Setup &Operation
Don't Worry It's Pretty Easy.
STEP 1
Position The System.
STEP2
Connect One Signal Cable.
STEP3
Connect the Power cable.
STEP4
Use the Soundbar remote to
turn on power and adjust volume.
Home Theater
Made Simple!
What's In The Box
SB400/SB500 cabinet • Remote control • Instruction sheets
AC power cord • Optical Digital and Analog signal cables
ZVOX '
Great Sound Made Simple
(866) 367-9869 I info@zvoxaudio.com
READ THIS FIRST
Important Safety Instructions For ZVOX System
TO PREVENT FIRE OR
SHOCK HAZARD, DO
NOT EXPOSE THIS
APPLIANCE TO RAIN
OR MOISTURE.
THIS APPLIANCE SHALL
NOT BE EXPOSED
TO DRIPPING OR
SPLASHING WATER
AND NO OBJECT
FILLED WITH LIQUIDS
SUCH AS VASES
SHALL BE PLACED
ON APPARATUS.
The exclamation point within an equilateral
triangle is intended to alert the user to the
presence of important operating and
maintenance (servicing) instructions in the
literature accompanying the appliance.
Warning: To reduce
the risk of electrical
shock, do not remove
cover (or back) - no
serviceable parts
inside. Refer servic ing
to qualified service
personnel.
A
This lightning flash with arrowhead
symbol, within an equilateral triangle, is
intended to alert the user to the presence
of uninsulated "dangerous voltage" within
the product's enclosure that may be of
sufficient magnitude to constitute a risk
of electrical shock to persons.
Important Safety Instructions
1.
Read these instructions.
2.
Keep these instructions.
3.
Heed all warnings.
4.
Follow all instructions.
5.
Do not use this apparatus near water.
6.
Clean only with dry cloth .
7.
Do not block any ventilation openings. Install in
accordance with the manufacturer's instructions.
8.
Do not install near any heat sources such as
radiators, heat registers, stoves, or other apparatus
(including amplifiers) that produce heat.
9.
Do not defeat the safety purpose of the polarized
or grounding-type plug. A polarized plug has two
blades with one wider than the other. A grounding
type plug has two blades and a third grounding
prong . The wide blade or the third prong are
provided for your safety. If the provided plug does
not fit into your outlet, consult an electrician for
replacement of the obsolete outlet.
10. Protect the power cord from being walked on
or pinched particularly at plugs, convenience
receptacles, and the point where they exit from
the apparatus.
11. Only use attachments/ accessories specified by
the manufacturer.
12. Use only with the cart, stand, tripod,
bracket, or table specified by the
manufacturer, or sold with the apparatus.
When a cart is used, use caution when
moving the cart/apparatus combination to
avoid injury from tip-over.
13. Unplug this apparatus during lightning storms or
when unused for long periods of time.
14. Refer all servicing to qualified service personnel.
Servicing is required when the apparatus has been
damaged in any way, such as power-supply cord or
plug is damaged, liquid has been spilled or objects
have fallen into the apparatus, the apparatus has
been exposed to rain or moisture, does not operate
normally, or has been dropped.
15. Grounding or Polarization-This product may be
equipped with a polarized alternating-current line
plug (a plug having one blade wider than the other).
This plug will fit into the power outlet only one way.
This is a safety feature. If you are unable to insert the
plug fully into the outlet, try reversing the plug. If the
plug should still fail to fit, contact your electrician to
replace your obsolete outlet. Do not defeat the safety
purpose of the polarized plug .
Alternate Warnings-This product is equipped with
a three-wire grounding-type plug , a plug having a
third (grounding) pin. This plug will only fit into a
grounding-type power outlet. This is a safety feature.
If you are unable to insert the plug into the outlet,
contact your electrician to replace your obsolete
outlet. Do not defeat the safety purpose of the
grounding-type plug.
16. Ventilation-Slots and openings in the cabinet
are provided for ventilation and to ensure reliable
operation of the product and to protect it from
overheating, and these openings must not be
blocked or covered. The openings should never be
blocked by placing the product on a bed , sofa, rug ,
or other similar surface. This product should not be
placed in a built-in installation such as a bookcase
or rack unless proper ventilation is provided or the
manufacturer's instructions have been adhered to.
17. The MAINS plug or an appliance coupler is used as the
disconnect device, the disconnect device shall remain
readily operable.
18. ClASS II apparatus with double insulation, and no
protective earth provided.
19. CAUTION: Danger of explosion if the remote control
battery is incorrectly replaced. Replace only with the
same or equivalent type.
20. WARNING: The remote control battery (battery or
batteries or battery pack) shall not be exposed to
excessive heat such as sunshine, fire or the like.
21 . No naked flame sources, such as lighted candles,
should be placed on the apparatus.
Special Safety Warnings Regarding Placement
of the ZVOX System and Other Equipment
Stable Placement. Do not place the
Z'JOX system on an unstable cart,
stand, bracket or table. The ZVOX
system may fall, causing serious
injury to a child or adult and serious
damage to the product. Do not use
the ZVOX system on any unstable surface.
The 58400/58500 sound bar has two keyholeshaped mounting locations on the back panel.
These mounting sites will securely hold a
screwhead that is no larger than 3/8" (10mm) in
diameter. It is the installer's responsibility to confirm
each mounting site used to support the the 58400/
58500 has an adequate weight-handling margin to
support both the weight of the 58400/58500 and
extra weight that may inadvertently be applied as
a result of a house-hold accident. Damage that
may occur to the 58400/58500 during or after the
mounting process or any other installation activity
is NOT covered under the terms of the ZVOX Audio
limited warranty.
© 201 5 ZVOX Audio LLC.
Simple Setup - Just Four Steps
Place or
hang the
SB400/SB500.
Connect the
SB400/SB500
to your TV.
"Teach" the
SB400/SB500
your preferred
remote.
Learn the
features of the
SB400/SB500.
D
Face Front
1. Speaker placement
Face Up
Wall Mount
You can place the SB400/ SB500 on any flat , stable surface near your TV.
There are three general placement options, illustrated above:
Face Front
Face Up
Wall Mount
You can place the SB400/ SB500 on a flat surface so it faces
forward . This placement is ideal for a shelf below, above or near
the television .
You can place the SB400/ SB500 facing up - often in front of the
television . Check to ensure the SB400/ SB500 does not block the
television infrared remote sensor. There should be no shelf or
flat surface immediately above the SB400/ SB500 in this
configuration.
The SB400/SB500 has two sturdy keyhole-shaped hanger mounts
on the back panel. You can hang the SB400/ SB500 on two
screwheads that are securely installed in a wall or other vertical
surface.
• Consider the finish of the surface that will support the SB400/SB500. It is the
SB400/SB500 owner's responsibility to insure the surface finish supporting
or contacting the SB400/SB500 is protected, should this be a concern.
The contact area on the SB400/ SB500 is made of inert synthetic materials that
typically do not react with furniture or wall finishes. But any wall or surface
finish can be altered by having any heavy object resting on it for a long period
of time. Place an appropriate barrier between any surface and the 584001
58500 if you are concerned about the finish of the supporting surface.
• A safe, secure installation is the SB400/ SB500 owner's responsibility.
• Use an unswitched AC outlet to provide power to a SB400/ SB500 . With the
SB400/SB500's Auto Standby feature turned on , an SB400/SB500 will enter its
Standby state on or before 30 minutes of inactivity. A SB400/SB500 uses less
than 0.5 watt in Standby. Using a switched AC outlet to cut off AC power to a
SB400/ SB500 system is not recommended. It delays subsequent turn-on.
• Do not place any objects on top of a SB400/SB500 .
2. Connecting your TV to the SB400/SB500
All current lVs have an audio output. It is likely that one of the cables provided with the
SB400/ SB500 can be used to connect the lV audio output to an input on the SB400/SB500.
DO NOT disconnect any video program source connected to your lV (like a cable or satellite
set top box, DVD/ Biuray or similar) .
H~m•
Soundbar
Input
Panel
TV
Optical
Output
@"""'l
AHALOGINPUT®
@"".J
@""""'l
DIGITALJNPUT
VIDEO
'
(Q)
-
Optical Digital
Audio Input
Q)
CJ-..J
Optical Cable
Optical Digital Audio Output Jack (see above image)
Most HDlVs have an optical digital audio output jack. Use the provided optical cable
to connect this lV output to the optical digital audio input on the SB400/SB500.
Analog Audio Output
You can connect a TV set's analog audio output to the analog audio input on the the
SB400/ SB500 (which is left and right RCA jacks). The analog audio output on your TV will
be a 1/8 inch stereo minijack or a pair of RCA jacks. The two illustrations below show the
appearance of these two audio output connections.
You can connect a TV's left & right RCA jack audio output to the soundbar analog input.
Right Channel
Left Channel
Soundbar
Input
Panel
OR
You can connect a TV's minijack audio output to the soundbar analog input.
(!)@
@
""'""
r <i>
(!)
I
Right Channel
B
B
Left Channel
TV Minijack
Audio Output
Soundbar
Input
Panel
Coaxial Digital Audio Output
You can connect a TV set's coaxial digital output (usually orange) to the yellow coaxial digital
audio input on the ZVOX back panel. Use a cable with an RCA plug at each end . The color of
the plug is not important.
3. Connect the power supply adapter
FIRST, connect the DC plug of the power supply adapter to the DC IN jack on the back of the
SB400/ SB500. THEN connect the AC plug of the power supply adapter to an unswitched AC
power outlet.
Soundbar
Input
Panel
@-"~liM®
@~.J
@-1
IIOTJI.. o.uT
a-J
CD
DC Power Input
Power Supply Adapter
If your home TV system does not match the descriptions in this guide, don't hesitate
to send an inquiry to info@zvoxaudio.com or call ZVOX Audio at (866) 367-9869.
Please provide your TV brand and model number. A ZVOX Audio representative
should be available (Eastern Time Zone) Monday through Friday 9:30 AM to 7:30 PM
and noon to 4:00 PM on Saturday.
4a. Infrared Remote Control of the
SB400/SB500
Learning:
You can "teach" the SB400/ SB500 to respond to your
current TV remote control for the following functions:
VOLUME, MUTE and POWER . This is described in the
separate instruction sheet beginning "Teach Your SB400/
SB500 ... " After this "learning" process, you will not need
the SB400/ SB500 remote control to control Volume,
Mute and Power. Teaching the SB400/SB500 to respond
to your preferred remote does not affect the included
SB400/ SB500 remote. The SB400/ SB500 remote will
always provide its full range of adjustments.
Input Selection:
A brief press and release of the INPUT button on the
SB400/SB500 remote control allows you to select between
the three separate inputs on the SB400/SB500.
..............
Input 1-digital
Bluetooth device
Input 2- analog (RCA jacks)
The SB400/SB500
supports one digital
audio source, either
optical or coaxial.
Volume
The VOLUME buttons operate in the normal manner
Power (STANDBY)
The Power button toggles the SoundBase between STANDBY and On. Note: A Sound Base
automatically enters STANDBY if it is silent for longer than approximately 30 minutes. A
Sound Base in STANDBY will automatically turn back on if it senses a volume adjustment or
power command from the "learned" remote control or the Sound Base remote control.
Mute
Mute
,-,,-,
-uuBass set at -2
U I
I 11
I
I
Treble set at 1
I
,-,
-1
The MUTE button on the SB400/ SB500 remote control
operates in the normal manner. When MUTE is active,
the display will show a blinking -00- for 20 seconds.
Bass and Treble
The Bass control has a range of -4 to 4.
The Treble control has a range of -4 to 4.
Note: The bass output of a SB400/SB500 system is affected
by its position within a room . You may find it sounds best
with slightly more or less bass than the neutral setting .
Lu-c
Surround Settings
There are three SURROUND levels:
• Surround One ("Sd 1") has low virtual surround effect and strong
vocals. Use this setting if vocal clarity is important to you .
• Surround Two ("Sd 2") has moderate virtual surround effect
and moderate vocals. Most people prefer this setting for most
program material.
• Surround Three ("Sd 3") has strong virtual surround effect
and moderate vocals. Many people prefer this setting when
watching movies.
,-11
L/L
n /- 1- I I
1-1 '- '- /_/
I
::1 Cl
I
I
C
C
I
::1 CJ
-1
C
Output Leveling
Press this button to prevent large changes in volume. When
engaged, it boosts quiet dialog and lowers the output of loud
commercial breaks. It also reduces volume swings between
cable or satellite channels. This feature can be used along
with any of the three Surround settings.
Accuvoice
Press this button to increase the clarity of most voices.
Pressing Accuvoice overrides the current Surround setting .
A second press returns the Sound Base to the last-used
Surround setting .
4b. End Panel Controls on the
SB400/SB500
'
On the viewer's right end of the speaker
are four buttons.
'
\
A) POWER button:
This button turns the 88400/ 88500 "ON" if
it is in Standby. If this button pressed briefly
while the 88400/88500 is "ON", it will mute
and unmute the 88400/88500. To turn off
the 88400/88500, press and hold down this
button for about five seconds.
B) Volume Up/Down rocker button
Press the "
side of the rocker button to
increase volume. Press the " - " side of the
rocker button to decrease volume. Pressing
either side of this button will "unmute" the
speaker if it is muted.
+"
C) Input button:
A brief press and release of the INPUT
button on the 88400/88500 remote
control allows you to select between the
three separate inputs on the 88400/ 88500.
5. Tonal Profile Setting
The 88400/88500 has an adjustment to allow
it to better match the acoustics of the of its room
position. There are three profile settings.
Face Front.. ...... PS16 - on a flat surface, facing front.
Face Up .......... PS17 - on a flat surface, facing up.
00
Wall mount
0000000
PS18 - on a vertical surface,
facing into the room.
The default setting for the 88400/88500 is Face Front.
\
/
---' _,
''
''
'
0
__ _
/
(.,
/
/
/
/
/
''
/
/
/
0
A @
~
ern
B
0
0
If your 88400/SBSOO's position is Face Up or
Wall mount, you should select PS17 or PS18
from the PS menu.
You bring up the PS menu by pressing down on two buttons on the end panel of the
88400/88500: Power(<!.>) and Volume Up (+). After about five to seven seconds you should
seePS start flashing. The first time you bring up the PS menu, it should show "PS 0".
Once you see the PS display, release the buttons. Then press and release the Volume Up
button to increase the PS number. Continue pressing and releasing the Volume Up button until
you reach the setting you want: PS16, PS17 or PS18.
For further information about the options provided by the PS menu, see the separate
information sheet SoundBase Adjustment Options.
STILL NEED ASSISTANCE? If your home TV system does
not conform to the descriptions in this guide, don't hesitate
to send an inquiry to info@zvoxaudio.com or call ZVOX Audio
at (866) 367-9869. Please provide your TV brand and model
number. A ZVOX Audio representative should be available
(Eastern Time Zone) Monday through Friday 9:30 AM to 7:30 PM
and noon to 4:00 PM on Saturday.
6. SB400/SB500 Wall Mounting Information
Please refer to the last page of the "Adjustment Options" booklet for dimensioned
drawings of the SB500 and SB400.
The SB400/SB500 has two keyhole mounting sites on its back panel. You can mount
the SB400/SB500 onto two screwheads using these mounting sites. The SB400/SB500
weighs 16 pounds. NOTE: It is the installer's responsibility to ensure the screws are
installed into the wall or other surface securely and that the screwheads are the correct
size for the hanger mounts on the rear of the SB400/SB500. ZVOX Audio recommends
your mounting sites be able to support at least twice the weight of the SB400/SB500.
®
ZVOX SB400/SB500 Soundbar Quick Setup
1
Position the
SB400/SB500.
2
3
4
Connect the
power cord.
Connect to
Optical Audio
Output of TV.
Connect to
Optical Audio
Input of
SB400/SB500.
1
',*,7$/
$8',2
287
DC
Power
Input
+'0,
+'0,
Face Front
Back of SB400/SB500
9,'(2
2
Face Up
Optical Digital
Audio Input
Back of TV
Optical Audio Output
Connect one end of an
optical digital cable to
the TV’s optical digital
Audio Out jack.
AC Power
Receptacle
Wall Mount
Place the SB400/SB500
on stable, flat surface.
Ensure all components
are stable and secure.
Connect the DC plug
to the DC power input
of the SB400/SB500.
Then insert the AC
plug into an AC power
receptacle.
Back of SB400/SB500
SB400/SB500
Optical Input
Connect the other end
of the optical cable to
the soundbar’s optical
digital input jack.
a
b
c
RCA Jack Analog Audio Out
69,'(2
$8',2
287
Right Channel
Left Channel
Confirm you hear
TV sound through
the SB400/SB500.
With a digital audio
connection, you
should hear the TV
sound through the
SB400/SB500 with the
soundbar’s volume set
to 12-15. If you don’t
hear sound or if you
did not use a digital
connection, press the
INPUT button on the
SB400/SB500 remote
control to select the
Bluetooth or analog input.
You can also select the
input using the INPUT
button on the SB400/
SB500 end panel.
Select an input on the
SB400/SB500 using the
remote control
32:(5
,1387
,138
',$/2*
(03+$6,6
Other Possible TV Audio Outputs
6'
9,'(2,1
5
6855281'
or the end panel.
Left & Right
Analog
Audio Input
A red/white pair of RCA jacks on the
back of the TV labeled OUTPUT. Do not
connect to RCA jacks labeled INPUT.
Back of TV
“Minijack” Analog
Audio Out
Some TVs use a minijack output
or headphone jack. Do not use a
minijack labeled INPUT.
<9,'(2
3%
35
Right Channel
Left Channel
/0212
Left & Right
Analog
Audio Input
$8',2
5
$8',2
,1
$8',2
287
$17
&$%/(
Input 1—digital (optical jack)
Back of TV
Coaxial Digital
Audio Output
Back of SB400/SB500
Back of SB400/SB500
'LJLWDO
$XGLR
Coaxial Digital
Left & Right
Analog
Audio Input
(Single RCA jack, may be orange)
Any cable with an RCA plug at
each end can be used.
Bluetooth input
Input 2—analog
(red/white RCA jacks)
Back of TV
Back of SB400/SB500
© 2015 ZVOX Audio LLC.
The PS Menu
Adjusting the PS Menu
The SB400 and SB500 have adjustments
that could prove useful, depending on the
installation location and user preferences.
The adjustments are made through the PS
Menu feature of both soundbars.
To make a selection from the PS menu listing,
press and hold down both the MUTE and
VOLUME UP front panel buttons for about
3 seconds. If this is the first time you
have used the PS menu, you will see the
characters "PS-0" start flashing. Immediately
release the two buttons when you see the
PS number flashing. Then quickly press and
release the Volume Up button while "PS" is
still flashing. This will increase PS number
setting. Pressing Volume Down will decrease
the PS number setting, down to "PS-0".
Each time you press the Volume Up or
Volume Down button, you have an additional
six seconds to make an adjustment.
For instance, your TV set may not have a
provision to turn off the internal speakers
or the TV may display a distracting "TV
speakers off" message. Adjustments to the
PS menu of the soundbar along with your
preferred remote control can allow your
remote control to adjust volume on the
sound bar without your TV speaker playing
or the distracting message.
These adjustments are made using the four
end panel buttons on the soundbar while
watching the numeric display. The remote
control provided with the SB400 and SB500
cannot make adjustments to the PS Menu.
Once you arrive at your intended PS number,
just wait for the display to stop flashing the
PS number. When the flashing stops, the
adjustment is made.
0
0
0
0
CIC _
I
Press both buttons for three or more
seconds to trigger the PS number
adjustment mode.
_/
n
U
While flashing, the Volume Up or Down
buttons set the PS number. After adjustment,
the setting is stored when the display turns off.
ZVOX '
Great Sound Made Sl'nplc
(866) 367-98691 info@zvoxaudio.com
PS Emulation Modes
Please note: the PS menu number sequence skips some numbers.
The first six options in the PS menu are emulation modes. See "Using the SB400/SB500
remote control emulation modes" for instructions.
No brand Sony
emulation
LG
Samsung
-
Vizio
Panasonic Marantz
Additional PS Settings
Additional SB400/SB500 adjustments affect how you turn the soundbar on and off and how it
responds to remotes.
"AS" Auto Standby:
"noAS" no Auto Standby:
"AO" Auto On:
When PS10 is selected, the
soundbar will automatically enter
a low-power draw Standby
mode after 20-30 minutes of
very low to no audio signal.
In most uses, this means the
soundbar will turn its self off
after you turn off the TV
The soundbar only enters
Standby in response to a press
of the POWER button on an
soundbar remote or "learned"
remote control. Auto Standby
is "off".
The soundbar turns on in
response to the POWER,
VOLUME and MUTE
commands from the
soundbar remote and from
the "learned" remote.
"noAO" no Auto On:
"OnEr'' One Remote:
The soundbar turns on in
response to a soundbar remote
command, but not a "learned"
remote command. Once on,
the souridbar will respond to a
learned remote.
The soundbar responds only
to the soundbar remote control.
A "learned" remote's control
is disabled. Chose PS12 or
PS13 to restore control by a
"learned" remote.
Tonal Profile Settings-SB400/SB500 only
The SB400/SB500 factory default tonal profile is Face Front.
Face Front position
Face Up position
Wall Mount position
Using the SB400/SB500 remote control emulation modes
PS 1 through PS 6:
Most users teach the sound bar to respond
to their preferred remote control using the
soundbar built-in "learning" function. Should
this approach not work with your preferred
remote control, there is an alternate method
that can allow your preferred remote to
control the sound level heard from
the soundbar.
To use this method, your preferred remote
control needs an Aux or Audio device button
in addition to device buttons for the lV and
set top box. This method cannot be used if
your preferred remote control has only two
device buttons. (Set Top Box and TV). You will
also need the User Manual for your specific
Cable or Satellite remote control, along
with the "device brand and code" list for
your remote control. This list may be a
separate document from the remote
control User Manual.
Using the PS numbers 1 through 6, you set
the SB400/SB500 to respond to the the
remote commands of a popular manufacturer
of lV or audio systems. In most cases, you
need to choose a different brand than your
lV. Choosing a brand that is different from
your lV eliminates the chance that the lV's
internal speakers will start playing along with
the soundbar. Sony is a good choice from the
PS menu for most lVs. Most cable or satellite
remote controls can be adjusted to control a
SB400/SB500 set to "Sony" in the PS menu.
Because most Sony lVs have an "internal
speakers off" option, you can even use the
"Sony" option in the PS menu with Sony lVs.
If your Sony lV does not let you turn off the
internal speakers, you will need to choose a
different brand from the PS menu numbers 1
through 6.
Once you have chosen a brand from the
soundbar's PS menu, you need to adjust
the setting on your cable or satellite remote
so its Volume buttons adjust that same
brand of Aux or Audio device. There are two
adjustments you may need to make on
the cable or satellite remote.
Cable/Sat remote adjustment 1: The
volume buttons on a cable or satellite remote
are typically "locked" on to the lV's internal
speakers. Even if you press the "Cable"
button on your remote, the volume buttons
will still send out volume commands for
your TY, not the cable box. You need to
unlock the Cable/Sat remote volume buttons
according to the cable or satellite remote
control's instructions. Once unlocked,
pressing Aux on the Cable/Sat remote
will then cause the volume buttons on the
Cable/Sat remote to control whatever brand
of device is set on the Aux button.
Cable/Sat remote adjustment 2: The
cable/ satellite remote instructions will also tell
you how to set the "AUX" or "AUDIO" button
to the brand you chose on the soundbar's
PS menu. The instructions should list a few
numbers that let you control a device that
responds to Sony codes, for instance.
Try the different "number code" options
listed until you find one that controls the
SB400/SB500. If you cannot find a code
that controls the soundbar, you can set the
sound bar to one of the other four brands
available and search for a compatible code
for that brand.
Once you find a code number that controls
the SB400/SB500, you can then "lock" the
cable or satellite remote volume buttons to
adjust only the Aux or Audio device and not
the 1V Once locked, the volume buttons will
always control the sound bar, even if a lVI
Cable/Satellite/DVD button on the Cable/
Satellite remote control is pressed.
Master Reset
A master reset restores a SB400/SB500
to the factory default behavior. It erases
any "learned" remote control response. It
sets the SURROUND mode to Surround
"2", sets OUTPUT LEVELING and DIALOG
EMPHASIS to OFF and sets BASS and
TREBLE to no boost or cut in bass or treble
output. It sets the INPUT to Optical Input 1.
To perform the Master Reset, first put the
SB400/SB500 in Standby mode by pressing
the POWER button on the SB400/SB500
remote control. When you see "OFF" on the
SB400/SB500 display, the unit is in Standby.
You can also put a SB500 in Standby by
pressing down on the end panel MUTE
button for about 5-7 seconds.
Once the SB400/SB500 is in Standby,
locate the INPUT button on the end panel
of the SB400/ SB500. (You cannot use the
INPUT button on the remote to perform a
Master Reset.)
Press and hold down the end panel INPUT
button for about 15 to 20 seconds. When
you see the three letters " r S t " appear
on the display (see figure below), release the
INPUT button. The SB400/SB500 will then
show the four-digit firmware code number and
turn "ON". The master reset is complete.
RESET Indication.
88400/88500 Wall Mounting
Information
The SB400/ SB500 has two keyhole mounting
sites on its back panel. You can mount the
SB400/ SB500 onto two screwheads using
these mounting sites. The SB400/SB500
weighs 16 pounds. NOTE: It is the installer's
responsibility to ensure the screws are installed
into the wall or other surface securely and
that the screwheads are the correct size for
the hanger mounts on the rear of the SB400/
SB500. NOX Audio recommends your
mounting sites be able to support at least
twice the weight of the SB400/SB500.
Back view with dimensions of the 88500 and 88400
Height 144.5 mm~
(511/16") l
58500
LJ-----------+-~~971m6") _-----t------lJ'fO1
II
743 mm (29 3/4")
- + - - - - - - - - - --
--
1114mm (43 7/8") - -- - - --
------
I
...,..._
Depth 84.5 mmJ
(3 5/16")
l
r------------11
I
743 mm (29 3/4")
-+--- --
-
-
-
-
-
902mm(35.5")
fll
Height 144.5 mm ~
(511/16") -
58400
-
-
- -- --
-
-
I
I
...,..._
Depth 84.5 mm J
(3 5/16")
Your Current TV Remote Can Control Your SB400/SB500.
After following the steps outlined in this guide, your cable or satellite
remote will adjust the volume output from your soundbar system. Please
Note: If you have a DirecTV remote control, use the DirecTV remote
guide included along with this instruction sheet.
To insure accuracy, the learning routine records each button’s
commands twice, then confirms a successful button learning.
The steps involve pressing the Volume, Mute, and Power buttons of your
preferred remote control with the remote positioned close to the numeric
display of the soundbar. Once complete, the soundbar will respond to
the buttons it has learned from your preferred remote control.
ZVOX® Audio has specific instruction sets available for a variety of
popular remote controls. These instructions provide an alternate method
for configuring your SB400/SB500 to respond to your preferred remote
control. If you cannot easily teach the SB400/SB500 to respond to your
preferred remote control, please contact ZVOX Audio about additional
instructions for your preferred remote control.
PREPARE
1
2
Stand or sit within easy reach
of the soundbar’s control buttons
(the end on your right hand side).
Locate the following
buttons on your
remote control:
You will need to press two buttons on
the SB400/SB500 end panel to start the
learning process. Then you will press four
buttons on your preferred remote control.
1 VOLUME UP
2 VOLUME DOWN
3 MUTE
4 POWER
3
4
Press both
VOLUME buttons
on the soundbar
until “Lrn” appears
(about 4 seconds).
Then release both
VOLUME buttons.
3
1
2
࠮ Get ready
to press
VOLUME UP
on the Remote
Control.
The learning process
involves pressing these
four buttons in sequence.
This remote is only an example. Your
remote is probably different. Please
locate these buttons on your remote.
Error Message of
the SB400/SB500
Learning Routine
If you see the “no change” message (nocH) during the learning routine,
the SB400/SB500 system system did not accept the infrared code.
The current step in the learning routine will repeat.
LEARN BUTTONS
volume up
1
When
appears, press
VOLUME UP for 1 second.
.
You should see
appears, press
When
VOLUME UP for 1 second, again.
You should see
followed by
,
.
mute
volume down
2
appears, press
When
VOLUME DOWN for 1 second.
You should see
power
3
4
appears, press
When
MUTE for 1 second.
appears,press
When
POWER for 1 second.
You should see
You should see
.
.
When
appears, press
VOLUME DOWN for 1 second, again.
When
appears, press
MUTE for 1 second, again.
appears, press
When
POWER for 1 second, again.
You should see
followed by
You should see
followed by
You should see
followed by
,
.
YOU ARE DONE!
,
.
,
.
© 2015 ZVOX Audio LLC.
®
Using Bluetooth
wireless audio with
your ZVOX SoundBase®
or Soundbar.
Your ZVOX system is equipped with Bluetooth, which
allows it to receive and play music wirelessly from
your smart phone, tablet, laptop computer or other
Bluetooth-equipped audio device.
‡7RVWDUWWKH%OXHWRRWKFRQQHFWLRQSURFHVVXVHWKH
,1387EXWWRQRQWKH=92;UHPRWHFRQWURORUWKH
,1387EXWWRQRQWKH=92;V\VWHPWRVHOHFW
.HHSSXVKLQJWKH,1387EXWWRQ
%OXHWRRWK
until the display on your ZVOX system reads “bLUE.”
‡1RZSDLU\RXUGHYLFHZLWKWKH=92;V\VWHP7KLV
W\SLFDOO\LQYROYHVJRLQJWR6HWWLQJVRQ\RXUGHYLFH
WKHQWRWKH%OXHWRRWK6HWWLQJVRSWLRQDQGWKHQ
FKRRVLQJ=92;ZKHQLWDSSHDUVRQWKHOLVWRIDYDLOable Bluetooth devices.
‡7KHE/8(V\PERORQWKH=92;GLVSOD\ZLOOÀDVK
GXULQJWKHFRQQHFWLRQSURFHVV2QFHWKHFRQQHFWLRQ
LVPDGHWKHE/8(V\PEROZLOOVWRSÀDVKLQJ<RXU
GHYLFHVKRXOGDOVRFRQ¿UPWKHFRQQHFWLRQ
$=92;V\VWHPFDQUHPHPEHU³SDLULQJ´ZLWKXSWR
¿YHGLIIHUHQW%OXHWRRWKGHYLFHV7KH=92;V\VWHP
connects faster to a Bluetooth device that was previously paired with the ZVOX system.
We strongly recommend that you only have one
Bluetooth-transmitting device in the same room as
the ZVOX system. +DYLQJDVHFRQG%OXHWRRWKGHYLFH
VHDUFKLQJIRUDFRQQHFWLRQQHDUD=92;V\VWHPFDQ
LQWHUUXSWWKH=92;V\VWHP
VDFWLYHVHVVLRQ6LPSO\
turn Bluetooth off on any other nearby Bluetooth
devices. If your ZVOX system drops a connection to a
%OXHWRRWKGHYLFHFKHFNWRVHHLIWKHUHLVDQRWKHUDFWLYH%OXHWRRWKGHYLFHOLNHDSKRQHRUWDEOHWQHDUE\LQ
another room or even outdoors.
If you wish to connect a ZVOX system to a different
%OXHWRRWKHTXLSSHGGHYLFH¿UVWWXUQ%OXHWRRWKRIILQ
WKHFXUUHQWO\FRQQHFWHGGHYLFH7KHQWXUQ%OXHWRRWK
on in the new device.
Troubleshooting suggestions
if Bluetooth won't connect.
‡%HVXUHWKH%OXHWRRWKGHYLFHLVZLWKLQUDQJHRIWKH
=92;V\VWHP7KHFORVHUWKHGHYLFHWKHEHWWHU7KH
device should be within 20 feet of the ZVOX system.
‡%HVXUHWKH=92;V\VWHPLQSXWLVVHWWRE/8(
‡%HVXUH%OXHWRRWKRQ\RXUGHYLFHLVDFWLYDWHG
‡,I\RXUGHYLFHLQGLFDWHVWKDWLWKDVFRQQHFWHG±EXW
WKHQGLVFRQQHFWVWU\UHFRQQHFWLQJWKHGHYLFH
‡,IUHSHDWHGDWWHPSWVWRFRQQHFWGRQ
WZRUN
WU\WKHIROORZLQJ
3UHVVDQGUHOHDVHWKH,1387EXWWRQRQWKH=92;
XQWLOLWUHWXUQVWRWKHE/8(LQSXW7KLVUHVWDUWVWKH
%OXHWRRWKFRQQHFWLRQ5HWU\WKHSDLULQJSURFHVV
- If there are other Bluetooth devices nearby, temporarily de-activate their Bluetooth function.
&OHDUWKH=92;HQWU\IURPWKHSDLULQJOLVWRQ\RXU
%OXHWRRWKGHYLFH&KRRVHWKH,JQRUH)RUJHW7KLV'HYLFHRSWLRQ7KHQVHDUFKIRUDQHZ%OXHWRRWKGHYLFH
to connect to the ZVOX system.
1RWH%OXHWRRWKUHFHSWLRQFDQEHGHJUDGHGE\
GHYLFHVWKDWWUDQVPLWUDGLRIUHTXHQF\VLJQDOV:L¿
router or radio-frequency remote control transmisVLRQVFDQUHGXFH%OXHWRRWKUHFHSWLRQUDQJH,QIUDUHG
UHPRWHFRQWUROVZLOO127DIIHFW%OXHWRRWKUHFHSWLRQ
www.zvoxaudio.com 866-367-9869
info@zvoxaudio.com
‹=92;$XGLR//&>5@=92;DQG6RXQG%DVHDUHUHJLVWHUHGWUDGHPDUNVRI=92;$XGLR//&%OXHWRRWKLVDUHJLVWHUGWUDGHPDUNRI%OXHWRRWK6,*
Download PDF
Similar pages