Official Sponsor
Purchasing guides for the electronics industry
Military & Aerospace
Technologies Resource Catalog 2009
www.eecatalog.com/military
Sponsors
Copyright: Alexandre Paringaux
Kontron VME Boards & Platforms
Fast, Flexible,
Powerful
v
Fast
v
Kontron VME products offer the latest
in multi - core processing technology
Flexible
Customization with features for exactly
what you need and when you need them
High Performance 6U VME PowerPC Boards
v
Powerful
VME Integrated Platforms available for
each phase of your project, boosting the
final application
VME Integrated Platforms
v
Outstanding Memory Bandwidth and Computing Performance
VME 2eSST Capability
v Real -Time Operating System Support
v Air-cooled and Conduction-cooled Ruggedization Levels
Kontron and the Kontron logo are registered trademarks of Kontron AG. All other
trademarks are the property of their respective owners. ©2008 Kontron America, Inc.
v
Easy VME Platforms
v
PowerPC VME platforms for
accelerated development
PowerEngine7
v
v
Dual PowerPC 750GX / 750FX
Low Power Dissipation
PowerNode5
v
v
Dual 64 - bit PowerPC 970FX
Onboard Serial RapidIO and
Serial FPDP Switch Fabric
Learn more about Kontron’s VME products: www.kontron.com
1-888-294-4558 - info@us.kontron.com — EMEA: +49 0 800 7253756 - Asia: +886 2 2910 3532
PowerMP VME Platforms
v
Suited to High Performance
Embedded Computing (HPEC)
such as radar, sonar
and seismic
When
You’re at
30,000 feet
Quality
Matters
Our Products and Services
are Second to None
A
t VersaLogic we know about building dependable, high reliability embedded
computers for mission critical applications. Our products have been designed
LQWRVRPHRIWKHPRVWVRSKLVWLFDWHGDQGKLJKSUR¿OHPLOLWDU\DQGDHURVSDFH
equipment used today. Every board we make is run through exhaustive
inspections and quality tests, ensuring that we deliver only the best. And with
RXUZRUOGFODVVVHUYLFHDQG¿YH\HDUDYDLODELOLW\JXDUDQWHHZH¶OODOZD\VEH
there when you need us. Whether you need one of our standard products or a
customized version, our skilled technical staff will work with you to meet your
exact requirements. So before your program launches, choose the company
with the quality and service to take you where you need to go.
&RQWDFWXVWR¿QGRXWKRZIRUPRUHWKDQ\HDUVZH¶YHEHHQSHUIHFWLQJWKH
¿QHDUWRIH[WUDRUGLQDU\VXSSRUWDQGRQWLPHGHOLYHU\2QHFXVWRPHUDWDWLPH
1.800.824.3163
1.541.485.8575
www.VersaLogic.com/jet
TopTrends drivingTechnologies for
Tomorrows Military and Aerospace Systems.
Today’s aerospace, avionics and defense companies use enabling technologies to build
tomorrow’s complex computer systems, on-time and on-budget. These technologies are
often labeled as COTS, and as you will see from the breadth of solutions detailed in this
catalog, they span both the hardware and software realms.
Many of these solutions were developed for the commercial sector where time-to-market
pressures are forcing daily innovation. However they also have properties and qualities that
make them very suitable for the Military and Aerospace markets. At LynuxWorks, we’ve
been examining the technology trends in the embedded market and how they might be used
by tomorrow’s Military and Aerospace systems.
Military & Aerospace
Technologies Resource
Catalog 2009
www.eecatalog.com/military
VP/Associate Publisher
Clair Bright - cbright@extensionmedia.com
(415) 255-0390 ext. 15
Editorial
Editorial Director
John Blyler
jblyler@extensionmedia.com
(503) 614-1082
Creative/Production
Production Director
Stephanie Rohrer - srohrer@extensionmedia.com
Graphic Designers
As the need for more complex software grows, the demand for increased processing power
of embedded cores is also growing dramatically. This call is now being answered by the
multi-core CPUs provided by the processor suppliers and are now utilized on COTS boards.
The challenge then becomes how to architect and design software to use these multi-core
processors. Operating system vendors like LynuxWorks are providing multi-processing
support for these new cores, allowing software developers the choice of partitioning their
code manually or allowing the SMP capabilities of the RTOS to do it for them.
The re-use of legacy software, and the additional use of commercial or open-source applications, is
another key factor in the design and deployment of complex embedded systems. This is aided by
the use of open standards based programming APIs such as POSIX or Linux, high level languages
and design tools, and open standards based development tools such as the Eclipse framework.
Many examples of products based on modern open-standards can be found in this catalog.
Keith Kelly - print
Brandon Solem - online
Traffic Coordinator
Liz Matos - traffic@extensionmedia.com
Traffic/Production Assistant
Kali Snowden
Online Director
Jeff Cheney
Advertising/Reprint Sales
VP/Associate Publisher
Embedded Electronics Media Group
Clair Bright - cbright@extensionmedia.com
(415) 255-0390 ext. 15
Sales Manager
Marcy Carnerie - mcarnerie@extensionmedia.com
Marketing/Circulation
Programmable and configurable systems, both hardware and software, are now becoming an integral component of many new embedded designs, where easily replaceable and upgradeable parts
add to the longevity and configurability of complex systems. Some programmable hardware such
as FPGAs now have processors embedded in their fabric, allowing complete systems to be built on
a programmable chip, which then requires the support of configurable COTS software.
Jenna Johnson - jjohnson@extensionmedia.com
Lastly, there is a heightened necessity for security in today and tomorrow’s military and aerospace
systems. This has interesting demands for both software and hardware solutions, especially
when additional security requirements are required in legacy systems. LynuxWorks and our strategic partners aren’t newcomers to this technology, we have been developing secure separation
kernels and hypervisors, such as LynxSecure, and the hardware companies have been adding
virtualization to their chips, both of which allow for efficient hosting of multiple operating systems
at different levels of security in a single system. Add to this the anti-tamper software solutions
now available, and the infrastructure is in place to create true secure systems.
President and Publisher
Inside you will find solutions and innovative technologies from LynuxWorks and our partners
in the Military and Aerospace industry that will address the trends we see on the horizon. We
hope you find this guide a valuable resource and we wish you a successful year in 2009.
Vice President, Business Development
To Subscribe
www.extensionmedia.com/free
Extension Media, LLC
Corporate Office
Vince Ridley
vridley@extensionmedia.com
Vice President, Sales
Embedded Electronics Media Group
Clair Bright
cbright@extensionmedia.com
Vice President, Marketing and Product
Development
Karen Murray
kmurray@extensionmedia.com
Melissa Sterling
msterling@extensionmedia.com
Special Thanks to Our Sponsors
Connect Tech Inc.
Industrial Strength Communications
Gurjot Singh
CEO, LynuxWorks
The Military & Aerospace Technologies Resource Catalog 2009 is published by Extension
Media LLC. Extension Media makes no warranty for the use of its products and assumes
no responsibility for any errors which may appear in this Catalog nor does it make a
commitment to update the information contained herein. Military & Aerospace Technologies
Resource Catalog 2009 is Copyright ®2009 Extension Media LLC. No information in this
Catalog may be reproduced without expressed written permission from Extension Media @
1786 18th Street, San Francisco, CA 94107-2343.All registered trademarks and trademarks
included in this Catalog are held by their respective companies. Every attempt was made to
include all trademarks and registered trademarks where indicated by their companies.
2
Military & Aerospace Technologies Resource Catalog 2009
60 Watt PC/104 Power Supply
HE
104
-DX
108 Watt PC/104+ Power Supply
- 60 Watt power supply
- 108 Watt power supply
- +5V, +12V, -5V, and -12V DC output
- +3.3V, +5V, +12V and -12V DC output
- 6V to 40V DC input range
- 6V to 40V DC input range
- High efficiency up to 95%
- High efficiency up to 95%
- PC/104 compliant
- Extended temperature: -40ºC to +85ºC
HE
104
+D
X
60 Watt PC/104 Power Supply / Smart Charging
168 Watt High Power PC/104 Power Supply
with Smart Charging
- 60 Watt output & 6V to 40V DC input range
- +5V, +12V, -5V, and -12V DC output
- Charging voltage: 9.5 - 19.5V
- Multistage charging SLA, NiCd, NiMh
HE
SC
104
- SMBus Level 3 compatible charger
- Extended temperature: -40º to 85° C
HP
SC
104
-SE
R
PC/Supercapacitor Backup Power Source
BA
T-S
C3
50
- Extended temperature: -40ºC to +85ºC
- 168 Watt & 6V to 40V DC input
- +5V, +12V, -5V, -12V and V5SBY (7amp)
DC outputs
- Multistage charging for SLA, NiCd, NiMh
- SMBus Level 3 compatible charger
- Charging voltage: 10V - 35V
- Both PC/104 and RS232 interfaces
- Extended temperature: -40º to 85° C
Battery Backup Module
- Super capacitors of 350 farads each
- Capacity 4500 mA-hr @ 8.4V nominal
- 500,000 recharge cycles
- Energy backup of 37.8 watt-hr.
- Compatible with Tri-M HESC and
HPSC series power supplies
- PC/104 footprint size.
- Includes built-in isolating mosfet for sleep
mode operation
- Available with built-in RTC
- Super capacitors are not harmed by deep
discharges
- Operating temperature range: -40º to 65ºC
BA
TNi
M
h4
5
7(/
)$;
- Digital I2C temperature sensor for
detecting battery temperature
Contents
Off-The-Shelf Migraines - The military’s push for standard components is
creating unexpected complications.
by Ed Sperling............................................................................................................................................................................................8
ELMA Electronic, Inc.
by ELMA Electronic, Inc............................................................................................................................................................................ 18
VPX: Guaranteeing the Long Term Future of VMEbus
by GE Fanuc Intelligent Platforms............................................................................................................................................................ 20
Kontron and Thales Computers Come Together to Deliver Advanced Rugged Embedded
Computing Products for Military Applications
by Kontron................................................................................................................................................................................................ 22
Products and Services
Chips, Cores & Components
Chips, Cores & Components
Advanced Micro Devices
AMD Athlon™ and AMD Athlon X2 dual-core processors... 25
AMD Geode™ LX 800@0.9W processor .............................. 26
AMD Opteron™ processor .................................................... 27
AMD Opteron™ processor .................................................... 28
Tundra Semiconductor
Tundra Serial RapidIO and VME............................................ 29
Application Solutions
Analog / Digital IO
VMETRO
AD3000 3GSPS A/D XMC/PMC module............................... 30
Batteries
Tri-M Engineering
CBP23 - 23 Farad Super Capacitor Backup Power Module .. 31
Carrier Boards
Kontron
ATCA 10Gbe Boards.............................................................. 32
COTS
Connect Tech Inc.
BlueStorm Serial Port Expansion Cards for PCI Express....... 33
PC/104, PC/104-Plus & PCI/104-Express.............................. 34
Kontron
Kontron Systems, Motherboards/SBCs & Custom System
Services................................................................................. 35
Sealevel Systems, Inc
ACC-188 Synchronous Serial Radio Adapter........................ 36
CPU or Single Board Computers
American Portwell Technology, Inc.
NANO-8044........................................................................... 37
Ampro Computers, Inc.
COM 840 Extreme Rugged COM Express Module &
RuffSystem 840..................................................................... 38
Ampro Computers, Inc.
CoreModule™ PC/104 Extreme Rugged Single Board
Computers ............................................................................. 39
4
Ampro Computers, Inc.
LittleBoard™ EBX Extreme Rugged Single Board Computers &
RuffSystem 800..................................................................... 40
ReadyBoard™ EPIC Rugged Single Board Computers .......... 41
DIGITAL-LOGIC AG
Stackable PCI 104 Express.................................................... 42
Emerson Network Power
CPCI7200 Multicore CompactPCI SBC .................................. 43
MVME7100 Multicore VMEbus Board.................................. 44
Quantum3D, Inc.
Sentiris 4110 PMC/XMC....................................................... 45
Tri-M Engineering
VSX104+ - 300MHz FanlessPC/104plus CPU Module with
Dual LAN ............................................................................... 46
Data Acquisition
Pentek
Model 7150: Quad 200 MHz, 16-bit A/D with Virtex-5 FPGAs
- PMC/XMC module .............................................................. 47
Enclosures
Carlo Gavazzi Computing Solutions
709......................................................................................... 48
716 Series ............................................................................. 49
Elma Electronic
Liquid Cooled ATR and Rackmount enclosures..................... 50
Ruggedized MicroTCA Chassis ............................................. 50
Emerson Network Power
Centellis™ 500 MicroTCA Platform ...................................... 51
Centellis™ 1000 MicroTCA Platform .................................... 52
Kontron
Kontron MicroTCA Integrated Platforms .............................. 53
Octagon Systems
CORE Systems™.................................................................... 54
RMB-C1 ................................................................................. 54
FPGAs
Connect Tech Inc.
FPGA Computing & Digital I/O.............................................. 55
Military & Aerospace Technologies Resource Catalog 2009
Instrumentation
Highland Technology, Inc.
V346 - Arbitrary Waveform Generator.................................. 56
Interconnects
Tyco Electronics
MULTIGIG RT Connector Products for VITA 41 and VITA 46
Standards .............................................................................. 57
Mass Storage
Connect Tech Inc.
Rugged, Solid State Storage FlashDrive/104 ....................... 58
VMETRO
Vortex Data Recorder ............................................................ 59
Mezzanine Modules
Kontron
AM4010 / AM4100 ............................................................... 60
Networking
Connect Tech Inc.
Blue Heat/Net Ethernet-to-Serial Networking Solutions..... 61
MOXA Americas, Inc.
IA240/241 Series .................................................................. 62
IA261-I/262-I Series.............................................................. 63
V460 Series: V462, V464, V466, V468 .................................. 64
Power Supplies
Tri-M Engineering
HE104+DX - 108W PC/104plus Power Module ................... 65
HESC104 - 60W DC-DC Power Module with
Smart Charging ................................................................ 66
Ruggedized
Carlo Gavazzi Computing Solutions
714......................................................................................... 67
DIGITAL-LOGIC AG
MICROSPACE® -PCX47 ......................................................... 68
Elma Electronic
ELMA Conduction Cooled ATRs ............................................ 69
Hybricon Corporation
Ruggedized Enclosure’s......................................................... 70
Kontron
CP6001 / CP6923................................................................... 71
Quantum3D, Inc.
Thermite 3 Tactical Visual Computer.................................... 72
Signal Processing
Curtiss-Wright Controls Embedded Computing
Digital Signal Processing ...................................................... 73
VMETRO
HPE720 Digital Signal Processor Board................................ 74
Single Board Computers
Curtiss-Wright Controls Embedded Computing
Single Board Computers ....................................................... 75
6
Test & Measurement
Highland Technology
V450 Analog Input Module ................................................... 76
QualiSystems
TestShell................................................................................ 77
Development Systems
Application
VersaLogic Corporation
Cheetah (EPM-32) ................................................................. 78
Cougar (EPM-14) ................................................................... 79
Sidewinder (EBX-22) ............................................................. 80
EDA
Mentor Graphics
Mentor’s DO-254 Program Development Solutions.............. 81
Emulators
iSYSTEM AG
In-Circuit Emulators and On-Chip Debuggers for Embedded
Systems Development and Test............................................ 82
Lauterbach Inc.
TRACE32 PowerTools............................................................ 83
Middleware
Real-Time Innovations (RTI)
RTI Data Distribution Service................................................ 84
Operating Systems / RTOS
LynuxWorks, Inc.
BlueCat Linux ........................................................................ 85
Luminosity IDE....................................................................... 86
LynxOS-178 RSC.................................................................... 87
LynxOS-178 RTOS ................................................................. 88
LynxOS Real-Time Operating System ................................... 89
LynxOS-SE ............................................................................. 90
LynxSecure ............................................................................ 91
Test & Analysis
Absolute Analysis, Inc.
Protocol Test Solutions for Military & Aerospace ................ 92
Development Tools
Software
Birdstep Technology, Inc.
Raima Database Manager (RDM)......................................... 93
Quantum3D, Inc.
IData Human-Machine Interface Toolset.............................. 94
Services
Consulting
Arxan Defense Systems
Arxan Defense Systems (ADS) Services............................... 95
Military & Aerospace Technologies Resource Catalog 2009
Off-The-Shelf Migraines
Industry Forecast
The military’s push for standard components is
creating unexpected complications.
by Ed Sperling
Encryption is another challenge because it all depends on who holds the
keys and how often they are changed. Gilles Garcia, director of marketing
at AMCC, says that encryption is regulated by country or by region and
varies by each of those. “European regulations are different from the
United States,” Gilles explains. “They are not following the same standard.
Europe is using different keys and encryption mechanisms.”
Complicating matters are the export controls on COTS parts. While
it’s well understood which parts can be sold where, parts are often sold
through brokers or distribution and the trail gets more convoluted.
“This has required us to put in place processes and rigorously check
which channel is using which parts,” Garcia says. He notes that all sorts
of mechanisms have been developed for tracking sensitive parts—
including radio-frequency identification (RFID)—so authorities know
where parts are at all times.
It sounds great on paper. After getting slammed for buying $900 oneof-a-kind hammers and other custom-made parts, the government’s
ongoing push for commercial-off-the-shelf (COTS) components is
successfully slashing the cost of new military equipment. At the
same time, it’s greatly speeding up time to market. But the military’s
buy-in of COTS also is creating some interesting problems. They
range from software security issues to compatibility problems with
encryption, export-regulation red tape, and the inability to find components containing lead.
Unfortunately, a potential overlap in military and non-military uses
of parts also can turn this into a very gray area. A bank may have
security needs that are as tight as a military operation, for example.
It also may have operations in countries where sales of military parts
are restricted. The silver lining is that parts made for commercial customers also can be sold to military customers in a variety of countries.
This greatly expands the market for makers of some components.
“We used to worry when a plane went down that you didn’t lose topsecret documents,” says Robert Day, vice president of marketing at
LynuxWorks. “Now you have to do the same for software used in the
plane. You have to make sure no one can get in.” That goal is particularly
challenging because the military is now using the same global information grid as everyone else—everyone from the soldiers on the front lines
to the generals directing military action to hackers sitting in their living
rooms. If that isn’t difficult enough, coalition forces need to share information on the same network, explains Day.
“At the moment, a lot of systems are not compatible,” he states. “They
don’t talk to each other well. We’re working on next-generation
systems where there will be different levels of security.” Even with
all of the compatibility problems, Day notes that the advantages of
using COTS components are significant—particularly for speeding
up time-to-market and time-to-battle.
With system complexity increasing, the difficulty and expense of
writing software code for each new project is enormous. “The amount
of software code in a military system is huge,” he says. “You don’t
want to have to rewrite millions of lines of code each time. Because
of that, we’re getting to a turnaround time that is more toward what
you find in the commercial world. It’s less about how much you can do
yourself and more about how much you can re-use.”
8
“There are military markets where they will only buy organically,”
states Jay Swenson, director of global marketing communications
at GE Fanuc. “But as with the United States, they are also buying
components all over the world and their suppliers are selling all over
the world. Most of these are the same big-name players, but there
will be new players coming in as well. There will be some emerging
companies because of the market for in-country components too.”
Military & Aerospace Technologies Resource Catalog 2009
IN THE AIR OR ON THE GROUND: VPX CHANGES
THE RUGGED LANDSCAPE
OIQ bl ma^ g^p <HML lmZg]Zk] _hk kn``^] ]^iehr^] \hfinmbg`' Bm [kbg`l
]blmkb[nm^]ikh\^llbg`%lpbm\a^]l^kbZe_Z[kb\lZg]ngfZm\a^]i^k_hkfZg\^
e^o^elmhma^[Zmme^Û^e]'Ghmmhfhkkhp[nmmh]Zr'
<nkmbll&Pkb`am ]^ebo^kl ^o^krmabg` rhn g^^] mh bgm^`kZm^ \hfie^m^ OIQ
lrlm^fl' /N Zg] ,N fnemb&\hk^ L;<l' =LI Zg] ?I@: ^g`bg^l' G^mphkd
lpbm\a^l' Ab`a i^k_hkfZg\^ `kZiab\l' EZ[&k^Z]r OIQ ^g\ehlnk^l' >o^g
[^mm^k% hnk ^gmbk^ OIQ _Zfber bl lniihkm^] [r Z \hffhg lh_mpZk^
_kZf^phkd%^glnkbg`bgm^khi^kZ[bebmrpabe^^Zlbg`bgm^`kZmbhg'
OIQ bl OF> _hk Z g^p `^g^kZmbhg' Kn``^] ]^iehr^] \hfinmbg` pbee
g^o^k[^ma^lZf^'
Curtiss-Wright’s comprehensive family of VPX boards includes
the VPX6-682 gigabit Ethernet switch, CHAMP-FX2 and
XMC-442 FPGA computing modules, CHAMP-AV6 quad
Power Architecture module, VPX6-185 SBC, VPX6-215
Carrier Card, VPX3-125 3U SBC, CHAMP-AV6 with 2LM
covers and VPX3-215 3U PCIe switch/carrier.
BgghoZmbhgBgFhmbhg'
\p\^f[^]]^]'\hf
RUGGED AND INTEROPERABLE...
The Search For Lead
One such opportunity is for leaded components. After getting the lead out
of electronic components in compliance with the European Restriction of
Hazardous Substances (RoHS), some companies and government agencies
are now looking for new suppliers of leaded parts—or at least for ways to
put the lead back in. At issue are the tiny tin whiskers that can grow out of
pure tin. What makes those whiskers grow and how to stop such growth
is the subject of intense scientific study and debate. So far, there are no
clear answers. But there is a growing body of evidence for the magnitude
of the problems that they can cause. One of the most celebrated examples
occurred in May 1998, when tin whiskers caused a Galaxy 4 satellite to
short circuit, rendering 40 million pagers useless and interrupting ATM
transactions at banks. Tin whiskers also were blamed for the unexpected
shutdown of a nuclear power plant in Waterford, Conn., in 2005. In addition, they have been implicated in pacemaker failures around the globe.
Nor are whiskers just confined to tin. NASA has been compiling papers
on whiskers emanating from a variety of types of metals (http://nepp.
nasa.gov/WHISKER/). Growing metal whiskers is bad enough when you
can replace a component or even an entire board. But for an incredibly
expensive spacecraft—paid for with taxpayer dollars, launched deep
into outer space, and surrounded by a massive marketing campaign—it
can devolve into a particularly sensitive subject. It’s also a very touchy
subject when it comes to applications like missile-guidance systems
and other potentially explosive devices. With
the number of lead-free parts increasing, the
threat of equipment failure is causing insomnia
for many military planners and administrators.
New Rugged, Reliable Servers for
Mission-Critical Applications
New! 1RU RES Servers
- 1 or 2 AMD® Opteron™ or Intel® Xeon® CPUs
(quad-core processors)
- Up to 32GB ECC SDRAM
- Up to 3 removable HDD
- Dual redundant, hot-swappable PSUs
- Dual redundant DC power option
- 0 – 55º C operation
- Vibration – 0.9g from 10 – 2000Hz
- Shock – up to 20G @ 20ms
- 2RU RES Servers also available
3RU RES Servers
- 1 or 2 AMD Opteron or Intel Xeon CPUs
(quad-core processors)
- Up to 32GB ECC SDRAM
- Up to 5 removable HDD
- Vibration – 0.9g from 10 – 2000Hz
- Shock – up to 25G @ 20ms
For Sun® Solaris™, Linux®, and
Microsoft® Windows® environments
When it comes to computing in harsh environments,
nobody is more at home with its surroundings than
Themis Computer. For over a decade, Themis
has delivered high performance, high availability
computing for the most demanding military,
aerospace and communications applications.
Themis’ new family of 1RU, 2RU and 3RU Rugged
Enterprise Servers™ (RES) includes the latest
quad-core processors from AMD and Intel,
offering ruggedized systems with the fastest,
widest range of performance options and scalability.
Themis servers provide far greater reliability,
improved life cycle management and substantially
lower TCO than other COTS systems solutions.
For more information on rugged Themis servers
or its new T2BC™ blade servers that run Solaris™
applications on the Sun® UltraSPARC® T2®
processor, please visit us at www.themis.com
or call (510) 252-0870.
Transformational.
©2008. Themis Computer, Themis, the Themis logo, Rugged Enterprise Servers, and T2BC are trademarks
or registered trademarks of Themis Computer. All other trademarks are the property of their respective owners.
10
Tin whiskers have been documented to grow
from components plated with pure tin. They
emanate out of “hillocks” that develop under
compressive stress when tin is deposited
through electroplating. Why exactly the lead
acts to mitigate this is unknown. Tin whiskers
weren’t even on the radar screen when the
U.S. government began trimming costs with
COTS parts. Enter RoHS regulations. While the
military and aerospace are exempt, many manufacturers of off-the-shelf parts have trouble
justifying the manufacture of leaded parts for
the military when the bulk of their sales are
non-military. Even within the military, not all
sectors are concerned about occasional failures.
For some of them, however, a short circuit can
be catastrophic.
For critical applications, there are still many
leaded parts available—at least for now. Lisa
Duckett is director of marketing at VersaLogic,
which makes embedded computers for the
military. She says that part of her company’s
strategy has been to stock up on leaded parts.
“We have a five-year guarantee on products,”
states Duckett. “All products we’ve launched
have an end-of-life guarantee that we will continue to provide them during that time.” She
also notes that VersaLogic’s end-of-life strategy
was initiated with the rollout of RoHS standards
on July 1, 2006. “Eventually, like it or not, government agencies are going to have to accept it.
We can stock as much as we can, but there will
be a finite end. Until then, we will try to make
leaded parts available.”
In cases where there are no leaded parts available, there’s a growing business for adding the
lead back in. Corfin Industries has seen a big
uptick in its business of adding lead back into
Military & Aerospace Technologies Resource Catalog 2009
GE Fanuc
Intelligent Platforms
There’s laboratory testing.
And there’s battle testing.
What we’ve learned in the field goes into every rugged board we build.
Over the decades, our single board computers and
rugged systems have seen significant action. During
deployment, they have often taken a great deal of
abuse. And this experience has given us real world
expertise that cannot be gained in the laboratory.
also firmly based on a proven design, the VG5, and on a
proven PowerPC® processor family. Decades of experience have demonstrated the wisdom of building on a
successful design, adding new capabilities, and doing
all we can to prepare for the rigors of deployment.
These lessons of battle inform our entire rugged
product design process, of which the new VG6 single
board computer is the latest example. The VG6 takes
rugged 6U VME multiprocessors to an entirely new
level with Dual or Single Node 8641D processors from
Freescale®, up to 3 GbE ports, 2 fast Ethernets, 6 USB,
2 SATA and 2 PCI-X capable PMC slots. However, it is
In the field of rugged computing, there is simply no
substitute for experience. Fortunately, our systems
have been deployed for many years by the land, sea
and air forces of the world, and we have learned from
that experience. The result is a product offering that
encompasses scores of rugged boards and systems in
VME, VPX, cPCI.
VG6
Conduction Cooled
-40 to +85 C, 40g shock
For more details, visit www.gefanucembedded.com/milaero.
© 2008 GE Fanuc Intelligent Platforms, Inc. All rights reserved.
This can mess up optical devices. Whiskers can break off and fuse things
together and they can cause devices to momentarily fail.”
Tyler says that the phenomenon has been well known since the 1950s,
which is why lead was added in the first place. He points out that there
have been numerous attempts to solve that with more accepted metals
and alloys. But such approaches often create different whiskers, weaken
the connection on printed-circuit boards, or both.
The Future
According to Bryan Brady, vice president of Avnet Electronics Marketing
Americas’ defense aerospace business unit, there’s still plenty of inventory
left for agencies and companies looking for leaded components—for the
moment. He says that the real issue is that new technologies aren’t being
introduced with leaded versions. “We’re still seeing some vendors introducing components with military specifications, and some say they will
continue producing it as long as there is demand,” Brady explains. “But
every time I go to a conference, I ask the audience what they’re going to do.
With commercial avionics, there’s less pressure to use lead. But when you
get to radar and missile applications, they definitely want lead. We’ve been
surprised by the lingering demand for leaded parts.”
parts. It replaces pure tin with tin-lead through a molten alloy process.
The company’s process actually dissolves the pure tin and—in the
same step—applies a new coating with a metallic bond.
Don Tyler, Corfin’s general manager and vice president of marketing,
says the pickup in business began even before RoHS took effect because
many suppliers wanted to be compliant ahead of time. That brought
in a variety of agencies whose focus ranged from medical to space and
nuclear power. “There is a lot of experience out there with tin whiskers,”
Tyler explains. “There are fewer people that have actually seen shorts,
but a lot of them have seen furry boards and are worried about them.
Ed Sperling is a regular contributing editor to Chip
Design magazine. Ed has spent the past two decades
immersed in technology. He is the recipient of numerous awards for journalistic excellence.
Creating Powerful, Low-Cost Applications
Don’t Miss These Power-Packed Events!
MicroTCA and AdvancedTCA Summits provide up-to-date information on the new standard platforms
for telecommunications equipment, mobile systems, military and defense systems, medical equipment,
and much more. Learn how these standards deliver turn-key solutions while reducing costs and
development time. Join industry experts, vendors and users. For information visit online.
E U R O P E
Q
12
Q
Q
Q
Q
May 28-30, 2008
September 23-24, 2008
October 21-23, 2008
Westfields Marriott
Chantillty, VA
Disney New York, New York
Paris, France
Santa Clara Convention Center
Santa Clara, CA
MicroTCAsummit.com
euroATCAsummit.com
AdvancedTCAsummit.com
Military & Aerospace Technologies Resource Catalog 2009
Product Brief
PowerPC™460SX
(PEHGGHG3URFHVVRU
With speeds of up to 1.4GHz, the PowerPC 460SX embedded processor offers a
powerful mix of high bandwidth, design flexibility and robust features. With three
PCI Express interfaces, an on-chip DDR2 SDRAM controller, I2O messaging unit,
RAID 5 and RAID 6 acceleration hardware, storage and network encryption
engines, and a rich peripheral mix, the PowerPC 460SX embedded processor is
ideally suited for RAID controllers, Storage Area Networking (SAN) equipment,
iSCSI, NAS, and other embedded storage and networking applications.
Benefits
The PowerPC 464 Core
• Delivers 800MHz to 1.4GHz
performance for embedded I/O processor designs
The 464 core is an enhanced version of the 440 core. To
enhance overall throughput, , the PowerPC 464
superscalar core incorporates a 7-stage pipeline and
executes up to two instructions per cycle. Its large 32KB
data cache and 32KB instruction cache are 64-way setassociative. For additional system performance, the
PowerPC 464 core includes dynamic branch prediction
and 24 digital signal processing (DSP) instructions, as
well as non-blocking caches that can be managed in
either write-through or write-back mode.
• 32K-I/32K-D L1 caches
• 512KB L2 cache, may also be
used as on-chip SRAM
• 32KB on-chip SRAM
• High-speed Processor Local
Bus (PLB) with 2-way crossbar,
supports 12.8 GB/sec. peak
bandwidth
• 2nd High Bandwidth (HB) bus
with 6.4GB/s bandwidth,
accelerates RAID transactions
• Three Gen 2 PCI Express
interfaces
• 32/64-bit SDRAM memory
controller, interfaced to all
three PLB slave segments,
supporting memory speeds
up to DDR2-800
• On-chip RAID 5 and RAID 6
acceleration (optional)
• On-chip storage and network
encryption engines (optional)
• Three-channel DMA engine
• Integrated I2O messaging
• On-chip peripherals including
four 10/100/1000 Ethernet
MAC, UARTs, IIC
• Offers low power dissipation
and small form factor for highdensity and power-conscious
applications
High-Bandwidth Bus Architecture
For high bandwidth transactions, the PowerPC 460SX
uses two independent buses. The primary bus is a
coreConnect 128-bit processor local bus (PLB), with a
two-way crossbar configuration. It provides separate
128-bit read and 128-bit write data buses for each or the
two ways. The four 128-bit data buses may operate
concurrently, providing up to 12.8 GB/s of peak on-chip
bandwidth. The secondary bus is a 128-bit bus with
separate 128-bit read and 128-bit write data buses.
These two 128-bit data buses may also operate
concurrently, providing additional up to 6.4 GB/s of
peak bandwidth. The aggregate on-chip bus bandwidth
is 19.2 GB/s. The SDRAM is attached to three PLB slave
ways to provide optimal access to memory from any
other peripheral/core. Lower bandwidth I/O devices are
supported by the on-chip peripheral bus (OPB).
Ethernet Ports, TCP/IP Acceleration, and QoS
For network connectivity options, the 460SX offers two
integrated 10/100/1000 Ethernet ports with TCP/IP
Acceleration Assist, QoS, and Jumbo Frame support.
Two additional 10/100/1000 Ethernet ports are also
provided, for a total of four. All four are configurable as
RGMII and RBTI or optionally as two GMII interfaces.
Storage Security Engine (optional)
For storage applications the 460SX offers on-chip high
speed hardware acceleration engine for IEEE1619
encryption/decryption for data at rest. It supports Galois
counter mode and XTS-AES and LRW-AES. It also
supports hashing for SHA-1 and SHA-2 (SHA-224, SHA256, SHA-384, SHA-512) and Hash Message
Authentication (HMAC).
Network Turbo Security (Optional)
The 460SX incorporates a high-performance DDR
memory controller supporting DDR2 memory devices.
The memory interface can operate at an effective rate of
DDR800, for a maximum bandwidth of 6.4 GB/s. The
interface can be configured for 64-bit or 32-bit memory
implementations. Optional ECC. Industry standard
DIMMS and discrete devices are supported for up to 16
GB of memory. For greater efficiency, the memory
controller provides parallel paths from each of the three
PLB slave segments and memory.
The PPC460SX delivers advanced security capabilities
with the optional Turbo Security Engine. This security
engine attaches directly to the PLB bus for the fastest
possible throughput between the PPC464 processor,
memory, and the security engine itself. The Turbo
Security engine supports DES, 3DES, AES, ARC-4
encryption, MD-5, SHA-1 and SHA-2 (SHA-256, SHA-384,
SHA-512) hashing. The security engine includes a
pseudo random number generator as well as header
and trailer protocol processor. The engine also
incorporates an on-chip true random number generator
and a public key accelerator. The algorithms are
compliant with FIPS-140-2 and ANSI X9.17 Annex C.
On-chip Memory
External Bus Interface
The PowerPC 460SX offers 32 KB of on-chip memory. It
can be used to store boot code, security keys, or other
user-specific functions.
To accommodate connectivity with other devices, the
PowerPC 460SX offers a 32-bit bus supporting up to four
ROM, EPROM, SRAM, flash memory or slave peripheral
I/O devices and speeds up to 100 MHz. The 4-Channel
DMA is also supported.
High Performance Memory Support
Gen 2 PCI Express Interfaces
The 460SX offers three independent PCI Express
interfaces compliant with PCI Express base specification
2.0 (5 GB/s per lane). The primary interface has eight
lanes and supports x8, x4, or x1 configurations. The
secondary two interfaces have 4 lanes each and can be
configured as x4 or x1 ports, or be combined as a
second 8-lane PCI-E port. All three interfaces can be
configured as either root or end point ports.
Standard Peripherals
Two IIC controllers operate at 100/400 KHz. Both
support master mode with multi-master and reset and
target mode, and one supports serial boot ROM. The
peripheral set also includes two UARTs, up to 32
general-purpose I/Os (GPIO) and general-purpose
timers.
PowerPC Partners Ecosystem
RAID Hardware (optional) and I2O Accelerate
Storage Applications
The 460SX offers on-chip acceleration hardware for
RAID 5 and RAID 6 parity generation and checking. This
hardware, along with an internal high efficiency threechannel DMA engine, implements XOR and Galois Field
14
P and Q parity operations in parallel at a high
throughput rate.
I/O processing and other applications using multiple
processors can benefit from the integrated messaging
unit. Using I2O message frames, this messaging unit
improves system performance by enabling the 460SX to
communicate with a host system on the host-side PCI
Express bus. This enables the 460SX to operate as an
intelligent I/O adapter controller.
AMCC's embedded PowerPC processors are supported
by an extensive ecosystem of products and services
from a wide range of leading suppliers. AMCC's PowerPC
Partners program includes industry-standard providers
of:
Military & Aerospace Technologies Resource Catalog 2009
Product Brief
PowerPCTM 460SX
• Embedded operating systems
• Hardware and software development tools
• Embedded software products and services
• Board-level products
• System design services
• Technical training
For full details of the products and services available through the PowerPC
Partners program, or to browse support available for a specific processor,
visit KWWSZZZDPFFFRP(PEHGGHG3DUWQHUV.
AMCC also provides an evaluation kit for this PowerPC processor,
including an optimized evaluation board as well as sample applications
and other software.
Features
•
•
•
•
•
•
•
•
•
•
•
•
•
•
•
•
•
•
•
•
CPU Speed (frequency): 800MHz to 1.4GHz
Performance: 2.0 DMIPS/MHz (2800 DMIPS @ 1.4GHz peak)
32 KB -I/32 KB D L1 caches, and 512 KB L2/SRAM with parity protection
32/64-bit DDR II SDRAM Controller, for up to DDR800 operation
Three Gen 2 PCI Express interfaces, one with eight lanes configurable as
x8, x4,x1 and two with four lanes configurable as two x4, or x1, or they
can be combined as a second 8-lane PCI-E; compliant with PCI Express
base specification 2.0; 5.0 Gb/s full duplex per lane; all ports
configurable as root or end point
RAID 5 and RAID 6 acceleration hardware for P & Q parity generation
and check functions
Intelligent Messaging Unit (I2O specification)
Three-channel high bandwidth DMA engine
External bus control (EBC) Interface (up to 100 MHz) with 29-bit address
bus, 32-bit data bus supporting up to four ROM, RAM, EPROM, flash
memory, or peripheral devices.
Storage Security Engine (Optional)
- Galois counter mode and XTS-AES, LRW-AES. SHA-1 and SHA-2 (SHA224, SHA-256, SHA-384, SHA-512) hashing
- Hash Message Authentication (HMAC).
Network Turbo Security Engine with IPSec/SSL hardware
acceleration (Optional)
- DES, 3DES, AES, ARC-4 encryption, MD-5, SHA-1 and SHA-2 (SHA256, SHA-384, SHA-512) hashing.
- True random number generator and a public key accelerator.
NAND Flash controller, which supports one to four banks of NAND
Flash memory devices; direct interfacing to discrete NAND Flash
devices (up to four devices) and Smart-Media Card socket (22-pins);
4 MB to 256 MB device sizes supported; boot-from-NAND
supported
4-channel DMA -available for internal use and 2 channels for
external use; scatter/gather capability
(4) Ethernet 10/100/1000-Mbit/s full duplex MACs, with Quality of
Service (QoS) support
- IPv4 and IPv6 Internet protocols
- Jumbo Frames
- Four ports RGMII, RTBI, or optional two ports GMII interfaces
- CRC32 error detection and checking
- TCP/IP and iSCSI Acceleration Hardware support
- DMA capability by means of memory access layer (MAL)
Two serial ports (16750-compliant UARTs) with 64-byte FIFOs
Two IIC controllers
Up to 32 General Purpose I/Os (GPIO)
General purpose timers
Universal Programmable Interrupt Controller supports 16 external
interrupt sources and 101 internal sources
Support for JTAG board testing, JTAG debuggers, and 4XX
instruction trace
6SHFLILFDWLRQV
7HFKQRORJ\
• 90 nm CMOS
3HUIRUPDQFHHVW
• 2800 Dhrystone MIPS @ 1400 MHz
0HPRU\
• 32-bit width: up to 3.2 GB/s (DDR800)
64-bit width: up to 6.4 GB/s (DDR800)
3&,([SUHVV
• One 8-lane @ 5.0 Gb/s per lane/direction
Two 4-lane @ 5.0 Gb/s per lane/direction (can be combined as one 8-lane PCI-E)
7\SLFDO3RZHU'LVVLSDWLRQ
• < 10W @ 1000 MHz
&DVH7HPSHUDWXUH5DQJH
• 0° C to +90° C (case temperature)
3RZHU6XSSO\
• 1.225 V (logic), 1.8V (SDRAM), 3.3 V (peripherals), 2.5 V (Ethernet, other
I/O)
6LJQDO,2V
• 435
3DFNDJLQJ
• 783 FC-PBGA, 29mm x 29mm with 1.0mm pad pitch
)RUPRUHLQIRUPDWLRQRQWKHSURGXFWIHDWXUHVYLVLWRXU:HEVLWH
DWKWWSZZZDPFFFRP
215 Moffett Park Drive
Sunnyvale, CA 94089
P +1 408 542 8600
F +1 408 542 8601
www.amcc.com
www.eecatalog.com/military
For technical support, please call 1-800-840-6055 or 858-535-6517, or email support@amcc.com.
AMCC reserves the right to make changes to its products, or to discontinue any product or service without notice and warrants its products solely pursuant to its terms
DQGFRQGLWLRQVRIVDOHRQO\WRVXEVWDQWLDOO\FRPSO\ZLWKWKHODWHVWDYDLODEOHGDWDVKHHW3OHDVHFRQVXOW$0&&¶V7HUPVDQG&RQGLtions of Sale for its warranties and
other terms, conditions, and limitations.
AMCC may discontinue any semiconductor product or service without notice, and advises its customers to obtain the latest version of relevant information to verify,
before placing any orders, that the information is current. AMCC does not assume any liability arising out of the application or use of any product or circuit described
herein, neither does it convey any license under its patent rights nor the rights of others. AMCC reserves the right to ship devices of higher grade in place of those of
lower grade.
$0&&6(0,&21'8&725352'8&76$5(127'(6,*1(',17(1'('$87+25,=('25:$55$17('72%(68,7$%/()2586(,1/,)(6833257
$33/,&$7,216'(9,&(6256<67(062527+(5&5,7,&$/$33/,&$7,216
AMCC is a registered trademark of Applied Micro Circuits Corporation. PowerPC and the PowerPC logo are registered trademarks of,%0FRUSRUDWLRQ$OORWKHU
trademarks are the property of their respective holders. CopyrighW‹$SSOLHG0LFUR&LUFXLWV&RUSRUDWLRQ$OO5LJKWV5HVHUYed.
32:(53&6;B3%BYB
15
Product Brief
Dual 460GT AMC Card Reference
Design Kit
Comprehensive reference design kit for high performance dual-processor 460GT-based AMC card
16
Product Highlights
Product Overview
• Comprehensive reference design kit for
AdvancedTCA and MicroTCA systems, including
industry-standard hardware and software solutions
• Dual 460GT processor based design
• AdvancedMC Compliant
–Serial RapidIO (AMC.4)
–Gigabit Ethernet (AMC.2)
–PCI Express (AMC.1)
• Single width Mid-size form factor
• Includes LINX, an open-source solution for distributed system Inter-Process Communication
that is platform/interconnect independent
• Supports RapidFET™, a network management
and diagnostic tool with a powerful graphical
user interface (GUI) for RapidIO-based systems
• Commercially available solution
• Architected to deliver improved reliability, flexibility, reduced equipment footprint, manageability and serviceability
• Incorporates the latest trends in high speed
interconnect technologies with higher I/O
capacity and computing performance.
• Resource CD with system-level benchmarks and
sample applications
• Industry-standard U-Boot firmware, Linux
operating system and Linux software development tools
• Board schematics, layout files, U-Boot source
and Linux source available from AMCC Web site
• Software development tools CDs from multiple
industry-leading suppliers
• Serial cable provides direct connection to the
host system for initial configuration
• Ethernet crossover cable provides direct connection to the host system for downloading and
running applications
• On-board JTAG connector enables connection of
any compatible external JTAG probe for runcontrol debugging
• Universal 120-240 V power adapter supports
operation worldwide
• Comprehensive processor, board and software
documentation on the Resource CD.
The AMCC Arches reference design kit provides users with a
solution which allows for quicker time to market and thus a
quicker time to revenue.
The Arches AMC card, incorporating the industry-standard Linux
operating system and U-Boot firmware, is a comprehensive
reference design kit specifically for AdvancedTCA and MicroTCA
systems.
The AMC card schematics and layout files for the reference design
kit are available so that customers can customize their designs
from a proven baseline. In addition, cards are available as a
commercial off the shelf product from Silicon Turnkey Express.
Likewise, the Linux code and U-Boot firmware source are available
to accelerate customers' software development.
LINX Inter-Process Communication from
ENEA
• An open-source solution for distributed system IPC that is platform and interconnect
independent, which scales well
to large systems regardless of topology. See http://sourceforge.net/projects/linx.
• Delivers the performance needed for high traffic bearing components of the system.
• Provides higher performance, ability to scale down to DSP
devices, and addressing flexibility
Arches AMC Solution
The Arches AMC card, with single
width Mid-size form factor
(180mm x 74mm x 17mm), was
developed by Silicon Turnkey
Express:
• Dual 1.0GHz 460GT processors
• Two 512MB DDR2 ECC memory
subsystems
• Two 64MB NOR Flashes
• 1GB Micro-SD Flash
• Two serial ports on front panel
• Two 10/100/1G Ethernet ports
on front panel
• Four 10/100/1G Ethernet ports
on AMC connector
• x1/x4 Serial RapidIO port on
AMC connector
• x1/x4 Serial RapidIO/PCIExpress port on AMC connector
• Shared JTAG connector
• Linux (2.6 kernel) and file system in Flash
• U-Boot boot firmware in Flash
RapidFET™ from Fabric Embedded Tools
Corporation
Sample Applications
and Utilities
The Resource CD provides a
wide range of sample
applications as a starting
point for software
development, and utilities to
assist in system
configuration:
• Web server on board
• Telnet server on board
• FTP server on board
• Processor / board configuration report
• Ethernet utility to configure IP address, MAC address, and
modify EMAC registers
• Example flash file system for persistent storage
• Script-based Linux root file system build environment
• Network management and
diagnostic tool for RapidIObased systems. Beneficial tool
from early prototype designs
through customer support in
the field.
• RapidFET™ can help configure systems, isolate problems, manage system traffic, and capture device or system settings in
automated reports.
• Graphical user interface (GUI) enables the user to visually
interact with a system map, allowing them to edit registers,
monitor throughput, change routing paths, and much more by
simply clicking on a device or link of interest
Military & Aerospace Technologies Resource Catalog 2009
Benchmarks
PowerPC 460GT Processor Technical Specifications
The Resource CD includes a wide range of industry-standard benchmarks for use in processor
performance analysis:
• DBench
• HINT
• Security benchmark for on-chip Turbo Security Engine
• MPEG-4 encode and decode
• STREAM
• TTCP
System Design Resources
Customers can use this reference design kit not only to evaluate the 460GT processor and to do
performance analysis, but also as the starting point for their own product designs. To facilitate
this, the complete hardware/software design is available to customers at http://
www.amcc.com/Embedded/Downloads/Arches/.
• Linux code (source and binary) for the Arches reference design
• U-Boot firmware (source and binary) for the Arches reference design
• Linux development tools used to develop the Arches code (from Denx)
• Schematics and layout files for the Arches reference design
• Benchmark code
• Sample application code
Development Tools & Operating Systems
The Arches reference design kit is provided with Linux (based on
the 2.6 kernel) in Flash. This Linux code is available to customers
on the Resource CD.
To assist customers in selecting the optimum development tools
environment for their system development, the kit includes CDs
from various industry-leading tools suppliers. These suppliers
include:
• Denx Software Engineering
• Corelis, Inc.
Ordering Information
The Arches evaluation kit may be
ordered from AMCC or any authorized
AMCC distributor using part number
RD-460GT-AMC-01. For more
information, please visit http://
CPU Complex
•
•
•
•
Power Architecture 440 processor core
Up to 1.0 GHz/2000 DMIPS
32KB I-cache/D-cache with parity
256KB L2 cache with parity
Memory and Bus Architecture
•
•
•
•
On chip Peripheral Bus - 32-bit, 100 MHz
External Bus Controller - 32-bit data/27-bit address 100MHz
64KB of on chip SRAM (OCM)
32/64-bit DDR1/2 up to 400Mbps with optional ECC (up to 16GB)
System Resources
• 4-channel DMA controller;
• High Speed DMA controller (HSDMA) for high bandwidth applications
• Interrupt Controller with 16 external interrupts
High Speed & Inter-Chip Connectivity
•
•
•
•
PCI-Express ports - one “x4” lane and one “x1” lane
PCI v2.3 compliant, 32-bit, 66Mhz
1 SPI, 2 IIC with boot strap controller
Serial RapidIO port (HSS shared with 2nd PCI-e x4 port)
Network Connectivity
• Four 10/100/1G Ethernet MACs, three with SGMII
• TCP/IP hardware assist and QoS
• Four UART serial ports
Special Functionality
• Turbo Security Engine: Optional on-chip IPSec/SSL/bulk data security
• acceleration engine (Crypto Engine)
• Kasumi encryption/decryption engine
Power
• 6W typical power @ 1 GHz (est.)
www.amcc.com/Sales/.
AMCC Partners Ecosystem
AMCC's embedded PowerPC processors are supported by an extensive ecosystem of products
and services from a wide range of leading suppliers. The AMCC Partners program includes
industry-standard providers of:
• Embedded operating systems
• Hardware and software development tools
• Software platforms
• Board-level products
• System design services
• Technical training
• Silicon partners
For full details of the products and services available through the AMCC Partners program, or
to browse support available for a specific processor, please visit http://
www.amcc.com/Embedded/Partners/.
Arches Block Diagram
Corporate address:
215 Moffett Park Drive
Sunnyvale, CA 94089
Tel: 408-542-8600
Fax: 408-542-8601
www.amcc.com
www.eecatalog.com/military
For technical support on this product please send email to archessupport@amcc.com.
AMCC reserves the right to make changes to its products, its datasheets, or related documentation, without notice and warrants its products solely pursuant to its terms and
conditions of sale, only to substantially comply with the latest available datasheet. Please consult AMCC’s Term and Conditions of Sale for its warranties and other terms, conditions
and limitations. AMCC may discontinue any semiconductor product or service without notice, and advises its customers to obtain the latest version of relevant information to verify,
before placing orders, that the information is current. AMCC does not assume any liability arising out of the application or use of any product or circuit described herein, neither does
it convey any license under its patent rights nor the rights of others. AMCC reserves the right to ship devices of higher grade in place of those of lower grade. AMCC SEMICONDUCTOR
PRODUCTS ARE NOT DESIGNED, INTENDED, AUTHORIZED, OR WARRANTED TO BE SUITABLE FOR USE IN LIFE-SUPPORT APPLICATIONS, DEVICES OR SYSTEMS OR OTHER CRITICAL
APPLICATIONS.
AMCC is a registered trademark of Applied Micro Circuits Corporation. PowerPC and the PowerPC logo are registered trademarks of IBM Corporation. All other trademarks are the
property of their respective holders. Copyright © 2008 Applied Micro Circuits Corporation. All Rights Reserved.
RD-460GT-AMC-01
17
ELMA Electronic, Inc.
by ELMA Electronic, Inc.
VME/64X Systems
Elma VME/64X systems feature a modular design and rugged, highquality construction. These chassis are available in 19” rackmount,
desktop or portable tower versions, with various types available, each
designed to meet the needs of specific applications. 1U – 15U heights are
available with depths from 15” to 24”. Vertical or horizontal card cages
accommodate 3U, 6U or 9U boards with depths from 160-400mm depths.
All systems come fully assembled, wired and tested prior to shipment.
Rugged COTS Systems
The COTS 12R2 is a high quality and cost-efficient rugged package for
all CompactPCI, Rugged MicroTCA, VME/VME64x, VXS, and VPX
applications. The rugged product line includes 5U-14U models for both
6U and 9U cards. The 12R2 uses honeycomb filters, braided gasketing,
and metal impregnated gasket sheets to seal off every external seam to
ensure compliance to MIL-STD-461D. To verify that the chassis will
more than meet shock and vibration requirements, the 12R2 has been
tested for shock, vibration, and structural integrity per MIL-STD-810F,
MIL-STD-167 and MIL-STD-901D. The 12R2 integrates standard offthe-shelf parts including aluminum flat frames and covers, ruggedized
side plates, cross-functional extruded profiles, standard electrical
components and wire harnesses to reduce lead time. The 12R2 features
MIL-grade components, system monitoring LEDs, a powerful, efficient
cooling system and holds up to 20 boards. A light-weight 12R1 line of
chassis is also available. They contain many of the same features as the
12R2, but are up to 20% lighter.
Custom versions. The VPX backplanes are available in 6U 5-slot and 3U 6slot sizes. Hybrid versions with legacy VME64x slots are also available.
ATR (Air Transport Rack)
The Elma ATR for COTS is convection cooled and available in sizes 1/2,
3/4, 1, or 1 1/2 ATR per ARINC 404A. Architecture formats include CompactPCI, Rugged MicroTCA, VME, VXS, VPX, and Custom, all built with
a modular design to ensure easy customization with minimum cost and
lead time. There are 2 chassis depths available with capacity for 5, 7, 12 or
15 slots, 6U x 160mm. The ATR features advanced airflow distribution,
removable front panels, rear panels, and top and bottom covers. Designed
to meet MIL-STD’s 5400, 810E, 461E, 704A, 275A, the Elma ATR family is
ideal for use with commercially available cards in airborne, ground mobile
or shipboard applications. Conduction cooled ATRs are also available.
Elma’s Liquid-cooled ATRs feature a modular design and are available
in various configurations. The liquid runs through the sidewalls of the
chassis, providing superior heat dissipation for conduction cooled cards.
Providing up to 150W/slot of cooling, this design is a much easier, simple,
and cost-effective solution than liquid-through-module solutions.
CONTACT US
VXS and VPX Systems
The Elma VXS (VITA 41) and VPX (VITA 46/48) chassis are available in a
portable tower version, open-frame test chassis, ATR or 19” rackmount.
Configurations are offered for both horizontal and vertical mounting
of 6U x 160mm cards. VXS backplanes are available in 5, 8, 10, 12, 18,
20, and 21 slots in Single Star, Dual Star, Switchless Mesh, Hybrid, and
18
ELMA Electronic, Inc.
44350 Grimmer Blvd.
Fremont, CA 94538 USA
510.656.3400 Telephone
sales@elma.com
www.elma.com
Military & Aerospace Technologies Resource Catalog 2009
VPX: Guaranteeing the Long
Term Future of VMEbus
by GE Fanuc Intelligent Platforms
The VMEbus architecture has delivered significant long term
benefits to its many thousands of users worldwide - including
many thousands of GE Fanuc Intelligent Platforms’ customers.
Its strength has been its ability to evolve, to adapt to new technologies and to embrace them, bringing increasing processing
power while minimizing - and in many cases eliminating - the
costly and time-consuming rewriting of application software or
the need to throw away hardware.
Serial switched fabrics, however, brought a new computing paradigm
to the market - a paradigm in which data transfer speeds from board
to board were revolutionized. The potential for significantly increased
processing throughput was enormously attractive.
For that potential to be realized, however, required a new kind
of board connector - one capable of sustaining high bandwidth
transfers - and this presented a challenge. Over a quarter of a
century and more, connectors on VMEbus boards remained
compatible: a board acquired twenty years ago could be simply
withdrawn from the chassis/backplane and replaced with one of
a modern vintage.
If VMEbus was to be able to take advantage of the advent of
serial switched fabrics, the unthinkable had to happen. A new
connector would need to be used. The connector selected was
the MultiGig RT2 from Tyco - a 7-row, 16-wafer (wafers can be
power, differential or single-ended) connector that delivers
highly controlled impedance, minimal insertion loss and less
than 3% crosstalk at transfer rates up to 6.25 Gbits/second.
A 6U VPX board features six 16-column 7-row RT2 connectors
and one 8-column 7-row RT2 connector, while a 3U board features two16-column 7-row RT2 connectors and one 8-column
7-row RT2 connector.
This new ‘flavor’ of VMEbus - which maintains compatibility
with legacy application software even though it does not
maintain the hardware compatibility that previous iterations of
VMEbus had done - is VPX or, more officially, VITA 46. Since the
first VPX products came to market in 2006, VPX has been – and
continues to be - extraordinarily well received by customers
whose applications demand cutting edge processing capability.
Particularly popular is VPX in its 3U form. The 3U form factor has
assumed growing significance over the years as the space in which
to house systems has become increasingly constrained, together
with the need to minimize weight - in unmanned vehicles, for
example, or man packs. 3U VMEbus suffered from important
performance limitations - limitations which, it could be said, led
to adoption of 3U CompactPCI in many programs. Now, however,
3U VPX offers the ability to pack significant processing capability
and bandwidth into a small enclosure.
GE Fanuc Intelligent Platforms was the first company to
announce 3U VPX products in the shape of the SBC340 single
board computer, the GR A110 graphics board and the GBX410
Gigabit Ethernet switch. The company’s VPX product range now
includes no fewer than eleven products. The 3U range features
single board computers based on both Intel and PowerPC processors and a solid state storage module including 6U single board
computers and multiprocessors, while the 6U VPX family offers
both single board computing and multiprocessing. The MAGIC1
3U VPX Rugged Display Computer delivers unprecedented
graphics performance, combining the Intel Core 2 Duo processor
and the NVIDIA G73 in a single subsystem to deliver a solution
capable of driving the most demanding visual applications.
While VPX may have created a small dislocation in the otherwise
seamless VMEbus continuum, the substantial performance benefits it brings more than compensate for this. VPX also ensures
that VMEbus is well positioned to continue to succeed over the
coming quarter century.
CONTACT US
Fig. 1: VPX board section showing new connector, alignment/keying block
20
GE Fanuc Intelligent Platforms
2500 Austin Drive
Charlottesville, VA 22901
USA
1-800-GE FANUC Toll Free
1-800-GE FANUC Telephone
www.gefanuc.com
Military & Aerospace Technologies Resource Catalog 2009
GE Fanuc
Intelligent Platforms
Here comes the future,
all engines full throttle.
VPX is revolutionizing the world of rugged COTS systems.
VPX systems are transforming rugged mil/aero applications, as our MAGIC1 clearly illustrates. It combines
desktop gaming silicon from NVIDIA® with the latest
Intel® Core™2 Duo processor and x16 PCI Express® technology. The result is a complete, integrated graphics
subsystem designed to deliver blazing performance in
the harshest environments.
With support for industry standard graphical environments such as VAPS, GL Studio and iData, the MAGIC1 is
the industry’s highest performance, ready-to-run, rugged
display processor. That makes it ideal for sophisticated,
real time applications that demand the utmost in 2D
and 3D graphics and video processing. Think embedded
training. Think simulation. Think mission rehearsal. Think
digital mapping. Think vehicle displays.
MAGIC1
3U VPX system with leading
edge graphics performance
For more information on VPX and the MAGIC1, please
visit our web site at www.gefanucembedded.com/vpx
and be prepared for a mind-changing experience.
© 2008 GE Fanuc Intelligent Platforms, Inc. All rights reserved.
Kontron and Thales Computers Come Together to Deliver Advanced
Rugged Embedded Computing Products for Military Applications
by Kontron
The Kontron acquisition of Thales Computers S.A. (France)
made headlines earlier this year as one of several key industry
acquisitions that have positively impacted embedded markets. By
acquiring Thales Computers, Kontron has furthered its market
penetration in the defense, aerospace and transportation arenas,
sharply extending its rugged product portfolio available to military and commercial customers worldwide.
presence, a significant advantage for Kontron customers. We’re
not only expanding what is already one of the broadest slates
of embedded products in the world, but adding to our extensive
knowledge base, research and development resources and local
support. Customers need products and services that go well
beyond their development resources and Kontron knows that is
what it takes to win the greatest share of the estimated $6B in
market dollars that stand open for competition.”
Kontron, already a significant leader in the embedded computing
market, is well-grounded in its long-term strategy of expanding
through internal growth and development in its own established
market segments. Bolstering this successful philosophy with the
acquisition of Thales Computers and its particular strength in
high-end government, aerospace and transportation sectors,
Kontron has simultaneously reinforced its core business while
extending its support for customers worldwide.
MEC-PPC-AV1
Customers of both Kontron and Thales Computers now have even
greater access to innovative embedded products and services on
a global basis – benefitng from an incredibly broad range of products made stronger still by bringing the two companies together.
Increased regional presence improves visibility of Kontron among
French authorities and government funded projects. In addition,
European customers of both companies now have more comprehensive local support through a greater sales presence and native
speakers. North American customers of both companies will also
see additional local staff and the availability of new products and
services.
Jointly, both companies offer a comprehensive line of products
that meet the demands of the VME, CompactPCI and Mezzanine
card markets and stand as a powerhouse of embedded computing
market leadership. The Kontron product portfolio supports a
wide range of applications and platforms with COTS single board
computers, embedded computers, and the full breadth of service
capabilities such as engineering and box-level production. Engineering staffs are highly complementary and are already fully
integrated along with overall operations and product support
– meaning customers have a single extensive resource for any
level of embedded computing product or service.
“Kontron is already a major player in an embedded marketplace
estimated at more than U.S. $30B worldwide,” said Ulrich Gehrmann, CEO of Kontron AG. “With the acquisition of Thales
Computers, the market will see us broaden our mainstream
business activities and greatly increase our sales and marketing
22
PowerEngine7
Thales Computers specialized in long term available embedded
computer boards and systems based on VME and CompactPCI as
well as mezzanine cards. The company focused on the full spectrum of PowerPC technology including relevant operating system
support. The Kontron acquisition of Thales Computers extends
beyond the company’s previous focus on Linux and VxWorks realtime operating systems, to now offering support for Integrity,
LynxOS, RedHat Enterprise, ElinOS and QNX Neutrino, amongst
others.
Thales Computers strengthens the Kontron customer support
even further, bringing additional sales and marketing resources
along with in-depth knowledge and understanding of the Power
Architecture segment. As a founding member of the Power
Architecture organization (www.power.org), Thales Computers
is a force in the market – blending well with Kontron’s influence
in Intel-based embedded computers.
Military & Aerospace Technologies Resource Catalog 2009
“Kontron’s market share is very well-balanced between infotainment (POS/POI/gaming), telecom automation and medical,” said
Norbert Hauser, vice president of marketing at Kontron. “We
view the major market categories similar to market forecaster
VDC and anticipate varied levels of growth in AdvancedTCA,
CompactPCI and next generation VME architectures. MicroTCA
is in early phases of growth but is now also gaining ground in
defense and aerospace, along with industrial and medical markets. Our customer base in all these arenas, and in particular,
diverse military and government applications, continues to grow
– and we attribute that to the comprehensive approach we apply to
developing products, services, expertise and market visibility.”
The extensive product line from Kontron also includes the
PENTXM2/4 series of server class manageable VME processor
boards. The PENTXM4 features two Low Power Dual-Core Intel
Xeon processor running at 1.67GHz and E7520 chipset and offers
high speed, server-class performance for advanced embedded
applications. The Kontron PENTXM2 family of single board
computers (SBCs) uses the latest Low Power Dual-Core Intel Xeon
processor and E7520 chipset and offers high speed, server-class
performance for advanced embedded applications. The single
slot versions of both the PENTXM4 and PENTXM2 SBC are ideal
for thermally constrained environments and include all the up to
date I/O standard interfaces required in a server blade PC.
Premier products include the Kontron turnkey COTS rugged
Modular Embedded Computers (MECs) designed for defense,
aerospace and avionics applications. Kontron recently unveiled
its latest in this product family, the MEC-PPC-AV1, a completely
rugged MEC specifically targeted towards avionics applications.
The Kontron MEC-PPC-AV1 is a low-cost 3U CompactPCI rugged
COTS subsystem designed to exceed requirements through its
compact dimensions, low-power dissipation, and real-time software with a very large I/O offering. The Kontron MEC-PPC-AV1
is targeted towards the avionics market due to its ATR footprint
dimensions, 28 VDC power supply, lightweight structure in
aluminum, conduction cooled dissipation, MIL-STD-1553 links,
MIL-C-38999 connectors and a very low power consumption of
less than 17W.
The Kontron PowerEngine7 features the latest PowerPC 750FX/
GX microprocessor from IBM which delivers 700 MHz to 1 GHz
performance for networking, storage, imaging, and other highperformance embedded applications. The PowerPC 750FX/GX
fully complies with the PowerPC architecture, and is the first
to combine IBM‘s most advanced process technologies onto
one chip, reducing power consumption by up to 50 percent or
increasing performance by up to 30 percent. Manufactured
in IBM‘s advanced 0.13 micron process, the chip is the first to
include copper interconnects, silicon-on-insulator (SOI) transistors, and low-k dielectric insulation technologies. This 6U VME
PowerPC Single Board Computer is designed to meet application
needs ranging from benign/development to the harshest mission-critical environments.
ITC-320
The Kontron rugged conduction-cooled dual-core CompactPCI
CPU boards power the most demanding embedded applications,
furthered by the recent launch of the Rugged Conduction-Cooled
(RC) version of the Kontron ITC-320 product series. The Kontron
ITC-320 series includes a range of 3U CompactPCI CPU boards
using a high performance and long-term available processing
chipset from the Intel® embedded architecture. The series features three types of top performance single and dual-core Intel®
processors in four different designs, including a Rugged Conduction-Cooled version for reliable operation in even the harshest
environments. Equipped with the latest dual-core 1.5 GHz Intel®
Core™2 Duo LV processor, the Kontron ITC-320 CompactPCI CPU
board is able to meet highly demanding signal and data processing
requirements. Using the 1.2 GHz Intel® Core™ Duo processor on
the Kontron ITC-320 provides the optimal performance-per-watt
ratio for applications that need to balance computing performance with low power consumption. The Kontron ITC-320 series
also supports the 1.0 GHz Intel® Celeron® M processor which is
an excellent choice when power dissipation is a critical issue.
www.eecatalog.com/military
“Kontron plans to stay head of business volumes and margins
with ingenuity,” said Georges Batarsé, CEO of Kontron Modular
Computers SA, France (formerly Thales Computers). “Kontron
offers streamlined designs, innovative mechanical concepts
and product configurations optimized for specific applications
like defense, aerospace and transportation – we have one of the
strongest engineering staffs in the embedded industry worldwide and we know embedded customers need creativity, skill and
high level service on a daily basis. Kontron will continue to meet
those demands by delivering intelligent solutions that keep our
customers’ success as the priority.”
CONTACT US
Kontron
14118 Stowe Drive
Poway, CA 92064
USA
888.294.4558 Telephone
info@us.kontron.com
www.kontron.com
23
CONFERENCE
OCTOBER 26-30, 2008
EXPO
OCTOBER 28-29, 2008
Hynes Convention Center
Boston, MA
LEARN TODAY.
DESIGN
TOMORROW.
The Embedded Systems Conference Boston was created specifically to meet the information
needs of the system architects and design engineers who create these complex systems.
The technical program at ESC is the Fall’s largest industry conference offering in-depth and
unbiased content, that delivers real world solutions from leading technology experts.
Tracks include:
s#OMMERCIAL/PEN3OURCE/PERATING
Systems
s$EBUGGING6ERIlCATION4EST
s$ESIGN4EAM-ANAGEMENT
s$30-ULTIMEDIA!LGORITHMS
Implementation
s(ARDWARE$ESIGNINCLUDING0ROGRAMMABLE
Logic
s-ULTICORE0ROCESSORS0ROGRAMMING
s2EALTIME$EVELOPMENT
s3ECURITY
s3OFTWARE$EVELOPMENT
s6IRTUALIZATION
s7IRED7IRELESS.ETWORKING
EARLY BIRD REGISTRATION NOW OPEN!
www.cmp-egevents.com/web/escb/registration
Signature Sponsor
0LATINUM3PONSOR
Advanced Micro Devices
Compatible Operating Systems: Windows, Linux
Chips, Cores & Components
Chips, Cores & Components
AMD Athlon™ and AMD Athlon
X2 dual-core processors
Supported Architectures: X86
AMD Athlon and AMD Athlon X2 dual-core processors
with Direct Connect Architecture can improve overall
system performance and efficiency by helping eliminate
traditional bottlenecks inherent in legacy architectures,
where traditional front-side buses restrict and interrupt
the flow of data. With AMD64 processors, there are no
front-side buses. Instead, the processors, memory controller, and I/O are directly connected to the CPU. Further,
the integrated memory controller dramatically reduces
memory latency while HyperTransport™ technology
delivers a very high I/O bandwidth. Data speeds through
the system without encountering the traditional front-side
bus bottleneck that plagues competing x86 platforms.
And all this performance comes in a low-power processor. AMD64 technology offers low operational costs
with reduced power draw and heat dissipation. It also
features Cool‘n’Quiet™ technology with Optimized Power
Management, which can deliver performance on demand
and minimize power consumption.
In addition to performance, AMD Athlon and AMD
Athlon X2 dual-core processors for the embedded
market are NEBS-friendly and offer Error Correcting
Code (ECC) to help deliver reliability and secure data
transactions for embedded systems.
AMD is committed to providing our embedded customers
with choices, and designing on the industry-standard
x86 platform provides access to thousands of software,
hardware, and development tools. AMD processors are
compatible with the major Microsoft ® Windows® operating systems as well as Linux.®
> Support for 64-bit DDR2 SDRAM memory—PC2-6400
(DDR2-800), PC2-5300 (DDR2-667), PC2-4200 (DDR2-533),
or PC2-3200 (DDR2-400) SDRAM, unbuffered DIMMs
> Up to 10.6GB/s memory bandwidth
> ECC checking with double-bit detect and
single-bit correct
V HyperTransport™ technology for high-speed I/O
communication
> Up to 8GB/s HyperTransport™ I/O bandwidth
> Up to 20.8GB/s total delivered processor-to-system
bandwidth (HyperTransport bus + memory bus)
V Large high-performance on-chip cache
> 64KB Level 1 instruction cache per core
> 64KB Level 1 data cache per core
> 512KB Level 2 cache with single-core processors
> Up to 1MB Level 2 cache per core with dual-core
processors
V Socket AM2 Packaging
> Lidded micro pin grid array (PGA)
> 31x31 grid array
> 1.27mm pin pitch
> Compliant with RoHS (EU Directive 2002/95/EC)
AVAILABILITY
Now
FEATURES & BENEFITS
APPLICATION AREAS
V Leading-edge performance for 32- and 64-bit applications
V 40-bit physical addresses, 48-bit virtual addresses
V Sixteen 64-bit integer registers
storage, telecommunications, point-of-sale, networking,
military, imaging, and gaming systems
Sixteen 128-bit SSE/SSE2/SSE3 registers
V AMD Digital Media Xpress™ technology provides
CONTACT INFORMATION
support for SSE, SSE2, SSE3, and MMX™ instructions
Enhanced Virus Protection*
V JTAG interface for debug support
TECHNICAL SPECS
V A high-bandwidth, low-latency integrated DDR
Advanced Micro Devices
One AMD Place
PO Box 3453
Sunnyvale, CA 94088-3453
USA
408-749-4000 Telephone
www.amd.com
memory controller
www.eecatalog.com/military
Chips, Cores & Components • 25
Advanced Micro Devices
Compatible Operating Systems: Windows, Linux
Chips, Cores & Components
Chips, Cores & Components
AMD Geode™ LX
800@0.9W processor
Supported Architectures: X86
Responding to customer demand, AMD is now providing
the high performance, very low power and x86 compatibility
of the AMD Geode LX 800@0.9W processor in an extended
temperature version supporting –40 to +85 degrees Celsius.
This ideal foundation for extended temperature embedded
systems is offered with the AMD Geode CS5536 companion
device, which also now supports the industrial temperature
range and is optimized to work with AMD Geode LX processors to deliver an integrated solution with very low power
consumption and internal data speeds above 1 GB/s.
DESIGN WITHOUT COMPROMISE
AMD Embedded solutions, including AMD Geode and
AMD64 processors, support the embedded industry’s
business need to shorten design cycles and get systems
to market fast. With a wealth of design tools and support
and a robust embedded processor roadmap with extended
component longevity, AMD is a leader in enabling high
performance, low power embedded designs.
V High-resolution CRT and TFT outputs (simultaneous
V
V
V
V
Along with the creativity and innovation of our customers,
AMD is helping push the embedded space further into
the future and enabling increasingly reliable, feature-rich
embedded products—all on an industry-standard x86
architecture supporting all major operating systems and
thousands of software applications.
V
V
operation) with support for High Definition (HD) and
Standard Definition (SD) standards and support for
1920x1440 in CRT mode and 1600x1200 in TFT mode
VESA 1.1 and 2.0 VIP/VDA support
481-terminal Plastic Ball Grid Array (PBGA) with
internal heatspreader
GeodeLink technology active hardware power
management
Hardware support for standard ACPI software power
management
Lower power I/O
Wakeup on SMI/INTR
AVAILABILITY
NOW
FEATURES & BENEFITS
APPLICATION AREAS
V x86/x87-compatible core
V Processor frequency up to 500 MHz
V Support for Industrial Temperature range of –40 to
+85 degrees Celsius
V 64K I/64K D L1 cache and 128K L2 cache
V 64-bit DDR memory interface up to 400 MHz
telecommunications infrastructure (including wired,
wireless, and BSC/MSC), single board computing,
automotive and transportation systems and industrial
control and monitoring.
TECHNICAL SPECS
V Integrated FPU that supports MMX™ and AMD
CONTACT INFORMATION
3DNow!™ technology instruction sets
V 9 GB/s internal GeodeLink™ technology Interface
Unit (GLIU)
V Security Block with 128-bit AES (CBC/ECB) and true
random number generator
26 • Chips, Cores & Components
Advanced Micro Devices
One AMD Place
PO Box 3453
Sunnyvale, CA 94088-3453
USA
408-749-4000 Telephone
www.amd.com/embedded
Military & Aerospace Technologies Resource Catalog 2009
Advanced Micro Devices
AMD Opteron™ processor
Supported Architectures: X86
Chips, Cores & Components
Chips, Cores & Components
Compatible Operating Systems: Windows, Linux
AMD64 technology with Direct Connect Architecture helps
provide a balanced foundation for embedded systems.
Based on the industry-standard x86 platform, AMD64
delivers the right match of processing power, memory performance, I/O throughput, and scalability. Add the vision of
32- and 64-bit application support with native multi-core
computing in a consistent thermal envelope and many
embedded designers are finding their next-generation systems deliver record-breaking application performance.
What can a leading processor platform offer?
AMD Opteron processors with its third generation Direct
Connect Architecture can help improve overall system
performance and efficiency by helping eliminate traditional bottlenecks inherent in architectures where
traditional front-side buses restrict and interrupt the
flow of data. With AMD Opteron processors, there are
no front-side buses. Instead, the processors, memory,
and I/O are directly connected to the CPU. Further, the
integrated memory controller reduces memory latency
while HyperTransport™ technology delivers a very high
I/O bandwidth. Data speeds through the system without
encountering the traditional front-side bus bottleneck
of competing x86 platforms. In addition to the architectural benefits inherent in Direct Connect Architecture,
the AMD Opteron processor offers the following unique
advantages for high-end embedded systems.
V Low operational costs – reduced power draw and heat
dissipation means lower data center energy costs.
Features like AMD PowerNow!™ technology with
Optimized Power Management helps deliver performance on demand and minimizes power consumption
TECHNICAL SPECS
V HyperTransport technology provides up to 24.0GB/s peak
V On-die integrated DDR2 memory controller offers
FEATURES & BENEFITS
available memory bandwidth up to 10.7GB/s (with
DDR2-667) per processor
V Hardware assisted AMD Virtualization™ technology in
AMD Opteron processors with DDR2 helps streamline
the efficiency of multiple servers and provides virtual
machine memory isolation for improved security
V AMD64 technology provides features like Error Cor-
AVAILABILITY
recting Code (ECC) and JTAG interfaces for effective
debug during system development.
V Direct Connect Architecture requires fewer
chips on the motherboard, further enhancing a
system’s overall reliability.
V provides unique scalability options with glueless multiprocessing from one socket (2 core) to 8 socket (16 core)
systems. This, combined with AMD64’s reliability, helps
provide an embedded design that can give customers a
long-range plan for the life cycle of their systems.
V Microprocessor architecture – AMD64 processor
design helps reduce the overall system power budget
with integration of the North Bridge, while multi-core
Processors are designed to offer increased performance, with higher compute density and scalability
www.eecatalog.com/military
Now
APPLICATION AREAS
storage and telecommunications, security and medical
imaging, military systems, and single board computing
CONTACT INFORMATION
Advanced Micro Devices
One AMD Place
P.O. Box 3453
Sunnyvale, CA 94088-3453
USA
408-749-4000 Telephone
www.amd.com
Chips, Cores & Components • 27
Advanced Micro Devices
AMD Opteron™ processor
Supported Architectures: X86
Chips, Cores & Components
Chips, Cores & Components
Compatible Operating Systems: Windows, Linux
AMD64 technology with Direct Connect Architecture helps
provide a balanced foundation for embedded systems.
Based on the industry-standard x86 platform, AMD64
delivers the right match of processing power, memory performance, I/O throughput, and scalability. Add the vision of
32- and 64-bit application support with native multi-core
computing in a consistent thermal envelope and many
embedded designers are finding their next-generation systems deliver record-breaking application performance.
What can a leading processor platform offer?
AMD Opteron processors with its third generation Direct
Connect Architecture can help improve overall system
performance and efficiency by helping eliminate traditional bottlenecks inherent in architectures where
traditional front-side buses restrict and interrupt the
flow of data. With AMD Opteron processors, there are
no front-side buses. Instead, the processors, memory,
and I/O are directly connected to the CPU. Further, the
integrated memory controller reduces memory latency
while HyperTransport™ technology delivers a very high
I/O bandwidth. Data speeds through the system without
encountering the traditional front-side bus bottleneck
of competing x86 platforms. In addition to the architectural benefits inherent in Direct Connect Architecture,
the AMD Opteron processor offers the following unique
advantages for high-end embedded systems.
V Low operational costs – reduced power draw and heat
dissipation means lower data center energy costs.
Features like AMD PowerNow!™ technology with
Optimized Power Management helps deliver performance on demand and minimizes power consumption
TECHNICAL SPECS
V HyperTransport technology provides up to 24.0GB/s peak
V On-die integrated DDR2 memory controller offers
FEATURES & BENEFITS
available memory bandwidth up to 10.7GB/s (with
DDR2-667) per processor
V Hardware assisted AMD Virtualization™ technology in
AMD Opteron processors with DDR2 helps streamline
the efficiency of multiple servers and provides virtual
machine memory isolation for improved security
V AMD64 technology provides features like Error Cor-
AVAILABILITY
recting Code (ECC) and JTAG interfaces for effective
debug during system development.
V Direct Connect Architecture requires fewer
chips on the motherboard, further enhancing a
system’s overall reliability.
V provides unique scalability options with glueless multiprocessing from one socket (2 core) to 8 socket (16 core)
systems. This, combined with AMD64’s reliability, helps
provide an embedded design that can give customers a
long-range plan for the life cycle of their systems.
V Microprocessor architecture – AMD64 processor
design helps reduce the overall system power budget
with integration of the North Bridge, while multi-core
Processors are designed to offer increased performance, with higher compute density and scalability
28 • Chips, Cores & Components
Now
APPLICATION AREAS
storage and telecommunications, security and medical
imaging, military systems, and single board computing
CONTACT INFORMATION
Advanced Micro Devices
One AMD Place
P.O. Box 3453
Sunnyvale, CA 94088-3453
USA
408-749-4000 Telephone
www.amd.com
Military & Aerospace Technologies Resource Catalog 2009
Tundra Semiconductor
Tundra is the leader in VME, providing embedded computing solutions with the industry’s #1 VME solutions.
Improve serial designs using Tundra’s market leading
Serial RapidIO Switches in conjunction with the Tsi148 to
add scalability to bandwidth hungry applications.
FEATURES & BENEFITS
V RapidIO Technical Specs - Low latency with
V VME Features - Industry’s best sustained transfer rate of
cut-through capability - Extremely flexible port
configuration - data rates from 1-10 Gbps per port
- High performance hardware multicast
305 MBytes/sec is a 4x improvement over other solution
V VME Technical Specs - Decoupled Architecture
allows maximum PCI and VME bus bandwidth
- VME64 Extensions, 2eVME and 2eSST protocols
bring support for higher bandwidth - Full VMEbus
system controller functionality
V RapidIO Features - Best overall system performance,
superior real time image processing resolution, size
and frames per second in military and medical imaging systems. - Lowest power dissipation (120-200mW
per port) tunable power per port to optimize power
for the application. - System level design - requires
only one clock input simplifying board design
Chips, Cores & Components
Chips, Cores & Components
Tundra Serial RapidIO and VME
APPLICATION AREAS
Industrial IC, Military/Aerospace IC, Wireless
CONTACT INFORMATION
Tundra Semiconductor
603 March Road
Ottawa, Ontario K2K2M5
Canada
613.592.0714 Telephone
613.592.1320 Fax
sales@tundra.com
www.tundra.com
Creating Powerful, Low-Cost Applications
Don’t Miss These Power-Packed Events!
MicroTCA and AdvancedTCA Summits provide up-to-date information on the new standard platforms
for telecommunications equipment, mobile systems, military and defense systems, medical equipment,
and much more. Learn how these standards deliver turn-key solutions while reducing costs and
development time. Join industry experts, vendors and users. For information visit online.
E U R O P E
Q
May 28-30, 2008
Westfields Marriott
Chantillty, VA
MicroTCAsummit.com
www.eecatalog.com/military
Q
Q
Q
Q
September 23-24, 2008
October 21-23, 2008
Disney New York, New York
Santa Clara Convention Center
Paris, France
Santa Clara, CA
CONTACT INFORMATION
euroATCAsummit.com
AdvancedTCAsummit.com
Chips, Cores & Components • 29
VMETRO
AD3000 3GSPS A/D
XMC/PMC module
The AD3000 closely couples a high performance Xilinx
Virtex-5 FPGA to a high-speed analog input front end providing both processing and up to 3 GSPS acquisition in a
single XMC/PMC card. The combination of a user programmable FPGA, data I/O sub-systems and multiple banks of
fast memory provides a powerful platform for acquiring
and processing high-speed data in one board. In addition
to processing digitized data, the Xilinx Virtex-5 SXT or LXT
FPGA is used to control the analog to digital converter
and provides the off-board interfaces to either PCI-X or
the multi-Gbps serial I/O used for the XMC interface. The
AD3000 is ideal for DSP applications including: Electronic
Counter Measures (ECM), Spectral Analysis and Radar.
APPLICATION AREAS
Intelligence, Surveillance and Reconnaissance (ISR) and
Electronic Warfare (EW)
CONTACT INFORMATION
TECHNICAL SPECS
VMETRO
1880 S Dairy Ashford, Suite 400
Houston, TX 77077
USA
+1 281-584-0728 Telephone
+1 281-584-9034 Fax
info@vmetro.com
http://www.vmetro.com/ad3000
V 3 GSPS, 8-bit ADC
V Xilinx Virtex-5 LX110T or SX95T FPGA (user
programmable)
V Dual banks of QDR2 SRAM and DDR2 SDRAM memories
V Capable of multi-board synchronization
V XMC/PMC Form factor (including rugged)
A network dedicated
edicated to the
th
he
en
needs off
s designe
ners
rs and
engineers, developers,
designers
ers
engineering managers
Diamond Sponsor
Official Sponsor
Purchasing guides for the electronics industry
Multicore
Technologies
Annual Resource Catalog
Diamond Sponsor
Purchasing guides for the Electronics Industry
Purchasing guides for the electronics industry
S P E C I A L
Embedded Security
Technologies Resource Catalog 2008
Embedded Linux
Resource Catalog 2009
Resource Catalog 2008
O p tio nal
Ap p lication fram ew ork & PIM
VPN
IM
Bro w s er
T h ird Party
Sup p o rted
MontaVista DevRocket IDE
R in g to ne en gine
Vo ic e rec o gnition
M M S en g in e
Pred ic tive tex t en try
Vo IP
M ultim ed ia en gine
O TA
J VM
Prio rity
In h eritance
Pre-lin king
X11
M em o ry
Pro tec tion
AR M EABI
N PT L
g libc
uC libc
Po w er M g r
D atabas e
Ap p XIP
SSM
Sy s tem U tils
Sec urity
F ram ew o rk
O BEX
IPSec
W i-F i
T elep h ony
Serv er & T API
(T ap root)
Blueto o th
SYSTEMVERILOG MEETS EMULATION
Telephony
Stacks
Multimedia
Processing
Kernel features and drivers
F ile s y s tem s
(N AN D /N O R )
C am era
Vid eo
F las h
Aud io
C am era
Po w er m g m t
Lo g g ing
Serial
IPv 6
F as t bo o t
R eal-tim e
U SB H o s t, G ad g et
T elep h ony
in terfac e
Kern el XIP
Sec urity
U SB O T G
SD IO
Optional Sub-Kernel
RTOS / L4
MINIMIZING THE EFFECTS OF
MANUFACTURING VARIATION
Hardware platform
Semiconductor Reference
June 2008
DRM
Middleware
OS-level features and services
G TK
D irec tF B
F ram e buffer
I S S U E
CODING PRACTICES IN A
LOW POWER WORLD
Application layer
D ata s y n c
W in dow M g r
T o uc h screen
D O U B L E
COLLABORATION MODELS
Baseband
Processor
/ Modem
“IS THAT AN ELEPHANT IN YOUR FLOW?”
www.eecatalog.com/multicore
CONTACT INFORMATION
www.eecatalog.com/security
Platinum Sponsor
Platinum Sponsor
Gold Sponsors
Affiliate Sponsor
Gold Sponsors
www.eecatalog.com/embeddedlinux
www.chipdesignmag.com
Gold Sponsors
Catalog Diamond Sponsor:
Catalog Gold Sponsor:
Affiliate Sponsors:
www.eecatalog.com
30 • Application Solutions
Military & Aerospace Technologies Resource Catalog 2009
Analog / Digital IO
Analog / Digital IO
Compatible Operating Systems: Windows, VxWorks and Linux support
Tri-M Engineering
CBP23 - 23 Farad Super Capacitor
Backup Power Module
Compatible Operating Systems: DOS, MSDOS, DRDOS, LINUX,
VxWorks, most RTOS and Windows
The CBP23 is a no-battery OEM backup module that uses
supercapacitors rather than conventional batteries. The
advantage of supercapacitors is that they charge very
quickly and they are able to be recharged a very large
number of times - 500,000 cycles compared to several
hundred for batteries. This is beneficial for applications
that have either a very large number of battery discharge
cycles or where a “maintenance free” solution is required
such as remote terminals, mobile data collectors, or
wherever changing spent batteries is not convenient.
The CBP23 total capacitance is 23.33 Farads with a maximum voltage of 15V and maximum energy storage of
2053 Joules at a cutoff voltage of 7.0V. This allows the
CBP23 to power a hypothetical 5W load for 6.84 minutes
or a 20W load for 1.71 minutes. When combined with a
Tri-M Engineering Smart Charge series of power supply
like the HESC104, HESC-SER, or HPSC104-SER, the result
is a “no Battery” uninterrupted power supply (UPS) complete with 4A charger and power management features
capable of supplying short term power to a system for a
set period of time until a proper shutdown is completed
and/or main power is restored.
Batteries
Batteries
Supported Architectures: x86, PC/104, PC/104-Plus, Serial, I2C
AVAILABILITY
Immediate Shipping
APPLICATION AREAS
Military, Aerospace, Industrial, Transportation, Security,
Mining, Oil and Natural Gas
The CBP23 is a PC/104 footprint (3.55” x 3.775”) capable
of being integrated into a PC/104 stack. Its operating
temperature of -40º to +65ºC and storage temperature of
-40º to +70ºC offers a far greater range over conventional
batteries makes the CBP23 an ideal solution for robust
and rugged systems. The CBP23 is available from stock
and is RoHS compliant.
FEATURES & BENEFITS
500,000 charge cycles
Not affected by deep discharges
Not affected by deep discharges
Combine with Tri-M HESC series power supply for a
no-battery UPS
V PC/104 Footprint
V
V
V
V
TECHNICAL SPECS
V
V
V
V
V
23.33 Farad total capacity
15 Volt maximum voltage (module)
2053 Joules maximum energy storage
-40ºC to +65ºC operating temp
-40ºC to +70ºC storage temp
www.eecatalog.com/military
CONTACT INFORMATION
Tri-M Engineering
1407 Kebet Way, Unit 100
Port Coquitlam, BC V3C 6L3
Canada
800-665-5600 Toll Free
604-945-9565 Telephone
604-945-9566 Fax
info@tri-m.com
www.tri-m.com
Application Solutions • 31
Kontron
ATCA 10Gbe Boards
The Kontron AT8030 has three Intel® dual-core processors
on a single blade and its mezzanine cane be populated
with an AMC such as a forth processor or a peripheral.
The Kontron AT8404 allows any four AMCs to be used
in order to best meet project requirements. The Kontron
AT8904 switch provides 10 Gigabit Ethernet connectivity
between the boards in the system.
V AT8404: Four (4) Mid-Size AMC slots that support
AMC.0 rev 2, AMC.2, AMC.3, and AMC.4
V AT8904: 10GbE service to redundant Hub Board,
Non-blocking Layer 2 switching with VLANs
CONTACT INFORMATION
FEATURES
Kontron
14118 Stowe Drive
Poway, CA 92064
USA
888.294.4558 Telephone
info@us.kontron.com
www.kontron.com
V AT8030: Triple Intel® Core™2 Duo, PCI Express
x4 and dual GbE connectivity, 1 X Mid-Size
AdvancedMC bay
To keep up-to-date with products and technology,
sign up for a FREE subscription to Extension Media’s
Resource Catalogs for the electronics industry.
2008 Issues include:
•
•
•
•
•
•
•
•
•
•
8-bit
Advanced TCA® Platform
Chip Design
Consumer Electronics
DSP
Embedded Intel® Solutions
Embedded Linux
IBM Software Development Platform
Medical
MIPS®
• PC/104 & PC/104-Plus
• PCI Technology
• Power Architecture
• PCI Express
• USB
• VMEbus
• Wind River
INFORMATION
•CONTACT
Windows
Embedded
• Wireless Technologies
And you can also register to win $500 by providing feedback on this catalog.
GO TO www.extensionmedia.com/win TODAY!
32 • Application Solutions
Military & Aerospace Technologies Resource Catalog 2009
Carrier Boards
Carrier Boards
Kontron’s 10Gbe ATCA portfolio is just an example of
computing power that ATCA represents. ATCA is the platform of choice for military derivative aircraft, datacenter
servers and server consolidation programs. Because
of its high compute density, very high communication
bandwidth, high reliability and fairly rugged form factor
ATCA platforms and components give designers a versatile solution for a number of applications.
Connect Tech Inc.
BlueStorm Serial Port Expansion
Cards for PCI Express
Compatible Operating Systems: Windows 2000/XP/XP x64/XPe/
Server 2003/Server 2003 x64/CE/Vista/QNX 4, QNX 6, Linux
Supported Architectures: PCI Express
BlueStorm/Express standard cards include surge suppression and switchable line interfaces. For added
protection, choose the BlueStorm/Express Opto as it
boosts surge suppression to new heights with its full 3kV
port to port and port to host optical isolation.
All BlueStorm/Express and BlueStorm/Express Opto
cards are compatible with x1, x4, x8 and x16 lane PCI
Express slots and provide standard data speeds of 921.6
Kbps in RS-232 and 1.8432Mbps in RS-422/485. These
high speed baud rates ensure quick data acquisition and
reduced latency for maximum system responsiveness
and high performance communications.
Superior data transfer speeds, high port densities,
surge suppression and optical isolation options ensure
that BlueStorm/Express and BlueStorm/Express Opto
products will continue to be the best choice for your
critical applications.
COTS
COTS
Connect Tech’s established BlueStorm/Express family provides field-tested products, optical isolation and offers the
industry’s first 16 port RS-232/422/485 PCI Express card.
With its constant innovation, Connect Tech continues to
lead the field in PCI Express serial communications.
AVAILABILITY
Visit www.connecttech.com for a complete list of products. RoHS compliant models available.
APPLICATION AREAS
Military, aerospace, industrial automation, POS, gaming,
medical systems, transportation systems, etc.
FEATURES & BENEFITS
V Compatible with any available x1, x4, x8, x16 lane
V
V
V
V
PCI Express slot
Available with 1 kV or 3kV peak to peak optical isolation
Multi-strike surge suppression on all signals, all ports
Plug and play compatible
Standard height and low profile models available
with various cabling options and software support
TECHNICAL SPECS
V Available with 2, 4, 8 or 16 switchable RS-232/422/485
serial ports
V Bidirectional data transfer speeds between 50bps
and 1.8432Mbps
V Supports full duplex with RTS/CTS flow control, half
duplex with TxD echo cancellation and multi-drop
modes in RS-422/485
V Dual UARTs with up to 64 byte transmit and receive
FIFO buffers on each port
V RoHS compliant
www.eecatalog.com/military
CONTACT INFORMATION
Connect Tech Inc.
42 Arrow Road
Guelph, Ontario N1K 1S6
Canada
800-426-8979 Toll Free
519-836-1291 Telephone
519-836-4878 Fax
sales@connecttech.com
www.connecttech.com
Application Solutions • 33
Connect Tech Inc.
PC/104, PC/104-Plus &
PCI/104-Express
Compatible Operating Systems: Windows 2000/XP/XP x64/XPe/
Server 2003/Server 2003 x64/CE/Vista/QNX 4, QNX 6, Linux
Supported Architectures: PC/104, PC/104-Plus & PCI/104-Express
Connect Tech offers a variety of products for your industrial and embedded needs. Choose our reconfigurable
FPGAs, solid state drives, multi-port serial boards, wireless radio modems and CAN controller boards.
FreeForm products provide off-the-shelf flexibility for
high speed, compute-intensive, reconfigurable applications. PC/104 or PCI-104 models feature the Xilinx Virtex-5
or Spartan-3E FPGAs.
COTS
COTS
Reconfigurable FPGAs
Solid State Drives
V Customization available on every board, including
FlashDrive/104 is a flash based, solid state storage
module for PC/104 or PC/104-Plus and offers driverless
operation. Immune to extreme temperatures, shock
and vibration. Available with 4, 8, 16 or 32GB storage
and -40°C to 85°C temperature range.
custom connectors, baud rates, software or complete
board redesigns
V Surge suppression and optical/electrical isolation models
V Lifetime warranty and free technical support
V RoHS compliant models available
Multi-port Serial
TECHNICAL SPECS
Up to 12 ports of serial communication for PC/104,
PC/104-Plus or PCI/104-Express. Options include; surge
suppression, optical/electrical isolation, industrial
temperature range (-40°C to 85°C), 9-bit data and synchronous communications models.
V PC/104, PC/104-Plus, PCI/104-Express and PCI-104
form factors
V Industrial temperature range (-40°C to 85°C)
V Synchronous communications available with numerous
protocols such as HDLC, SDLC, MonoSync, BiSync and
Asynch (PC/104 multi-port serial models only)
Wireless Radio Modems
AVAILABILITY
CTI’s wireless radio modems provide communications
in license-free frequency ranges of 900MHz and 2.4GHz.
Xtreme/104 Radio Modems also feature FHSS technology
for immunity to jamming and multipath fading to ensure
robust, reliable communications in noisy environments.
CAN Controllers
CANpro/104 Opto features two NXP SJA1000 CAN controllers for PC/104. 500V of optical/power isolation ensure
ultimate data protection. Fail-safe power-up/powerdown and on-board high input impendence transceivers
maximize nodes on the bus.
FEATURES & BENEFITS
V FPGAs, solid state drives, multi-port serial, wireless
radio modems and CAN controller boards
34 • Application Solutions
Visit www.connecttech.com for a complete list of products. RoHS compliant models available.
APPLICATION AREAS
Industrial automation, POS, gaming, medical systems,
transportation systems and military and defense
applications, etc.
CONTACT INFORMATION
Connect Tech Inc.
42 Arrow Road
Guelph, Ontario N1K 1S6
Canada
800-426-8979 Toll Free
519-836-1291 Telephone
519-836-4878 Fax
sales@connecttech.com
www.connecttech.com
Military & Aerospace Technologies Resource Catalog 2009
Kontron
Kontron Systems, Motherboards/
SBCs & Custom System Services
Kontron embedded motherboards and SBCs have lifespan
of up to 7 years to eliminate design churn and frequent
qualification/certification. By coupling the processor
with the state-of-the-art chipset, Kontron offers the most
advanced memory control and I/O functionality for each
motherboard and SBC. Kontron’s high speed, digital logic
with up to 12-layer stacking PCB designs ensures signal
integrity, reduces radiation, improves signal quality, and
aids in the decoupling of the power bus, resulting in high
quality electromagnetic compatibility.
Consider Kontron for your next embedded system. For
more info visit: www.kontron.com
V Network Platforms -- The Kontron KNP-2000 includes
up to an Intel® Xeon® 3000 Sequence processor and
3010 chipset with over 2 GHz clock speed for accelerating network traffic, SSL or XML applications or for
security (IPS, firewall, VPN).
V Motherboards/SBCs – Kontron offers embedded
longlife boards based on Intel® and AMD ® processors
and chipsets, supporting Windows® and Linux OSs in
mini-ITX to ATX form factors; along with nanoETXexpress-SP for Intel® Atom™.
V Custom Systems -- When requirements eliminate
COTS solutions, Kontron provides complete design
through post production and fulfillment customer
systems services, including all testing, certification
and supply chain and revision management.
COTS
COTS
Kontron provides military and aerospace customers with
highly reliable system and motherboard products that
continue to work under extreme temperatures and high
levels of physical stress. Whether using a KISS industrial server, a Kontron thin client or display, a network
platform or a Kontron motherboard in a custom system,
each Kontron product has been extensively tested to
minimize the risk of failure. The dual redundant power
supplies and hot swap SATA HDD on the KNP-2000 network platform and the hot swap chassis fans (and SBCs)
in the Kontron KISS industrial servers are designed to
make repairs easy, even in field environments.
AVAILABILITY
FEATURES & BENEFITS
V Silent Industrial Servers – Kontron’s KISS rack
New product pictured above: KTUS15/mITX motherboard
with Intel® Atom® and US15W chipset available late 2008.
mount servers range from 1U to 4U, with 2U and
4U short versions for space constrained use. These
configurable COTS servers have CPU clock speeds
of up to 3.8 GHz.
V HMI – Kontron offers a full range of touch screens,
panel PCs and thin clients designed to accommodate
human machine interface applications. Displays
range from 7 inches up to 19 inches with resolution
from 800x480 to 1280x1024.
CONTACT INFORMATION
Kontron
14118 Stowe Dr.
Poway, CA 92064-7147
USA
888-294-4558 Telephone
858-677-0898 Fax
info@us.kontron.com
www.kontron.com
www.eecatalog.com/military
Application Solutions • 35
Sealevel Systems, Inc
ACC-188 Synchronous
Serial Radio Adapter
Compatible Operating Systems: Microsoft Windows 2000, XP
Supported Architectures: Various radio brands and models using
MIL-STD-188-184
The ACC-188 operates in conjunction with standard PDA184 software developed by and available from DISA. The
PDA-184 software provides a Graphical User Interface
(GUI) that allows radio users to transmit and receive a
variety of data types at much higher speeds than is possible with comparable, proprietary solutions.
A key advantage of the ACC-188 is that it enables
interoperability among the various radio brands and
models used by the defense community. The ACC-188
is compatible with any tactical radio that has a synchronous communication port using MIL-STD-188-184. This
includes the most prevalent brands and models: Raytheon AN/PSC-5D and AN/ARC-231, Harris AN/PRC-117F
and AN/PRC-150, Thales AN/PRC-148, Rockwell Collins
AN/ARC-210, Motorola LST-5B and LST-5C.
The PDA-184 software is government-developed and
government-owned by DISA.
TECHNICAL SPECS
V
V
V
V
V
Implements MIL-STD-188-184 Data Waveform
Easy-to-use Java-based GUI
Runs in Microsoft Windows 2000 or XP
Overall cable length is 60 inches
PDA-184 software is available from DISA
AVAILABILITY
Immediately from stock
APPLICATION AREAS
Synchronous Military Radio Communications
The ACC-188 is available from stock for USB (Item# 9065) and
PCMCIA (Item# 9064) interfaces. Call us today at 864-8434343 to discuss your military communication application.
FEATURES & BENEFITS
V Enables tactical radios currently utilized by the US
V
V
V
V
Armed Forces to interface to PCs and transmit IP
based data
Interoperability allows communications among various radio brands and models
Available with a variety of radio connector options
Reduces tax-payers costs compared to purchasing
ultra-expensive proprietary hardware and software
Available in USB and PCMCIA form factors
36 • Application Solutions
CONTACT INFORMATION
Sealevel Systems, Inc
2779 Greenville Highway
PO Box 830
Liberty, SC 29657
USA
864-843-4343 Telephone
864-843-3067 Fax
sales@sealevel.com
www.sealevel.com
Military & Aerospace Technologies Resource Catalog 2009
COTS
COTS
The ACC-188 USB synchronous serial radio adapter and
free software from the Defense Information Systems
Agency (DISA) upgrades tactical radios with the capability to send and receive IP data such as GPS maps,
images, coordinates, and IM-type communications.
American Portwell Technology, Inc.
NANO-8044
The NANO-8044 supports dual display by VGA and
LVDS connector. In addition, it features one SO-DIMM
memory slot for DDR2 SDRAM up to 1GB, and one
PCIe x1 expansion slot, and comes with one GbE,
one IDE, one CompactFlash ® socket, one SD, one
RS232/422/485, audio, and six USB 2.0 ports.
APPLICATION AREAS
Portable POS, Medical Healthcare, Mobile Kiosk, EntryGaming, and Digital Signage
FEATURES
CONTACT INFORMATION
V Intel Atom processor Z510/Z530 and the Intel System
V
V
V
V
American Portwell Technology, Inc.
44200 Christy Street
Fremont, CA 94538
USA
510-403-3399 Telephone
510-403-3184 Fax
info@portwell.com
www.portwell.com
Controller Hub US15W
One 200-pin SO-DIMM supports DDR2 SDRAM up to 1GB
Dual independent display by VGA and 24bit LVDS
One Type II CompactFlash, one IDE and one SD
One Gigabit Ethernet port
CPU or Single Board Computers
CPU or Single Board Computers
The NANO-8044, utilizing the Nano-ITX form factor, is
based on the Intel Atom processor Z510/Z530 and the
Intel System Controller Hub US15W. The new microarchitecture of the Intel platform benefits a range of
low-power systems and handheld mobile devices in
applications such as Portable POS, Medical Healthcare,
Mobile Kiosk, Entry-Gaming, and Digital Signage.
Creating Powerful, Low-Cost Applications
Don’t Miss These Power-Packed Events!
MicroTCA and AdvancedTCA Summits provide up-to-date information on the new standard platforms
for telecommunications equipment, mobile systems, military and defense systems, medical equipment,
and much more. Learn how these standards deliver turn-key solutions while reducing costs and
development time. Join industry experts, vendors and users. For information visit online.
E U R O P E
Q
May 28-30, 2008
Westfields Marriott
Chantillty, VA
MicroTCAsummit.com
www.eecatalog.com/military
Q
Q
Q
Q
September 23-24, 2008
October 21-23, 2008
Disney New York, New York
Santa Clara Convention Center
Paris, France
Santa Clara, CA
CONTACT INFORMATION
euroATCAsummit.com
AdvancedTCAsummit.com
Application Solutions • 37
Ampro Computers, Inc.
COM 840 Extreme Rugged COM
Express Module & RuffSystem 840
An industry leader in developing products for harsh environments, Ampro introduces the industry’s first extreme
rugged COM Express computer-on-module based on
Intel’s Core™ 2 Duo and GME965 chipset.
Featuring the Intel® Core™2 Duo and GME965 chipset,
the COM 840 is well-suited for harsh environment
applications such as military/defense and aviation. The
highly-integrated COM 840 packs a broad complement
of I/O including Gigabit Ethernet, eight USB 2.0 ports,
AC97/HD audio controller, and two SATA II and one UDMA
EIDE interfaces. To ensure the COM 840 is able to endure
the rigors of military and aviation applications, this COM
Express module is designed to operate over an extended
temperature range of -40º to +85ºC, withstand shock up to
50Gs and vibration to 12Gs.
RuffSystem™ 840
Based on the industry’s first extreme rugged COM Express
module, the RuffSystem™ 840 embedded computer is
built for the harshest of environments. Featuring the
extreme rugged COM 840 module and EBX Baseboard,
OEMs in the military and avionics markets can speed their
time-to-market by using a fully-integrated system up to
1.6GHz. The RuffSystem provides conductive cooling for
the Core 2 Duo processor and is designed to meet MILSTD-810 shock and vibration over a wide temperature
and humidity range. The system also features up to 4GB
DDR2 667 memory, USB 2.0, Dual Gigabit Ethernet and
an extreme environment hard drive or solid state drive
(SSD). It is also expandable with PCI Express Mini Card,
Mini PCI or Compact Flash.
FEATURES & BENEFITS
TECHNICAL SPECS
V COM 840: 1.6GHz Core™2 Duo L7500, up to 4GB
DDR2 667, Gigabit Ethernet, eight USB 2.0 ports,
HDTV support and CRT resolution up to 2048 x 1536
V RuffSystem 840: Extreme rugged COM 840 and EBX
baseboard with up to 4GB DDR2 667, USB 2.0, Dual
Gigabit Ethernet, USB 2.0 and is designed to meet
MIL-STD-810
V Operating Systems: Windows® XP, XPe, CE, Ampro
Embedded Linux ®, QNX® and VxWorks®
AVAILABILITY
Visit www.ampro.com for more information or call
408-360-0200.
APPLICATION AREAS
Military, Aviation, Transportation
V Intel® Core™2 Duo processor and GME965 chipset
V Extreme rugged design for harshest environments
V Industry leading three-year warranty on extreme
rugged products
V True PICMG COM Express COM.0 compliance
V Rugged resistance to shock and vibration, HALT
CONTACT INFORMATION
reports available
V Optional -40º to +85ºC support (ETT) and conformal
coating
38 • Application Solutions
Ampro Computers, Inc.
5215 Hellyer Avenue Suite 110
San Jose, California 95138-1007
USA
+1 408-360-0200 Telephone
+1 408-360-0222 Fax
info@ampro.com
www.ampro.com
Military & Aerospace Technologies Resource Catalog 2009
CPU or Single Board Computers
CPU or Single Board Computers
COM 840
Ampro Computers, Inc.
Ampro, the inventor of the PC/104 standard, offers its reliable and extreme rugged CoreModule family of PC/104
single board computers. The CoreModule products
provide unmatched fanless operation over temperature
extremes, resistance to shock and vibration, conformal
coating, no wings, embedded BIOS and a long product
life reputation. It continues to distinguish itself as an
extreme rugged product for a multitude of applications
including military/defense and aviation.
CoreModule™ 800
The extreme rugged CoreModule 800 PCI-104 compatible
single board computer offers ultra low power Centrino™
performance with advanced networking, high-performance graphics and all of the PC-compatible component
subsystems. With a footprint of less than 16 square
inches, this extremely dense PCI-104 compliant design
is a must-have for applications where performance and
small size are the dominant requirements. Choose the
CoreModule 800 for extremely rugged embedded applications that require ultra-high performance in a compact
module that complies with the PCI-104 specification.
TECHNICAL SPECS
V CoreModule 800: 1.0GHz Celeron® M CPU, up 1GB DDR
SODIMM, two USB 2.0 ports, PCI-104 (PCI) expansion,
optional MiniModule ISA PC/104-Plus bridge module
CPU or Single Board Computers
CPU or Single Board Computers
CoreModule™ PC/104 Extreme
Rugged Single Board Computers
V CoreModule 620: 500MHz Geode™ LX 800, 128kB
Level 2 Cache, PC/104 (ISA) bus interface, up to
1GB DDR SODIMM
CoreModule™ 620
V Operating Systems: Windows® XP, XPe, CE, Ampro
The CoreModule 620 is our newest PC/104 product for
embedded applications and brings technical innovation to the form factor at a critical time when system
companies’ revenues are at risk due to the depletion of
end-of-life (EOL) CPUs and chipsets. Ampro satisfies the
urgent migration need using the AMD Geode™ LX 800
processor in order to meet the performance, price and
low power requirements. Offerings include a 500MHz
Geode™ LX 800 processor, PCI-to-ISA bridge and a standard temperature range of -20º to +70ºC with an extended
range of -40º to +85ºC.
Embedded Linux ®, QNX® and VxWorks®
AVAILABILITY
Visit www.ampro.com for more information or call
408-360-0200.
APPLICATION AREAS
Military, Aviation, Transportation
FEATURES & BENEFITS
V Scalability from 500MHz to 1.0GHz
V Small PC/104 size, stackable I/O expansion
V Industry leading three-year warranty on extreme
CONTACT INFORMATION
rugged products
V Rugged resistance to shock and vibration, HALT
reports available
V Optional -40º to +85ºC support (ETT) and conformal
coating
www.eecatalog.com/military
Ampro Computers, Inc.
5215 Hellyer Avenue Suite 110
San Jose, California 95138-1007
USA
+1 408-360-0200 Telephone
+1 408-360-0222 Fax
info@ampro.com
www.ampro.com
Application Solutions • 39
Ampro Computers, Inc.
LittleBoard™ EBX Extreme
Rugged Single Board Computers
& RuffSystem 800
Ampro, the inventor of the EBX standard, offers its reliable
and extreme rugged LittleBoard family of single board
computers with a 5-year lifecycle, broad OS support, -40º
to +85ºC extended temperature and conformal coating.
The LittleBoard 800 EBX single board computer is an
extreme rugged, I/O rich, Pentium® M single board computer that includes a PCI-to-ISA bridge chip for PC/104-Plus
expansion. Bridging from PCI allows flexible IRQ assignment and full 16-bit I/O, memory and DMA operation for the
hundreds of commercially available ISA-based I/O modules.
This extreme rugged EBX single board computer is unique
in offering fanless -40º to +85ºC operation for all but one of
the processor options (1.4GHz with Fan).
LittleBoard™ 620
The LittleBoard 620 single board computer is Ampro’s
newest EBX and provides an extreme rugged migration
solution for EOL’d 486, Celeron® and Geode™ GX1 based
single board computers. Featuring the 500MHz Geode™ LX
800 CPU and up to 1GB DDR333 SODIMM, the LittleBoard
620 features robust I/O including four serial ports (two are
RS232/422/285), four USB 2.0, Dual Ethernet, SATA and
PC/104-Plus bus interface. Just like Ampro’s other extreme
rugged single board computers, the LittleBoard 620 features
a thicker board, wide standard temperature range of -20º to
+70ºC and an extended temperature range of -40º to +85ºC.
TECHNICAL SPECS
V LittleBoard 800: Pentium® M or Celeron® M processor up
to 1.4GHz and up to 1GB DDR, LVDS and TTL/TFT video,
1000BaseT and 10/100 Ethernets, USB 2.0 and PC/104-Plus
(PCI & ISA) expansion
V LittleBoard 620: 500MHz Geode™ LX 800 with up to 1GB
DDR333, LVDS and TTL video, Dual Ethernet, USB 2.0 and
PC/104-Plus expansion
V RuffSystem 800: LittleBoard 800 with 1.4GHz Pentium® M
with up to 1GB DDR333, Gigabit and 10/100BaseT Ethernet, USB 2.0 and is designed to meet MIL-STD-810
V Operating Systems: Windows® XP, XPe, CE, Ampro
Embedded Linux ®, QNX® and VxWorks®
AVAILABILITY
RuffSystem™ 800
Based on the industry’s most rugged EBX single board
computer, the RuffSystem™ embedded computer is built
for the harshest of environments. The RuffSystem provides
conductive cooling for the Pentium™ M processor and is
designed to meet MIL-STD-810 over a wide temperature and
humidity range. The system also features up to 1GB DDR333
SODIMM, USB 2.0, Gigabit and 10/100BaseT Ethernet, an
extreme environment hard drive or solid state drive (SSD)
and room for two PC/104-Plus expansion cards.
Visit www.ampro.com for more information or call
408-360-0200.
APPLICATION AREAS
Military, Aviation, Transportation
CONTACT INFORMATION
FEATURES & BENEFITS
V Industry leading three-year warranty on extreme
rugged products
V Rugged resistance to shock and vibration, HALT
reports available
V Optional -40º to +85ºC support (ETT) and conformal
Ampro Computers, Inc.
5215 Hellyer Avenue Suite 110
San Jose, California 95138-1007
USA
+1 408-360-0200 Telephone
+1 408-360-0222 Fax
info@ampro.com
www.ampro.com
coating
40 • Application Solutions
Military & Aerospace Technologies Resource Catalog 2009
CPU or Single Board Computers
CPU or Single Board Computers
LittleBoard™ 800
Ampro Computers, Inc.
Ampro, a co-inventor of the popular EPIC standard,
offers its rugged, reliable, fanless, low-cost ReadyBoard
family of single board computers with PC-style connectors for its robust I/O. The standardized I/O block
allows scalability and easy migration for small footprint
applications. Ampro’s ReadySystem™ Fanless rugged,
turn-key PC, with pre-installed operating systems, gives
OEMs the fastest time-to-market possible. Just load the
application software and you’re ready to go!
ReadyBoard™ 830
Featuring a 1.66GHz Intel® Core™ Duo L2400 or 1.07GHz
Celeron® processor, the ReadyBoard 830 integrates up to
4GB 533MHz DDR2 RAM, graphics and networking and
powerful I/O. The onboard GMA950 graphics display provides support for CRTs, flat panels and wide screen digital
TVs at resolutions up to 2048 x 1536.
V Extensive I/O that is not available in non-standard
mid-size form factors
V Compact Flash socket, SODIMM Memory
TECHNICAL SPECS
ReadyBoard™ 820
The ReadyBoard 820 gives you a choice of ultra high performance Pentium® M and power efficient Centrino™ processors
with stackable PCI-104 expansion. It includes Gigabit Ethernet,
USB 2.0, SATA and high performance graphics in an easy to
use EPIC form factor single board computer.
CPU or Single Board Computers
CPU or Single Board Computers
ReadyBoard™ EPIC Rugged
Single Board Computers
V ReadyBoard 830: Up to 1.66GHz Core Duo CPU, 4GB DDR2,
serial ports, USB 2.0, SATA, PCI Express Mini Card socket
V ReadyBoard 820: Up to 1.4GHz Pentium® M CPU, 2GB
DDR2, serial ports, USB 2.0, SATA
V ReadyBoard 620: Rugged EPIC single board computer
ReadyBoard™ 620
The ReadyBoard 620 is for high volume embedded applications requiring fanless, low power operation. The product is
used for advanced networking and has all the PC-compatible
component subsystems with PC-style connectors. It features
a 500MHz AMD Geode™ LX 800 processor, up to 1GB DDR333
SODIMM, PC/104-Plus expansion and Dual Ethernet.
with 500MHz Geode LX 800 CPU, 1GB DDR333, PC/104Plus (ISA and PCI) interface, USB 2.0
V ReadySystem Fanless: Complete rugged PC with
choice of ReadyBoard product and up to 1GB
SODIMM, 160GB HDD and pre-installed Ampro
Embedded Linux ® or Windows® XP
V Operating Systems: Windows® XP, XPe, CE, Ampro
ReadySystem™ Fanless
The Ampro ReadySystem Fanless embedded computer
is an ideal system for environments that contain excessive dust and dirt. Featuring your choice of an Ampro
ReadyBoard single board computer with Pentium®,
Celeron®, or Geode™ LX processors, the ReadySystem
Fanless contains all electronics in a compact housing for
embedded fanless applications requiring limited space.
FEATURES & BENEFITS
V Scalability from 500MHz to 1.66GHz
V Easy migration due to standardized PC-Style
connector block
www.eecatalog.com/military
Embedded Linux ®, QNX® and VxWorks®
AVAILABILITY
Visit www.ampro.com for more information or call
408-360-0200.
CONTACT INFORMATION
Ampro Computers, Inc.
5215 Hellyer Avenue Suite 110
San Jose, California 95138-1007
USA
+1 408-360-0200 Telephone
+1 408-360-0222 Fax
info@ampro.com
www.ampro.com
Application Solutions • 41
DIGITAL-LOGIC AG
Stackable PCI 104 Express
V PCI Express is a point-to-point connection with a
Compatible Operating Systems: Windows CE, Windows XP
Embedded, Linux, QNX
V PCI/104 Express sets the technical standard in the
2.5 GHz data rate.
long term, since currently nothing compairable is
in the development stage.
V PCI/104 Express has the bandwidth to support highspeed applications such as 1-and 10-Gbit Ethernet.
V Options: on board Compact Flash, Cable Kit,
Power Supply, etc.
To complete small form factor systems, several PCI/104
Express peripheral cards are available from DIGITAL-LOGIC.
One 1-Gbit Ethernet LAN card (MSMGE104EX), one ExpressCard adapter (MSMEC104EX), one fourfold frame grabber with
4XBT878 up to 16 channels (MSMG104EX), one MXM adapter
with high-performance graphic ATi-X2400 (MSMX104EX)
and one power-supply module (MSMPS104A/B). The line
of PCI/104 Express cards will be expanded in the future to
include a SATA card, a fourfold LAN card and more.
APPLICATION AREAS
The PCI/104Express, with powerful Intel® Core Duo or
Core2 Duo CPUs is a low power consumption solution
for high video performance, for applications in the field
of video processing, video streaming, biometric data
processing, high speed OCR applications
DIGITAL-LOGIC is also the first company worldwide to
feature industrial motherboards with PCI/104 Express
extension. These include the MSEP945P (a single-board
computer in EPIC format) and the MSEBX945P, a highperformance EBX-embedded computer.
CONTACT INFORMATION
DIGITAL-LOGIC AG
Nordstrasse 11/F
CH-4542 Luterbach,
+41 (0)32 681 58 00 Telephone
+41 (0)32 681 58 01 Fax
sales@digitallogic.com
www.digitallogic.com
TECHNICAL SPECS
V PCI/104 Express:a future-oriented standard which
will, over the next 10 to 20 years, allow the design of
computer modules with PC/104 form factor and the
use of this serial bus standard.
Creating Powerful, Low-Cost Applications
Don’t Miss These Power-Packed Events!
MicroTCA and AdvancedTCA Summits provide up-to-date information on the new standard platforms
for telecommunications equipment, mobile systems, military and defense systems, medical equipment,
and much more. Learn how these standards deliver turn-key solutions while reducing costs and
development time. Join industry experts, vendors and users. For information visit online.
E U R O P E
Q
May 28-30, 2008
Westfields Marriott
Chantillty, VA
MicroTCAsummit.com
42 • Application Solutions
Q
Q
Q
Q
September 23-24, 2008
October 21-23, 2008
Disney New York, New York
Santa Clara Convention Center
Paris, France
Santa Clara, CA
CONTACT INFORMATION
euroATCAsummit.com
AdvancedTCAsummit.com
Military & Aerospace Technologies Resource Catalog 2009
CPU or Single Board Computers
CPU or Single Board Computers
Supported Architectures: X86
Emerson Network Power
CPCI7200 Multicore
CompactPCI SBC
Compatible Operating Systems: VxWorks, Linux
The Emerson Network Power CPCI7200 single-board
computer (SBC) uses the Intel® Core™2 Duo processor
and E7520 + 6300ESB chipset. The single-slot configuration is ideal for thermally constrained environments and
includes dual GbE interfaces and dual channel 3.2GBps
high speed, double data rate DDR2, for a combined maximum bandwidth of 6.4GBps.
The CPCI7200 is a low-power, high-performance SBC that
offers full hot swap compliance per PICMG® 2.1 and supports the PICMG 2.9 System Management and PICMG 2.16
CompactPCI® Packet Switching Backplane open specifications. In addition to the PICMG 2.16 variants, the CPCI7200
offers other value-added features including the PLX6466
PCI-to-PCI Bridge (PPB) for universal CompactPCI systemor peripheral-slot functionality.
In addition, the CPCI7200 board supports the Intelligent
Platform Management Interface (IPMI) specification for
full board remote system and platform management
as well as Baseboard Management Controller (BMC)
and peripheral mode. Overall, with the value-added
PLX6466 and GbE/PICMG 2.16 features, the CPCI7200
board is a superior choice for telecom applications like
softswitches, control plane media-transport nodes,
wireless gateways, and control plane CompactPCI and
PICMG 2.16 systems as well as industrial automation,
aerospace, medical imaging, railway control, and onboard flight information systems.
FEATURES & BENEFITS
TECHNICAL SPECS
V 1.06 or 1.5 GHz Intel Core2 Duo processor and
V
V
V
V
Intel ® E7520 + 6300ESB dual channel 3.2 GBps
memory controller
533 or 667 MHz frontside bus
2GB ECC-protected DDR2-400
PLX6466 PCI-to-PCI bridge technology
Dual PMC sites or single with SATA HD
CPU or Single Board Computers
CPU or Single Board Computers
Supported Architectures: CompactPCI
AVAILABILITY
Early access units available now. General availability
September 2008.
APPLICATION AREAS
Telecom, industrial automation, aerospace, medical
imaging, railway control, on-board flight information
systems, etc.
V Dual core processor enables higher platform perfor-
mance at same or lower power levels
V Dual channel memory for server class data throughput
V Dual on-board GbE, USB and COM interfaces for
flexible and advanced I/O performance
V AMP and SMP OS support provides ability to run
multiple OS, legacy code or multiple workloads
V Low power thermally constrained environments
CONTACT INFORMATION
Emerson Network Power
2900 S. Diablo Way, Suite 190
Tempe, AZ 85282
USA
1 800 759 1107 Toll Free
1 602 438 5720 Telephone
EmbeddedComputingSales@
emerson.com
EmersonNetworkPower.com/
EmbeddedComputing
www.eecatalog.com/military
Application Solutions • 43
Emerson Network Power
MVME7100 Multicore VMEbus Board
Compatible Operating Systems: Linux, LynxOS, VxWorks
The MVME7100, Emerson Network Power’s highest performance VMEbus single-board computer (SBC), features a dual
core PowerPC® processor and 2eSST high speed VMEbus
interface. The MVME7100 is designed to enable industrial, medical, and defense/aerospace original equipment
manufacturers (OEMs) to add performance and features for
competitive advantage while providing backwards compatibility to protect their investment in VMEbus technologies.
Customers can keep their VMEbus infrastructure (chassis,
backplanes, and other VMEbus and PMC boards) while
improving performance and extending the lifecycle.
Incorporating the most beneficial and proven features of
Emerson’s embedded controllers and SBCs, the MVME7100
gives OEMs the flexibility to support varying I/O requirements with the same base platform, simplifying part number
maintenance, technical expertise requirements, and sparing.
It also provides optimal speed, which is achieved due to
the independence of the PCI busses for each PMC site. In
addition, the board’s non-volatile memory feature prevents
system memory loss in the event of a power loss.
The MVME7100 SBC is based on the system-on-chip
Freescale MPC8641D with dual PowerPC e600 processor
cores, high capacity DDR2 memory, up to 8GB of NAND
flash, PCI-X, USB, and 2eSST. The MVME7100 series
features dual integrated memory controllers, DMA
engine, PCI Express interface, Gigabit Ethernet, and
local I/O. Cost–effective peripherals can be integrated
easily using USB interfaces.
FEATURES & BENEFITS
TECHNICAL SPECS
V System-on-chip Freescale MPC8641D with dual Pow-
erPC® e600 processor cores, dual integrated memory
controllers, DMA engine, PCI Express interface,
Ethernet, and local I/O
V Four Gigabit Ethernet ports
V Up to 2GB of DDR2 ECC memory, 128MB NOR flash
and 4 or 8GB NAND flash
V Board support packages for VxWorks, LynxOS,
and Linux
AVAILABILITY
Early access now. General availability September 2008
APPLICATION AREAS
Communications/networking, industrial automation,
medical imaging, military/aerospace, transportation
V USB 2.0 controller for integrating cost-effective
peripherals
V 2eSST VMEbus protocol offering interoper-
ability with products such as the MVME6100 and
MVME3100 at higher bandwidths
V Dual 33/66/100MHz PMC-X sites for expansion
via industry standard modules with support for
processor PMCs
V 8x PCI Express expansion connector for PMC-X and
XMC expansion using Emerson XMCspan
V MVME721A direct-connect rear transition module (RTM)
for I/O routing through rear of compact VMEbus chassis
44 • Application Solutions
CONTACT INFORMATION
Emerson Network Power
2900 S. Diablo Way, Suite 190
Tempe, AZ 85282
USA
1 800 759 1107 Toll Free
+1 602 438 5720 Telephone
EmbeddedComputingSales@
emerson.com
EmersonNetworkPower.com/
EmbeddedComputing
Military & Aerospace Technologies Resource Catalog 2009
CPU or Single Board Computers
CPU or Single Board Computers
Supported Architectures: VMEbus, VME64, VME32
Quantum3D, Inc.
Sentiris 4110 PMC/XMC
Compatible Operating Systems: Windows 2000, Windows XP,
Windows XP Embedded
Sentiris 4110 delivers the extended or MIL-Spec environmental
capabilities to meet today’s demanding requirements for realtime visualization. It is ideal for ASSB Avionics digital map and
situational awareness for helicopter pilots; Titan’s head-down
display for high-speed, fully-amphibious assault hovercraft
navigation; L-3’s Landing Signal Officer (LSO) workstation for
aircraft recovery on U.S. Navy aircraft carriers; and both the
airborne radar units and ground control stations for General
Atomics’ Predator unmanned aerial vehicle.
TECHNICAL SPECS
V IEEE P1381.1 Compliant PCI Mezzanine Card with
either Convective or Conductive Cooling.
V PCI Bus Support – 32-bit PCI, 33 MHz and 66 MHz Capable
Sentiris 4110 delivers unmatched performance—with
fill-rate-intensive applications exhibiting up to 130%
greater performance, and anti-aliased line-intensive
applications exhibiting up to 630% greater performance,
than competing solutions.
Sentiris 4110 provides industry-leading image quality, which
is crucial for situational awareness and streaming video.
Compatible with legacy vehicle displays and flat panels,
Sentiris is also ready for next-generation displays. Furthermore, Sentiris was designed with features that enable new
lab capabilities to be rapidly migrated to the field.
FEATURES & BENEFITS
| Both 3.3V and 5V PCI Signal Compatible | NVIDIA
Quadro4 Embedded GPU | 128-bit Wide Interface to 64MB
DDR SDRAM Frame Buffer with 220 MHz Operation.
V Up to 5.4M Independent Trilinear Textured Triangles/
Sec | Acceleration for Enhanced AA Point, Line and
Polygon Performance | Up to 4.8M Independent,
Z-buffered, Lit Anti-Aliased Lines/Sec.
V Environmental Compatibility – FCC Part 15 Level A
and CE on All Models | Mil-Std-461E on Sentiris PMC
4110 CD13 | Mil-Std-810F on Sentiris PMC 4110 CD13.
V Software and Platform Support – Microsoft ®
Windows2000™, WindowsXP ®, and WindowsXP
Embedded with OpenGL® 1.4 and DirectX 9.0 on
Intel® IA32™ Platforms | WindRiver ® VxWorks™ |
RedHat ® Linux® V7.3.
CPU or Single Board Computers
CPU or Single Board Computers
When performance matters, the Sentiris line of Mezzanine
cards is king. Whether for embedded training, synthetic
vision, avionics, or C41SR applications, Sentiris delivers
high graphics performance per watt of power. For realtime visualization in critical applications and with limited
power, no graphics subsystem delivers the 2D or 3D
graphics performance Sentiris does.
V Unmatched Image Quality – For 2D and 3D, Sentiris
V
V
V
V
leverages NVIDIA’s Quadro4 processor for industryleading image quality.
Flexibility – For integration apps with multiple
channel outputs, Sentiris supports implementation of
2-channel display systems per PMC.
Open Architecture Application Design – Compliant
with the IEEE 1386.1 PCI Mezzanine card standard,
Sentiris is compatible with embedded single-board
computers with either 33 MHz or 66 MHz PMC slots.
Designed for Mil-Spec – Using Q3D’s power management technology, Sentiris delivers high performance,
with heat dissipation and low power consumption.
Development Systems Available – For rapid development
and testing, a development system can jumpstart an
advanced embedded graphics development effort in
Windows-, Linux-, or RTOS-based environments.
www.eecatalog.com/military
APPLICATION AREAS
Video capture, signal processing, graphical computing
AVAILABILITY
United States, International
CONTACT INFORMATION
Quantum3D
6330 San Ignacio
San Jose, CA 95119
United States
408.361.9999 Telephone
408.361.9980 Fax
salesinfo@quantum3d.com
www.quantum3d.com
Application Solutions • 45
Tri-M Engineering
VSX104+ - 300MHz Fanless
PC/104plus CPU Module with Dual LAN
Compatible Operating Systems: Windows®CE, Linux, DOS, and
most popuar 32-bit RTOS.
The VSX104+ a new PC/104plus CPU module with dual
10/100 LAN complements Tri-M Engineering’s existing
PC/104 product line. The VSX104+ features a fanless
design with a complement of robust features such as
extended temperature operation and soldered DDR2 RAM
integrated in a small, low power package. The VSX104+
is RoHS compliant and conforms to the PC/104plus form
factor which allows users to easily add a wide-range of
low-cost I/O options.
The VSX104+’s 300MHz DM&P Vortex86SX Systemon-Chip (SoC) is a high performance and fully static
32-bit X86 processor designed to work with embedded
operating systems including Windows®CE, Linux, DOS,
and most popuar 32-bit RTOS. Standard features of the
VSX104+ include 128MB soldered on DDR2 RAM, four
COM ports, two USB2.0 ports and two 10/100 Ethernet
ports. An 8-bit GPIO port and redundancy port are also
standard features. In addition to 2MB onboard SPI flash
(floppy emulation), it also includes both a Type I CompactFlash™ socket as well as a microSD socket. System
expansion is supported by the PC/104plus interface.
CPU or Single Board Computers
CPU or Single Board Computers
Supported Architectures: PC/104, PC/104+
Immediate Shipping
APPLICATION AREAS
Ideal for industrial control, transportation, wireless and ruggedized routers, homeland security, remote monitoring.
The VSX104+ is a compact design measuring 3.55” x
3.775” x 0.9” and has an operating temperature of -40º
to +85ºC. Single +5VDC power is supplied through the
PC/104 bus or 2-position screw terminal and total power
consumption is a mere 2.5 Watts.
FEATURES & BENEFITS
V
V
V
V
V
Fanless operation
2.5 Watt power consumption
Type 1 CompactFlash™ and microSD sockets
Extended temperature operation
RoHS compliant
TECHNICAL SPECS
V 300MHz Vortex86SX SoC
V 128MB soldered DDR2 RAM
V Integrated dual 10/100 LAN, 4x RS232, 2x USB 2.0, 1x
LPT, keyboard, mouse
V 2MB onboard SPI Flash
V PC/104plus compliant
AVAILABILITY
46 • Application Solutions
CONTACT INFORMATION
Tri-M Engineering
1407 Kebet Way, Unit 100
Port Coquitlam, BC V3C 6L3
Canada
800-665-5600 Toll Free
604-945-9565 Telephone
604-945-9566 Fax
info@tri-m.com
www.tri-m.com
Military & Aerospace Technologies Resource Catalog 2009
Pentek
Model 7150: Quad 200 MHz,
16-bit A/D with Virtex-5
FPGAs - PMC/XMC module
Compatible Operating Systems: The 7150 is supported under
Linux, Windows and VxWorks with board support packages for
each OS. The BSPs include an OS driver as well as a full feature
ReadyFlow C language library to support all board functions and
provide sample applications for quick development startup.
The 7150 connects directly to the RF or IF inputs of a communications system, delivering the industry’s highest
resolution A/Ds and enhanced processing power in a
single PMC/XMC module. The 7150 is the first in the 715x
series, which, with sampling rates to 200 MHz and 16 bits
of resolution, fulfills the market demand for products with
both wider bandwidths and improved dynamic range.
The Pentek 7150 stands apart from competing products
on the market because its unique architecture combines
the faster and higher precision DSP slices in the two Xilinx
Virtex-5 FPGAs with four 200 MHz, 16-bit A/D converters
offering increased resolution and wider signal bandwidths.
This combination is ideal for anyone seeking to detect very
small signals across a wide range of frequencies.
The dual FPGA architecture of the 7150 simplifies task
assignments and boosts efficiency for each device. The
processing FPGA handles data flow and data routing,
controls all clock and synchronization functions, and
manages memory resources. It is at the center of all data
flow paths making it ideally positioned for performing
DSP and data processing. By assigning the board interfaces and the associated resources to a second FPGA,
the processing FPGA can be kept free to perform the
processing tasks it is designed for.
Data Acquisition
Data Acquisition
Supported Architectures: This board is a PMC/XMC module and
is also available in 3U and 6U cPCI and PCI form factors.
TECHNICAL SPECS
V Complete software radio interface solution
V VITA 42.0 XMC compatible with switched fabric
interfaces
V Up to 2.56 seconds of data capture at 200 MHz
V 32 pairs of LVDS connections to the Virtex-5 FPGAs
for custom I/O
V Up to 1.5 GB of DDR2 SDRAM
AVAILABILITY
Call Mario Schiavone at 201-818-5900 for price and
availability.
FEATURES & BENEFITS
APPLICATION AREAS
V 4X better resolution and 2x DRAM memory
Wideband radar and wideband communication systems.
V
V
V
V
resources than previous solutions
Multi-module synchronization capability
Variety of IP cores to match specific requirements
Built-in data capture modes
10-min online Product Techcast:
http://www.pentek.com/go/madir7150tc
CONTACT INFORMATION
Pentek
One Park Way
Upper Saddle River, NJ 08022
USA
201-818-5900 Telephone
201-818-5904 Fax
sales@pentek.com
http://www.pentek.com/go/madir7150tc
www.eecatalog.com/military
Application Solutions • 47
Carlo Gavazzi Computing Solutions
709
Supported Architectures: cPCI, VME, VXS, VPX
Enclosures are configured as a 19” rack mount system
capable of supporting a wide variety of industry bus
standards such as VME, VME64x, VXS, VXI, CompactPCI
and custom bussed backplane technologies. Available in
heights ranging from 8u to 14u, these systems are configurable for either a rigid mount or shock isolated card
cages. The 709 Series utilizes is an aluminum, welded
design incorporating EMI “honeycomb” filters and environmental gaskets on all access panels to meet stringent
emissions requirements. Power supply options provide
a wide range of inputs from AC single and three-phase
to DC and provide output power up to 2400 watts. The
internal rack infrastructure has been designed to meet
IEEE1101.10/.11. All systems can be designed to accommodate application specific I/O requirements. Rugged,
Reliable and Ready for deployment, Carlo Gavazzi Computing Solutions 709 Series of Enclosures.
Carlo Gavazzi Computing Solutions 709 Series Rugged
Rackmount Enclosures are engineered for dependability
in some of the most severe and extreme environments
involving airborne, shipboard and ground mobile
applications. Designed as a rugged solution to meet
a broad spectrum of Military Standards, the 709 has a
longstanding reputation as a commercial-off-the-shelf
(COTS) product that can be easily configured to meet the
most challenging deployed requirements.
Enclosures
Enclosures
709 SERIES
TECHNICAL SPECS
V
V
V
V
V
Temperature: Per MIL-STD-810F
Operating: 0∞C to 50∞C
Storage: -20∞C to 85∞
EMI and EMC per MIL-STD-461E
Altitude 10,000 feet
Humidity Less than 95% noncondensing
Shock: 20g for 11ms
APPLICATION AREAS
Vibration: Per MIL-STD-167-1
FEATURES & BENEFITS
V VME, VME64x, VXS (Vita 41.0), VXI, CompactPCI
compatible
V 8U to 14U height offerings
V .125” Aluminum welded construction and .187”
Aluminum front panel
V 350-1600 watt power supply options
V AC Input: 85-264VAC, 47-440Hz and DC Input: 18-
36VDC options
CONTACT INFORMATION
Carlo Gavazzi Computing Solutions
10 Mupac Drive
Brockton, MA 02301
USA
508.588.6110 Telephone
508.588.0498 Fax
pr@cg-cs.com
www.gavazzi-computing.com
48 • Application Solutions
Military & Aerospace Technologies Resource Catalog 2009
Carlo Gavazzi Computing Solutions
716 Series
Compatible Operating Systems:
Supported Architectures: VME, VME64x, VXS, VPX, VPX REDI
The 716 Series is available in standard ARINC sizes
that include 1/2 ATR Short to 1-1/2 ATR Long and any
custom form factor required. The 716 will accept all
bus structures and platforms from the stability and
solid performance of the VME, cPCI, VXS, VPX and VPX
REDI architectures, both in 3U and 6U form factors.
Enclosures
Enclosures
Carlo Gavazzi Computing Solutions 716 Series Conduction
Cooled ATR Enclosures offer a wide range of COTS solutions
from a rugged precision machined design. Engineered for
strength, light weight, and maximum cooling in a conduction
cooled environment, the 716 Series incorporates a unique
frame and configurable conducting walls that allow the ATR
to be tailored to meet a wide range of thermal requirements.
The 716 Series can be configured with an optional
avionics tray for isolation from shock and vibration
environments common to airborne, vehtronics and
shipboard applications.
FEATURES & BENEFITS
V Precision machined construction for Rugged
V
V
V
V
Deployments
Expansive range of ARINC sizes
Easily configurable for custom sizes
Modular power supply / AC or DC filtered inputs
System perfomance monitoring, Configurable I/O
panel
AVAILABILITY
NOW
CONTACT INFORMATION
Carlo Gavazzi Computing
Solutions
10 Mupac Drive
Brockton, MA 02301
USA
508.588.6110 Telephone
508.588.0498 Fax
pr@cg-cs.com
www.cg-cs.com
www.eecatalog.com/military
Application Solutions • 49
Elma Electronic
Liquid Cooled ATR and
Rackmount enclosures
The liquid cooled ATR chassis can fit up to ten 6U x 160mm
slots in a 1 ATR Short size. Designed to ARINC404A, the
chassis accepts conduction cooled modules in various
architectures. The independent dual liquid-cooled side
walls dissipate up to 150W per slot. With a proven highintegrity frame construction, the unit is highly ruggedized
and meets MIL-STD 810E, 461D and 704E. With a modular
design, the ATR can be designed in various configurations.
To reduce costs, the liquid cooling can be optionally limited
to one side wall. Various plug-in power supply modules and
front I/O configurations are possible in this design. Liquidcooled 19” rackmout enclosures are also available.
TECHNICAL SPECS
V Input Power Mil-Std 704E, DC 28V / 270V, 1 and 3
phase 115VAC 400Hz on request.
V In accordance with ARINC 404A. Tested to MIL-STD-
810E, 704E, 461, and 901D.
CONTACT INFORMATION
Elma Electronic
44350 Grimmer Blvd
Fremont, CA 94538
USA
510-656-3400 Telephone
sales@elma.com
www.elma.com
V Liquid cooled ATR or rackmount enclosure in VME,
CPCI, MicroTCA, VXS, VPX, and custom.
V Interchangeable liquid cooled sidewalls provide
superior cooling in simple and cost effective solution.
V 1 ATR size can accommodate up to 10 x 6U x 160mm
conduction cooled cards.
Elma Electronic
Ruggedized MicroTCA Chassis
Elma’s ruggedized MicroTCA solutions come in ATR and
19” rackmount versions. A modular design approach
allows great flexibility in sizes and configurations.
Elma performed verification testing on its ruggedized
ATR (testing on rackmount version coming soon). The
unit passed MIL-STD-810E for shock/vibration using
only front panel clamps and specialized rugged card
guides. Further protection can be incorporated with
isolators/dampers and shock absorbers. The chassis
also passed MIL-STD-461 for EMC. A full 35-page test
report is available upon request.
Versions will be available in forced air and conduction
cooled formats. Elma’s team is authoring key sections
of the MicroTCA.1 and MicroTCA.2 specifications for
Rugged MicroTCA. Contact Elma for more details.
TECHNICAL SPECS
V Ruggedized MicroTCA enclosures in ATR and 19”
rackmount styles.
50 • Application Solutions
V Modular design allows wide range of sizes and
configuration options.
V Testing verifies the unit passes MIL-STD-810E for
shock and vibration.
V Testing verifies the unit passes MIL-STD-461 for EMC.
V Structural integrity through milled front-and rear-panel
CONTACT INFORMATION
Elma Electronic
44350 Grimmer Blvd
Fremont, CA 94538
USA
510-656-3400 Telephone
sales@elma.com
www.elma.com
Military & Aerospace Technologies Resource Catalog 2009
Enclosures
Enclosures
Supported Architectures: CompactPCI, MicroTCA, VME/64x, VXS,
and VPX
Emerson Network Power
Centellis™ 500 MicroTCA Platform
Compatible Operating Systems: Wind River PNE 2.0
Engineered for dependable embedded applications, the
Centellis™ 500 is an innovative MicroTCA™ solution
that is suitable for use in enterprise applications. It has
been designed to be an economically viable solution by
utilizing an injection molded plastic enclosure with the
smallest number of internal components possible for
low-cost, high volume manufacture. The MicroTCA backplane, fans, power module, MicroTCA Carrier Hub (MCH),
and card cage are included and the system is supplied
fully tested to speed time to market.
TECHNICAL SPECS
V Best in class MicroTCA Carrier Hub
V Managed system supporting hot-swap of AMC modules
V Fully FCC part 15 Class A certified for enterprise
deployment
V Extensively tested system passing vigorous 48 hour
stress, power cycle and boot tests
Centellis 500 is a solidly constructed and engineered tabletop or shelf placement MicroTCA system. As a complete
system, the Centellis 500 ships with SpiderWare ®M3 Platform Management software designed for quick system
configuration and remote management through a set of
graphical tools. It is supplied complete with Emerson’s
MCH, and the PrAMC-7211, an Intel® Core™2 Duo based
processor AMC. The MCH is a high performance and
dependable solution that supports Gigabit Ethernet fabric
to all the AMC payload slots and also provides individual
status and power control to each AMC which allows hot
swap. In addition to the standard AMC hot-swap and outof-service LEDs, GbE link status LEDs are provided on
the front panel for ease of operation. The PrAMC-7211
AMC comes with 2GB of DRAM, 1GB of on-board flash
storage, and USB 2.0 connector on the front panel.
V Star topology backplane supporting signal rates
up to 3.215Gbps
Enclosures
Enclosures
Specification Compliance: PICMG® MicroTCA.0 R1.0, AMC.0 R2,
AMC.2, AMC.3
AVAILABILITY
September 2008
APPLICATION AREAS
Enterprise, VoIP gateways, packet processing, IP-PBX,
network POS, industrial automation, telemedicare,
healthcare office management, remote radiology, patient
monitoring, and access gateways
MicroTCA technology will be used in a wide range of
applications such as VoIP gateways, packet processing,
IP-PBX, network POS, industrial automation, telemedicare,
healthcare office management, remote radiology, patient
monitoring, and access gateways where reducing the capital cost of installing or extending next-generation network
elements are very important. The Centellis 500 is uniquely
suitable for a variety of enterprise deployment scenarios.
FEATURES & BENEFITS
V Low profile, lightweight, solidly constructed injection
V
V
V
V
molded plastic table-top, or shelf placement chassis
is easily transported
Three (3) available AMC mid-size expansion payload
slots for application customization
Dynamic cooling for low noise enterprise deployment
SpiderWare®M3 Platform Management software for
ease of use and low total cost of ownership
Highly robust AMC connectors stringently tested to
prevent AMC insertion failure
www.eecatalog.com/military
CONTACT INFORMATION
Emerson Network Power
2900 S. Diablo Way, Suite 190
Tempe, AZ 85282
USA
+1 602 438 5720 Telephone
+1 800 759 1107 Toll Free
EmbeddedComputingSales@
emerson.com
EmersonNetworkPower.com/
EmbeddedComputing
Application Solutions • 51
Emerson Network Power
Centellis™ 1000 MicroTCA Platform
Compatible Operating Systems: Wind River PNE/LE 1.4 or
MontaVista CGE Linux
The Centellis™ 1000 is a MicroTCA™ platform from
Emerson Network Power that is suitable for a wide range
of markets and application spaces. The MicroTCA standard is based on highly robust technology derived from
the AdvancedTCA® standard that is widely deployed in
telecommunications networks. MicroTCA products offer
low granularity and scalability with lots of off-the-shelf
AdvancedMC plug-in modules to enable users to easily
and quickly develop differentiating applications. The
Centellis 1000 platform is based on a 5U shelf which contains a cooling unit and one or two power modules.
TECHNICAL SPECS
V 5U, 11-slot MicroTCA system (483 mm x 178 mm x
In addition, there is a single MicroTCA Carrier Hub (MCH)
module that provides the system management and
switching functions for Gigabit Ethernet, and optionally PCI
Express, to all the AdvancedMC™ (AMC) modules. These
AMCs provide hot-swappable functionality for the system
and are available with a wide variety of functions and features for control processing, storage, packet processing,
DSP, I/O, etc. Within the Centellis 1000 shelf there is space
for 11 AMC modules with sufficient power and cooling to
allow users to mix and match modules as required.
By supporting Intel®, PowerPC® and other architecture
control processor modules, plus a variety of operating
systems, Emerson enables users to choose the most
suitable processor technology for their application. In
addition, through a strategic alliance, Emerson is able
to offer ruggedized packaging for MicroTCA equipment
to retain the benefit of using commercial off-the-shelf
(COTS) technologies.
FEATURES & BENEFITS
237 mm)
V Single 600 watt AC or dual -48V DC power entry modules
V Gigabit Ethernet backplane fabric with optional PCI
Express secondary fabric
V MicroTCA Carrier Hub (MCH) combines shelf man-
agement, clocking, and fabric switching in a single
module, maximizing payload capacity
V Designed for embedding in rugged environments
using suitable packaging which can be supplied by a
strategic alliance member
AVAILABILITY
Available now.
APPLICATION AREAS
Defense and aerospace applications that require rugged,
small footprint, low power, and high performance based
on COTS products such as WiMAX, software-defined
radio, command and control, mobile based systems.
V Highly integrated and well tested MicroTCA system to
reduce development costs and accelerate time-to-market
V Configurable with broad portfolio of AdvancedMCs
from Emerson and ecosystem members to suit
diverse application requirements for multiple markets
V Wind River and MontaVista operating system support for ease of application porting and development
V Dual core, high performance Intel and Freescale based
processor AMCs for excellent control processing
V A 5U rackmount platform developed for demanding
thermal requirements of current and next-generation AMC to ensure long-term platform scaling and
performance for advanced application
52 • Application Solutions
CONTACT INFORMATION
Emerson Network Power
2900 S. Diablo Way, Suite 190
Tempe, AZ 85282
USA
1 800 759 1107 Toll Free
+1 602 438 5720 Telephone
EmbeddedComputingSales@
emerson.com
EmersonNetworkPower.com/
EmbeddedComputing
Military & Aerospace Technologies Resource Catalog 2009
Enclosures
Enclosures
Supported Architectures: Single star Gigabit Ethernet and
optional PCI Express fabric
Kontron
Kontron MicroTCA
Integrated Platforms
With vast amounts of compute and communication power,
Kontron MicroTCA integrated platforms have more than
enough bandwidth for the most challenging applications.
FEATURES
APPLICATION AREAS
V Kontron offers a wide-range of integrated platform to
Military/Aerospace
V
V
V
V
speed up development and time-to-market
Kontron offers many different form-factors from 2
slot 1U platforms through 12 slot 8U platforms
For fully customized projects, Kontron offers each of
the unique MicroTCA building blocks
Kontron’s wide variety of AMCs provide a comprehensive
range of functionality for use in many application spaces
Kontron’s experienced engineering staff are available
through all stages of the design process
Enclosures
Enclosures
The systems supporting the next generation warfighter
demand an architecture high processing power connected to a high throughput IP-based network. MicoTCA
is uniquely targeted to meet these needs in a small form
factor that can be widely deployed.
CONTACT INFORMATION
Kontron
14118 Stowe Drive
Poway, CA 92064
USA
888.294.4558 Telephone
info@us.kontron.com
www.kontron.com
Creating Powerful, Low-Cost Applications
Don’t Miss These Power-Packed Events!
MicroTCA and AdvancedTCA Summits provide up-to-date information on the new standard platforms
for telecommunications equipment, mobile systems, military and defense systems, medical equipment,
and much more. Learn how these standards deliver turn-key solutions while reducing costs and
development time. Join industry experts, vendors and users. For information visit online.
E U R O P E
Q
May 28-30, 2008
Westfields Marriott
Chantillty, VA
MicroTCAsummit.com
www.eecatalog.com/military
Q
Q
Q
Q
September 23-24, 2008
October 21-23, 2008
Disney New York, New York
Santa Clara Convention Center
Paris, France
Santa Clara, CA
CONTACT INFORMATION
euroATCAsummit.com
AdvancedTCAsummit.com
Application Solutions • 53
Octagon Systems
CORE Systems™
Compatible Operating Systems: Linux, Embedded XP
Supported Architectures: X86
The XMB–S, RMB–S, and RMB–C1 are ideal for installation in police cars, buses, rail cars, taxis, trucks, mining
equipment, and other harsh industrial environments.
FEATURES & BENEFITS
APPLICATION AREAS
Military, Security, Transportation, Industrial
CONTACT INFORMATION
V Integrated thermal system optimized for fanless
V
V
V
V
Octagon Systems
7403 Church Ranch Blvd.
Westminster, CO 80021
USA
303-430-1500 Telephone
303-426-8126 Fax
sales@octagonsystems.com
www.octagonsystems.com
operation
Wireless friendly: GPS, GSM, GPRS, Wi-Fi, etc.
Software drivers included for Linux and Windows® XPe
Standard platform allows reuse of software from
project to project
Internal power supply immune to extreme transients
Octagon Systems
RMB-C1
Compatible Operating Systems: Linux, Embedded XP
Supported Architectures: X86
The RMB–C1 is designed for applications where severe
environment and high performance meet, requiring a
COTS–level solution. Long–term reliability is the core of
our COTS design philosophy. The RMB–C1 is one of our
CORE Systems™ products, whose tightly–integrated
design ultimately combines the electrical, thermal, and
mechanical components into a complete system with
no compromise to any one segment.
The RMB–C1 packages an advanced computer/server
system in an environmentally sealed enclosure. The
unique thermal design allows fanless operation over
the full temperature range with CPU speeds to 1.5
GHz. The RMB–C1 can be used as a central server, a
stand–alone CPU, or a remote control.
FEATURES & BENEFITS
V –40 °C to +85 °C, operating temperature, 1.5 GHz CPU
V Optional UPS module to protect data
54 • Application Solutions
V MIL–STD 810F available, Meets CE Class requirements
V PC/104 and Mini PCI expansion, Up to three (3) wire-
less devices supported
V 122 mm high x 170 mm wide x 340 mm deep
APPLICATION AREAS
Military, Security, Transportation, Industrial
CONTACT INFORMATION
Octagon Systems
7403 Church Ranch Blvd
Westminster, CO 80021
USA
303-430-1500 Telephone
303-426-8126 Fax
sales@octagonsystems.com
www.octagonsystems.com
Military & Aerospace Technologies Resource Catalog 2009
Enclosures
Enclosures
Octagon has leveraged its 27 years of experience to
develop a line of fully functional, powerful computing
systems where reliable operation in harsh environments
is the overriding requirement. These rugged, mobile
servers operate fanless even at extended temperatures.
The no–compromise design optimizes electrical, thermal,
and mechanical components for maximum reliability.
Connect Tech Inc.
FPGA Computing & Digital I/O
Supported Architectures: PC/104 and PCI-104
Connect Tech provides maximum performance reconfigurable FPGA computing modules to save users time
and money. Based on the Xilinx Virtex-5 and Spartan3E FPGAs, CTI’s FreeForm products provide a powerful,
versatile FPGA platform for design flexibility.
While CTI consistently expands our FPGA product offerings, the following FreeForm FPGA computing modules
ensure reliability for your critical applications. Please
visit our website for the latest model availability.
FPGAs
FPGAs
Combating the most demanding design issues will be
made easy with the rugged design and adaptability of
FreeForm. These user programmable, reconfigurable
FPGA boards are perfect for high speed, computeintensive, real-time applications.
FreeForm/PCI-104
V Reconfigurable in the field or through CTI’s
•
•
•
•
•
•
•
Virtex-5 FPGA – 3 million logic gates
8MB flash for embedded coding
128MB DDR2-400 memory
2 x10/100 Ethernet
2 x RS-485 serial interface
64 single ended or 32 LVDS I/O
Designed for embedded processing using
MicroBlaze™
FreeForm/104
• Spartan-3E FPGA – 500,000 gates
• On-board flash for run-time design changes
• Standard core includes:
• 96 digital I/0, 8255 compatible
• 6 counter/timers, 8254 compatible
• 48 Opto-22 compatible digital I/O
Use FreeForm products when time to market is of the
essence, field-reprogrammability is a must or where
speed and accuracy are critical.
All FreeForm products include comprehensive documentation for your development needs.
Should you
require it, CTI offers engineering services for support in
design or customization.
FEATURES & BENEFITS
V Xilinx Virtex-5 or Spartan-3E FPGAs
V Standard and custom cores available
V Includes free ISE webpack for complete FPGA design
www.eecatalog.com/military
engineering services
V Lifetime warranty and free technical support. RoHS
models available.
TECHNICAL SPECS
PC/104 and PCI-104 form factors
Up to 3 million logic gates
On-board Flash memory for run-time design changes
Industrial temperature range models available
(-40 °C to 85 °C)
V Provides an external 5V power connector
V
V
V
V
AVAILABILITY
Visit www.connecttech.com for a complete list of products.
RoHS compliant models available.
APPLICATION AREAS
FPGA, DSP, software-defined radio, avionics, autonomous
vehicles, lab testing and industrial process monitor/control.
CONTACT INFORMATION
Connect Tech Inc.
42 Arrow Road
Guelph, Ontario N1K 1S6
Canada
800-426-8979 Toll Free
519-836-1291 Telephone
519-836-4878 Fax
sales@connecttech.com
www.connecttech.com
Application Solutions • 55
Highland Technology, Inc.
V346 - Arbitrary
Waveform Generator
Channel-channel modulation, summing, synchronization, and noise generation allow complex coordinated
waveform generation within one module or across
multiple modules. Hundreds or thousands of channels
may be exactly synchronized through local electrical or
remote fiberoptic links. Any output may be switched to a
front-panel test connector, allowing in-crate calibration
check without removing field cables.
The signal-processing capability of the V346 is sufficiently general that a wide range of complex functions
can be easily programmed from the “first principles” of
signal/systems theory. This includes quadrature signal
generation, DSB/SSB of arbitrary waveforms, sweeps
and chirps, QAM/constellation generation, frequency
hopping, FSK generation, multichannel frequency
tracking, and quantitative control of noise and jitter.
One or more V346 modules may also be used to simulate
complex, high-channel-count processes, such as radar
and sonar arrays, complex rotating machinery and structural systems, diesel/jet engine simulation, stationary
and aircraft AC power systems, thyristor/IGBT phase
control, and many others.
Instrumentation
Instrumentation
The V346 provides eight independent digitally synthesized
waveform outputs, each programmable for frequency,
amplitude, and phase.
TECHNICAL SPECS
V 8 independent channels, 0 to 32 MHz with 0.015 Hz
V
V
V
resolution, or 0-250 KHz with 166 uHz resolution; 16bit programmable amplitude, DC offset, and phase.
14-bit DAC output resolution.
Two programmable ranges, +-5.12 volts and +-1.024
volts peak, 50-ohm output impedance.
Arb memory of 4096 points, 16-bit data per channel.
Hardware interpolation is available.
Gaussian noise, programmable amplitude 0-1 volts
RMS, programmable 3 dB bandwidth 0 to 2 MHz
Channels may be synchronized across up to 16
modules, 128 channels. Adjacent channel summing,
cascadable up to 8 channels.
The T346, a compact stand-alone, non-VME, RS-232/Ethernet controlled version of the V346, is also available for
embedded applications.
V
FEATURES & BENEFITS
AVAILABILITY
V Channel-channel modulation: AM, FM, PM, PWM,
Available Now
V
V
V
V
and channel summing.
Channel/board sync provisions allow generation
of polyphase or synchronized waveforms, across
unlimited channels.
Bandlimited Gaussian noise generation allows direct
noise output, modulation, noise floor summing, and
calibrated jitter.
PWM facility generates precision digital outputs for
motion control or optical encoder simulation.
Includes built-in self-test (BIST) and channel test
connector.
56 • Application Solutions
APPLICATION AREAS
Complex RF, Sonar Rotating Machinery and Electromechanical System Simulation; Vibration Testing and
Polyphase AC Waveform Generation
CONTACT INFORMATION
Highland Technology, Inc.
18 Otis Street
San Francisco, CA 94103
USA
415-551-1700 Telephone
415-551-5129 Fax
info@highlandtechnology.com
www.highlandtechnology.com
Military & Aerospace Technologies Resource Catalog 2009
Tyco Electronics
MULTIGIG RT Connector Products
for VITA 41 and VITA 46 Standards
Tyco Electronics is dedicated to supporting the requirements
of the military and aerospace industry with our product portfolio, including connectors, wire, fiber optic components,
harnessing products, relays, solenoids and identification
products. We are presently featuring the MULTIGIG RT 2
family of backplane connectors. Although we offer a variety
of Eurocard connectors for heritage VMEbus, the MULTIGIG
RT 2 family represents a major revolution in technology and is
utilized in the latest architectures, including both VITA 41 VXS
and VITA 46 VPX. The MULTIGIG RT 2 as specified in VITA
41, 46, 47 and 48 is the most rugged, high performance backplane connector in the industry. Please visit www.multigigrt.
com for a complete overview of this powerful product.
V Superior crosstalk performance and optimized foot-
prints for signal integrity and ease of board design
V 10 Gpbs performance; optic and RF modules in
development
APPLICATION AREAS
Military, Aerospace and Defense
CONTACT INFORMATION
FEATURES
Tyco Electronics
P.O. Box 3608
Harrisburg, PA 17105-3608
United States
1-800-522-6752 Toll Free
1-717-986-7777 Telephone
1-717-986-7575 Fax
product.info@tycoelectronics.com
www.multigigrt.com
V Provides density, data throughout and signal integrity
V Use of printed circuit wafers in this connector system
allows for cost effective sequencing
V Wafers can be manufactured specifically for
differential or single ended performance
Interconnects
A network dedicated
edicated to the
th
he
en
needs off
s designe
ners
rs and
engineers, developers,
designers
ers
engineering managers
Diamond Sponsor
Official Sponsor
Purchasing guides for the electronics industry
Multicore
Technologies
Annual Resource Catalog
Diamond Sponsor
Purchasing guides for the Electronics Industry
Purchasing guides for the electronics industry
S P E C I A L
Embedded Security
Technologies Resource Catalog 2008
Embedded Linux
Resource Catalog 2009
Resource Catalog 2008
O p tio nal
Ap p lication fram ew ork & PIM
VPN
IM
Bro w s er
T h ird Party
Sup p o rted
R in g to ne en gine
Vo ic e rec o gnition
M M S en g in e
Pred ic tive tex t en try
Vo IP
M ultim ed ia en gine
O TA
J VM
Prio rity
In h eritance
Pre-lin king
X11
M em o ry
Pro tec tion
AR M EABI
N PT L
g libc
uC libc
Po w er M g r
D atabas e
Ap p XIP
SSM
Sy s tem U tils
Sec urity
F ram ew o rk
O BEX
IPSec
W i-F i
T elep h ony
Serv er & T API
(T ap root)
Blueto o th
F ile s y s tem s
(N AN D /N O R )
C am era
Vid eo
F las h
Aud io
C am era
Po w er m g m t
Lo g g ing
Serial
IPv 6
F as t bo o t
R eal-tim e
U SB H o s t, G ad g et
T elep h ony
in terfac e
Kern el XIP
Sec urity
U SB O T G
SD IO
Optional Sub-Kernel
RTOS / L4
MINIMIZING THE EFFECTS OF
MANUFACTURING VARIATION
Hardware platform
Semiconductor Reference
June 2008
SYSTEMVERILOG MEETS EMULATION
Telephony
Stacks
Multimedia
Processing
Kernel features and drivers
D irec tF B
F ram e buffer
I S S U E
DRM
Middleware
OS-level features and services
G TK
W in dow M g r
T o uc h screen
D O U B L E
COLLABORATION MODELS
CODING PRACTICES IN A
LOW POWER WORLD
Application layer
D ata s y n c
MontaVista DevRocket IDE
Interconnects
Supported Architectures: VITA 41, VITA 46, VITA 48
Baseband
Processor
/ Modem
“IS THAT AN ELEPHANT IN YOUR FLOW?”
www.eecatalog.com/multicore
CONTACT INFORMATION
www.eecatalog.com/embeddedlinux
www.eecatalog.com/security
Platinum Sponsor
Platinum Sponsor
Gold Sponsors
Affiliate Sponsor
Gold Sponsors
www.chipdesignmag.com
Gold Sponsors
Catalog Diamond Sponsor:
Catalog Gold Sponsor:
Affiliate Sponsors:
www.eecatalog.com
www.eecatalog.com/military
Application Solutions • 57
Connect Tech Inc.
Rugged, Solid State
Storage FlashDrive/104
Compatible Operating Systems: Driverless operation. Suitable
for any operating system.
Supported Architectures: Suitable for any platform.
This solid state drive was engineered with components
capable of enduring harsh conditions and high density
flash memory chips to provide immense storage capabilities for reduced latency and rapid data transfer.
Programs/files are stored without the disruptions that can
be caused by extreme temperatures, shock or vibration.
FlashDrive/104 also features an on-board flash controller
that provides bad block management, error code correction and an embedded flash file system to protect and
retain data files and programs. Easily access the flash
using industry standard ATA or IDE interfaces.
Mass Storage
Mass Storage
FlashDrive/104 is a flash based, solid state storage solution
for rugged applications. Designed with the latest NAND
technology and no moving parts, FlashDrive/104 offers a
robust, reliable replacement for magnetic hard drives that
can be prone to corruption and mechanical failures.
TECHNICAL SPECS
FlashDrive/104 fits any PC/104 or PC/104-Plus stack and
is suitable for stand alone usage. It can be used with any
platform and offers driverless operation so that it may
be utilized with any operating system.
V Suitable for PC/104 and PC/104-Plus stacks or stand
Protect your data from damage or corruption that can
occur on traditional hard drives with FlashDrive/104.
V 10Mbps read/write speeds
V Industrial temperature range model options (-40°C
alone usage
V 4, 8, 16 or 32GB storage
V Industry standard ATA/IDE interfaces with standard
and 2.5” hard drive connectors
to 85°C)
Hard Disk Interface
• Industry standard ATA/IDE interfaces
• Read/write performance up to 10Mbps
• Supports up to PIO (programmed input/output)
• Mode-4
• Supports up to multi-word DMA Mode-2
• Standard master/slave selection
Flash Storage
• 4, 8, 16 or 32GB storage
• Global write protect
• On-board Flash controller
FEATURES & BENEFITS
V Flash based solid state storage, using the latest
NAND technology (No mechanical failures!)
V Withstands extreme temperatures, shock and vibration
V Driverless operation – suitable for any operating system
V Lifetime warranty and free technical support. RoHS
models available.
58 • Application Solutions
AVAILABILITY
Visit www.connecttech.com for a complete list of products. RoHS compliant models available.
APPLICATION AREAS
Ideal for military/industrial storage applications requiring
high tolerance to extreme temperatures, shock or vibration.
CONTACT INFORMATION
Connect Tech Inc.
42 Arrow Road
Guelph, Ontario N1K 1S6
Canada
800-426-8979 Toll Free
519-836-1291 Telephone
519-836-4878 Fax
sales@connecttech.com
www.connecttech.com
Military & Aerospace Technologies Resource Catalog 2009
VMETRO
Vortex Data Recorder
Compatible Operating Systems: VxWorks, Linux, Windows XP
The Vortex family of real-time data recorder, playback
and analysis systems offer sustained recording at rates
up to 800 MB/s. These high-speed recorders achieve
the performance rating in both commercial and ruggedized environments utilizing Fibre Channel storage area
network media in JBOD or RAID configurations from
cost effective commercial to rugged and solid-state
storage. Available as targeted recorders or open custom
recorders, the Vortex family easily integrates into any
VXS (VITA-41), VME, CompactPCI or PC based system.
Vortex Data Recorders are a family of hardware and
software products that focus on the task of high-speed
streaming, data recording, playback, and analysis. Vortex
is the most powerful, flexible, scalable, yet easy-to-use
recording capability available today. Complementing
these very capable engines are extensive open recorder
software libraries that utilize a common code base across
all hardware and OS’s providing fully maintained and
consistent API’s, capability, and compatibility across all
VORTEX recorder, SAN and workstation connectivity
products. The recorders are ideally suited for application in digital signal analysis environments such as
Intelligence, Surveillance and Reconnaissance (ISR) applications including Electronic Intelligence (ELINT), COMINT,
SIGINT, Synthetic Aperture Radar (SAR), Moving Target
Indicators (MTI), Software Defined Radio (SDR) as well as
medical scanners and industrial inspection systems.
TECHNICAL SPECS
V Dual PMC/XMC sites for User I/O
V PowerPC Processors with local DDR-SDRAM
Mass Storage
Mass Storage
Supported Architectures: VME, VXS, CompactPCI and Industrial PC
memory for high speed data movement
V Single to Quad 2Gbit or 4Gbit Fibre Channel
V For use in deployed or commercial environments
AVAILABILITY
Now
APPLICATION AREAS
Digital signal analysis environments, medical scanners,
industrial inspection systems
FEATURES & BENEFITS
V 90% complete recording system - JUST ADD I/O
V Up to 800MB/s sustained performance per 6U
VME/VXS/cPCI card slot
V Pre-programmed web-browser GUI for all recorder
functions - JUST ADD I/O
V Fully compatible with Fibre Channel Storage Area
Network options for scaleability in storage capacity
V Fully compatible with SAN Access Kit for workstation
connectivity
CONTACT INFORMATION
VMETRO
1880 S Dairy Ashford, Suite 400
Houston, TX 77077
USA
+1 281-584-0728 Telephone
+1 281-584-9034 Fax
info@vmetro.com
www.vmetro.com/recorders
www.eecatalog.com/military
Application Solutions • 59
Kontron
AM4010 / AM4100
The Kontron AM4010 and Kontron AM4100 modules are
powerful multi-core processor AMCs for use in both
AdvancedTCA and MicroTCA applications.
The AM4010 is a highly integrated CPU board implemented as a Single Mid-size or Full-size AdvancedMC.
The design is based on the Intel® Core™ Duo and the
Intel® Core™2 Duo processors combined with the Intel®
3100 server-class chipset.
Kontron AM4010
Kontron AM4100
V 4010: Single width, full-size or mid-size
V 4100: Freescale dual-core MPC8641D PowerPC,
V 4100: 0.5/1/2 GByte soldered SDRAM memory
APPLICATION AREAS
Military/Aerospace
CONTACT INFORMATION
Kontron
14118 Stowe Drive
Poway, CA 92064
USA
888.294.4558 Telephone
info@us.kontron.com
www.kontron.com
FEATURES
V 4010: Intel® Core™ Duo or Intel® Core™2 Duo, scalable
up to 1.66 GHz
V 4010: Up to 2 GByte SDRAM memory (soldered) with
ECC running at 400 MHz
To keep up-to-date with products and technology,
sign up for a FREE subscription to Extension Media’s
Resource Catalogs for the electronics industry.
2008 Issues include:
•
•
•
•
•
•
•
•
•
•
8-bit
Advanced TCA® Platform
Chip Design
Consumer Electronics
DSP
Embedded Intel® Solutions
Embedded Linux
IBM Software Development Platform
Medical
MIPS®
• PC/104 & PC/104-Plus
• PCI Technology
• Power Architecture
• PCI Express
• USB
• VMEbus
• Wind River
INFORMATION
•CONTACT
Windows
Embedded
• Wireless Technologies
And you can also register to win $500 by providing feedback on this catalog.
GO TO www.extensionmedia.com/win TODAY!
60 • Application Solutions
Military & Aerospace Technologies Resource Catalog 2009
Mezzanine Modules
Mezzanine Modules
1.0/1.33/1.5 GHz
The AM4100 is a sophisticated AdvancedMC module
designed for performance demanding applications such
as protocol processing or data management systems.
Built around the state-of-the-art Freescale dual-core PowerPC MPC8641D, the board addresses the ever-increasing
need of equipment manufacturer for cost-effective and
modular processing capabilities.
Connect Tech Inc.
Blue Heat/Net Ethernet-toSerial Networking Solutions
Compatible Operating Systems: Windows 2000/XP/XP x64/
Server 2003/Vista/QNX 4, QNX 6, Linux
Supported Architectures: Ethernet
Blue Heat/Net includes auto-sensing 10Base-T, 100BaseTX LAN interface and can achieve data speeds up to
460.8Kbps. Each port is independently configurable with
data bits of 5, 6, 7 or 8; stop bits of 1, 1.5 or 2, with or
without parity and is available with 2, 4, 8 or 16 ports of
RS-232/422/485 connectivity.
Based on the uClinux embedded operating system, Blue
Heat/Net provides a familiar Linux API for programmers. A full range of open source development tools are
included through a free software development kit.
Use Blue Heat/Net for your applications where harsh
conditions exist. Available with PoE, industrial temperature ranges, synchronous communication options and
industrial protocols; Modbus, Allen Bradley/Rockwell,
DNP3 and BACnet or create customized protocols and
download them directly to the on-board Flash memory.
Blue Heat/Net is one of the most flexible Ethernet-to-serial
products on the market and offers superior performance
and reliability to ensure that your critical data communications remain error free. Network enable your serial
devices with Connect Tech’s Blue Heat/Net.
Networking
Networking
Blue Heat/Net allows you to add virtual serial ports wherever you need them, allowing you to access, configure
and control equipment remotely from any workstation
connected to your Ethernet LAN or the Internet. This Ethernet-to-serial solution is designed with a ColdFire CPU
and is capable of running application-specific protocols.
TECHNICAL SPECS
V Available with 2, 4, 8 or 16 RS-232/422/485 serial ports
V Data transfer rates between 50bps and 460.8Kbps
V Auto-sensing 10Base-T, 100Base-TX LAN Ethernet
interface
V 5V DC to 30V DC power or PoE available
V Lifetime warranty and free technical support. RoHS
compliant models available.
AVAILABILITY
Visit www.connecttech.com for a complete list of products.
RoHS compliant models available.
APPLICATION AREAS
FEATURES & BENEFITS
V Performance: built around a ColdFire CPU featuring
Military, aerospace, industrial automation, POS, gaming,
medical systems, transportation systems, etc.
16MB SDRAM and 4MB Flash
V Programmable: built on uClinux operating system,
enabling the development of customized software.
Free software development kit.
V Multiple modes and protocols available
V Commercial and industrial temperature range
(-40°C to 85°C) models
V Surge suppression, PoE, industrial protocols and
synchronous communications options
www.eecatalog.com/military
CONTACT INFORMATION
Connect Tech Inc.
42 Arrow Road
Guelph, Ontario N1K 1S6
Canada
800-426-8979 Toll Free
519-836-1291 Telephone
519-836-4878 Fax
sales@connecttech.com
www.connecttech.com
Application Solutions • 61
MOXA Americas, Inc.
IA240/241 Series
Compatible Operating Systems: Embedded Linux
The IA240/241’s vertical DIN-rail form factor makes it
easy to install the computers in a small cabinet. This
space-saving solution also facilitates easy wiring,
making the IA240/241 a great choice as front-end
embedded controllers for industrial applications. The
IA240-T and IA241-T can operate reliably in an operating
temperature range of _40ºC to 75ºC, making them appropriate for harsh industrial automation environments.
FEATURES & BENEFITS
V MOXA ART 32-bit ARM9 industrial processor; 64 MB
RAM, 16 MB flash onboard
V 4 RS-232/422/485 serial ports; 4-ch digital input and
4-ch digital output (TTL signal); Dual 10/100 Mbps
Ethernet for network redundancy
V PCMCIA slot for wireless expansion (802.11b/g,
GPRS/UMTS/HSDPA); SD socket for storage expansion; Ready-to-run Linux Kernel 2.6 platform; Unique
patented Software Encryption Lock
V Installation options: DIN-rail, wall-mount (with accessory);
Robust, fanless design, IP30 protection mechanism
TECHNICAL SPECS
V System Specifications:
CPU: MOXA ART ARM9 32-bit RISC CPU, 192 MHz;
OS pre-installed): Embedded Linux
DRAM: 64 MB onboard (128 MB for IA241 ODM);
Flash: 16 MB onboard (32 MB for IA241 ODM)
PCMCIA: Cardbus card and 16-bit PCMCIA 2.1/JEIDA 4.2
card (IA241 only)
Storage Expansion: SD socket; USB: USB 2.0 host;
DI/DO: DI x 4, DO x 4, TTL (3.3 v)
V LAN Interface
Ethernet: 10/100 Mbps x 2, RJ45 connectors
Magnetic Isolation Protection: 1.5 KV built-in
V Serial Interface
Number of Ports: 4
Serial Standards: RS-232/422/485, software-selectable
Connectors: 8-pin RJ45
ESD Protection: 15 KV for all signals
Console Port: RS-232, RJ45 connector, supports PPP
62 • Application Solutions
Serial Communication Parameters
Data Bits: 5, 6, 7, 8
Stop Bits: 1, 1.5, 2
Parity: None, Even, Odd, Space, Mark
Flow Control: RTS/CTS, XON/XOFF, ADDC™ (automatic
data direction control) for RS-485
Baudrate: 50 bps to 921.6 Kbps (supports non-standard
baudrates; see user’s manual for details)
V LEDs
System: Power x 1, Ready x 1
LAN: 10M/Link x 2, 100M/Link x 2 (on connector)
Serial: TxD x 4, RxD x 4 (on connector)
Physical Characteristics
Housing: Aluminum (1 mm)
Weight: IA240: 430 g; IA241: 500 g
Dimensions: 60 x 137 x 100 mm (2.36 x 5.39 x 3.94 in)
Mounting: DIN-Rail, wall
Environmental Limits
Operating Temperature: Standard Models: -10°C to
60°C (14°C to 140°F); Wide Temp. Models: -40°C to
75°C (-40°C to 167°F)
Operating Humidity: 5 to 95% RH
Storage Temperature: Standard Models: -20°C to
80°C (-4 to 176°F); Wide Temp. Models: -40°C to 85°C
(-40°C to 185°F)
Alert Tools: Built-in buzzer and RTC (real-time clock)
Automatic Reboot Trigger: Built-in WDT (watchdog timer)
Warranty Period: 5 years
Details: See www.moxa.com/warranty
AVAILABILITY
Now
APPLICATION AREAS
Industrial Automation
CONTACT INFORMATION
MOXA Americas, Inc.
3001 Enterprise Street Suite 210
Brea, CA 92821
USA
888-MOXA-USA Toll Free
714-528-6777 Telephone
714-528-6778 Fax
usa@moxa.com
www.moxa.com
Military & Aerospace Technologies Resource Catalog 2009
Networking
Networking
The IA240/241 embedded computers are designed for
industrial automation applications. The computers feature 4 RS-232/422/485 serial ports, dual LANs, 4 digital
input channels, 4 digital output channels, and a PCMCIA
cardbus and SD socket in a compact, IP30 protected,
industrial-strength rugged case.
MOXA Americas, Inc.
IA261-I/262-I Series
Compatible Operating Systems: Windows Embedded, Linux
Embedded
The IA261/262 computers use the Cirrus Logic EP9315 ARM9,
32-bit, 200 MHz RISC CPU. This powerful computing engine
supports several useful communication functions, but will
not generate too much heat. The built-in 32 MB NOR Flash
ROM and 128 MB SDRAM give you enough memory to run
your application software directly on the IA261/262.
With its built-in VGA output interface, the IA261/262 is
suitable for use with SCADA systems in industrial applications, such as manufacturing automation, production
line process monitoring, and mining automation, that
require VGA and HMI features.
The IA261/262 computers support RS-232/422/485,
CANbus, digital I/O, come with 2 KV isolation protection,
and have dual LAN ports, making them ideal as communication platforms for industrial applications that require
network redundancy. In addition to the standard models,
wide temperature (-40 to 75°C) models are available for
use in harsh industrial automation environments.
The IA261/262 computers come with Windows CE 6.0
pre-installed, and support general Windows and .NET
2.0 computing environments. This means that programs
developed for standard PC operating systems with tools
such Embedded Visual C++ or Visual Studio 2005 can
run on the IA261/262 without much porting effort.
TECHNICAL SPECS
V Computer
• CPU: Cirrus EP9315 ARM9 CPU, 200 MHz
• OS (pre-installed): Windows CE 6.0
• DRAM: 128 MB onboard (optional 256 MB)
• Flash: 32 MB onboard
• Storage Expansion: CompactFlash socket
• USB: USB hosts x 2, compliant with USB 2.0 (OHCI)
type A connectors
V Serial Interface
• Number of Ports: IA261: 4 and IA262: 2
• Serial Standards: RS-232/422/485, software-selectable
• Connectors: DB9 male
• ESD Protection: 15 KV for all signalsn
• Optical Isolation Protection: 2500 Vrms
• Console/Debugging Port: RS-232 (TxD, RxD, GND),
4-pin header output (115200, n, 8, 1)
V LEDs
• System: Power x 1, Ready x 1, Storage x 1
• LAN: 10M/Link x 2, 100M/Link x 2 (on connector)
• Serial: TxD x 4, RxD x 4
• IA261: P1 to P4 for serial ports
• IA262: P1 to P2 for serial ports, P3 to P4 for CAN ports
V Physical Characteristics
•Housing: Aluminum, industrial vertical form factor
•Weight: 950 g
•Dimensions: 60 x 115 x 152 mm (2.36 x 4.53 x 5.98 in)
•Mounting: DIN-Rail, wall
•5 year Warrenty
Networking
Networking
The IA261/262 embedded computers come with 2 (IA262)
or 4 (IA261) RS-232/422/485 serial ports, dual CANbus ports
(IA262 only), dual Ethernet ports, 8 digital input channels,
8 digital output channels, VGA output, 2 USB hosts, and a
CompactFlash socket. The computers are housed in a compact, IP40 protected, industrial-strength aluminum case.
AVAILABILITY
NOW
FEATURES & BENEFITS
APPLICATION AREAS
V Cirrus Logic EP9315 ARM9 CPU, 200 MHz; 128 MB
RAM on-board, 32 MB flash disk
V VGA interface for field site monitoring; 2 KV digitally
Harsh industrial automation environments, factory automation, mining, and product line management
isolated RS-232/422/485 serial ports
V Dual 10/100 Mbps Ethernet for network redundancy;
Dual 2 KV digitally isolated CAN ports with CANopen
protocol support
V 8+8 DI/DO with 3 KV optical isolation protection; 12
to 48 VDC redundant power input design
V Supports CompactFlash and USB 2.0 hosts; Readyto-run WinCE 6.0 platform; -40°C to 75°C wide
temperature models available
www.eecatalog.com/military
CONTACT INFORMATION
MOXA Americas, Inc.
3001 Enterprise Street Suite 210
Brea, Ca 92821
USA
888-MOXA USA Toll Free
714-528-6777 Telephone
714-528-6778 Fax
usa@moxa.com
www.moxa.com
Application Solutions • 63
MOXA Americas, Inc.
V460 Series: V462,
V464, V466, V468
Compatible Operating Systems: Windows Embedded
Specific models include the V462, V464, V466, and V468.
Multiple data connection options
Additional Features Include:
• 8 switch ports, and 8+8 DI/DO channels (5 to 30V),
enabling integrators to control more remote devices with
fewer controllers and develop applications at a lower cost.
• Four USB hosts, and CompactFlash and PCMCIA sockets
are included, providing ample room for storage expansion.
Wide temperature models for harsh environments
In addition to the standard models, the V460 computers
are available in wide temperature models that are rated
for operation in temperatures between -40 and 75°C. This
makes the V460 computers especially well-suited for use
in harsh industrial automation environments.
Lower power consumption
A fanless, robust hardware design allows V460 computers to consume less power and generate less heat,
resulting in higher MTBF values, and ensuring that your
industrial applications are more cost-effective.
Ready-to-run platform
Every embedded computer offered by Moxa comes with the
operating system pre-installed, and includes middleware
and sample code. Programmers will enjoy the user-friendly
application development environment and benefit by
spending less time and effort for system integration.
FEATURES & BENEFITS
V
V
V
V
V
Ready-to-run platform for easy programming
Wide temperature (-40°C to 75°C) for harsh environments
Fan-less design and a 5-year warranty
2 RS-232 serial ports and 2 RS-232/422/485 serial ports
256 KB battery backup SRAM and low power
consumption
64 • Application Solutions
TECHNICAL SPECS
V CPU: AMD Geode LX 800@0.9W processor 128K L2
Cache, 500 MHz
V BIOS: 4 mega-bit Flash BIOS, supporting Plug & Play,
APM 1.2, ACPI 1.0
V System Memory: 200-pin SO-DIMM socket with
built-in 256 MB DDR (for CE models) or 512 MB DDR
(for XPE models), supporting DDR400 up to 1 GB
V SRAM: 256 KB, battery backup
V 4 USB 2.0 Hosts support system boot up
AVAILABILITY
V462-CE: x86 embedded computer with 4 serial ports, dual
LANs, VGA, CompactFlash, PCMCIA, USB V462-XPE: x86
embedded computer with 4 serial ports, dual LANs, VGA,
CompactFlash, PCMCIA, USB V464-CE: x86 embedded
computer with 4 serial ports, quad LANs, VGA, CompactFlash, USB V464-XPE: x86 embedded computer with 4
serial ports, quad LANs, VGA, CompactFlash, USB V466CE: x86 embedded computer with 4 serial ports, quad
LANs, 8-port Ethernet switch, VGA, CompactFlash, USB
V466-XPE: x86 embedded computer with 4 serial ports,
quad LANs, 8-port Ethernet switch, VGA, CompactFlash,
USB V468-CE: x86 embedded computer with 4 serial
ports, quad LANs, VGA, 8 DI, 8 DO, CompactFlash, USB
V468-XPE: x86 embedded computer with 4 serial ports,
quad LANs, VGA, 8 DI, 8 DO, CompactFlash, USB
APPLICATION AREAS
Harsh industrial automation environments, and mining
CONTACT INFORMATION
MOXA Americas, Inc.
3001 Enterprise Street Suite 210
Brea, CA 92821
USA
888-MOXA-USA Toll Free
714-528-6777 Telephone
714-528-6778 Fax
usa@moxa.com
www.moxa.com/usa
Military & Aerospace Technologies Resource Catalog 2009
Networking
Networking
Each model in the V460 Series features a rich selection of
connection interfaces, including 4 serial ports, multiple
Ethernet ports. Since support for VGA output is built in,
the V460 computers can be used for industrial automation applications that require an HMI or display.
Tri-M Engineering
HE104+DX - 108W PC/
104plus Power Module
Compatible Operating Systems: DOS, MSDOS, DRDOS, LINUX,
VxWorks, most RTOS and Windows
Supported Architectures: PC/104, PC/104+
The HE104+DX is a state-of-the-art Mosfet based design
that provides outstanding line and load regulation with
efficiencies up to 90 percent. Organic Semiconductor
Capacitors provide filtering that reduces ripple noises
below 20mV. The low noise design makes the HE104+DX
ideal for use aboard aircraft or military applications or
wherever EMI or RFI must be minimized. The +5VDC and
+12VDC outputs are controlled by a constant frequency
architecture regulator that provides excellent line and
load transient response.
The HE104+DX has an optocoupled on/off input (SD)
to control the outputs of the HE104+DX. To enable the
HE104+DX outputs, a 6 to 40V signal must be connected
to the SD input. If remote control is not required, the
SD input can be connected to the main power input.
The common for the remote 6 to 40V signal must be
connected to the HE104+DX common. If the SD input is
connected directly to the main input power connector,
the common for the SD input is already done.
Power Supplies
Power Supplies
The HE104+DX is designed for low noise embedded computer systems, has a wide input range of 6-40V (&gt;6:1)
and is ideal for battery or unregulated input applications.
The HE104+DX is specifically designed for vehicular
applications and has heavy-duty transient suppressors
(9000W on both main and secondary inputs) that clamp
the input voltage to safe levels, while maintaining normal
power supply operation.
AVAILABILITY
Immediate shipping
APPLICATION AREAS
Industrial, military, aerospace, transportation, mining,
oil and gas
FEATURES & BENEFITS
V
V
V
V
V
High efficiency up to 90%
High transient suppression
Low output ripple
Remote on/off standard
Removable connector blocks
TECHNICAL SPECS
V
V
V
V
V
108 Watt DC-DC converter
+3.3V, +5V, +12V and -12V DC output
6V to 40V DC input range
Extended temperature: -40ºC to +85ºC
PC/104plus compliant
www.eecatalog.com/military
CONTACT INFORMATION
Tri-M Engineering
1407 Kebet Way, Unit 100
Port Coquitlam, BC V3C 6L3
Canada
800-665-5600 Toll Free
604-945-9565 Telephone
604-945-9566 Fax
info@tri-m.com
www.tri-m.com
Application Solutions • 65
Tri-M Engineering
HESC104 - 60W DC-DC Power
Module with Smart Charging
Compatible Operating Systems: DOS, MSDOS, DRDOS, LINUX,
VxWorks, most RTOS and Windows
The HESC104 is a 60W DC-DC converter that includes
a flash based microcontroller and 4 amp charger for
advanced power management and smart battery
charging. Combined with a Tri-M standard battery pack
or super cap module, the HESC104 can be used as an
Uninterruptible Power Source (UPS) for a PC/104 system.
The HESC104 is designed for low noise embedded computer systems, has a wide input range of 6-40V (&gt;6:1)
and is ideal for battery or unregulated input applications. The HESC104 is specifically designed for vehicular
applications and has heavy-duty transient suppressors
(5000W) that clamp the input voltage to safe levels, while
maintaining normal power supply operation. The +/-5V
DC and +/-12V DC outputs are controlled by a constant
off-time current-mode architecture regulator that provides excellent line and load transient response.
Power Supplies
Power Supplies
Supported Architectures: PC/104
AVAILABILITY
The HESC104 provides up to four stages of battery
charging and can charge SLA, NiCd, and NiMh batteries
and level two and three SMBus compatible batteries.
Charge currents are up to 4A, and battery charging
voltages from 9.5 to 19.5V. The HESC104 has advanced
power management functions that allows timed on/off
control of the HESC104, notification of changes to main
power and changes in the battery status. For example,
the HESC104 can be programmed to power off the main
outputs in 60 seconds and then turn them on again 12
hours later. In addition to smart charging and power
management the HESC104 can monitor up to 16 different
temperatures using digital I²C digital temp sensors. The
HESC104 is available as RoHS, is PC/104 compliant and
-40ºC to +85ºC is standard.
Immediate shipping
APPLICATION AREAS
Industrial, military, aerospace, transportation, security,
mining, oil and gas
FEATURES & BENEFITS
V
V
V
V
V
High efficiency up to 95%
High transient suppression
Reverse polarity input protection
Monitor up to 16 different temperatures
Low output ripple
CONTACT INFORMATION
TECHNICAL SPECS
6V to 40V DC input range
+5V, +12V, -5V and -12V DC output
4A charger at 9.5V to 19.5V
Multistage charging SLA, NiCd, NiMh, SMBus level
three
V Extended temperature: -40ºC to +85ºC
V
V
V
V
66 • Application Solutions
Tri-M Engineering
1407 Kebet Way, Unit 100
Port Coquitlam, BC V3C 6L3
Canada
800-665-5600 Toll Free
604-945-9565 Telephone
604-945-9566 Fax
info@tri-m.com
www.tri-m.com
Military & Aerospace Technologies Resource Catalog 2009
Carlo Gavazzi Computing Solutions
714
Supported Architectures: cPCI, VME, VXS, VPX
The 714 Series is the Convection Cooled line of ATR’s.
Designed to direct air over conventional air cooled cards,
the cooling can be configured to best meet the application requirements whether pressurized, evacuation or a
combination push - pull method. When challenged with
non-pressurized environments, the 714 Series is configured with a high altitude cooling scheme to permit
ultimate performance at altitudes up to 50,000 feet.
When used in conjunction with Carlo Gavazzi’s “System
Performance Monitoring” technology, the 714 Series
ATR can be configured to activate internal heaters in
cold start-ups or performance control the outputs of the
cooling fans to maintain optimal thermal environments
for the circuit card assemblies.
FEATURES & BENEFITS
V Aircraft Frame Construction for lightweight deployment
V Configurable I/O Panel
V Expansive range of ARINC sizes and easily configu-
rable for custom sizes
V Modular power supply and AC or DC filtered inputs
V System Performance Monitoring and Multiple Bus
Architectures
Ruggedized
Ruggedized
The 714 Series is available in standard ARINC sizes that
include 1.4 ATR Short to 11/2 ATR Long and any custom
form factor desired due to the flexibility of the modular
frame. The 714 Series will accept a variety of bus structures and platforms including VME, VME64x, VXS, VXI
and CPCI technologies, providing an expansive product
offering of bus standards as well as application specific
custom designs.
The 714 Series utilizes an exclusive adjustable card cage
to strategically position the cards for either front panel
card or backplane I/O. This feature combined with the
modular rugged frame provides flexibility that to date
has not been available in the ATR format. Innovation
through design. Consult a Carlo Gavazzi representative
for more information about the 714 Series ATR’s
CONTACT INFORMATION
Carlo Gavazzi Computing Solutions
10 Mupac Drive
Brockton, MA 02301
USA
508.588.6110 Telephone
pr@cg-cs.com
www.gavazzi-computing.com
www.eecatalog.com/military
Application Solutions • 67
DIGITAL-LOGIC AG
MICROSPACE® -PCX47
V VGA, DVI, LVDS, Audio, Video-in, LAN, COM1, COM2,
4x USB, 2x firewire, 8 Digital input, 8 Digital output, 8
Analogue Input
V Exchangeable mediapack, 40GB automotive HDD,
1x CF Typell
V Options: GSM, GPS, WLAN, CAN, etc.
Compatible Operating Systems: Windows CE, Windows XP
Embedded, Linux
The MPCX47 is based on the i855GME chip set and
uses the 1.4GHz Intel® Pentium® M 738 processor with
2’045K L2cache, which shows a performance comparable with a 2.8GHz Intel® Pentium®4 processor. The
main memory is 512MB DDR RAM (optional 1GB). The
MPCX47 provides interfaces such as two PS/2 ports
for keyboard and mouse, and interfaces for printer,
COM1 and COM2. In addition, there are stereo line
in/outputs as well as microphone and headphone
connectors. As mass storage a 2.5”-hard disk with a
storage capacity of 20GB and a DVD/CD-RW drive are
used. The LAN connection is carried out via 100/10Base-T (RJ45) or WLAN 802.11b/g. In addition, the
MPCX47 is equipped with a PC/104-Plus extension
socket and a CompactFlash type II slot.
APPLICATION AREAS
The MPCX47 computer is supplied by a voltage of 10VDC
to 30VDC and can therefore be used in battery powered
systems. Because of its light weight of 3.2kg, compact
dimensions and high functionality, the MPCX47 is the
ideal solution for applications in vehicle
Ruggedized
Ruggedized
Supported Architectures: X86
CONTACT INFORMATION
DIGITAL-LOGIC AG
Nordstrasse 11/F
CH-4542 Luterbach,
+41 (0)32 681 58 00 Telephone
+41 (0)32 681 58 01 Fax
sales@digitallogic.com
www.digitallogic.com
TECHNICAL SPECS
V Smallest dimensions, fanless, high reliability, rugged
design, IP52 or IP65 protection
V Intel® Pentium® M 738,1.4GHz
A network dedicated
edicated to the
th
he
en
needs off
s designe
ners
rs and
engineers, developers,
designers
ers
engineering managers
Diamond Sponsor
Official Sponsor
Purchasing guides for the electronics industry
Multicore
Technologies
Annual Resource Catalog
Diamond Sponsor
Purchasing guides for the Electronics Industry
Purchasing guides for the electronics industry
S P E C I A L
Embedded Security
Technologies Resource Catalog 2008
Embedded Linux
Resource Catalog 2009
Resource Catalog 2008
O p tio nal
Ap p lication fram ew ork & PIM
VPN
IM
Bro w s er
T h ird Party
Sup p o rted
MontaVista DevRocket IDE
R in g to ne en gine
Vo ic e rec o gnition
M M S en g in e
Pred ic tive tex t en try
Vo IP
M ultim ed ia en gine
O TA
J VM
Prio rity
In h eritance
Pre-lin king
X11
M em o ry
Pro tec tion
AR M EABI
N PT L
g libc
uC libc
Po w er M g r
D atabas e
Ap p XIP
SSM
Sy s tem U tils
Sec urity
F ram ew o rk
O BEX
IPSec
W i-F i
T elep h ony
Serv er & T API
(T ap root)
Blueto o th
SYSTEMVERILOG MEETS EMULATION
Telephony
Stacks
Multimedia
Processing
Kernel features and drivers
F ile s y s tem s
(N AN D /N O R )
C am era
Vid eo
F las h
Aud io
C am era
Po w er m g m t
Lo g g ing
Serial
IPv 6
F as t bo o t
R eal-tim e
U SB H o s t, G ad g et
T elep h ony
in terfac e
Kern el XIP
Sec urity
U SB O T G
SD IO
Optional Sub-Kernel
RTOS / L4
MINIMIZING THE EFFECTS OF
MANUFACTURING VARIATION
Hardware platform
Semiconductor Reference
June 2008
DRM
Middleware
OS-level features and services
G TK
D irec tF B
F ram e buffer
I S S U E
CODING PRACTICES IN A
LOW POWER WORLD
Application layer
D ata s y n c
W in dow M g r
T o uc h screen
D O U B L E
COLLABORATION MODELS
Baseband
Processor
/ Modem
“IS THAT AN ELEPHANT IN YOUR FLOW?”
www.eecatalog.com/multicore
CONTACT INFORMATION
www.eecatalog.com/security
Platinum Sponsor
Platinum Sponsor
Gold Sponsors
Affiliate Sponsor
Gold Sponsors
www.eecatalog.com/embeddedlinux
www.chipdesignmag.com
Gold Sponsors
Catalog Diamond Sponsor:
Catalog Gold Sponsor:
Affiliate Sponsors:
www.eecatalog.com
68 • Application Solutions
Military & Aerospace Technologies Resource Catalog 2009
Elma Electronic
ELMA Conduction Cooled ATRs
Compatible Operating Systems: VME, VME64x, cPCI, cPCI
Express, MicroTCA, VXS, and VPX
The conduction cooled ATR was optimized for low weight,
ideal for Avionics applications where weight is a critical
issue. Designed for 3U cards, the chassis has backplane
options in cPCI, cPCI Express, VME, or VPX or customized
versions. Versions for 6U cards are also available. The
chassis also features a MIL 38999 type power connector
with an integrated line filter. The power supply and line
filter combination are optimized to meet MIL-STD 461E.
The rugged aluminum construction is designed to meet
MIL-STD 810F for shock and vibration.
Ruggedized
Ruggedized
Elma’s conduction cooled ATR platforms provide the
highest level of environmental protection with exceptional thermal performance. The heat load is transferred
via wedge locks from the boards to the machined platform
walls with the integrated card guides. The ATRs accept all
3U and 6U boards complying with IEEE 1101.2. The cooling
concept of all conduction cooled ATRs is optimized by
thermal analysis. The chassis parts are made from special
grade aluminum and joined by a dip-brazing process to
ensure the best conductivity of heat load.
TECHNICAL SPECS
V Backplane options for VME/64X, cPCI, cPCI Express,
MicroTCA, VXS, VPX and custom
Elma offers a full line of convection cooled ATR enclosures offer a standardized, cost effective solution for
VME, VME64x, cPCI, cPCI Express, MicroTCA, VXS, and
VPX based applications. Liquid cooled ATRs are also
available. Available in 1/2, 3/4, 1 and 1 1/2 ATR tall long
formats per ARINC 404A specifications, the modular
design concept allows for customization options without
the cost and lead time penalties associated with traditional construction techniques.
V Operating temperature range of -40˚C to +70˚C
V Power supply and line filter combination are opti-
mized to meet MIL-STD 461E
V Air-cooled versions also available
V Liquid-cooled versions also available
Elma now offers Rugged MicroTCA ATR and 19” rackmount enclosures. With a modular design, various
configurations of AMCs, MCH’s, Power Modules, and JTag Switch modules can be incorporated. Fully tested to
MIL-STD-810E for shock and vibration.
FEATURES & BENEFITS
V Meets ARINC 404A, ARINC600 and IEEE 1101.2
V
V
V
V
specifications
Features a MIL 38999 type power connector with an
integrated line filter
Low weight, ideal for applications where the
weight is critical
Rugged aluminum dip-brazed construction is designed
to meet MIL-STD 810F for shock and vibration
Optimized for cooling via thermal simulation studies
www.eecatalog.com/military
CONTACT INFORMATION
Elma Electronic
44350 Grimmer Blvd.
Fremont, CA 94538
USA
510.656.3400 Telephone
sales@elma.com
www.elma.com
Application Solutions • 69
Hybricon Corporation
Ruggedized Enclosure’s
As an ISO 9001 registered company, Hybricon is dedicated
to ensuring the highest level of quality- a necessity for products that must be able to function anywhere, anytime.
Hybricon is the industry leader in backplane design,
offering the newest technologies for VPX, VXS, VME64X,
CompactPCI, MicroTCA and custom bus structures.
FEATURES & BENEFITS
V
V
19.62”D With front to rear air flow.
• Shock Mounted Micro TCA Card Cage for rugged
environments
• MIL-STD-461 EMI Containment; fully EMI gasketed
• Top load MicroTCA/AMC Cards
• MicroTCA Card Cage supports a front 150MM section and rear 75MM section, with air flowing through
the two series front to back
• Designed to cool 80W per double width full height
slot and 40W per single width full height slot at
10,000 feet altitude
2U Rugged Enclosure:
• 2U Rugged Enclosure
• 19” Rackmount
• 6U Horizontal card cage
• 4 Slot VME64X Backplane
• Front to Rear Air Flow
• 291 Watt Power Supply
• System Monitoring
• Air Filtering
Version 1: Air Filtering
Version 2: Air Filtering/EMI Honeycomb
• Top Access Panel with Captive Hardware
• Rear I/O Panel
• Provisions to mount rugged slides
Rugged PC-104 Enclosure:
• Mixed force convection/conduction cooled chassis.
Utilizing air to air heat exchanger to make sure the
external and internal air paths are kept separate to avoid
condensation forming on the Printed Circuit Cards (PCC).
• The primary input power to the chassis is 28 Volts DC
in accordance with MIL-STD-704F. Avionics Packaging
• Light Weight, Compact Size (Holds up to 8 PC-104
Modules)
• Complex System Monitoring; Thermal Monitor controls
heaters and fans. Front panel removable and configurable
• Operates at: -40 deg C to +50 deg C. Operates at:
45k ft altitude.
70 • Application Solutions
Ruggedized
Ruggedized
V Rugged MicroTCA ATR:
• Full ATR Tall Long chassis 10.5”W x 10.625”H x
V Rugged 8U 19” VME Rackmount Enclosure:
• VME 20 slot backplane
• 220 VAC Power input
• 3 Drive Bays
• 1+1 Redundant 1.9 KW Power Supplies
• Temperature Range - Operating: -5 to 50.0°C (at
10,000 feet)
• Humidity (non-condensing) – Operating: 0 to 95%
• Shock - Operating/Non-Operating: 30G @ 40 ms
• Vibration - Operating: 0.90 grms – 10-2000Hz
AVAILABILITY
To speak to a representative please visit us at www.
hybricon.com or call us at 1 877 HYBRICON.
CONTACT INFORMATION
Hybricon Corporation
12 Willow Road
Ayer, MA 01432
USA
877 HYBRICON Toll Free
9787725422 Telephone
9787722963 Fax
info@hybricon.com
www.hybricon.com
Military & Aerospace Technologies Resource Catalog 2009
Kontron
CP6001 / CP6923
In today’s demanding world, designers need smart solutions. The Kontron CP6001 and CP6923 were designed
with exactly that in mind. The CP6001 is a rugged Intel®
Core™2 Duo CPU and is a perfect fit with the CP6923
PICMG 2.16 rugged Ethernet switch board. Both boards
are available in three rugged levels: R1-Standard,
R2-Rugged Air-Cooled, R3-Conduction-Cooled. (R3-Conduction-Cooled versions shown here)
Kontron CP6001-R3
Kontron CP6923-R3
V CP6923: 24x GbE ports
V CP6923: Leading edge technology based on
V CP6923: Copper, optical, rear I/O verson – Hot Swap,
IPMI – Comprehensive firmware package
APPLICATION AREAS
Ruggedized
Ruggedized
BCM5650X chip
With up to 8Gbyte of USB or 2 GByte soldered flash,
the CP6001 enables construction of a highly shock and
vibration resistant system with non-rotating, non-volatile memory. The CP6923 supports all relevant standards
on carrier grade L2 and L3 switching and routing.
Military/Aerospace
Together, these 6U CompactPCI boards provide a costeffective solution for rugged, high performance systems.
CONTACT INFORMATION
Kontron
14118 Stowe Drive
Poway, CA 92064
USA
888.294.4558 Telephone
info@us.kontron.com
www.kontron.com
FEATURES
V CP6001: Up to 8GB of USB or 2 GB soldered flash
V CP6001: Based on the Mobile Intel® 945GM chipset
with a front side busy of up to 667 MHz and ICH7-R
Southbridge
To keep up-to-date with products and technology,
sign up for a FREE subscription to Extension Media’s
Resource Catalogs for the electronics industry.
2008 Issues include:
•
•
•
•
•
•
•
•
•
•
8-bit
Advanced TCA® Platform
Chip Design
Consumer Electronics
DSP
Embedded Intel® Solutions
Embedded Linux
IBM Software Development Platform
Medical
MIPS®
• PC/104 & PC/104-Plus
• PCI Technology
• Power Architecture
• PCI Express
• USB
• VMEbus
• Wind River
INFORMATION
•CONTACT
Windows
Embedded
• Wireless Technologies
And you can also register to win $500 by providing feedback on this catalog.
GO TO www.extensionmedia.com/win TODAY!
www.eecatalog.com/military
Application Solutions • 71
Quantum3D, Inc.
Thermite 3 Tactical Visual Computer
Compatible Operating Systems: Microsoft Windows XP Embedded
The Thermite 3 series has been specifically designed to
accommodate necessary modifications, allowing optimized computing performance for specific requirements
and minimizing obsolescence issues. The system’s highly
modular design allows for tailoring of the CPU, graphics,
video processing, networking, I/O, and storage. And, of
course, just like every Thermite Tactical Visual Computer,
Thermite 3 brings the power of PC workstations to the
battlefield—for deployment on tanks, humvees, Bradley
Fighting Vehicles, aircraft, maritime, or other vehicles. It
is perfect for field-based training, situational awareness,
sensor processing/display, mission planning, mission
rehearsal, weapon system control, maintenance, and
other augmented reality simulations.
When a ruggedized computing solution is needed,
nothing comes even close to a Thermite. Thermite 3 is
the most powerful in the line, but there are other Thermite Tactical Visual Computers that are perfectly suited
for man-wearable 2D/3D graphics as well.
FEATURES & BENEFITS
Ruggedized
Ruggedized
Mobile and embedded computers take abuse. Tackling
battlefield conditions requires ultra-high-performance
computing power and ruggedness. The Thermite 3.0
series of Tactical Visual Computers is the newest in the
Thermite line—delivering state-of-the-art embedded
computing, mobile graphics, extended environment
packaging, and conduction cooling.
V Connectors - VGA + TV video out | Eidetix PCIe video
capture | IEEE 802.3 10/100/1000 Ethernet | Two USB
2.0 | 2 RS-232C, 1 RS-422 Async, 1 RS-422 Synch
(DLC) | Stereo audio input and HD audio output.
V Graphics Processor - Intel® Integrated or NVIDIA®
G73GLM | 256 MB DDR2 DRAM PCIe x16 interface.
V Power/Performance - 10 – 36 VDC (per MIL-STD-704F,
STANAG1008, and MIL-STD-1275) | Advanced powersaving technologies | Optional 100-240 VAC, 50-60 Hz
AC-DC power adapter.
V Dimensions - 233 mm x 160 mm x 81.5 mm (D x W x
H) (with fixed internal drive), 3.5 kg | 244 mm x 160
mm x 81.5 mm (D x W x H) (with removable drive
bay), 4 kg | 1.29 kg typical, including connectors.
V Modularity – Q3D’s Thermite 3 provides unique
V
V
V
V
flexibility for tailoring CPU, graphics, video
processing, networking, I/O, and storage.
Video Capture – Quantum3D’s Eidetix advanced
PCIe-based video capture and processing options for
real-time video capture.
Performance & Graphics – Intel® Core 2 Duo LV and
other CPU options, with up to 4 GB system memory;
Intel® Integrated NVIDIA® or AMD/ATI® GPUs with
dual graphics and video outputs.
Power Efficiency – T3’s dynamic power control
minimizes consumption and thermal dissipation.
Media Drives – Comes with removable or integrated,
solid-state or shock-resistant rotating media drives.
TECHNICAL SPECS
V CPU & Memory - Intel Core 2 Duo 1.6 GHz | Intel 965GME
“Santa Rosa” MCH, ICH8-M south bridge | Up to 4MB L2
Cache | 1, 2, or 4 GB dual-channel DDR2 DRAM.
72 • Application Solutions
AVAILABILITY
United States, International
APPLICATION AREAS
Embedded Computing
CONTACT INFORMATION
Quantum3D, Inc.
6330 San Ignacio
San Jose, CA 95119
United States
408.361.9999 Telephone
408.361.9980 Fax
salesinfo@quantum3d.com
www.quantum3d.com
Military & Aerospace Technologies Resource Catalog 2009
Curtiss-Wright Controls Embedded Computing
The Curtiss-Wright Controls Advanced Multi-Computing
division builds high-performance digital signal processing (DSP) computing solutions tailored to the needs
of the most demanding defense applications such as
radar, sonar, signal intelligence and image processing.
Our DSP products are designed for harsh environment
applications and backed by industry leading customer
support and lifecycle management to meet the programmatic needs of defense customers. Curtiss-Wright’s DSP
products are ideal for high-performance real-time data
processing applications that demand multiple processors, FPGA compute engines, fabric interconnect and
software to develop and debug complex systems.
• High-performance serial FPDP PMC modules for
sensor interfaces
• High-speed A/D PMC modules for digital radio,
signal intelligence applications
• High performance inter-processor communication
(IPC) libraries
• Signal Processing Libraries optimized for PowerPC
Altivec
• Multi-processor Power Architecture™ (PowerPC boards)
• Xilinx Virtex™ family FPGA-based reconfigurable
compute engines
• VME, VPX (VITA 46/48), PMC, and XMC form factors
• Serial RapidIO and StarFabric high-speed switched
serial interconnect
DIGITAL SIGNAL PROCESSING
Product
Form
Factor
Processor(s)
Memory
Flash
(Max)
NVRAM
Mezzanine
Sites
Ethernet
Ruggedization
OS
EIA-232
ports
EIA-422/
485 PORTS
Discrete
I/o
Other
Features
CHAMPAV6
6U
VPXREDI
Quad 8641/
8641D 1 GHz
4 GB DDR2
(ECC)
256 MB
128 KB
1x XMC
(PCIe)
4x GbE via
switch
AC 0, 100
CC 100, 200
VxWorks
4
2
16-bits
SRIO fabric,
PCIe I/O port
CHAMPAV IV
6U
VME
Quad 7447/ 7448
1 GHz/ 1.25 GHz
2 GB DDR
(ECC)
256 MB
128 KB
2x 164-bit/
100 MHz
4x GbE via
switch
AC 0, 100
CC 100, 200
Linux
Gedae
VxWorks
4
-
8-bits
On-board
Gigabit
Ethernet
Switch
CHAMPFX2
6U
VPXREDI
Two Xilinx
Virtex-5 FPGAs,
LX110T/LX220T/
LX330T. One
8641D
(Note 1)
512 MB
128 KB
1x XMC
(PCIe)
10/100/
1000 Mbps
AC 0, 100
CC 100, 200
VxWorks
2
2
16-bits of
LVTTL, 18
pairs of
LVDS from
each FPGA
SRIO Fabric
(four x4 ports
offboard),
one or two
x4 RocketIO
ports to the
backplane
MANTA
QX3
6U
VME
Quad 7457
733Mhz/1 GHz
2 GB DDR
64 MB
(NOR)
1 GB
(NAND)
128 KB
1x 64-bit/
66 MHz
2x 10/100/
1000 Mbps
AC 0, 50
INTEGRITY
Linux
VxWorks
4
2
12-bits
2 x StarFabric
Links, 2x
FireWire
XMC-442
XMC
Virtex-5 SX50T/
SX95T
256 MB DDR2
SDRAM,
18 MB QDR2
SRAM
-
-
-
-
AC 0, 100
CC 100, 200
VxWorks
-
-
(Note 2)
FPGA design
kit, Camera
Link option
PMC-440
PMC
Virtex-II Pro
VP20/VP40
256 MB
SDRAM
-
-
-
-
AC 0, 100
CC 100, 200
VxWorks
-
-
78 LVTTL
or 39 LVDS,
8 RocketIO
FPGA
design kit
Signal Processing
Signal Processing
Digital Signal Processing
notes
1. 512 MB DDR2 SDRAM, 36 MB
QDR2 SRAM per FPGA, 1 GB
DDR2 SDRAM for the PowerPC.
2. 80-bits (40-pairs) front panel,
48-bits (24-pairs) rear panel.
CONTACT INFORMATION
Curtiss- Wright Controls
Embedded Computing
741-G Miller Dr., SE
Leesburg, VA 20175
703-779-7800 Telephone
703-779-7805 Fax
info@cwcembedded.com
www.cwcembedded.com
www.eecatalog.com/military
Application Solutions • 73
VMETRO
HPE720 Digital Signal
Processor Board
Compatible Operating Systems: VxWorks and Linux
Input/output is provided through a number of channels
including gigabit Ethernet ports, FMC/XMC/PMC for a
wide choice of I/O options, RS232 ports or VPX serial I/O
for interboard communications. The HPE720 provides
flexible front panel I/O with support for either two FPGA
Mezzanine Card (FMC/VITA 57) site connected to the
FPGAs or one FMC site and one XMC/PMC site.
Signal Processing
Signal Processing
The HPE720 high performance hybrid processing engine
coupling a dual-core Freescale Power Architecture
MPC8641D with two latest generation Xilinx Virtex-5
(LX110/220/330T, SX240T or FX200T) FPGAs. With its
combination of high performance CPU and latest generation twin FPGAs, this DSP product provides leading
edge performance with flexible high-bandwidth I/O.
TECHNICAL SPECS
For the most demanding applications, the HPE720 offers a
variety of high speed memory resources. The MPC8641D
PowerPC processor supports 2 GB of DDR II SDRAM. The
HPE720 utilizes four independent banks of QDR II SRAM
for each FPGA that are each 9MB in capacity. These banks
of memory are each 36-bits wide. The HPE720 has two
independent banks of 256MB DDR II SDRAM per FPGA.
Each bank of DDR II is 32-bits wide. The HPE720 has up
to 128MB of NOR FLASH.
V Single or Dual-core Freescale MPC8641D processor
This 6U VPX board is available in both air-cooled or conduction cooled versions with VxWorks or Linux board
support packages. The HPE720 also supports the FusionIPC Inter-Processor Communication software stack for
Distributed Multi-Processing (DMP) systems.
AVAILABILITY
FEATURES & BENEFITS
Signal intelligence, image processing, electronic warfare, radar processing
at 1.0/1.25/1.33 GHz
V Dual Xilinx Virtex-5 FPGAs (LX110/220/330T, SX240T
or FX200T options)
V Dual FPGA Mezzanine Card (FMC/VITA 57) sites OR 1
FMC and 1 XMC/PMC site
V Serial RapidIO connectivity for distributed multi-pro-
cessing (DMP) systems
V 6U VPX/VPX-REDI form factor
Now
APPLICATION AREAS
V Dense FPGA resources combined with general purpose
processing for the most demanding DSP applications
V Maximum I/O flexibility to the front panel and backplane
V Support for multi-processing applications
V Air or conduction-cooled rugged versions for use in
deployed or commercial environments
CONTACT INFORMATION
VMETRO
1880 S Dairy Ashford, Suite 400
Houston, TX 77077
USA
+1 281-584-0728 Telephone
+1 281-584-9034 Fax
info@vmetro.com
http://www.vmetro.com/hpe720
74 • Application Solutions
Military & Aerospace Technologies Resource Catalog 2009
Curtiss-Wright Controls Embedded Computing
Single Board Computers
Single Board Computers
Single Board Computers
Curtiss-Wright offers the industry’s widest selection of
high performance rugged single board computers (SBCs),
engineered to meet the most demanding deployed
aerospace and defense applications. With both air- and
conduction-cooled high performance variants, Curtiss-Wright SBC designs support Power Architecture™
(PowerPC™) and Intel™ processor families. CurtissWright SBCs are available in 6U and 3U form factors in
VPX, VME and CompactPCI bus architectures. CurtissWright supports long life cycle of military programs with
unmatched life cycle management services.
Curtiss-Wright’s SBCs are available in a range of
ruggedization levels covering requirements from
Naval between-decks, through tracked land vehicles,
helicopters and manned aircraft right through to the
latest generations of unmanned air vehicles. Products
may be air- or conduction-cooled depending upon
their end-use application.
6U AND 3U SINGLE BOARD COMPUTERS
Product
Form
Factor
Processor(s)
SDRAM/
DDR
Flash
NVRAM
PMC Sites
Serial I/O
USB
Ethernet
Ruggedization
OS
Other
VPX3-127
3U VPX
8640D @
1.0 GHz,
Single/Dual
2 GB
DDR2
SDRAM
256 MB
NOR,
1 GB NAND
512 KB
FRAM
1x 64bit, 100
MHz or 1
XMC x8 PCIe
2x EIA232 2x
EIA-422
2x
USB
2.0
2x GbE
or 2x
1000x
AC 0, 100
CC100, 200
Linux
VxWorks
Pinout as per
VITA 46.9. DIO,
DIFFIO, 2x 4 PCIe
or 1x4 SRIO
VPX6-185
6U
VPX/
VPXREDI
Single/Dual
core
8640/8641,
1.0/1.33 GHz
2 GB
DDR II
512 MB
128 KB
1x 64-bit/ 100
MHz or 8-lane
PCIe, 1x 64bit/ 66 MHz or
4-lane PCIe
4x RS-232,
4x RS-232/
422/485
2x
USB
2.0
4x GbE
AC 0, 100,
CC 100, 200,
300 CC VITA
48.2. Type I
INTEGRITY
Linux
LynxOS
VxWorks
PCIe backplane
fabric, 2x 1553B,
dual SATA option,
SCSI option,
5V-only, DIO
& DIFF DIO
SVME/
DMV1901
6U VME
Intel Core2
Duo @
1.5 GHz
1 GB, 2 GB
or 4 GB
DDR2 RAM
2 GB USB
NAND
2x 64-bit/
100-133 MHz
PMC or 1x
64-bit/ 100133 PMC + 1x
4xPCIe XMC
2x EIA232, 4x
EIA-422
3x
USB
2.0
2x GbE
AC 0, 100
CC 100, 200
Linux
Solaris
VxWorks
Windows
2x SATA, 2x
SCSI 320/160, 1x
VGA Graphics,
1x AC97 Audio
SVME/
DMV-184
6U VME
Dual-core
8640/8641
1.0 GHz
2 GB
DDR2
512 MB
1x 64-bit/
100 MHz or
8 lane 1x 64bit/ 66 MHz
2x EIA-232
4x EIA422/ 485
2x
USB
2.0
3x GbE
AC 0, 10 0
CC 10 0, 20 0
INTEGRITY
Linux
LynxOS
VxWorks
Dual 1553B option,
Dual SATA option,
SCSI option, 5Vonly, DIO & DIFF DIO
SCP/
DCP-1201
3U cPCI
Intel Core2
Duo @
1.5 GHz
1 GB
DDR2
SDRAM
1GB USB
NAND
1x 64-bit/
66 MHz
2x EIA232 4x
EIA-422
3x
USB
2.0
2x GbE
AC 0, 100
CC 100, 200
Linux
Solaris
VxWorks
Windows
System &
Peripheral
Controller, 1x
Serial ATA
SCP/
DCP-124
3U cPCI
7447A @
1.0 MHz or
7448 @ up
to 1.4 Ghz
1 GB DDR
SDRAM
256 MB
1x 64-bit/
100 MHz
2x EIA-232
2x EIA422/485
1x
USB
2.0
2x GbE
AC 0, 10 0
CC 10 0, 20 0
INTEGRITY
Linux
VxWorks
System &
Peripheral
controller, DIO
and DIFFIO
Available, Sync
Capable EIA-422
128 KB
128 KB
CONTACT INFORMATION
Curtiss- Wright Controls
Embedded Computing
741-G Miller Dr., SE
Leesburg, VA 20175
703-779-7800 Telephone
703-779-7805 Fax
info@cwcembedded.com
www.cwcembedded.com
www.eecatalog.com/military
Application Solutions • 75
Highland Technology
The V450 is a 16-channel, fully isolated A/D converter
VME module featuring 24-bit bipolar voltage ranges
from 25 mV to 250 V. It also performs automatic thermocouple signal conditioning using any of four external
platinum RTDs or an onboard temperature sensor to provide cold junction compensation. Each channel is fully
independent and can be associated with any reference
junction. Channels are each isolated to 750 V commonmode and are protected up to 350 Vdc or 15 kV spikes.
Sampling rate is programmable from 4-500 sps, and data
presented is always valid with no real-time hand shaking
required. Junction temperatures are readable. Calibration can be checked without disconnecting field wiring,
and an optional self-test is available. Fully compatible
with the V470 Analog Output Module.
Test & Measurement
Test & Measurement
V450 Analog Input Module
FEATURES & BENEFITS
V 16 channels of fully isolated 24-bit analog input acquisi-
tion, each programmable for mode and input range.
V Voltage mode: input ranges from ±25 mV to ±250
V; Thermocouple mode: reports temperatures for
common T/C types.
V Includes four non-isolated precision RTD signal
conditioners, plus one onboard temperature sensor.
V Reports thermocouple loop resistance and detects
open thermocouples without inducing offset errors.
V Test connector supports in-crate calibration check;
optional Built-In Self Test (BIST).
TECHNICAL SPECS
APPLICATION AREAS
V 16 channels, programmable functions, galvanically
Avionics, Industrial Automation, Systems Monitoring,
Power Systems Testing and Temperature and Datalogging.
V
V
V
V
isolated.
Programmable per channel.
Voltage: 14 bipolar ranges, ±25 mV - 250V.
Thermocouples: types J K E T R S B N.
Resolution: Voltage mode, 24 bits.
Temperature mode, 0.0625 ºC.
Offset Error : Ranges < 1 volt: ±1 uV over time/temp.
Ranges < 1 volt: ±20 PPM over time/temp.
Gain Accuracy : Ranges < 1 volt: ±100 PPM of range
±15 PPM/ºC.
Ranges > 1 volt: ±250 PPM ±50 PPM/ºC.
Sample rate: Programmable per channel, 4 to 500
readings/second.
AVAILABILITY
Available Now
CONTACT INFORMATION
Highland Technology
18 Otis Street
San Francisco, CA 94103
USA
415.551.1700 Telephone
415.551.5129 Fax
info@highlandtechnology.com
www.highlandtechnology.com
76 • Application Solutions
Military & Aerospace Technologies Resource Catalog 2009
QualiSystems
TestShell
FEATURES & BENEFITS
Compatible Operating Systems: Multi Platform
V TestShell allows easy integration with external testing
Supported Architectures: Open Architecture
TestShell solutions constitute a suite of integrated applications that can be used for virtually any type of software
or hardware testing. Each application manages and automates certain aspects of the functional testing process,
and supplies data to a unified database. Together, they
turn the testing process into a complete quality optimization solution, while reducing cost and time to market.
V
V
V
CONTACT INFORMATION
QualiSystems
2033 Gateway Place, 5th Floor
San Jose, CA 95110
USA
+1-877-QUALI-10 Toll Free
+1-408-573-5941 Telephone
+1-408-437-1201 Fax
info@qualisystems.com
www.qualisystems.com
Test & Measurement
Test & Measurement
V
TestShell manages testing throughout the entire product
lifecycle – from design verification stages to production
and support –providing a unified testing environment.
Its automated test builder allows creation of complex
tests without programming. Its automated test execution
tools include distributed stations and testing farms, network and database tools, collection and synchronization
of all test data, and business intelligence tools allowing
automatic analysis of test results.
tools & languages e.g. EXE, DLL, LabVIEW, CVI, Python/
TCL/Perl/Math Scripts & more
TestShell supports a wide range of protocols such as
Bluetooth, TCP/IP, UDP, USB, WCDMA, PIB, Serial, COMBuses, 1553 & more
TestShell suite includes advanced web-based BI
tools offering comprehensive reporting & real-time
dashboard views of all testing results
TestShell suite offers smart algorithm engines to follow,
monitor and control the production floor processes
TestShell suite offers a built in Failure Reporting
Analysis & Corrective Action System, enhancing
RMS processes to outstanding level of automation
Creating Powerful, Low-Cost Applications
Don’t Miss These Power-Packed Events!
MicroTCA and AdvancedTCA Summits provide up-to-date information on the new standard platforms
for telecommunications equipment, mobile systems, military and defense systems, medical equipment,
and much more. Learn how these standards deliver turn-key solutions while reducing costs and
development time. Join industry experts, vendors and users. For information visit online.
E U R O P E
Q
May 28-30, 2008
Westfields Marriott
Chantillty, VA
MicroTCAsummit.com
www.eecatalog.com/military
Q
Q
Q
Q
September 23-24, 2008
October 21-23, 2008
Disney New York, New York
Santa Clara Convention Center
Paris, France
Santa Clara, CA
CONTACT INFORMATION
euroATCAsummit.com
AdvancedTCAsummit.com
Application Solutions • 77
VersaLogic Corporation
Cheetah (EPM-32)
Compatible Operating Systems: Windows CE/XP/XPe, Linux,
VxWorks, and QNX.
The Cheetah single board computer reaches a new level
of sophistication for embedded product technology,
integrating very high performance with an expanded
feature set on the compact and rugged PC/104-Plus form
factor. The advanced design of the Pentium M processor
makes it suitable for a wide range of higher-end applications such as security systems, telematics, UAVs, and
sophisticated communications equipment.
An impressive amount of functionality is packed into
the 2-board set, including 10/100 Ethernet, two USB 2.0
ports, two COM ports, LPT, IDE, audio, and high-resolution video output. It includes a CompactFlash socket for
on-board bootable media storage, TVS devices on the
user I/O for enhanced ESD protection, and a watchdog
timer. The Cheetah accommodates up to 1 GB DDR
system RAM in a high-retention SODIMM socket.
TECHNICAL SPECS
V Embedded BIOS OEM embedded features. Field-
upgradeable. Customization available.
V 400 MHz Processor-side Bus. Improved system
throughput.
The Extreme Graphics 2 video built into the chipset offers
outputs for LVDS flat panels and analog (CRT) monitors at
resolutions up to 2048 x 1536. It supports 24-bit color, very
fast rendering, and MPEG-2 decoding for full motion video.
Video RAM is allocated from system memory (up to 64 MB).
In addition to the Cheetah’s extensive feature set, the
PC/104 and PC/104-Plus connectors provide support for
many off-the-shelf expansion boards for added system
functionality with minimal space requirements.
232/422/485 configurable), IDE interface, LPT port, audio.
V CompactFlash Socket. Removable storage device has
no moving parts.
V SODIMM Memory Socket. Accommodates up to 1 GB
of DDR RAM.
AVAILABILITY
Currently in stock.
APPLICATION AREAS
The Cheetah features a General Software Embedded BIOS
with OEM enhancements. The field-reprogrammable
BIOS supports custom defaults and CMOS settings.
The Cheetah is suitable for a wide range of higher-end
applications such as security systems, telematics, UAVs,
and sophisticated communications equipment.
FEATURES & BENEFITS
V
V
V
V
V
PC/104-Plus Form Factor
Intel Pentium M at 1.8 GHz Processor
Extreme Graphics 2 Video
Extended Temperature and Fanless Versions Available
RoHS-compliant Versions
CONTACT INFORMATION
VersaLogic Corporation
3888 Stewart Rd
Eugene, OR 97402
USA
1.800.824.3163 Toll Free
541.485.8575 Telephone
541.485.5712 Fax
Info@VersaLogic.com
www.VersaLogic.com
78 • Development Systems
Military & Aerospace Technologies Resource Catalog 2009
Application
Application
V On-board I/O. Two USB 2.0 ports, two COM ports (one
VersaLogic Corporation
Cougar (EPM-14)
Compatible Operating Systems: Windows CE/XP/XPe/NT, Linux,
VxWorks, and QNX.
The PC/104-Plus Cougar is a feature-rich, mid-performance single board computer that offers very low
power consumption without sacrificing performance.
The highly efficient AMD LX 800 processor provides fanless extended temperature operation, while soldered-on
memory ensures high reliability. Equipped with dual
10/100 Ethernet, USB 2.0 ports, and RS-232/422/485 COM
ports, the Cougar is ideal for military, avionics, homeland security, medical, and other embedded computing
applications.
This highly-integrated 800 MHz-equivalent processor,
along with its companion chip, provide the majority of the
Cougar’s on-board I/O, including USB 2.0 support, high
performance video, and RS-232/422/485 COM ports. The
high resolution video output can be configured for either
standard desktop-type displays or LVDS flat panels.
TECHNICAL SPECS
V 256 MB DDR Memory. Soldered-on RAM for high
reliability.
V Network Support. Dual 10/100 Ethernet provides fast
This small and efficient SBC is designed to support OEM
applications where high reliability and long-term availability
are required. From design-in to 5+ years production life, its
quality and longevity provide a cost-effective, long-term
solution. Customization is available on as few as 100 pieces.
The Cougar is manufactured and tested to the highest quality
standards, and is backed by a two year limited warranty.
FEATURES & BENEFITS
V
V
V
V
V
V USB Ports. Four USB 2.0 ports provide flexible I/O
options for keyboard, mouse, floppy drives, and
other devices.
V Integrated I/O. Three COM ports (two RS-232, one
RS-422/485) and one IDE interface.
V CompactFlash Socket. Removable non-volatile media
has no moving parts and is bootable.
Application
Application
network access and boot ROM support.
The Cougar features a General Software Embedded BIOS
with OEM enhancements. This field-reprogrammable
BIOS supports custom defaults and the addition of firmware and firmbase applications for security processes,
remote booting, and other pre-OS software functions.
AVAILABILITY
Currently in stock.
APPLICATION AREAS
Ideal for military, avionics, homeland security, medical,
and other embedded computing applications.
PC/104-Plus Form Factor
AMD LX 800 Processor
Integrated High Performance Video
Fanless, Extended Temperature Operation
RoHS-Compliant
CONTACT INFORMATION
VersaLogic Corporation
3888 Stewart Rd
Eugene, OR 97402
USA
1.800.824.3163 Toll Free
541.485.8575 Telephone
541.485.5712 Fax
Info@VersaLogic.com
www.VersaLogic.com
www.eecatalog.com/military
Development Systems • 79
VersaLogic Corporation
Sidewinder (EBX-22)
Compatible Operating Systems: Windows CE/XP/XPe, Linux,
VxWorks, and QNX.
The EBX-compliant Sidewinder is a feature-packed single
board computer that uses a VIA Eden 1.2 GHz processor,
which offers very high per-watt performance, excellent heat
dissipation, and outstanding cost of ownership. The platform incorporates dual 10/100 Ethernet, a CompactFlash
socket, and integrated I/O including 8-channel 12-bit analog
input, 32-channel digital I/O, and two counter/timers. The
Sidewinder design also supports PC/104, PC/104-Plus and
SPX expansion sites and incorporates six USB 2.0 ports to
create a highly reliable, cost-effective SBC.
TECHNICAL SPECS
V Embedded BIOS. OEM embedded features and firmware
support. Field-upgradeable. Customization available.
V USB Ports. Six USB 2.0-compatible.
V CompactFlash Socket. Removable non-volatile media
has no moving parts and is bootable.
V Digital and Analog I/O. 32-line digital I/O port. 8-chan-
nel 12-bit analog input port.
V Ethernet Interface. Dual on-board 10/100 Ethernet
The Sidewinder features General Software’s Embedded
BIOS with OEM enhancements. This field-upgradeable
BIOS supports custom defaults and the addition of
firmware and firmbase applications for security, remote
booting, and other pre-OS software functions. The Sidewinder is an ideal solution for industrial control, medical
devices, and other embedded applications where high
reliability and long-term availability are required.
FEATURES & BENEFITS
V
V
V
V
V
provides easy network access and boot ROM support.
AVAILABILITY
Currently in stock.
APPLICATION AREAS
The Sidewinder is ideal for applications requiring high performance coupled with lower power consumption, rock solid
reliability, and compatibility with leading operating systems.
EBX Form Factor
VIA Eden 1.2 GHz Processor
High Performance Video
Suspend-to-RAM Power Management Function
RoHS-compliant, Fanless Operation
CONTACT INFORMATION
VersaLogic Corporation
3888 Stewart Rd
Eugene, OR 97402
USA
1.800.824.3163 Toll Free
541.485.8575 Telephone
541.485.5712 Fax
Info@VersaLogic.com
www.VersaLogic.com
80 • Development Systems
Military & Aerospace Technologies Resource Catalog 2009
Application
Application
Powered by the VIA Eden processor, the companion
digital media chipset integrates the VIA UniChrome Pro
II 2D/3D graphics core and an array of high-end video
technologies, including hardware MPEG-2/4 and WMV9
video decoding/acceleration. The Sidewinder can be
configured for use with either standard desktop-type
displays or LVDS flat panels. For cost-effective I/O expansion without the need for additional PC/104 modules, the
Sidewinder includes VersaLogic’s SPX interface.
Mentor Graphics
Mentor’s DO-254 Program
Development Solutions
Compatible Operating Systems: Linux, Unix, Windows
RTCA/DO-254 “Design Assurance Guidance for Airborne Electronic Hardware” is a newly enforced
standard for all in-flight PLD/FPGA/ASIC designs.
Mentor takes the needs of DO-254 seriously and
offers the following solutions to deliver a best-practice methodology to help meet DO-254 and quality
objectives while improving the productivity of flows
and valuable resources.
FEATURES & BENEFITS
Requirements Tracking
V Dynamic requirements traceability throughout
design and verification
System requirements must be traced to the corresponding design and verification data. Mentor’s solution
for requirements traceability helps automate DO-254
compliance by performing a top-down and bottom-up
tracing of these requirements to their respective design
and verification data.
V Design creation environment supporting RTL design,
reuse, and code checking, along with configuration
management, artifact generation, audit support
V Industry leading verification – from basic to the most
advanced techniques, supporting level A/B requirements
Design Creation
V Project support through DO-254 compliance training,
methodology assessments and recommendations,
and on-site consulting, including a DO-254 verification jumpstart consulting package
EDA
EDA
V Vendor-independent “safer” synthesis
Mentor’s design creation solution includes a comprehensive editing environment along with key DO-254
compliance features including RTL code checking,
reuse assurance, configuration management, design
artifacts generation, and web-based design review
and audit sites.
Advanced Verification
Verifying that the device performs its intended function
is a crucial part of DO-254 flows. Mentor’s industryleading advanced verification solution supports even
the most complex designs, including automating
requirements-based test, verification management,
and a unified coverage database to meet both your
DO-254 compliance and business goals.
Safer Synthesis
Ensuring synthesis is done as safely as possible is
a high priority for safety-critical and DO-254 flows.
Mentor offers a vendor-independent FPGA synthesis
solution that provides numerous features for added
assurance and repeatability of the process.
www.eecatalog.com/military
CONTACT INFORMATION
Mentor Graphics
8005 SW Boeckman Road
Wilsonville, OR 97070
USA
800-547-3000 Toll Free
503-685-8000 Telephone
DO254info_request@mentor.com
www.mentor.com/go/do-254
Development Systems • 81
iSYSTEM AG
In-Circuit Emulators and OnChip Debuggers for Embedded
Systems Development and Test
Compatible Operating Systems: WindowsXP SP2, Vista, 2000
SP4, NT 4.0 SP3, Eclipse
Supported Architectures: 1000+ MCUs such as all Freescale MPC,
ARM7/9, Cortex, TI, NEC, ...
As your technological partner iSYSTEM offers expert
knowledge based on more than 22 years of experience
with embedded systems. We are pioneers in emulation
and debug technology for 8-/16-/32-bit microcontroller
architectures and FPGA based emulator hardware tools.
We fulfil our obligation for an efficient, secure and fast
development of your embedded systems application.
FEATURES & BENEFITS
The development environment is easy to learn and to
use, and open interfaces allow for the flexible integration
and application of the iSYSTEM solutions in the entire
development process.
Beside our own product line we distribute code analysis
and test automation tools from LDRA.
iSYSTEM has positioned itself as a leading tool partner
in technologically demanding areas of the electronics
industry. The majority of the renowned manufacturers
of car electronics, embedded aerospace and defence
technology, medical, and safety as well as consumer
electronics belong to our list of satisfied customers.
V One development environment for all supported
V
V
V
V
microcontrollers and iSYSTEM emulators or debuggers
Support for almost all known embedded compiler
High-speed target access via JTAG, BDM, NEXUS,
ETM or in-circuit emulation
isystem.connect, a generic interface to remote
control all iSYSTEM products from any 3rd party tool
Flexible integration of iSYSTEM tools and technology
within the complete embedded systems development process
AVAILABILITY
Now
APPLICATION AREAS
Aerospace and Defense, Automotive, Medical, ...
CONTACT INFORMATION
iSYSTEM AG
Carl-Zeiss-Str. 1
85247, Schwabhausen
Germany
+49 8138 6971 50 Telephone
+49 8138 6971 46 Fax
sales@isystem.com
www.isystem.com
82 • Development Systems
Military & Aerospace Technologies Resource Catalog 2009
Emulators
Emulators
iSYSTEM solutions offer a modular system that enables
you to choose, combine and integrate the tools you
need throughout the entire development process. Our
modular system contains in-circuit and on-chip emulation hardware for more than 50 microcontroller families
and their derivatives.
Lauterbach Inc.
TRACE32 PowerTools
Compatible Operating Systems: Windows, Linux, SUNSolaris, HP-UX
Supported Architectures: PowerPC and MicroBlaze, PQ, PQ2,
PQ3, G4, MPC74xx, MPC5200, MPC55xx, ARM, XScale, SH, MIPS,
68K, x86 and many others
TRACE32 provides a complete set of development and
testing tools for a wide range of microprocessor families. The advanced modularity of TRACE32-PowerTools
allows the user to extend the debugger with a trace
extension. This trace extension can provide full support
for program flow, bus-, ARM-ETM- or Nexus tracing.
TRACE32-PowerTools are controlled by TRACE32-PowerView, the powerful IDE allowing Source-Level debugging
at the C, C++, ADA or assembly level. It works together
with all third party compilers and includes RTOS awareness for all major real time kernels, including QNX,
LynxOS, LynxOS-178, VXWorks, Linux and many others.
It allows unlimited software breakpoints, but also supports the on chip hardware break- and watchpoints. A
flash programming utility is included, which supports
programming of nearly all flash devices. The comfortable windowed user interface is completely configurable
by the user. No other system offers more flexibility.
TECHNICAL SPECS
V Download speed up to 3,8 MByte/s
V Display of internal and external peripherals at a
logical level (peripheral browser)
V Powerful script language
V High-speed link via Ethernet, USB-2
V Universal hardware for all supported debuggers
AVAILABILITY
All products are available. More information can be
found under http://www.lauterbach.com
Emulators
Emulators
TRACE32 works with the highest variety of host interfaces, including Windows 98/NT/XP/ME, Vista, Linux,
Sun, and HP-UX. The communication link between the
TRACE32 system and the host is made via USB-2 or
Ethernet (1G/100/10BaseT), enabling the highest speed
data transfers in the industry. It is possible to share a
TRACE32 in a LAN of PCs and workstations.
APPLICATION AREAS
Hardware and software development, verification
FEATURES & BENEFITS
V
V
V
V
V
Interface to all compilers for C/C++, ADA and Java
RTOS awareness and FLASH programming
Cache debugging and MMU support
Multiprocessor/Multicore support
Trace extension up to 650 MHz and 4 Gbyte trace
memory
CONTACT INFORMATION
Lauterbach Inc.
4, Mount Royal Avenue
Marlborough, MA
USA
++1 508 303 6812 Telephone
info_us@lauterbach.com
www.lauterbach.com
www.eecatalog.com/military
Development Systems • 83
Real-Time Innovations (RTI)
RTI Data Distribution Service is communications middleware for distributed real-time applications. It is the most
reliable, flexible and highest performing implementation
of the Object Management Group’s (OMG) Data Distribution Service for Real-Time Systems (DDS) standard
available today. RTI Data Distribution Service is field
proven and is used in many time-critical and data-critical
applications such as national railways, air traffic control,
traffic monitoring, mission-critical combat systems and
industrial automation. RTI Data Distribution Service is
operating system and programming language agnostic,
allowing heterogeneous systems to communicate easily
with each other. System designers can connect multiple
different physical connection points using pluggable
transports, including Ethernet, shared memory and
backplane interfaces. Available Quality of Service (QoS)
parameters enable designers to tune applications for the
best combination of performance and resource usage.
RTI Data Distribution Service is used by developers who
need a fast and flexible implementation of a data-centric
publish-subscribe communication network that is transport, operating system, and programming language
independent.
V Flexible: RTI Data Distribution Service is exception-
ally flexible to use, supporting different design
patterns and topologies. RTI Data Distribution
Service supports multiple communication modes,
autodiscovery and pluggable transports. New or
specialized transports are easily accommodated
without any programming change. For example,
custom transport layers could be developed for
native VMEbus, Infiniband, IEEE1394, etc. RTI Data
Distribution Service supports C, C++ and Java, and
the most commonly used host and real-time operating systems.
TECHNICAL SPECS
V Supported Operating Systems: Linux, Solaris, Win-
FEATURES & BENEFITS
dows, Integrity, LynxOS, QNX, VxWorks, Windows
CE, Yellow Dog Linux
V Target Architectures: AMD64, ARM, IA-32, PowerPC,
SPARC
V Language Support: ANSI C (C89) and ISO C (C99),
with GNU extensions, ANSI C++, Java 1.3 or later,
V RTI Data Distribution Service QoS available include
Deadline, Durability, History, Latency Budget, Reliability, Resource Limits, Time-Based Filter, etc.
V Robust & Feature-Rich: RTI Data Distribution Service
AVAILABILITY
is the most robust, feature-rich and up-to-date standards compliant implementation of DDS available
today. It has met the demanding needs of thousands
of users and has been deployed around the world.
V Easy to Use: The easily understood publish-subscribe paradigm of RTI Data Distribution Service
allows developers to spend significantly less time on
creating communications infrastructure and more
time concentrating on their application.
V Reliable: RTI Data Distribution Service has unsurpassed reliability, supporting deterministic data
delivery and includes many user configurable QoS
policies. Its peer-to-peer architecture eliminates all
central servers that may crash or hang, resulting in
no single point of failure. Since RTI Data Distribution
Service entities do not share address spaces, applications are isolated from each other and memory
corruption is prevented.
RTI Data Distribution Service is available today. RTI
continually adds support for new hosts and targets, so
please contact RTI for the latest list of supported platforms
CONTACT INFORMATION
Real-Time Innovations (RTI)
385 Moffett Park Drive
Sunnyvale, CA 94089
USA
+1.408.990.7400 Telephone
408.990.7402 Fax
info@rti.com
www.rti.com
84 • Development Systems
Military & Aerospace Technologies Resource Catalog 2009
Middleware
Middleware
RTI Data Distribution Service
LynuxWorks, Inc.
BlueCat Linux
Compatible Operating Systems: LynxOS and LynxSecure
Supported Architectures: Intel IA-32, XScale microarchitecture,
PowerPC (750, 970, 4XX), ARM, Xilinx PPC and MicroBlaze
The new 2.6 kernel at the heart of BlueCat Linux 5.x is
preemptible. Preemption points in the kernel allow you
to suspend an executing process so that you can launch
another, higher priority process. Linux 2.6 also features
a rewritten scheduler that speeds up the process of
selecting tasks for execution, which is of particular benefit to complex multitasking applications. Scheduling is
now completed in a predictable amount of time. These
new features, together with improved POSIX threading
support and new POSIX signals and timers, give your
BlueCat Linux applications an improved level of realtime performance.
AVAILABILITY
Now
APPLICATION AREAS
Military & Aerospace, Consumer Electronics, POS, Office
Automation, Entertainment
Operating Systems / RTOS
Operating Systems / RTOS
BlueCat ® Linux® from LynuxWorksTM, based on the 2.6
kernel, is an implementation of the Linux model enhanced
for use in embedded systems ranging from small consumer-type devices to large-scale, multi-CPU systems.
BlueCat Linux delivers the flexibility and cost benefits of
open-source software. It’s uniquely constructed to be a
stable, commercial-grade embedded operating system
release which provides immediate productivity and optimized performance.
FEATURES & BENEFITS
V Preemptible kernel- preemption points in the kernel
allow you to suspend an executing process so that
you can launch another, higher priority process
V Low-latency scheduler- ensures that processes
are executed when they are ready to run, which
improves overall system performance
V Improved POSIX threading support- open-standards
ideology providing compatibility of applications over
different architectures, complementing our LynxOS
strategy
V POSIX timers- time and alarm management needed
for real-time. Applications requiring high throughput
or fast response time would benefit from these highresolution timers
CONTACT INFORMATION
LynuxWorks, Inc.
855 Embedded Way
San Jose, CA 95138
USA
800.255.5969 Toll Free
408.979.3900 Telephone
408.979.3920 Fax
inside@lnxw.com
www.lynuxworks.com
www.eecatalog.com/military
Development Systems • 85
LynuxWorks, Inc.
Luminosity IDE
Compatible Operating Systems: LynxOS, LynxOS-178, BlueCat
Linux, LynxOS-SE
Supported Architectures: IA-32, PowerPC (750, 74xx, 405,
440,PQII, PQIII)
Advanced operating system awareness is provided
for the LynuxWorks operating systems extending the
common debug features and providing extra views in
the debug perspective. These extended views include
information on the state of the operating system and its
communication mechanisms such as message queues,
semaphores, condition variables, and mutexes. The
debugger also provides views for multiple threads and
the ability to dynamically attach to new processes in
the system. For time- and space-partitioned operating
systems such as LynxOS-178, additional partition awareness is provided by Luminosity to allow debugging of
applications running in different partitions.
This open approach to solving embedded development issues is very much in LynuxWorks’ nature, and
the Luminosity development environment is the latest
in a long line of products designed to make embedded
development easier.
FEATURES & BENEFITS
V Pristine Eclipse framework - extends CDT project
V Easily switch between perspectives - C/C++ build,
Debug, Target, Process view, Profiling, Remote file view
V Advanced OS-aware debugging
V Processor- and partition-aware debugging
V Cross process viewer and SpyKer trace tool give
unparalleled system level information
CONTACT INFORMATION
LynuxWorks, Inc.
855 Embedded Way
San Jose, CA 95138
USA
1-800-255-5969 Toll Free
1-408-979-3900 Telephone
1-408-979-3920 Fax
inside@lnxw.com
www.lynuxworks.com
86 • Development Systems
Military & Aerospace Technologies Resource Catalog 2009
Operating Systems / RTOS
Operating Systems / RTOS
The Luminosity embedded development tools suite from
LynuxWorks™ offers powerful development, debug and
analysis tools integrated into an Eclipse-based environment for maximum interoperability. Based on the popular
Eclipse framework, Luminosity offers a modern open
standards interface, giving a consistent user experience
across the LynuxWorks family of real-time operating
systems (BlueCat ® Linux®, LynxOS®, LynxOS-178 and
LynxOS-SE), different host development platforms, and
multiple target processor architectures.
LynuxWorks, Inc.
LynxOS-178 RSC
Compatible Operating Systems: LynxOS-178
Supported Architectures: Intel Pentium X86, PowerPC
As described in FAA advisory circular AC 20-148, standalone software components (such as math libraries,
operating systems and communication protocols) can
now be accepted by the FAA as meeting DO-178B objectives across hardware platforms. LynxOS-178 is the first
and only RTOS to be give this Reusable Software Component (RSC) award. The LynxOS-178 RSC is designed to be
hardware-agnostic, so no changes are required to move
the RSC onto other hardware platforms. The LynxOS-178
RSC acceptance applies to a family of PowerPC® processors, including the PPC 75x, 74xx, 4xx, 603 and IBM 970.
The LynxOS® -178 RSC is more than just a set of DO-178B
artifacts. In fact the RSC follows the guidance of AC 20148 by addressing the most difficult and critical areas
of certification: integration with multiple applications at
various levels of DO-178B criticality.
V High value- most robust feature set of any DO-178B
certifiable OS enables rapid time-to-market
AVAILABILITY
APPLICATION AREAS
Safety-Critical Applications, Military & Aerospace, Security
FEATURES & BENEFITS
Operating Systems / RTOS
Operating Systems / RTOS
Now
The documentation set includes a detailed partitioning
and interface analysis that focuses on time, space and
resource partitioning as well as timing margin analysis
so developers can allocate budgets to use of operating
system services. The set of RSC guidance documentation also includes requirements, design data, test suites
and coverage analysis to meet DO-178B requirements.
V Support for ARINC 653- ensures application portabil-
ity, software reuse and interoperability between
embedded systems
V POSIX conformance- the only DO-178B-certifiable
RTOS available today for safety-critical systems with
POSIX conformance
V Low risk- FAA-accepted RSC time/space-partitioned
RTOS for multiple applications up to Level A
V Reduced costs- eliminates manyears of effort and
significantly lowers overall cost of certification
CONTACT INFORMATION
LynuxWorks, Inc.
855 Embedded Way
San Jose, CA 95138
USA
800.255.5969 Toll Free
408.979.3900 Telephone
408.979.3920 Fax
inside@lnxw.com
www.lynuxworks.com
www.eecatalog.com/military
Development Systems • 87
LynuxWorks, Inc.
LynxOS-178 RTOS
Compatible Operating Systems: LynxOS and LynxSecure
Supported Architectures: Intel Pentium X86, PowerPC
LynxOS® -178 RTOS is the first hard real-time operating
system certifiable to DO-178B level A with the interoperability benefits of POSIX® and support for the ARINC 653
APplication EXecutive (APEX).
LynxOS-178 is also the first and only RTOS to be awarded
the FAA-accepted Reusable Software Component (RSC).
LynxOS-178 provides previously certified software and
artifacts in order to fully satisfy the DO-178B level A
requirement that every line of software in the system be
verified with Modified Condition/Decision Coverage.
LynxOS-178 is based on open standards and is
designed specifically to fulfill the stringent needs of
multithread and multiprocess applications in safetycritical real-time systems.
FEATURES & BENEFITS
V Reusable Software Component (RSC)- first and only
FAA-accepted RSC for an RTOS
V Low risk- known DO-178B level A certifiable, real-
time operating system package at a known cost
This RTOS provides safety through Virtual Machine
(VM) brick-wall partitions which make it impossible for
system events in one partition of the RTOS to interfere
with events in another.
LynxOS-178 RTOS ushers in a new era of safety, certifiability
and productivity for safety-critical system development.
RTOS available today for safety-critical systems with
POSIX conformance
V Support for ARINC 653- ensures application portability, software reuse and interoperability
V Now includes TCP/IP/UDP networking certifiable to
level A/B
APPLICATION AREAS
Automotive, Communications/Networking, Industrial,
Medical, Military/Aerospace, Security, Transportation
CONTACT INFORMATION
LynuxWorks, Inc.
855 Embedded Way
San Jose, CA 95138
USA
800.255.5969 Toll Free
408.979.3900 Telephone
408.979.3920 Fax
inside@lnxw.com
www.lynuxworks.com
88 • Development Systems
Military & Aerospace Technologies Resource Catalog 2009
Operating Systems / RTOS
Operating Systems / RTOS
V POSIX conformance- the only DO-178B-certifiable
LynuxWorks, Inc.
LynxOS Real-Time Operating System
Compatible Operating Systems: LynxOS-178, BlueCat Linux and
LynxSecure
The LynxOS® RTOS is the superior foundation for sophisticated real-time systems. Broad conformance to open
and de facto standards like Linux ®, POSIX and UNIX®
means that you can confidently build products with the
LynxOS RTOS to meet the most stringent requirements
for real-time mission-critical applications. LynxOS is the
superior foundation for sophisticated real-time systems
that must:
• Perform complex series of tasks within set periods
of time
• Support multiple applications with multiple interrupting devices
• Take full advantage of today’s powerful high-end
microprocessor and advanced networking architectures
• Its native interfaces are those of Linux, UNIX and
POSIX, it is ABI-compatible with Linux, and it is
part of a family of open operating systems from
LynuxWorks that also includes BlueCat ® Linux,
LynxOS-SE, and LynxOS-178.
• LynxOS 5.0 now supports Symmetric MultiProcessing (SMP) on available dual and multi-core
hardware.
AVAILABILITY
Now
APPLICATION AREAS
Industrial, Automotive, Communications, Military & Aerospace, Office Automation
FEATURES & BENEFITS
Operating Systems / RTOS
Operating Systems / RTOS
Supported Architectures: Intel Pentium, Intel Pentium M, Intel
Xeon, Intel Core 2 Duo, and PowerPC
V Mission-critical performance and reliability; absolute
determinism and linear performance scalability
V Industry-leading openness; open APIs and Linux ABI
compatibility, plus full POSIX conformance
V Latest technologies for internet communications;
advanced networking feature sets for rapid development of differentiated products
V Symmetric MultiProcessing (SMP)
CONTACT INFORMATION
LynuxWorks, Inc.
855 Embedded Way
San Jose, CA 95138
USA
800.255.5969 Toll Free
408.979.3900 Telephone
408.979.3920 Fax
inside@lnxw.com
www.lynuxworks.com
www.eecatalog.com/military
Development Systems • 89
LynuxWorks, Inc.
LynxOS-SE
Compatible Operating Systems: LynxSecure
Supported Architectures: Intel Pentium X86, PowerPC
The LynxOS® -SE RTOS is the first and only time-space
partitioned, hard real-time operating system to offer the
ability to run POSIX®, ARINC 653 and Linux® applications
simultaneously in a single partition.
TECHNICAL SPECS
LynxOS-SE is based on open standards and is designed
specifically to fulfill the stringent needs of multithreaded
and multiprocess applications in high-performance systems. It offers the interoperability benefits of the latest
POSIX 1003.13:2003 (PSE53) standard as well as the
ARINC 653 APplication EXecutive (APEX).
Safety and reliability are achieved through Virtual
Machine (VM) brick-wall partitions, which make it impossible for system events in one partition to interfere with
events in another.
V POSIX 1003.1-2003 PSE53 conformance
V Linux 2.6 (glibc 2.3.3) ABI support
V TCP/IP Networking stack with IPv4, IPSEC and QoS
AVAILABILITY
Now
APPLICATION AREAS
Operating Systems / RTOS
Operating Systems / RTOS
Safety-Critical Applications, Military & Aerospace, Security
At the core of the LynxOS-SE operating system is LynxOS,
a mature UNIX® -style operating system designed from
the start for hard real-time determinism. LynxOS and its
variants have been deployed in millions of safety-critical
applications worldwide, including multiple military and
aerospace systems certified to DO-178B, up to level A.
FEATURES & BENEFITS
V Time and space partitioning for fault containment
V Support of open standards by offering a powerful
combination of POSIX and ARINC 653 compliance.
V Linux Application Binary Interface (ABI) support
V ARINC 653 space and time partitioning
V Full POSIX conformance
CONTACT INFORMATION
LynuxWorks, Inc.
855 Embedded Way
San Jose, CA 95138
USA
800.255.5969 Toll Free
408.979.3900 Telephone
408.979.3920 Fax
inside@lnxw.com
www.lynuxworks.com
90 • Development Systems
Military & Aerospace Technologies Resource Catalog 2009
LynuxWorks, Inc.
LynxSecure
Compatible Operating Systems: LynxOS, LynxOS-178, BlueCat
Linux, LynxOS SE
Supported Architectures: Intel Pentium X86 (Intel VT technology),
PowerPC
With the introduction of the new LynxSecure separation
kernel and embedded hypervisor, LynuxWorksTM once
again raises the bar when it comes to superior embedded
software security and safety. LynxSecure expands on the
proven real-time capabilities of the LynxOS® real-time
operating system (RTOS) with time-space partitioning
and operating-system virtualization.
Now
APPLICATION AREAS
Safety-Critical Applications, Military & Aerospace, Security
Operating Systems / RTOS
Operating Systems / RTOS
AVAILABILITY
The LynxSecure separation kernel is a virtual machine
monitor that is certifiable to (a) Common Criteria EAL-7
security certification (Evaluated Assurance Level 7), which
is a level of certification unattained by any known operating system to date; and (b) DO-178B level A, the highest
level of FAA certification for safety-critical avionics applications. LynxSecure conforms to the Multiple Independent
Levels of Security/Safety (MILS) architecture.
The embedded hypervisor component to LynxSecure
allows multiple “guest” operating systems to run in their
own secure partitions. These can be run in either paravirtualized or fully virtualized modes, helping to preserve
legacy applications and OSes in systems that now have a
security requirement.
FEATURES & BENEFITS
V Optimal security and safety- the only operating
system to support CC EAL-7 and DO-178B level A
V Real time- time-space partitioned RTOS for superior
determinism and performance
V Virtualization technology- supports multiple het-
erogeneous operating system environments on the
same physical hardware using Intel VT hardware
V Highly scalable- supports Symmetric MultiProcessing
(SMP) and 64-bit addressing for high-end scalability
V Support for open standards- supports 100%
binary compatibility for Linux or POSIX-based
software application to migrate to a highly robust,
secure environment
CONTACT INFORMATION
LynuxWorks, Inc.
855 Embedded Way
San Jose, CA 95138
USA
800.255.5969 Toll Free
408.979.3900 Telephone
408.979.3920 Fax
inside@lnxw.com
www.lynuxworks.com
www.eecatalog.com/military
Development Systems • 91
Absolute Analysis, Inc.
Protocol Test Solutions for
Military & Aerospace
Compatible Operating Systems: Windows XP
Supported Architectures: 4-bit, 8-bit, 16-bit, 32-bit, 64-bit
Absolute Analysis provides critical protocol test solutions
in a variety of technologies for many of today’s cutting edge
Military and Aerospace programs including advanced
combat systems, satellite communications, unmanned
aerial vehicles, avionics, radar imaging, and many others.
Applications
• Protocol Analysis
• Protocol Creator
• Bit Error Rate Test (BERT)
• Traffic Generation
• Simulation
• Error Injection
• Impairment Test
Protocols Supported:
CONTACT INFORMATION
Upper Layer
• Custom Protocols
• AFDX/ARINC644
• FC-AV/ARINC818
• AS5653/MIL-STD-1760
• FC-AE-ASM/FC-AE-1553
• AS1760
Absolute Analysis, Inc.
2393 Teller Road
Suite 109
Newbury Park, CA 91320
USA
805.376.6048 Telephone
805.376.6041 Fax
AAsales@absoluteanalysis.com
www.absoluteanalysis.com
A network dedicated
edicated to the
th
he
en
needs off
s designe
ners
rs and
engineers, developers,
designers
ers
engineering managers
Diamond Sponsor
Official Sponsor
Purchasing guides for the electronics industry
Multicore
Technologies
Annual Resource Catalog
Diamond Sponsor
Purchasing guides for the Electronics Industry
Purchasing guides for the electronics industry
S P E C I A L
Embedded Security
Technologies Resource Catalog 2008
Embedded Linux
Resource Catalog 2009
Resource Catalog 2008
O p tio nal
Ap p lication fram ew ork & PIM
VPN
IM
Bro w s er
T h ird Party
Sup p o rted
MontaVista DevRocket IDE
R in g to ne en gine
Vo ic e rec o gnition
M M S en g in e
Pred ic tive tex t en try
Vo IP
M ultim ed ia en gine
O TA
J VM
Prio rity
In h eritance
Pre-lin king
X11
M em o ry
Pro tec tion
AR M EABI
N PT L
g libc
uC libc
Po w er M g r
D atabas e
Ap p XIP
SSM
Sy s tem U tils
Sec urity
F ram ew o rk
O BEX
IPSec
W i-F i
T elep h ony
Serv er & T API
(T ap root)
Blueto o th
SYSTEMVERILOG MEETS EMULATION
Telephony
Stacks
Multimedia
Processing
Kernel features and drivers
F ile s y s tem s
(N AN D /N O R )
C am era
Vid eo
F las h
Aud io
C am era
Po w er m g m t
Lo g g ing
Serial
IPv 6
F as t bo o t
R eal-tim e
U SB H o s t, G ad g et
T elep h ony
in terfac e
Kern el XIP
Sec urity
U SB O T G
SD IO
Optional Sub-Kernel
RTOS / L4
MINIMIZING THE EFFECTS OF
MANUFACTURING VARIATION
Hardware platform
Semiconductor Reference
June 2008
DRM
Middleware
OS-level features and services
G TK
D irec tF B
F ram e buffer
I S S U E
CODING PRACTICES IN A
LOW POWER WORLD
Application layer
D ata s y n c
W in dow M g r
T o uc h screen
D O U B L E
COLLABORATION MODELS
Baseband
Processor
/ Modem
“IS THAT AN ELEPHANT IN YOUR FLOW?”
www.eecatalog.com/multicore
CONTACT INFORMATION
www.eecatalog.com/security
Platinum Sponsor
Platinum Sponsor
Gold Sponsors
Affiliate Sponsor
Gold Sponsors
www.eecatalog.com/embeddedlinux
www.chipdesignmag.com
Gold Sponsors
Catalog Diamond Sponsor:
Catalog Gold Sponsor:
Affiliate Sponsors:
www.eecatalog.com
92 • Development Systems
Military & Aerospace Technologies Resource Catalog 2009
Test & Analysis
Test & Analysis
Physical Layer
• Ethernet – up to 10Gbps
• Fibre Channel
• Serial FPDP
• Custom Interfaces
Birdstep Technology, Inc.
Raima Database Manager (RDM)
Compatible Operating Systems: AIX, Embedded Linux, FreeBSD,
Integrity, HP-UX, Linux, MacOS, MicroC, QNX Neutrino, Solaris,
VxWorks, Windows, Windows CE, Windows Embedded
Compatible Architectures: PowerPC 32 bit, PowerPC 64 bit, x86, PARISC 32 bit, PA-RISC 64 bit, Itanium 32 bit, Itanium 64 bit, x64/AMD64,
Microblaze, SPARC 32bit, SPARC 64bit, x86 (Simulator), XScale,
others on request
We’re solving today’s complex interconnected problems
with over 25 years of successful track record, RDM products are embedded in thousands of different applications,
resulting in tens of millions of runtimes targeting all kinds
of hardware environments. Including applications for
telecommunication, defense and aerospace, consumer
electronics, financial and banking, automotive, and business automation. All over the world, application vendors
are entrusting their business critical data with RDM.
V Concurrent Access
Multi thread and multi process access with row level
locking granularity.
V Full and Hybrid In-Memory Modes
Choose to store data and or indexes in memory or on
disk for ultimate flexibility and performance.
TECHNICAL SPECS
V Code size from 250kB to 2MB, depending on technol-
In an increasingly competitive market, embedded application vendors are constantly looking at new ways to cut
application cost, time to market, and increase application functionality, to ultimately gain market share and
increase product sales. While revenue margins are being
squeezed, consumers are expecting higher quality and
functionality as new products are released. With 25 years
of proven stability and a family of products to grow into,
embedded application vendors have a highly reliable
one-stop shop for any of their data management needs.
ogy and features.
V ative and Industrial Standard Interfaces (SQL, ODBC,
JDBC, ADO.Net, PHP, and XML)
V Standalone and heterogeneous client/server versions
V High performance ACID transactions, automatic data
recovery
V Handles unlimited amount of data
AVAILABILITY
Data integrity and reliability, concurrency access, and
full data schema capabilities, are only a few high level
advantages of these products.
APPLICATION AREAS
Advanced Telecomunications Computing Architecture
(ATCA); Building Automation; Car Infotainment and Telematics; Carrier Class Networking; Emerging Consumer
Devices; Enterprise Data Networking; General Aerospace &
Defense; Industrial Automation; Instrumentation; Medical;
Networking Technologies; Power Generation & Distribution;
Radar, Sonar & Signal Processing; Safety Critical Avionics;
Server and Storage Networking; Space; Transportation
Software
Software
Immediate.
RDM products offer your developers a rich set of tools
and features unmatched in the embedded database
space. The relational model supporting industrial standards like SQL and ad-hoc querying can be combined
with the efficiency of the network model in the RDM
products solving problems requiring extreme performance with standard access APIs.
FEATURES & BENEFITS
V Network and Relational Data Models
Mix both data models for unmatched schema
V
V
design flexibility.
32- and 64 bit support
Supports both 32- and 64 bit architectures and
data types.
High Availability
Sophisticated synchronous and asynchronous data
mirroring and networked replication for any high
availability problem.
www.eecatalog.com/military
CONTACT INFORMATION
Birdstep Technology, Inc.
2101 4th Ave
Suite 240
Seattle, WA 98121
USA
877.462.2473 Toll Free
206.748.5300 Telephone
206.748.5200 Fax
dbsales@birdstep.com
www.raima.com
Development Tools • 93
Quantum3D, Inc.
IData Human-Machine
Interface Toolset
Compatible Operating Systems: Eclipse, Embedded Linux, Green
Hills, RTES, VxWorks/Wind River, Windows Embedded
IData is a powerful suite of tools that enables the rapid
creation of human-machine interfaces (HMIs). Whether
developing cockpit displays, handheld user interface UIs,
or C4ISR applications, IData is ideal for embedded systems,
instrument display, and simulation apps. IData’s support
for rich, flexible, interactive HMI content; 2D and 3D digital
map displays; and advanced features and capabilities make
it the most powerful tool in the HMI industry.
Whenever developing intelligent visual graphics displays is
necessary, IData enable users to improve HMI quality and
performance, as well as reduce time to market. In environments with constrained computing resources and small
footprints, these goals can be difficult to achieve, but IData
offers a solution. IData offers easy-to-use content creation
tools that enable developers to rapidly prototype graphic
displays and their associated behavior. IData has built-in
logic modeling and logic engine capabilities that allow even
non-programmers unprecedented power and flexibility
in defining the HMI. So, whether the need is for a simple
dynamic graphics display, one with innovative user interaction, live video, sensor data, geospatial information, or
complex 3D content, IData is ideal.
FEATURES & BENEFITS
V IData Pro is a comprehensive, feature-rich HMI
V
V
V
V
design tool for defining graphics, behaviors
fonts, and widgets, as well as for deploying these
applications to target systems.
The IData SDK allows user-developed code in any
programming language to be easily added to an
IData design.
The IData Cert Kit for FAA DO-178B (Level A)
provides all of the necessary plans, artifacts, and
test components that are required to accelerate the
certification process.
IData Map is a set of digital map libraries for incorporating
large digital moving map data with chart, imagery, vector,
and multi-resolution datasets in both 2D and 3D.
IData 3D is a scene manager for interactive visualizations and content manipulation. UI creation and a
geospatial environment are driven by a 3D terrain
generation engine and integration of 3D models.
V Easy-to-Use – IData’s content creation tools enable
V
V
V
V
rapid prototyping and simplify the move from prototype to product; even nonprogrammers can flexibly
define the look and behavior of the HMI.
Eliminates Obsolescence – By adding Quantum3D’s
IGL software-based OpenGL SC driver, customers can
eliminate the dependency on obsolescence-prone
graphics hardware used in embedded systems.
Standard Formats – IData supports the use of digital
images and 3D models in standard formats, allowing
content creation tools such as Adobe Photoshop and
3D Studio Max to be used for HMI content.
Standards Support – OpenGL, OpenGL ES, and OpenGL
SC are all supported by the IData render engine.
Electronic Flight Instrument System – Support
includes complex behaviors, map and radar image
displays, live video overlay, complex stencil-clipping
regions, and high quality anti-aliasing.
94 • Development Tools
APPLICATION AREAS
HMI Toolset
AVAILABILITY
United States, International
CONTACT INFORMATION
Quantum3D
6330 San Ignacio
San Jose, CA 95119
United States
408.361.9999 Telephone
408.361.9980 Fax
salesinfo@quantum3d.com
www.quantum3d.com
Military & Aerospace Technologies Resource Catalog 2009
Software
Software
IData’s tools and libraries are designed for use in
aerospace, defense, C4ISR, industrial automation, transportation, and medical applications. IData’s model-based
development approach eliminates code generation and
dramatically reduces development time.
TECHNICAL SPECS
Arxan Defense Systems
Arxan Defense Systems
(ADS) Services
ADS provides government clients and contractors with
our end-to-end support and create comprehensive
solutions that include the development of anti-tamper
plans, vulnerability assessments, technical training and
product-specific protection schemes.
The ADS Professional Services team is comprised of
experienced, security-cleared engineers, with specific
expertise in the Anti-Tamper (AT) market, including
in-depth knowledge of third party products.
Red Teaming
Red Teaming analysis is a blind security assessment
performed by a skilled team of ethical hackers. A Red
Team uses the same tactics that would be employed
by malicious hackers to breach information systems.
Arxan’s “black box” approach assumes that the attacker
has no prior knowledge of the system and all exploitable
system faults that are discovered during this process will
be reported back to the organization for patching.
Our Red Team analysis will produce a detailed report
that includes a vulnerability assessment which outlines threats, vulnerabilities and attack scenarios.
The report will also include methodology, key performance parameters and risk mitigation tools and
techniques that address all threat vectors.
Blue Teaming
A Blue Team analysis includes a design-and architecture-documentation review, along with source code
analysis. For the most complete security analysis, a
Blue Teaming effort can be supplemented in parallel or
prior to Red Teaming.
Government Liaison for Anti-Tamper (AT) Plan Development
Complete AT plan creation, as required by the DoD
directives 5000.2 and 5200.39 and aligned with the
DoD acquisition process.
www.eecatalog.com/military
Training
ADS Professional Services provides training courses in
AT historical perspective, tools and techniques for CPI/IP
attacks and penetration and customized training options.
Custom Solutions
We will work with Program Managers and development teams to design a customized protection that best
leverages the characteristics of products, platforms and
available hardware anti-tamper measures to build a
robust protection network.
Implement AT Plan
Utilizing a layered approach, Arxan will craft the protection
necessary for your system. This will include components
from Arxan’s own anti-tamper arsenal EnforcIT® as well
as any additional solutions required by the DoD Validation Committees. This combined approach will ensure a
best-of-breed solution that is flexible and maintainable.
CONTACT INFORMATION
Consulting
Consulting
A Blue Teaming security analysis is similar to Red Teaming,
however, Blue Teams work hand-in-hand with the targeted
system’s engineers to do a vulnerability assessment. As
such, the Blue Team has access to resources and information that are unavailable to a Red Team (or what an
attacker would see in the field) and results can usually be
achieved faster than Red Teaming.
The AT plan will include, but not be limited to, the following—
identify CPI, IP, and threats, conduct vulnerability assessment
including impact of exploitation, evaluate potential AT solutions including recommendations and prepare Verification
and Validation plan.
Arxan Defense Systems
3000 Kent Ave, Suite D2-100
West Lafayette, IN 47906
USA
877-445-1350 Toll Free
765-775-1038 Fax
info@arxan.com
www.arxandefense.com
Services • 95
portabledesign
conference & exhibition
Power Management
for a Wireless World
Conference sessions, Analyst Presentations and
Panel Discussions on designing and powering portable,
low-power wireless consumer devices.
Complimentary Registration
Keynotes
Panel Discussions
Technical Seminars
Exhibition
Lunch
Networking Reception
September 18, 2008
San Jose, California
Wyndham Hotel
Attend for free. Register now.
www.portabledesignconference.com
sponsored by
Oh yes, we’re
SECURE
Military-grade security & non-secure applications
working side-by-side from LynuxWorks
LynuxWorks has a proven legacy of meeting rigidly mandated military and aerospace software
systems throughout the world. Now, with the LynxSecure separation kernel, the highest levels
of security can be met by taking advantage of hypervisor and virtualization technologies while
embracing open standards.
Offering Multiple Independent Levels of Security (MILS) LynxSecure can be designed into
environments where secure applications need to run on the same hardware as, but be securely
partitioned away from, non-secure applications and operating systems.
Open.Reliable.Safe.Secure.
Ultimate flexibility, yet maximum security partitioning is what sets LynxSecure apart for the new
generation of secure embedded systems for the military, industrial, medical and other industries.
Download the whitepaper at http://www.lynuxworks.com/security to learn more
about working side-by-side with the LynxSecure separation kernel.