V output to cycle a motorized water valve or other device with compressor contactor.
n. Unit Performance Sentinel (UPS). The UPS warns when the heat pump is running inefficiently.
o. Water coil low temperature sensing (selectable for water or anti-freeze).
p. Air coil low temperature sensing.
NOTE: Units not providing the 8 safety protections of anti-short cycle, low voltage, high voltage, high refrigerant
pressure, low pressure (loss of charge), air coil low temperature cut-out, water coil low temperature cut-out, and
condensate overflow protections will not be accepted.
Option: Enhanced solid state control system (DXM)
This control system features two-stage control of cooling and two-stage control of heating modes for exacting temperature and
dehumidification purposes.
41
Submittal Data - Large HKV
Large (HK) Series 60Hz
Engineering Specifications – Page 4
Control shall have all of the above-mentioned features of the CXM control system along with the following expanded features:
a.
b.
c.
d.
Removable thermostat connector.
Night setback control.
Random start on return from night setback.
Minimized reversing valve operation (Unit control logic shall only switch the reversing valve when cooling is demanded for the
first time. The reversing valve shall be held in this position until the first call for heating, ensuring quiet operation and increased
valve life.).
e. Override temperature control with 2-hour timer for room occupant to override setback temperature at the thermostat.
f. Dry contact night setback output for digital night setback thermostats.
g. Ability to work with heat pump or heat/cool (Y, W) type thermostats.
h. Ability to work with heat pump thermostats using O or B reversing valve control.
i. Emergency shutdown contacts.
j. Boilerless system heat control at low loop water temperature.
k. Ability to allow up to 3 units to be controlled by one thermostat.
l. Relay to operate an external damper.
m. Ability to automatically change fan speed from multistage thermostat.
n. Relay to start system pump.
o. 75 VA control transformer. Control transformer shall have load side short circuit and overload protection via a built in circuit
breaker.
Digital Night Setback with Pump Restart (DXM w/ ATP32U03/04)
The unit will be provided with a Digital Night Setback feature using an accessory relay on the DXM controller with an ATP32U03/04
thermostat and an external, field-provided time clock. The external time clock will initiate and terminate the night setback period.
The thermostat will have a night setback override feature with a programmable override time period.
An additional accessory relay on the unit DXM controller will energize the building loop pump control for the duration of the override
period. (Note: this feature requires additional low voltage wiring. Consult Application Drawings for details.)
Remote Service Sentinel (CXM/DXM):
Solid state control system shall communicate with thermostat to display (at the thermostat) the unit status, fault status, and specific
fault condition, as well as retrieve previously stored fault that caused unit shutdown. The Remote Service Sentinel allows building
maintenance personnel or service personnel to diagnose unit from the wall thermostat. The control board shall provide a signal to
the thermostat fault light, indicating a lockout. Upon cycling the G (fan) input 3 times within a 60 second time period, the fault light
shall display the specific code as indicated by a sequence of flashes. A detailed flashing code shall be provided at the thermostat
LED to display unit status and specific fault status such as over/under voltage fault, high pressure fault, low pressure fault, low
water temperature fault, condensate overflow fault, etc. Units that do not provide this remote service sentinel shall not be
acceptable.
Option: Lonworks interface system
Units shall have all the features listed above (either CXM or DXM) and the control board will be supplied with a LONWORKS
interface board, which is LONMark certified. This will permit all units to be daisy chained via a 2-wire twisted pair shielded cable.
The following points must be available at a central or remote computer location:
a. Space temperature
b. Leaving water temperature
c. Discharge air temperature
d. Command of space temperature setpoint
e. Cooling status
f. Heating status
g. Low temperature sensor alarm
h. Low pressure sensor alarm
i. High pressure switch alarm
j. Condensate sensor alarm
k. Hi/low voltage alarm
l. Fan “ON/AUTO” position of space thermostat as specified above
m. Unoccupied / occupied command
n. Cooling command
o. Heating command
p. Fan “ON/AUTO” command
q. Fault reset command
r. Itemized fault code revealing reason for specific shutdown fault (any one of 7)
42
Submittal Data - Large HKV
Large (HK) Series 60Hz
Engineering Specifications – Page 5
This option also provides the upgraded 75VA control transformer with load side short circuit and overload protection via a built in
circuit breaker.
Option: MPC (Multiple Protocol Control) interface system
Units shall have all the features listed above (either CXM or DXM) and the control board will be supplied with a Multiple Protocol
interface board. Available protocols are BACnet MS/TP, Modbus, or Johnson Controls N2. The choice of protocol shall be field
selectable/changeable via the use of a simple selector switch. Protocol selection shall not require any additional programming or
special external hardware or software tools. This will permit all units to be daisy chain connected by a 2-wire twisted pair shielded
cable. The following points must be available at a central or remote computer location:
a. Space temperature
b. Leaving water temperature
c. Discharge air temperature
d. Command of space temperature setpoint
e. Cooling status
f. Heating status
g. Low temperature sensor alarm
h. Low pressure sensor alarm
i. High pressure switch alarm
j. Condensate overflow alarm
k. Hi/low voltage alarm
l. Fan “ON/AUTO” position of space thermostat as specified above
m. Unoccupied / occupied command
n. Cooling command
o. Heating command
p. Fan “ON/AUTO” command
q. Fault reset command
r. Itemized fault code revealing reason for specific shutdown fault (any one of 7)
This option also provides the upgraded 75VA control transformer with load side short circuit and overload protection via a built in
circuit breaker.
Warranty:
MARS shall warranty equipment for a period of 12 months from start up or 18 months from shipping (which ever occurs first).
Option: Extended 4-year compressor warranty covers compressor for a total of 5 years.
Option: Extended 4-year refrigeration circuit warranty covers coils, reversing valve, expansion valve and compressor for a total of 5
years.
Option: Extended 4-year control board warranty covers the CXM/DXM control board for a total of 5 years.
FIELD INSTALLED OPTIONS
Hose Kits:
All units 120,000 BTUH (35 kW) and below shall be connected with hoses. The hoses shall be 2 feet (61cm) long, braided
stainless steel; fire rated hoses complete with adapters. Only fire rated hoses will be accepted.
Valves:
The following valves are available and will be shipped loose:
a. Ball valve; bronze material, standard port full flow design, FPT connections.
b. Ball valve with memory stop and PT port.
c. “Y” strainer with blowdown valve; bronze material, FPT connections.
d. Motorized water valve; slow acting, 24v, FPT connections.
Hose Kit Assemblies:
The following assemblies ship with the valves already assembled to the hose described:
a. Supply and return hoses having ball valve with PT port.
b. Supply hose having ball valve with PT port; return hose having automatic flow regulator valve with PT ports, and ball valve.
c. Supply hose having “Y” strainer with blowdown valve, and ball valve with PT port; return hose having automatic flow regulator
with PT ports, and ball valve.
43
Submittal Data - Large HKV
Large (HK) Series 60Hz
Engineering Specifications – Page 6
d. Supply hose having “Y” strainer with blowdown valve, and ball valve with PT port; return hose having ball valve with PT port.
Thermostats:
The thermostat shall be a MARS mechanical or electronic type thermostat as selected below with the described features:
a. Single Stage Digital Auto or Manual Changeover (ATA11U01)
Thermostat shall be a single-stage, digital, auto or manual changeover with HEAT-OFF-COOL-AUTO system switch and fan
ON-AUTO switch. Thermostat shall have an LCD display with temperature and set-point(s) in ºF or ºC. The Thermostat shall
provide permanent memory of set-point(s) without batteries. A fault LED shall be provided to display specific fault condition.
Thermostat shall provide temperature display offset for custom applications.
b. Multistage Digital Automatic Changeover (ATA22U01)
Thermostat shall be multi-stage (2H/2C), manual or automatic changeover with HEAT-OFF-COOL-AUTO-EM HEAT system
settings and fan ON-AUTO settings. Thermostat shall have an LCD display with temperature, set-point(s), mode, and status
indication. The temperature indication shall be selectable for ºF or ºC. The thermostat shall provide permanent memory of
set-point(s) without batteries. A fault LED shall be provided to indicate specific fault condition(s). Thermostat shall provide
temperature display offset for custom applications. Thermostat shall allow unit to provide better dehumidification with optional
DXM controller by automatically using lower fan speed on stage 1 cooling (higher latent cooling) as main cooling mode, and
automatically shifting to high speed fan on stage 2 cooling.
c. Multistage Manual Changeover Programmable 5/2 Day (ATP21U01)
Thermostat shall be 5 day/2 day programmable (with up to 4 setpoints per day), multi-stage (2H/1C), manual changeover
with HEAT-OFF-COOL-EM HEAT system settings and fan ON-AUTO settings. Thermostat shall have an LCD display with
temperature, setpoint(s), mode, and status indication. The temperature indication shall be selectable for º F or º C. The
thermostat shall provide permanent memory of setpoint(s) without batteries. Thermostat shall provide convenient override
feature to temporarily change setpoint.
d. Multistage Automatic or Manual Changeover Programmable 7 Day (ATP32U03C)
Thermostat shall be 7 day programmable (with up to 4 setpoints per day), multi-stage (3H/2C), automatic or manual
changeover with HEAT-OFF-COOL-AUTO-EM HEAT system settings and fan ON-AUTO settings. Thermostat shall have a
blue backlit dot matrix LCD display with temperature, setpoints, mode, and status indication. The temperature indication shall
be selectable for ºF or ºC. Time display shall be selectable for 12 or 24 hour clock. Fault identification shall be provided (when
used with MARS CXM or DXM controls) to simplify troubleshooting by providing specific unit fault at the thermostat with red
backlit LCD during unit lockout. The thermostat shall provide permanent memory of setpoints without batteries. Thermostat
shall provide heating set-point range limit, cooling setpoint range limit, temperature display offset, keypad lockout, dead-band
range setting, and inter-stage differential settings. Thermostat shall provide progressive recovery to anticipate time required to
bring space temperature to the next programmed event. Thermostat shall provide an installer setup for configuring options and
for setup of servicing contractor name and contact information. Thermostat shall allow the use of an accessory remote and/or
outdoor temperature sensor (AST008). Thermostat navigation shall be accomplished via five buttons (up/down/right/left/select)
with menu-driven selections for ease of use and programming.
e. Multistage Automatic or Manual Changeover Programmable 7 Day with Humidity Control (ATP32U04C)
Thermostat shall be 7 day programmable (with up to 4 set points per day), multi-stage (3H/2C), automatic or manual
changeover with HEAT-OFF-COOL-AUTO-EM HEAT system settings and fan ON-AUTO settings. Separate dehumidification
and humidification set points shall be configurable for discreet outputs to a dehumidification option and/or an external
humidifier. Thermostat shall have a blue backlit dot matrix LCD display with temperature, relative humidity, setpoints, mode,
and status indication. The temperature indication shall be selectable for ºF or ºC. Time display shall be selectable for 12 or 24
hour clock. Fault identification shall be provided (when used with MARS CXM or DXM controls) to simplify troubleshooting by
providing specific unit fault at the thermostat with red backlit LCD during unit lockout. The thermostat shall provide permanent
memory of setpoints without batteries. Thermostat shall provide heating set-point range limit, cooling set-point range limit,
temperature display offset, keypad lockout, dead-band range setting, and inter-stage differential settings. Thermostat shall
provide progressive recovery to anticipate time required to bring space temperature to the next programmed event. Thermostat
shall provide an installer setup for configuring options and for setup of servicing contractor name and contact information.
Thermostat shall allow the use of an accessory remote and/or outdoor temperature sensor (AST008). Thermostat navigation
shall be accomplished via five buttons (up/down/right/left/select) with menu-driven selections for ease of use and programming.
DDC Sensors:
MARS wall mounted DDC sensor to monitor room temperature and interfaces with optional interface system described above.
Several types as described below:
a. Sensor only with no display (LON and MPC).
b. Sensor with override (LON only).
44
Submittal Data - Large HKV
Large (HK) Series 60Hz
Engineering Specifications – Page 7
c. Sensor with setpoint adjustment and override (MPC only).
d. Sensor with setpoint adjustment and override, LCD display, status/fault indication (LON and MPC)
45
Submittal Data - Large HKV
Revision History
Date:
06/16/14
Item:
Pages 4, 7, 38, 39, 52
Action:
Updated filter frame description
06/09/14
Find/Change text “rack” to “rail” - All
Updated
09/30/13
Edit Text - Page 50
Updated
04/15/13
EAT for ClimaDry® Option
Updated
12/11/12
Engineering Specifications
Decoder
Unit Features - Options
Updated
Updated
02/20/12
Engineering Specifications
01/24/12
HK Series Nomenclature with ClimaDry® II Option
Updated
11/29/11
HKV240 Blower Performance Table
Updated
08/19/11
All
Removed 460 volt neutral wire with Climadry/internal pump
08/09/11
Unit Maximum Working Water Pressure
Updated to Reflect New Safeties
08/03/11
Engineering Specifications
Added Digital Night Setback with Pump Restart (DXM w/ ATP32U03/04)
06/01/11
Document
Incorporated ClimaDry® Information
04/07/11
Engineering Specifications NOTICE
Updated
02/11/11
Performance Data Selection Notes
Updated
01/03/11
Format - All Pages
Updated
12/07/10
Entering Air Correction Table
Updated
10/27/10
Wiring Diagram Matrix
Updated
10/15/10
Physical Data Table
Updated
09/28/10
Engineering Specifications
Updated
09/14/10
Unit Features
Added
09/14/10
Table of Contents
Updated
07/26/10
Wiring Diagrams
Updated
07/26/10
Compressor Mounting Information and Graphics Engineering Specifications
Updated to Reflect Spring/Grommet Change
06/11/10
Format - All Pages
Updated
06/11/10
Engineering Specifiations
Updated
HKV168-300 Dimensional Data
Corrected "M" in Rear Return Top Discharge
Corrected "M" in Front Return Top Discharge
Corrected 300 Column in Legend (2 1/2")
05/03/10
HKV084-150 Dimensional Data
Corrected "T" in Rear Return Top Discharge
11/16/09
‘Plugs are Shipped with Unit’ Note
Note Corrected to ‘Plugs are Field Supplied’
03/27/09
Created
'XHWRRQJRLQJSURGXFWLPSURYHPHQWVVSHFLILFDWLRQVDQGGLPHQVLRQVDUH
VXEMHFWWRFKDQJHDQGFRUUHFWLRQZLWKRXWQRWLFHRULQFXUULQJREOLJDWLRQV'HWHUPLQLQJWKH
DSSOLFDWLRQDQGVXLWDELOLW\IRUXVHRIDQ\SURGXFWLVWKHUHVSRQVLELOLW\RIWKHLQVWDOOHU
$GGLWLRQDOO\WKHLQVWDOOHULVUHVSRQVLEOHIRUYHULI\LQJGLPHQVLRQDOGDWDRQWKHDFWXDOSURGXFW
SULRUWREHJLQQLQJDQ\LQVWDOODWLRQSUHSDUDWLRQV
,QFHQWLYHDQGUHEDWHSURJUDPVKDYHSUHFLVHUHTXLUHPHQWVDVWRSURGXFWSHUIRUPDQFH
DQGFHUWLILFDWLRQ$OOSURGXFWVPHHWDSSOLFDEOHUHJXODWLRQVLQHIIHFWRQGDWHRIPDQXIDFWXUH
KRZHYHUFHUWLILFDWLRQVDUHQRWQHFHVVDULO\JUDQWHGIRUWKHOLIHRIDSURGXFW
7KHUHIRUHLWLVWKHUHVSRQVLELOLW\RIWKHDSSOLFDQWWRGHWHUPLQHZKHWKHUDVSHFLILF
PRGHOTXDOLILHVIRUWKHVHLQFHQWLYHUHEDWHSURJUDPV
8/2015
Download PDF
Similar pages