Thermoplastic Hoses
for Ultra High Pressure
Catalogue 4462 Global Edition
Thermoplastic Hoses for Ultra High Pressure
Table of Contents
!
A
Introduction and General Statements
How to use the catalog . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
Part number system . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
II
IV
Explanation of symbols . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
User Manual for the Application of Hose Assemblies . . . . . . . . . . . . . . .
Polyflex Division. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
Why use Parker thermoplastic hose? . . . . . . . . . . . . . . . . . . . . . . . . . . . .
Value added services . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
V
VI
XII
XIII
XIX
Hose and Fitting Selection
Hose selection chart by working pressure – design factor >2:1 . . . . . . . A – 2
Hose selection chart by working pressure – design factor 4:1 . . . . . . . . A – 4
Hose fitting chart . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . A – 5
B
Hoses with design factor 4:1
C
Hoses with design factor >2:1
D
Polyflex-Lok
Polyflex-Lok components . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . D – 2
E
Connectors & Adapters – Valves
High Pressure Connectors & Adapters . . . . . . . . . . . . . . . . . . . . . . . . . . . E – 4
Valves . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . E – 40
F
Accessories
Heavy duty abrasion cover . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . F
Heavy duty abrasion cover sleeves . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . F
Spring guards . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . F
Support grips . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . F
PVC-S – Anti-abrasion sleeve. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . F
HS - Containment grips . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . F
UHPLABEL – Precautions for ultra-high pressure applications . . . . . . . F
–
–
–
–
–
–
–
2
2
3
3
4
4
4
Catalogue 4462 Global Edition
Thermoplastic Hoses for Ultra High Pressure
Table of contents
G
Technical Information
Installation tips . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . G – 2
Selection, installation, and maintenance of polyflex hose . . . . . . . . . . . G – 3
Dash sizes . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . G – 4
Selection of hose diameter from flow rate and velocity . . . . . . . . . . . . . G – 5
Pressure drop . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . G – 6
Glossary . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . G – 11
Permeability coefficient . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . G – 12
Recommended tightening procedures . . . . . . . . . . . . . . . . . . . . . . . . . . . G – 13
Metric conversion chart . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . G – 14
General chemical resistance table . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . G – 15
Parker Safety Guide . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . G – 20
H
Index of Part Numbers
Index . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . H – 1
Safety note . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . H – 16
The content contained in this catalogue has been compiled with the greatest
care and corresponds to the information currently available to us.
However, we would like to point out that we reserve the right to make technical changes and we kindly request you to contact us should you have any
special questions.
I
Catalogue 4462 Global Edition
Intro
! A B C D E F G H
Intro
Thermoplastic Hoses for Ultra High Pressure
How to use the catalogue
How to use the catalogue
Overall structure of the catalogue:
General Info
Products
Detailed Technical Info
Index
II
Hose data is always colored in blue
Thermoplastic Hoses for Ultra High Pressure
How to use the catalogue
Chapter selector
if you know the chapter you are looking for
– this is the quickest way to get there
Shows the current chapter
Category selector
– superordinates chapters
into product groups
Fitting data is always colored in yellow
III
Intro
!
Intro
Thermoplastic Hoses for Ultra High Pressure
Part number system
Part number system
Hoses
2440 N - 16 V91
Hose
type
Core tube
material
Hose I.D.
in 1/16"
Design
variation
Fittings
6 0 1 LX - 8 - 8 C
Manufacturing
location
IV
Connection
code
Parker
fitting
series
Connection
size
thread/
tube
Hose inner
diameter
(Dash size)
Material
• without indication:
steel
• C4462:
Super Duplex 1.4462
• C:
Stainless Steel
AISI 316 /AISI 316Ti
Thermoplastic Hoses for Ultra High Pressure
Explanation of symbols
Explanation of symbols
Symbol
Description
Part number
Nominal inner diameter
Nominal outer diameter
Working pressure
Burst pressure
Bend radius
Weight
Fittings
Thread size
( , *
Wrench size
Thickness
V
Intro
!
Intro
Thermoplastic Hoses for Ultra High Pressure
User Manual for the Application of Hose Assemblies
User Manual for the Application of Hose Assemblies
for High-Pressure Water Jet Machines
This User Manual has been prepared according to the requirements of EN 1829-2: 2008 HighPressure Water Jet machines – Safety Requirements – Part 2: Hoses, Hose Lines and Connectors. It contains instructions on the proper use of hose assemblies made by Parker Hannifin
GmbH, Polyflex Division, for high pressure water-jetting applications. Never use hose assemblies without thoroughly reading and understanding this User Manual. Any additional safety requirements issued by machine manufacturers, trade associations etc. must be complied with.
We recommend wearing protective clothing.
1. Hazard notice
2. Description
3. Marking
4. Assembly and installation, proper use
5. Storage and utilization time of hose assemblies
6. Maintenance, repair, inspection, periodic pressure tests
1. Hazard notice
Hazards due to escaping media
– Media escaping at high pressure can cause personal injury and property damage.
– The escape of flammable media can cause fire.
– The escape of toxic media can cause intoxication if these are inhaled or ingested.
Hazards because of whipping hose assemblies
– If after break of the hose assembly the pressure is not immediately reduced to zero, the
hose starts whipping, which may cause personal injury or property damage.
Hazards due to change in length of the hose assembly
– In the event of a sudden pressure change in the hose assembly, its length may change
by +-2%. This may lead to the operators losing their safe foothold.
Hazards due to incorrect behavior of operator
– Hazards may arise from the use of unsuitable substances or components by the operator, especially in case the application limits defined by the manufacturer are exceeded
(e.g. too high pressure, too high tensile loads).
2. Description
The hose assemblies are made from high-pressure hose and the corresponding fittings by
Parker Polyflex and the company’s trained and certified distributors in compliance with Parker
assembly instructions. They are pressure tested after completion. Upon customer’s request,
the hose assemblies can be equipped with protective sleeves or other safety equipment such
as containment grips.
VI
Thermoplastic Hoses for Ultra High Pressure
User Manual for the Application of Hose Assemblies
3. Marking
– The hose bears a factory marking specifying the manufacturer, the maximum working
pressure, the part number, nominal size, batch number and the date of manufacture
(quarter/year). The marking may include additional information.
– Protective sleeve has no marking as a standard.
– On its crimping shell or marking sleeve, the hose assembly bears a marking specifying
the manufacturer, the maximum working pressure, the month and year of manufacture
and the standard “EN 1829-2”.
The working pressures of both hoses and fittings are limited. In rare cases, fittings with a lower
working pressure than the hose may be used. In this case the hose assembly bears an additional warning. For the application of the hose assembly, it is not the pressure stated on the hose
but the pressure on the crimping shell and/or marking sleeve that is relevant.
4. Assembly and installation, proper use
Assembly and installation
To ensure the proper function of hose assemblies and in order not to shorten their life by additional strain, the following instructions need to be followed:
– The maximum working pressure shall not be exceeded.
– The hose shall not be bent to less than its minimum bend radius.
– Do not kink or twist hose assemblies. Especially when long hose assemblies are routed, loops
may form which can lead to kinks in the hose when pulled. Parker manufactures special fittings
(Polyflex-Lok) which minimize this problem.
– Under pressure, any hose may become shorter or longer. Change in length of Parker hoses is in
the range of approx. 2%.
– Before installing a hose assembly, make a visual inspection of the following:
o The working pressure of the hose assembly corresponds to the pressure of the
pump.
o The hose cover does not show any damage.
o The fittings do not show any signs of corrosion.
o Threads and sealing faces are not damaged or dirty.
o O-rings are available and not damaged.
– Make sure that the connecting thread of the fitting matches its counter-piece.
– Do not remove protective caps until immediately prior to assembly.
– When mounting the fitting, slightly grease the threads of the fitting and the adapter to prevent cold welding (seizing).
When putting the hose assembly into operation, slowly build up the pressure and check the
assemblies for leaks.
Proper use
Operating medium: Parker High Pressure hose assemblies are designed for use with water. For
information about use with other media, please contact your Parker distributor – Parker’s range
includes special hoses which are suitable for e.g. corrosive media.
VII
Intro
!
Intro
Thermoplastic Hoses for Ultra High Pressure
User Manual for the Application of Hose Assemblies
Temperature: The hose assemblies are designed for safe operation at temperatures from -10
to +70°C. If you wish to operate the hose assembly beyond this range, please contact your
Parker distributor. Parker’s range also includes special hoses suitable for higher temperatures.
If hose assemblies are operated at low temperatures, no problems should be expected with
the hose assemblies themselves; however, measures should be taken to prevent the operating
medium from freezing.
Trouble-shooting: Immediately eliminate any leakage on the connectors (refasten connectors,
replace O-rings, if necessary, or rework the cone).
Caution: Prior to performing any work, always relieve the pressure – never work on hose assemblies while they are under pressure. Should the leakage occur in the hose (blisters in the
hose cover, leaks at the relief holes of the fitting) put the hose assembly out of operation immediately.
Continued use of a leaky hose assembly exposes the operators to serious hazards.
Special types of application: When used in tall buildings, hose assemblies have to be supported to prevent tensile stress. If hose assemblies are used under tensile stress, this will shorten
their life.
When using hose assemblies in potentially explosive atmospheres, it needs to be considered
that Parker high-pressure hose assemblies are electrically conductive in general (from fitting to
fitting). However, neither the protective sleeves nor the hose cover are electrically conductive.
5. Storage and utilization time of hose assemblies
Even if properly stored and operated at permissible loads, hose assemblies are subject to
natural ageing. This limits their storage and utilization time. Improper storage, mechanical damage and excessive stress are the most frequent causes of failure.
For the storage of hose assemblies, the following instructions shall be followed:
– Store the hose assemblies in a cool and dry place with low levels of dust.
– Do not expose the hose assemblies to direct sunlight or UV radiation.
– Protect the hose assemblies from heat sources.
– Do not use any ozone-generating luminaries (fluorescent sources of light, mercury vapor
lamps) or electrical devices in the immediate vicinity of hose assemblies.
– Store hose assemblies stress-free and in a horizontal position.
– When storing hose assemblies in bundles, the hose shall not be bent to less than its
minimum bend radius.
– Store fittings with protective caps to prevent damage to the thread.
The maximum storage time of bulk hose is 10 years and that of completed hose assemblies is
up to 2 years. If possible, storage of hose assemblies should be avoided. The natural properties of the hose materials cause a loss of compression in the fitting, which may lead to premature leakage of the fitting.
Utilization period and replacement intervals
Parker does not limit the utilization period of a hose assembly, however it should not exceed 6
years.
Hose assemblies are used in a great variety of applications. For this reason Parker Polyflex is
unable to guarantee a specific useful life of the hose assembly in a particular application.
VIII
Thermoplastic Hoses for Ultra High Pressure
User Manual for the Application of Hose Assemblies
The following guidelines may be useful:
a) Parker Polyflex hose assemblies meet, or in most cases, exceed the requirements of
DIN EN 1829-2. This standard prescribes that hose assemblies have to resist at least
20,000 cycles from zero to working pressure. This is relevant for industrial applications
(e.g. cleaning of parts in the automotive industry) where hose assemblies are used on
a permanent basis. In this case, no periodic pressure tests are required, but periodic
visual inspections are recommended. The intervals for visual inspection and replacement must be determined by the manufacturer of the plant.
b) In the construction industry (e.g. concrete refurbishment) and in flexible guns, hose assemblies are usually exposed to additional stress (e.g. tensile loads, mechanical damage) which may considerably reduce their useful life. Therefore the tests according to
Section 6 are mandatory.
6. Maintenance, repair, inspection, periodic pressure tests
Prior to the first putting into operation and at least every six months:
Check the hose assemblies for their function and as to whether they can be safely used.
This inspection should be done by a skilled person, who due to professional training and experience has sufficient knowledge about hoses.
Scope of tests: visual inspection of the hose assemblies. Check whether the working pressure of the hose assembly corresponds to the actual working pressure of the application and
whether the hose assembly shows any visible damage. Visible damage may include:
– Damage of the hose cover (e.g. abrasion, cuts or cracks).
– Deformation beyond the natural shape of the hose assembly in depressurized or pressurized state or during bending. This may include separation of layers, blisters, crushed
or kinked hose.
– Damage or deformation of the fitting.
– Corroded fitting.
– Hose detaching from the fitting.
– Maximum storage and utilization times have been exceeded.
Daily:
– Visual inspection of the hose assemblies by the operator (see above)
Upon discovery of any visible damage, replace the hose assembly or have it approved for further use by a qualified person.
According to EN 1829-2 hose assemblies whose cover is so badly damaged that the wire reinforcement becomes visible have to be withdrawn from service. Repair of the hose cover is not
allowed.
Yearly:
In addition to the visual inspection of the hose assembly, a pressure test with 1.2 x the working
pressure has to be performed with this pressure being applied for two minutes. This pressure
test is not required for hose assemblies in continuous use (industrial plants).
Repair of hose assemblies
Parker Polyflex advises against the repair of hose assemblies as the safety of a hose assembly
that has already been in service is always reduced.
In general, repair of hose assemblies by authorized Parker Polyflex distributors is permissible
with certain restrictions. Please consult your Parker distributor.
IX
Intro
!
Intro
Thermoplastic Hoses for Ultra High Pressure
User Manual for the Application of Hose Assemblies
7. Polyflex-Lok
Polyflex-Lok is a system designed for the fast mounting of hose assemblies and/or for the connection of the hose assemblies to the pump / gun without any tools.
The system for connecting hose assemblies consists of hose assemblies (equipped with protective sleeve as a standard) with special connectors and protective caps, connection sleeves
and shells.
Assembly:
Remove the protective caps from the hose connectors.
Slightly grease the hose connectors or wet them with some water and push them into the connection sleeve up to the stop. CAUTION: Make sure that all parts are perfectly clean and free
from dirt and damage or deposits. Otherwise proper tightness and/or easy disassembly cannot
be ensured. If necessary, clean the parts prior to assembly.
Close the shells over the connection sleeve.
Pull the hose assemblies apart (important, as otherwise the protective caps cannot be mounted) and mount the protective caps between the shells and the clamping sleeves for the protective sleeve.
High-pressure hose
Clamping sleeve for protective sleeve
Shells (long)
Connecting sleeve
Hose connection with O-ring and backup ring
Protective cap / Distance holder
Protective sleeve
X
Thermoplastic Hoses for Ultra High Pressure
User Manual for the Application of Hose Assemblies
Disassembly:
Remove the protective caps.
Push the hose assemblies together up to the stop as otherwise the shells cannot be opened.
Open the shells and remove them.
Pull the hose connectors out of the connecting sleeve and immediately place the protective caps
on the hose connectors.
The Polyflex-Lok system for the connection of the hose assembly to the pump / gun is designed according to the same principle. An adapter is screwed onto the pump; a hose assembly is pushed into the adapter and fixed with shells and a cap. Here as well cleanliness is
mandatory.
Shells (short)
Adaptor
Hose connector with O-ring and backup ring
Protective cap / Distance holder
High-pressure hose
Protective sleeve
Clamping sleeve for protective sleeve
XI
Intro
!
Intro
Thermoplastic Hoses for Ultra High Pressure
Parker Hannifin – Polyflex Division
Parker Hannifin – Polyflex Division
Parker Hannifin offers an extensive programme of systems and components for fluid
technology. Parker is structured by sales offices and manufacturing divisions to guarantee optimum focus on our customers' demands and market interests at any time.
The Polyflex division, with headquarters located in Hüttenfeld, Germany, provides
thermoplastic hoses and tubes. These are applied in a variety of different markets
such as standard hydraulics, ultra high pressure applications, and oil & gas industry.
As a market leader in many areas and with a unique product range we are pleased to
assist you with all your queries.
This catalogue includes hoses for high and ultra high pressure applications. The
indicated fittings are always adapted to the correspondent hose and offer optimum
performance.
Other catalogues with thermoplastic hoses
Catalogue 4460-UK
Catalogue 4465-UK
XII
Thermoplastic Hoses for Ultra High Pressure
Why use Parker thermoplastic hoses?
Why use Parker thermoplastic hoses?
Parker thermoplastic hose is the right answer for many technical challenges. With
unique features and performance characteristics thermoplastic hose outrivals even
established alternatives. Whether the task requires extreme temperatures, pressures,
robustness or special custom designs, these hoses will not disappoint you.
See below the benefits offered by our complete hose range – also products featured
in other catalogs – shown in comparison to other standard hose types :
Temperature Range
• Operating temperatures ranging from
-50°C up to +230°C
• Best choice for dynamic applications even
at very low temperatures
• Full working pressure even at extreme
temperatures
Chemical Resistance
• Chemically inert, no interaction with the
media
• Resistant against virtually all acids and
alkalines
XIII
Intro
!
Intro
Thermoplastic Hoses for Ultra High Pressure
Why use Parker thermoplastic hoses?
Abrasion
• Outer covers to withstand extreme wear
• Superior resistance and extended service
life
UV / Ozone & Seawater Resistance
• Build for harsh and exposed installations
• Environmental influences have minimal
effect on hose life
Compact OD
• Space saving due to very small diameters
• Optimized routing and design in constricted
installation spaces
• Prevent using overdimensioned hoses
XIV
Thermoplastic Hoses for Ultra High Pressure
Why use Parker thermoplastic hoses?
Small ID
• Only thermoplastic hoses allow small
IDs down to below 2mm
• Space saving
• Offers improved technical solutions in
constricted installation spaces
Low Weight
• Major weight savings
• Energy savings as less mass needs to be
moved
Non-Conductive
• Mandatory safety feature for applications
with high voltage and high frequency
• Electrically isolating according to SAE J517
XV
Intro
!
Intro
Thermoplastic Hoses for Ultra High Pressure
Why use Parker thermoplastic hoses?
Customization
• Multiple colors
• Twin and multiple lines
• Hose bundles
• Customer specific designs
Preforming
• Combining the advantages of bent metal
pipe with the flexibility of hose
• Reducing weight, noise and vibration
compared to bent metal pipe solutions
• Preformed hoses are maintaining their full
technical specifications
Cleanliness
• Less abrasion and contamination inside
the hose
• Reduced residue build up
• Extended lifetime for filters, valves and
hydraulic systems
XVI
Thermoplastic Hoses for Ultra High Pressure
Why use Parker thermoplastic hoses?
Permeation Resistance
• Low gas permeation
• Reduced ingression reduced risk of media
contamination
Long Length
• Up to 5,000 m and more continuous length
• Reduced scrap of bulk hose
• Easy winching and handling offer fast
deployment of long length
Highest Pressure
• Up to 4,000 bar working pressure
• Highest technical standards and production
controls assure safety
XVII
Intro
!
Intro
Thermoplastic Hoses for Ultra High Pressure
Why use Parker thermoplastic hoses?
Wide range of applications
• Standard hydraulics
• Hydraulic control
• Industrial hydraulics e.g.
• Chemical injection
– alternative energies
• BOP Control
– machine tools
• Hydraulic lines on Subsea BOPs
– injection molding
• Hot lines from vessel or rig
to Subsea BOP
• Mobile hydraulics e.g.
– material handling
• Hydrostatic testing
– construction
• Equipment maintenance
– agriculture
• Well equipment testing
• Automotive and truck industry
• Mini hydraulics
• Lubrication
• Chemical industry
• Process industry
• Industrial gases
• Alternative fuels
• Boats and yachts
• Pneumatics
• Life Science
• Media transfer
• Sewer Cleaning
• Water jetting
• Water blasting
• Water cutting
• Hydro testing
• Bolt tensioning
• Hydraulic jacking
• Rescue equipment
XVIII
• Cementing operations
acc. to API 7K FSL 0
• Acidizing
• General Fluid and Gas Injection
• Mud Circulation
• Jumpers
• Flying Leads
• Electro/Hydraulic Workover
• Pipeline Testing
Thermoplastic Hoses for Ultra High Pressure
Value added services
Value added services
Parker Polyflex and the Parker Sales Companies offer value
added services that compliment our production capabilities and product portfolio. These services are in place to
meet the increasing customization and system criteria that
our customers expect from a world-class supplier.The value
added services detailed below are typical of the products and
secondary services that we provide to our customers. If you
have additional service needs that we have not detailed below please contact us. We are happy to discuss all potential
solutions for your requirements.
ParkerStore™
At Parker Hannifin, we’re continually looking for ways
to deliver more products, more efficiently.
The Global ParkerStore™ network enables Parker
to provide:
• Prompt, efficient, professional in-store services
while you wait
• Expert local services and support
• A safe, friendly and convenient shopping
environment
• A greater range of parts options so you get
exactly what you’re looking for.
Customers trust ParkerStores to provide OEM and MRO customers with direct access to:
• Custom-made hydraulic hose assemblies and
complementary products to support their applications
and decrease their downtime
• Expert technical support
• Professional, personalized services, including
24/7/365 support
• The convenience, comfort and amenities of a local
service provider.
XIX
Intro
!
Intro
Thermoplastic Hoses for Ultra High Pressure
Value added services
The Parker® Tracking System Enterprise (PTS)
is designed to help customers reduce vehicle or asset
down-time through increases in the speed, timing and
accuracy of necessary repairs. PTS provides a unique
8 digit identification code and bar code printed on a
durable label for each hose assembly. PTS labels are
specifically engineered to withstand harsh chemicals,
temperatures, UV exposure and other challenging
conditions.
• PTS captures, records and recalls unique hose assembly
information – on demand
• Provides fast and accurate product indentification to
speed up replacement regardless of where the original
assembly was made.
• Assembly can be replaced with only the 8 digit PTS ID
number/bar code eliminating the need to remove hoses
prior to replacement. This can provide critical machine
uptime and enable more conveniently scheduled repair.
• PTS includes additional reporting tools to assist in
continuous improvement programmes and preventative
maintenance initiatives.
Parker HOSE DOCTORS
are a network of independently-owned, mobile service
technicians built around the commitment to identify
and replace hose assemblies wherever their customers
need them, with the fastest response times possible.
HOSE DOCTORS® are an extension of the worldwide
Parker distribution network, coupling their service
commitment with Parker products – the highest quality
hoses and fittings available in the market today.
Parker Store Container Service
The ParkerStore container is a transportable workshop,
providing on-site maintenance and product support
for large construction projects such as roadworks,
tunnels, railways, underground systems, etc. Provides
an on-site product and hose replacement service. With
this service on your site, you can reduce your downtime
keeping your project on time and on budget!
XX
Thermoplastic Hoses for Ultra High Pressure
Value added services
Tech Services
Optimises the performance of your hydraulic and pneumatic
circuits
• With Parker Tech Services involved, your time to market is shorter, which saves on development costs
• The 3 year no-leak guarantee enhances your reputation and lowers your warranty costs
• More reliable operation lowers your customer’s operating costs
• More efficient performance and no-leak guarantee is
beneficial to the environment
• Parker worldwide coverage ensures you can use the
service and save costs wherever you are
Breadman
Lean logistics and delivery of Parker products and kits directly
to the customer’s assembly line, work stations or warehouse
• 100 % parts availability minimises downtime, increases production and reduces costs
• Elimination of stock checking reduces manpower and
maintains production levels
• Daily delivery reduces inventory and overheads
• Electronic order processing eliminates paperwork and
reduces administration costs
Kitting
Multiple components are supplied under a single part number
• Reduced number of suppliers
• Reduced stocks and no obsolete items
• Optimized management (stock and supplies)
• Simplified and optimised order handling
• Reduced assembly costs
• Greater productivity
XXI
Intro
!
Intro
Thermoplastic Hoses for Ultra High Pressure
Value added services
Hose & Fitting Selection Database
• Always the right hose and fitting combination
• Accessories corresponding to the selected hose
• Frequent updates for new hose-fitting combinations and accessories
XXII
A
Hose and Fitting Selection
Table of contents
General Information
Hose selection chart by working pressure – design factor >2:1 ........... A-2
Hose selection chart by working pressure – design factor 4:1 ............. A-4
Hose fitting chart ................................................................................... A-5
A-1
Catalogue 4462 Global Edition
Selection
Chapter A
Hose selection chart
by working pressure – design factor >2:1
3
-02
120
150
[17,400] [21,750]
5
-03
4.8 3/16
100
140
[14,500] [20,300]
6
-04
6.4
110
[15,950]
8
-05
7.9 5/16
9.5
1/4
100
[14,500]
12 -08 12.7 1/2
20
[2,900]
25
[3,625]
20 -12 19.0 3/4
20
[2,900]
25
[3,625]
25 -16 25.4
20
[2,900]
25
[3,625]
20
25
[3,625]
2580N
2388N (size -08)
2380M
100
[14,500]
86
[12,470]
160
[23,200]
88
[12,760]
110
140
[15,950] [20,300]
TX / PL
KX / LX
BS
BS
KX
BS
BL
120
[17,400]
TX / PL
Page
100
[14,500]
EH / EJ
32 -20 31.8 1 1/4 [2,900]
Fitting series
110
128
110
[15,950] [18,560] [15,950]
3/8
1
2388N (size -04)
110
[15,950]
4 -025 4.0 5/32
10 -06
2380N
1/8
2244N
3.2
2248D-TC
inch
2240D-TC
mm
ESH
Nominal size
DN size
ESH250Plus
Working pressure MPa [psi]
EH / NC
Selection
Hose and Fitting Selection
Hose selection chart by working pressure – design factor >2:1
C-2
C-5
C-8
C-9
C-16
C-19
C-20
C-25
C-27
C-30
A-2
Catalogue 4462 Global Edition
A
Selection
Hose and Fitting Selection
Hose selection chart by working pressure – design factor >2:1
2849D
2848D
2841D
2840D
2749D
2748D
2748D 2nd cover
2741D
2740D
2648N
2640D
2640N
2448D-TC
2440D-TC
2440D
2440N
Working pressure MPa [psi]
207
[30,000]
220
220
301
280
[31,900] [31,900] [43,640] [40,600]
300
[43,500]
180
180
[26,100] [26,100]
250
[36,250]
280
[40,600]
164
164
[23,780] [23,780]
250
[36,250]
150
150
[21,750] [21,750]
210
[30,450]
250
250
280
301
300
300
320
380
[36,250] [36,250] [40,600] [43,645] [43,500] [43,500] [46,400] [55,000]
130
[18,850]
180
[26,100]
200
[29,000]
100
[14,500]
140
160
[20,300] [23,200]
90
[13,050]
120
150
[17,400] [21,750]
301
400
[43,645] [58,000]
140
[20,300]
LX
LX
JX / 2X / 5X
JX / CX
2X / HX
2X / HX
2X / HX
2X / HX
2X / WX
2X / WX
2X / WX
WX
300
[43,500]
LX
250
[36,250]
C-33
C-34
C-46
C-49
C-56
C-58
C-59
C-60
C-62
C-67
C-68
C-69
C-72
A-3
Catalogue 4462 Global Edition
-025
4.0
5/32
5
-03
4.8
3/16
6
-04
6.4
1/4
8
-05
7.9
5/16
10
-06
9.5
3/8
12
-08
12.7
1/2
20
-12
19.0
3/4
25
-16
25.4
1
32
-20
31.8
1 1/4
Fitting series
Page
75
[10,875]
75
[10,875]
69
[10,000]
70
[10,150]
70
[10,150]
80
[11,600]
2580N-MSHA
4
62.5
[9,060]
69
[10,000]
53.5
[7,755]
57.5
[8,337]
70
[10,150]
55
[7,975]
55
[7,975]
70
[10,150]
27.5
[3,990]
27.5
[3,990]
BL
1/8
2388N
3.2
8X / NX
-02
2380N-MSHA
3
8X
inch
2380N
mm
8X / LX / NX
size
2244N
DN
8X / NX
Nominal size
2022N
Hose selection chart
by working pressure – design factor 4:1
8X / 3X
Selection
Hose and Fitting Selection
Hose selection chart by working pressure – design factor 4:1
B-2
B-5
B-18
B-25
B-27
B-33
A-4
Catalogue 4462 Global Edition
A
Hose fitting chart
Fitting
Fitting
description
Fitting
designation
National Pipe Tapered (NPT) male
01
National Pipe Tapered (NPT) female
02
JIC male
03
UNF male with O-ring
05
JIC female swivel
06
NPSM female swivel
07
Metric female swivel light series
C3
Metric female swivel heavy series
C6
Metric female swivel heavy series with O-ring
C9
Metric female swivel heavy series with O-ring
45° elbow
0C
Metric female swivel heavy series with O-ring
90° elbow
1C
Metric male heavy series
D2
A-5
Catalogue 4462 Global Edition
Selection
Hose and Fitting Selection
Hose fitting chart
Selection
Hose and Fitting Selection
Hose fitting chart
Hose fitting chart
Fitting
Fitting
description
Fitting
designation
BSP female swivel (60° cone)
92
BSP female swivel (ballnose)
U0
BSP male
D9 or 3B
BSP male for USIT ring
Y9
Type “M” female swivel
AY
Medium pressure tube nipple
Y2
Medium pressure female swivel
5Y
High pressure female swivel
6Y
High pressure tube nipple
UNF-LH thread
Y4 or YA
High pressure tube nipple
metric-LH thread
YM
BSP male nozzle nipple
YB
Metric male nozzle nipple
YZ
A-6
Catalogue 4462 Global Edition
A
Hose fitting chart
Fitting
Fitting
description
Fitting
designation
UNF female for water jetting nozzle (left hand)
HY (-LH)
Male water jetting nozzle
3Z or ZE
Female water jetting nozzle
EZ
UNF male nozzle nipple
YH
SAE code 61 flange
15
SAE code 61 flange 45° elbow
17
SAE code 61 flange 90° elbow
19
SAE code 62 flange
6A
SAE code 62 flange 45° elbow
6F
SAE code 62 flange 90° elbow
6N
Metric female swivel 59° cone
MR
A-7
Catalogue 4462 Global Edition
Selection
Hose and Fitting Selection
Hose fitting chart
Selection
Hose and Fitting Selection
Notes
A-8
Catalogue 4462 Global Edition
B
Hoses with design factor 4:1
Table of contents
Hoses with design factor 4:1
Hose
2022N – High pressure hose – electrically non-conductive................. B-2
2244N – High pressure hose................................................................ B-5
2380N – High pressure hose .............................................................. B-18
2380N-MSHA – High pressure mining hose ...................................... B-25
2388N – High pressure hose.............................................................. B-27
2580N-MSHA – High pressure mining hose ....................................... B-33
B-1
Catalogue 4462 Global Edition
Design Factor 4:1
Chapter B
Hoses with design factor 4:1
2022N
2022N – High pressure hose
Design Factor 4:1
electrically non-conductive
CONSTRUCTION
Core tube
: Polyamide 11, methanol washed
Pressure reinforcement : Two braided layers of high tensile aramid fibre
Cover
Standard colour
TEMPERATURE RANGE
: Sea water resistant TPU
: Orange
-40°C up to +55°C
DN
size
mm
inch
mm
MPa
psi
MPa
psi
mm
kg/m
2022N-04V15-10K
6
-04
6.4
1/4
13.8
69.0
10,000
276
40,000
100
0.14
2022N-06V15-10K
10
-06
9.7
3/8
19.0
69.0
10,000
276
40,000
100
0.24
NOTES
–
B-2
Catalogue 4462 Global Edition
B
Hoses with design factor 4:1
1068X / 1063X – 1928X / 1923X
MATERIAL
Carbon Steel, zinc plated
C: Stainless steel (AISI 316), other materials on request.
DN
size mm inch
A
B
*
Nipple Ferrule
ID
OD
mm
mm
mm
MPa
psi
mm
mm
7/16 - 20 UNF
57
26
19
69
10,000
2.8
18.4
1/4
1/2 - 20 UNF
55
24
19
80
11,600
3.6
18.4
1/4
9/16 - 18 UNF
55
24
19
80
11,600
3.6
18.4
3/8
9/16 - 18 UNF
69
33
22
69.0 10,000
5.3
23.2
1068X-4-04
6
-04 6.4
1/4
1068X-5-04
6
-04 6.4
1068X-6-04C
6
-04 6.4
1063X-6-06C
10
-06 9.5
1928X / 1923X – BSP female swivel (60° cone)
MATERIAL
Stainless steel (AISI 316), other materials on request.
DN
size mm inch
A
B
*
Nipple Ferrule
ID
OD
mm
mm
mm
MPa
mm
mm
1928X-6-04C
6
-04 6.4
1/4
G 1/4
56
25
19
69.0 10,000
3.6
18.4
1923X-8-06C
10
-06 9.5
3/8
G 1/2
66
22
30
69.0 10,000
5.3
23.2
B-3
psi
Catalogue 4462 Global Edition
Design Factor 4:1
1068X / 1063X – JIC female swivel
Hoses with design factor 4:1
1C98X / 1C93X
1C98X / 1C93X – Metric female swivel
Design Factor 4:1
Heavy series
MATERIAL
Stainless steel (AISI 316), other materials on request.
DN
B
*
Nipple Ferrule
ID
OD
mm
mm
mm
MPa
mm
mm
6
-04 6.4
1/4
M16 x 1.5
59
27
19
69.0 10,000
3.6
18.4
1C98X-10-04C
6
-04 6.4
1/4
M18 x 1.5
65
33
22
69.0 10,000
3.6
18.4
1C93X-14-06C
10
-06 9.5
3/8
M22 x 1.5
75
30
30
69.0 10,000
5.3
23.2
1C93X-16-06C
10
-06 9.5
3/8
M24 x 1.5
88
34
30
69.0 10,000
5.3
23.2
1C98X-8-04C
size mm inch
A
B-4
psi
Catalogue 4462 Global Edition
B
Hoses with design factor 4:1
2244N
CONSTRUCTION
Core tube
: Polyamide
Pressure reinforcement : Two spiral layers, one braided layer of high tensile steel
wire
Cover
Standard colour
TEMPERATURE RANGE
: Polyurethane, DN32: Polyamide
: Black
-40°C up to +100°C
DN
size
mm
inch
mm
MPa
psi
MPa
psi
mm
kg/m
2244N-025V00
4
-025
3.9
5/32
9.6
75.0
10,875
300
43,500
55
0.19
2244N-06V00
10
-06
9.8
3/8
18.0
53.5
7,755
215
31,175
120
0.50
2244N-08V10
12
-08
12.9
1/2
22.7
55.0
7,975
220
31,900
150
0.80
2244N-20V30
32
-20
31.8
1 1/4
44.0
27.5
3,990
110
15,950
400
1.83
NOTES
–
B-5
Catalogue 4462 Global Edition
Design Factor 4:1
2244N – High pressure hose
Hoses with design factor 4:1
1C38X
A
1C38X – Metric female swivel light series
B
Design Factor 4:1
J
MATERIAL
Carbon steel, zinc plated
A
B
*
Nipple Ferrule
ID
OD
DN
size mm inch
mm
mm
mm
MPa
psi
mm
mm
1C38X-8-06
10
-06 9.5
3/8
M14x1.5
61
21
19
42.0
6,090
6.8
23.8
1C38X-10-06
10
-06 9.5
3/8
M16x1.5
49
20
22
57.5
8,340
6.8
23.8
1C38X-12-06
10
-06 9.5
3/8
M18x1.5
48
19
22
57.5
8,340
6.8
23.8
1C38X-12-08
12
-08 12.7 1/2
M18x1.5
52
20
24
55.0
7,975
8.8
29.5
1C38X-15-08
12
-08 12.7 1/2
M22x1.5
51
20
27
55.0
7,975
8.8
29.5
A
1C38X – Metric female swivel light series
With stainless steel nipple
MATERIAL
B
J
Carbon steel, zinc plated (shell and nut)
stainless steel nipple (material 1.4301)
A
B
*
Nipple Ferrule
ID
OD
DN
size mm inch
mm
mm
mm
MPa
psi
mm
mm
1C38X-10-06C2W
10
-06 9.5
3/8
M16x1.5
49
20
22
57.5
8,340
6.8
23.8
1C38X-12-06C2W
10
-06 9.5
3/8
M18x1.5
48
19
22
57.5
8,340
6.8
23.8
1C38X-12-08C2W
12
-08 12.7 1/2
M18x1.5
52
20
24
55.0
7,975
8.8
29.5
1C38X-15-08C2W
12
-08 12.7 1/2
M22x1.5
51
20
27
55.0
7,975
8.8
29.5
B-6
Catalogue 4462 Global Edition
B
Hoses with design factor 4:1
1C68X – 1C98X / 1C9NX
A
1C68X – Metric female swivel heavy series
MATERIAL
Carbon steel, zinc plated
A
B
*
Nipple Ferrule
ID
OD
DN
size mm inch
mm
mm
mm
MPa
psi
mm
mm
1C68X-14-06
10
-06 9.5
3/8
M22x1.5
64
24
27
63.0
9,135
6.8
23.8
1C68X-16-08
12
-08 12.7 1/2
M24x1.5
67
24
30
55.0
7,975
8.8
29.5
A
1C98X / 1C9NX – Metric female swivel
heavy series with O-ring
B
J
ISO 12151-2
MATERIAL
Carbon steel, zinc plated
DN
size mm inch
A
B
*
Nipple Ferrule
ID
OD
mm
mm
mm
MPa
mm
mm
5/32
M16x1.5
54
27
19
75.0 10,875
2.3
13.2
-06 9.5
3/8
M20x1.5
70
30
24
63.0
9,135
6.8
23.8
-06 9.5
3/8
M22x1.5
71
30
27
63.0
9,135
6.8
23.8
12
-08 12.7 1/2
M24x1.5
78
35
30
63.0
9,135
8.8
29.5
32
-20 31.8 1 1/4
M52x2
113
52
60
44.0
6,380
25.3
50.0
1C98X-8-025
4
-025
1C98X-12-06
10
1C98X-14-06
10
1C98X-16-08
1C9NX-38-20
4
B-7
psi
Catalogue 4462 Global Edition
Design Factor 4:1
B
J
Hoses with design factor 4:1
10C8X – 11C8X
J
ISO 12151-2
MATERIAL
A
B
E
Carbon steel, zinc plated
A
B
E
*
Nipple Ferrule
ID
OD
DN
size mm inch
mm
mm
mm
mm
MPa
psi
mm
mm
10C8X-12-06
10
-06 9.5
3/8
M20x1.5
81
40
19
24
63.0
9,135
6.8
23.8
10C8X-14-06
10
-06 9.5
3/8
M22x1.5
81
40
19
27
63.0
9,135
6.8
23.8
10C8X-16-08
12
-08 12.7 1/2
M24x1.5
96
53
23
30
63.0
9,135
8.8
29.5
A
11C8X – Metric female swivel heavy series
with O-ring, 90° elbow
B
ISO 12151-2
E
Design Factor 4:1
10C8X – Metric female swivel heavy series
with O-ring, 45° elbow
MATERIAL
Carbon steel, zinc plated
J
A
B
E
*
Nipple Ferrule
ID
OD
DN
size mm inch
mm
mm
mm
mm
MPa
psi
mm
mm
11C8X-14-06
10
-06 9.5
3/8
M22x1.5
71
30
36
27
63.0
9,135
6.8
23.8
11C8X-16-08
12
-08 12.7 1/2
M24x1.5
85
42
44
30
63.0
9,135
8.8
29.5
B-8
Catalogue 4462 Global Edition
B
Hoses with design factor 4:1
1D28X – 1928X
A
1D28X – Metric male heavy series
MATERIAL
Carbon steel, zinc plated
H
A
B
(
Nipple Ferrule
ID
OD
DN
size mm inch
mm
mm
mm
MPa
psi
mm
mm
1D28X-12-06
10
-06 9.5
3/8
M20x1.5
69
29
22
63.0
9,135
6.8
23.8
1D28X-14-06
10
-06 9.5
3/8
M22x1.5
71
31
22
63.0
9,135
6.8
23.8
1D28X-16-08
12
-08 12.7 1/2
M24x1.5
74
31
24
63.0
9,135
8.8
29.5
1D2NX-38-20
32
-20 31.8 1 1/4
M52x1.5
106
34
55
44.0
6,380
25.3
50.0
A
1928X – BSP female swivel (60° cone)
J
MATERIAL
B
Carbon steel, zinc plated
A
B
*
Nipple Ferrule
ID
OD
DN
size mm inch
mm
mm
mm
MPa
mm
mm
1928X-4-025
4
-025 4.0 5/32
G 1/4
48
20
19
75.0 10,875
2.3
13.2
1928X-6-06
10
-06 9.5
3/8
G 3/8
59
19
22
57.5
8,340
6.8
23.8
1928X-8-06
10
-06 9.5
3/8
G 1/2
60
20
27
57.5
8,340
6.8
23.8
1928X-8-08
12
-08 12.7 1/2
G 1/2
63
20
27
55.0
7,975
8.8
29.5
B-9
psi
Catalogue 4462 Global Edition
Design Factor 4:1
B
ISO 12151-2
Hoses with design factor 4:1
1U08X
A
1U08X – BSP female swivel (ballnose)
B
Design Factor 4:1
J
MATERIAL
Carbon steel, zinc plated
A
B
*
Nipple Ferrule
ID
OD
DN
size mm inch
mm
mm
mm
MPa
psi
mm
mm
1U08X-6-06
10
-06 9.5
3/8
G 3/8
61
20
22
57.5
8,340
6.8
23.8
1U08X-8-06
10
-06 9.5
3/8
G 1/2
61
20
27
53.5
7,755
6.8
23.8
1U08X-8-08
12
-08 12.7 1/2
G1/2
61
22
27
55.0
7,975
6.8
23.8
1U0NX-24-20
32
-20 31.8 1 1/4
G 1 1/2
91
30
55
27.5
3,988
25.3
50.0
A
1U08X – BSP female swivel (ballnose)
MATERIAL
B
J
With stainless steel nipple
Carbon steel, zinc plated (shell and nut)
stainless steel nipple (material 1.4301)
A
B
*
Nipple Ferrule
ID
OD
DN
size mm inch
mm
mm
mm
MPa
psi
mm
mm
1U08X-6-06C2W
10
-06 9.5
3/8
G 3/8
61
20
22
57.5
8,340
6.8
23.8
1U08X-8-06C2W
10
-06 9.5
3/8
G 1/2
61
20
27
53.5
7,755
6.8
23.8
1U08X-8-08C2W
12
-08 12.7 1/2
G1/2
61
22
27
55.0
7,975
8.8
29.5
B-10
Catalogue 4462 Global Edition
B
Hoses with design factor 4:1
13B8X / 13BNX – 1018X
A
13B8X / 13BNX – BSP male
Carbon steel, zinc plated
H
A
B
(
Nipple Ferrule
ID
OD
DN
size mm inch
mm
mm
mm
MPa
mm
mm
13B8X-4-025
4
-025 4.0 5/32
G 1/4
57
30
17
75.0 10,875
psi
2.3
13.2
13B8X-6-06
10
-06 9.5
3/8
G 3/8
71
30
22
57.5
8,340
6.8
23.8
13B8X-8-06
10
-06 9.5
3/8
G 1/2
76
35
22
57.5
8,340
6.8
23.8
13B8X-8-08
12
-08 12.7 1/2
G 1/2
79
35
24
55.0
7,974
8.8
29.5
13BNX-24-20
32
-20 31.8 1 1/4
G 1 1/2
118
57
55
44.0
6,380
25.3
50.0
A
1018X – NPT male
MATERIAL
B
Carbon steel, zinc plated
H
A
B
(
DN
size mm inch
mm
mm
mm
4
-025 4.0 5/32
1/8 NPT
51
24
8
1018X-4-025
4
-025 4.0 5/32
1/4 NPT
59
32
1018X-6-06
10
-06 9.5
3/8
3/8 NPT
71
31
1018X-8-06
10
-06 9.5
3/8
1/2 NPT
76
1018X-8-08
12
-08 12.7 1/2
1/2 NPT
79
1018X-2-025
B-11
Nipple Ferrule
ID
OD
mm
mm
75.0 10,875
MPa
psi
2.3
13.2
13
75.0 10,875
2.3
13.2
19
103.4 15,000
6.8
23.8
36
22
103.4 15,000
6.8
23.8
37
22
103.4 15,000
8.8
29.5
Catalogue 4462 Global Edition
Design Factor 4:1
MATERIAL
B
Hoses with design factor 4:1
1038X / 103NX – 1068X / 106NX
A
Design Factor 4:1
1038X / 103NX – JIC male
MATERIAL
B
Carbon steel, zinc plated
H
A
B
(
Nipple Ferrule
ID
OD
DN
size mm inch
mm
mm
mm
MPa
psi
mm
mm
1038X-6-06
10
-06 9.5
3/8
9/16 - 18UNF
70
30
22
53.5
7,755
6.8
23.8
1038X-8-06
10
-06 9.5
3/8
3/4 - 16UNF
74
34
22
69.0 10,000
6.8
23.8
1038X-8-08
12
-08 12.7 1/2
3/4 - 16UNF
77
35
22
69.0 10,000
8.8
29.5
1038X-10-08
12
-08 12.7 1/2
7/8 - 14UNF
83
40
24
55.0
7,974
8.8
29.5
103NX-24-20
32
-20 31.8 1 1/4 1 7/8 - 12UNF
110
49
50
44.0
6,380
25.3
50.0
A
1068X / 106NX – JIC female swivel
MATERIAL
B
Carbon steel, zinc plated, C: Stainless steel
J
A
B
*
Nipple Ferrule
ID
OD
DN
size mm inch
mm
mm
mm
MPa
psi
mm
mm
4
-025 4.0 5/32
7/16 - 20 UNF
55
27
14
69
10,000
2.3
13.2
1068X-6-025
4
-025 4.0 5/32
9/16 - 18 UNF
51
24
19
75
10,875
2.3
13.2
1068X-6-06
10
-06 9.5
3/8
9/16 - 18 UNF
59
18
22
69
10,000
6.8
23.8
1068X-6-06C
10
-06 9.5
3/8
9/16 - 18 UNF
59
18
22
69
10,000
6.8
23.8
1068X-8-06
10
-06 9.5
3/8
3/4 - 16 UNF
59
19
24
69
10,000
6.8
23.8
1068X-8-08
12
-08 12.7 1/2
3/4 - 16 UNF
64
21
27
69
10,000
8.8
29.5
1068X-8-08C
12
-08 12.7 1/2
3/4 - 16 UNF
64
21
27
69
10,000
8.8
29.5
1068X-10-08
12
-08 12.7 1/2
7/8 - 14 UNF
62
19
27
69
10,000
8.8
29.5
106NX-20-20
32
-20 31.8 1 1/4 1 5/8 - 12 UNF
104
44
50
44
6,380
25.3
50.0
1068X-4-025
B-12
Catalogue 4462 Global Edition
B
Hoses with design factor 4:1
1078X
A
1078X – NPSM female swivel
J
MATERIAL
Carbon steel, zinc plated, C: Stainless steel
A
B
*
Nipple Ferrule
ID
OD
DN
size mm inch
mm
mm
mm
MPa
psi
mm
mm
1078X-6-06
10
-06 9.5
3/8
3/8 - 18NPSM
50
21
22
57.5
8,340
6.8
23.8
1078X-6-06C
10
-06 9.5
3/8
3/8 - 18NPSM
50
21
22
57.5
8,340
6.8
23.8
1078X-8-08
12
-08 12.7 1/2
1/2 - 14NPSM
50
19
27
55.0
7,975
8.8
29.5
1078X-8-08C
12
-08 12.7 1/2
1/2 - 14NPSM
50
19
27
55.0
7,975
8.8
29.5
A
1078X – NPSM female swivel
With stainless steel nipple
MATERIAL
B
J
Carbon steel, zinc plated
stainless steel nipple (material 1.4301)
A
B
*
Nipple Ferrule
ID
OD
DN
size mm inch
mm
mm
mm
MPa
psi
mm
mm
1078X-6-06C2W
10
-06 9.5
3/8
3/8 - 18NPSM
50
21
22
57.5
8,340
6.8
23.8
1078X-8-08C2W
12
-08 12.7 1/2
1/2 - 14NPSM
50
19
27
55.0
7,975
8.8
29.5
B-13
Catalogue 4462 Global Edition
Design Factor 4:1
B
Hoses with design factor 4:1
1AY8X – 1158X / 115NX
A
MATERIAL
1AY8X-6-025
B
J
Carbon steel, zinc plated
DN
size mm inch
4
-025 4.0 5/32
9/16 - 18 UNF
Nipple Ferrule
ID
OD
A
B
*
mm
mm
mm
MPa
psi
mm
mm
56
28
19
75
10,875
2.3
13.2
A
1158X / 115NX – SAE code 61 flange
B
ISO 12151-3
D
Design Factor 4:1
1AY8X – Type “M” female swivel
MATERIAL
Carbon steel, zinc plated
A
B
D
Nipple Ferrule
ID
OD
DN
size mm inch
mm
mm
mm
MPa
psi
mm
mm
1158X-8-08
12
-08 12.7 1/2
87
44
30
21
3,000
8.8
29.5
115NX-20-20
32
-20 31.8 1 1/4 117
56
51
21
3,000
25.3
50.0
B-14
Catalogue 4462 Global Edition
B
Hoses with design factor 4:1
1178X / 117NX – 1198X / 119NX
A
1178X / 117NX – SAE code 61 flange 45° elbow
B
E
Carbon steel, zinc plated
D
MATERIAL
A
B
D
E
Nipple Ferrule
ID
OD
DN
size mm inch
mm
mm
mm
mm
MPa
psi
mm
mm
1178X-8-08
12
-08 12.7 1/2
95
53
30
20
55.0
7,974
8.8
29.5
117NX-20-20
32
-20 31.8 1 1/4 174
113
51
37
44.0
6,380
25.3
50.0
1198X / 119NX – SAE code 61 flange 90° elbow
B
A
E
ISO 12151-3
MATERIAL
Carbon steel, zinc plated
D
A
B
D
E
Nipple Ferrule
ID
OD
DN
size mm inch
mm
mm
mm
mm
MPa
psi
mm
mm
1198X-8-08
12
-08 12.7 1/2
78
35
30
44
55.0
7,974
8.8
29.5
119NX-20-20
32
-20 31.8 1 1/4 165
104
51
82
44.0
6,380
25.3
50.0
B-15
Catalogue 4462 Global Edition
Design Factor 4:1
ISO 12151-3
Hoses with design factor 4:1
16A8X / 16ANX – 16F8X / 16FNX
A
16A8X / 16ANX – SAE code 62 flange
B
D
MATERIAL
Carbon steel, zinc plated
A
B
D
Nipple Ferrule
ID
OD
DN
size mm inch
mm
mm
mm
MPa
psi
mm
mm
16A8X-8-08
12
-08 12.7 1/2
88
45
32
55.0
7,974
8.8
29.5
16ANX-20-20
32
-20 31.8 1 1/4 126
65
54
44.0
6,380
25.3
50.0
A
16F8X / 16FNX – SAE code 62 flange
45° elbow
B
ISO 12151-3
MATERIAL
E
Design Factor 4:1
ISO 12151-3
Carbon steel, zinc plated
A
B
D
E
Nipple Ferrule
ID
OD
DN
size mm inch
mm
mm
mm
mm
MPa
psi
mm
mm
16F8X-8-08
12
-08 12.7 1/2
95
52
32
21
55.0
7,974
8.8
29.5
16FNX-20-20
32
-20 31.8 1 1/4 180
119
54
44
44.0
6,380
25.3
50.0
B-16
Catalogue 4462 Global Edition
B
Hoses with design factor 4:1
16A8X / 16ANX – 16N8X / 16NNX
A
16N8X / 16NNX – SAE code 62 flange
90° elbow
E
ISO 12151-3
MATERIAL
Carbon steel, zinc plated
A
B
D
E
Nipple Ferrule
ID
OD
DN
size mm inch
mm
mm
mm
mm
MPa
psi
mm
mm
16N8X-8-08
12
-08 12.7 1/2
87
44
32
41
55.0
7,974
8.8
29.5
16NNX-20-20
32
-20 31.8 1 1/4 165
104
54
91
44.0
6,380
25.3
50.0
B-17
Catalogue 4462 Global Edition
Design Factor 4:1
B
Hoses with design factor 4:1
2380N
Design Factor 4:1
2380N – High pressure hose
CONSTRUCTION
Core tube
: Polyamide
Pressure reinforcement : Two spiral layers and two open spiral layers of high
tensile steel wire
Cover
Standard colour
TEMPERATURE RANGE
: Polyurethane, DN32: Polyamide
: Black
-40°C up to +100°C
DN
size
mm
inch
mm
MPa
psi
MPa
psi
mm
kg/m
2380N-025V10
4
-025
3.9
5/32
9.7
75.0
10,875
300
43,500
55
0.16
2380N-04V00
6
-04
6.3
1/4
13.3
70.0
10,150
280
40,600
70
0.27
2380N-05V00
8
-05
8.3
5/16
15.8
62.5
9,060
250
36,250
90
0.35
2380N-06V10
10
-06
9.8
3/8
17.9
57.5
8,337
230
33,350
120
0.44
2380N-08V10
12
-08
12.9
1/2
22.9
55.0
7,975
220
31,900
150
0.68
2380N-20V30
32
-20
31.8
1 1/4
44.0
27.5
3,985
110
15,950
400
1.83
NOTES
–
B-18
Catalogue 4462 Global Edition
B
Hoses with design factor 4:1
1018X
1018X – National Pipe Tapered (NPT)
male
Carbon steel, zinc plated, C: Stainless steel
H
DN
size mm inch
1018X-2-025
4
-025 4.0 5/32
1018X-4-025
4
1018X-1-04
6
1018X-2-04
A
B
(
mm
mm
mm
1/8 NPT
51
24
8
-025 4.0 5/32
1/4 NPT
59
32
-04 6.4
1/4
1/16 NPT
59
27
6
-04 6.4
1/4
1/8 NPT
60
1018X-4-04
6
-04 6.4
1/4
1/4 NPT
1018X-4-04C
6
-04 6.4
1/4
1018X-6-04
6
-04 6.4
1018X-6-04C
6
-04 6.4
1018X-4-05
Nipple Ferrule
ID
OD
mm
mm
75.0 10,875
2.3
13.2
13
75.0 10,875
2.3
13.2
14
103.4 15,000
3.6
18.5
28
13
103.4 15,000
3.6
18.5
65
33
14
103.4 15,000
3.6
18.5
1/4 NPT
65
33
14
103.4 15,000
3.6
18.5
1/4
3/8 NPT
67
35
19
103.4 15,000
3.6
18.5
1/4
3/8 NPT
67
35
19
103.4 15,000
3.6
18.5
8
-05 7.9 5/16
1/4 NPT
61
30
14
103.4 15,000
4.8
20.1
1018X-4-05C
8
-05 7.9 5/16
1/4 NPT
61
30
14
103.4 15,000
4.8
20.1
1018X-6-05
8
-05 7.9 5/16
3/8 NPT
70
30
19
103.4 15,000
4.8
20.1
1018X-6-05C
8
-05 7.9 5/16
3/8 NPT
70
30
19
103.4 15,000
4.8
20.1
1018X-6-06
10
-06 9.5
3/8
3/8 NPT
71
31
19
103.4 15,000
6.8
23.4
1018X-6-06C
10
-06 9.5
3/8
3/8 NPT
71
31
19
103.4 15,000
6.8
23.4
1018X-8-06
10
-06 9.5
3/8
1/2 NPT
76
36
22
103.4 15,000
6.8
23.4
1018X-8-06C
10
-06 9.5
3/8
1/2 NPT
76
36
22
103.4 15,000
6.8
23.4
1018X-8-08
12
-08 12.7 1/2
1/2 NPT
79
37
22
103.4 15,000
6.6
30.0
1018X-8-08C
12
-08 12.7 1/2
1/2 NPT
79
37
22
103.4 15,000
6.6
30.0
B-19
MPa
psi
Catalogue 4462 Global Edition
Design Factor 4:1
MATERIAL
A
B
Hoses with design factor 4:1
1058X – 1068X
A
Design Factor 4:1
1058X – UNF male with O-ring
MATERIAL
B
Special materials
H
DN
size mm inch
A
B
(
Nipple Ferrule
ID
OD
mm
mm
mm
MPa
psi
mm
mm
1058X-4-04
6
-04 6.4
1/4
7/16 - 20 UNF
61
29
14
80
11,600
3.6
18.5
1058X-6-04
6
-04 6.4
1/4
9/16 - 18 UNF
62
30
17
80
11,600
3.6
18.5
A
1068X – JIC female swivel
MATERIAL
B
Carbon steel, zinc plated, C: Stainless steel
J
DN
size mm inch
A
B
*
Nipple Ferrule
ID
OD
mm
mm
mm
MPa
mm
mm
1068X-4-04
6
-04 6.4
1/4
7/16 - 20 UNF
57
26
19
69.0 10,000
2.8
18.5
1068X-4-04C
6
-04 6.4
1/4
7/16 - 20 UNF
57
26
19
69.0 10,000
2.8
18.5
1068X-5-04
6
-04 6.4
1/4
1/2 - 20 UNF
55
24
19
80.0 11,600
2.8
18.5
1068X-5-04C
6
-04 6.4
1/4
1/2 - 20 UNF
55
24
19
80.0 11,600
2.8
18.5
1068X-6-04
6
-04 6.4
1/4
9/16 - 18 UNF
55
24
19
80.0 11,600
3.6
18.5
1068X-6-04C
6
-04 6.4
1/4
9/16 - 18 UNF
55
24
19
80.0 11,600
3.6
18.5
1068X-6-05
8
-05 7.9 5/16
9/16 - 18 UNF
56
16
19
69.0 10,000
4.8
20.1
1068X-6-05C
8
-05 7.9 5/16
9/16 - 18 UNF
56
16
19
69.0 10,000
4.8
20.1
1068X-8-05
8
-05 7.9 5/16
3/4 - 16 UNF
64
33
24
69.0 10,000
4.8
20.1
1068X-6-06
10
-06 9.5
3/8
9/16 - 18 UNF
59
18
22
69.0 10,000
4.8
23.4
1068X-6-06C
10
-06 9.5
3/8
9/16 - 18 UNF
59
18
22
69.0 10,000
4.8
23.4
1068X-8-08
12
-08 12.7 1/2
3/4 - 16 UNF
64
21
27
69.0 10,000
6.6
30.0
1068X-8-08C
12
-08 12.7 1/2
3/4 - 16 UNF
64
21
27
69.0 10,000
6.6
30.0
B-20
psi
Catalogue 4462 Global Edition
B
Hoses with design factor 4:1
1928X / 192LX – 1D98X
A
1928X / 192LX – BSP female swivel (60° cone)
MATERIAL
Carbon steel, zinc plated, C: Stainless steel
A
B
*
Nipple Ferrule
ID
OD
DN
size mm inch
mm
mm
mm
MPa
mm
mm
1928X-4-025
4
-025 4.0 5/32
G 1/4
48
20
19
75.0 10,875
2.3
13.2
1928X-4-04
6
-04 6.4
1/4
G 1/4
56
25
19
80.0 11,600
3.6
18.5
1928X-4-04C
6
-04 6.4
1/4
G 1/4
56
25
19
80.0 11,600
3.6
18.5
1928X-6-06
10
-06 9.5
3/8
G 3/8
59
19
22
57.5
8,340
6.8
23.4
1928X-6-06C
10
-06 9.5
3/8
G 3/8
59
19
22
57.5
8,340
6.8
23.4
1928X-8-06
10
-06 9.5
3/8
G 1/2
60
20
27
57.5
8,340
6.8
23.4
1928X-8-06C
10
-06 9.5
3/8
G 1/2
60
20
27
57.5
8,340
6.8
23.4
192LX-8-08
12
-08 12.7 1/2
G 1/2
75
21
30
130.0 18,850
6.7
30.7
192LX-8-08C
12
-08 12.7 1/2
G 1/2
75
21
30
130.0 18,850
6.7
30.7
A
1D98X – BSP male
MATERIAL
psi
B
Carbon steel, zinc plated, C: Stainless steel
H
A
B
(
Nipple Ferrule
ID
OD
DN
size mm inch
mm
mm
mm
MPa
mm
mm
1D98X-4-025
4
-025 4.0 5/32
G 1/4
60
33
19
75.0 10,875
2.3
13.2
1D98X-4-025C
4
-025 4.0 5/32
G 1/4
60
33
19
75.0 10,875
2.3
13.2
1D98X-4-04
6
-04 6.4
1/4
G 1/4
67
35
19
80.0 11,600
3.6
18.5
1D98X-4-04C
6
-04 6.4
1/4
G 1/4
67
35
19
80.0 11,600
3.6
18.5
1D98X-6-04
6
-04 6.4
1/4
G 3/8
69
37
22
80.0 11,600
3.6
18.5
1D98X-6-04C
6
-04 6.4
1/4
G 3/8
69
37
22
80.0 11,600
3.6
18.5
1D98X-6-05
8
-05 7.9 5/16
G 3/8
70
31
22
62.5
9,060
4.8
20.1
1D98X-6-06
10
-06 9.5
3/8
G 3/8
70
30
22
57,5
8,340
6.8
23.4
1D98X-6-06C
10
-06 9.5
3/8
G 3/8
70
30
22
57,5
8,340
6.8
23.4
1D98X-8-08
12
-08 12.7 1/2
G 1/2
77
35
27
55.0
7,974
6.6
30.0
B-21
psi
Catalogue 4462 Global Edition
Design Factor 4:1
B
J
Hoses with design factor 4:1
1AY8X – 1078X
A
Design Factor 4:1
1AY8X – Type “M” female swivel
MATERIAL
B
J
Carbon steel, zinc plated
DN
B
*
Nipple Ferrule
ID
OD
mm
mm
mm
MPa
mm
mm
6
-04 6.4
1/4
9/16 - 18 UNF
60
28
19
80.0 11,600
3.6
18.5
1AY8X-8-05
8
-05 7.9 5/16
3/4 - 16 UNF
74
30
27
69.0 10,000
4.8
20.1
1AY8X-8-06
10
-06 9.5
3/4 - 16 UNF
70
26
27
57.5
6.8
23.4
1AY8X-6-04
size mm inch
A
3/8
8,340
A
1078X – NPSM female swivel
B
J
MATERIAL
NOTE
psi
Carbon steel, zinc plated
C2W: Stainless steel nipple
DN
size mm inch
A
B
*
Nipple Ferrule
ID
OD
mm
mm
mm
MPa
mm
mm
1078X-4-04
6
-04 6.4
1/4
1/4 - 18NPSM
59
28
19
80.0 11,600
3.6
18.5
1078X-4-04C2W
6
-04 6.4
1/4
1/4 - 18NPSM
59
28
19
80.0 11,600
3.6
18.5
1078X-6-05
8
-05 7.9 5/16
3/8 - 18NPSM
60
21
22
62.5
9,060
4.8
20.1
1078X-6-05C2W
8
-05 7.9 5/16
3/8 - 18NPSM
60
21
22
62.5
9,060
4.8
20.1
1078X-6-06
10
-06 9.5
3/8
3/8 - 18NPSM
62
21
22
57.5
8,340
6.8
23.4
1078X-6-06C2W
10
-06 9.5
3/8
3/8 - 18NPSM
62
21
22
57.5
8,340
6.8
23.4
B-22
psi
Catalogue 4462 Global Edition
B
Hoses with design factor 4:1
1U08X – 13B8X / 13BNX
A
1U08X – BSP female swivel (ballnose)
B
MATERIAL
NOTE
Carbon steel, zinc plated
C2W: Stainless steel nipple
DN
size mm inch
A
B
*
Nipple Ferrule
ID
OD
mm
mm
mm
MPa
mm
mm
1U08X-4-04
6
-04 6.4
1/4
G 1/4
58
27
19
80.0 11,600
3.6
18.5
1U08X-4-04C2W
6
-04 6.4
1/4
G 1/4
58
27
19
80.0 11,600
3.6
18.5
1U08X-6-04
6
-04 6.4
1/4
G 3/8
58
27
27
80.0 11,600
3.6
18.5
1U08X-6-04C2W
6
-04 6.4
1/4
G 3/8
58
27
27
80.0 11,600
3.6
18.5
1U08X-6-05
8
-05 7.9 5/16
G 3/8
59
19
19
62.5
9,060
4.8
20.1
1U08X-6-05C2W
8
-05 7.9 5/16
G 3/8
59
19
19
62.5
9,060
4.8
20.1
1U08X-6-06
10
-06 9.5
3/8
G 3/8
61
20
22
57.5
8,340
6.8
23.4
1U08X-6-06C2W
10
-06 9.5
3/8
G 3/8
61
20
22
57.5
8,340
6.8
23.4
1U08X-8-06
10
-06 9.5
3/8
G 1/2
61
20
27
57.5
8,340
6.8
23.4
1U08X-8-06C2W
10
-06 9.5
3/8
G 1/2
61
20
27
57.5
8,340
6.8
23.4
1U08X-8-08
12
-08 12.7 1/2
G 1/2
61
22
27
55.0
7,975
6.6
30.0
A
13B8X / 13BNX – BSP male
MATERIAL
psi
B
Carbon steel, zinc plated
H
A
B
(
Nipple Ferrule
ID
OD
DN
size mm inch
mm
mm
mm
MPa
mm
mm
13B8X-4-025
4
-025 4.0 5/32
G 1/4
57
30
17
75.0 10,875
2.3
13.2
13B8X-4-04
6
-04 6.4
1/4
G 1/4
64
32
17
80.0 11,600
3.6
18.5
13B8X-6-04
6
-04 6.4
1/4
G 3/8
67
35
19
80.0 11,600
3.6
18.5
13B8X-6-05
8
-05 7.9 5/16
G 3/8
69
30
22
62.5
9,060
4.8
20.1
13B8X-6-06
10
-06 9.5
3/8
G 3/8
70
30
22
57.5
8,340
6.8
23.4
13B8X-8-06
10
-06 9.5
3/8
G 1/2
75
35
22
57.5
8,340
6.8
23.4
13B8X-8-08
12
-08 12.7 1/2
G 1/2
79
35
24
55.0
7,974
6.6
30.0
13BNX-24-20
32
-20 31.8 1 1/4
G 1 1/2
118
57
55
27.5
3,990
24.9
49.4
B-23
psi
Catalogue 4462 Global Edition
Design Factor 4:1
J
Hoses with design factor 4:1
1C98X / 1C9LX / 1C9NX
Design Factor 4:1
1C98X / 1C9LX / 1C9NX – Metric female swivel
heavy series with O-ring
MATERIAL
A
J
B
Carbon steel, zinc plated, C: Stainless steel
A
B
*
Nipple Ferrule
ID
OD
DN
size mm inch
mm
mm
mm
MPa
mm
mm
1C98X-8-025
4
-025 4.0 5/32
M16x1.5
54
27
19
75.0 10,875
2.3
13.2
1C98X-8-025C
4
-025 4.0 5/32
M16x1.5
54
27
19
75.0 10,875
2.3
13.2
1C98X-8-04
6
-04 6.4
1/4
M16x1.5
59
27
19
80.0 11,600
3.6
18.5
1C98X-8-04C
6
-04 6.4
1/4
M16x1.5
59
27
19
80.0 11,600
3.6
18.5
1C98X-10-04
6
-04 6.4
1/4
M18x1.5
56
33
22
80.0 11,600
3.6
18.5
1C98X-10-04C
6
-04 6.4
1/4
M18x1.5
56
33
22
80.0 11,600
3.6
18.5
1C98X-12-04
6
-04 6.4
1/4
M20x1.5
69
37
24
80.0 11,600
3.6
18.5
1C98X-12-05
8
-05 7.9 5/16
M20x1.5
62
23
24
63.0
9,135
4.8
20.1
1C98X-16-05
8
-05 7.9 5/16
M24x1.5
65
25
30
63.0
9,135
4.8
20.1
1C98X-12-06
10
-06 9.5
3/8
M20x1.5
70
30
24
63.0
9,135
6.8
23.4
1C98X-12-06C
10
-06 9.5
3/8
M20x1.5
70
30
24
63.0
9,135
6.8
23.4
1C98X-14-06
10
-06 9.5
3/8
M22x1.5
70
30
27
63.0
9,135
6.8
23.4
1C98X-14-06C
10
-06 9.5
3/8
M22x1.5
70
30
27
63.0
9,135
6.8
23.4
1C9LX-16-08
12
-08 12.7 1/2
M24x1.5
88
34
30
130.0 18,850
6.6
30.0
1C9NX-38-20
32
-20 31.8 1 1/4
M52x2
113
52
60
44.0
24.9
49.4
B-24
psi
6,380
Catalogue 4462 Global Edition
B
Hoses with design factor 4:1
2380N-MSHA
CONSTRUCTION
Core tube
: Polyamide
Pressure reinforcement : Two spiral layers and two open spiral layers of high
tensile steel wire
Cover
Standard colour
TEMPERATURE RANGE
: Polyurethane, MSHA approved
: Black
-40°C up to +100°C
Mining applications
2380N-04V10-MSHA
NOTES
DN
size
mm
inch
mm
MPa
psi
MPa
psi
mm
kg/m
6
-04
6.3
1/4
13.3
70
10,150
280
40,600
70
0.28
–
B-25
Catalogue 4462 Global Edition
Design Factor 4:1
2380N-MSHA – High pressure mining hose
Hoses with design factor 4:1
1018X
1018X – National Pipe Tapered (NPT) male
A
Design Factor 4:1
B
MATERIAL
Carbon steel, zinc plated; ZE: Carbon steel, special plating
for high corrosion protection in mining applications
DN
size mm inch
A
B
(
H
Nipple Ferrule
ID
OD
mm
mm
mm
mm
mm
1018X-4-04ZE
6
-04 6.4
1/4
1/4 NPT
65
33
14
103.4 15,000
3.6
18.5
1018X-6-04ZE
6
-04 6.4
1/4
3/8 NPT
67
35
19
103.4 15,000
3.6
18.5
B-26
MPa
psi
Catalogue 4462 Global Edition
B
Hoses with design factor 4:1
2388N
CONSTRUCTION
Core tube
: Polyamide
Pressure reinforcement : Two spiral layers and two open spiral layers of high
tensile steel wire
Cover
Standard colour
TEMPERATURE RANGE
2388N-04V00
NOTES
: Polyurethane
: Black
-40°C up to +100°C
DN
size
mm
inch
mm
MPa
psi
MPa
psi
mm
kg/m
6
-04
6.3
1/4
13.3
80
11,600
320
46,400
80
0.30
–
B-27
Catalogue 4462 Global Edition
Design Factor 4:1
2388N – High pressure hose
Hoses with design factor 4:1
1018X – 1058X
Design Factor 4:1
1018X – National Pipe Tapered (NPT)
male
MATERIAL
A
B
Carbon steel, zinc plated, C: Stainless steel
H
DN
size mm inch
A
B
(
Nipple Ferrule
ID
OD
mm
mm
mm
mm
mm
1018X-1-04
6
-04 6.4
1/4
1/16 NPT
59
27
14
103.4 15,000
MPa
psi
3.6
18.3
1018X-2-04
6
-04 6.4
1/4
1/8 NPT
60
28
13
103.4 15,000
3.6
18.3
1018X-4-04
6
-04 6.4
1/4
1/4 NPT
65
33
14
103.4 15,000
3.6
18.3
1018X-4-04C
6
-04 6.4
1/4
1/4 NPT
65
33
14
103.4 15,000
3.6
18.3
1018X-6-04
6
-04 6.4
1/4
3/8 NPT
67
35
19
103.4 15,000
3.6
18.3
1018X-6-04C
6
-04 6.4
1/4
3/8 NPT
67
35
19
103.4 15,000
3.6
18.3
A
1058X – UNF male with O-ring
MATERIAL
B
Special materials
H
DN
size mm inch
A
B
(
Nipple Ferrule
ID
OD
mm
mm
mm
MPa
psi
mm
mm
1058X-4-04
6
-04 6.4
1/4
7/16 - 20 UNF
61
29
14
80
11,600
3.6
18.3
1058X-6-04
6
-04 6.4
1/4
9/16 - 18 UNF
62
30
17
80
11,600
3.6
18.3
B-28
Catalogue 4462 Global Edition
B
Hoses with design factor 4:1
1068X – 1928X
A
1068X – JIC female swivel
Carbon steel, zinc plated, C: Stainless steel
J
DN
size mm inch
A
B
*
Nipple Ferrule
ID
OD
mm
mm
mm
MPa
mm
mm
1068X-4-04
6
-04 6.4
1/4
7/16 - 20 UNF
57
26
19
69.0 10,000
2.8
18.3
1068X-4-04C
6
-04 6.4
1/4
7/16 - 20 UNF
57
26
19
69.0 10,000
2.8
18.3
1068X-5-04
6
-04 6.4
1/4
1/2 - 20 UNF
55
24
19
80.0 11,600
3.6
18.3
1068X-5-04C
6
-04 6.4
1/4
1/2 - 20 UNF
55
24
19
80.0 11,600
3.6
18.3
1068X-6-04
6
-04 6.4
1/4
9/16 - 18 UNF
55
24
19
80.0 11,600
3.6
18.3
1068X-6-04C
6
-04 6.4
1/4
9/16 - 18 UNF
55
24
19
80.0 11,600
3.6
18.3
A
1928X – BSP female swivel (60° cone)
B
J
MATERIAL
psi
Carbon steel, zinc plated, C: Stainless steel
DN
size mm inch
A
B
*
Nipple Ferrule
ID
OD
mm
mm
mm
MPa
mm
mm
1928X-4-04
6
-04 6.4
1/4
G 1/4
56
25
19
80.0 11,600
3.6
18.3
1928X-4-04C
6
-04 6.4
1/4
G 1/4
56
25
19
80.0 11,600
3.6
18.3
B-29
psi
Catalogue 4462 Global Edition
Design Factor 4:1
MATERIAL
B
Hoses with design factor 4:1
1D98X – 1AY8X
A
Design Factor 4:1
1D98X – BSP male
MATERIAL
B
Carbon steel, zinc plated, C: Stainless steel
H
DN
size mm inch
A
B
(
Nipple Ferrule
ID
OD
mm
mm
mm
MPa
mm
mm
1D98X-4-04
6
-04 6.4
1/4
G 1/4
67
35
19
80.0 11,600
3.6
18.3
1D98X-4-04C
6
-04 6.4
1/4
G 1/4
67
35
19
80.0 11,600
3.6
18.3
A
1AY8X – Type “M” female swivel
MATERIAL
B
J
Carbon steel, zinc plated
DN
1AY8X-6-04
psi
6
size mm inch
-04 6.4
1/4
9/16 - 18 UNF
B-30
Nipple Ferrule
ID
OD
A
B
*
mm
mm
mm
MPa
60
28
19
80.0 11,600
psi
mm
mm
3.6
18.3
Catalogue 4462 Global Edition
B
Hoses with design factor 4:1
1078X – 1U08X
A
1078X – NPSM female swivel
J
MATERIAL
NOTE
Carbon steel, zinc plated
C2W: Stainless steel nipple
DN
size mm inch
A
B
*
Nipple Ferrule
ID
OD
mm
mm
mm
MPa
1078X-4-04
6
-04 6.4
1/4
1/4 - 18NPSM
59
28
19
80.0 11,600
1078X-4-04C2W
6
-04 6.4
1/4
1/4 - 18NPSM
59
28
19
80
psi
11,600
mm
mm
3.6
18.3
3.6
18.3
A
1U08X – BSP female swivel (ballnose)
B
J
MATERIAL
NOTE
Carbon steel, zinc plated
C2W: Stainless steel nipple
DN
size mm inch
A
B
*
Nipple Ferrule
ID
OD
mm
mm
mm
MPa
1U08X-4-04
6
-04 6.4
1/4
G 1/4
58
27
19
80.0 11,600
1U08X-4-04C2W
6
-04 6.4
1/4
G 1/4
58
27
19
1U08X-6-04
6
-04 6.4
1/4
G 3/8
58
27
27
1U08X-6-04C2W
6
-04 6.4
1/4
G 3/8
58
27
27
B-31
mm
mm
3.6
18.3
11,600
3.6
18.3
80.0 11,600
3.6
18.3
3.6
18.3
80
80
psi
11,600
Catalogue 4462 Global Edition
Design Factor 4:1
B
Hoses with design factor 4:1
13B8X – 1C98X / 1C9NX
A
Design Factor 4:1
13B8X – BSP male
MATERIAL
B
Carbon steel, zinc plated
H
DN
size mm inch
A
B
(
Nipple Ferrule
ID
OD
mm
mm
mm
MPa
mm
mm
13B8X-4-04
6
-04 6.4
1/4
G 1/4
64
32
17
80.0 11,600
3.6
18.3
13B8X-6-04
6
-04 6.4
1/4
G 3/8
67
35
19
80.0 11,600
3.6
18.3
A
1C98X / 1C9NX – Metric female swivel
heavy series with O-ring
MATERIAL
psi
J
B
Carbon steel, zinc plated, C: Stainless steel
DN
size mm inch
A
B
*
Nipple Ferrule
ID
OD
mm
mm
mm
MPa
mm
mm
1C98X-8-04
6
-04 6.4
1/4
M16x1.5
59
27
19
80.0 11,600
3.6
18.3
1C98X-8-04C
6
-04 6.4
1/4
M16x1.5
59
27
19
80.0 11,600
3.6
18.3
1C98X-10-04
6
-04 6.4
1/4
M18x1.5
56
33
22
80.0 11,600
3.6
18.3
1C98X-10-04C
6
-04 6.4
1/4
M18x1.5
56
33
22
80.0 11,600
3.6
18.3
1C98X-12-04
6
-04 6.4
1/4
M20x1.5
69
37
24
80.0 11,600
3.6
18.3
B-32
psi
Catalogue 4462 Global Edition
B
Hoses with design factor 4:1
2580N-MSHA
CONSTRUCTION
Core tube
: Polyamide
Pressure reinforcement : Four spiral layers and two open spiral layers of high
tensile steel wire
Cover
Standard colour
TEMPERATURE RANGE
: Polyurethane, MSHA approved
: Black
-40°C up to +100°C
Mining applications
DN
size
mm
inch
mm
MPa
psi
MPa
psi
mm
kg/m
2580N-06V10-MSHA
10
-06
9.8
3/8
21.6
70
10,150
280
40,600
95
0.94
2580N-08V10-MSHA
12
-08
12.9
1/2
25.0
70
10,150
280
40,600
110
1.19
NOTES
–
B-33
Catalogue 4462 Global Edition
Design Factor 4:1
2580N-MSHA – High pressure mining hose
Hoses with design factor 4:1
101BL
A
Design Factor 4:1
101BL – National Pipe Tapered (NPT) male
MATERIAL
B
Carbon steel, zinc plated; ZE: Carbon steel, special plating
for high corrosion protection in mining applications
A
B
(
H
Nipple Ferrule
ID
OD
DN
size mm inch
mm
mm
mm
MPa
mm
mm
101BL-6-06ZE
10
-06 9.5
3/8
3/8 NPT
80
35
22
160 23,200
5.5
28.5
101BL-8-08ZE
12
-08 12.7 1/2
1/2 NPT
90
45
22
140 20,300
6.9
30.0
B-34
psi
Catalogue 4462 Global Edition
C
Hoses with design factor >2:1
Table of contents
Chapter C
Hose
ESH
– Sewer cleaning hose ..................................................... C-2
ESH250plus – Sewer cleaning hose ..................................................... C-5
2240D – TOUGH COVER High pressure hose ....................................... C-8
2248D – TOUGH COVER High pressure hose ....................................... C-9
2244N – High pressure hose.............................................................. C-16
2380N – High pressure hose.............................................................. C-19
2388N – High pressure hose (size -04) .............................................. C-20
2380M – High pressure hose ............................................................. C-25
2388N – High pressure hose (size -08) .............................................. C-27
2580N – High pressure hose.............................................................. C-30
2440D – Ultra-high pressure hose ..................................................... C-33
2440N – Ultra-high pressure hose ..................................................... C-33
2440D – TOUGH COVER Ultra-high pressure hose ............................. C-34
2448D – TOUGH COVER Ultra-high pressure hose ............................. C-46
2640D – Ultra-high pressure hose ..................................................... C-49
2640N – Ultra-high pressure hose ..................................................... C-49
2648N – Ultra-high pressure hose ..................................................... C-56
2740D – Ultra-high pressure hose ..................................................... C-58
2741D – Ultra-high pressure hose with 2nd cover ............................ C-59
2748D – Ultra-high pressure hose ..................................................... C-60
2748D – Ultra-high pressure hose with 2nd cover ............................ C-61
2749D – Ultra-high pressure hose ..................................................... C-62
2840D – Ultra-high pressure hose ....................................................... C-67
2841D – Ultra-high pressure hose ....................................................... C-68
2848D – Ultra-high pressure hose ....................................................... C-69
2849D – Ultra-high pressure hose ....................................................... C-72
C-1
Catalogue 4462 Global Edition
Design Factor >2:1
Hoses with design factor >2:1
Hoses with design factor >2:1
ESH
ESH – Sewer cleaning hose
Design Factor >2:1
CONSTRUCTION
Core tube
: Polyethylene compound, grey
Pressure reinforcement : Two braided layers of high tensile synthetic yarn
Cover
Standard colour
TEMPERATURE RANGE
: Polyurethane compound
: Yellow
-10°C up to +50°C
DN
size
mm
inch
mm
MPa
psi
MPa
psi
mm
kg/m
ESH-08
12
-08
12.7
1/2
20.6
20
2,900
50
7250
100
0.23
ESH-12
20
-12
19.2
3/4
28.6
20
2,900
50
7250
125
0.37
ESH-16
25
-16
25.3
1
36.6
20
2,900
50
7250
150
0.59
ESH-20
32
-20
31.9
1 1/4
46.0
20
2,900
50
7250
225
0.89
Hose assemblies
Length (m)
Fittings
Standard
max.
BSP
female swivel
BSP
male
80
100
120
160
180
ESH-08
•
•
•
•
•
500
G 1/2
G 1/2
ESH-12
•
•
•
•
•
500
G 3/4
G 3/4
ESH-16
•
•
•
•
•
500
G1
G1
ESH-20
•
•
•
•
•
400
G 1 1/4
G 1 1/4
NOTES
• ESH available as bulk hose on a drum
• Crimp on a Parkrimp system or on a free adjustable crimper
C-2
Catalogue 4462 Global Edition
C
Hoses with design factor >2:1
192EH – 1D9EH
A
192EH – BSP female swivel (60° cone)
J
Carbon steel zinc plated
A
B
*
DN
size mm inch
mm
mm
mm
MPa
psi
192EH-08-08
12
-08 12.8 1/2
G 1/2
57
22
27
25
3,625
192EH-12-12
20
-12 19.6 3/4
G 3/4
61
22
32
25
3,625
192EH-16-16
25
-16 25.0
G1
55
25
41
25
3,625
192EH-20-20
32
-20 32.0 1 1/4
G 1 1/4
80
32
50
25
3,625
1
A
1D9EH – BSP male
MATERIAL
Design Factor >2:1
MATERIAL
B
B
H
Carbon steel zinc plated
A
B
(
DN
size mm inch
mm
mm
mm
MPa
psi
1D9EH-08-08
12
-08 12.8 1/2
G 1/2
64
30
27
25
3,625
1D9EH-12-12
20
-12 19.6 3/4
G 3/4
72
33
32
25
3,625
1D9EH-16-16
25
-16 25.0
G1
72
42
41
25
3,625
1D9EH-20-20
32
-20 32.0 1 1/4
G 1 1/4
93
45
50
25
3,625
1
C-3
Catalogue 4462 Global Edition
Hoses with design factor >2:1
292NC – 2D9NC
A
292NC – BSP female swivel (60° cone)
B
J
Field attachable fitting
MATERIAL
Carbon steel zinc plated
W
Design Factor >2:1
H
A
B
(
*
7
mm
mm
mm
mm
mm
MPa
psi
77
37
27
27
27
17
2,465
2,465
DN
size mm inch
292NC-08-08
12
-08 12.8 1/2
G 1/2
292NC-12-12
20
-12 19.6 3/4
G 3/4
87
39
36
32
36
17
292NC-16-16
25
-16 25.0
G1
100
50
46
46
46
17
2,465
292NC-20-20
32
-20 32.0 1 1/4
G 1 1/4
113
60
55
55
55
17
2,465
1
A
2D9NC – BSP male
B
Field attachable fitting
MATERIAL
Carbon steel zinc plated
H
A
B
(
7
mm
mm
mm
mm
MPa
psi
75
35
27
27
17
2,465
DN
size mm inch
2D9NC-08-08
12
-08 12.8 1/2
G 1/2
2D9NC-12-12
20
-12 19.6 3/4
G 3/4
86
38
36
36
17
2,465
2D9NC-16-16
25
-16 25.0
G1
100
50
46
46
17
2,465
2D9NC-20-20
32
-20 32.0 1 1/4
G 1 1/4
113
60
55
55
17
2,465
1
C-4
W
Catalogue 4462 Global Edition
C
Hoses with design factor >2:1
ESH250plus
ESH250plus – Sewer cleaning hose
CONSTRUCTION
Core tube
: Thermoplastic Elastomere
Pressure reinforcement : Two braided layers of high tensile synthetic fiber,
homogenuous compound
TEMPERATURE RANGE
: Polyurethane, extreme abrasive and cut resistance
: Green
Design Factor >2:1
Cover
Standard colour
-10°C up to +50°C
DN
size
mm
inch
mm
MPa
psi
MPa
psi
mm
kg/m
ESH250Plus-08
12
-08
12.4
1/2
21.2
25
3,625
62.5
9,060
100
0.24
ESH250Plus-12
20
-12
19.0
3/4
28.6
25
3,625
62.5
9,060
125
0.40
ESH250Plus-16
25
-16
25.4
1
36.5
25
3,625
62.5
9,060
150
0.60
ESH250Plus-20
32
-20
32.0
1 1/4
46.0
25
3,625
62.5
9,060
225
1.00
Hose assemblies
Length (m)
Fittings
Standard
80
100
120
max.
160
180
BSP
female swivel
BSP
male
ESH250Plus-08
•
•
•
•
•
500
G 1/2
G 1/2
ESH250Plus-12
•
•
•
•
•
500
G 3/4
G 3/4
ESH250Plus-16
•
•
•
•
•
500
G1
G1
ESH250Plus-20
•
•
•
•
•
400
G 1 1/4
G 1 1/4
NOTES
• Standard available hose assemblies see table above. Ordering example: ESH250Plus-12-160
• Crimp your own assembly: ESH250Plus available as bulk hose on a drum
• Crimp on a Parkrimp system or on a free adjustable crimper
C-5
Catalogue 4462 Global Edition
Hoses with design factor >2:1
192EH – 1D9EH
A
192EH – BSP female swivel (60° cone)
J
Design Factor >2:1
MATERIAL
B
Carbon steel zinc plated
A
B
*
DN
size mm inch
mm
mm
mm
MPa
psi
192EH-08-08
12
-08 12.8 1/2
G 1/2
57
22
27
25
3,625
192EH-12-12
20
-12 19.6 3/4
G 3/4
61
22
32
25
3,625
192EH-16-16
25
-16 25.0
G1
55
25
41
25
3,625
192EH-20-20
32
-20 32.0 1 1/4
G 1 1/4
80
32
50
25
3,625
1
A
1D9EH – BSP male
MATERIAL
B
H
Carbon steel zinc plated
A
B
(
DN
size mm inch
mm
mm
mm
MPa
psi
1D9EH-08-08
12
-08 12.8 1/2
G 1/2
64
30
27
25
3,625
1D9EH-12-12
20
-12 19.6 3/4
G 3/4
72
33
32
25
3,625
1D9EH-16-16
25
-16 25.0
G1
72
42
41
25
3,625
1D9EH-20-20
32
-20 32.0 1 1/4
G 1 1/4
93
45
50
25
3,625
1
C-6
Catalogue 4462 Global Edition
C
Hoses with design factor >2:1
292EJ – 2D9EJ
292EJ – BSP female swivel (60° cone)
MATERIAL
B
J
A
Carbon steel zinc plated
W
A
B
(
*
7
DN
size mm inch
mm
mm
mm
mm
mm
MPa
psi
292EJ-8-08
12
-08 12.8 1/2
G 1/2
71
33
27
27
27
18
2,610
292EJ-12-12
20
-12 19.6 3/4
G 3/4
82
37
32
32
36
18
2,610
292EJ-16-16
25
-16 25.0
G1
89
48
41
41
46
18
2,610
292EJ-20-20
32
-20 32.0 1 1/4
G 1 1/4
112
59
50
50
55
18
2,610
1
A
2D9EJ – BSP male
MATERIAL
Design Factor >2:1
H
B
Carbon steel zinc plated
H
A
B
(
7
DN
size mm inch
mm
mm
mm
mm
MPa
psi
2D9EJ-8-08
12
-08 12.8 1/2
G 1/2
70
32
27
27
18
2,610
2D9EJ-12-12
20
-12 19.6 3/4
G 3/4
83
38
32
36
18
2,610
2D9EJ-16-16
25
-16 25.0
G1
91
50
41
46
18
2,610
2D9EJ-20-20
32
-20 32.0 1 1/4
G 1 1/4
112
59
50
55
18
2,610
1
C-7
W
Catalogue 4462 Global Edition
Hoses with design factor >2:1
2240D-Tough Cover
2240D-TOUGH COVER* – High pressure hose
Design Factor >2:1
CONSTRUCTION
Core tube
: Polyoxymethylene
Pressure reinforcement : Two spiral layers of high tensile steel wire
Cover
Standard colour
TEMPERATURE RANGE
: Polyamide
: blue
-10°C up to +70°C
DN
size
mm
inch
mm
MPa
psi
MPa
psi
mm
kg/m
2240D-02V32-TC
3
-02
3.0
1/8
7.0
110
15,950
275
39,875
60
0.07
2240D-025V32-TC
4
-025
4.0
5/32
7.7
120
17,400
300
43,500
75
0.10
2240D-03V32-TC
5
-03
4.8
3/16
9.5
100
14,500
250
36,250
95
0.13
2240D-04V32-TC
6
-04
6.4
1/4
11.5
110
15,950
275
39,875
110
0.20
NOTES
* Non TOUGH COVER Versions available on request.
C-8
Catalogue 4462 Global Edition
C
Hoses with design factor >2:1
2248D-Tough Cover
2248D-TOUGH COVER* – High pressure hose
CONSTRUCTION
Core tube
: Polyoxymethylene
Pressure reinforcement : Two spiral layers of high tensile steel wire
TEMPERATURE RANGE
: Polyamide
: blue
Design Factor >2:1
Cover
Standard colour
-10°C up to +70°C
DN
size
mm
inch
mm
MPa
psi
MPa
psi
mm
kg/m
2248D-025V32-TC
4
-025
4.0
5/32
7.9
150
21,750
375
54,375
75
0.10
2248D-03V32-TC
5
-03
4.9
3/16
9.5
140
20,300
350
50,750
95
0.14
2248D-05V32-TC
8
-05
8.1
5/16
13.4
100
14,500
250
36,250
120
0.25
NOTES
* Non TOUGH COVER Versions available on request.
C-9
Catalogue 4462 Global Edition
Hoses with design factor >2:1
106TX – 1AYTX
A
106TX – JIC female swivel
MATERIAL
B
Carbon steel zinc plated
Design Factor >2:1
J
DN
size mm inch
A
B
*
Nipple Ferrule
ID
OD
mm
mm
mm
MPa
mm
mm
106TX-4-02W
3
-02 3.0
1/8
7/16-20 UNF
40
21
17
110 15,950
1.6
9.1
106TX-4-025W
4
-025 4.0 5/32
7/16-20 UNF
44
21
17
150 21,750
2.3
9.9
106TX-6-03W
5
-03 4.8 3/16
9/16-18 UNF
48
25
19
140 20,300
2.8
12.0
106TX-6-04W
6
-04 6.4
9/16-18 UNF
53
26
19
110 15,950
3.8
13.6
1/4
A
1AYTX – Type “M” female swivel
MATERIAL
psi
B
J
Carbon steel zinc plated
DN
size mm inch
A
B
*
Nipple Ferrule
ID
OD
mm
mm
mm
MPa
mm
mm
1AYTX-6-02W
3
-02 3.0
1/8
9/16-18 UNF
47
28
19
110 15,950
1.6
9.1
1AYTX-6-025W
4
-025 4.0 5/32
9/16-18 UNF
45
23
19
150 21,750
2.3
9.9
1AYTX-6-03W
5
-03 4.8 3/16
9/16-18 UNF
50
23
19
150 21,750
2.8
12.0
1AYTX-6-04W
6
-04 6.4
1/4
9/16-18 UNF
52
25
19
110 15,950
3.8
13.6
1AYTX-8-05W
8
-05 7.9 5/16
3/4-16 UNF
64
30
27
100 14,500
4.8
16.1
C-10
psi
Catalogue 4462 Global Edition
C
Hoses with design factor >2:1
1C9TX – 1U0TX
A
1C9TX – Metric female swivel
heavy series with O-ring
Carbon steel zinc plated
* DN4-6 with support ferrule – DN3 and 8 without support ferrule
DN
size mm inch
A
B
*
Nipple Ferrule
ID
OD
mm
mm
mm
MPa
mm
mm
1C9TX-16-02W
3
-02 3.0
1/8
M24x1.5
60
39
30
110 15,950
1.6
9.1
1C9TX-16-025W
4
-025 4.0 5/32
M24x1.5
66
35
30
150 21,750
2.3
9.9
1C9TX-16-03W
5
-03 4.8 3/16
M24x1.5
74
42
30
150 21,750
2.8
12.0
1C9TX-10-04W
6
-04 6.4
1/4
M18x1.5
60
33
22
110 15,950
3.8
13.6
1C9TX-16-04W
6
-04 6.4
1/4
M24x1.5
70
44
30
110 15,950
3.8
13.6
1C9TX-12-05W
8
-05 7.9 5/16
M20x1.5
70
31
24
100 14,500
4.8
16.1
1C9TX-14-05W
8
-05 7.9 5/16
M22x1,5
68
29
27
100 14,500
4.8
16.1
1C9TX-16-05W *
8
-05 7.9 5/16
M24x1.5
71
38
30
100 14,500
4.8
16.1
A
1U0TX – BSP female swivel (ballnose)
J
MATERIAL
psi
B
Carbon steel zinc plated
DN
size mm inch
A
B
*
Nipple Ferrule
ID
OD
mm
mm
mm
MPa
mm
mm
1U0TX-2-02W
3
-02 3.0
1/8
G 1/8
36
18
12
110 15,950
1.6
9.1
1U0TX-4-02W
3
-02 3.0
1/8
G 1/4
44
22
17
110 15,950
1.6
9.1
1U0TX-4-025W
4
-025 4.0 5/32
G 1/4
45
23
17
150 21,750
2.3
9.9
1U0TX-4-03W
5
-03 4.7 3/16
G 1/4
49
23
17
150 21,750
2.8
12.0
1U0TX-4-04W
6
-04 6.3
1/4
G 1/4
51
25
17
110 15,950
3.8
13.6
1U0TX-6-05W
8
-05 7.9 5/16
G 3/8
60
26
27
100 14,500
4.8
16.1
C-11
psi
Catalogue 4462 Global Edition
Design Factor >2:1
MATERIAL
NOTE
B
J
Hoses with design factor >2:1
101TX – 102TX
101TX – National Pipe Tapered (NPT) male
A
B
MATERIAL
Carbon steel zinc plated
Design Factor >2:1
H
DN
size mm inch
A
B
(
Nipple Ferrule
ID
OD
mm
mm
mm
mm
mm
101TX-1-02W
3
-02 3.0
1/8
1/16 NPT
46
25
10
103.4 15,000
MPa
1.6
9.1
101TX-2-02W
3
-02 3.0
1/8
1/8 NPT
44
22
10
103.4 15,000
1.6
9.1
101TX-1-025W
4
-025 4.0 5/32
1/16 NPT
47
25
10
150.0 21,750
2.3
9.9
101TX-2-025W
4
-025 4.0 5/32
1/8 NPT
49
27
10
150.0 21,750
2.3
9.9
101TX-4-025W
4
-025 4.0 5/32
1/4 NPT
56
34
13
150.0 21,750
2.3
9.9
101TX-2-03W
5
-03 4.8 3/16
1/8 NPT
54
27
10
140.0 20,300
2.8
12.0
101TX-4-03W
5
-03 4.8 3/16
1/4 NPT
61
34
13
140.0 20,300
2.8
12.0
101TX-4-04W
6
-04 6.4
1/4
1/4 NPT
62
35
13
140.0 20,300
3.8
13.6
101TX-4-05W
8
-05 7.9 5/16
1/4 NPT
69
35
13
103.4 15,000
4.8
16.1
101TX-6-05W
8
-05 7.9 5/16
3/8 NPT
69
35
17
103.4 15,000
4.8
16.1
A
102TX – National Pipe Tapered (NPT) female
MATERIAL
psi
B
Carbon steel zinc plated
A
B
R
Nipple Ferrule
ID
OD
DN
size mm inch
mm
mm
mm
102TX-1-025W
4
-025 4.0 5/32
1/16 NPT
45
23
12
103.4 15,000
2.3
9.9
102TX-2-03W
5
-03 4.8 3/16
1/8 NPT
50
23
14
103.4 15,000
2.8
12.0
102TX-4-04W
6
-04 6.4
1/4 NPT
56
29
19
103.4 15,000
3.8
13.6
1/4
C-12
MPa
psi
mm
mm
Catalogue 4462 Global Edition
C
Hoses with design factor >2:1
6HYPL – 63ZPL / 6ZEPL
6HYPL – Left hand female
for water jetting nozzle
Carbon steel zinc plated
* ProLance fitting; only for 2240D
DN
6HYPL-1-2*
3
size mm inch
-02 3.0
1/8
12 - 28 UNF
A
B
R
mm
mm
mm
29
13
10
Nipple Ferrule
ID
OD
MPa
psi
103.4 15,000
63ZPL / 6ZEPL – Male water jetting nozzle
mm
mm
1.6
8.4
A
B
MATERIAL
NOTE
Carbon steel zinc plated, C: Stainless steel
* ProLance fitting; only for 2240D
DN
size mm inch
A
B
R
Nipple Ferrule
ID
OD
mm
mm
mm
mm
mm
63ZPL-5-2A*
3
-02 3.0
1/8
5/16 - 32 UNF
28
11
11
103.4 15,000
2.5
10.1
6ZEPL-5-2A*
3
-02 3.0
1/8
5/16 - 24 UNF
33
18
11
103.4 15,000
2.5
10.1
63ZPL-5-3*
5
-03 4.8 3/16
5/16 - 32 UNF
33
13
13
103.4 15,000
3.2
11.7
63ZPL-5-3C*
5
-03 4.8 3/16
5/16 - 32 UNF
34
9
14
103.4 15,000
3.2
11.7
63ZPL-5-4C*
6
-04 6.4
5/16 - 32 UNF
71
11
17
103.4 15,000
3.2
13.2
1/4
C-13
MPa
psi
Catalogue 4462 Global Edition
Design Factor >2:1
MATERIAL
NOTE
A
B
Hoses with design factor >2:1
6EZPL – 1YZTX
6EZPL – Female water jetting nozzle
Design Factor >2:1
MATERIAL
NOTE
A
B
Carbon steel zinc plated
* ProLance fitting; only for 2240D
DN
size mm inch
A
B
R
Nipple Ferrule
ID
OD
mm
mm
mm
mm
mm
6EZPL-1-2A*
3
-02 3.0
1/8
12 - 28 UNF
33
17
11
103.4 15,000
MPa
2.5
10.1
6EZPL-5-2A*
3
-02 3.0
1/8
5/16 - 24 UNF
38
23
11
103.4 15,000
2.5
10.1
A
1YZTX – Metric male nozzle nipple
MATERIAL
psi
B
Carbon steel zinc plated
DN
H
size mm inch
A
B
(
Nipple Ferrule
ID
OD
mm
mm
mm
mm
mm
1YZTX-1-02WS
3
-02 3.0
1/8
M5
49
28
6
110 15,950
1.6
9.1
1YZTX-2-02W
3
-02 3.0
1/8
M7
49
28
7
110 15,950
1.6
9.1
1YZTX-1-025W
4
-025 4.0 5/32
M5
51
29
8
150 21,750
2.3
9.9
1YZTX-2-025W
4
-025 4.0 5/32
M7
51
29
8
150 21,750
2.3
9.9
1YZTX-4-025W
4
-025 4.0 5/32
M8
53
30
8
150 21,750
2.3
9.9
1YZTX-5-025W
4
-025 4.0 5/32
M10x1
52
30
8
150 21,750
2.3
9.9
1YZTX-2-03W
5
-03 4.8 3/16
M7
55
28
10
150 21,750
2.8
12.0
1YZTX-4-03W
5
-03 4.8 3/16
M8
53
28
10
150 21,750
2.8
12.0
1YZTX-5-04W
6
-04 6.4
1/4
M10x1
59
33
13
110 15,950
3.8
13.6
1YZTX-5-05W
8
-05 7.9 5/16
M10x1
68
34
13
100 14,500
4.8
16.1
C-14
MPa
psi
Catalogue 4462 Global Edition
C
Hoses with design factor >2:1
1YBTX – 1YHTX
A
1YBTX – BSP male nozzle nipple
Carbon steel zinc plated
H
DN
size mm inch
A
B
(
Nipple Ferrule
ID
OD
mm
mm
mm
mm
mm
1YBTX-2-02W
3
-02 3.0
1/8
G 1/8
48
27
8
MPa
110 15,950
1.6
9.1
1YBTX-2-025W
4
-025 4.0 5/32
G 1/8
53
30
8
150 21,750
2.3
9.9
1YBTX-4-025W
4
-025 4.0 5/32
G 1/4
54
30
10
150 21,750
2.3
9.9
1YBTX-2-03W
5
-03 4.8 3/16
G 1/8
53
27
10
150 21,750
2.8
12.0
1YBTX-4-03W
5
-03 4.8 3/16
G 1/4
58
31
10
150 21,750
2.8
12.0
1YBTX-2-04W
6
-04 6.4
1/4
G 1/8
60
33
10
110 15,950
3.8
13.6
1YBTX-4-04W
6
-04 6.4
1/4
G 1/4
62
36
10
110 15,950
3.8
13.6
1YBTX-4-05W
8
-05 7.9 5/16
G 1/4
68
35
13
100 14,500
4.8
16.1
1YBTX-6-05W
8
-05 7.9 5/16
G 3/8
71
37
17
100 14,500
4.8
16.1
A
1YHTX – BSP male nozzle nipple
MATERIAL
psi
B
Carbon steel zinc plated
H
Nipple Ferrule
ID
OD
A
B
(
mm
mm
mm
mm
mm
47
23
8
150 21,750
2.3
9.9
DN
size mm inch
1YHTX-4-025W
4
-025 4.0 5/32
1YHTX-4-025W-LH
4
-025 4.0 5/32 1/4 - 28 UNF LH
47
23
8
150 21,750
2.3
9.9
1YHTX-6-03W
5
-03 4.8 3/16
54
28
11
150 21,750
2.8
12.0
1YHTX-6-03W-LH
5
-03 4.8 3/16 3/8 - 24 UNF LH
54
28
11
150 21,750
2.8
12.0
1YHTX-6-04W
6
-04 6.4
1/4
56
29
11
150 21,750
3.8
13.6
1YHTX-6-04W-LH
6
-04 6.4
1/4 3/8 - 24 UNF LH
56
29
11
150 21,750
3.8
13.6
1YHTX-6-05W
8
-05 7.9 5/16
65
33
13
150 21,750
4.8
16.1
1YHTX-6-05W-LH
8
-05 7.9 5/16 3/8 - 24 UNF LH
65
33
13
150 21,750
4.8
16.1
1/4 - 28 UNF
3/8 - 24 UNF
3/8 - 24 UNF
3/8 - 24 UNF
C-15
MPa
psi
Catalogue 4462 Global Edition
Design Factor >2:1
MATERIAL
B
Hoses with design factor >2:1
2244N
2244N – High pressure hose
CONSTRUCTION
Core tube
: Polyamide
Pressure reinforcement : Two spiral layers, one braided layer of high tensile steel
Design Factor >2:1
wire
Cover
Standard colour
TEMPERATURE RANGE
: Polyurethane
: Black
-10°C up to +70°C
DN
size
mm
inch
mm
MPa
psi
MPa
psi
mm
kg/m
2244N-06V10W
10
-06
9.7
3/8
18.0
86
12,470
215
31,175
120
0.50
2244N-08V10W
12
-08
12.8
1/2
22.7
88
12,760
220
31,900
150
0.80
NOTES
–
C-16
Catalogue 4462 Global Edition
C
Hoses with design factor >2:1
1C9KX / 1C9LX – 192KX / 192LX
A
1C9KX / 1C9LX – Metric female swivel
heavy series with O-ring
Special materials
A
B
*
Nipple Ferrule
ID
OD
DN
size mm inch
mm
mm
mm
MPa
psi
mm
mm
1C9KX-14-06W
10
-06 9.5
3/8
M22x1.5
79
37
27
86
12,470
7.0
23.5
1C9LX-16-08
12
-08 12.7 1/2
M24x1.5
88
34
30
130 18,850
6.8
30.0
192KX / 192LX – BSP female swivel (60° cone)
MATERIAL
A
B
J
Special materials
A
B
*
Nipple Ferrule
ID
OD
DN
size mm inch
mm
mm
mm
MPa
psi
mm
mm
192KX-6-06W
10
-06 9.5
3/8
G3/8
72
29
22
86
12,470
7.0
23.5
192LX-8-08W
12
-08 12.7 1/2
G1/2
75
21
30
130 18,850
6.7
30.7
C-17
Catalogue 4462 Global Edition
Design Factor >2:1
MATERIAL
B
J
Hoses with design factor >2:1
1AYKX / 1AYLX
A
1AYKX / 1AYLX – Type “M” female swivel
Design Factor >2:1
MATERIAL
B
J
Special materials
DN
size mm inch
1AYKX-8-06W
10
-06 9.5
1AYLX-11-08
12
-08 12.7 1/2
3/8
A
B
*
Nipple Ferrule
ID
OD
mm
mm
mm
MPa
psi
mm
mm
3/4 - 16UNF
74
32
27
86
12,470
7.0
23.5
1 - 12 UNF
80
27
32
130 18,850
6.7
30.7
C-18
Catalogue 4462 Global Edition
C
Hoses with design factor >2:1
2380N
2380N – High pressure hose
CONSTRUCTION
Core tube
: Polyamide
Pressure reinforcement : Two spiral layers and two open spiral layers of high
tensile steel wire
TEMPERATURE RANGE
: Polyurethane
: Black
Design Factor >2:1
Cover
Standard colour
-10°C up to +70°C
DN
size
mm
inch
mm
MPa
psi
MPa
psi
mm
kg/m
2380N-04V00W
6
-04
6.3
1/4
13.3
110
15,950
280
40,600
70
0.28
2380N-05V00W
8
-05
8.3
5/16
15.8
100
14,500
250
36,250
90
0.35
NOTES
–
C-19
Catalogue 4462 Global Edition
Hoses with design factor >2:1
2388N
2388N – High pressure hose
CONSTRUCTION
Core tube
: Polyamide
Pressure reinforcement : Two spiral layers and two open spiral layers of high
Design Factor >2:1
tensile steel wire
Cover
Standard colour
TEMPERATURE RANGE
2388N-04V12W
NOTES
: Polyurethane
: Blue
-10°C up to +70°C
DN
size
mm
inch
mm
MPa
psi
MPa
psi
mm
kg/m
6
-04
6.3
1/4
13.3
128
18,560
320
46,400
80
0.30
–
C-20
Catalogue 4462 Global Edition
C
Hoses with design factor >2:1
1C9KY – 192KY
A
1C9KY – Metric female swivel heavy series
with O-ring
Carbon steel, zinc plated, C: Stainless steel
DN
size mm inch
A
B
*
Nipple Ferrule
ID
OD
mm
mm
mm
MPa
mm
mm
1C9KY-10-04
6
-04 6.4
1/4
M18x1.5
68
36
22
110 15,950
3.8
18.0
1C9KY-10-04C
6
-04 6.4
1/4
M18x1.5
68
36
22
110 15,950
3.8
18.0
1C9KY-16-04
6
-04 6.4
1/4
M24x1.5
70
44
30
110 15,950
3.8
18.0
1C9KY-16-04C
6
-04 6.4
1/4
M24x1.5
70
44
30
110 15,950
3.8
18.0
1C9KY-12-05
8
-05 7.9 5/16
M20x1.5
70
31
24
100 14,500
4.9
20.0
1C9KY-14-05
8
-05 7.9 5/16
M22x1,5
68
29
27
100 14,500
4.9
20.0
1C9KY-16-05
8
-05 7.9 5/16
M24x1.5
77
38
30
100 14,500
4.9
20.0
A
192KY – BSP female swivel (60° cone)
MATERIAL
192KY-6-05
psi
B
J
Carbon steel, zinc plated, C: Stainless steel
DN
size mm inch
8
-05 7.9 5/16
G 3/8
C-21
Nipple Ferrule
ID
OD
A
B
*
mm
mm
mm
MPa
64
25
27
100 14,500
psi
mm
mm
4.9
20.0
Catalogue 4462 Global Edition
Design Factor >2:1
MATERIAL
B
J
Hoses with design factor >2:1
1AYKY – 1YMKY – 1Y4KY
A
1AYKY – Type “M” female swivel
Design Factor >2:1
MATERIAL
B
J
Carbon steel, zinc plated, C: Stainless steel
DN
size mm inch
A
B
*
Nipple Ferrule
ID
OD
mm
mm
mm
MPa
mm
mm
1AYKY-6-04
6
-04 6.4
1/4
9/16 - 18UNF
61
30
22
110 15,950
3.8
18.0
1AYKY-6-04C
6
-04 6.4
1/4
9/16-18 UNF
62
32
22
128 18,560
3.6
18.2
1AYKY-8-05
8
-05 7.9 5/16
3/4 - 16UNF
70
31
27
100 14,500
4.9
20.0
A
1YMKY – High pressure tube nipple
metric – LH thread
MATERIAL
1YMKY-6-05
B
High strength carbon steel, zinc plated
DN
size mm inch
8
-05 7.9 5/16
M14x1.5-LH
Nipple Ferrule
ID
OD
A
B
mm
mm
MPa
psi
mm
mm
100
61
100
14,500
4.9
20.0
A
1Y4KY – High pressure tube nipple
UNF – LH thread
MATERIAL
1Y4KY-9-05
psi
B
Special materials
DN
size mm inch
8
-05 7.9 5/16
9/16 - 18UNF-LH
C-22
Nipple Ferrule
ID
OD
A
B
mm
mm
MPa
psi
mm
mm
100
61
100
14,500
4.9
20.0
Catalogue 4462 Global Edition
C
Hoses with design factor >2:1
1U0KY – 1D9KY
A
1U0KY – BSP female swivel (ballnose)
J
Carbon steel zinc plated, C: Stainless steel
DN
size mm inch
A
B
*
Nipple Ferrule
ID
OD
mm
mm
mm
MPa
mm
mm
1U0KY-4-04
6
-04 6.3
1/4
G 1/4
51
25
17
110 15,950
psi
3.8
18.0
1U0KY-4-04C
6
-04 6.3
1/4
G 1/4
51
25
17
110 15,950
3.8
18.0
A
1D9KY – BSP male
MATERIAL
B
Carbon steel, zinc plated, C: Stainless steel
DN
size mm inch
H
A
B
(
Nipple Ferrule
ID
OD
mm
mm
mm
MPa
mm
mm
1D9KY-4-04
6
-04 6.3
1/4
G 1/4
62
36
19
110 15,950
3.8
18.0
1D9KY-4-04C
6
-04 6.3
1/4
G 1/4
62
36
19
110 15,950
3.8
18.0
C-23
psi
Catalogue 4462 Global Edition
Design Factor >2:1
MATERIAL
B
Hoses with design factor >2:1
1YBKY – 101KY – 1TMBS
A
1YBKY – BSP male nozzle nipple
Design Factor >2:1
MATERIAL
B
Carbon steel zinc plated, C: Stainless steel
H
DN
size mm inch
A
B
(
Nipple Ferrule
ID
OD
mm
mm
mm
MPa
mm
mm
1YBKY-4-04
6
-04 6.4
1/4
G 1/4
62
36
10
110 15,950
psi
3.8
18.0
1YBKY-4-04C
6
-04 6.4
1/4
G 1/4
62
36
10
110 15,950
3.8
18.0
1YBKY-4-05
8
-05 7.9 5/16
G 1/4
68
35
13
100 14,500
4.9
20.0
1YBKY-6-05
8
-05 7.9 5/16
G 3/8
71
37
17
100 14,500
4.9
20.0
101KY – National Pipe Tapered (NPT) male
MATERIAL
A
B
Carbon steel zinc plated, C: Stainless steel
H
DN
size mm inch
A
B
(
Nipple Ferrule
ID
OD
mm
mm
mm
mm
mm
101KY-4-04
6
-04 6.4
1/4
1/4 NPT
62
35
13
103.4 15,000
MPa
psi
3.8
18.0
101KY-4-04C
6
-04 6.4
1/4
1/4 NPT
62
35
13
103.4 15,000
3.8
18.0
101KY-6-04
6
-04 6.4
1/4
3/8 NPT
67
35
17
103.4 15,000
3.8
18.0
101KY-6-04C
6
-04 6.4
1/4
3/8 NPT
67
35
17
103.4 15,000
3.8
18.0
101KY-4-05
8
-05 7.9 5/16
1/4 NPT
69
35
13
103.4 15,000
4.9
20.0
101KY-6-05
8
-05 7.9 5/16
3/8 NPT
69
35
17
103.4 15,000
4.9
20.0
1TMBS – Polyflex Lok components
Description
1TMBS-8-05-HPK
Fitting for DN8 hoses incl. caps (refer to pages D-2, D-3)
C-24
Catalogue 4462 Global Edition
C
Hoses with design factor >2:1
2380M
2380M – High pressure hose
CONSTRUCTION
Core tube
: Polyamide
Pressure reinforcement : Two spiral layers and two open spiral layers of high
tensile steel wire
TEMPERATURE RANGE
: Polyurethane
: Black
Design Factor >2:1
Cover
Standard colour
-10°C up to +120°C
DN
size
mm
inch
mm
MPa
psi
MPa
psi
mm
kg/m
2380M-04V30W
6
-04
6.3
1/4
15.8
110
15,950
280
40,600
70
0.28
2380M-05V30W
8
-05
8.3
5/16
15.8
100
14,500
250
36,250
90
0.35
NOTES
–
C-25
Catalogue 4462 Global Edition
Hoses with design factor >2:1
1C9KX – 192KX – 1AYKX
A
1C9KX – Metric female swivel heavy series
with O-ring
Design Factor >2:1
MATERIAL
B
J
Carbon steel, zinc plated
DN
size mm inch
A
B
*
Nipple Ferrule
ID
OD
mm
mm
mm
MPa
mm
mm
1C9KX-10-04W
6
-04 6.4
1/4
M18x1.5
68
36
22
110 15,950
4.0
17.4
1C9KX-16-05W
8
-05 7.9 5/16
M24x1.5
77
38
30
100 14,500
5.3
20.2
192KX – BSP female swivel (60° cone)
A
B
J
MATERIAL
psi
Carbon steel, zinc plated
DN
size mm inch
A
B
*
Nipple Ferrule
ID
OD
mm
mm
mm
MPa
mm
mm
192KX-4-04W
6
-04 6.4
1/4
G 1/4
56
25
19
110 15,950
4.0
17.4
192KX-6-05W
8
-05 7.9 5/16
G 3/8
64
25
27
100 14,500
5.3
20.2
A
1AYKX – Type “M” female swivel
MATERIAL
psi
B
J
Carbon steel, zinc plated
DN
size mm inch
A
B
*
Nipple Ferrule
ID
OD
mm
mm
mm
MPa
mm
mm
1AYKX-6-04W
6
-04 6.4
1/4
9/16 - 18UNF
61
30
22
110 15,950
4.0
17.4
1AYKX-8-05W
8
-05 7.9 5/16
3/4 - 16UNF
70
31
27
100 14,500
5.3
20.2
C-26
psi
Catalogue 4462 Global Edition
C
Hoses with design factor >2:1
2388N
2388N – High pressure hose
CONSTRUCTION
Core tube
: Polyamide
Pressure reinforcement : Two spiral layers and two open spiral layers of high
tensile steel wire
TEMPERATURE RANGE
2388N-08V12W
NOTES
: Polyurethane
: Blue
Design Factor >2:1
Cover
Standard colour
-10°C up to +70°C
DN
size
mm
inch
mm
MPa
psi
MPa
psi
mm
kg/m
12
-08
13.0
1/2
23.0
110
15,950
275
39,875
100
0.80
–
C-27
Catalogue 4462 Global Edition
Hoses with design factor >2:1
101BS – 192BS – 1C9BS
A
101BS – National Pipe Tapered (NPT) male
Design Factor >2:1
MATERIAL
B
Carbon steel, zinc plated, C: Stainless steel
H
A
B
(
Nipple Ferrule
ID
OD
DN
size mm inch
mm
mm
mm
mm
mm
101BS-8-08
12
-08 12.7 1/2
1/2 NPT
93
40
22
103.5 15,000
MPa
7.6
28.5
101BS-8-08C
12
-08 12.7 1/2
1/2 NPT
93
40
22
103.5 15,000
7.6
28.5
A
192BS – BSP female swivel (60° cone)
B
J
MATERIAL
psi
Carbon steel, zinc plated, C: Stainless steel
A
B
*
Nipple Ferrule
ID
OD
DN
size mm inch
mm
mm
mm
MPa
mm
mm
192BS-8-08
12
-08 12.7 1/2
G1/2
81
28
27
110 15,950
7.6
28.5
192BS-8-08C
12
-08 12.7 1/2
G1/2
81
28
27
110 15,950
7.6
28.5
A
1C9BS – Metric female swivel
heavy series with O-ring
MATERIAL
psi
B
J
Carbon steel, zinc plated, C: Stainless steel
A
B
*
Nipple Ferrule
ID
OD
DN
size mm inch
mm
mm
mm
MPa
mm
mm
1C9BS-14-08
12
-08 12.7 1/2
M22x1.5
89
36
27
110 15,950
7.6
28.5
1C9BS-14-08C
12
-08 12.7 1/2
M22x1.5
89
36
27
110 15,950
7.6
28.5
1C9BS-16-08
12
-08 12.7 1/2
M24x1.5
89
36
30
110 15,950
7.6
28.5
1C9BS-16-08C
12
-08 12.7 1/2
M24x1.5
89
36
30
110 15,950
7.6
28.5
C-28
psi
Catalogue 4462 Global Edition
C
Hoses with design factor >2:1
1AYBS – 1TMBS
A
1AYBS – Type “M” female swivel
Carbon steel, zinc plated, C: Stainless steel
A
B
*
Nipple Ferrule
ID
OD
DN
size mm inch
mm
mm
mm
MPa
mm
mm
1AYBS-11-08
12
-08 12,7 1/2
1 - 12 UNF
77
31
32
110 15,950
psi
7.6
28.5
1AYBS-11-08C
12
-08 12,7 1/2
1 - 12 UNF
77
31
32
110 15,950
7.6
28.5
1TMBS – Polyflex Lok components
Description
1TMBS-9-08-HPK
Fitting for DN12 hoses incl. caps (refer to pages D-2, D-3)
C-29
Catalogue 4462 Global Edition
Design Factor >2:1
MATERIAL
B
J
Hoses with design factor >2:1
2580N
2580N – High pressure hose
CONSTRUCTION
Core tube
: Polyamide
Pressure reinforcement : Four spiral layers and two open spiral layers of high
Design Factor >2:1
tensile steel wire
Cover
Standard colour
TEMPERATURE RANGE
: Polyurethane
: Dark blue
-10°C up to +70°C
DN
size
mm
inch
mm
MPa
psi
MPa
psi
mm
kg/m
2580N-06V12
10
-06
9.8
3/8
21.6
160
23,200
400
58,000
95
0.94
2580N-08V12
12
-08
12.9
1/2
25.0
140
20,300
350
50,750
110
1.19
2580N-12V12
20
-12
19.8
3/4
32.6
120
17,400
300
43,500
170
1.76
NOTES
–
C-30
Catalogue 4462 Global Edition
C
Hoses with design factor >2:1
101BL – 192BL
A
101BL – National Pipe Tapered (NPT) male
MATERIAL
B
Carbon steel, zinc plated, C: Stainless steel
H
B
(
Nipple Ferrule
ID
OD
DN
size mm inch
mm
mm
mm
MPa
mm
mm
101BL-6-06
10
-06 9.5
3/8
3/8 NPT
80
35
22
160 23,200
5.5
28.5
101BL-8-08
12
-08 12.7 1/2
1/2 NPT
90
45
22
140 20,300
7.5
30.5
101BL-8-08C
12
-08 12.7 1/2
1/2 NPT
90
45
22
140 20,300
7.5
30.5
101BL-12-12
20
-12 19.0 3/4
3/4 NPT
98
45
30
120 17,400 12.5
39.8
A
192BL – BSP female swivel (60° cone)
MATERIAL
psi
J
B
Carbon steel, zinc plated, C: Stainless steel
A
B
*
Nipple Ferrule
ID
OD
DN
size mm inch
mm
mm
mm
MPa
mm
mm
192BL-6-06
10
-06 9.5
3/8
G3/8
68
24
22
160 23,200
5.5
28.5
192BC-8-06
10
-06 9.5
3/8
G1/2
71
26
27
160 23,200
5.5
28.5
192BL-8-08
12
-08 12.7 1/2
G1/2
71
26
27
140 20,300
7.5
30.5
192BL-8-08C
12
-08 12.7 1/2
G1/2
71
26
27
140 20,300
7.5
30.5
192BL-16-12
20
-12 19.0 3/4
G1
82
28
41
120 17,400 12.5
39.8
C-31
psi
Catalogue 4462 Global Edition
Design Factor >2:1
A
Hoses with design factor >2:1
1C9BL – 1AYBL – 1TMBL
A
1C9BL – Metric female swivel heavy series
with O-ring
Design Factor >2:1
MATERIAL
B
J
Carbon steel, zinc plated, C: Stainless steel
A
B
*
Nipple Ferrule
ID
OD
DN
size mm inch
mm
mm
mm
mm
MPa
mm
mm
1C9BL-14-06
10
-06 9.5
3/8
M22 x 1.5
14
80
36
30
160 23,200
5.5
28.5
1C9BL-16-06
10
-06 9.5
3/8
M24 x 1.5
16
84
36
30
160 23,200
5.5
28.5
1C9BL-14-08
12
-08 12.7 1/2
M22 x 1.5
14
80
36
27
140 20,300
7.5
30.5
1C9BL-14-08C
12
-08 12.7 1/2
M22 x 1.5
14
80
36
27
140 20,300
7.5
30.5
1C9BL-16-08
12
-08 12.7 1/2
M24 x 1.5
16
80
36
30
140 20,300
7.5
30.5
1C9BL-16-08C
12
-08 12.7 1/2
M24 x 1.5
16
80
36
30
140 20,300
7.5
30.5
1C9BL-25-12
20
-12 19.0 3/4
M36 x 2.0
25
97
44
46
120 17,400 12.5
39.8
A
1AYBL – Type “M” female swivel
MATERIAL
psi
B
J
Carbon steel, zinc plated, C: Stainless steel
A
B
*
Nipple Ferrule
ID
OD
DN
size mm inch
mm
mm
mm
MPa
mm
mm
1AYBL-11-06
10
-06 9.5
3/8
1 - 12 UNF
77
31
32
160 23,200
psi
5.5
28.5
1AYBL-11-08
12
-08 12.7 1/2
1 - 12 UNF
77
31
32
140 20,300
7.5
30.5
1AYBL-11-08C
12
-08 12.7 1/2
1 - 12 UNF
77
31
32
140 20,300
7.5
30.5
1TMBL – Polyflex Lok components
Description
1TMBL-9-08-HPK
Fitting for DN12 hoses incl. caps (refer to pages D-2, D-3)
C-32
Catalogue 4462 Global Edition
C
Hoses with design factor >2:1
2440D / 2440N
2440D / 2440N – Ultra-high pressure hose
CONSTRUCTION
Core tube
: DN 3-8: Polyoxymethylene; DN 10-25: Polyamide
Pressure reinforcement : Four spiral layers of maximum tensile steel wire
TEMPERATURE RANGE
: Polyamide
: DN 3-8: blue; DN 10-25: black
Design Factor >2:1
Cover
Standard colour
-10°C up to +70°C
DN
size
mm
inch
mm
MPa
psi
MPa
psi
mm
kg/m
2440D-02V32
3
-02
3.0
1/8
7.9
207
30,000
518
75,000
100
0.12
2440D-025V32
4
-025
4.0
5/32
10.4
220
31,900
550
79,750
100
0.21
2440D-03V32
5
-03
4.8
3/16
11.5
180
26,100
450
65,250
130
0.28
2440D-04V32
6
-04
6.4
1/4
12.5
164
23,780
410
59,450
155
0.33
2440D-05V32
8
-05
8.1
5/16
15.1
150
21,750
375
54,375
175
0.44
2440N-06V30
10
-06
9.7
3/8
19.4
140
20,300
350
50,750
190
0.73
2440N-08V30
12
-08
12.8
1/2
22.5
130
18,850
325
47,125
200
0.94
2440N-12V30
20
-12
19.6
3/4
30.0
100
14,500
250
36,250
250
1.39
2440N-16V30
25
-16
25.0
1
37.0
90
13,050
225
32,625
300
2.00
NOTES
–
C-33
Catalogue 4462 Global Edition
Hoses with design factor >2:1
2440D-Tough Cover
2440D-TOUGH COVER – Ultra-high pressure hose
Design Factor >2:1
CONSTRUCTION
Core tube
: Polyoxymethylene
Pressure reinforcement : Four spiral layers of maximum tensile steel wire
Cover
Standard colour
TEMPERATURE RANGE
: Polyamide
: blue
-10°C up to +70°C
DN
size
mm
inch
mm
MPa
psi
MPa
psi
mm
kg/m
2440D-025V32-TC
4
-025
3.9
5/32
10.4
220
31,900
550
79,750
100
0.21
2440D-03V32-TC
5
-03
4.7
3/16
11.5
180
26,100
450
65,250
130
0.28
2440D-04V32-TC
6
-04
6.3
1/4
12.5
164
23,780
410
59,450
155
0.33
2440D-05V32-TC
8
-05
8.0
5/16
15.1
150
21,750
375
54,375
175
0.44
2440N-06V30-TC
10
-06
9.7
3/8
19.4
140
20,300
350
50,750
190
0.73
2440N-08V30-TC
12
-08
12.8
1/2
22.5
130
18,850
325
47,125
200
0.94
NOTES
–
C-34
Catalogue 4462 Global Edition
C
Hoses with design factor >2:1
1C9LX
A
1C9LX – Metric female swivel heavy series
with O-ring
J
High strength carbon steel, zinc plated, C: Stainless steel
A
B
*
Nipple Ferrule
ID
OD
DN
size mm inch
mm
mm
mm
MPa
mm
mm
1C9LX-8-025
4
-025 4.0 5/32
M16x1.5
67
30
22
220 31,900
1.4
14.6
1C9LX-14-03
5
-03 4.8 3/16
M22x1.5
75
33
30
180 26,100
1.4
15.3
1C9LX-16-03
5
-03 4.8 3/16
M24x1.5
80
38
30
180 26,100
1.4
15.3
1C9LX-10-04
6
-04 6.4
1/4
M18x1.5
76
31
27
164 23,780
2.9
17.0
1C9LX-16-04
6
-04 6.4
1/4
M24x1.5
85
40
30
164 23,780
2.9
17.0
1C9LX-12-05
8
-05 7.9 5/16
M20x1.5
78
34
27
150 21,750
3.7
21.0
1C9LX-14-05
8
-05 7.9 5/16
M22x1.5
84
40
30
150 21,750
3.7
21.0
1C9LX-16-05
8
-05 7.9 5/16
M24x1.5
84
40
30
150 21,750
3.7
21.0
1C9LX-16-05C
8
-05 7.9 5/16
M24x1.5
84
40
30
150 21,750
3.7
21.0
1C9LX-12-06
10
-06 9.5
3/8
M20x1.5
76
30
27
140 20,300
5.8
26.9
1C9LX-14-06
10
-06 9.5
3/8
M22x1.5
76
30
30
140 20,300
5.8
26.9
1C9LX-14-06C
10
-06 9.5
3/8
M22x1.5
76
30
30
140 20,300
5.8
26.9
1C9LX-16-06
10
-06 9.5
3/8
M24x1.5
80
34
30
140 20,300
5.8
26.9
1C9LX-16-06C
10
-06 9.5
3/8
M24x1.5
80
34
30
140 20,300
5.8
26.9
1C9LX-16-08
12
-08 12.7 1/2
M24x1.5
88
34
30
130 18,850
6.7
30.7
1C9LX-16-08C
12
-08 12.7 1/2
M24x1.5
88
34
30
130 18,850
6.7
30.7
1C9LX-25-12
20
-12 19.0 3/4
M36x2
92
39
46
100 14,500 12.7
38.5
1C9LX-25-12C4462
20
-12 19.0 3/4
M36x2
92
39
46
100 14,500 12.7
38.5
1C9LX-30-16
25
-16 25.4
1
M42x2
98
45
50
90
13,050 17.2
45.3
6C9LX-30-16C
25
-16 25.4
1
M42x2
118
52
50
90
13,050 17.2
45.3
C-35
psi
Catalogue 4462 Global Edition
Design Factor >2:1
MATERIAL
B
Hoses with design factor >2:1
6AYLX / 1AYLX – 1YMLX
A
6AYLX / 1AYLX – Type “M” female swivel
Design Factor >2:1
MATERIAL
B
J
High strength carbon steel, zinc plated, C: Stainless steel
DN
size mm inch
A
B
*
Nipple Ferrule
ID
OD
mm
mm
mm
MPa
1AYLX-6-02
3
-02 3.0
1/8
9/16 - 18UNF
48
26
22
207 30,000
1.5
9.8
6AYLX-6-2AC
4
-025 4.0 5/32
9/16 - 18 UNF
64
33
17
301 43,645
1.6
13.2
1AYLX-6-025
4
-025 4.0 5/32
9/16 - 18 UNF
64
33
22
220 31,900
1.4
14.6
1AYLX-6-03
5
-03 4.8 3/16
9/16 - 18UNF
66
26
22
180 26,100
1.4
15.3
1AYLX-6-03C
5
-03 4.8 3/16
9/16 - 18 UNF
67
26
22
180 26,100
1.4
15.3
1AYLX-6-04
6
-04 6.4
1/4
9/16 - 18UNF
61
29
22
164 23,780
2.9
17.0
1AYLX-6-04C
6
-04 6.4
1/4
9/16 - 18UNF
61
29
22
164 23,780
2.9
17.0
1AYLX-8-05
8
-05 7.9 5/16
3/4 - 16UNF
74
30
27
150 21,750
3.7
21.0
1AYLX-8-05C
8
-05 7.9 5/16
3/4 - 16 UNF
70
31
27
150 21,750
3.7
21.0
1AYLX-8-06
10
-06 9.5
3/8
3/4 - 16UNF
70
26
27
140 20,300
5.8
26.9
1AYLX-8-06C
10
-06 9.5
3/8
3/4 - 16 UNF
70
25
27
140 20,300
5.8
26.9
1AYLX-11-08
12
-08 12.7 1/2
1 - 12 UNF
80
27
32
130 18,850
6.7
30.7
1AYLX-11-08C
12
-08 12.7 1/2
1 - 12 UNF
80
27
32
130 18,850
6.7
30.7
1AYLX-16-12
20
-12 19.0 3/4
1 5/16-12UNF
82
29
41
100 14,500 12.7
38.5
1AYLX-16-12C4462
20
-12 19.0 3/4
1 5/16-12 UNF
82
29
41
100 14,500 12.7
38.5
6AYLX-16-16C
25
-16 25.4
1 5/16 - 12 UNF
100
47
38
90
45.3
1
mm
13,050 17.2
mm
A
1YMLX – High pressure tube nipple
metric – LH thread
MATERIAL
psi
B
High strength carbon steel, zinc plated, C: Stainless steel
A
B
Nipple Ferrule
ID
OD
DN
size mm inch
mm
mm
MPa
psi
mm
mm
4
-025 4.0 5/32
M14x1.5-LH
103
66
220
31,900
1.4
14.6
1YMLX-6-05
8
-05 7.9 5/16
M14x1.5-LH
110
66
150
21,750
3.7
21.0
1YMLX-11-08
12
-08 12.7 1/2
M18x1.5-LH
120
65
250
36,250
6.7
30.7
1YMLX-11-12C4462
20
-12 19.0 3/4
M18x1.5-LH
122
69
250
36,250
12.7
38.5
1YMLX-6-025
C-36
Catalogue 4462 Global Edition
C
Hoses with design factor >2:1
1YALX / 1Y4LX
A
1YALX / 1Y4LX – High pressure tube nipple
UNF – LH thread
Special materials, C: Stainless steel
A
B
Nipple Ferrule
ID
OD
DN
size mm inch
mm
mm
MPa
psi
mm
mm
1YALX-1-025
4
-025 4.0 5/32
1/4 - 28UNF-LH
87
50
220
31,900
1.4
14.6
1YALX-1-025C
4
-025 4.0 5/32
1/4 - 28UNF-LH
87
50
220
31,900
1.4
14.6
1YALX-3-025
4
-025 4.0 5/32
3/8 - 24UNF-LH
89
50
220
31,900
1.4
14.6
1YALX-1-03
5
-03 4.8 3/16
1/4 - 28UNF-LH
92
53
180
26,100
1.4
15.3
1YALX-1-03C
5
-03 4.8 3/16
1/4 - 28UNF-LH
92
53
180
26,100
1.4
15.3
1YALX-3-03
5
-03 4.8 3/16
3/8 - 24UNF-LH
99
57
180
26,100
1.4
15.3
1YALX-3-03C
5
-03 4.8 3/16
3/8 - 24UNF-LH
99
57
180
26,100
1.4
15.3
1YALX-6-03
5
-03 4.8 3/16
9/16 - 18UNF-LH
108
78
180
26,100
1.4
15.3
1YALX-6-03C
5
-03 4.8 3/16
9/16 - 18UNF-LH
108
78
180
26,100
1.4
15.3
1YALX-3-04
6
-04 6.4
1/4
3/8 - 24UNF-LH
102
58
164
23,780
2.9
17.0
1YALX-6-04
6
-04 6.4
1/4
9/16 - 18UNF-LH
112
67
164
23,780
2.9
17.0
1YALX-3-05C
8
-05 7.9 5/16
3/8 - 24UNF-LH
103
59
150
21,750
3.7
21.0
1YALX-6-05
8
-05 7.9 5/16
9/16 - 18UNF-LH
110
66
150
21,750
3.7
21.0
1YALX-6-05C
8
-05 7.9 5/16
9/16 - 18UNF-LH
110
66
150
21,750
3.7
21.0
1YALX-6-06
10
-06 9.5
9/16 - 18UNF-LH
106
62
140
20,300
5.8
26.9
3/8
C-37
Catalogue 4462 Global Edition
Design Factor >2:1
MATERIAL
B
Hoses with design factor >2:1
192LX / 692LX – 1Y9LX
A
192LX / 692LX – BSP female swivel (60° cone)
B
J
Design Factor >2:1
MATERIAL
High strength carbon steel, zinc plated, C: Stainless steel
A
B
*
Nipple Ferrule
ID
OD
DN
size mm inch
mm
mm
mm
MPa
mm
mm
192LX-4-03
5
-03 4.8 3/16
G 1/4
64
25
22
180 26,100
1.4
15.3
192LX-4-03C
5
-03 4.8 3/16
G 1/4
64
25
22
180 26,100
1.4
15.3
192LX-6-05
8
-05 7.9 5/16
G 3/8
69
25
27
150 21,750
3.7
21.0
192LX-6-05C
8
-05 7.9 5/16
G 3/8
69
25
27
150 21,750
3.7
21.0
192LX-8-06
10
-06 9.5
3/8
G 1/2
66
22
30
140 20,300
5.8
26.9
192LX-8-06C
10
-06 9.5
3/8
G 1/2
66
22
30
140 20,300
5.8
26.9
192LX-8-08
12
-08 12.7 1/2
G 1/2
75
21
30
130 18,850
6.7
30.7
192LX-8-08C
12
-08 12.7 1/2
G 1/2
75
21
30
130 18,850
6.7
30.7
192LX-12-08C
12
-08 12.7 1/2
G 3/4
85
30
32
130 18.850
6.7
30.7
192LX-16-12
20
-12 19.0 3/4
G1
77
24
41
100 14,500 12.7
38.5
192LX-16-12C4462
20
-12 19.0 3/4
G1
77
24
41
100 14,500 12.7
38.5
192LX-20-16
25
-16 25.4
1
G 1 1/4
78
25
50
90
13,050 17.2
45.3
692LX-16-16C
25
-16 25.4
1
G 1 1/4
78
25
50
90
13,050 17.2
45.3
A
1Y9LX – BSP male for USIT ring
MATERIAL
psi
B
High strength carbon steel, zinc plated, C: Stainless steel
H
A
B
(
Nipple Ferrule
ID
OD
DN
size mm inch
mm
mm
mm
MPa
mm
mm
1Y9LX-4-03
5
-03 4.8 3/16
G 1/4
72
32
22
180 26,100
1.4
15.3
1Y9LX-4-03C
5
-03 4.8 3/16
G 1/4
72
32
22
180 26,100
1.4
15.3
1Y9LX-6-05
8
-05 7.9 5/16
G 3/8
82
38
27
150 21,750
3.7
21.0
1Y9LX-8-08
12
-08 12.7 1/2
G 1/2
87
32
36
130 18,850
6.7
30.7
C-38
psi
Catalogue 4462 Global Edition
C
Hoses with design factor >2:1
1D9LX – 1C3LX
A
1D9LX – BSP male
MATERIAL
B
High strength carbon steel, zinc plated
H
B
(
Nipple Ferrule
ID
OD
DN
size mm inch
mm
mm
mm
MPa
mm
mm
1D9LX-4-025
4
-025 4.0 5/32
G 1/4
73
36
19
220 31,900
1.4
14.6
1D9LX-4-03
5
-03 4.8 3/16
G 1/4
77
35
19
180 26,100
1.4
15.3
1D9LX-4-04
6
-04 6.4
1/4
G 1/4
80
36
19
164 23,780
2.9
17.0
1D9LX-4-05
8
-05 7.9 5/16
G 1/4
77
33
19
150 21,750
3.7
21.0
1D9LX-4-06
10
-06 9.5
G 1/4
76
30
19
140 20,300
5.8
26.9
3/8
A
1C3LX – Metric female swivel light series
B
J
MATERIAL
psi
High strength carbon steel, zinc plated, C: Stainless steel
A
B
*
Nipple Ferrule
ID
OD
DN
size mm inch
mm
mm
mm
MPa
mm
mm
1C3LX-8-025
4
-025 4.0 5/32
M14x1,5
63
26
22
220 31,900
1.4
14.6
1C3LX-8-03
5
-03 4.8 3/16
M14x1.5
64
25
22
180 26,100
1.4
15.3
1C3LX-8-03C
5
-03 4.8 3/16
M14x1.5
64
25
22
180 26,100
1.4
15.3
1C3LX-8-04
6
-04 6.4
1/4
M14x1.5
69
25
22
164 23,780
2.9
17.0
1C3LX-8-04C
6
-04 6.4
1/4
M14x1.5
69
25
22
164 23,780
2.9
17.0
C-39
psi
Catalogue 4462 Global Edition
Design Factor >2:1
A
Hoses with design factor >2:1
1C6LX – 1MRLX
A
1C6LX – Metric female swivel heavy series
Design Factor >2:1
MATERIAL
B
J
High strength carbon steel, zinc plated
DN
size mm inch
A
B
*
Nipple Ferrule
ID
OD
mm
mm
mm
MPa
mm
mm
1C6LX-12-04
6
-04 6.4
1/4
M20x1,5
80
36
27
164 23,780
psi
2.9
17.0
1C6LX-12-05
8
-05 7.9 5/16
M20x1.5
78
34
27
150 21,750
3.7
21.0
A
1MRLX – Metric female swivel 59° cone
B
J
MATERIAL
High strength carbon steel, zinc plated
A
B
*
Nipple Ferrule
ID
OD
DN
size mm inch
mm
mm
mm
MPa
mm
mm
1MRLX-6-03
5
-03 4.8 3/16
M12x1.5
92
53
17
180 26,100
1.4
15.3
1MRLX-8-03
5
-03 4.8 3/16
M14x1.5
66
26
22
180 26,100
1.4
15.3
C-40
psi
Catalogue 4462 Global Edition
C
Hoses with design factor >2:1
101LX / 601LX
A
101LX / 601LX – National Pipe Tapered (NPT)
male
MATERIAL
B
Special materials, C: Stainless steel
H
B
(
Nipple Ferrule
ID
OD
DN
size mm inch
mm
mm
mm
mm
mm
101LX-2-025
4
-025 4.0 5/32
1/8 NPT
68
30
14
103.4 15,000
1.4
14.6
101LX-4-03
5
-03 4.8 3/16
1/4 NPT
75
33
14
103.4 15,000
1.4
15.3
101LX-2-04
6
-04 6.4
1/4
1/8 NPT
75
30
14
103.4 15,000
2.9
17.0
101LX-4-04
6
-04 6.4
1/4
1/4 NPT
80
36
14
103.4 15,000
2.9
17.0
101LX-4-04C
6
-04 6.4
1/4
1/4 NPT
80
36
14
103.4 15,000
2.9
17.0
101LX-6-04
6
-04 6.4
1/4
3/8 NPT
80
36
19
103.4 15,000
2.9
17.0
101LX-4-05
8
-05 7.9 5/16
1/4 NPT
76
31
14
103.4 15,000
3.7
21.0
101LX-4-05C
8
-05 7.9 5/16
1/4 NPT
76
31
14
103.4 15,000
3.7
21.0
101LX-6-05
8
-05 7.9 5/16
3/8 NPT
75
35
19
103.4 15,000
3.7
21.0
101LX-6-05C
8
-05 7.9 5/16
3/8 NPT
81
36
19
103.4 15,000
3.7
21.0
101LX-6-06
10
-06 9.5
3/8
3/8 NPT
76
30
19
103.4 15,000
5.8
26.9
101LX-8-06
10
-06 9.5
3/8
1/2 NPT
81
35
22
103.4 15,000
5.8
26.9
101LX-8-06C
10
-06 9.5
3/8
1/2 NPT
81
35
22
103.4 15,000
5.8
26.9
101LX-8-08
12
-08 12.7 1/2
1/2 NPT
91
37
22
103.4 15,000
6.7
30.7
101LX-8-08C
12
-08 12.7 1/2
1/2 NPT
91
37
22
103.4 15,000
6.7
30.7
101LX-12-12
20
-12 19.0 3/4
3/4 NPT
124
57
35
69.0 10,000 12.7
38.5
101LX-16-16
25
-16 25.4
1
1 NPT
125
64
35
69.0 10,000 17.2
45.3
601LX-16-16C
25
-16 25.4
1
1 NPT
125
64
35
69.0 10,000 17.2
45.3
C-41
MPa
psi
Catalogue 4462 Global Edition
Design Factor >2:1
A
Hoses with design factor >2:1
6YHLX
6YHLX – UNF male nozzle nipple
A
B
ØR
Design Factor >2:1
MATERIAL
NOTE
Special materials, C: Stainless steel
*ProLance fitting
Nipple Ferrule
ID
OD
A
B
R
mm
mm
mm
MPa
psi
mm
mm
58
26
8
280
40,600
1.6
11.6
DN
size mm inch
4
-025 4.0 5/32
6YHLX-4-2AC-PL-LH*
4
-025 4.0 5/32 1/4 - 28 UNF LH
58
26
8
280
40,600
1.6
11.6
6YHLX-4-3C-PL*
5
-03
62
29
10
280
40,600
2.1
12.5
6YHLX-4-2AC-PL*
4.8 3/16
1/4 - 28 UNF
1/4 - 28 UNF
6YHLX-4-3C-PL-LH*
5
-03
4.8 3/16 1/4 - 28 UNF LH
62
29
10
280
40,600
2.1
12.5
6YHLX-6-3C-PL*
5
-03
4.8 3/16
65
32
10
250
36,250
2.1
12.5
3/8 - 24 UNF
6YHLX-6-3C-PL-LH*
5
-03
4.8 3/16 3/8 - 24 UNF LH
65
32
10
250
36,250
2.1
12.5
6YHLX-6-4C-PL*
6
-04
6.4
1/4
3/8 - 24 UNF
66
36
11
250
36,250
3.4
15.0
1/4
250
6YHLX-6-4C-PL-LH*
6
-04
6.4
3/8 - 24 UNF LH
66
36
11
36,250
3.4
15.0
6YHLX-9-5C-PL*
8
-05
7.9 5/16
9/16 - 18 UNF
80
36
16
137.9 20,000
4.3
17.4
6YHLX-9-5C-PL-LH*
8
-05
7.9 5/16
9/16 - 18 UNF
80
36
16
137.9 20,000
4.3
17.4
C-42
Catalogue 4462 Global Edition
C
Hoses with design factor >2:1
6HYLX
6HYLX – UNF female
for water jetting nozzle
A
B
ØR
Special materials, C: Stainless steel
*ProLance fitting
6HYLX-4-2AC-PL*
DN
size mm inch
4
-025 4.0 5/32
1/4 - 28 UNF
Nipple Ferrule
ID
OD
A
B
R
mm
mm
mm
MPa
psi
mm
mm
51
19
9
280
40,600
1.6
11.6
6HYLX-4-2AC-PL-LH*
4
-025 4.0 5/32 1/4 - 28 UNF LH
51
19
9
280
40,600
1.6
11.6
6HYLX-6-2AC-PL-LH*
4
-025 4.0 5/32 3/8 - 24 UNF-LH
49
21
11
280
40,600
1.6
11.6
6HYLX-4-3C-PL*
5
-03
4.8 3/16
6HYLX-4-3C-PL-LH*
5
-03
4.8 3/16 1/4 - 28 UNF LH
1/4 - 28 UNF
6HYLX-6-3C-PL*
5
-03
4.8 3/16
6HYLX-6-3C-PL-LH*
5
-03
4.8 3/16 3/8 - 24 UNF LH
3/8 - 24 UNF
52
19
9
280
40,600
2.1
12.5
52
19
9
280
40,600
2.1
12.5
56
23
11
250
36,250
2.1
12.5
56
23
11
250
36,250
2.1
12.5
6HYLX-6-4C-PL*
6
-04
6.4
1/4
3/8 - 24 UNF
58
25
11
250
36,250
3.4
15.0
6HYLX-6-4C-PL-LH*
6
-04
6.4
1/4
3/8 - 24 UNF LH
58
25
11
250
36,250
3.4
15.0
6HYLX-9-5C-PL*
8
-05
7.9 5/16
9/16 - 18 UNF
72
28
17
137.9 20,000
4.3
17.4
6HYLX-9-5C-PL-LH*
8
-05
7.9 5/16
9/16 - 18 UNF
72
28
17
137.9 20,000
4.3
17.4
C-43
Catalogue 4462 Global Edition
Design Factor >2:1
MATERIAL
NOTE
Hoses with design factor >2:1
66YLX – 65YLX
A
66YLX – High pressure female swivel
Design Factor >2:1
MATERIAL
J
B
Special materials, C: Stainless steel
A
B
*
Nipple Ferrule
ID
OD
DN
size mm inch
mm
mm
mm
MPa
mm
mm
66YLX-4-3
5
-03 4.8 3/16
9/16 - 18 UNF
71
33
19
180 26,100
2.1
15.0
66YLX-4-3C
5
-03 4.8 3/16
9/16 - 18 UNF
74
36
17
180 26,100
2.1
15.0
A
65YLX – Medium pressure female swivel
MATERIAL
psi
J
B
Special materials, C: Stainless steel
A
B
*
Nipple Ferrule
ID
OD
DN
size mm inch
mm
mm
mm
mm
mm
65YLX-6-3
5
-03 4.8 3/16
9/16 - 18
78
39
19
137.9 20,000
2.1
15.0
65YLX-6-3C
5
-03 4.8 3/16
9/16 - 18
78
39
19
137.9 20,000
2.1
15.0
65YLX-6-4
6
-04 6.4
1/4
9/16 - 18
72
39
19
137.9 20,000
3.4
15.6
65YLX-6-4C
6
-04 6.4
1/4
9/16 - 18
72
39
19
137.9 20,000
3.4
15.6
C-44
MPa
psi
Catalogue 4462 Global Edition
C
Hoses with design factor >2:1
6ZELX – 1Y2LX / 6Y2LX
A
6ZELX – Male water jetting nozzle
Special materials, C: Stainless steel
6ZELX-5-3C
DN
size mm inch
5
-03 4.8 3/16
5/16 - 24 RH
Nipple Ferrule
ID
OD
A
B
mm
mm
MPa
psi
mm
mm
56
28
137.9
20,000
2.1
15.0
A
1Y2LX / 6Y2LX – Medium pressure tube nipple
MATERIAL
B
Special materials, C: Stainless steel
A
B
Nipple Ferrule
ID
OD
DN
size mm inch
mm
mm
MPa
psi
mm
mm
1Y2LX-6-025
4
-025 4.0 5/32
3/8 - 24UNF-LH
112
65
137.9
20,000
1.4
14.6
1Y2LX-6-03
5
-03 4.8 3/16
3/8 - 24UNF-LH
118
65
137.9
20,000
1.4
15.3
1Y2LX-6-04
6
-04 6.4
1/4
3/8 - 24UNF-LH
120
65
137.9
20,000
2.9
17.0
1Y2LX-3-04C
6
-04 6.4
1/4
3/8 - 24UNF-LH
109
65
137.9
20,000
2.9
17.0
1Y2LX-9-05
8
-05 7.9 5/16
9/16 - 18 UNF LH
105
60
137.9
20,000
3.7
21.0
1Y2LX-9-06C
10
-06 9.5
3/8
9/16 - 18 UNF LH
137
91
137.9
20,000
5.8
26.9
1Y2LX-9-08
12
-08 12.7 1/2
9/16 - 18 UNF LH
110
60
137.9
20,000
6.7
30.7
1Y2LX-12-08C
12
-08 12.7 1/2
3/4 - 16 UNF LH
158
104
137.9
20,000
6.7
30.7
1Y2LX-12-12C4462
20
-12 19.0 3/4
3/4 - 16 UNF LH
160
100
137.9
20,000
12.7
38.5
6Y2LX-16-12C
20
-12 19.0 3/4
1 - 14 UNS-LH
137
70
137.9
20,000
13.3
34.2
C-45
Catalogue 4462 Global Edition
Design Factor >2:1
MATERIAL
B
Hoses with design factor >2:1
2448D-Tough Cover
2448D-TOUGH COVER – Ultra-high pressure hose
Design Factor >2:1
CONSTRUCTION
Core tube
: Polyoxymethylene
Pressure reinforcement : Four spiral layers of maximum tensile steel wire
Cover
Standard colour
TEMPERATURE RANGE
2448D-025V32-TC
NOTES
: Polyamide
: blue
-10°C up to +70°C
DN
size
mm
inch
mm
MPa
psi
MPa
psi
mm
kg/m
4
-025
4.0
5/32
9.9
325
47,120
650
94,240
100
0.21
–
C-46
Catalogue 4462 Global Edition
C
Hoses with design factor >2:1
6YHLX – 6HYLX
6YHLX – UNF male nozzle nipple
A
B
ØR
Stainless steel
*ProLance fitting
DN
size mm inch
6YHLX-4-2AC-PL*
4
-025 4.0 5/32
6YHLX-4-2AC-PL-LH*
4
-025 4.0 5/32 1/4 - 28 UNF LH
1/4 - 28 UNF
Nipple Ferrule
ID
OD
A
B
R
mm
mm
mm
MPa
psi
mm
mm
58
26
8
280
40,600
1.6
11.6
58
26
8
280
40,600
1.6
11.6
6HYLX – UNF female
for water jetting nozzle
A
B
ØR
MATERIAL
NOTE
Stainless steel
*ProLance fitting
6HYLX-4-2AC-PL*
DN
size mm inch
4
-025 4.0 5/32
1/4 - 28 UNF
Nipple Ferrule
ID
OD
A
B
R
mm
mm
mm
MPa
psi
mm
mm
51
19
9
280
40,600
1.6
11.6
6HYLX-4-2AC-PL-LH*
4
-025 4.0 5/32 1/4 - 28 UNF LH
51
19
9
280
40,600
1.6
11.6
6HYLX-6-2AC-PL-LH*
4
-025 4.0 5/32 3/8 - 24 UNF-LH
49
21
11
280
40,600
1.6
11.6
C-47
Catalogue 4462 Global Edition
Design Factor >2:1
MATERIAL
NOTE
Hoses with design factor >2:1
6Y4LX – 6AYLX
A
6Y4LX – High pressure tube nipple
UNF – LH thread
Design Factor >2:1
MATERIAL
B
Stainless steel
A
B
Nipple Ferrule
ID
OD
DN
size mm inch
mm
mm
MPa
psi
mm
mm
6Y4LX-4-2AC
4
-025 4.0 5/32
1/4 - 28UNF-LH
75
44
400
58,000
1.6
13.2
6Y4LX-6-2AC
4
-025 4.0 5/32
3/8 - 24UNF-LH
86
55
400
58,000
1.6
13.2
A
6AYLX – Type “M” female swivel
MATERIAL
6AYLX-6-2AC
B
J
Stainless steel
DN
size mm inch
4
-025 4.0 5/32
9/16 - 18 UNF
C-48
Nipple Ferrule
ID
OD
A
B
*
mm
mm
mm
MPa
64
33
17
301 43,645
psi
mm
mm
1.6
13.2
Catalogue 4462 Global Edition
C
Hoses with design factor >2:1
2640D / 2640N
2640D / 2640N – Ultra-high pressure hose
CONSTRUCTION
Core tube
: DN 4-8: Polyoxymethylene; DN 12-25: Polyamide
Pressure reinforcement : Six spiral layers of maximum tensile steel wire
TEMPERATURE RANGE
: Polyamide
: Blue
Design Factor >2:1
Cover
Standard colour
-10°C up to +70°C
DN
size
mm
inch
mm
MPa
psi
MPa
psi
mm
kg/m
2640D-025V32
4
-025
3.9
5/32
12.0
280
40,600
700
101,500
140
0.29
2640D-03V32
5
-03
4.8
3/16
13.0
250
36,250
625
90,625
175
0.41
2640D-04V32
6
-04
6.4
1/4
14.6
250
36,250
625
90,625
200
0.64
2640D-05V32
8
-05
8.0
5/16
16.9
210
30,450
525
76,125
225
0.68
2640N-08V32
12
-08
12.8
1/2
24.5
180
26,100
450
65,250
290
1.36
2640N-12V32
20
-12
19.6
3/4
33.0
140
20,300
350
50,750
350
2.10
2640N-16V32
25
-16
25.0
1
40.0
120
17,400
300
43,500
400
2.90
NOTES
–
C-49
Catalogue 4462 Global Edition
Hoses with design factor >2:1
1Y42X – 1YM2X / 1YMJX
A
1Y42X – High pressure tube nipple
UNF – LH thread
MATERIAL
B
Nipple: very high strength stainless steel
Design Factor >2:1
Shell: high strength carbon steel, zinc plated
Nipple Ferrule
ID
OD
A
B
mm
mm
MPa
psi
mm
mm
88
45
400
58,000
1.9
15.6
DN
size mm inch
1Y42X-4-025
4
-025 4.0 5/32
1/4 - 28UNF-LH
1Y42X-6-025
4
-025 4.0 5/32
3/8 - 24UNF-LH
98
55
400
58,000
1.9
15.6
1Y42X-4-03
5
-03 4.8 3/16
1/4 - 28UNF-LH
116
63
400
58,000
2.3
18.6
1Y42X-6-03
5
-03 4.8 3/16
3/8 - 24UNF-LH
116
63
400
58,000
2.3
18.6
1Y42X-9-03
5
-03 4.8 3/16
9/16 - 18UNF-LH
116
63
400
58,000
2.3
18.6
1Y42X-6-04
6
-04 6.4
1/4
3/8 - 24UNF-LH
116
63
400
58,000
3.1
19.1
1Y42X-9-04
6
-04 6.4
1/4
9/16 - 18UNF-LH
116
63
400
58,000
3.1
19.1
1Y42X-6-05
8
-05 7.9 5/16
3/8 - 24UNF-LH
116
63
400
58,000
3.7
22.0
1Y42X-9-05
8
-05 7.9 5/16
9/16 - 18UNF-LH
125
72
400
58,000
3.7
22.0
A
1YM2X / 1YMJX – High pressure tube nipple
metric – LH thread
MATERIAL
B
Nipple: very high strength stainless steel
Shell: high strength carbon steel, zinc plated
A
B
Nipple Ferrule
ID
OD
DN
size mm inch
mm
mm
MPa
psi
mm
mm
1YM2X-6-025
4
-025 4.0 5/32
M14x1.5-LH
108
55
400
58,000
1.9
15.6
1YM2X-6-03
5
-03 4.8 3/16
M14x1.5-LH
116
63
400
58,000
2.3
18.6
1YM2X-6-04
6
-04 6.4
1/4
M14x1.5-LH
116
63
400
58,000
3.1
19.1
1YM2X-6-05
8
-05 7.9 5/16
M14x1.5-LH
125
72
400
58,000
3.7
22.0
1YMJX-11-08W
12
-08 12.7 1/2
M18x1.5-LH
141
87
250
36,250
6.8
34.0
1YMJX-12-08W
12
-08 12.7 1/2
M20x1.5-LH
141
87
300
43,500
6.8
34.0
C-50
Catalogue 4462 Global Edition
C
Hoses with design factor >2:1
1AY2X / 1AYJX – 1C92X / 1C9JX
A
1AY2X / 1AYJX – Type “M” female swivel
MATERIAL
B
J
Nipple: very high strength stainless steel
Shell and nut: high strength carbon steel, zinc plated
B
*
Nipple Ferrule
ID
OD
DN
size mm inch
mm
mm
mm
MPa
mm
mm
1AY2X-6-025
4
-025 4.0 5/32
9/16 - 18UNF
61
24
22
400 58,000
1.9
15.6
1AY2X-6-03
5
-03 4.8 3/16
9/16 - 18UNF
91
38
22
400 58,000
2.3
18.6
1AY2X-8-05
8
-05 7.9 5/16
3/4 - 16UNF
91
38
27
320 46,400
3.7
22.0
1AY2X-10-05
8
-05 7.9 5/16
7/8 - 14UNF
91
38
30
320 46,400
3.7
22.0
1AY2X-13-05
8
-05 7.9 5/16
1 1/8 - 11UNF
91
38
36
320 46,400
3.7
22.0
1AYJX-11-08W
12
-08 12.7 1/2
1 - 12UNF
86
29
32
180 26,100
6.8
34.0
1AYJX-16-12W
20
-12 19.0 3/4
1 5/16-12UNF
90
31
41
160 23,200 12.5
40.6
A
1C92X / 1C9JX – Metric female swivel
heavy series with O-ring
MATERIAL
psi
B
J
Nipple: very high strength stainless steel
Shell and nut: high strength carbon steel, zinc plated
Nipple Ferrule
ID
OD
A
B
*
mm
mm
mm
MPa
mm
mm
91
38
27
280 40,600
3.7
22.0
DN
size mm inch
1C92X-12-05
8
-05 7.9 5/16
M20x1.5
1C9JX-16-08W
12
-08 12.7 1/2
M24x1.5
96
39
32
180 26,100
6.8
34.0
1C9JX-25-12W
20
-12 19.0 3/4
M36x2
108
49
46
160 23,200 12.5
40.6
1C9JX-30-16W
25
-16 25.4
M42x2
121
55
55
150 21,750 17.3
49.0
1
C-51
psi
Catalogue 4462 Global Edition
Design Factor >2:1
A
Hoses with design factor >2:1
1922X – 16Y2X – 6Y25X / 1Y2JX
A
1922X – BSP female swivel (60° cone)
B
J
MATERIAL
Nipple: very high strength carbon steel, zinc plated
Design Factor >2:1
Shell and nut: high strength carbon steel, zinc plated
A
B
*
Nipple Ferrule
ID
OD
DN
size mm inch
mm
mm
mm
MPa
psi
mm
mm
1922X-4-025
4
-025 4.0 5/32
G 1/4
70
26
22
300
43500
1.9
15.6
1922X-4-03
5
-03 4.8 3/16
G 1/4
79
26
22
300
43500
2.3
18.6
A
16Y2X – High pressure female swivel
MATERIAL
J
B
Nipple: very high strength stainless steel
Shell and nut: high strength carbon steel, zinc plated
DN
size mm inch
A
B
*
Nipple Ferrule
ID
OD
mm
mm
mm
MPa
mm
mm
16Y2X-4-025
4
-025
5/32
9/16 - 18UNF
76
23
19
300 43,500
1.9
15.6
16Y2X-4-03
5
-03 4.8 3/16
9/16 - 18UNF
76
23
19
300 43,500
2.3
18.6
4
psi
6Y25X / 1Y2JX – Medium pressure tube nipple
MATERIAL
A
B
Nipple: very high strength stainless steel
Shell: stainless steel
DN
size mm inch
6Y25X-9-8C
12
-08 12.7 1/2
6Y25X-12-8C
12
1Y2JX-16-12W
20
1Y2JX-16-16W
25
A
B
Nipple Ferrule
ID
OD
mm
mm
MPa
psi
mm
mm
9/16 - 18 LH
107
53
137.9
20,000
8.1
31.0
-08 12.7 1/2
3/4 - 16 LH
107
53
137.9
20,000
8.1
31.0
-12 19.0 3/4
1 - 14 UNF-LH
133
70
137.9
20,000
12.5
40.6
-16 25.4
1 - 14 UNF-LH
146
70
137.9
20,000
17.3
49.0
1
C-52
Catalogue 4462 Global Edition
C
Hoses with design factor >2:1
1MR2X – 1TM2X
A
1MR2X – Metric female swivel 59° cone
B
J
High strength carbon steel, zinc plated
A
B
*
Nipple Ferrule
ID
OD
DN
size mm inch
mm
mm
mm
MPa
mm
mm
1MR2X-8-03
5
-03 4.8 3/16
M14x1.5
91
38
22
400 58,000
psi
2.3
18.6
1MR2X-10-03
5
-03 4.8 3/16
M16x1.5
91
38
22
400 58,000
2.3
18.6
1MR2X-12-03
5
-03 4.8 3/16
M18x1.5
91
38
24
400 58,000
2.3
18.6
1TM2X – Polyflex Lok components
Description
1TM2X-8-05-HPK
Fitting for DN8 hoses incl. caps (refer to pages D-2, D-3)
1TM2X-8-03-HPK
Fitting for DN5 hoses incl. caps (refer to pages D-2, D-3)
C-53
Catalogue 4462 Global Edition
Design Factor >2:1
MATERIAL
Hoses with design factor >2:1
1C35X – 1C95X – 1AY5X
A
1C35X – Metric female swivel light series
B
J
For hydraulic oil only
MATERIAL
Nipple: very high strength carbon steel, zinc plated
Design Factor >2:1
Shell and nut: high strength carbon steel, zinc plated
1C35X-8-03
DN
size mm inch
5
-03 4.8 3/16
M14x1.5
Nipple Ferrule
ID
OD
A
B
*
mm
mm
mm
MPa
64
25
22
250 36,250
psi
mm
mm
1.7
19.1
A
1C95X – Metric female swivel
heavy series with O-ring
B
J
For hydraulic oil only
MATERIAL
Nipple: very high strength carbon steel, zinc plated
Shell and nut: high strength carbon steel, zinc plated
A
B
*
Nipple Ferrule
ID
OD
DN
size mm inch
mm
mm
mm
MPa
1C95X-16-08
12
-08 12.7 1/2
M24x1.5
87
34
32
180 26,100
psi
mm
mm
6.7
34.1
1C95X-25-12
20
-12 19.0 3/4
M36x2
92
39
46
140 20,300 12.7
41.8
A
1AY5X – Type “M” female swivel
B
J
For hydraulic oil only
MATERIAL
Nipple: very high strength carbon steel, zinc plated
Shell and nut: high strength carbon steel, zinc plated
DN
size mm inch
1AY5X-6-03
5
-03 4.8 3/16
1AY5X-11-08
12
1AY5X-16-12
20
A
B
*
Nipple Ferrule
ID
OD
mm
mm
mm
MPa
mm
mm
9/16 - 18UNF
66
26
22
250 36,250
1.7
19.1
-08 12.7 1/2
1 - 12 UNF
80
27
32
180 26,100
6.7
34.1
-12 19.0 3/4
1 5/16 - 12UNF
82
29
41
140 20,300 12.7
41.8
C-54
psi
Catalogue 4462 Global Edition
C
Hoses with design factor >2:1
1YA5X – 1925X
A
1YA5X – High pressure tube nipple
UNF – LH thread
B
For hydraulic oil only
Special materials
A
B
Nipple Ferrule
ID
OD
DN
size mm inch
mm
mm
MPa
psi
mm
mm
1YA5X-1-03
5
-03 4.8 3/16
1/4 - 28UNF-LH
92
53
250
36,250
1.3
19.1
1YA5X-3-03
5
-03 4.8 3/16
3/8 - 24UNF-LH
97
58
250
36,250
1.3
19.1
A
1925X – BSP female swivel (60° cone)
B
J
For hydraulic oil only
MATERIAL
Nipple: very high strength carbon steel, zinc plated
Shell and nut: high strength carbon steel, zinc plated
1925X-4-03
DN
size mm inch
5
-03 4.8 3/16
G 1/4
C-55
Nipple Ferrule
ID
OD
A
B
*
mm
mm
mm
MPa
78
32
22
250 36,250
psi
mm
mm
1.7
19.1
Catalogue 4462 Global Edition
Design Factor >2:1
MATERIAL
Hoses with design factor >2:1
2648N
2648N – Ultra-high pressure hose
Design Factor >2:1
CONSTRUCTION
Core tube
: Polyamide
Pressure reinforcement : Six spiral layers of maximum tensile steel wire
Cover
Standard colour
TEMPERATURE RANGE
: Polyamide
: Blue
-10°C up to +70°C
DN
size
mm
inch
mm
MPa
psi
MPa
psi
mm
kg/m
2648N-12V32
20
-12
19.8
3/4
33.7
160
23,200
400
58,000
350
2.28
2648N-16V32
25
-16
25.0
1
40.8
150
21,750
375
54,375
400
3.10
NOTES
–
C-56
Catalogue 4462 Global Edition
C
Hoses with design factor >2:1
1C9JX / 1C9CX – 1AYJX / 1AYCX – 1Y2CX
A
1C9JX / 1C9CX – Metric female swivel
heavy series with O-ring
MATERIAL
B
J
Nipple: very high strength stainless steel
Shell and nut: high strength carbon steel, zinc plated
B
*
Nipple Ferrule
ID
OD
DN
size mm inch
mm
mm
mm
MPa
mm
mm
1C9JX-25-12W
20
-12 19.0 3/4
M36x2
108
50
46
160 23,200 12.5
40.6
1C9CX-30-16W
25
-16 25.4
M42x2
121
55
55
150 21,750 17.3
49.0
1
A
1AYJX / 1AYCX – Type “M” female swivel
MATERIAL
psi
B
J
Nipple: very high strength stainless steel
Shell and nut: high strength carbon steel, zinc plated
A
B
*
Nipple Ferrule
ID
OD
DN
size mm inch
mm
mm
mm
MPa
mm
mm
1AYJX-16-12W
20
-12 19.0 3/4
1 5/16-12UNF
90
31
41
160 23,200 12.5
40.6
1AYCX-16-16W
25
-16 25.4
1 5/16-12UNF
146
72
41
138 20,000 17.3
49.0
1
psi
A
1Y2CX – Medium pressure tube nipple
MATERIAL
B
Nipple: very high strength stainless steel
Shell: high strength carbon steel, zinc plated
1Y2CX-16-16W
DN
size mm inch
25
-16 25.4
1
1-14UNF-LH
C-57
Nipple Ferrule
ID
OD
A
B
mm
mm
MPa
psi
mm
mm
146
72
138
20,000
17.3
49
Catalogue 4462 Global Edition
Design Factor >2:1
A
Hoses with design factor >2:1
2740D
2740D – Ultra-high pressure hose
Design Factor >2:1
CONSTRUCTION
Core tube
: Polyoxymethylene
Pressure reinforcement : Six spiral layers of maximum tensile steel wire
Cover
Standard colour
TEMPERATURE RANGE
: DN4: Polyurethane, DN5-12: Polyamide
: DN4: yellow, DN5-8: red, DN12: black
-10°C up to +70°C
DN
size
mm
inch
mm
MPa
psi
MPa
psi
mm
kg/m
2740D-025V16
4
-025
3.9
5/32
12.0
300
43,500
780
113,100
120
0.40
2740D-03V34
5
-03
4.8
3/16
13.2
280
40,600
700
101,500
200
0.47
2740D-05V34
8
-05
7.8
5/16
17.2
250
36,250
625
90,625
200
0.83
2740D-08V30
12
-08
12.7
1/2
27.0
200
29,000
500
72,500
300
1.85
NOTES
–
C-58
Catalogue 4462 Global Edition
C
Hoses with design factor >2:1
2741D
2741D – Ultra-high pressure hose
with 2nd cover
CONSTRUCTION
: 1st: Polyamide; 2nd: Polyurethane, abrasion resistant
: 1st: Red; 2nd: Black
Cover
Standard colour
TEMPERATURE RANGE
2741D-05V34/10
NOTES
-10°C up to +70°C
DN
size
mm
inch
mm
MPa
psi
MPa
psi
mm
kg/m
8
-05
7.7
5/16
21.2
250
36,250
625
90,625
200
0.95
–
C-59
Catalogue 4462 Global Edition
Design Factor >2:1
Core tube
: Polyoxymethylene
Pressure reinforcement : Six spiral layers of maximum tensile steel wire
Hoses with design factor >2:1
2748D
2748D – Ultra-high pressure hose
Design Factor >2:1
CONSTRUCTION
Core tube
: Polyoxymethylene
Pressure reinforcement : Six spiral layers of maximum tensile steel wire
Cover
Standard colour
TEMPERATURE RANGE
2748D-05V34
NOTES
: Polyamide
: Red
-10°C up to +70°C
DN
size
mm
inch
mm
MPa
psi
MPa
psi
mm
kg/m
8
-05
7.8
5/16
17.3
280
40,600
700
101,500
230
0.83
–
C-60
Catalogue 4462 Global Edition
C
Hoses with design factor >2:1
2748D
2748D – Ultra-high pressure hose
with 2nd cover
CONSTRUCTION
: 1st: Polyamide; 2nd: Polyurethane, abrasion resistant
: 1st: Red; 2nd: Yellow
Cover
Standard colour
TEMPERATURE RANGE
2748D-05V34/16
NOTES
-10°C up to +70°C
DN
size
mm
inch
mm
MPa
psi
MPa
psi
mm
kg/m
8
-05
7.8
5/16
21.8
280
40,600
700
101,500
230
0.99
–
C-61
Catalogue 4462 Global Edition
Design Factor >2:1
Core tube
: Polyoxymethylene
Pressure reinforcement : Six spiral layers of maximum tensile steel wire
Hoses with design factor >2:1
2749D
2749D – Ultra-high pressure hose
Design Factor >2:1
CONSTRUCTION
Core tube
: Polyoxymethylene
Pressure reinforcement : Six spiral layers of maximum tensile steel wire
Cover
Standard colour
TEMPERATURE RANGE
: Polyamide
: Red
-10°C up to +70°C
DN
size
mm
inch
mm
MPa
psi
MPa
psi
mm
kg/m
2749D-03V34
5
-03
4.8
3/16
13.3
301
43,645
700
101,500
200
0.47
2749D-05V34
8
-05
7.8
5/16
17.3
301
43,645
700
101,500
230
0.83
NOTES
–
C-62
Catalogue 4462 Global Edition
C
Hoses with design factor >2:1
1YM2X / 6YMHX – 1Y42X / 6Y4HX
A
1YM2X / 6YMHX – High pressure tube nipple
metric – LH thread
MATERIAL
B
Nipple: very high strength stainless steel
Shell: high strength carbon steel, zinc plated
B
Nipple Ferrule
ID
OD
DN
size mm inch
mm
mm
MPa
psi
mm
mm
1YM2X-6-025
4
-025 4.0 5/32
M14x1.5-LH
108
55
400
58,000
1.9
15.6
1YM2X-6-03
5
-03 4.8 3/16
M14x1.5-LH
116
63
400
58,000
2.3
18.6
1YM2X-6-05
8
-05 7.9 5/16
M14x1.5-LH
125
72
400
58,000
3.7
22.8
6YMHX-11-8C
12
-08 12.7 1/2
M18x1.5-LH
138
80
250
36,250
7.5
31.9
6YMHX-12-8C
12
-08 12.7 1/2
M20x1.5-LH
138
80
300
43,500
7.5
31.9
A
1Y42X / 6Y4HX – High pressure tube nipple
UNF – LH thread
MATERIAL
B
Nipple: very high strength stainless steel
Shell: high strength carbon steel, zinc plated
Nipple Ferrule
ID
OD
A
B
mm
mm
MPa
psi
mm
mm
88
45
400
58,000
1.9
15.6
DN
size mm inch
1Y42X-4-025
4
-025 4.0 5/32
1/4 - 28UNF-LH
1Y42X-6-025
4
-025 4.0 5/32
3/8 - 24UNF-LH
98
55
400
58,000
1.9
15.6
1Y42X-4-03
5
-03 4.8 3/16
1/4 - 28UNF-LH
116
63
400
58,000
2.3
18.6
1Y42X-6-03
5
-03 4.8 3/16
3/8 - 24UNF-LH
116
63
400
58,000
2.3
18.6
1Y42X-9-03
5
-03 4.8 3/16
9/16 - 18UNF-LH
116
63
400
58,000
2.3
18.6
1Y42X-6-05
8
-05 7.9 5/16
3/8 - 24UNF-LH
116
63
400
58,000
3.7
22.8
1Y42X-9-05
8
-05 7.9 5/16
9/16 - 18UNF-LH
125
72
400
58,000
3.7
22.8
6Y4HX-16-8C
12
-08 12.7 1/2
1 - 14UNF-LH
138
80
300
43500
7.5
31.9
C-63
Catalogue 4462 Global Edition
Design Factor >2:1
A
Hoses with design factor >2:1
1AY2X – 16Y2X
A
1AY2X – Type “M” female swivel
MATERIAL
B
J
Nipple: very high strength stainless steel
Design Factor >2:1
Shell and nut: high strength carbon steel, zinc plated
A
B
*
Nipple Ferrule
ID
OD
DN
size mm inch
mm
mm
mm
MPa
mm
mm
1AY2X-6-025
4
-025 4.0 5/32
9/16 - 18UNF
61
24
22
400 58,000
1.9
15.6
1AY2X-6-03
5
-03 4.8 3/16
9/16 - 18UNF
91
38
22
400 58,000
2.3
18.6
1AY2X-8-05
8
-05 7.9 5/16
3/4 - 16UNF
91
38
27
320 46,400
3.7
22.8
1AY2X-10-05
8
-05 7.9 5/16
7/8 - 14UNF
91
38
30
320 46,400
3.7
22.8
1AY2X-13-05
8
-05 7.9 5/16
1 1/8 - 11UNF
91
38
36
320 46,400
3.7
22.8
16Y2X – High pressure female swivel
MATERIAL
psi
A
J
B
Nipple: very high strength stainless steel
Shell and nut: high strength carbon steel, zinc plated
DN
size mm inch
A
B
*
Nipple Ferrule
ID
OD
mm
mm
mm
MPa
mm
mm
16Y2X-4-025
4
-25
5/32
9/16 - 18
76
23
19
300 43,500
1.9
15.6
16Y2X-4-03
5
-03 4.8 3/16
9/16 - 18
76
23
19
300 43,500
2.3
18.6
4
C-64
psi
Catalogue 4462 Global Edition
C
Hoses with design factor >2:1
1922X – 6Y4HX
A
1922X – BSP female swivel (60° cone)
MATERIAL
B
J
Nipple: very high strength stainless steel
Shell and nut: high strength carbon steel, zinc plated
B
*
Nipple Ferrule
ID
OD
DN
size mm inch
mm
mm
mm
MPa
mm
mm
1922X-4-025
4
-025 4.0 5/32
G 1/4
70
26
22
300 43,500
1.9
15.6
1922X-4-03
5
-03 4.8 3/16
G 1/4
79
26
22
300 43,500
2.3
18.6
A
6Y4HX – High pressure tube nipple
UNF – LH thread
MATERIAL
psi
B
Nipple: very high strength stainless steel
Shell: high strength carbon steel, zinc plated
6Y4HX-16-8C
DN
size mm inch
12
-08 12.7 1/2
1 - 14 UNS-LH
C-65
Nipple Ferrule
ID
OD
A
B
mm
mm
MPa
psi
mm
mm
138
80
300
43500
7.5
31.9
Catalogue 4462 Global Edition
Design Factor >2:1
A
Hoses with design factor >2:1
1C92X – 1TM2X
A
1C92X – Metric female swivel
heavy series with O-ring
MATERIAL
B
J
Nipple: very high strength stainless steel
Design Factor >2:1
Shell and nut: high strength carbon steel, zinc plated
1C92X-12-05
DN
size mm inch
8
-05 7.9 5/16
M20x1.5
Nipple Ferrule
ID
OD
A
B
*
mm
mm
mm
MPa
91
38
27
280 40,600
psi
mm
mm
3.7
22.0
1TM2X – Polyflex Lok components
Description
1TM2X-8-05-HPK
Fitting for DN8 hoses incl. caps (refer to pages D-2, D-3)
1TM2X-8-03-HPK
Fitting for DN5 hoses incl. caps (refer to pages D-2, D-3)
C-66
Catalogue 4462 Global Edition
C
Hoses with design factor >2:1
2840D
2840D – Ultra-high pressure hose
CONSTRUCTION
Core tube
: Polyoxymethylene
Pressure reinforcement : Eight spiral layers of maximum tensile steel wire
TEMPERATURE RANGE
: Polyamide
: DN5: red, DN8: yellow, DN12: black
Design Factor >2:1
Cover
Standard colour
-10°C up to +70°C
DN
size
mm
inch
mm
MPa
psi
MPa
psi
mm
kg/m
2840D-03V34
5
-03
4.6
3/16
15.0
400
58,000
800
116,000
200
0.66
2840D-05V36
8
-05
7.8
5/16
19.5
300
43,500
700
101,500
250
1.10
2840D-08V30
12
-08
12.7
1/2
29.8
250
36,250
625
90,625
350
2.50
NOTES
The design factor of burst pressure over working pressure can be adjusted to the specific application but must not be reduced below a ratio of 1:2.
C-67
Catalogue 4462 Global Edition
Hoses with design factor >2:1
2841D
2841D – Ultra-high pressure hose
Design Factor >2:1
CONSTRUCTION
Core tube
: Polyoxymethylene
Pressure reinforcement : Eight spiral layers of maximum tensile steel wire
: 1st: Polyamide; 2nd: Polyurethane, abrasion resistant
: 1st: Yellow; 2nd: Grey
Cover
Standard colour
TEMPERATURE RANGE
2841D-05V36/17
NOTES
-10°C up to +70°C
DN
size
mm
inch
mm
MPa
psi
MPa
psi
mm
kg/m
8
-05
7.7
5/16
23.5
300
43,500
700
101,500
250
1.38
–
C-68
Catalogue 4462 Global Edition
C
Hoses with design factor >2:1
2848D
2848D – Ultra-high pressure hose
CONSTRUCTION
Core tube
: Polyoxymethylene
Pressure reinforcement : Eight spiral layers of maximum tensile steel wire
TEMPERATURE RANGE
: Polyamide
: DN8: Red; DN12: Black
Design Factor >2:1
Cover
Standard colour
-10°C up to +70°C
DN
size
mm
inch
mm
MPa
psi
MPa
psi
mm
kg/m
2848D-05V34
8
-05
7.8
5/16
19.6
320
46,400
800
116,000
280
1.10
2848D-08V30
12
-08
13.0
1/2
29.9
300
43,500
625
90,625
350
2.5
NOTES
–
C-69
Catalogue 4462 Global Edition
Hoses with design factor >2:1
1YM2X / 6YMWX – 1Y42X / 6Y4WX
A
1YM2X / 6YMWX – High pressure tube nipple
metric – LH thread
MATERIAL
B
Nipple: very high strength stainless steel
Design Factor >2:1
Shell: high strength carbon steel, zinc plated
A
B
Nipple Ferrule
ID
OD
DN
size mm inch
mm
mm
MPa
psi
mm
mm
5
-03 4.8 3/16
M14x1.5-LH
116
63
400
58,000
2.3
19.6
1YM2X-6-05
8
-05 7.9 5/16
M14x1.5-LH
125
72
400
58,000
3.7
24.0
6YMWX-11-8C
12
-08 12.8 1/2
M18x1.5-LH
138
80
250
36250
7.5
33.8
6YMWX-12-8C
12
-08 12.8 1/2
M20x1.5-LH
138
80
300
43500
7.5
33.8
1YM2X-6-03
A
1Y42X / 6Y4WX – High pressure tube nipple
metric – UNF thread
MATERIAL
B
Nipple: very high strength stainless steel
Shell: high strength carbon steel, zinc plated
A
B
Nipple Ferrule
ID
OD
DN
size mm inch
mm
mm
MPa
psi
mm
mm
1Y42X-6-03
5
-03 4.8 3/16
3/8 - 24UNF-LH
116
63
400
58,000
2.3
19.6
1Y42X-9-03
5
-03 4.8 3/16
9/16 - 18UNF-LH
116
63
400
58,000
2.3
19.6
1Y42X-6-05
8
-05 7.9 5/16
3/8 - 24UNF-LH
116
63
400
58,000
3.7
24.0
1Y42X-9-05
8
-05 7.9 5/16
9/16 - 18UNF-LH
125
72
400
58,000
3.7
24.0
6Y4WX-16-8C
12
-08 12.7 1/2
1 - 14UNF-LH
138
80
300
43,500
7.6
34.2
C-70
Catalogue 4462 Global Edition
C
Hoses with design factor >2:1
1AY2X – 1TM2X
A
1AY2X – Type “M” female swivel
MATERIAL
B
J
Nipple: very high strength stainless steel
Shell and nut: high strength carbon steel, zinc plated
B
*
Nipple Ferrule
ID
OD
DN
size mm inch
mm
mm
mm
MPa
mm
mm
1AY2X-6-03
5
-03 4.8 3/16
9/16 - 18UNF
91
38
22
400 58,000
psi
2.3
19.6
1AY2X-8-05
8
-05 7.9 5/16
3/4 - 16UNF
91
38
27
320 46,400
3.7
24.0
1AY2X-10-05
8
-05 7.9 5/16
7/8 - 14UNF
91
38
30
320 46,400
3.7
24.0
1AY2X-13-05
8
-05 7.9 5/16
1 1/8 - 11UNF
91
38
36
320 46,400
3.6
24.0
1TM2X – Polyflex Lok components
Description
1TM2X-8-05-HPK
Fitting for DN8 hoses incl. caps (refer to pages D-2, D-3)
1TM2X-8-03-HPK
Fitting for DN5 hoses incl. caps (refer to pages D-2, D-3)
C-71
Catalogue 4462 Global Edition
Design Factor >2:1
A
Hoses with design factor >2:1
2849D
2849D – Ultra-high pressure hose
Design Factor >2:1
CONSTRUCTION
Core tube
: Polyoxymethylene
Pressure reinforcement : Eight spiral layers of maximum tensile steel wire
Cover
Standard colour
TEMPERATURE RANGE
2849D-05V34
NOTES
: Polyamide
: Red
-10°C up to +70°C
DN
size
mm
inch
mm
MPa
psi
MPa
psi
mm
kg/m
8
-05
7.8
5/16
19.6
380
55,000
800
116,000
280
1.10
–
C-72
Catalogue 4462 Global Edition
C
Hoses with design factor >2:1
6YMWX – 6Y4WX
A
6YMWX – High pressure tube nipple
metric – LH thread
MATERIAL
B
Nipple: very high strength stainless steel
Shell: high strength carbon steel, zinc plated
DN
size mm inch
8
-05 7.9 5/16
M14x1.5-LH
B
mm
mm
MPa
psi
mm
mm
120
65
400
58,000
3.6
24.0
A
6Y4WX – High pressure tube nipple
UNF – LH thread
MATERIAL
B
Nipple: very high strength stainless steel
Shell: high strength carbon steel, zinc plated
6Y4WX-9-5C-55
DN
size mm inch
8
-05 7.9 5/16
9/16 - 18 UNF-LH
C-73
Nipple Ferrule
ID
OD
A
B
mm
mm
MPa
psi
mm
mm
120
65
400
58,000
3.6
24.0
Catalogue 4462 Global Edition
Design Factor >2:1
6YMWX-6-5C-55
Nipple Ferrule
ID
OD
A
Hoses with design factor >2:1
6AYWX
A
6AYWX – Type “M” female swivel
MATERIAL
B
J
Nipple: very high strength stainless steel
Design Factor >2:1
Shell and nut: high strength carbon steel, zinc plated
6AYWX-10-5C-55
DN
size mm inch
8
-05 7.9 5/16
7/8 - 14UNF
C-74
Nipple Ferrule
ID
OD
A
B
*
mm
mm
mm
MPa
113
45
32
380 55,000
psi
mm
mm
3.6
24.0
Catalogue 4462 Global Edition
D
Polyflex-Lok
Table of contents
Chapter D
Polyflex-Lok
Polyflex-Lok
Polyflex-Lok components ..................................................................... D-2
D-1
Catalogue 4462 Global Edition
Polyflex-Lok
Polyflex-Lok components
Polyflex-Lok components
Polyflex-Lok
D-2
Catalogue 4462 Global Edition
D
Polyflex-Lok
Polyflex-Lok components
1
2
3
4
5
6
Part Number
1TM2X-8-03-HPK
1TM2X-8-05-HPK
1TMKY-8-05-HPK
1TMBL-9-08-HPK
1TMBS-9-08-HPK
TFTF-8-8
TFTF-8-9
TFTF-9-9
HPK-HS-8
HPK-HSP-8
YTTF-6-8
YTTF-9-8
YTTF-9-9
YTTF-10-8
YTTF-10-9
YTTF-12-8
YTTF-12-9
Y6TF-6-8
Y6TF-9-8
TMCAP-8
TMCAP-9
Description
Fitting for DN 5 hoses incl. caps
Fitting for DN 8 hoses incl. caps
Fitting for DN 8 hoses incl. caps
Fitting for DN 12 hoses incl. caps
Fitting for DN 12 hoses incl. caps
Hose connector bushing for DN 5 and DN 8
Hose connector bushing - connection DN 5 or DN 8 to DN 12
Hose connector bushing for DN 12
Hose connector
Pump/gun connector
Adapter M20 x 1.5 to DN 5 or DN 8
Adapter M26 x 1.5 to DN 5 or DN 8
Adapter M26 x 1.5 to DN 12
Adapter M30 x 2 to DN 5 or DN 8
Adapter M30 x 2 to DN 12
Adapter M42 x 2 to DN 5 or DN 8
Adapter M42 x 2 to DN 12
Adapter 3/4 - 16UNF to DN 5 or DN 8
Adapter 1 1/8 - 12UNF to DN 5 or DN 8
Cap DN 5 or DN 8
Cap DN 12
D-3
Catalogue 4462 Global Edition
Polyflex-Lok
Ref
Polyflex-Lok
Polyflex-Lok
Notes
D-4
Catalogue 4462 Global Edition
E
Connectors & Adapters – Valves
Table of contents
Chapter E
Connectors & Adapters – Valves
High Pressure Connectors & Adapters
20,000 PSI — Medium Pressure
5YY5 .................................................................................................... E-11
5YY6 .................................................................................................... E-12
6YY5 .................................................................................................... E-13
5Y01 .................................................................................................... E-14
02Y5 .................................................................................................... E-15
5Y5Y .................................................................................................... E-16
5Y6Y .................................................................................................... E-17
5Y02 .................................................................................................... E-18
Y5Y5 .................................................................................................... E-19
Y5Y6 .................................................................................................... E-20
Y501 .................................................................................................... E-21
L5Y ...................................................................................................... E-22
T5Y ...................................................................................................... E-22
X5Y ...................................................................................................... E-23
Y2N ..................................................................................................... E-23
Y2C ..................................................................................................... E-24
HBPLM Plugs ...................................................................................... E-24
Y204, Y206, Y209, Y212, and Y216 Nipples ...................................... E-25
E-1
Catalogue 4462 Global Edition
Adapters & Valves
Type M
YAYA ...................................................................................................... E-5
YAY6 ...................................................................................................... E-5
Plugs and Caps ..................................................................................... E-6
Torpedos ............................................................................................... E-7
YAY5 ...................................................................................................... E-7
YA02 ...................................................................................................... E-8
YA01 ...................................................................................................... E-9
Adapters & Valves
Connectors & Adapters – Valves
Table of contents
30,000/60,000 psi — High Pressure
6YY6 .................................................................................................... E-27
6Y01 .................................................................................................... E-28
02Y6 .................................................................................................... E-29
Y6Y6 .................................................................................................... E-30
Y601 .................................................................................................... E-30
6Y6Y .................................................................................................... E-31
6Y02 .................................................................................................... E-32
L6Y ...................................................................................................... E-33
T6Y ...................................................................................................... E-33
X6Y ...................................................................................................... E-34
Y4N ..................................................................................................... E-34
Y4C ..................................................................................................... E-34
HBPHM Plug ....................................................................................... E-35
Locking Nut and Collar ....................................................................... E-35
Nipples ................................................................................................ E-35
National Pipe Tapered (NPT)
K0202 – Couplers................................................................................ E-37
KL02 – Elbows .................................................................................... E-37
KX02 – Crosses ................................................................................... E-38
KT02 – Tees ......................................................................................... E-38
K0101 – Nipples .................................................................................. E-39
K0201 – Reducer bushings ................................................................. E-39
E-2
Catalogue 4462 Global Edition
E
Connectors & Adapters – Valves
Table of contents
Valves
Medium Pressure (20,000 psi)
SV5Y ................................................................................................... E-41
AV5Y.................................................................................................... E-42
TV25Y .................................................................................................. E-43
TV15Y .................................................................................................. E-44
CV5Y ................................................................................................... E-45
High Pressure (60,000 psi)
SV6Y ................................................................................................... E-50
AV6Y.................................................................................................... E-51
TV26Y .................................................................................................. E-52
TV16Y .................................................................................................. E-53
CV6Y ................................................................................................... E-54
E-3
Catalogue 4462 Global Edition
Adapters & Valves
High Pressure (30,000 psi)
SV6Y ................................................................................................... E-46
AV6Y.................................................................................................... E-47
TV26Y .................................................................................................. E-48
TV16Y .................................................................................................. E-49
Connectors & Adapters – Valves
Type “M” Swivel Hose Fittings and Adapters
Type “M” Swivel Hose Fittings and Adapters
Features
• Rated for the full working pressure of hose.
• Provides a swivel for quick and easy connection.
• Internal threads and seal are protected from external damage.
• Non rotating seal reduces galling and minimizes tightening torque.
• Can be adapted to almost any connection required.
Construction
Adapters & Valves
Swivel nut
Adapter
Weep hole
HP male cone insert
The Type “M” Swivel End Fitting is a swivel nut fitting with a 58°
male cone nipple.
Each Type “M” Swivel End Fitting is rated for the full working
pressure of the hose.
Sizes
Determined by hose type.
9/16“ - 18 thread
3/4“ - 16 thread
7/8“ - 14 thread
1“ - 12 thread
1 5/16“ - 12 thread
E-4
Catalogue 4462 Global Edition
E
Connectors & Adapters – Valves
Type “M” Swivel Hose Fittings and Adapters
YAYA – Type “M” male x Type “M” male
A
T1
H
T2
T2
YAYA-6-6C
9/16" - 18 UNF
9/16" - 18 UNF
mm
35.1
inch
1.38
mm
16.0
inch
0.63
MPa
413.7
psi
60,000
YAYA-8-6C
3/4" - 16 UNF
9/16" - 18 UNF
41.4
1,63
19.1
0.75
413.7
30,000
YAYA-8-8C
3/4" - 16 UNF
3/4" - 16 UNF
44.5
1.75
19.1
0.75
206.8
30,000
YAYA-10-6C
7/8" - 14 UNF
9/16" - 18 UNF
47.8
1.88
25.4
1.00
413.7
60,000
YAYA-10-10C
7/8" - 14 UNF
7/8" - 14 UNF
50.8
2.00
25.4
1.00
413.7
60,000
YAYA-11-8C
1" - 12 UNF
3/4" - 16 UNF
47.8
1.88
25.4
1.00
206.8
30,000
YAYA-11-11C
1" - 12 UNF
1" - 12 UNF
47.8
1.88
25.4
1.00
206.8
30,000
YAYA-16-11C
1-5/16" - 12 UNF
1" - 12 UNF
54.1
2.13
35.1
1.38
137.9
20,000
YAYA-16-16C
1-5/16" - 12 UNF
1-5/16" - 12 UNF
54.1
2.13
35.1
1.38
137.9
20,000
YAY6 – Type “M” male x High pressure
A
T1
A
T1
H
T2
(
T2
YAY6-6-4C
9/16" - 18 UNF 9/16" - 18 UNF
DN size mm inch
6 -04 6.4 1/4
YAY6-6-6C
9/16" - 18 UNF
10
-06 9.5
3/8
44.5 1,75 19.1 0.75 413.7 60,000
YAY6-6-9C
9/16" - 18 UNF 1-1/8" - 12 UNF
8
-05 7.9
5/16
50.8 2.00 28.7 1.13 413.7 60,000
3/4" - 16 UNF
mm inch mm inch MPa
psi
38.7 1.53 16.0 0.63 413.7 60,000
YAY6-8-6C
3/4" - 16 UNF
10
-06 9.5
3/8
50.8 2.00 19.1 0.75 206.8 30,000
YAY6-8-9C
3/4" - 16 UNF 1-1/8" - 12 UNF
8
-05 7.9
5/16
57.1 2.25 28.7 1.13 206.8 30,000
YAY6-10-6C
7/8" - 14 UNF
10
-06 9.5
3/8
57.1 2.25 25.4 1.00 413.7 60,000
YAY6-10-9C
7/8" - 14 UNF 1-1/8" - 12 UNF
8
-05 7.9
5/16
60.5 2.38 28.7 1.13 413.7 60,000
8
-05 7.9
5/16
57.1 2.25 28.7 1.13 206.8 30,000
YAY6-11-9C
1" - 12 UNF
3/4" - 16 UNF
3/4" - 16 UNF
1-1/8" - 12 UNF
E-5
Catalogue 4462 Global Edition
Adapters & Valves
(
A
T1
Connectors & Adapters – Valves
Type “M” Swivel Hose Fittings and Adapters
A
Plugs
T1
H
(
A
Adapters & Valves
T1
YA6C-PLUG
9/16" - 18
mm
52.6
inch
2.07
mm
19.1
inch
0.75
MPa
413.7
psi
60,000
YA8C-PLUG
3/4" - 16
54.1
2.13
25.4
1.00
206.8
30,000
YA11C-PLUG
1" - 12
31.8
1.25
25.4
1.00
206.8
30,000
YA16C-PLUG
1 5/16" - 12
66.8
2.63
35.1
1.38
137.9
20,000
Caps
A
T1
H
(
A
T1
YA6C-CAP
9/16" - 18
mm
21.6
inch
0.85
mm
17.5
inch
0.69
MPa
413.7
psi
60,000
YA8C-CAP
3/4" - 16
23.1
0.91
25.4
1.00
206.8
30,000
YA11C-CAP
1" - 12
33.3
1.31
31.8
1.25
206.8
30,000
YA16C-CAP
1 5/16" - 12
30.5
1.20
38.1
1.50
137.9
20,000
E-6
Catalogue 4462 Global Edition
E
Connectors & Adapters – Valves
Type “M” Swivel Hose Fittings and Adapters
Torpedos
A
T1
T2
H
T2
YAY1-8-16C
3/4" - 16
1" - 14LH
mm
90.4
inch
3.56
mm
28.7
inch
1.13
MPa
137.9
psi
20,000
YAY2-8-16C
3/4" - 16
1" - 14LH
90.4
3.56
35.1
1.38
137.9
20,000
YAY1-11-16C
1" - 12
1" - 14LH
90.4
3.56
28.7
1.13
137.9
20,000
YAY2-11-16C
1" - 12
1" - 14LH
90.4
3.56
35.1
1.38
137.9
20,000
YAY1-16-16C
1 5/16" - 12
1" - 14LH
94.0
3.70
35.1
1.38
137.9
20,000
YAY2-16-16C
1 5/16" - 12
1" - 14LH
94.0
3.70
35.1
1.38
137.9
20,000
YAY5 – Type ”M” male x Medium pressure
A
T1
H
A
T2
(
T1
T2
YAY5-6-4C
9/16" - 18 UNF
7/16" - 20 UNF
DN size mm inch
6 -04 6.4 1/4
mm inch mm inch MPa
psi
39.6 1.56 16.0 0.63 137.9 20,000
YAY5-6-6C
9/16" - 18 UNF
9/16" - 18 UNF
10
-06 9.5
3/8
41.4 1,63 16.0 0.63 137.9 20,000
YAY5-6-12C
9/16" - 18 UNF
3/4" - 14 NPS
20
-12 19.0
3/4
58.9 2.32 28.7 1.13 137.9 20,000
YAY5-8-6C
3/4" - 16 UNF
9/16" - 18 UNF
10
-06 9.5
3/8
47.8 1.88 19.1 0.75 137.9 20,000
YAY5-8-12C
3/4" - 16 UNF
3/4" - 14 NPS
20
-12 19.0
3/4
62.0 2.44 28.7 1.13 137.9 20,000
YAY5-11-6C
1" - 12 UNF
9/16" - 18 UNF
10
-06 9.5
3/8
50.4 2.00 25.4 1.00 137.9 20,000
YAY5-11-12C
1" - 12 UNF
3/4" - 14 NPS
20
-12 19.0
3/4
62.0 2.44 28.7 1.13 137.9 20,000
1 5/16" - 12 UNF 13/16" - 16 UNF 20
-12 19.0
3/4
68.6 2.70 35.1 1.38 137.9 20,000
YAY5-16-12C
E-7
Catalogue 4462 Global Edition
Adapters & Valves
(
A
T1
Connectors & Adapters – Valves
Type “M” Swivel Hose Fittings and Adapters
YA02 – Type ”M” male x NPT female
A
T2
T1
H
(
A
T2
YA02-6-4C
9/16" - 18 UNF
1/4" - 18 UNF
mm
38.1
inch
1.50
mm
19.1
inch
0.75
MPa
103.4
psi
15,000
YA02-6-8C
9/16" - 18 UNF
1/2" - 14 UNF
50.8
2.00
31.8
1.25
103.4
15,000
YA02-8-8C
3/4" - 16 UNF
1/2" - 14 UNF
50.8
2.00
31.8
1.25
103.4
15,000
YA02-11-8C
1" - 12 UNF
1/2" - 14 UNF
63.5
2.50
25.4
1.00
103.4
15,000
Adapters & Valves
T1
E-8
Catalogue 4462 Global Edition
E
Connectors & Adapters – Valves
Type “M” Swivel Hose Fittings and Adapters
YA01 – Type “M” male x NPT male
A
T1
H
T2
T2
YA01-6-2C
9/16" - 18 UNF
1/8" - 27 NPT
mm
32.5
inch
1.28
mm
16.0
inch
0.63
MPa
103.4
psi
15,000
YA01-6-4C
9/16" - 18 UNF
1/4" - 18 NPT
35.1
1.38
16.0
0.63
103.4
15,000
YA01-6-6C
9/16" - 18 UNF
3/8" - 18 NPT
39.9
1.57
19.1
0.75
103.4
15,000
YA01-6-8C
9/16" - 18 UNF
1/2" - 14 NPT
44.5
1.75
22.4
0.88
103.4
15,000
YA01-8-4C
3/4" - 16 UNF
1/4" - 18 NPT
45.7
1.80
19.1
0.75
103.4
15,000
YA01-8-6C
3/4" - 16 UNF
3/8" - 18 NPT
43.9
1.73
19.1
0.75
103.4
15,000
YA01-8-8C
3/4" - 16 UNF
1/2" - 14 NPT
49.5
1.95
22.4
0.88
103.4
15,000
YA01-8-12C
3/4" - 16 UNF
3/4" - 12 NPT
54.1
2.13
28.7
1.13
68.9
10,000
YA01-8-16C
3/4" - 16 UNF
1" - 11 1/2 NPT
60.6
2.38
35.1
1.38
68.9
10,000
YA01-11-6C
1" - 12 UNF
3/8" - 18 NPT
47.0
1.85
25.4
1.00
103.4
15,000
YA01-11-8C
1" - 12 UNF
1/2" - 14 NPT
50.8
2.00
25.4
1.00
103.4
15,000
YA01-11-12C
1" - 12 UNF
3/4" - 12 NPT
54.1
2.13
28.7
1.13
68.9
10,000
YA01-11-16C
1" - 12 UNF
1" - 11 1/2 NPT
60.5
2.38
35.1
1.38
68.9
10,000
YA01-16-8C
1 5/16" - 12 UNF
1/2" - 14 NPT
54.1
2.13
35.1
1.38
103.4
15,000
YA01-16-12C
1 5/16" - 12 UNF
3/4" - 12 NPT
60.5
2.38
35.1
1.38
68.9
10,000
YA01-16-16C
1 5/16" - 12 UNF
1" - 11 1/2 NPT
63.5
2.50
35.1
1.38
68.9
10,000
YA01-16-20C
1 5/16" - 12 UNF 1 1/4” - 11 1/2 NPT
69.9
2.75
44.5
1.75
68.9
10,000
YA01-16-24C
1 5/16" - 12 UNF 1 1/4" - 11 1/2 NPT
69.9
2.75
50.8
2.00
51.7
7,500
YA01-16-32C
1 5/16" - 12 UNF
69.9
2.75
60.5
2.38
51.7
7,500
2" - 11 1/2 NPT
E-9
Catalogue 4462 Global Edition
Adapters & Valves
(
A
T1
Connectors & Adapters – Valves
Medium Pressure Fittings & Adapters
Medium Pressure Fittings & Adapters
Features
• An industry standard for use at elevated pressures.
• Large orifice allows maximum flow of liquids and gases.
• Suitable for repetitive assembly and disassembly.
Adapters & Valves
Construction
Medium Pressure is a 58/60° coned and threaded tubing design.
They have a maximum working pressure rating of 20,000 psi.
Sizes
1/4“ O.D. x 0.109“ I.D. • 7/16“ - 20 male thread on gland nut
3/8“ O.D. x 0.19“ I.D. • 9/16“ - 18 male thread on gland nut
9/16“ O.D. x 0.31“ I.D. • 13/16“ - 16 male thread on gland nut
3/4“ O.D. x 0.44“ I.D. • 3/4“ - National Pipe Straight (NPT) male
1“ O.D. x 0.56“ I.D. • 1 3/8“ - 12 male thread on gland nut
Identification is by tubing O.D.
E-10
Catalogue 4462 Global Edition
E
Connectors & Adapters – Valves
Medium Pressure Fittings & Adapters
5YY5 – Female medium pressure
to male medium pressure
A
H
5YY5-4-6C
1/4" M.P. Female to 3/8" M.P. Male
mm
44.5
inch
1.75
mm
19.1
inch
0.75
MPa
137.9
psi
20,000
5YY5-4-9C
1/4" M.P. Female to 9/16" M.P. Male
47.5
1.87
22.1
0.87
137.9
20,000
5YY5-4-12C
1/4" M.P. Female to 3/4" M.P. Male
50.8
2.00
28.4
1.12
137.9
20,000
5YY5-4-16C
1/4" M.P. Female to 1" M.P. Male
76.2
3.00
25.4
1.00
137.9
20,000
5YY5-6-4C
3/8" M.P. Female to 1/4" M.P. Male
44.5
1.75
19.1
0.75
137.9
20,000
5YY5-6-9C
3/8" M.P. Female to 9/16" M.P. Male
47.5
1.87
22.1
0.87
137.9
20,000
5YY5-6-12C
3/8" M.P. Female to 3/4" M.P. Male
50.8
2.00
28.4
1.12
137.9
20,000
5YY5-9-4C
9/16" M.P. Female to 1/4" M.P. Male
53.8
2.12
25.4
1.00
137.9
20,000
5YY5-9-6C
9/16" M.P. Female to 3/8" M.P. Male
53.8
2.12
25.4
1.00
137.9
20,000
5YY5-9-12C
9/16" M.P. Female to 3/4" M.P. Male
63.5
2.50
28.4
1.12
137.9
20,000
5YY5-9-16C
9/16" M.P. Female to 1" M.P. Male
85.6
3.37
25.4
1.00
137.9
20,000
5YY5-12-4C
3/4" M.P. Female to 1/4" M.P. Male
31.8
1.25
34.8
1.37
137.9
20,000
5YY5-12-6C
3/4" M.P. Female to 3/8" M.P. Male
60.2
2.37
34.8
1.37
137.9
20,000
5YY5-12-9C
3/4" M.P. Female to 9/16" M.P. Male
72.9
2.87
34.8
1.37
137.9
20,000
5YY5-12-16C
3/4" M.P. Female to 1" M.P. Male
95.3
3.75
34.8
1.37
137.9
20,000
5YY5-16-4C
1" M.P. Female to 1/4" M.P. Male
69.9
2.75
44.5
1.75
137.9
20,000
5YY5-16-6C
1" M.P. Female to 3/8" M.P. Male
72.9
2.87
44.5
1.75
137.9
20,000
5YY5-16-9C
1" M.P. Female to 9/16" M.P. Male
76.2
3.00
44.5
1.75
137.9
20,000
5YY5-16-12C
1" M.P. Female to 3/4" M.P. Male
82.6
3.25
44.5
1.75
137.9
20,000
E-11
Catalogue 4462 Global Edition
Adapters & Valves
(
A
Connectors & Adapters – Valves
Medium Pressure Fittings & Adapters
5YY6 – Female medium pressure
to male high pressure
A
H
(
A
1/4" M.P. Female to 1/4" H.P. Male
mm
34.8
inch
1.37
mm
19.1
inch
0.75
MPa
137.9
psi
20,000
5YY6-4-6C
1/4" M.P. Female to 3/8" H.P. Male
44.5
1.75
19.1
0.75
137.9
20,000
5YY6-4-9C
1/4" M.P. Female to 9/16" H.P. Male
53.8
2.12
28.4
1.12
137.9
20,000
5YY6-6-4C
3/8" M.P. Female to 1/4" H.P. Male
44.5
1.75
19.1
0.75
137.9
20,000
5YY6-6-6C
3/8" M.P. Female to 3/8" H.P. Male
44.5
1.75
19.1
0.75
137.9
20,000
5YY6-6-9C
3/8" M.P. Female to 9/16" H.P. Male
53.8
2.12
28.4
1.12
137.9
20,000
5YY6-9-4C
9/16" M.P. Female to 1/4" H.P. Male
47.5
1.87
25.4
1.00
137.9
20,000
5YY6-9-6C
9/16" M.P. Female to 3/8" H.P. Male
53.8
2.12
25.4
1.00
137.9
20,000
5YY6-9-9C
9/16" M.P. Female to 9/16" H.P. Male
53.8
2.12
28.4
1.12
137.9
20,000
5YY6-12-4C
3/4" M.P. Female to 1/4" H.P. Male
63.5
2.50
34.8
1.37
137.9
20,000
5YY6-12-6C
3/4" M.P. Female to 3/8" H.P. Male
60.2
2.37
34.8
1.37
137.9
20,000
5YY6-12-9C
3/4" M.P. Female to 9/16" H.P. Male
66.5
2.62
34.8
1.37
137.9
20,000
5YY6-16-6C
1" M.P. Female to 3/8" H.P. Male
72.9
2.87
44.5
1.75
137.9
20,000
5YY6-16-9C
1" M.P. Female to 9/16" H.P. Male
79.2
3.12
44.5
1.75
137.9
20,000
Adapters & Valves
5YY6-4-4C
E-12
Catalogue 4462 Global Edition
E
Connectors & Adapters – Valves
Medium Pressure Fittings & Adapters
6YY5 – Female high pressure
to male medium pressure
A
H
1/4" H.P. Female to 1/4" M.P. Male
mm
44.5
inch
1.75
mm
19.1
inch
0.75
MPa
137.9
psi
20,000
6YY5-4-6C
1/4" H.P. Female to 3/8" M.P. Male
44.5
1.75
19.1
0.75
137.9
20,000
6YY5-4-9C
1/4" H.P. Female to 9/16" M.P. Male
47.5
1.87
22.1
0.87
137.9
20,000
6YY5-4-12C
1/4" H.P. Female to 3/4" M.P. Male
57.2
2.25
28.4
1.12
137.9
20,000
6YY5-4-16C
1/4" H.P. Female to 1" M.P. Male
76.2
3.00
25.4
1.00
137.9
20,000
6YY5-6-4C
3/8" H.P. Female to 1/4" M.P. Male
47.5
1.87
25.4
1.00
137.9
20,000
6YY5-6-6C
3/8" H.P. Female to 3/8" M.P. Male
47.5
1.87
25.4
1.00
137.9
20,000
6YY5-6-9C
3/8" H.P. Female to 9/16" M.P. Male
50.8
2.00
25.4
1.00
137.9
20,000
6YY5-6-12C
3/8" H.P. Female to 3/4" M.P. Male
57.2
2.25
28.4
1.12
137.9
20,000
6YY5-6-16C
3/8" H.P. Female to 1" M.P. Male
82.6
3.25
25.4
1.00
137.9
20,000
6YY5-9-4C
9/16" H.P. Female to 1/4" M.P. Male
53.8
2.12
34.8
1.37
137.9
20,000
6YY5-9-6C
9/16" H.P. Female to 3/8" M.P. Male
53.8
2.12
34.8
1.37
137.9
20,000
6YY5-9-9C
9/16" H.P. Female to 9/16" M.P. Male
60.2
2.37
34.8
1.37
137.9
20,000
6YY5-9-12C
9/16" H.P. Female to 3/4" M.P. Male
63.5
2.50
34.8
1.37
137.9
20,000
6YY5-9-16C
9/16" H.P. Female to 1" M.P. Male
91.1
3.62
34.8
1.37
137.9
20,000
6YY5-4-4C
E-13
Catalogue 4462 Global Edition
Adapters & Valves
(
A
Connectors & Adapters – Valves
Medium Pressure Fittings & Adapters
5Y01 – Female medium pressure
to NPT male
A
H
(
Adapters & Valves
A
5Y01-4-2C
1/4" M.P. Female to 1/8" NPT Male
mm
36.3
inch
1.43
mm
19.1
inch
0.75
MPa
139.7
psi
15,000
5Y01-4-4C
1/4" M.P. Female to 1/4" NPT Male
41.1
1.62
19.1
0.75
139.7
15,000
5Y01-4-6C
1/4" M.P. Female to 3/8" NPT Male
41.1
1.62
19.1
0.75
139.7
15,000
5Y01-4-8C
1/4" M.P. Female to 1/2" NPT Male
44.5
1.75
25.4
1.00
139.7
15,000
5Y01-4-12C
1/4" M.P. Female to 3/4" NPT Male
47.5
1.87
34.8
1.37
103.4
10,000
5Y01-4-16C
1/4" M.P. Female to 1" NPT Male
47.5
1.87
34.8
1.37
103.4
10,000
5Y01-6-2C
3/8" M.P. Female to 1/8" NPT Male
36.3
1.43
19.1
0.75
139.7
15,000
5Y01-6-4C
3/8" M.P. Female to 1/4" NPT Male
41.1
1.62
19.1
0.75
139.7
15,000
5Y01-6-6C
3/8" M.P. Female to 3/8" NPT Male
41.1
1.62
19.1
0.75
139.7
15,000
5Y01-6-8C
3/8" M.P. Female to 1/2" NPT Male
44.2
1.74
25.4
1.00
139.7
15,000
5Y01-6-12C
3/8" M.P. Female to 3/4" NPT Male
47.5
1.87
34.8
1.37
103.4
10,000
5Y01-6-16C
3/8" M.P. Female to 1" NPT Male
47.5
1.87
34.8
1.37
103.4
10,000
5Y01-9-2C
9/16" M.P. Female to 1/4" NPT Male
47.5
1.87
25.4
1.00
139.7
15,000
5Y01-9-4C
9/16" M.P. Female to 1/4" NPT Male
47.5
1.87
25.4
1.00
139.7
15,000
5Y01-9-6C
9/16" M.P. Female to 3/8" NPT Male
47.5
1.87
25.4
1.00
139.7
15,000
5Y01-9-8C
9/16" M.P. Female to 1/2" NPT Male
47.5
1.87
25.4
1.00
139.7
15,000
5Y01-9-12C
9/16" M.P. Female to 3/4" NPT Male
47.5
1.87
34.8
1.37
103.4
10,000
5Y01-9-16C
9/16" M.P. Female to 1" NPT Male
47.5
1.87
34.8
1.37
103.4
10,000
5Y01-12-2C
3/4" M.P. Female to 1/8" NPT Male
63.5
2.50
34.8
1.37
139.7
15,000
5Y01-12-4C
3/4" M.P. Female to 1/4" NPT Male
63.5
2.50
34.8
1.37
139.7
15,000
5Y01-12-6C
3/4" M.P. Female to 3/8" NPT Male
63.5
2.50
34.8
1.37
139.7
15,000
5Y01-12-8C
3/4" M.P. Female to 1/2" NPT Male
63.5
2.50
34.8
1.37
139.7
15,000
5Y01-12-12C
3/4" M.P. Female to 3/4" NPT Male
63.5
2.50
34.8
1.37
139.7
15,000
5Y01-12-16C
3/4" M.P. Female to 1" NPT Male
63.5
2.50
34.8
1.37
139.7
15,000
5Y01-16-2C
1" M.P. Female to 1/8" NPT Male
63.5
2.50
34.8
1.37
139.7
15,000
5Y01-16-4C
1" M.P. Female to 1/4" NPT Male
63.5
2.50
34.8
1.37
139.7
15,000
5Y01-16-6C
1" M.P. Female to 3/8" NPT Male
63.5
2.50
34.8
1.37
139.7
15,000
5Y01-16-8C
1" M.P. Female to 1/2" NPT Male
63.5
2.50
34.8
1.37
139.7
15,000
5Y01-16-12C
1" M.P. Female to 3/4" NPT Male
63.5
2.50
34.8
1.37
139.7
15,000
5Y01-16-16C
1" M.P. Female to 1" NPT Male
63.5
2.50
34.8
1.37
103.4
10,000
E-14
Catalogue 4462 Global Edition
E
Connectors & Adapters – Valves
Medium Pressure Fittings & Adapters
02Y5 – Female NPT
to male medium pressure
A
H
1/8" NPT Female to 3/4" M.P. Male
mm
50.8
inch
2.00
mm
28.4
inch
1.12
MPa
103.4
psi
15,000
02Y5-2-16C
1/8" NPT Female to 1" M.P. Male
76.2
3.00
25.4
1.00
103.4
15,000
02Y5-2-4C
1/8" NPT Female to 1/4" M.P. Male
44.5
1.75
19.1
0.75
103.4
15,000
02Y5-2-6C
1/8" NPT Female to 3/8" M.P. Male
47.5
1.87
19.1
0.75
103.4
15,000
02Y5-2-9C
1/8" NPT Female to 9/16" M.P. Male
47.5
1.87
22.1
0.87
103.4
15,000
02Y5-4-4C
1/4" NPT Female to 1/4" M.P. Male
44.5
1.75
19.1
0.75
103.4
15,000
02Y5-4-6C
1/4" NPT Female to 3/8" M.P. Male
47.5
1.87
19.1
0.75
103.4
15,000
02Y5-4-9C
1/4" NPT Female to 9/16" M.P. Male
47.5
1.87
22.1
0.87
103.4
15,000
02Y5-4-12C
1/4" NPT Female to 3/4" M.P. Male
50.8
2.00
28.4
1.12
103.4
15,000
02Y5-4-16C
1/4" NPT Female to 1" M.P. Male
76.2
3.00
25.4
1.00
103.4
15,000
02Y5-6-4C
3/8" NPT Female to 1/4" M.P. Male
50.8
2.00
25.4
1.00
103.4
15,000
02Y5-6-6C
3/8" NPT Female to 3/8" M.P. Male
53.8
2.12
25.4
1.00
103.4
15,000
02Y5-6-9C
3/8" NPT Female to 9/16" M.P. Male
57.2
2.25
25.4
1.00
103.4
15,000
02Y5-6-12C
3/8" NPT Female to 3/4" M.P. Male
50.8
2.00
28.4
1.12
103.4
15,000
02Y5-6-16C
3/8" NPT Female to 1" M.P. Male
76.2
3.00
25.4
1.00
103.4
15,000
02Y5-8-4C
1/2" NPT Female to 1/4" M.P. Male
53.8
2.12
28.4
1.12
103.4
15,000
02Y5-8-6C
1/2" NPT Female to 3/8" M.P. Male
31.8
1.25
28.4
1.12
103.4
15,000
02Y5-8-8C
1/2" NPT Female to 9/16" M.P. Male
60.2
2.37
28.4
1.12
103.4
15,000
02Y5-8-12C
1/2" NPT Female to 3/4" M.P. Male
63.5
2.50
28.4
1.12
103.4
15,000
02Y5-8-16C
1/2" NPT Female to 1" M.P. Male
95.3
3.75
28.4
1.12
103.4
15,000
02Y5-12-4C
3/4" NPT Female to 1/4" M.P. Male
60.2
2.37
34.8
1.37
68.9
10,000
02Y5-12-6C
3/4" NPT Female to 3/8" M.P. Male
63.5
2.50
34.8
1.37
68.9
10,000
02Y5-12-9C
3/4" NPT Female to 9/16" M.P. Male
66.5
2.62
34.8
1.37
68.9
10,000
02Y5-12-12C
3/4" NPT Female to 3/4" M.P. Male
69.9
2.75
38.1
1.50
68.9
10,000
02Y5-12-16C
3/4" NPT Female to 1" M.P. Male
104.6
4.12
38.1
1.50
68.9
10,000
02Y5-16-6C
1" NPT Female to 3/8" M.P. Male
72.9
2.87
47.5
1.87
68.9
10,000
02Y5-16-9C
1" NPT Female to 9/16" M.P. Male
76.2
3.00
47.5
1.87
68.9
10,000
02Y5-16-12C
1" NPT Female to 3/4" M.P. Male
76.2
3.00
47.5
1.87
68.9
10,000
02Y5-16-16C
1" NPT Female to 1" M.P. Male
111.0
4.37
47.5
1.87
68.9
10,000
02Y5-2-12C
E-15
Catalogue 4462 Global Edition
Adapters & Valves
(
A
Connectors & Adapters – Valves
Medium Pressure Fittings & Adapters
5Y5Y – Straight coupling
A
H
(
A
1/4" Medium pressure female
mm
41.1
inch
1.62
mm
19.1
inch
0.75
MPa
137.9
psi
20,000
5Y5Y-6-6C
3/8" Medium pressure female
44.5
1.75
19.1
0.75
137.9
20,000
5Y5Y-9-9C
9/16" Medium pressure female
53.8
2.12
25.4
1.00
137.9
20,000
5Y5Y-12-12C
3/4" Medium pressure female
63.5
2.50
34.8
1.37
137.9
20,000
5Y5Y-16-16C
1" Medium pressure female
88.9
3.50
44.5
1.75
137.9
20,000
Adapters & Valves
5Y5Y-4-4C
5Y5Y – Reducer coupling
A
H
(
A
5Y5Y-4-6C
1/4" M.P. Female to 3/8" M.P. Female
mm
44.5
inch
1.75
mm
19.1
inch
0.75
MPa
137.9
psi
20,000
5Y5Y-4-9C
1/4" M.P. Female to 9/16" M.P. Female
53.8
2.12
25.4
1.00
137.9
20,000
5Y5Y-4-12C
1/4" M.P. Female to 3/4" M.P. Female
63.5
2.50
34.8
1.37
137.9
20,000
5Y5Y-4-16C
1/4" M.P. Female to 1" M.P. Female
88.9
3.50
44.5
1.75
137.9
20,000
5Y5Y-6-9C
3/8" M.P. Female to 9/16" M.P. Female
53.8
2.12
25.4
1.00
137.9
20,000
5Y5Y-6-12C
3/8" M.P. Female to 3/4" M.P. Female
63.5
2.50
34.8
1.37
137.9
20,000
5Y5Y-6-16C
3/8" M.P. Female to 1" M.P. Female
88.9
3.50
44.5
1.75
137.9
20,000
5Y5Y-9-12C
9/16" M.P. Female to 3/4" M.P. Female
63.5
2.50
34.8
1.37
137.9
20,000
5Y5Y-9-16C
9/16" M.P. Female to 1" M.P. Female
88.9
3.50
44.5
1.75
137.9
20,000
5Y5Y-12-16C
3/4" M.P. Female to 1" M.P. Female
88.9
3.50
44.5
1.75
137.9
20,000
E-16
Catalogue 4462 Global Edition
E
Connectors & Adapters – Valves
Medium Pressure Fittings & Adapters
5Y6Y – Female medium pressure
to female high pressure coupling
A
H
1/4" M.P. Female to 1/4" H.P. Female
mm
41.1
inch
1.62
mm
19.1
inch
0.75
MPa
137.9
psi
20,000
5Y6Y-4-6C
1/4" M.P. Female to 3/8" H.P. Female
47.5
1.87
25.4
1.00
137.9
20,000
5Y6Y-4-9C
1/4" M.P. Female to 9/16" H.P. Female
60.2
2.37
34.8
1.37
137.9
20,000
5Y6Y-6-4C
3/8" M.P. Female to 1/4" H.P. Female
44.5
1.75
19.1
0.75
137.9
20,000
5Y6Y-6-6C
3/8" M.P. Female to 3/8" H.P. Female
47.5
1.87
25.4
1.00
137.9
20,000
5Y6Y-6-9C
3/8" M.P. Female to 9/16" H.P. Female
60.2
2.37
34.8
1.37
137.9
20,000
5Y6Y-9-4C
9/16" M.P. Female to 1/4" H.P. Female
53.8
2.12
25.4
1.00
137.9
20,000
5Y6Y-9-6C
9/16" M.P. Female to 3/8" H.P. Female
53.8
2.12
25.4
1.00
137.9
20,000
5Y6Y-9-9C
9/16" M.P. Female to 9/16" H.P. Female
60.2
2.37
34.8
1.37
137.9
20,000
5Y6Y-12-4C
3/4" M.P. Female to 1/4" H.P. Female
63.5
2.50
34.8
1.37
137.9
20,000
5Y6Y-12-6C
3/4" M.P. Female to 3/8" H.P. Female
63.5
2.50
34.8
1.37
137.9
20,000
5Y6Y-12-9C
3/4" M.P. Female to 9/16" H.P. Female
63.5
2.50
34.8
1.37
137.9
20,000
5Y6Y-16-4C
1" M.P. Female to 1/4" H.P. Female
88.9
3.50
34.8
1.37
137.9
20,000
5Y6Y-16-6C
1" M.P. Female to 3/8" H.P. Female
88.9
3.50
34.8
1.37
137.9
20,000
5Y6Y-16-9C
1" M.P. Female to 9/16" H.P. Female
88.9
3.50
34.8
1.37
137.9
20,000
5Y6Y-4-4C
E-17
Catalogue 4462 Global Edition
Adapters & Valves
(
A
Connectors & Adapters – Valves
Medium Pressure Fittings & Adapters
5Y02 – Female medium pressure
to NPT female coupling
A
H
(
Adapters & Valves
A
mm
inch
mm
inch
MPa
psi
5Y02-4-2C
1/4" M.P. Female to 1/8" NPT Female
41.1
1.62
19.1
0.75
103.4
15,000
5Y02-4-4C
1/4" M.P. Female to 1/4" NPT Female
41.1
1.62
19.1
0.75
103.4
15,000
5Y02-4-6C
1/4" M.P. Female to 3/8" NPT Female
50.8
2.00
25.4
1.00
103.4
15,000
5Y02-4-8C
1/4" M.P. Female to 1/2" NPT Female
50.8
2.00
28.4
1.12
103.4
15,000
5Y02-4-12C
1/4" M.P. Female to 3/4" NPT Female
60.2
2.37
34.8
1.37
68.9
10,000
5Y02-4-16C
1/4" M.P. Female to 1" NPT Female
66.5
2.62
50.8
2.00
68.9
10,000
5Y02-6-2C
3/8" M.P. Female to 1/8" NPT Female
44.5
1.75
19.1
0.75
103.4
15,000
5Y02-6-4C
3/8" M.P. Female to 1/4" NPT Female
44.5
1.75
19.1
0.75
103.4
15,000
5Y02-6-6C
3/8" M.P. Female to 3/8" NPT Female
53.8
2.12
25.4
1.00
103.4
15,000
5Y02-6-8C
3/8" M.P. Female to 1/2" NPT Female
53.8
2.12
28.4
1.12
103.4
15,000
5Y02-6-12C
3/8" M.P. Female to 3/4" NPT Female
60.2
2.37
34.8
1.37
68.9
10,000
5Y02-6-16C
3/8" M.P. Female to 1" NPT Female
69.9
2.75
50.8
2.00
68.9
10,000
5Y02-9-2C
9/16" M.P. Female to 1/8" NPT Female
53.8
2.12
25.4
1.00
103.4
15,000
5Y02-9-4C
9/16" M.P. Female to 1/4" NPT Female
53.8
2.12
25.4
1.00
103.4
15,000
5Y02-9-6C
9/16" M.P. Female to 3/8" NPT Female
53.8
2.12
25.4
1.00
103.4
15,000
5Y02-9-8C
9/16" M.P. Female to 1/2" NPT Female
57.2
2.25
28.4
1.12
103.4
15,000
5Y02-9-12C
9/16" M.P. Female to 3/4" NPT Female
63.5
2.50
34.8
1.37
68.9
10,000
5Y02-9-16C
9/16" M.P. Female to 1" NPT Female
72.9
2.87
50.8
2.00
68.9
10,000
5Y02-12-2C
3/4" M.P. Female to 1/8" NPT Female
63.5
2.50
34.8
1.37
103.4
15,000
5Y02-12-4C
3/4" M.P. Female to 1/4" NPT Female
63.5
2.50
34.8
1.37
103.4
15,000
5Y02-12-6C
3/4" M.P. Female to 3/8" NPT Female
63.5
2.50
34.8
1.37
103.4
15,000
5Y02-12-8C
3/4" M.P. Female to 1/2" NPT Female
63.5
2.50
34.8
1.37
103.4
15,000
5Y02-12-12C
3/4" M.P. Female to 3/4" NPT Female
69.9
2.75
38.1
1.50
68.9
10,000
5Y02-12-16C
3/4" M.P. Female to 1" NPT Female
76.2
3.00
47.5
1.87
68.9
10,000
5Y02-16-2C
1" M.P. Female to 1/8" NPT Female
76.2
3.00
44.5
1.75
103.4
15,000
5Y02-16-4C
1" M.P. Female to 1/4" NPT Female
76.2
3.00
44.5
1.75
103.4
15,000
5Y02-16-6C
1" M.P. Female to 3/8" NPT Female
76.2
3.00
44.5
1.75
103.4
15,000
5Y02-16-8C
1" M.P. Female to 1/2" NPT Female
76.2
3.00
44.5
1.75
103.4
15,000
5Y02-16-12C
1" M.P. Female to 3/4" NPT Female
88.9
3.50
38.1
1.50
68.9
10,000
5Y02-16-16C
1" M.P. Female to 1" NPT Female
95.2
3.75
47.5
1.87
68.9
10,000
E-18
Catalogue 4462 Global Edition
E
Connectors & Adapters – Valves
Medium Pressure Fittings & Adapters
A
Y5Y5 – Male medium pressure
to male medium pressure
H
Y5Y5-4-4C
1/4" M.P. Male to 1/4" M.P. Male
mm
50.8
inch
2.00
mm
15.7
inch
0.62
MPa
137.9
psi
20,000
Y5Y5-4-6C
1/4" M.P. Male to 3/8" M.P. Male
53.8
2.12
19.1
0.75
137.9
20,000
Y5Y5-4-12C
1/4" M.P. Male to 3/4" M.P. Male
50.8
2.50
28.4
1.12
137.9
20,000
Y5Y5-4-16C
1/4" M.P. Male to 1" M.P. Male
91.9
3.62
25.4
1.00
137.9
20,000
Y5Y5-6-6C
3/8" M.P. Male to 3/8" M.P. Male
57.2
2.25
19.1
0.75
137.9
20,000
Y5Y5-6-9C
3/8" M.P. Male to 9/16" M.P. Male
63.5
2.50
22.1
0.87
137.9
20,000
Y5Y5-6-12C
3/8" M.P. Male to 3/4" M.P. Male
66.5
2.62
28.4
1.12
137.9
20,000
Y5Y5-6-16C
3/8" M.P. Male to 1" M.P. Male
95.3
3.75
25.4
1.00
137.9
20,000
Y5Y5-9-9C
9/16" M.P. Male to 9/16" M.P. Male
63.5
2.50
25.4
1.00
137.9
20,000
Y5Y5-9-12C
9/16" M.P. Male to 3/4" M.P. Male
72.9
2.87
28.4
1.12
137.9
20,000
Y5Y5-9-16C
9/16" M.P. Male to 1" M.P. Male
101.6
4.00
25.4
1.00
137.9
20,000
Y5Y5-12-12C
3/4" M.P. Male to 3/4" M.P. Male
76.2
3.00
28.4
1.12
137.9
20,000
Y5Y5-12-16C
3/4" M.P. Male to 1" M.P. Male
31.8
1.25
28.4
1.12
137.9
20,000
E-19
Catalogue 4462 Global Edition
Adapters & Valves
(
A
Connectors & Adapters – Valves
Medium Pressure Fittings & Adapters
A
Y5Y6 – Male medium pressure
to male high pressure
H
(
A
1/4" M.P. Male to 1/4" H.P. Male
mm
43.9
inch
1.73
mm
16.0
inch
0.63
MPa
137.9
psi
20,000
Y5Y6-4-6C
1/4" M.P. Male to 3/8" H.P. Male
53.3
2.10
19.1
0.75
137.9
20,000
Y5Y6-4-9C
1/4" M.P. Male to 9/16" H.P. Male
60.2
2.37
28.4
1.12
137.9
20,000
Y5Y6-6-4C
3/8" M.P. Male to 1/4" H.P. Male
53.8
2.12
15.7
0.62
137.9
20,000
Y5Y6-6-9C
3/8" M.P. Male to 9/16" H.P. Male
63.5
2.50
28.4
1.12
137.9
20,000
Y5Y6-9-4C
9/16" M.P. Male to 1/4" H.P. Male
57.2
2.25
22.1
0.87
137.9
20,000
Y5Y6-9-9C
9/16" M.P. Male to 9/16" H.P. Male
66.5
2.62
28.4
1.12
137.9
20,000
Y5Y6-12-4C
3/4" M.P. Male to 1/4" H.P. Male
66.5
2.62
28.4
1.12
137.9
20,000
Y5Y6-12-6C
3/4" M.P. Male to 3/8" H.P. Male
69.9
2.75
28.4
1.12
137.9
20,000
Y5Y6-12-9C
3/4" M.P. Male to 9/16" H.P. Male
76.2
3.00
28.4
1.12
137.9
20,000
Y5Y6-16-4C
1" M.P. Male to 1/4" H.P. Male
91.9
3.62
25.4
1.00
137.9
20,000
Y5Y6-16-6C
1" M.P. Male to 3/8" H.P. Male
101.6
4.00
25.4
1.00
137.9
20,000
Y5Y6-16-9C
1" M.P. Male to 9/16" H.P. Male
101.6
4.00
28.4
1.12
137.9
20,000
Adapters & Valves
Y5Y6-4-4C
E-20
Catalogue 4462 Global Edition
E
Connectors & Adapters – Valves
Medium Pressure Fittings & Adapters
Y501 – Male medium pressure to NPT male
A
H
Y501-4-4C
1/4" M.P. Male to 1/4" NPT Male
mm
40.6
inch
1.60
mm
16.0
inch
0.63
MPa
103.4
psi
15,000
Y501-4-8C
1/4" M.P. Male to 1/2" NPT Male
53.8
2.12
22.1
0.87
103.4
15,000
Y501-6-4C
3/8" M.P. Male to 1/4" NPT Male
52.3
2.06
19.1
0.75
103.4
15,000
Y501-6-6C
3/8" M.P. Male to 3/8" NPT Male
52.3
2.06
19.1
0.75
103.4
15,000
Y501-6-8C
3/8" M.P. Male to 1/2" NPT Male
55.4
2.18
22.1
0.87
103.4
15,000
Y501-9-2C
9/16" M.P. Male to 1/8" NPT Male
53.8
2.12
22.1
0.87
103.4
15,000
Y501-9-4C
9/16" M.P. Male to 1/4" NPT Male
57.2
2.25
22.1
0.87
103.4
15,000
Y501-9-6C
9/16" M.P. Male to 3/8" NPT Male
57.2
2.25
22.1
0.87
103.4
15,000
Y501-9-8C
9/16" M.P. Male to 1/2" NPT Male
60.2
2.37
22.1
0.87
103.4
15,000
Y501-9-12C
9/16" M.P. Male to 3/4" NPT Male
66.5
2.62
28.4
1.12
68.9
10,000
Y501-9-16C
9/16" M.P. Male to 1" NPT Male
66.5
2.62
34.8
1.37
68.9
10,000
Y501-12-2C
3/4" M.P. Male to 1/8" NPT Male
60.2
2.37
28.4
1.12
103.4
15,000
Y501-12-4C
3/4" M.P. Male to 1/4" NPT Male
63.5
2.50
28.4
1.12
103.4
15,000
Y501-12-6C
3/4" M.P. Male to 3/8" NPT Male
63.5
2.50
28.4
1.12
103.4
15,000
Y501-12-8C
3/4" M.P. Male to 1/2" NPT Male
66.5
2.62
28.4
1.12
103.4
15,000
Y501-12-12C
3/4" M.P. Male to 3/4" NPT Male
69.9
2.75
28.4
1.12
68.9
10,000
Y501-12-16C
3/4" M.P. Male to 1" NPT Male
76.2
3.00
34.8
1.37
68.9
10,000
Y501-16-2C
1" M.P. Male to 1/8" NPT Male
91.9
3.62
25.4
1.00
103.4
15,000
Y501-16-4C
1" M.P. Male to 1/4" NPT Male
95.2
3.75
25.4
1.00
103.4
15,000
Y501-16-6C
1" M.P. Male to 3/8" NPT Male
95.2
3.75
25.4
1.00
103.4
15,000
Y501-16-8C
1" M.P. Male to 1/2" NPT Male
98.3
3.87
25.4
1.00
103.4
15,000
Y501-16-12C
1" M.P. Male to 3/4" NPT Male
98.3
3.87
28.4
1.12
68.9
10,000
Y501-16-16C
1" M.P. Male to 1" NPT Male
101.6
4.00
34.8
1.37
68.9
10,000
E-21
Catalogue 4462 Global Edition
Adapters & Valves
(
A
Connectors & Adapters – Valves
Medium Pressure Fittings & Adapters
L5Y – Medium pressure elbow
E
G
H
F
E
G
H
1/4" M.P.
mm
19.1
inch
0.75
mm
30.0
inch
1.18
mm
25.4
inch
1.00
mm
22.1
inch
0.87
mm
17.3
inch MPa
psi
0.68 137.9 20,000
L5Y-6C
3/8" M.P.
19.1
0.75
34.8
1.37
34.8
1.37
25.4
1.00
25.4
1.00
137.9 20,000
L5Y-9C
9/16" M.P.
25.4
1.00
44.5
1.75
44.5
1.75
31.8
1.25
31.8
1.25
137.9 20,000
L5Y-12C
3/4" M.P.
34.8
1.37
57.2
2.25
57.2
2.25
38.1
1.50
38.1
1.50
137.9 20,000
L5Y-16C
1" M.P.
44.5
1.75
76.2
3.00
76.2
3.00
52.3
2.06
52.3
2.06
137.9 20,000
L5Y-4C
Adapters & Valves
F
T5Y – Medium pressure elbow
E
G
H
F
E
F
G
H
1/4" M.P.
mm
15.7
inch
0.62
mm
44.5
inch
1.75
mm
25.4
inch
1.00
mm
22.1
inch
0.87
mm
17.3
inch MPa
psi
0.68 137.9 20,000
T5Y-6C
3/8" M.P.
19.1
0.75
50.8
2.00
34.8
1.37
25.4
1.00
25.4
1.00
137.9 20,000
T5Y-9C
9/16" M.P.
25.4
1.00
63.5
2.50
44.5
1.75
31.8
1.25
31.8
1.25
137.9 20,000
T5Y-12C
3/4" M.P.
34.8
1.37
76.2
3.00
57.2
2.25
38.1
1.50
38.1
1.50
137.9 20,000
T5Y-16C
1" M.P.
44.5
1.75
104.6
4.12
76.2
3.00
52.3
2.06
52.3
2.06
137.9 20,000
T5Y-4C
E-22
Catalogue 4462 Global Edition
E
Connectors & Adapters – Valves
Medium Pressure Fittings & Adapters
E
X5Y – Medium pressure elbow
G
H
F
E
F
G
H
mm
15.7
inch
0.62
mm
44.5
inch
1.75
mm
34.8
inch
1.37
mm
22.1
inch
0.87
mm
17.3
inch MPa
psi
0.68 137.9 20,000
X5Y-6C
3/8" M.P.
19.1
0.75
50.8
2.00
50.8
2.00
25.4
1.00
25.4
1.00
137.9 20,000
X5Y-9C
9/16" M.P.
25.4
1.00
63.5
2.50
63.5
2.50
31.8
1.25
31.8
1.25
137.9 20,000
X5Y-12C
3/4" M.P.
34.8
1.37
76.2
3.00
76.2
3.00
38.1
1.50
38.1
1.50
137.9 20,000
X5Y-16C
1" M.P.
44.5
1.75
104.6
4.12
104.6
4.12
52.3
2.06
52.3
2.06
137.9 20,000
Adapters & Valves
1/4" M.P.
X5Y-4C
Y2N – Medium pressure gland nut
Y2N-4C
1/4" M.P.
MPa
137.9
psi
20,000
Y2N-6C
3/8" M.P.
137.9
20,000
Y2N-9C
9/16" M.P.
137.9
20,000
Y2N-12C
3/4" M.P.
137.9
20,000
Y2N-16C
1" M.P.
137.9
20,000
E-23
Catalogue 4462 Global Edition
Connectors & Adapters – Valves
Medium Pressure Fittings & Adapters
Y2C – Medium pressure collar
Adapters & Valves
Y2C-4C
1/4" M.P.
MPa
137.9
psi
20,000
Y2C-6C
3/8" M.P.
137.9
20,000
Y2C-9C
9/16" M.P.
137.9
20,000
Y2C-12C
3/4" M.P.
137.9
20,000
Y2C-16C
1" M.P.
137.9
20,000
HBPLM – Medium pressure plug
1/4" M.P.
MPa
137.9
psi
20,000
HBPLM6-B
3/8" M.P.
137.9
20,000
HBPLM9-B
9/16" M.P.
137.9
20,000
HBPLM12-B
3/4" M.P.
137.9
20,000
HBPLM16-B
1" M.P.
137.9
20,000
HBPLM4-B
E-24
Catalogue 4462 Global Edition
E
Connectors & Adapters – Valves
Medium Pressure Fittings & Adapters
Y204, Y206, Y209, Y212 and Y216 –
Medium pressure nipple
Length
mm
69.9
inch
2.75
1/4” O.D.
Y204-0275C
3/8” O.D.
—
9/16” O.D.
—
3/4” O.D.
—
1” O.D.
—
3.00
Y204-0300C
Y206-0300C
—
—
—
4.00
Y204-0400C
Y206-0400C
Y209-0400C
Y212-0400C
—
152.4
6.00
Y204-0600C
Y206-0600C
Y209-0600C
Y212-0600C
Y216-0600C
203.2
8.00
Y204-0800C
Y206-0800C
Y209-0800C
Y212-0800C
Y216-0800C
254.0
10.00
Y204-1000C
Y206-1000C
Y209-1000C
Y212-1000C
Y216-1000C
304.8
12.00
Y204-1200C
Y206-1200C
Y209-1200C
Y212-1200C
Y216-1200C
Adapters & Valves
72.2
101.6
E-25
Catalogue 4462 Global Edition
Connectors & Adapters – Valves
High Pressure Fittings & Adapters
High Pressure Fittings & Adapters
Features
• An industry standard for use at elevated pressures.
• Suitable for repetitive assembly and disassembly.
Adapters & Valves
Construction
High Pressure is a 58/60 degree coned and threaded tubing design.
With small bore sizes, they have a maximum working pressure
rating of 60,000 psi.
Sizes
1/4“ O.D. x 0.08“ I.D. • 9/16“ - 18 male thread on gland nut
3/8“ O.D. x 0.12“ I.D. • 3/4“ - 16 male thread on gland nut
9/16“ O.D. x 0.18“ I.D. • 1 1/8“ - 12 male thread on gland nut
Identification is by tubing O.D.
E-26
Catalogue 4462 Global Edition
E
Connectors & Adapters – Valves
High Pressure Fittings & Adapters
6YY6 – Female high pressure
to male high pressure
(
A
1/4" H.P. Female to 3/8" H.P.
mm
44.5
inch
1.75
mm
19.1
inch
0.75
MPa
413.7
psi
60,000
6YY6-4-9C
1/4" H.P. Female to 9/16" H.P.
53.8
2.12
28.4
1.12
413.7
60,000
6YY6-6-4C
3/8" H.P. Female to 1/4" H.P.
38.1
1.50
25.4
1.00
413.7
60,000
6YY6-6-9C
3/8" H.P. Female to 9/16" H.P.
53.8
2.12
28.4
1.12
413.7
60,000
6YY6-9-4C
9/16" H.P. Female to 1/4" H.P.
44.5
1.75
34.8
1.37
413.7
60,000
6YY6-9-9C
9/16" H.P. Female to 3/8" H.P.
47.5
1.87
34.8
1.37
413.7
60,000
Adapters & Valves
6YY6-4-6C
E-27
Catalogue 4462 Global Edition
Connectors & Adapters – Valves
High Pressure Fittings & Adapters
6Y01 – Female high pressure to male NPT
(
Adapters & Valves
A
6Y01-4-2C
1/4" H.P. Female to 1/8" NPT
mm
31.8
inch
1.25
mm
19.1
inch
0.75
MPa
103.4
psi
15,000
6Y01-4-4C
1/4" H.P. Female to 1/4" NPT
34.8
1.37
19.1
0.75
103.4
15,000
6Y01-4-6C
1/4" H.P. Female to 3/8" NPT
34.8
1.37
19.1
0.75
103.4
15,000
6Y01-4-8C
1/4" H.P. Female to 1/2" NPT
44.5
1.75
25.4
1.00
103.4
15,000
6Y01-4-12C
1/4" H.P. Female to 3/4" NPT
44.5
1.75
38.4
1.37
68.9
10,000
6Y01-4-16C
1/4" H.P. Female to 1" NPT
41.1
1.62
38.4
1.37
68.9
10,000
6Y01-6-2C
3/8" H.P. Female to 1/8" NPT
38.1
1.50
25.4
1.00
103.4
15,000
6Y01-6-4C
3/8" H.P. Female to 1/4" NPT
41.1
1.62
25.4
1.00
103.4
15,000
6Y01-6-6C
3/8" H.P. Female to 3/8" NPT
41.1
1.62
25.4
1.00
103.4
15,000
6Y01-6-8C
3/8" H.P. Female to 1/2" NPT
44.5
1.75
25.4
1.00
103.4
15,000
6Y01-6-12C
3/8" H.P. Female to 3/4" NPT
47.5
1.87
38.4
1.37
68.9
10,000
6Y01-6-16C
3/8" H.P. Female to 1" NPT
47.5
1.87
38.4
1.37
68.9
10,000
6Y01-9-2C
9/16" H.P. Female to 1/8" NPT
38.1
1.50
38.4
1.37
103.4
15,000
6Y01-9-4C
9/16" H.P. Female to 1/4" NPT
41.1
1.62
32.3
1.27
103.4
15,000
6Y01-9-6C
9/16" H.P. Female to 3/8" NPT
44.5
1.75
38.4
1.37
103.4
15,000
6Y01-9-8C
9/16" H.P. Female to 1/2" NPT
47.5
1.87
38.4
1.37
103.4
15,000
6Y01-9-12C
9/16" H.P. Female to 3/4" NPT
47.5
1.87
38.4
1.37
68.9
10,000
6Y01-9-16C
9/16" H.P. Female to 1" NPT
50.8
2.00
38.4
1.37
68.9
10,000
E-28
Catalogue 4462 Global Edition
E
Connectors & Adapters – Valves
High Pressure Fittings & Adapters
A
02Y6 – Female NPT to male high pressure
H
1/8" NPT to 1/4" H.P.
mm
41.1
inch
1.62
mm
19.1
inch
0.75
MPa
103.4
psi
15,000
02Y6-2-6C
1/8" NPT to 3/8" H.P.
41.1
1.62
19.1
0.75
103.4
15,000
02Y6-2-9C
1/8" NPT to 9/16" H.P.
53.8
2.12
28.4
1.12
103.4
15,000
02Y6-4-4C
1/4" NPT to 1/4" H.P.
44.5
1.75
19.1
0.75
103.4
15,000
02Y6-4-6C
1/4" NPT to 3/8" H.P.
44.5
1.75
19.1
0.75
103.4
15,000
02Y6-4-9C
1/4" NPT to 9/16" H.P.
53.8
2.12
28.4
1.12
103.4
15,000
02Y6-6-4C
3/8" NPT to 1/4" H.P.
44.5
1.75
25.4
1.00
103.4
15,000
02Y6-6-6C
3/8" NPT to 3/8" H.P.
44.5
1.75
25.4
1.00
103.4
15,000
02Y6-6-9C
3/8" NPT to 9/16" H.P.
53.8
2.12
28.4
1.12
103.4
15,000
02Y6-8-4C
1/2" NPT to 1/4" H.P.
53.8
2.12
28.4
1.12
103.4
15,000
02Y6-8-6C
1/2" NPT to 3/8" H.P.
53.8
2.12
28.4
1.12
103.4
15,000
02Y6-8-9C
1/2" NPT to 9/16" H.P.
53.8
2.12
28.4
1.12
103.4
15,000
02Y6-12-6C
3/4" NPT to 3/8" H.P.
38.1
1.50
41.1
1.62
68.9
10,000
02Y6-12-9C
3/4" NPT to 9/16" H.P.
57.2
2.25
34.8
1.37
68.9
10,000
02Y6-16-9C
1" NPT to 9/16" H.P.
50.8
2.0
69.9
2.75
68.9
10,000
02Y6-2-4C
E-29
Catalogue 4462 Global Edition
Adapters & Valves
(
A
Connectors & Adapters – Valves
High Pressure Fittings & Adapters
A
Y6Y6 – Male high pressure
to male high pressure
H
(
A
1/4" H.P. to 1/4" H.P.
mm
42.7
inch
1.68
mm
15.7
inch
0.62
MPa
413.7
psi
60,000
Y6Y6-4-6C
1/4" H.P. to 3/8" H.P.
52.3
2.06
19.1
0.75
413.7
60,000
Y6Y6-4-9C
1/4" H.P. to 9/16" H.P.
57.2
2.25
28.4
1.12
413.7
60,000
Y6Y6-6-6C
3/8" H.P. to 3/8" H.P.
57.2
2.25
19.1
0.75
413.7
60,000
Y6Y6-6-9C
3/8" H.P. to 9/16" H.P.
63.5
2.50
28.4
1.12
413.7
60,000
Y6Y6-9-9C
9/16" H.P. to 9/16" H.P.
66.5
2.62
28.4
1.12
413.7
60,000
Adapters & Valves
Y6Y6-4-4C
Y601 – Male high pressure to male NPT
A
H
(
A
Y601-4-2C
1/4" H.P. to 1/8" NPT
mm
47.5
inch
1.87
mm
15.7
inch
0.62
MPa
103.4
psi
15,000
Y601-4-4C
1/4" H.P. to 1/4" NPT
52.3
2.06
19.1
0.75
103.4
15,000
Y601-4-6C
1/4" H.P. to 3/8" NPT
50.8
2.00
19.1
0.75
103.4
15,000
Y601-4-8C
1/4" H.P. to 1/2" NPT
53.8
2.12
22.1
0.87
103.4
15,000
Y601-4-12C
1/4" H.P. to 3/4" NPT
57.2
2.25
28.4
1.12
68.9
10,000
Y601-6-4C
1/4" H.P. to 1" NPT
53.8
2.12
22.1
0.87
103.4
15,000
Y601-6-6C
3/8" H.P. to 1/8" NPT
53.8
2.12
22.1
0.87
103.4
15,000
Y601-9-4C
3/8" H.P. to 1/4" NPT
60.2
2.37
28.4
1.12
103.4
15,000
Y601-9-6C
3/8" H.P. to 3/8" NPT
60.2
2.37
28.4
1.12
103.4
15,000
Y601-9-8C
3/8" H.P. to 1/2" NPT
63.5
2.50
28.4
1.12
103.4
15,000
Y601-9-12C
3/8" H.P. to 3/4" NPT
66.5
2.62
28.4
1.12
68.9
10,000
Y601-9-16C
3/8" H.P. to 1" NPT
69.9
2.75
34.8
1.37
68.9
10,000
E-30
Catalogue 4462 Global Edition
E
Connectors & Adapters – Valves
High Pressure Fittings & Adapters
6Y6Y – Straight coupling
A
H
(
A
1/4" H.P.
mm
44.5
inch
1.75
mm
25.4
inch
1.00
MPa
413.7
psi
60,000
6Y6Y-6-6C
3/8" H.P.
50.8
2.00
25.4
1.00
413.7
60,000
6Y6Y-9-9C
9/16" H.P.
60.2
2.37
34.8
1.37
413.7
60,000
6Y6Y – Reducer coupling
A
Adapters & Valves
6Y6Y-4-4C
H
(
A
6Y6Y-4-6C
1/4" H.P. to 3/8" H.P.
mm
41.1
inch
1.62
mm
25.4
inch
1.00
MPa
413.7
psi
60,000
6Y6Y-4-9C
1/4" H.P. to 9/16" H.P.
44.5
1.75
34.8
1.37
413.7
60,000
6Y6Y-6-9C
3/8" H.P. to 9/16" H.P.
50.8
2.00
34.8
1.37
413.7
60,000
E-31
Catalogue 4462 Global Edition
Connectors & Adapters – Valves
High Pressure Fittings & Adapters
6Y02 – Female high pressure
to female NPT coupling
(
Adapters & Valves
A
6Y02-4-2C
1/4" H.P. to 1/8" NPT
mm
38.1
inch
1.50
mm
25.4
inch
1.00
MPa
103.4
psi
15,000
6Y02-4-4C
1/4" H.P. to 1/4" NPT
38.1
1.50
25.4
1.00
103.4
15,000
6Y02-4-6C
1/4" H.P. to 3/8" NPT
47.5
1.87
25.4
1.00
103.4
15,000
6Y02-4-8C
1/4" H.P. to 1/2" NPT
47.5
1.87
28.4
1.12
103.4
15,000
6Y02-4-12C
1/4" H.P. to 3/4" NPT
50.8
2.00
41.1
1.62
68.9
10,000
6Y02-4-16C
1/4" H.P. to 1" NPT
63.5
2.50
44.5
1.75
68.9
10,000
6Y02-6-2C
3/8" H.P. to 1/8" NPT
47.5
1.87
25.4
1.00
103.4
15,000
6Y02-6-4C
3/8" H.P. to 1/4" NPT
47.5
1.87
25.4
1.00
103.4
15,000
6Y02-6-6C
3/8" H.P. to 3/8" NPT
47.5
1.87
25.4
1.00
103.4
15,000
6Y02-6-8C
3/8" H.P. to 1/2" NPT
47.5
1.87
28.4
1.12
103.4
15,000
6Y02-6-12C
3/8" H.P. to 3/4" NPT
53.8
2.12
34.8
1.37
68.9
10,000
6Y02-6-16C
3/8" H.P. to 1" NPT
63.5
2.50
44.5
1.75
68.9
10,000
6Y02-9-2C
9/16" H.P. to 1/8" NPT
60.2
2.37
34.8
1.37
103.4
15,000
6Y02-9-4C
9/16" H.P. to 1/4" NPT
60.2
2.37
34.8
1.37
103.4
15,000
6Y02-9-6C
9/16" H.P. to 3/8" NPT
60.2
2.37
34.8
1.37
103.4
15,000
6Y02-9-8C
9/16" H.P. to 1/2" NPT
60.2
2.37
34.8
1.37
103.4
15,000
6Y02-9-12C
9/16" H.P. to 3/4" NPT
60.2
2.37
34.8
1.37
68.9
10,000
6Y02-9-16C
9/16" H.P. to 1" NPT
66.5
2.62
50.8
2.00
68.9
10,000
E-32
Catalogue 4462 Global Edition
E
Connectors & Adapters – Valves
High Pressure Fittings & Adapters
L6Y – High pressure elbow
E
F
G
H
mm
25.4
inch
1.00
mm
34.8
inch
1.37
mm
38.1
inch
1.50
mm
22.1
inch
0.87
mm
25.4
inch MPa
psi
1.00 413.7 60,000
L6Y-6C
3/8" H.P.
25.4
1.00
44.5
1.75
38.1
1.50
31.8
1.25
25.4
1.00
413.7 60,000
L6Y-9C
9/16" H.P.
38.1
1.50
66.5
2.62
47.5
1.87
28.4
1.12
28.4
1.12
413.7 60,000
Adapters & Valves
1/4" H.P.
L6Y-4C
T6Y – High pressure tee
E
F
G
H
1/4" H.P.
mm
25.4
inch
1.00
mm
34.8
inch
1.37
mm
34.8
inch
1.37
mm
25.4
inch
1.00
mm
22.1
inch MPa
psi
0.87 413.7 60,000
T6Y-6C
3/8" H.P.
25.4
1.00
44.5
1.75
39.6
1.56
25.4
1.00
26.9
1.06
413.7 60,000
T6Y-9C
9/16" H.P.
38.1
1.50
66.5
2.62
53.8
2.12
41.1
1.62
34.8
1.37
413.7 60,000
T6Y-4C
E-33
Catalogue 4462 Global Edition
Connectors & Adapters – Valves
High Pressure Fittings & Adapters
X6Y – High pressure cross
E
G
H
1/4" H.P.
mm
25.4
inch
1.00
mm
50.8
inch
2.00
mm
38.1
inch
1.50
mm
25.4
inch
1.00
mm
19.1
inch MPa
psi
0.75 413.7 60,000
X6Y-6C
3/8" H.P.
25.4
1.00
53.8
2.12
50.8
2.00
26.9
1.06
25.4
1.00
413.7 60,000
X6Y-9C
9/16" H.P.
38.1
1.50
69.9
2.75
66.5
2.62
34.8
1.37
33.3
1.31
413.7 60,000
X6Y-4C
Adapters & Valves
F
Y4N – High pressure
gland nut
Y4N-4C
1/4" H.P.
Y4C – High pressure collar
MPa
413.7
psi
60,000
Y4C-4C
1/4" H.P.
MPa
413.7
psi
60,000
Y4N-6C
3/8" H.P.
413.7
60,000
Y4C-6C
3/8" H.P.
413.7
60,000
Y4N-9C
9/16" H.P.
413.7
60,000
Y4C-9C
9/16" H.P.
413.7
60,000
E-34
Catalogue 4462 Global Edition
E
Connectors & Adapters – Valves
High Pressure Fittings & Adapters
HBPHM – High pressure plug
1/4" H.P.
MPa
413.7
psi
60,000
HBPHM6-B
3/8" H.P.
413.7
60,000
HBPHM9-B
9/16" H.P.
413.7
60,000
HBPHM4-B
Locking nut/collar – Anti-vibration
Y4NC-4C-AV
1/4" H.P.
mm
17.3
inch
0.68
MPa
16.0
psi
0.63
Y4NC-6C-AV
3/8" H.P.
26.9
1.06
17.3
0.68
Y4NC-9C-AV
9/16" H.P.
39.6
1.56
42.7
1.68
Adapters & Valves
A
H
Nipples – High pressure
Length
mm
69.9
inch
2.75
1/4” O.D.
Y404-0275C
3/8” O.D.
—
9/16” O.D.
Y409-0275C
76.2
3.00
Y404-0300C
Y406-0300C
—
101.6
4.00
Y404-0400C
—
Y409-0400C
152.4
6.00
Y404-0600C
Y406-0600C
Y409-0600C
203.2
8.00
Y404-0800C
Y406-0800C
Y409-0800C
254.0
10.00
Y404-1000C
Y406-1000C
Y409-1000C
304.8
12.00
Y404-1200C
Y406-1200C
Y409-1200C
E-35
Catalogue 4462 Global Edition
Connectors & Adapters – Valves
National Pipe Tapered (NPT)
National Pipe Tapered (NPT)
Features
• An industry standard for use at elevated pressures.
• Suitable for repetitive assembly and disassembly.
Construction
Adapters & Valves
polyflex™ offers a broad range of high quality stainless steel high
pressure NPT adapters.
Sizes 1/8" to 1/2" are rated up to 15,000 psi, 3/4" and above are
rated to 10,000 psi.
E-36
Catalogue 4462 Global Edition
E
Connectors & Adapters – Valves
National Pipe Tapered (NPT)
K0202 – NPT coupler
A
H
15K0202-2-2C
1/8" NPT Female
mm
38.1
inch
1.50
mm
19.1
inch
0.75
MPa
103.4
psi
15,000
15K0202-4-4C
1/4" NPT Female
44.5
1.75
22.1
0.87
103.4
15,000
15K0202-6-6C
3/8" NPT Female
44.5
1.75
25.4
1.00
103.4
15,000
15K0202-8-8C
1/2" NPT Female
54.1
2.13
31.8
1.25
103.4
15,000
10K0202-12-12C
3/4" NPT Female
54.1
2.13
38.1
1.50
68.9
10,000
10K0202-16-16C
1" NPT Female
63.5
2.50
50.8
2.00
68.9
10,000
E
KL02 – NPT elbow
G
H
F
E
F
G
H
15KL02-4C
1/4" NPT Female
mm
29.1
inch
1.15
mm
43.2
inch
1.70
mm
43.2
inch
1.70
mm
20.3
inch
0.80
mm
20.3
inch
0.80
MPa
psi
103.4 15,000
15KL02-6C
3/8" NPT Female
35.1
1.38
48.3
1.90
48.3
1.90
22.9
0.90
22.9
0.90
103.4 15,000
15KL02-8C
1/2" NPT Female
41.4
1.63
54.6
2.15
54.6
2.15
26.2
1.03
26.2
1.03
103.4 15,000
10KL02-12C
3/4" NPT Female
52.1
2.05
47.0
1.85
47.0
1.85
34.3
1.35
34.3
1.35
68.9 10,000
10KL02-16C
1" NPT Female
63.5
2.50
97.3
3.83
97.3
3.83
46.2
1.82
46.2
1.82
68.9 10,000
E-37
Catalogue 4462 Global Edition
Adapters & Valves
(
A
Connectors & Adapters – Valves
National Pipe Tapered (NPT)
E
KX02 – NPT cross
G
H
F
Adapters & Valves
E
F
G
H
15KX02-4C
1/4" NPT Female
mm
29.2
inch
1.15
mm
40.6
inch
1.60
mm
40.6
inch
1.60
mm
20.3
inch
0.80
mm
20.3
inch
0.80
MPa
psi
103.4 15,000
15KX02-6C
3/8" NPT Female
35.1
1.38
45.7
1.80
45.7
1.80
22.9
0.90
22.9
0.90
103.4 15,000
15KX02-8C
1/2" NPT Female
41.4
1.63
52.1
2.05
52.1
2.05
26.2
1.03
26.2
1.03
103.4 15,000
10KX02-12C
3/4" NPT Female
52.1
2.05
68.6
2.70
68.6
2.70
34.3
1.35
34.3
1.35
68.9 10,000
10KX02-16C
1" NPT Female
63.5
2.50
92.2
3.63
92.2
3.63
46.2
1.82
46.2
1.82
68.9 10,000
E
KT02 – NPT tee
G
H
F
E
F
G
H
15KT02-4C
1/4" NPT Female
mm
29.2
inch
1.15
mm
40.6
inch
1.60
mm
43.2
inch
1.70
mm
20.3
inch
0.80
mm
29.2
inch
1.15
MPa
psi
103.4 15,000
15KT02-6C
3/8" NPT Female
35.1
1.38
45.7
1.80
48.3
1.90
22.9
0.90
35.1
1.38
103.4 15,000
15KT02-8C
1/2" NPT Female
41.4
1.63
52.1
2.05
54.6
2.15
26.2
1.03
41.4
1.63
103.4 15,000
10KT02-12C
3/4" NPT Female
52.1
2.05
68.6
2.70
47.0
1.85
34.3
1.35
52.1
2.05
68.9 10,000
10KT02-16C
1" NPT Female
63.5
2.50
92.2
3.63
97.3
3.83
46.2
1.82
65.3
2.50
68.9 10,000
E-38
Catalogue 4462 Global Edition
E
Connectors & Adapters – Valves
National Pipe Tapered (NPT)
K0101 – NPT nipple
A
H
15K0101-1-1C
1/16" NPT Male
mm
25.4
inch
1.00
mm
9.7
inch
0.38
MPa
103.4
psi
15,000
15K0101-2-2C
1/8" NPT Male
30.5
1.20
12.7
0.50
103.4
15,000
15K0101-4-4C
1/4" NPT Male
36.6
1.44
16.0
0.63
103.4
15,000
15K0101-6-6C
3/8" NPT Male
43.2
1.70
19.1
0.75
103.4
15,000
15K0101-8-8C
1/2" NPT Male
57.2
2.25
25.4
1.00
103.4
15,000
10K0101-12-12C
3/4" NPT Male
62.0
2.44
28.7
1.13
68.9
10,000
10K0101-16-16C
1" NPT Male
69.9
2.75
35.1
1.38
68.9
10,000
K0201 – NPT reducer bushing
A
H
(
A
15K0201-1-8C
1/16" NPT Female to 1/2" NPT Male
mm
31.8
inch
1.25
mm
22.1
inch
0.87
MPa
103.4
psi
15,000
15K0201-2-8C
1/8" NPT Female to 1/2" NPT Male
31.8
1.25
22.1
0.87
103.4
15,000
15K0201-4-8C
1/4" NPT Female to 1/2" NPT Male
31.8
1.25
22.1
0.87
103.4
15,000
15K0201-6-8C
3/8" NPT Female to 1/2" NPT Male
41.4
1.63
25.4
1.00
103.4
15,000
E-39
Catalogue 4462 Global Edition
Adapters & Valves
(
A
Connectors & Adapters – Valves
Up to 20,000 psi
Valves
Medium Pressure — Up to 20,000 psi
High Pressure — Up to 60,000 psi
Scope
Adapters & Valves
Developed to assure safe and easy plumbing through 60,000 psi.
These needle valves are engineered to the highest standards of
repeatable quality. The medium pressure valves are designed with
a compact cone-and-threaded connection which permits the larger
bore sizes and increased flow rates common in this pressure class.
The high pressure valves also use a coned-and-threaded connection which accommodates the high pressures common in these
applications.
Non-rotating tip stems are standard for on-off service and insure
long life on valve seats.
Materials include high tensile type 316 stainless steel bodies and
hardened 17-4PH stainless steel lower section stems.
Packing is TFE standard with optional Viton®, BUNA-N and Grafoil
available as non-standard.
Two Way Straight valves are standard with five additional patterns
to satisfy widely varied requirements are available on request.
Features
• Non-Rotating Stem Tips
• Packing Below Stem Threads
• Type 316 ss high tensile bodies
• Positive gland lock device
• No stem adjustment needed
• Black T-handles standard or choice of 4 colors (special order)
• Tube sizes
Medium Pressure — 1/4" through 1"
High Pressure — 1/4" through 9/16"
E-40
Catalogue 4462 Global Edition
E
Connectors & Adapters – Valves
Up to 20,000 psi
SV5Y – Two way straight valves
Medium Pressure (M.P.) – 20,000 psi
Orifice
K
SV5Y-4C-20
1/4" M.P.
mm
2.5
inch
0.10
mm
19.1
inch
0.75
MPa
137.9
psi
20,000
SV5Y-6C-20
3/8" M.P.
5.1
0.20
19.1
0.75
137.9
20,000
SV5Y-9C-20
9/16" M.P.
7.9
0.31
25.4
1.00
137.9
20,000
SV5Y-12C-20
3/4 M.P.
13.0
0.51
34.8
1.37
137.9
20,000
SV5Y-16C-20
1" M.P.
17.3
0.68
44.5
1.75
137.9
20,000
D
J
L
H
G
F
D
E
F
G
H
J
K
L
SV5Y-4C-20
mm inch mm inch mm inch mm inch mm inch mm inch mm inch mm inch
111.0 4.37 50.8 2.00 9.4 0.37 20.6 0.81 50.8 2.00 9.4 0.37 31.8 1.25 5.3 0.21
SV5Y-6C-20
111.0 4.37
50.8
2.00
9.4
0.37
20.6
0.81
50.8
2.00
9.4
0.37
31.8
1.25
5.3
0.21
SV5Y-9C-20
155.4 6.12
63.5
2.50
12.7
0.50
28.4
1.12
72.9
2.87
12.7
0.50
34.8
1.37
8.6
0.34
SV5Y-12C-20
177.8 7.00
76.2
3.00
19.1
0.75
38.1
1.50
95.3
3.75
15.7
0.62
44.5
1.75
10.9
0.43
SV5Y-16C-20
213.9 8.42 106.6 4.12
22.1
0.87
46.0
1.81 117.3 4.62
28.4
1.12
63.5
2.50
14.2
0.56
E-41
Catalogue 4462 Global Edition
Adapters & Valves
E
Connectors & Adapters – Valves
Up to 20,000 psi
AV5Y – Two way angle valves
Medium Pressure (M.P.) – 20,000 psi
Orifice
K
J
1/4" M.P.
mm
2.5
inch
0.10
mm
19.1
inch
0.75
MPa
137.9
psi
20,000
AV5Y-6C-20
3/8" M.P.
5.1
0.20
19.1
0.75
137.9
20,000
AV5Y-9C-20
9/16" M.P.
7.9
0.31
25.4
1.00
137.9
20,000
AV5Y-12C-20
3/4 M.P.
13.0
0.51
34.8
1.37
137.9
20,000
AV5Y-16C-20
1" M.P.
17.3
0.68
44.5
1.75
137.9
20,000
AV5Y-4C-20
D
L
H
G
F
Adapters & Valves
E
D
E
F
G
H
J
K
L
AV5Y-4C-20
mm inch mm inch mm inch mm inch mm inch mm inch mm inch mm inch
122.2 4.81 50.8 2.00 25.4 1.00 31.8 1.25 61.7 2.43 9.4 0.37 31.8 1.25 5.3 0.21
AV5Y-6C-20
122.2 4.81
50.8
2.00
25.4
1.00
31.8
1.25
61.7
2.43
9.4
0.37
31.8
1.25
5.3
0.21
AV5Y-9C-20
168.1 6.62
63.5
2.50
31.8
1.25
41.1
1.62
85.6
3.37
12.7
0.50
34.8
1.37
8.6
0.34
AV5Y-12C-20
190.5 7.50
76.2
3.00
38.1
1.50
50.8
2.00 108.0 4.25
15.7
0.62
44.5
1.75
10.9
0.43
AV5Y-16C-20
236.5 9.37 104.6 4.12
52.3
2.06
65.0
2.56 137.9 5.43
28.4
1.12
63.5
2.50
14.2
0.56
E-42
Catalogue 4462 Global Edition
E
Connectors & Adapters – Valves
Up to 20,000 psi
TV25Y – Three way valves
Medium Pressure (M.P.) – 20,000 psi
Two pressure connections
Orifice
K
1/4" M.P.
mm
2.5
inch
0.10
mm
19.1
inch
0.75
MPa
137.9
psi
20,000
TV25Y-6C-20
3/8" M.P.
5.1
0.20
19.1
0.75
137.9
20,000
TV25Y-9C-20
9/16" M.P.
7.9
0.31
25.4
1.00
137.9
20,000
TV25Y-4C-20
TV25Y-12C-20
3/4 M.P.
13.0
0.51
34.8
1.37
137.9
20,000
TV25Y-16C-20
1" M.P.
17.3
0.68
44.5
1.75
137.9
20,000
J
D L
H
G
F
D
E
F
G
H
J
K
L
TV25Y-4C-20
mm inch mm inch mm inch mm inch mm inch mm inch mm inch mm inch
127.0 5.00 50.8 2.00 25.4 1.00 36.3 1.43 66.5 2.62 9.4 0.37 31.8 1.25 5.3 0.21
TV25Y-6C-20
127.0 5.00
50.8
2.00
25.4
1.00
36.3
1.43
66.5
2.62
9.4
0.37
31.8
1.25
5.3
0.21
TV25Y-9C-20
174.5 6.87
63.5
2.50
31.8
1.25
47.5
1.87
91.9
3.62
12.7
0.50
34.8
1.37
8.6
0.34
TV25Y-12C-20
199.9 7.87
76.2
3.00
66.5
2.62
60.2
2.37 117.3 4.62
15.7
0.62
44.5
1.75
10.9
0.43
TV25Y-16C-20
247.7 9.75 104.6 4.12
53.8
2.12
77.7
3.06 149.1 5.87
28.4
1.12
63.5
2.50
14.2
0.56
E-43
Catalogue 4462 Global Edition
Adapters & Valves
E
Connectors & Adapters – Valves
Up to 20,000 psi
TV15Y – Three way valves
Medium Pressure (M.P.) – 20,000 psi
One pressure connection
Orifice
K
1/4" M.P.
mm
2.5
inch
0.10
mm
19.1
inch
0.75
MPa
137.9
psi
20,000
TV15Y-6C-20
3/8" M.P.
5.1
0.20
19.1
0.75
137.9
20,000
TV15Y-9C-20
9/16" M.P.
7.9
0.31
25.4
1.00
137.9
20,000
TV15Y-4C-20
TV15Y-12C-20
3/4 M.P.
13.0
0.51
34.8
1.37
137.9
20,000
TV15Y-16C-20
1" M.P.
17.3
0.68
44.5
1.75
137.9
20,000
D
J
L
H
F
G
Adapters & Valves
E
D
E
F
G
H
J
K
L
TV15Y-4C-20
mm inch mm inch mm inch mm inch mm inch mm inch mm inch mm inch
122.2 4.81 50.8 2.00 31.8 1.25 31.8 1.25 61.7 2.43 9.4 0.37 31.8 1.25 5.3 0.21
TV15Y-6C-20
122.2 4.81
50.8
2.00
31.8
1.25
31.8
1.25
61.7
2.43
9.4
0.37
31.8
1.25
5.3
0.21
TV15Y-9C-20
168.1 6.62
63.5
2.50
41.1
1.62
41.1
1.62
85.6
3.37
12.7
0.50
34.8
1.37
8.6
0.34
TV15Y-12C-20
190.5 7.50
76.2
3.00
50.8
2.00
50.8
2.00 108.0 4.25
15.7
0.62
44.5
1.75
10.9
0.43
TV15Y-16C-20
236.5 9.37 104.6 4.12
52.3
2.62
52.3
2.62 137.9 5.43
28.4
1.12
63.5
2.50
14.2
0.56
E-44
Catalogue 4462 Global Edition
E
Connectors & Adapters – Valves
Up to 20,000 psi
CV5Y – Ball check valves
A
Medium Pressure (M.P.) – 20,000 psi
H
Orifice
CV5Y-6C-20
CV5Y-9C-20
1/4" M.P.
mm
95.3
inch
3.75
mm
25.4
inch
1.00
MPa
137.9
psi
20,000
3/8" M.P.
95.3
3.75
25.4
1.00
137.9
20,000
9/16" M.P. 110.5
4.35
34.8
1.37
137.7
20,000
Adapters & Valves
CV5Y-4C-20
E-45
Catalogue 4462 Global Edition
Connectors & Adapters – Valves
Up to 30,000 psi
SV6Y – Two way straight valves
High Pressure (H.P.) – 30,000 psi
Orifice
K
SV6Y-4C-30
1/4" H.P.
mm
2.3
inch
0.09
mm
25.4
inch
1.00
MPa
206.8
psi
30,000
SV6Y-6C-30
3/8" H.P.
3.0
0.12
25.4
1.00
206,8
30,000
SV6Y-9C-30
9/16" H.P.
3.0
0.12
38.1
1.50
206.8
30,000
D
J
L
H
G
F
Adapters & Valves
E
D
E
F
G
H
J
K
L
SV6Y-4C-30
mm inch mm inch mm inch mm inch mm inch mm inch mm inch mm inch
131.6 5.18 50.8 2.00 15.7 0.62 25.4 1.00 61.7 2.43 12.7 0.50 34.8 1.37 5.3 0.21
SV6Y-6C-30
131.6 5.18
50.8
2.00
15.7
0.62
25.4
1.00
61.7
2.43
12.7
0.50
34.8
1.37
5.3
0.21
SV6Y-9C-30
142.7 5.62
66.5
2.62
25.4
1.00
36.3
1.43
72.9
2.87
12.7
0.50
34.8
1.37
5.3
0.21
E-46
Catalogue 4462 Global Edition
E
Connectors & Adapters – Valves
Up to 30,000 psi
AV6Y – Two way angle valves
High Pressure (H.P.) – 30,000 psi
Orifice
K
J
1/4" H.P.
mm
2.3
inch
0.09
mm
25.4
inch
1.00
MPa
206.8
psi
30,000
AV6Y-6C-30
3/8" H.P.
3.0
0.12
25.4
1.00
206,8
30,000
AV6Y-9C-30
9/16" H.P.
3.0
0.12
38.1
1.50
206.8
30,000
AV6Y-4C-30
D
L
H
G
F
D
E
F
G
H
J
K
L
AV6Y-4C-30
mm inch mm inch mm inch mm inch mm inch mm inch mm inch mm inch
131.6 5.18 50.8 2.00 25.4 1.00 25.4 1.00 61.7 2.43 12.7 0.50 34.8 1.37 5.3 0.21
AV6Y-6C-30
141.2 5.56
50.8
2.00
25.4
1.00
34.8
1.37
71.4
2.81
12.7
0.50
34.8
1.37
5.3
0.21
AV6Y-9C-30
142.7 5.62
66.5
2.62
33.3
1.31
36.3
1.43
72.9
2.87
12.7
0.50
34.8
1.37
5.3
0.21
E-47
Catalogue 4462 Global Edition
Adapters & Valves
E
Connectors & Adapters – Valves
Up to 30,000 psi
TV26Y – Three way valves
High Pressure (H.P.) – 30,000 psi
Two pressure connections
Orifice
K
1/4" H.P.
mm
2.3
inch
0.09
mm
25.4
inch
1.00
MPa
206.8
psi
30,000
TV26Y-6C-30
3/8" H.P.
3.0
0.12
25.4
1.00
206,8
30,000
TV26Y-9C-30
9/16" H.P.
3.0
0.12
38.1
1.50
206.8
30,000
TV26Y-4C-30
D
J
L
H
G
F
Adapters & Valves
E
D
E
F
G
H
J
K
L
TV26Y-4C-30
mm inch mm inch mm inch mm inch mm inch mm inch mm inch mm inch
131.6 5.18 50.8 2.00 15.7 0.62 25.4 1.00 61.7 2.43 12.7 0.50 34.8 1.37 5.3 0.21
TV26Y-6C-30
141.2 5.56
50.8
2.00
25.4
1.00
34.8
1.37
71.4
2.81
12.7
0.50
34.8
1.37
5.3
0.21
TV26Y-9C-30
153.9 6.06
66.5
2.62
36.3
1.43
47.5
1.87
84.1
3.31
12.7
0.50
34.8
1.37
5.3
0.21
E-48
Catalogue 4462 Global Edition
E
Connectors & Adapters – Valves
Up to 30,000 psi
TV16Y – Three way valves
High Pressure (H.P.) – 30,000 psi
One pressure connection
Orifice
K
1/4" H.P.
mm
2.3
inch
0.09
mm
25.4
inch
1.00
MPa
206.8
psi
30,000
TV16Y-6C-30
3/8" H.P.
3.0
0.12
25.4
1.00
206,8
30,000
TV16Y-9C-30
9/16" H.P.
3.0
0.12
38.1
1.50
206.8
30,000
TV16Y-4C-30
D
J
L
G
F
D
E
F
G
H
J
K
L
TV16Y-4C-30
mm inch mm inch mm inch mm inch mm inch mm inch mm inch mm inch
131.6 5.18 50.8 2.00 25.4 1.00 25.4 1.00 61.7 2.43 12.7 0.50 34.8 1.37 5.3 0.21
TV16Y-6C-30
141.2 5.56
50.8
2.00
50.8
2.00
36.3
1.43
71.4
2.81
12.7
0.50
34.8
1.37
5.3
0.21
TV16Y-9C-30
142.7 5.62
66.5
2.62
55.4
2.18
36.3
1.43
72.9
2.87
12.7
0.50
34.8
1.37
5.3
0.21
E-49
Catalogue 4462 Global Edition
Adapters & Valves
E
Connectors & Adapters – Valves
Up to 60,000 psi
SV6Y – Two way straight valves
High Pressure (H.P.) – 60,000 psi
Orifice
K
SV6Y-4C-60
1/4" H.P.
mm
1.5
inch
0.06
mm
25.4
inch
1.00
MPa
413.7
psi
60,000
SV6Y-6C-60
3/8" H.P.
1.5
0.06
25.4
1.00
413.7
60,000
SV6Y-9C-60
9/16" H.P.
1.5
0.06
38.1
1.50
413.7
60,000
D
J
L
H
G
F
Adapters & Valves
E
D
E
F
G
H
J
K
L
SV6Y-4C-60
mm inch mm inch mm inch mm inch mm inch mm inch mm inch mm inch
131.6 5.18 50.8 2.00 15.7 0.62 25.4 1.00 61.7 2.43 12.7 0.50 34.8 1.37 5.3 0.21
SV6Y-6C-60
131.6 5.18
50.8
2.00
15.7
0.62
25.4
1.00
61.7
2.43
12.7
0.50
34.8
1.37
5.3
0.21
SV6Y-9C-60
142.7 5.62
66.5
2.62
25.4
1.00
36.1
1.43
72.9
2.87
12.7
0.50
34.8
1.37
5.3
0.21
E-50
Catalogue 4462 Global Edition
E
Connectors & Adapters – Valves
Up to 60,000 psi
AV6Y – Two way angle valves
High Pressure (H.P.) – 60,000 psi
Orifice
K
J
1/4" H.P.
mm
1.5
inch
0.06
mm
25.4
inch
1.00
MPa
413.7
psi
60,000
AV6Y-6C-60
3/8" H.P.
1.5
0.06
25.4
1.00
413.7
60,000
AV6Y-9C-60
9/16" H.P.
1.5
0.06
38.1
1.50
413.7
60,000
AV6Y-4C-60
D
L
H
G
F
D
E
F
G
H
J
K
L
AV6Y-4C-60
mm inch mm inch mm inch mm inch mm inch mm inch mm inch mm inch
131.6 5.18 50.8 2.00 25.4 1.00 25.4 1.00 61.7 2.43 12.7 0.50 34.8 1.37 5.3 0.21
AV6Y-6C-60
141.2 5.56
50.8
2.00
25.4
1.00
34.8
1.37
71.4
2.81
12.7
0.50
34.8
1.37
5.3
0.21
AV6Y-9C-60
141.7 5.62
66.5
2.62
33.3
1.31
36.3
1.43
72.9
2.87
12.7
0.50
34.8
1.37
5.3
0.21
E-51
Catalogue 4462 Global Edition
Adapters & Valves
E
Connectors & Adapters – Valves
Up to 60,000 psi
TV26Y – Three way valves
High Pressure (H.P.) – 60,000 psi
Two pressure connections
Orifice
K
1/4" H.P.
mm
1.5
inch
0.06
mm
25.4
inch
1.00
MPa
413.7
psi
60,000
TV26Y-6C-60
3/8" H.P.
1.5
0.06
25.4
1.00
413.7
60,000
TV26Y-9C-60
9/16" H.P.
1.5
0.06
38.1
1.50
413.7
60,000
TV26Y-4C-60
J
D L
H
G
F
Adapters & Valves
E
D
E
F
G
H
J
K
L
TV26Y-4C-60
mm inch mm inch mm inch mm inch mm inch mm inch mm inch mm inch
131.6 5.18 50.8 2.00 15.7 0.62 25.4 1.00 61.7 2.43 12.7 0.50 34.8 1.37 5.3 0.21
TV26Y-6C-60
141.6 5.56
50.8
2.00
25.4
1.00
34.8
1.37
71.4
2.81
12.7
0.50
34.8
1.37
5.3
0.21
TV26Y-9C-60
153.9 6.06
66.5
2.62
36.3
1.43
47.5
1.87
84.1
3.31
12.7
0.50
34.8
1.37
5.3
0.21
E-52
Catalogue 4462 Global Edition
E
Connectors & Adapters – Valves
Up to 60,000 psi
TV16Y – Three way valves
High Pressure (H.P.) – 60,000 psi
One pressure connection
Orifice
K
1/4" H.P.
mm
1.5
inch
0.06
mm
25.4
inch
1.00
MPa
413.7
psi
60,000
TV16Y-6C-60
3/8" H.P.
1.5
0.06
25.4
1.00
413.7
60,000
TV16Y-9C-60
9/16" H.P.
1.5
0.06
38.1
1.50
413.7
60,000
TV16Y-4C-60
D
J
L
G
F
D
E
F
G
H
J
K
L
TV16Y-4C-60
mm inch mm inch mm inch mm inch mm inch mm inch mm inch mm inch
131.6 5.18 50.8 2.00 25.4 1.00 25.4 1.00 61.7 2.43 12.7 0.50 34.8 1.37 5.3 0.21
TV16Y-6C-60
141.6 5.56
50.8
2.00
50.8
2.00
36.3
1.43
71.4
2.81
12.7
0.50
34.8
1.37
5.3
0.21
TV16Y-9C-60
142.7 5.62
66.5
2.62
55.4
2.18
36.3
1.43
72.9
2.87
12.7
0.50
34.8
1.37
5.3
0.21
E-53
Catalogue 4462 Global Edition
Adapters & Valves
E
Connectors & Adapters – Valves
Up to 60,000 psi
CV6Y – Ball check valves
A
High Pressure (H.P.)
H
Orifice
1/4" H.P.
mm inch
106.2 4.18
mm
38.1
inch
1.50
MPa
413.7
psi
60,000
CV6Y-6C-60
3/8" H.P.
108.0
4.25
38.1
1.50
413.7
60,000
CV6Y-9C-60
9/16" H.P.
117.3
4.62
39.6
1.56
413.7
60,000
Adapters & Valves
CV6Y-4C-60
E-54
Catalogue 4462 Global Edition
F
Accessories
Table of contents
Chapter F
Accessories
Accessories
Heavy duty abrasion cover ....................................................................F-2
Heavy duty abrasion cover sleeves .......................................................F-2
Spring guards .........................................................................................F-3
Support grips .........................................................................................F-3
PVC-S – Anti-abrasion sleeve ................................................................F-4
HS - Containment grips .........................................................................F-4
UHPLABEL – Precautions for ultra-high pressure applications .............F-4
F-1
Catalogue 4462 Global Edition
Accessories
Accessories
Heavy duty abrasion cover
Description
MHDC010
5/8“ I.D. Clear Vinyl
MHDC011
5/8“ I.D. Clear Vinyl with white Helix reinforcement
MHDC012
3/4“ I.D. Clear Vinyl with white Helix reinforcement
MHDC014
7/8“ I.D. Clear Vinyl with white Helix reinforcement
MHDC016
1“ I.D. Clear Vinyl with white Helix reinforcement
MHDC018
1-1/8“ I.D. Clear Vinyl with white Helix reinforcement
MHDC020
1-1/4“ I.D. Clear Vinyl with white Helix reinforcement
MHDC022
1-3/8“ I.D. Clear Vinyl with white Helix reinforcement
MHDC024
1-1/2“ I.D. Clear Vinyl with white Helix reinforcement
MHDC026
1-5/8“ I.D. Clear Vinyl with white Helix reinforcement
MHDC032
2“ I.D. Clear Vinyl with white Helix reinforcement
Accessories
Heavy duty abrasion cover sleeves
Description
508-J-500-10
MHDC010, MHDC011
510-A-500-12
MHDC012
612-400-14
MHDC014
216-200-18
MHDC016, MHDC018
620-100-18
MHDC018 (w/2640N-08 hose)
220-200-22
MHDC022, MHDC024
520-A-500-26
MHDC026
F-2
Catalogue 4462 Global Edition
F
Accessories
Accessories
Spring guards
Description
MSG060
0.60“ I.D. Continuous Spring
MSG1006
For 2040N-04V00 Hose
MSG2006
For 2245N-04V00 Hose
MSG2106
For 2380N-04v00 Hose
MSG4113
For -8 Hoses
MSG4120
For 2440n-12V37 Hose
MSG4125
For 2440N-16V37 Hose
MSG6020
For 2640N-12v32 Hose
Accessories
Support grips
Description
MK022-03-038
For Hose O.D. 0.63“ - 0.74“
MK022-03-039
For Hose O.D. 0.75“ - 0.99“
MK022-03-041
For Hose O.D. 1.00“ - 1.24“
MK022-03-042
For Hose O.D. 1.25“ - 1.49“
MK022-03-043
For Hose O.D. 1.50“ - 1.74“
MK022-03-045
For Hose O.D. 2.25“ - 2.49“
F-3
Catalogue 4462 Global Edition
Accessories
Accessories
PVC-S - Anti-abrasion sleeve
COLOUR
NOTE
Yellow
As an alternative, rubber anti-abrasion sleeves are available
For hose
Protective sleeve
PVC-S-03
Clamp ferrule
KL-03
Diameter in mm
DN
size
mm
inch
d1
d2
5
-03
4.8
3/16
22
28
Hose type
Mountable
Length
in m
2640D-03
20/40
l1
PVC-S-05
KL-05
8
-05
7.9
5/16
27
33
2640D-05
20/40
PVC-S-08
KL-08
12
-08
12.7
1/2
35
45
2640N-08
20
PVC-S-12
KL-12
20
-12
19.0
3/4
40
50
2640N-12
20
PVC-S-16
KL-16
25
-16
25.4
1
55
65
2640N-16
20
HS - Containment grips
MATERIAL
NOTE
electrogalvanized steel wire
*F-KN 3/9: working load 3 KN, breaking load 9 KN, e.g. DN5
For hose
Protective sleeve
Length
of Loops
in mm
DN
size
mm
inch
Ø mm
F-KN*
l1
l2
5
-03
4.8
3/16
9-15
3/9
600
200
HS-05
8
-05
7.9
5/16
15-20
6/18
600
200
HS-08
12
-08
12.7
1/2
20-30
11/33
600
200
HS-12
20
-12
19.0
3/4
30-40
11/33
600
200
HS-16
25
-16
25.4
1
40-50
16/48
600
200
HS-03
Accessories
Total Length
UHPLABEL – Precautions for
ultra-high pressure applications
MATERIAL
Achtung Höchstdruck !
Verletzungsgefahr durch unsachgemäße Handhabung !
Vor Inbetriebnahme bitte Schlauchleitung visuell prüfen
sowie Benutzerhinweise beachten.
Attention High Pressure !
Danger of injury by inappropriate handling!
Prior to use please inspect hose assembly visually
and pay attention to the handling instructions.
polyflex®
+49 (0)6256 81 0
+49 (0)6256 81 100
E-Mail: polyflextechnical@parker.com
self-adhesive PE sticker
Dimensions
UHPLABEL
60 x 250 mm
F-4
Catalogue 4462 Global Edition
G
Technical information
Table of contents
Chapter G
Technical information
Technical information
Installation tips ......................................................................................G-2
Selection, installation, and maintenance of polyflex hose
and hose assemblies ............................................................................G-3
Dash sizes .............................................................................................G-4
Selection of hose diameter from flow rate and velocity ........................G-5
Pressure drop ........................................................................................G-6
Glossary ..............................................................................................G-11
Permeability coefficient .......................................................................G-12
Recommended tightening procedures................................................G-13
Metric conversion chart ......................................................................G-14
General chemical resistance table ......................................................G-15
Parker Safety Guide ............................................................................G-20
G-1
Catalogue 4462 Global Edition
Technical information
Installation tips
Installation tips
right
wrong
wrong
right
Hose is weakened when installed in twisted position. Also, pressure pulses in twisted hose tend to
fatigue wire and loosen fitting connections. Design
so that machine motion produces bending rather
than torsion.
Hose should exit coupling in a straight position
rather than side loaded. The minimum bend radius
must not be exceeded to avoid kinking of hose
and flow restriction.
wrong
right
right
Technical information
wrong
When hose assembly is installed in a flexing applica- Use elbows or adaptors as necessary to eliminate
tion, remember that metal hose fittings are not part
excess hose length and to ensure neater installatiof the flexible portion.
on and easier maintenance.
Free hose length allowance:
right
wrong
wrong
right
Pressure can change hose in length by as much as
±2%. This must be considered when cutting hose to
appropriate length.
G-2
Avoid installing hose assemblies close to heat
sources. However, if this should be required,
insulate hose.
Catalogue 4462 Global Edition
G
Technical information
Selection, installation, and maintenance of polyflex hose and hose assemblies
Selection, installation, and maintenance of polyflex hose and
hose assemblies
Hose and hose assemblies have a finite life span and many factors can reduce this time. This recommended practice should be read by designers and users of hose to assist them in the proper selection of hose.
These guidelines, while not exhaustive, will assist the user in maintaining hydraulic and pneumatic systems.
PART 1 - How to select hose
• Pressure - Maximum operating pressure of the
hose must be greater than or equal to the system pressure. Pressure surges or system “spikes” in excess of the maximum operating pressure will shorten hose life and must be avoided.
• Temperature - Ambient and fluid temperatures
must not exceed the hose/fittings rated design
temperature. Attempt to route hose or shield
hose from high temperature sources.
• Size - Adequately size hose and fittings to avoid
damaging hose with excessive turbulence, or
heat build-up, while maintaining proper flow and
pressure. (Refer to fluid velocity nomogram.)
• Fluid Compatibility - Refer to Chemical Compatibility Guide in this catalog for use of fluids
with various materials. If unsure of an application, contact the factory. Additional care must be
taken with gaseous applications.
• Environment- Conditions such as ozone, UV
light, harsh chemicals, salt water, and other airborne contaminants can degrade hose and
shorten its life.
• Length - Hose length changes with pressure.
This, along with equipment movement, must be
considered in the system design.
• Proper couplings - Always follow manufacturers specifications and do not mix components
of different manufacturers.
• Mechanical loads - Conditions such as tensile
and side loads, vibration, excessive flexing, and
twist will reduce hose life. Use swivel fittings and
adaptors to avoid hose twisting. Test the hose if
the application is potentially problematic or unusual.
• Electrical conductivity - Determine if the hose
must be non-conductive to prevent electrical
current flow or conductive to dissipate static
electricity. Choose hose and fittings accordingly.
PART 2 - Installation and maintenance
• Inspect components - Check hose for cover cracks, blisters, cleanliness, kinks, cracks
or core tube obstructions or other defects. Examine fittings for poor threads, obstructions,
cracks, rust. Do not use hose or fittings if these
problems exist.
• Assemble per instructions - Instructions are
available for companies, trained and authorized
by Polyflex.
• Do not exceed specified minimum bend radius - Use stress relievers to prevent sharp bends
at the hose and fitting juncture. These can be
spring guards or other stress relieving members.
• Ensure that hose bends rather than twists
with equipment motion.
• Use a torque wrench or the flats from finger tight
method to properly install port connections.
• After installation, eliminate air entrapped
In system, pressurise to maximum operating pressure, and check for leaks and proper
system function.
• After installation, periodically (frequency depends on severity of application and potential
risk) inspect the system for the following:
1. Blistered, degraded, or loose hose covers.
2. Stiff, cracked, or charred hose.
3. Cuts or abrasion of hose. Look for exposed
reinforcement.
4. Leaks in hose or fittings.
5. Damaged or corroded fittings.
6. Excessive build up of dirt, grease, oils, etc.
7. Defective or broken accessories (clamping
devices, kink guards)
8. Kinks in hoses.
Upon discovery of any of these items, replace it,
repair it, but DO NOT IGNORE IT!
• Retest the system after all maintenance procedures.
• Establish replacement schedules based on previous service life, or when failures could result in
damage, personal injury, excessive or unacceptable downtime.
G-3
Catalogue 4462 Global Edition
Technical information
READ THE PARKER SAFETY GUIDE CONTAINED IN THIS CATALOGUE IN ITS ENTIRETY.
Technical information
Dash sizes
Dash sizes
Dash sizes are commonly used to designate hose I. D., plastic tubing and metal tubing O. D. and coupling
size. Dash size systems in common use:
Nominal hose I.D.
or tubing O.D.
Inches
Dash number
for all polyflex
hose
Nominal
DN size
Millimeters
3/32
2.0
-012
2
1/8
3.2
-2
3
5/32
4.0
-025 or 2A
4
3/16
4.8
-3
5
1/4
6.3
-4
6
5/16
7.9
-5
8
10
3/8
9.5
-6
13/32
10.3
-6.5
–
1/2
12.7
-8
12
15.9
-10
16
19.1
-12
20
7/8
22.2
-14
–
1
25.4
-16
25
1-1/8
28.6
–
–
1-1/4
31.8
-20
32
1-3/8
34.9
–
–
1-1/2
38.1
-24
40
1-13/16
46.0
–
–
2
50.8
-32
50
Technical information
5/8
3/4
G-4
Catalogue 4462 Global Edition
G
Technical information
Selection of hose diameter from flow rate and velocity
Selection of hose diameter from flow rate and velocity
Volumetric flow Q
(l/min)
Gal/min*
Flow capacities of Parker hose at recommended flow velocities
The chart below is provided as an aid in the determination of the correct hose size.
Suitable for hydraulic applications.
Example:
at 10 gallons per minute (gal/min), what is the proper hose size within the recommended velocity range for pressure lines?
Locate 10 gallons per minute in the left-hand column and 25 feet per second in the
right-hand column (the maximum recommended velocity range for pressure lines).
Lay a straight line across these two points. The inside diameter shown in the centre
column is above -6 so we have to use -8 (1/2“).
For suction hose, follow the same procedure except use recommended velocity
range for intake lines in the right-hand column.
where:
Q
V
d
=
=
=
flow in gallons per minute (gal/min & l/min)
velocity in feet per second (f/s & m/s)
hose inside diameter (mm & dash size)
Hose inner diameter d
mm
dash
sizes
Flow velocity v
(m/s)
feet/s
Recommended
maximum velocity
for return lines
Recommended
maximum velocity
for pressure lines
* gallons are UK gallons
Conversion factors: gal/min x 4.546 = l/min
feet/s x 0.3948 = m/s
* Recommended velocities are according to hydraulic fluids of maximum viscosity 315 S.S.U. at 38 °C working at roomtemperature within 18 ° and 68 °C.
G-5
Catalogue 4462 Global Edition
Technical information
Recommended
maximum velocity
for suction lines
Technical information
Pressure drop
Pressure drop
For size -02 (3 mm) hoses
åMMåHOSEåPRESSUREåDROP
0RESSUREåDROPå-0Aå;PSI=
å;=
å;=
å;=
g
å;=
g
å;=
g
å;=
å;=
å;=
&LOW RATE LMINå;GPM=
å;=
å;=
For size -025 (4 mm) hoses
åMMåHOSEåPRESSUREåDROP
å;=
0RESSUREåDROPå-0Aå;PSI=
Technical information
å;=
å;=
g
å;=
å;=
å;=
g
å;=
g
å;=
å;=
å;=
å;=
å;=
&LOW RATE LMINå;GPM=
å;=
å;=
Results obtained from actual pressure drop tests, pumping water through hose assemblies with normal end fittings.
G-6
Catalogue 4462 Global Edition
G
Technical information
Pressure drop
For size -03 (5 mm) hoses
åMMåHOSEåPRESSUREåDROP
å;=
0RESSUREåDROPå-0Aå;PSI=
å;=
å;=
å;=
100'
å;=
å;=
å;=
50'
å;=
25'
å;=
å;=
å;=
å;=
å;=
å;=
å;=
&LOW RATE LMINå;GPM=
å;=
å;=
For Hose:
2840D-03
$åHOSEåPRESSUREåDROP
å;=
å;=
å;=
å;=
100'
å;=
50'
25'
å;=
å;=
å;=
å;=
å;=
å;=
&LOW RATE LMINå;GPM=
å;=
å;=
Results obtained from actual pressure drop tests, pumping water through hose assemblies with normal end fittings.
G-7
Catalogue 4462 Global Edition
Technical information
0RESSUREåDROPå-0Aå;PSI=
å;=
Technical information
Pressure drop
For size -04 (6 mm) hoses
åMMåHOSEåPRESSUREåDROP
å;=
0RESSUREåDROPå-0Aå;PSI=
å;=
å;=
å;=
å;=
å;=
100'
å;=
å;=
50'
å;=
25'
å;=
å;=
å;=
å;=
&LOW RATE LMINå;GPM=
å;=
For size -05 (8 mm) hoses
åMMåHOSEåPRESSUREåDROP
å;=
0RESSUREåDROPå-0Aå;PSI=
Technical information
å;=
å;=
å;=
100'
å;=
50'
å;=
25'
å;=
å;=
å;=
å;=
å;=
å;=
&LOW RATE LMINå;GPM=
å;=
å;=
Results obtained from actual pressure drop tests, pumping water through hose assemblies with normal end fittings.
G-8
Catalogue 4462 Global Edition
G
Technical information
Pressure drop
For size -06 (10 mm) hoses
åMMåHOSEåPRESSUREåDROP
å;=
0RESSUREåDROPå-0Aå;PSI=
å;=
å;=
100'
å;=
å;=
50'
å;=
25'
å;=
å;=
å;=
å;=
å;=
å;=
å;=
&LOW RATE LMINå;GPM=
å;=
å;=
å;=
For size -08 (13 mm) hoses
åMMåHOSEåPRESSUREåDROP
å;=
å;=
å;=
å;=
å;=
100'
å;=
å;=
50'
25'
å;=
å;=
å;=
å;=
å;=
å;= å;= å;=
&LOW RATE LMINå;GPM=
å;= å;= å;=
Results obtained from actual pressure drop tests, pumping water through hose assemblies with normal end fittings.
G-9
Catalogue 4462 Global Edition
Technical information
0RESSUREåDROPå-0Aå;PSI=
å;=
Technical information
Pressure drop
For size -12 (20 mm) hoses
åMMåHOSEåPRESSUREåDROP
å;=
0RESSUREåDROPå-0Aå;PSI=
å;=
å;=
200'
å;=
å;=
å;=
å;=
100'
å;=
50'
25'
å;=
å;=
å;= å;=
å;=
å;= å;= å;= å;= å;= å;=
&LOW RATE LMINå;GPM=
For size -16 (25 mm) hoses
åMMåHOSEåPRESSUREåDROP
å;=
0RESSUREåDROPå-0Aå;PSI=
Technical information
å;=
200'
å;=
å;=
å;=
å;=
100'
å;=
50'
25'
å;=
å;=
å;=
å;=
å;=
å;=
å;= å;= å;=
&LOW RATE LMINå;GPM=
å;= å;=
Results obtained from actual pressure drop tests, pumping water through hose assemblies with normal end fittings.
G-10
Catalogue 4462 Global Edition
G
Technical information
Glossary
Glossary
Abrasion
mum rated burst pressure, except as otherwise
specifically stated in those product specifications.
For more severe service, a higher rated working
pressure hose may have to be selected.
Abrasion occurs in numerous forms; two of the
more common are the typical rubbing or chafing,
with the second being very high frequency, low
amplitude friction. This type of abrasion results
from pump pressure pulses otherwise known as
pump ripple. It can also be caused by equipment
vibration or resonance. Abrasion may occur when
two hose lines cross or when a hose line rubs or
bears against a fixed point. Abrasion resistance is
also a function of temperature and attack of the
cover material by aggressive chemicals.
Spring guards or other protective sleeving can
also ward off premature hose failure resulting from
abrasion. Spring guards also distribute bending
force often associated with excessive side loading
or even kinking at the skirt of the coupling.
Hose installation tips
Establish hose size (I. D.) and style based upon
flow rate (GPM), pressure drop, and chemical
compatibility with fluid medium. Other significant
factors to be considered in hose selection and
installation are discussed briefly as follows:
Operating temperature
Exceedingly high or low ambient temperatures
will affect the materials from which the hose is
constructed and will negatively influence hose life.
When at all possible, the hose should be routed in
such a manner as to protect it from heat sources.
In extreme cold applications, the equipment
should be designed with remote relief valves to allow circulation and warming of the oil before hose
articulation is attempted. The hose liner (core tube)
of choice for extremely high or low temperature is
Teflon®. Teflon® is serviceable at temperatures
as low as -100°F and as high as +450°. Consult
the specific hose operating parameters for more
information.
Pressure effects
Pressure surges and system shocks (spikes)
are common in hydraulic systems. The normal
4:1 design factor should reflect these transient
pressures. Where these surges and shocks are
considered severe or hazardous, the design factor
should be increased.
When hose is under pressure, it may change in
length by as much as ±3%. Installation should
compensate for shortening by providing an appropriate amount of slack and for lengthening by
allowing space for this growth to be absorbed.
Bend radius
Routing and clamping
The minimum bend radii listed in this catalog are
valid at rated working pressures and indicated
service temperatures. Service life of a hose may
be shortened if the minimum radius is exceeded or
if the hose is flexed continuously in use.
Burst pressure and working pressure
The specified burst pressure for each hose style
and dash size are for unaged hoses tested at
normal laboratory temperature in accordance
with SAE J343 specification for normal service
and technically ideal installations. The maximum
recommended working pressure is 1/4 of the mini-
Whenever possible, and maximum efforts should
be made to do so, hose should be routed to flex
in a single plane. Routing hoses in flexure through
compound bends results in torsions. When this
is unavoidable, the torsion should be distributed
over the maximum hose length possible. Wire reinforced hoses suffer the most rapid and severe loss
of service life when applied in torsion. Extremely
tight and improperly located clamps focus this
torsion over short distances.
Analysis of the hose function is required before
G-11
Catalogue 4462 Global Edition
Technical information
Ambient temperature
The temperature range for satisfactory service
(maximum hose life) depends to a great extent
upon the fluid being conveyed. Use of a hose
above maximum specified temperature ratings will
shorten hose life due, but not limited, to oxidation,
chemical degradation and loss of compression
within the coupling.
Technical information
Glossary
the proper clamping techniques can be selected.
In some applications, hoses must be contained to
stay out of harm's way and at the same time be
free to come and go with equipment articulation.
Other applications may require restrictive clamping, in which case a protective material should be
used around the hose to provide the grasp without
deformation of the hose by the clamp. These
techniques also apply to the use of the popular
method of clamping and clustering hoses with
plastic tie straps.
Parker swivel adaptors feature 360° swiveling
action that especially suits them for use in applications where hose moves, bends or twists.
Swivel adapters connected to hose assemblies
relieve twisting, prevent excessive flexing of hose,
eliminate need for long radius bends, and cushion
intraline shock caused by peak system pressure
pulses.
Technical information
High pressure adapters
It is critical that the adapter material be properly suited to the fluid media. Widely varying
conditions frequently necessitate high pressure
adapters constructed of materials other than
conventional 316 stainless steel. Since many
variables affect the corrosion resistance of metallic materials, it is Parker Hannifin’s policy not to
recommend materials based on corrosion resistance for specific fluid applications. The published
recommended working pressure represent the
capability of the subject fitting. Nevertheless, in
some instances, the hose, hose fitting or other
connector assembled to the adapter may dictate
the maximum working pressure. The end-user
should read and understand the Parker Safety
Guide (Bulletin 4400-B.1) and follow its suggested
practices and warnings.
G-12
Catalogue 4462 Global Edition
G
Technical information
Permeability coefficient
Permeability coefficient
Permeability Coefficient =
Where:
V
A
T
p
V
AxTxp
is the volume of gas, in cm3, which diffuses through a 1mm thickness.
is the area across which the gas diffuses, in m2.
is the diffusion time, in days.
is the pressure difference across the plastic, in bar.
Permeability Coefficients per DIN 53380
Gas
N2
O2
CO2
PTFE
50
150
1500
PVDF
3
2
10
—
60
PA-6 XE 3289
1
4
10
100*
60*
PA-6 A 28 NZ
0.5
2
5
50*
30*
PA-12 L 2124
—
30
180
210
160
PA-12 P40 TL
—
—
105
—
—
8
35
150
1000*
500*
PA-12 L 2140
—
12
71
—
130
PA-11 P 40 TL
—
—
55
130
—
PA-11 POTL
2
20
65
65
—
POM H 2320
5
10
130
35
40
POM 150 SA
2
4
20
—
—
PEE 4055
150
—
3000
—
1400
PEE 5556
120
—
1600
—
900
PEE 7246
—
—
—
—
300
PA-12 L 25W40
H2
—
He
3500
* Calculated value. Diffusion constants based on normal room temperature. Actual behavior may vary
considerably because of variations in processing the plastic.
G-13
Catalogue 4462 Global Edition
Technical information
Material
Technical information
Recommended tightening procedures
Recommended tightening procedures
Connection
High Pressure
1/4"
3/8"
9/16"
9/16" - 18
3/4" - 16
1-1/8" - 12
25
50
75
34
69
103
Medium Pressure
1/4"
3/8"
9/16"
3/4"
1"
7/16" - 20
9/16" - 18
13/16" - 16
3/4" NPSM
1-3/8" - 12
20
30
85
90
125
28
41
117
124
173
Type “M” Swivel
A9
A12
A14
A16
A21
9/16" - 18
3/4" - 16
7/8" - 14
1" - 12
1-5/16 - 12
25-30
40-50
50-60
75-85
100-120
34-41
55-69
69-83
103-117
138-166
Fitting
swivel nut
Technical information
Tightening torque
ft•lb
N•m
Thread sizes
Weep hole
Adapter
cone surface
Fitting nipple
cone surface
Leakage at swivel nut-to-adapter Joint
(Seen by leak at weep hole in swivel nut)
1. Reduce system pressure to zero
2. Unscrew swivel nut and check cone surfaces of
adapter and hose insert.
3. If hose insert is damaged, return hose to
polyflex for repair and retest.
4. If cone surfaces look good after cleaning,
re-tighten swivel nut. Do not exceed 150%
of recommended torque.
Your
equipment
port
Adapter
cone surface
Adapter
Leakage at type “M” adapter-to-port
(Seen by leak at weep hole in pressure port,or leak
at threads for NPT adapters.)
1. Reduce system pressure to zero.
2. Slacken hose swivel nut.
3. Tighten adaptor into port.
4. Re-tighten swivel nut.
Never use the swivel nut to tighten the adapter
into the port.
G-14
Catalogue 4462 Global Edition
G
Technical information
Metric conversion chart
Metric conversion chart
Multiply
645.16
sq. in. (in2)
sq. cm (cm2)
6.4516
sq. ft. (ft2)
sq. meters (m2)
0.0929
Density
pounds/cubic foot (lb/ft3)
Kilograms/cubic
meter
(kg/m3)
Energy
British Thermal Units (Btu)
(1 J = Ws = 0.2388 cal)
Force
Area
Length
Mass
(Weight)
Power
Metric to English
To
sq. in. (in 2)
0.00155
16.02
Kilograms/cubic
meter
(kg/m3)
pounds/cubic foot (lb/ft3)
0.0624
joules (J)
1055
joules (J)
British Thermal Units (Btu)
0.000947
pounds - force (lbf)
(1N = 0.102 kgf)
newtons (N)
4.448
newtons (N)
pounds - force (lbf)
inches (in)
millimeters (mm)
25.4
millimeters (mm)
inches (in)
0.2248
0.03937
feet ( ft)
meters ( m)
0.3048
meters ( m)
feet ( ft)
miles (mi)
kilometers (km)
1.609
kilometers (km)
miles (mi)
0.621
ounces (oz.)
grams (g)
28.35
grams (g)
ounces (oz.)
0.035
pounds - mass (lb)
kilograms (kg)
0.4536
kilograms (kg)
pounds - mass (lb)
short tons (2000 lb) (tn)
metric tons (1000 kg)
0.9072
metric tons (1000 kg) short tons (2000 lb) (tn)
1.102
0.7457
kilowatts (kW)
1.341
0.0703
kilograms (f)/square
cm
pounds/square inch (psi)
(kg(f)/cm2)
horsepower (550 ft. lb/s) (hp) kilowatts (kW)
pounds/square inch (psi)
kilograms (f)/square
cm
(kg(f)/cm2)
3.281
horsepower (550 ft. lb/s) (hp)
2.205
14.22
kilopascals (kPa)
pounds/square inch (psi)
0.145
bars (100 kPa)
pounds/square inch (psi)
14.503
megapascals (MPa)
0.006895 megapascals (MPa) pounds/square inch (psi)
145.039
degrees Celsius (°C)
5/9 (after
subtracting degrees Celsius (°C) degrees Fahrenheit (°F)
32)
9/5 (then
add 32)
pounds/square inch (psi)
kilopascals (kPa)
pounds/square inch (psi)
bars (100 kPa)
0.06895
pounds/square inch (psi)
(1N/mm2 = 1MPa)
Temperaturedegrees Fahrenheit (°F)
6.8948
Torque or
Bending
Moment
pounds-force-foot (lb-ft)
Newtons-meter (Nm)
1.3567
Newtons-meter (Nm) pounds-force-foot (lb-ft)
pounds-force-inch (lb-in)
Newtons-meter (Nm)
0.113
Newtons-meter (Nm) pounds-force-inch (lb-in)
Velocity
feet/seconds (ft/s)
meters/second (m/S)
0.3048
meters/second (m/S) feet/seconds (ft/s)
Viscosity
Multiply
sq. mm (mm2)
Pressure
Stress
To Convert From
0.737
8.85
3.2808
dynamic (centipoise)
Pascal-second (Pas)
0.001
Pascal-second (Pas) dynamic (centipoise)
kenematic-foot2/sec (ft2/s)
0.0929
16.3871
quarts (qt)
meter2/sec (m2/s)
cubic centimeter
(cm3)
(milliliter)
liters (1000 cm3)
0.9464
meter2/sec (m2/s)
cubic centimeter
(cm3)
(milliliter)
liters (1000 cm3)
quarts (qt)
1.057
gallons (gal)
liters
3.7854
liters
gallons (gal)
0.2642
cubic inch (in3)
Volume
G-15
kenematic-foot2/sec (ft2/s)
cubic inch (in3)
1000
10.7643
0.061
Catalogue 4462 Global Edition
Technical information
English to Metric
To Convert From
To
sq. mm (mm2)
sq. in. (in2)
Technical information
General chemical resistance table
General chemical resistance table
Ratings code
G – Good to excellent. Little or no swelling, tensile or surface changes. Preferred choice.
L – Marginal or conditional. Noticeable effects but not necessarily indicating lack of
serviceability. Further testing suggested for specific application. Very long-term effects
such as stiffening or potential for crazing should be evaluated.
P – Poor or unsatisfactory. Not recommended without extensive and realistic testing.
— – Indicates that this was not tested.
Materials code for hose core tubes
N
M
Polyamide
Coextruded tube with Fluorpolymer inner liner
Materials code for hose cover
N
Polyamide
U/HF Polyurethane
Technical information
Notes on the chemical resistance table
(1) The fluid resistance tables are simplified rating tabulations based on immersion tests at 24°
C. Higher temperatures tend to reduce ratings. Since final selection depends on pressure,
fluid and ambient temperature and other factors not known to Parker Hannifin , no performance guarantee is expressed or implied. The indications do not imply any compliance with
standards and regulations and do not refer to possible changes of colour, taste or smell. For
food and drinking water specially approved materials have to be used. For fluids not listed
or for advice on particular applications, please consult Parker Hannifin GmbH, polyflex
Division in Hüttenfeld, Germany.
(2) Hose applications for these fluids must take into account legal and insurance regulations.
The chemical resistance indicated does not express or imply approval by certain institutions.
(3) Satisfactory at some concentrations and temperatures, unsatisfactory at others.
(4) For gas applications, the cover should be pin-pricked and the pressure must not be released
quickly. Special safety guard accessories are to be used to prevent damage or personal
injury in the event of failure..
(5) Chemical resistance does not imply low permeation rates. Please consult Parker Hannifin for
a recommendation for your specific requirements.
(6) The indication of chemical resistance does not imply any special food compatibility; it refers
only to the chemical resistance of the material.
(7) Chemical resistance does not imply acceptability for use in airless paintspray applications.
These applications require a special, electrically conductive hose.
Not all remarks may apply to Oil&Gas products
G-16
Catalogue 4462 Global Edition
G
Technical information
General chemical resistance table
N
U/HF
M
Acetone
G
P
L
Acetylene
--
--
--
Air (4)
G
G
G
Ammonium Chloride
P
G
G
Ammonium Hydroxyde
G
P
G
Anhydrous Ammonia
P
P
--
Aniline
P
P
G
Aromatic Hydrocarbons
G
L
--
Asphalt
G
G
L
Benzene
G
L
G
Butane (2) (4)
G
L
--
Calcium Chloride
--
G
G
Carbon Dioxide (4)
G
G
--
Carbon Monoxide (4)
--
G
--
Carbon Tetrachloride
G
P
G
Chlorinated Hydrocarbon Base Fluids
G
L
--
Chlorinated Petroleum Oil
G
L
--
Chlorinated Solvents
--
P
---
Chlorine, Gaseous, Dry
P
P
Chromic Acid
--
P
L
Citric Acid Solutions
G
L
G
Crude Petroleum Oil
G
G
--
Cyclohexan (2)
G
G
G
Diesel Fuel (2)
G
G
--
Diester Oils
G
P
--
Ethanol (6)
G
L
--
Ethers
G
P
G
Ethylene Glycol
G
L
G
Ethylene Oxide
G
L
--
Fatty Acids
G
--
G
Formaldehyde
L
P
G
Formic Acid J
P
P
G
Fuel Oil (2)
G
L
G
Gas (Oil) (2)
G
G
Gasoline
G
--
G
Glycerine
G
L
G
G-17
Catalogue 4462 Global Edition
Technical information
Chemical
Technical information
Technical information
General chemical resistance table
Chemical
N
U/HF
M
Glycols (to 135 °F)
G
L
G
Grease (petroleum base)
G
G
-G
Hexane (2)
G
G
Hydraulic Fluid (petroleum base)
G
G
L
Hydraulic Fluid phosphate ester base)
G
L
---
Hydraulic Fluid water base)
G
G
Hydraulic oil (petroleum base)
G
G
L
Hydrochloric Acid
L
P
G
Hydrofluoric Acid
P
P
G
Hydrolube (hydraulic fluid/water glycol base)
G
L
--
IRUS 902 (hydraulic fluid/water-oil emulsion)
G
G
--
Isooctane (2)
G
G
G
Kerosene (2)
G
L
G
Ketones
G
P
G
Lime (calcium oxide)
G
G
G
Lindol (hydraulic fluid/phosphate esters)
G
P
--
LP-Gas
--
--
--
Lubricating Oils (diester base)
G
P
--
Lubricating Oils (petroleum base)
G
G
G
Methane
--
--
--
Methanol
G
P
--
Methyl Alcohol (6)
G
P
G
Methyl Ethyl Ketone (MEK)
G
P
G
Methyl Ethyl Ketone Peroxide (MEKP)
L
P
--
Methyl Isobutyl Ketone (MIBK)
G
P
G
Methylen Chloride
L
P
G
Mineral Oil
G
G
G
Mineral Spirits
--
L
-G
Motor Oils
G
G
Naphta
G
P
G
Natural Gas (4)
--
--
--
Nitric Acid
P
P
L
Nitrobenzene
G
P
G
Nitrogen, Gaseous (4) (5)
G
G
G
Nitrous Oxide
L
--
--
Oil (SAE)
G
G
--
G-18
Catalogue 4462 Global Edition
G
Technical information
General chemical resistance table
N
U/HF
M
Oxygen, Gaseous (4) (5) (6)
G
G
G
Pentane (2)
G
L
G
Perchloric Acid
P
P
L
Petroleum Ether
--
--
--
Petroleum Oils
G
G
--
Phenols
P
P
--
Phosphate Esters (above 135 °F)
G
P
--
Phosphate Esters (to 135 °F)
G
P
--
Propane (4) (5)
--
--
--
Propylen Glycol
--
G
G
Salt Water
--
--
G
Silicone Greases
G
G
--
Silicone Oils
G
G
--
Sodium Borate
G
G
G
Sodium Carbonate
--
--
--
Sodium Chloride Solutions
G
G
G
Sodium Hydroxide, 50%
P
P
G
Sodium Hypochloride
P
P
G
Steam
P
P
G
Straight Synthetic Oils (phosphate esters)
G
P
--
Sulphur Dioxide
L
L
G
Sulphur Hexafluoride Gas (4) (5)
G
G
---
Sulphuric Acid
P
P
Toluol, Toluene
G
L
G
Trichlorethylene
L
P
G
Ucon (hydraulic fluid/water glycol base
G
L
--
Water (above 60 °C) (6)
G
P
L
Water (to 60 °C) (6)
G
G
G
--
Water Glycols (above 60 °C)
L
P
Water Glycols (to 60 °C)
G
L
--
Water in oil Emulsions (above 60 °C)
L
P
--
Water in oil Emulsions (to 60 °C)
G
L
--
Xylene
G
P
G
Zinc Chloride
G
G
G
G-19
Catalogue 4462 Global Edition
Technical information
Chemical
Technical information
Parker Safety Guide
Parker Safety Guide
For selecting and using Hose, Tubing, Fittings, and Related Accessories
! Parker Safety Guide for Selecting and Using Hose, Tubing, Fittings and Related Accessories
Publication No. 4400-B.1
Revised: November 2007
‡,QMHFWLRQVE\KLJKSUHVVXUHÀXLGGLVFKDUJH
‡'DQJHURXVO\ZKLSSLQJ+RVH
‡&RQWDFWZLWKFRQYH\HGÀXLGVWKDWPD\EHKRWFROGWR[LFRURWKHUZLVH
LQMXULRXV
‡6SDUNLQJRUH[SORVLRQFDXVHGE\VWDWLFHOHFWULFLW\EXLOGXSRURWKHU
VRXUFHVRIHOHFWULFLW\
‡6SDUNLQJRUH[SORVLRQZKLOHVSUD\LQJSDLQWRUÀDPPDEOHOLTXLGV
‡,QMXULHVUHVXOWLQJIURPLQKDODWLRQLQJHVWLRQRUH[SRVXUHWRÀXLGV
WARNING: Failure or improper selection or improper use of hose, tubing,
¿WWLQJVDVVHPEOLHVRUUHODWHGDFFHVVRULHV³3URGXFWV´FDQFDXVHGHDWK
SHUVRQDOLQMXU\DQGSURSHUW\GDPDJH3RVVLEOHFRQVHTXHQFHVRIIDLOXUHRULPSURSHUVHOHFWLRQRULPSURSHUXVHRIWKHVH3URGXFWVLQFOXGHEXWDUHQRWOLPLWHGWR
‡)LWWLQJVWKURZQRIIDWKLJKVSHHG
‡+LJKYHORFLW\ÀXLGGLVFKDUJH
‡([SORVLRQRUEXUQLQJRIWKHFRQYH\HGÀXLG
‡(OHFWURFXWLRQIURPKLJKYROWDJHHOHFWULFSRZHUOLQHV
‡&RQWDFWZLWKVXGGHQO\PRYLQJRUIDOOLQJREMHFWVWKDWDUHFRQWUROOHGE\
WKHFRQYH\HGÀXLG
%HIRUH VHOHFWLQJ RU XVLQJ DQ\ RI WKHVH 3URGXFWV LW LV LPSRUWDQW WKDW \RX
UHDGDQGIROORZWKHLQVWUXFWLRQVEHORZ2QO\+RVHIURP3DUNHU¶V6WUDWRÀH[
3URGXFWV'LYLVLRQLVDSSURYHGIRULQÀLJKWDHURVSDFHDSSOLFDWLRQV
1.0 GENERAL INSTRUCTIONS
6FRSH 7KLV VDIHW\ JXLGH SURYLGHV LQVWUXFWLRQV IRU VHOHFWLQJ DQG
XVLQJ LQFOXGLQJ DVVHPEOLQJ LQVWDOOLQJ DQG PDLQWDLQLQJ WKHVH 3URGXFWV
)RU FRQYHQLHQFH DOO UXEEHU DQGRU WKHUPRSODVWLF SURGXFWV FRPPRQO\
FDOOHG ³KRVH´ RU ³WXELQJ´ DUH FDOOHG ³+RVH´ LQ WKLV VDIHW\ JXLGH $OO DVVHPEOLHV PDGH ZLWK +RVH DUH FDOOHG ³+RVH$VVHPEOLHV´ $OO SURGXFWV
FRPPRQO\ FDOOHG ³¿WWLQJV´ ³FRXSOLQJV´ RU ³DGDSWHUV´ DUH FDOOHG ³)LWWLQJV´
$OO UHODWHG DFFHVVRULHV LQFOXGLQJ FULPSLQJ DQG VZDJLQJ PDFKLQHV DQG
WRROLQJ DUH FDOOHG ³5HODWHG$FFHVVRULHV´ 7KLV VDIHW\ JXLGH LV D VXSSOHPHQW WR DQG LV WR EH XVHG ZLWK WKH VSHFL¿F 3DUNHU SXEOLFDWLRQV IRU WKH
VSHFL¿F+RVH)LWWLQJVDQG5HODWHG$FFHVVRULHVWKDWDUHEHLQJFRQVLGHUHG
IRUXVH3DUNHUSXEOLFDWLRQVDUHDYDLODEOHDWZZZSDUNHUFRP6$(-
Z Z Z V D H R U J D Q G , 6 2 Z Z Z D Q V L R U J D O V R S U R YLGH UHFRPPHQGHG SUDFWLFHV IRU K\GUDXOLF +RVH $VVHPEOLHV
)DLO6DIH +RVH +RVH $VVHPEOLHV DQG )LWWLQJV FDQ DQG GR
IDLO ZLWKRXW ZDUQLQJ IRU PDQ\ UHDVRQV 'HVLJQ DOO V\VWHPV DQG
HTXLSPHQW LQ D IDLO VDIH PRGH VR WKDW IDLOXUH RI WKH +RVH +RVH
$ V V H P E O \ R U ) L W W L Q J Z L O O Q R W H Q G D Q J H U S H U V R Q V R U S U R S H U W \
Technical information
'LVWULEXWLRQ3URYLGHDFRS\RIWKLVVDIHW\JXLGHWRHDFKSHUVRQUHVSRQVLEOHIRUVHOHFWLQJRUXVLQJ+RVHDQG)LWWLQJSURGXFWV'RQRWVHOHFWRU
XVH3DUNHU+RVHRU)LWWLQJVZLWKRXWWKRURXJKO\UHDGLQJDQGXQGHUVWDQGLQJ
WKLVVDIHW\JXLGHDVZHOODVWKHVSHFL¿F3DUNHUSXEOLFDWLRQVIRUWKH3URGXFWV
8VHU5HVSRQVLELOLW\'XHWRWKHZLGHYDULHW\RIRSHUDWLQJFRQGLWLRQV
DQGDSSOLFDWLRQVIRU+RVHDQG)LWWLQJV3DUNHUGRHVQRWUHSUHVHQWRUZDUUDQW
WKDWDQ\SDUWLFXODU+RVHRU)LWWLQJLVVXLWDEOHIRUDQ\VSHFL¿FHQGXVHV\VWHP
7KLVVDIHW\JXLGHGRHVQRWDQDO\]HDOOWHFKQLFDOSDUDPHWHUVWKDWPXVWEH
FRQVLGHUHGLQVHOHFWLQJDSURGXFW7KHXVHUWKURXJKLWVRZQDQDO\VLVDQG
WHVWLQJLVVROHO\UHVSRQVLEOHIRU
‡0DNLQJWKH¿QDOVHOHFWLRQRIWKH3URGXFWV
‡$VVXULQJWKDWWKHXVHU¶VUHTXLUHPHQWVDUHPHWDQGWKDWWKHDSSOLFDWLRQ
SUHVHQWVQRKHDOWKRUVDIHW\KD]DUGV
‡3URYLGLQJDOODSSURSULDWHKHDOWKDQGVDIHW\ZDUQLQJVRQWKHHTXLSPHQW
RQZKLFKWKH3URGXFWVDUHXVHG
‡$VVXULQJFRPSOLDQFHZLWKDOODSSOLFDEOHJRYHUQPHQWDQGLQGXVWU\VWDQGDUGV
$GGLWLRQDO4XHVWLRQV&DOOWKHDSSURSULDWH3DUNHUWHFKQLFDOVHUYLFH
GHSDUWPHQWLI\RXKDYHDQ\TXHVWLRQVRUUHTXLUHDQ\DGGLWLRQDOLQIRUPDWLRQ
6HHWKH3DUNHUSXEOLFDWLRQIRUWKH3URGXFWVEHLQJFRQVLGHUHGRUXVHGRU
FDOO&3$5.(5RUJRWRZZZSDUNHUFRPIRUWHOHSKRQHQXPEHUVRI
WKHDSSURSULDWHWHFKQLFDOVHUYLFHGHSDUWPHQW
2.0 HOSE AND FITTING SELECTION INSTRUCTIONS
(OHFWULFDO&RQGXFWLYLW\&HUWDLQDSSOLFDWLRQVUHTXLUHWKDWWKH+RVHEH
QRQFRQGXFWLYHWRSUHYHQWHOHFWULFDOFXUUHQWÀRZ2WKHUDSSOLFDWLRQVUHTXLUH
WKH+RVHDQGWKH)LWWLQJVDQGWKH+RVH)LWWLQJLQWHUIDFHWREHVXI¿FLHQWO\
FRQGXFWLYHWRGUDLQRIIVWDWLFHOHFWULFLW\([WUHPHFDUHPXVWEHH[HUFLVHG
ZKHQVHOHFWLQJ+RVHDQG)LWWLQJVIRUWKHVHRUDQ\RWKHUDSSOLFDWLRQVLQZKLFK
HOHFWULFDOFRQGXFWLYLW\RUQRQFRQGXFWLYLW\LVDIDFWRU
7KHHOHFWULFDOFRQGXFWLYLW\RUQRQFRQGXFWLYLW\RI+RVHDQG)LWWLQJVLVGHSHQGHQWXSRQPDQ\IDFWRUVDQGPD\EHVXVFHSWLEOHWRFKDQJH7KHVHIDFWRUV
LQFOXGHEXWDUHQRWOLPLWHGWRWKHYDULRXVPDWHULDOVXVHGWRPDNHWKH+RVH
DQGWKH)LWWLQJV)LWWLQJ¿QLVKVRPH)LWWLQJ¿QLVKHVDUHHOHFWULFDOO\FRQGXFWLYH
ZKLOHRWKHUVDUHQRQFRQGXFWLYHPDQXIDFWXULQJPHWKRGVLQFOXGLQJPRLVWXUH
FRQWUROKRZWKH)LWWLQJVFRQWDFWWKH+RVHDJHDQGDPRXQWRIGHWHULRUDWLRQ
RUGDPDJHRURWKHUFKDQJHVPRLVWXUHFRQWHQWRIWKH+RVHDWDQ\SDUWLFXODU
WLPHDQGRWKHUIDFWRUV
7KHIROORZLQJDUHFRQVLGHUDWLRQVIRUHOHFWULFDOO\QRQFRQGXFWLYHDQGFRQGXFWLYH
+RVH)RURWKHUDSSOLFDWLRQVFRQVXOWWKHLQGLYLGXDOFDWDORJSDJHVDQGWKH
DSSURSULDWHLQGXVWU\RUUHJXODWRU\VWDQGDUGVIRUSURSHUVHOHFWLRQ
(OHFWULFDOO\1RQFRQGXFWLYH+RVH&HUWDLQDSSOLFDWLRQVUHTXLUHWKDW
WKH+RVHEHQRQFRQGXFWLYHWRSUHYHQWHOHFWULFDOFXUUHQWÀRZRUWRPDLQWDLQ
HOHFWULFDO LVRODWLRQ )RU DSSOLFDWLRQV WKDW UHTXLUH +RVH WR EH HOHFWULFDOO\
QRQFRQGXFWLYHLQFOXGLQJEXWQRWOLPLWHGWRDSSOLFDWLRQVQHDUKLJKYROWDJH
HOHFWULFOLQHVRQO\VSHFLDOQRQFRQGXFWLYH+RVHFDQEHXVHG7KHPDQXIDFWXUHURIWKHHTXLSPHQWLQZKLFKWKHQRQFRQGXFWLYH+RVHLVWREHXVHGPXVW
EHFRQVXOWHGWREHFHUWDLQWKDWWKH+RVHDQG)LWWLQJVWKDWDUHVHOHFWHGDUH
SURSHUIRUWKHDSSOLFDWLRQ'RQRWXVHDQ\3DUNHU+RVHRU)LWWLQJVIRUDQ\
VXFK DSSOLFDWLRQ UHTXLULQJ QRQFRQGXFWLYH +RVH LQFOXGLQJ EXW QRW OLPLWHG
WRDSSOLFDWLRQVQHDUKLJKYROWDJHHOHFWULFOLQHVXQOHVVLWKHDSSOLFDWLRQLV
H[SUHVVO\DSSURYHGLQWKH3DUNHUWHFKQLFDOSXEOLFDWLRQIRUWKHSURGXFWLLWKH
+RVHLVPDUNHG³QRQFRQGXFWLYH´DQGLLLWKHPDQXIDFWXUHURIWKHHTXLSPHQW
RQZKLFKWKH+RVHLVWREHXVHGVSHFL¿FDOO\DSSURYHVWKHSDUWLFXODU3DUNHU
+RVHDQG)LWWLQJVIRUVXFKXVH
(OHFWULFDOO\&RQGXFWLYH+RVH3DUNHUPDQXIDFWXUHVVSHFLDO+RVHIRU
FHUWDLQDSSOLFDWLRQVWKDWUHTXLUHHOHFWULFDOO\FRQGXFWLYH+RVH
3DUNHUPDQXIDFWXUHVVSHFLDO+RVHIRUFRQYH\LQJSDLQWLQDLUOHVVSDLQWVSUD\LQJDSSOLFDWLRQV7KLV+RVHLVODEHOHG³(OHFWULFDOO\&RQGXFWLYH$LUOHVV3DLQW
6SUD\+RVH´RQLWVOD\OLQHDQGSDFNDJLQJ7KLV+RVHPXVWEHSURSHUO\FRQQHFWHGWRWKHDSSURSULDWH3DUNHU)LWWLQJVDQGSURSHUO\JURXQGHGLQRUGHUWR
GLVVLSDWHGDQJHURXVVWDWLFFKDUJHEXLOGXSZKLFKRFFXUVLQDOODLUOHVVSDLQW
VSUD\LQJDSSOLFDWLRQV'RQRWXVHDQ\RWKHU+RVHIRUDLUOHVVSDLQWVSUD\LQJ
HYHQLIHOHFWULFDOO\FRQGXFWLYH8VHRIDQ\RWKHU+RVHRUIDLOXUHWRSURSHUO\
FRQQHFWWKH+RVHFDQFDXVHD¿UHRUDQH[SORVLRQUHVXOWLQJLQGHDWKSHUVRQDO
LQMXU\DQGSURSHUW\GDPDJH
3DUNHU PDQXIDFWXUHV D VSHFLDO +RVH IRU FHUWDLQ FRPSUHVVHG QDWXUDO JDV
³&1*´DSSOLFDWLRQVZKHUHVWDWLFHOHFWULFLW\EXLOGXSPD\RFFXU3DUNHU&1*
+RVHDVVHPEOLHVFRPSO\ZLWKWKHUHTXLUHPHQWVRI$16,,$61*9
&6$0³+RVHVIRU1DWXUDO*DV9HKLFOHVDQG'LVSHQVLQJ6\VWHPV´
ZZZDQVLRUJ7KLV+RVHLVODEHOHG³(OHFWULFDOO\&RQGXFWLYHIRU&1*8VH´
RQ LWV OD\OLQH DQG SDFNDJLQJ 7KLV +RVH PXVW EH SURSHUO\ FRQQHFWHG WR
WKHDSSURSULDWH3DUNHU)LWWLQJVDQGSURSHUO\JURXQGHGLQRUGHUWRGLVVLSDWH
G-20
Catalogue 4462 Global Edition
G
Technical information
Parker Safety Guide
Safety Guide
6XFWLRQ +RVHV XVHG IRU VXFWLRQ DSSOLFDWLRQV PXVW EH VHOHFWHG
WR LQVXUH WKDW WKH +RVH ZLOO ZLWKVWDQG WKH YDFXXP DQG SUHVVXUH RI WKH
V\VWHP ,PSURSHUO\ VHOHFWHG +RVH PD\ FROODSVH LQ VXFWLRQ DSSOLFDWLRQ
7HPSHUDWXUH%HFHUWDLQWKDWÀXLGDQGDPELHQWWHPSHUDWXUHVERWK
VWHDG\DQGWUDQVLHQWGRQRWH[FHHGWKHOLPLWDWLRQVRIWKH+RVH7HPSHUDWXUHVEHORZDQGDERYHWKHUHFRPPHQGHGOLPLWFDQGHJUDGH+RVHWRDSRLQW
ZKHUHDIDLOXUHPD\RFFXUDQGUHOHDVHÀXLG3URSHUO\LQVXODWHDQGSURWHFW
WKH+RVH$VVHPEO\ZKHQURXWLQJQHDUKRWREMHFWVHJPDQLIROGV'RQRW
XVHDQ\+RVHLQDQ\DSSOLFDWLRQZKHUHIDLOXUHRIWKH+RVHFRXOGUHVXOWLQ
WKHFRQYH\HGÀXLGVRUYDSRUVRUPLVWIURPWKHFRQYH\HGÀXLGVFRQWDFWLQJ DQ\ RSHQ ÀDPH PROWHQ PHWDO RU RWKHU SRWHQWLDO ¿UH LJQLWLRQ VRXUFH
WKDW FRXOG FDXVH EXUQLQJ RU H[SORVLRQ RI WKH FRQYH\HG ÀXLGV RU YDSRUV
)OXLG &RPSDWLELOLW\ +RVH$VVHPEO\ VHOHFWLRQ PXVW DVVXUH FRPSDWLELOLW\ RI WKH +RVH WXEH FRYHU UHLQIRUFHPHQW DQG )LWWLQJV ZLWK WKH
ÀXLG PHGLD XVHG 6HH WKH ÀXLG FRPSDWLELOLW\ FKDUW LQ WKH 3DUNHU SXEOLFDWLRQ IRU WKH SURGXFW EHLQJ FRQVLGHUHG RU XVHG 7KLV LQIRUPDWLRQ LV
RIIHUHG RQO\ DV D JXLGH $FWXDO VHUYLFH OLIH FDQ RQO\ EH GHWHUPLQHG E\
WKH HQG XVHU E\ WHVWLQJ XQGHU DOO H[WUHPH FRQGLWLRQV DQG RWKHU DQDO\VLV
+RVH WKDW LV FKHPLFDOO\ FRPSDWLEOH ZLWK D SDUWLFXODU ÀXLG PXVW EH DVVHPEOHGXVLQJ)LWWLQJVDQGDGDSWHUVFRQWDLQLQJOLNHZLVHFRPSDWLEOHVHDOV
3HUPHDWLRQ3HUPHDWLRQWKDWLVVHHSDJHWKURXJKWKH+RVHZLOORFFXU
IURPLQVLGHWKH+RVHWRRXWVLGHZKHQ+RVHLVXVHGZLWKJDVHVOLTXLGDQGJDV
IXHOVDQGUHIULJHUDQWVLQFOXGLQJEXWQRWOLPLWHGWRVXFKPDWHULDOVDVKHOLXP
GLHVHOIXHOJDVROLQHQDWXUDOJDVRU/3*7KLVSHUPHDWLRQPD\UHVXOWLQ
KLJKFRQFHQWUDWLRQVRIYDSRUVZKLFKDUHSRWHQWLDOO\ÀDPPDEOHH[SORVLYHRU
WR[LFDQGLQORVVRIÀXLG'DQJHURXVH[SORVLRQV¿UHVDQGRWKHUKD]DUGV
FDQUHVXOWZKHQXVLQJWKHZURQJ+RVHIRUVXFKDSSOLFDWLRQV7KHV\VWHP
GHVLJQHUPXVWWDNHLQWRDFFRXQWWKHIDFWWKDWWKLVSHUPHDWLRQZLOOWDNHSODFH
DQGPXVWQRWXVH+RVHLIWKLVSHUPHDWLRQFRXOGEHKD]DUGRXV7KHV\VWHP
GHVLJQHU PXVW WDNH LQWR DFFRXQW DOO OHJDO JRYHUQPHQW LQVXUDQFH RU DQ\
RWKHU VSHFLDO UHJXODWLRQV ZKLFK JRYHUQ WKH XVH RI IXHOV DQG UHIULJHUDQWV
1HYHUXVHD+RVHHYHQWKRXJKWKHÀXLGFRPSDWLELOLW\LVDFFHSWDEOHZLWKRXW
FRQVLGHULQJWKHSRWHQWLDOKD]DUGRXVHIIHFWVWKDWFDQUHVXOWIURPSHUPHDWLRQ
WKURXJKWKH+RVH$VVHPEO\
3HUPHDWLRQRIPRLVWXUHIURPRXWVLGHWKH+RVHWRLQVLGHWKH+RVHZLOODOVRRFFXU
LQ+RVHDVVHPEOLHVUHJDUGOHVVRILQWHUQDOSUHVVXUH,IWKLVPRLVWXUHSHUPHDWLRQZRXOGKDYHGHWULPHQWDOHIIHFWVSDUWLFXODUO\EXWQRWOLPLWHGWRUHIULJHUDWLRQ
DQGDLUFRQGLWLRQLQJV\VWHPVLQFRUSRUDWLRQRIVXI¿FLHQWGU\LQJFDSDFLW\LQWKH
V\VWHPRURWKHUDSSURSULDWHV\VWHPVDIHJXDUGVVKRXOGEHVHOHFWHGDQGXVHG
6L]H 7UDQVPLVVLRQ RI SRZHU E\ PHDQV RI SUHVVXUL]HG IOXLG YDULHV ZLWK SUHVVXUH DQG UDWH RI IORZ 7KH VL]H RI WKH FRPSRQHQWV PXVW EH DGHTXDWH WR NHHS SUHVVXUH ORVVHV WR D PLQLPXP DQG
DYRLG GDPDJH GXH WR KHDW JHQHUDWLRQ RU H[FHVVLYH IOXLG YHORFLW\
5RXWLQJ $WWHQWLRQ PXVW EH JLYHQ WR RSWLPXP URXWLQJ WR PLQLPL]H
LQKHUHQWSUREOHPVNLQNLQJRUÀRZUHVWULFWLRQGXHWR+RVHFROODSVHWZLVWLQJ
RIWKH+RVHSUR[LPLW\WRKRWREMHFWVRUKHDWVRXUFHV)RUDGGLWLRQDOURXWLQJUHFRPPHQGDWLRQVVHH6$(-DQG,62+RVH$VVHPEOLHV
KDYHD¿QLWHOLIHDQGLISRVVLEOHVKRXOGEHLQVWDOOHGLQDPDQQHUWKDWDOORZV
IRUHDVHRILQVSHFWLRQDQGIXWXUHUHSODFHPHQW5XEEHU+RVHEHFDXVHRI
LWV UHODWLYH VKRUW OLIH VKRXOG QRW EH XVHG LQ UHVLGHQWLDO DQG FRPPHUFLDO
EXLOGLQJVIRU+9$&KHDWLQJYHQWLODWLQJDQGDLUFRQGLWLRQLQJDSSOLFDWLRQV
(QYLURQPHQW&DUHPXVWEHWDNHQWRLQVXUHWKDWWKH+RVHDQG)LWWLQJVDUH
HLWKHUFRPSDWLEOHZLWKRUSURWHFWHGIURPWKHHQYLURQPHQWWKDWLVVXUURXQGLQJ
FRQGLWLRQVWRZKLFKWKH\DUHH[SRVHG(QYLURQPHQWDOFRQGLWLRQVLQFOXGLQJEXW
QRWOLPLWHGWRXOWUDYLROHWUDGLDWLRQVXQOLJKWKHDWR]RQHPRLVWXUHZDWHUVDOWZDWHUFKHPLFDOVDQGDLUSROOXWDQWVFDQFDXVHGHJUDGDWLRQDQGSUHPDWXUHIDLOXUH
0HFKDQLFDO/RDGV([WHUQDOIRUFHVFDQVLJQL¿FDQWO\UHGXFH+RVHOLIHRU
FDXVHIDLOXUH0HFKDQLFDOORDGVZKLFKPXVWEHFRQVLGHUHGLQFOXGHH[FHVVLYH
ÀH[LQJWZLVWNLQNLQJWHQVLOHRUVLGHORDGVEHQGUDGLXVDQGYLEUDWLRQ8VHRI
VZLYHOW\SH)LWWLQJVRUDGDSWHUVPD\EHUHTXLUHGWRLQVXUHQRWZLVWLVSXWLQWRWKH
+RVH8QXVXDODSSOLFDWLRQVPD\UHTXLUHVSHFLDOWHVWLQJSULRUWR+RVHVHOHFWLRQ
3K\VLFDO'DPDJH&DUHPXVWEHWDNHQWRSURWHFW+RVHIURPZHDUVQDJJLQJNLQNLQJEHQGLQJVPDOOHUWKDWPLQLPXPEHQGUDGLXVDQGFXWWLQJDQ\RI
ZKLFKFDQFDXVHSUHPDWXUH+RVHIDLOXUH$Q\+RVHWKDWKDVEHHQNLQNHGRUEHQW
WRDUDGLXVVPDOOHUWKDQWKHPLQLPXPEHQGUDGLXVDQGDQ\+RVHWKDWKDVEHHQ
FXWRULVFUDFNHGRULVRWKHUZLVHGDPDJHGVKRXOGEHUHPRYHGDQGGLVFDUGHG
3URSHU(QG)LWWLQJ6HHLQVWUXFWLRQVWKURXJK7KHVHUHFRPPHQGDWLRQVPD\EHVXEVWDQWLDWHGE\WHVWLQJWRLQGXVWU\VWDQGDUGVVXFKDV
6$(-IRUK\GUDXOLFDSSOLFDWLRQVRU0,/$$6RU$6IRU
+RVHVIURP3DUNHU¶V6WUDWRÀH[3URGXFWV'LYLVLRQIRUDHURVSDFHDSSOLFDWLRQV
/HQJWK:KHQHVWDEOLVKLQJDSURSHU+RVHOHQJWKPRWLRQDEVRUSWLRQ+RVHOHQJWKFKDQJHVGXHWRSUHVVXUHDQG+RVHDQGPDFKLQHWROHUDQFHVDQGPRYHPHQWPXVWEHFRQVLGHUHG
6SHFL¿FDWLRQVDQG6WDQGDUGV:KHQVHOHFWLQJ+RVHDQG)LWWLQJV
JRYHUQPHQWLQGXVWU\DQG3DUNHUVSHFL¿FDWLRQVDQGUHFRPPHQGDWLRQV
PXVWEHUHYLHZHGDQGIROORZHGDVDSSOLFDEOH
+RVH&OHDQOLQHVV+RVHFRPSRQHQWVPD\YDU\LQFOHDQOLQHVV
OHYHOV&DUHPXVWEHWDNHQWRLQVXUHWKDWWKH+RVH$VVHPEO\VHOHFWHGKDV
DQDGHTXDWHOHYHORIFOHDQOLQHVVIRUWKHDSSOLFDWLRQ
)LUH5HVLVWDQW)OXLGV6RPH¿UHUHVLVWDQWÀXLGVWKDWDUHWREHFRQYH\HG
E\+RVHUHTXLUHXVHRIWKHVDPHW\SHRI+RVHDVXVHGZLWKSHWUROHXPEDVH
ÀXLGV6RPHVXFKÀXLGVUHTXLUHDVSHFLDO+RVHZKLOHDIHZÀXLGVZLOOQRWZRUN
ZLWKDQ\+RVHDWDOO6HHLQVWUXFWLRQVDQG7KHZURQJ+RVHPD\IDLODIWHUDYHU\VKRUWVHUYLFH,QDGGLWLRQDOOOLTXLGVEXWSXUHZDWHUPD\EXUQ¿HUFHO\
XQGHUFHUWDLQFRQGLWLRQVDQGHYHQSXUHZDWHUOHDNDJHPD\EHKD]DUGRXV
5DGLDQW+HDW+RVHFDQEHKHDWHGWRGHVWUXFWLRQZLWKRXWFRQWDFWE\VXFK
QHDUE\LWHPVDVKRWPDQLIROGVRUPROWHQPHWDO7KHVDPHKHDWVRXUFHPD\WKHQ
LQLWLDWHD¿UH7KLVFDQRFFXUGHVSLWHWKHSUHVHQFHRIFRRODLUDURXQGWKH+RVH
:HOGLQJRU%UD]LQJ:KHQXVLQJDWRUFKRUDUFZHOGHULQFORVHSUR[LPLW\WRK\GUDXOLFOLQHVWKHK\GUDXOLFOLQHVVKRXOGEHUHPRYHGRUVKLHOGHGZLWK
DSSURSULDWH¿UHUHVLVWDQWPDWHULDOV)ODPHRUZHOGVSDWWHUFRXOGEXUQWKURXJK
WKH+RVHDQGSRVVLEO\LJQLWHHVFDSLQJÀXLGUHVXOWLQJLQDFDWDVWURSKLFIDLOXUH
+HDWLQJRISODWHGSDUWVLQFOXGLQJ+RVH)LWWLQJVDQGDGDSWHUVDERYHƒ)
ƒ&VXFKDVGXULQJZHOGLQJEUD]LQJRUVROGHULQJPD\HPLWGHDGO\JDVHV
$WRPLF5DGLDWLRQ$WRPLFUDGLDWLRQDIIHFWVDOOPDWHULDOVXVHGLQ
+RVHDVVHPEOLHV6LQFHWKHORQJWHUPHIIHFWVPD\EHXQNQRZQGRQRW
H[SRVH+RVHDVVHPEOLHVWRDWRPLFUDGLDWLRQ
$HURVSDFH$SSOLFDWLRQV 7KH RQO\ +RVH DQG )LWWLQJV WKDW PD\
EH XVHG IRU LQ IOLJKW DHURVSDFH DSSOLFDWLRQV DUH WKRVH DYDLODEOH IURP
3DUNHU¶V 6WUDWRIOH[ 3URGXFWV 'LYLVLRQ 'R QRW XVH DQ\ RWKHU +RVH
RU )LWWLQJV IRU LQ ÀLJKW DSSOLFDWLRQV 'R QRW XVH DQ\ +RVH RU )LWWLQJV
IURP 3DUNHU¶V 6WUDWRÀH[ 3URGXFWV 'LYLVLRQ ZLWK DQ\ RWKHU +RVH RU )LWWLQJV XQOHVV H[SUHVVO\ DSSURYHG LQ ZULWLQJ E\ WKH HQJLQHHULQJ PDQDJHU RU FKLHI HQJLQHHU RI 6WUDWRÀH[ 3URGXFWV 'LYLVLRQ DQG YHUL¿HG E\
WKH XVHU¶V RZQ WHVWLQJ DQG LQVSHFWLRQ WR DHURVSDFH LQGXVWU\ VWDQGDUGV
8QORFNLQJ&RXSOLQJV%DOOORFNLQJFRXSOLQJVRURWKHU)LWWLQJVZLWK
TXLFNGLVFRQQHFWDELOLW\FDQXQLQWHQWLRQDOO\GLVFRQQHFWLIWKH\DUHGUDJJHG
RYHUREVWUXFWLRQVRULIWKHVOHHYHRURWKHUGLVFRQQHFWPHPEHULVEXPSHGRU
PRYHGHQRXJKWRFDXVHGLVFRQQHFW7KUHDGHG)LWWLQJVVKRXOGEHFRQVLGHUHG
ZKHUHWKHUHLVDSRWHQWLDOIRUDFFLGHQWDOXQFRXSOLQJ
G-21
Catalogue 4462 Global Edition
Technical information
3UHVVXUH+RVHVHOHFWLRQPXVWEHPDGHVRWKDWWKHSXEOLVKHGPD[LPXP
ZRUNLQJSUHVVXUHRIWKH+RVHDQG)LWWLQJVDUHHTXDOWRRUJUHDWHUWKDQWKH
PD[LPXP V\VWHP SUHVVXUH 7KH PD[LPXP ZRUNLQJ SUHVVXUH RI D +RVH
$VVHPEO\LVWKHORZHURIWKHUHVSHFWLYHSXEOLVKHGPD[LPXPZRUNLQJSUHVVXUHVRIWKH+RVHDQGWKH)LWWLQJVXVHG6XUJHSUHVVXUHVRUSHDNWUDQVLHQW
SUHVVXUHV LQ WKH V\VWHP PXVW EH EHORZ WKH SXEOLVKHG PD[LPXP ZRUNLQJ
SUHVVXUHIRUWKH+RVH6XUJHSUHVVXUHVDQGSHDNSUHVVXUHVFDQXVXDOO\
RQO\ EH GHWHUPLQHG E\ VHQVLWLYH HOHFWULFDO LQVWUXPHQWDWLRQ WKDW PHDVXUHV
DQG LQGLFDWHV SUHVVXUHV DW PLOOLVHFRQG LQWHUYDOV 0HFKDQLFDO SUHVVXUH
JDXJHVLQGLFDWHRQO\DYHUDJHSUHVVXUHVDQGFDQQRWEHXVHGWRGHWHUPLQH
VXUJH SUHVVXUHV RU SHDN WUDQVLHQW SUHVVXUHV 3XEOLVKHG EXUVW SUHVVXUH
UDWLQJVIRU+RVHLVIRUPDQXIDFWXULQJWHVWSXUSRVHVRQO\DQGLVQRLQGLFDWLRQWKDWWKH3URGXFWFDQEHXVHGLQDSSOLFDWLRQVDWWKHEXUVWSUHVVXUHRU
RWKHUZLVHDERYHWKHSXEOLVKHGPD[LPXPUHFRPPHQGHGZRUNLQJSUHVVXUH
Technical information
Parker Safety Guide
Safety Guide
3.0 HOSE AND FITTING ASSEMBLY AND INSTALLATION
INSTRUCTIONS
&RPSRQHQW,QVSHFWLRQ3ULRUWRDVVHPEO\DFDUHIXOH[DPLQDWLRQRIWKH
+RVHDQG)LWWLQJVPXVWEHSHUIRUPHG$OOFRPSRQHQWVPXVWEHFKHFNHGIRU
FRUUHFWVW\OHVL]HFDWDORJQXPEHUDQGOHQJWK7KH+RVHPXVWEHH[DPLQHG
for cleanliness, obstructions, blisters, cover looseness, kinks, cracks, cuts or
DQ\RWKHUYLVLEOHGHIHFWV,QVSHFWWKH)LWWLQJDQGVHDOLQJVXUIDFHVIRUEXUUV
QLFNVFRUURVLRQRURWKHULPSHUIHFWLRQV'R127XVHDQ\FRPSRQHQWWKDW
GLVSOD\VDQ\VLJQVRIQRQFRQIRUPDQFH
+RVHDQG)LWWLQJ$VVHPEO\'RQRWDVVHPEOHD3DUNHU)LWWLQJRQD3DUNHU
+RVHWKDWLVQRWVSHFL¿FDOO\OLVWHGE\3DUNHUIRUWKDW)LWWLQJXQOHVVDXWKRUL]HG
in writing by the engineering manager or chief engineer of the appropriate
3DUNHUGLYLVLRQ'RQRWDVVHPEOHD3DUNHU)LWWLQJRQDQRWKHUPDQXIDFWXUHU¶V
+RVH RU D 3DUNHU +RVH RQ DQRWKHU PDQXIDFWXUHU¶V )LWWLQJ XQOHVV L WKH
HQJLQHHULQJPDQDJHURUFKLHIHQJLQHHURIWKHDSSURSULDWH3DUNHUGLYLVLRQ
DSSURYHVWKH$VVHPEO\LQZULWLQJRUWKDWFRPELQDWLRQLVH[SUHVVO\DSSURYHG
LQWKHDSSURSULDWH3DUNHUOLWHUDWXUHIRUWKHVSHFL¿F3DUNHUSURGXFWDQGLL
WKH XVHU YHUL¿HV WKH$VVHPEO\ DQG WKH DSSOLFDWLRQ WKURXJK DQDO\VLV DQG
WHVWLQJ)RU3DUNHU+RVHWKDWGRHVQRWVSHFLI\D3DUNHU)LWWLQJWKHXVHULV
VROHO\UHVSRQVLEOHIRUWKHVHOHFWLRQRIWKHSURSHU)LWWLQJDQG+RVH$VVHPEO\
SURFHGXUHV6HHLQVWUXFWLRQ
7RSUHYHQWWKHSRVVLELOLW\RISUREOHPVVXFKDVOHDNDJHDWWKH)LWWLQJRUV\VWHPFRQWDPLQDWLRQLWLVLPSRUWDQWWRFRPSOHWHO\UHPRYHDOOGHEULVIURPWKH
FXWWLQJRSHUDWLRQEHIRUHLQVWDOODWLRQRIWKH)LWWLQJV7KH3DUNHUSXEOLVKHG
LQVWUXFWLRQVPXVWEHIROORZHGIRUDVVHPEOLQJWKH)LWWLQJVRQWKH+RVH7KHVH
LQVWUXFWLRQVDUHSURYLGHGLQWKH3DUNHU)LWWLQJFDWDORJIRUWKHVSHFL¿F3DUNHU
)LWWLQJEHLQJXVHGRUE\FDOOLQJ&3$5.(5RUDWZZZSDUNHUFRP
5HODWHG$FFHVVRULHV'RQRWFULPSRUVZDJHDQ\3DUNHU+RVHRU)LWWLQJ
ZLWKDQ\WKLQJEXWWKHOLVWHGVZDJHRUFULPSPDFKLQHDQGGLHVLQDFFRUGDQFH
ZLWK3DUNHUSXEOLVKHGLQVWUXFWLRQV'RQRWFULPSRUVZDJHDQRWKHUPDQXIDFWXUHU¶V)LWWLQJZLWKD3DUNHUFULPSRUVZDJHGLHXQOHVVDXWKRUL]HGLQZULWLQJE\
WKHHQJLQHHULQJPDQDJHURUFKLHIHQJLQHHURIWKHDSSURSULDWH3DUNHUGLYLVLRQ
3DUWV'RQRWXVHDQ\3DUNHU)LWWLQJSDUWLQFOXGLQJEXWQRWOLPLWHGWR
VRFNHWVKHOOQLSSOHRULQVHUWH[FHSWZLWKWKHFRUUHFW3DUNHUPDWLQJSDUWVLQ
DFFRUGDQFHZLWK3DUNHUSXEOLVKHGLQVWUXFWLRQVXQOHVVDXWKRUL]HGLQZULWLQJE\
WKHHQJLQHHULQJPDQDJHURUFKLHIHQJLQHHURIWKHDSSURSULDWH3DUNHUGLYLVLRQ
Technical information
)LHOG$WWDFKDEOH3HUPDQHQW 'R QRW UHXVH DQ\ ¿HOG DWWDFKDEOH
+RVH)LWWLQJWKDWKDVEORZQRUSXOOHGRIID+RVH'RQRWUHXVHD3DUNHU
SHUPDQHQW +RVH )LWWLQJ FULPSHG RU VZDJHG RU DQ\ SDUW WKHUHRI &RPSOHWH +RVH $VVHPEOLHV PD\ RQO\ EH UHXVHG DIWHU SURSHU LQVSHFWLRQ
XQGHU VHFWLRQ 'R QRW DVVHPEOH )LWWLQJV WR DQ\ SUHYLRXVO\ XVHG
K\GUDXOLF +RVH WKDW ZDV LQ VHUYLFH IRU XVH LQ D ÀXLG SRZHU DSSOLFDWLRQ
3UH,QVWDOODWLRQ,QVSHFWLRQ3ULRUWRLQVWDOODWLRQDFDUHIXOH[DPLQDWLRQRIWKH+RVH$VVHPEO\PXVWEHSHUIRUPHG,QVSHFWWKH+RVH$VVHPEO\IRUDQ\GDPDJHRUGHIHFWV'2127XVHDQ\+RVH$VVHPEO\WKDW
GLVSOD\VDQ\VLJQVRIQRQFRQIRUPDQFH
0LQLPXP%HQG5DGLXV,QVWDOODWLRQRID+RVHDWOHVVWKDQWKHPLQLPXPOLVWHGEHQGUDGLXVPD\VLJQL¿FDQWO\UHGXFHWKH+RVHOLIH3DUWLFXODU
DWWHQWLRQ PXVW EH JLYHQ WR SUHFOXGH VKDUS EHQGLQJ DW WKH +RVH WR )LWWLQJ
MXQFWXUH$Q\EHQGLQJGXULQJLQVWDOODWLRQDWOHVVWKDQWKHPLQLPXPEHQG
UDGLXVPXVWEHDYRLGHG,IDQ\+RVHLVNLQNHGGXULQJLQVWDOODWLRQWKH+RVH
PXVWEHGLVFDUGHG
7ZLVW$QJOHDQG2ULHQWDWLRQ+RVH$VVHPEO\LQVWDOODWLRQPXVWEHVXFK
WKDWUHODWLYHPRWLRQRIPDFKLQHFRPSRQHQWVGRHVQRWSURGXFHWZLVWLQJ
6HFXUHPHQW,QPDQ\DSSOLFDWLRQVLWPD\EHQHFHVVDU\WRUHVWUDLQ
SURWHFWRUJXLGHWKH+RVHWRSURWHFWLWIURPGDPDJHE\XQQHFHVVDU\ÀH[LQJSUHVVXUHVXUJHVDQGFRQWDFWZLWKRWKHUPHFKDQLFDOFRPSRQHQWV&DUH
PXVWEHWDNHQWRLQVXUHVXFKUHVWUDLQWVGRQRWLQWURGXFHDGGLWLRQDOVWUHVV
RUZHDUSRLQWV
3URSHU&RQQHFWLRQRI3RUWV3URSHUSK\VLFDOLQVWDOODWLRQRIWKH+RVH
$VVHPEO\UHTXLUHVDFRUUHFWO\LQVWDOOHGSRUWFRQQHFWLRQLQVXULQJWKDWQRWZLVW
RUWRUTXHLVWUDQVIHUUHGWRWKH+RVHZKHQWKH)LWWLQJVDUHEHLQJWLJKWHQHG
RURWKHUZLVHGXULQJXVH
([WHUQDO'DPDJH3URSHULQVWDOODWLRQLVQRWFRPSOHWHZLWKRXWLQVXULQJ
WKDWWHQVLOHORDGVVLGHORDGVNLQNLQJÀDWWHQLQJSRWHQWLDODEUDVLRQWKUHDG
GDPDJHRUGDPDJHWRVHDOLQJVXUIDFHVDUHFRUUHFWHGRUHOLPLQDWHG6HH
LQVWUXFWLRQ
6\VWHP&KHFNRXW$OODLUHQWUDSPHQWPXVWEHHOLPLQDWHGDQGWKH
V\VWHPSUHVVXUL]HGWRWKHPD[LPXPV\VWHPSUHVVXUHDWRUEHORZWKH+RVH
PD[LPXPZRUNLQJSUHVVXUHDQGFKHFNHGIRUSURSHUIXQFWLRQDQGIUHHGRP
IURP OHDNV 3HUVRQQHO PXVW VWD\ RXW RI SRWHQWLDO KD]DUGRXV DUHDV ZKLOH
WHVWLQJDQGXVLQJ
5RXWLQJ7KH+RVH$VVHPEO\VKRXOGEHURXWHGLQVXFKDPDQQHUVR
LIDIDLOXUHGRHVRFFXUWKHHVFDSLQJPHGLDZLOOQRWFDXVHSHUVRQDOLQMXU\RU
SURSHUW\GDPDJH,QDGGLWLRQLIÀXLGPHGLDFRPHVLQFRQWDFWZLWKKRWVXUIDFHVRSHQÀDPHRUVSDUNVD¿UHRUH[SORVLRQPD\RFFXU6HHVHFWLRQ
*URXQG)DXOW(TXLSPHQW3URWHFWLRQ'HYLFHV*)(3'V:$51,1*
)LUHDQG6KRFN+D]DUG7RPLQLPL]HWKHGDQJHURI¿UHLIWKHKHDWLQJFDEOH
RID0XOWLWXEHEXQGOHLVGDPDJHGRULPSURSHUO\LQVWDOOHGXVHD*URXQG)DXOW
(TXLSPHQW3URWHFWLRQ'HYLFH(OHFWULFDOIDXOWFXUUHQWVPD\EHLQVXI¿FLHQWWR
WULSDFRQYHQWLRQDOFLUFXLWEUHDNHU
)RUJURXQGIDXOWSURWHFWLRQWKH,(((ZZZDQVLRUJVWDQGDUGIRU
KHDWLQJFDEOHVUHFRPPHQGVWKHXVHRI*)(3'VZLWKDQRPLQDOPLOOLDPSHUHWULSOHYHOIRU³SLSLQJV\VWHPVLQFODVVL¿HGDUHDVWKRVHDUHDVUHTXLULQJ
DKLJKGHJUHHRIPDLQWHQDQFHRUZKLFKPD\EHH[SRVHGWRSK\VLFDODEXVH
RUFRUURVLYHDWPRVSKHUHV´
4.0 HOSE AND FITTING MAINTENANCE AND REPLACEMENT
INSTRUCTIONS
(YHQZLWKSURSHUVHOHFWLRQDQGLQVWDOODWLRQ+RVHOLIHPD\EHVLJQL¿FDQWO\
UHGXFHGZLWKRXWDFRQWLQXLQJPDLQWHQDQFHSURJUDP7KHVHYHULW\RIWKHDSSOLFDWLRQULVNSRWHQWLDOIURPDSRVVLEOH+RVHIDLOXUHDQGH[SHULHQFHZLWKDQ\
+RVHIDLOXUHVLQWKHDSSOLFDWLRQRULQVLPLODUDSSOLFDWLRQVVKRXOGGHWHUPLQH
WKHIUHTXHQF\RIWKHLQVSHFWLRQDQGWKHUHSODFHPHQWIRUWKH3URGXFWVVRWKDW
3URGXFWVDUHUHSODFHGEHIRUHDQ\IDLOXUHRFFXUV$PDLQWHQDQFHSURJUDP
PXVWEHHVWDEOLVKHGDQGIROORZHGE\WKHXVHUDQGDWPLQLPXPPXVWLQFOXGH
LQVWUXFWLRQVWKURXJK
9LVXDO,QVSHFWLRQ+RVH)LWWLQJ$Q\RIWKHIROORZLQJFRQGLWLRQVUHTXLUH
LPPHGLDWHVKXWGRZQDQGUHSODFHPHQWRIWKH+RVH$VVHPEO\
‡)LWWLQJVOLSSDJHRQ+RVH
‡'DPDJHGFUDFNHGFXWRUDEUDGHGFRYHUDQ\UHLQIRUFHPHQWH[SRVHG
‡+DUGVWLIIKHDWFUDFNHGRUFKDUUHG+RVH
‡&UDFNHGGDPDJHGRUEDGO\FRUURGHG)LWWLQJV
‡/HDNVDW)LWWLQJRULQ+RVH
‡.LQNHGFUXVKHGÀDWWHQHGRUWZLVWHG+RVHDQG
‡%OLVWHUHGVRIWGHJUDGHGRUORRVHFRYHU
9LVXDO,QVSHFWLRQ$OO2WKHU7KHIROORZLQJLWHPVPXVWEHWLJKWHQHG
UHSDLUHGFRUUHFWHGRUUHSODFHGDVUHTXLUHG
‡/HDNLQJSRUWFRQGLWLRQV
‡([FHVVGLUWEXLOGXS
‡:RUQFODPSVJXDUGVRUVKLHOGVDQG
‡6\VWHPÀXLGOHYHOÀXLGW\SHDQGDQ\DLUHQWUDSPHQW
)XQFWLRQDO7HVW2SHUDWHWKHV\VWHPDWPD[LPXPRSHUDWLQJSUHVVXUH
DQGFKHFNIRUSRVVLEOHPDOIXQFWLRQVDQGOHDNV3HUVRQQHOPXVWDYRLGSRWHQWLDOKD]DUGRXVDUHDVZKLOHWHVWLQJDQGXVLQJWKHV\VWHP6HHVHFWLRQ
5HSODFHPHQW ,QWHUYDOV +RVH DVVHPEOLHV DQG HODVWRPHULF VHDOV
XVHGRQ+RVH)LWWLQJVDQGDGDSWHUVZLOOHYHQWXDOO\DJHKDUGHQZHDUDQG
GHWHULRUDWHXQGHUWKHUPDOF\FOLQJDQGFRPSUHVVLRQVHW+RVH$VVHPEOLHV
DQG HODVWRPHULF VHDOV VKRXOG EH LQVSHFWHG DQG UHSODFHG DW VSHFL¿F UHSODFHPHQWLQWHUYDOVEDVHGRQSUHYLRXVVHUYLFHOLIHJRYHUQPHQWRULQGXVWU\
UHFRPPHQGDWLRQVRUZKHQIDLOXUHVFRXOGUHVXOWLQXQDFFHSWDEOHGRZQWLPH
GDPDJHRULQMXU\ULVN6HHVHFWLRQ+RVHDQG)LWWLQJVPD\EHVXEMHFWHG
WRLQWHUQDOPHFKDQLFDODQGRUFKHPLFDOZHDUIURPWKHFRQYH\LQJÀXLGDQG
PD\IDLOZLWKRXWZDUQLQJ7KHXVHUPXVWGHWHUPLQHWKHSURGXFWOLIHXQGHU
VXFKFLUFXPVWDQFHVE\WHVWLQJ$OVRVHHVHFWLRQ
6HHVHFWLRQ
G-22
Catalogue 4462 Global Edition
G
Technical information
Parker Safety Guide
Safety Guide
+RVH,QVSHFWLRQDQG)DLOXUH+\GUDXOLFSRZHULVDFFRPSOLVKHGE\XWLOL]LQJKLJKSUHVVXUHÀXLGVWRWUDQVIHUHQHUJ\DQGGRZRUN+RVHV)LWWLQJVDQG
+RVH$VVHPEOLHVDOOFRQWULEXWHWRWKLVE\WUDQVPLWWLQJÀXLGVDWKLJKSUHVVXUHV
)OXLGVXQGHUSUHVVXUHFDQEHGDQJHURXVDQGSRWHQWLDOO\OHWKDODQGWKHUHIRUH
H[WUHPHFDXWLRQPXVWEHH[HUFLVHGZKHQZRUNLQJZLWKÀXLGVXQGHUSUHVVXUH
DQGKDQGOLQJWKH+RVHVWUDQVSRUWLQJWKHÀXLGV)URPWLPHWRWLPH+RVH
$VVHPEOLHVZLOOIDLOLIWKH\DUHQRWUHSODFHGDWSURSHUWLPHLQWHUYDOV8VXDOO\
these failures are the result of some form of misapplication, abuse, wear or
IDLOXUHWRSHUIRUPSURSHUPDLQWHQDQFH:KHQ+RVHVIDLOJHQHUDOO\WKHKLJK
SUHVVXUHÀXLGVLQVLGHHVFDSHLQDVWUHDPZKLFKPD\RUPD\QRWEHYLVLEOHWR
WKHXVHU8QGHUQRFLUFXPVWDQFHVVKRXOGWKHXVHUDWWHPSWWRORFDWHWKHOHDN
E\³IHHOLQJ´ZLWKWKHLUKDQGVRUDQ\RWKHUSDUWRIWKHLUERG\+LJKSUHVVXUH
ÀXLGVFDQDQGZLOOSHQHWUDWHWKHVNLQDQGFDXVHVHYHUHWLVVXHGDPDJHDQG
SRVVLEO\ORVVRIOLPE(YHQVHHPLQJO\PLQRUK\GUDXOLFÀXLGLQMHFWLRQLQMXULHV
PXVWEHWUHDWHGLPPHGLDWHO\E\DSK\VLFLDQZLWKNQRZOHGJHRIWKHWLVVXH
GDPDJLQJSURSHUWLHVRIK\GUDXOLFÀXLG
,ID+RVHIDLOXUHRFFXUVLPPHGLDWHO\VKXWGRZQWKHHTXLSPHQWDQGOHDYHWKH
DUHDXQWLOSUHVVXUHKDVEHHQFRPSOHWHO\UHOHDVHGIURPWKH+RVH$VVHPEO\
6LPSO\VKXWWLQJGRZQWKHK\GUDXOLFSXPSPD\RUPD\QRWHOLPLQDWHWKHSUHVVXUHLQWKH+RVH$VVHPEO\0DQ\WLPHVFKHFNYDOYHVHWFDUHHPSOR\HGLQ
DV\VWHPDQGFDQFDXVHSUHVVXUHWRUHPDLQLQD+RVH$VVHPEO\HYHQZKHQ
SXPSVRUHTXLSPHQWDUHQRWRSHUDWLQJ7LQ\KROHVLQWKH+RVHFRPPRQO\
NQRZQDVSLQKROHVFDQHMHFWVPDOOGDQJHURXVO\SRZHUIXOEXWKDUGWRVHH
VWUHDPVRIK\GUDXOLFÀXLG,WPD\WDNHVHYHUDOPLQXWHVRUHYHQKRXUVIRUWKH
SUHVVXUHWREHUHOLHYHGVRWKDWWKH+RVH$VVHPEO\PD\EHH[DPLQHGVDIHO\
2QFHWKHSUHVVXUHKDVEHHQUHGXFHGWR]HURWKH+RVH$VVHPEO\PD\EH
WDNHQ RII WKH HTXLSPHQW DQG H[DPLQHG ,W PXVW DOZD\V EH UHSODFHG LI D
IDLOXUHKDVRFFXUUHG1HYHUDWWHPSWWRSDWFKRUUHSDLUD+RVH$VVHPEO\WKDW
KDVIDLOHG&RQVXOWWKHQHDUHVW3DUNHUGLVWULEXWRURUWKHDSSURSULDWH3DUNHU
GLYLVLRQIRU+RVH$VVHPEO\UHSODFHPHQWLQIRUPDWLRQ
1HYHUWRXFKRUH[DPLQHDIDLOHG+RVH$VVHPEO\XQOHVVLWLVREYLRXVWKDW
WKH+RVHQRORQJHUFRQWDLQVÀXLGXQGHUSUHVVXUH7KHKLJKSUHVVXUHÀXLG
LVH[WUHPHO\GDQJHURXVDQGFDQFDXVHVHULRXVDQGSRWHQWLDOO\IDWDOLQMXU\
5.0 HOSE STORAGE
$JH&RQWURO+RVHDQG+RVH$VVHPEOLHVPXVWEHVWRUHGLQDPDQQHU
WKDWIDFLOLWDWHVDJHFRQWURODQG¿UVWLQDQG¿UVWRXWXVDJHEDVHGRQPDQXIDFWXULQJGDWHRIWKH+RVHDQG+RVH$VVHPEOLHV7KHVKHOIOLIHRIUXEEHU
+RVHRU+RVH$VVHPEOLHVWKDWKDYHSDVVHGYLVXDOLQVSHFWLRQDQGDSURRI
WHVWLV\HDUVTXDUWHUVIURPWKHGDWHRIPDQXIDFWXUH7KHVKHOIOLIH
RIWKHUPRSODVWLFDQGSRO\WHWUDÀXRURHWK\OHQH+RVHRU+RVH$VVHPEOLHVLV
FRQVLGHUHGWREHXQOLPLWHG
6WRUDJH6WRUHG+RVHDQG+RVH$VVHPEOLHVPXVWQRWEHVXEMHFWHG
WRGDPDJHWKDWFRXOGUHGXFHWKHLUH[SHFWHGVHUYLFHOLIHDQGPXVWEHSODFHG
LQDFRROGDUNDQGGU\DUHDZLWKWKHHQGVFDSSHG6WRUHG+RVHDQG+RVH
$VVHPEOLHVPXVWQRWEHH[SRVHGWRWHPSHUDWXUHH[WUHPHVR]RQHRLOVFRUURVLYHOLTXLGVRUIXPHVVROYHQWVKLJKKXPLGLW\URGHQWVLQVHFWVXOWUDYLROHW
OLJKWHOHFWURPDJQHWLF¿HOGVRUUDGLRDFWLYHPDWHULDOV
(ODVWRPHULFVHDOV(ODVWRPHULFVHDOVZLOOHYHQWXDOO\DJHKDUGHQZHDU
DQGGHWHULRUDWHXQGHUWKHUPDOF\FOLQJDQGFRPSUHVVLRQVHW(ODVWRPHULF
VHDOVVKRXOGEHLQVSHFWHGDQGUHSODFHG
5HIULJHUDQWJDVHV6SHFLDOFDUHVKRXOGEHWDNHQZKHQZRUNLQJZLWK
UHIULJHUDWLRQV\VWHPV6XGGHQHVFDSHRIUHIULJHUDQWJDVHVFDQFDXVHEOLQGQHVVLIWKHHVFDSLQJJDVHVFRQWDFWWKHH\HDQGFDQFDXVHIUHH]LQJRURWKHU
VHYHUHLQMXULHVLILWFRQWDFWVDQ\RWKHUSRUWLRQRIWKHERG\
G-23
Technical information
&RPSUHVVHGQDWXUDOJDV&1*3DUNHU&1*+RVH$VVHPEOLHVVKRXOG
EHWHVWHGDIWHULQVWDOODWLRQDQGEHIRUHXVHDQGDWOHDVWRQDPRQWKO\EDVLV
SHU$16,,$61*9&6$06HFWLRQ³9LVXDO,QVSHFWLRQ
+RVH)LWWLQJ´7KHUHFRPPHQGHGSURFHGXUHLVWRSUHVVXUL]HWKH+RVHDQG
FKHFNIRUOHDNVDQGWRYLVXDOO\LQVSHFWWKH+RVHIRUGDPDJH
&DXWLRQ0DWFKHVFDQGOHVRSHQÀDPHRURWKHUVRXUFHVRILJQLWLRQVKDOO
QRWEHXVHGIRU+RVHLQVSHFWLRQ/HDNFKHFNVROXWLRQVVKRXOGEHULQVHG
RIIDIWHUXVH
Catalogue 4462 Global Edition
Technical information
Technical information
Notes
G-24
Catalogue 4462 Global Edition
H
Index of part numbers
Table of contents
Chapter H
Index of part numbers
H-1
Catalogue 4462 Global Edition
Index
Index ..................................................................................................... H-2
Index of part numbers
Index
Index of part numbers
Part number
page
Part number
1018X-2-025 . . . . . . . . . . . . . . . . . . . . . . , B-11
1018X-2-04 . . . . . . . . . . . . . . . . . . . B-19, B-28
1018X-4-025 . . . . . . . . . . . . . . . . . . . . . . , B-11
1018X-4-04 . . . . . . . . . . . . . . . . . . . . . . . , B-28
1018X-4-04C . . . . . . . . . . . . . . . . . . . . . . , B-28
1018X-4-04ZE . . . . . . . . . . . . . . . . . . . . . . B-26
1018X-4-05 . . . . . . . . . . . . . . . . . . . . . . . . B-19
1018X-4-05C . . . . . . . . . . . . . . . . . . . . . . . B-19
1018X-6-04C . . . . . . . . . . . . . . . . . . . . . . , B-28
1018X-6-04ZE . . . . . . . . . . . . . . . . . . . . . . B-26
1018X-6-05 . . . . . . . . . . . . . . . . . . . . . . . . B-19
1018X-6-05C . . . . . . . . . . . . . . . . . . . . . . . B-19
1018X-6-06 . . . . . . . . . . . . . . . . . . . . . . . , B-11
1018X-6-06C . . . . . . . . . . . . . . . . . . . . . . . B-19
1018X-6-4 . . . . . . . . . . . . . . . . . . . . . . . . , B-28
1018X-8-06 . . . . . . . . . . . . . . . . . . . . . . . , B-11
1018X-8-06C . . . . . . . . . . . . . . . . . . . . . . . B-19
1018X-8-08 . . . . . . . . . . . . . . . . . . . . . . . , B-11
1018X-8-08C . . . . . . . . . . . . . . . . . . . . . . . B-19
101BL-12-12 . . . . . . . . . . . . . . . . . . . . . . . C-31
101BL-6-06 . . . . . . . . . . . . . . . . . . . . . . . . C-31
101BL-6-06ZE . . . . . . . . . . . . . . . . . . . . . . B-34
101BL-8-08 . . . . . . . . . . . . . . . . . . . . . . . . C-31
101BL-8-08C . . . . . . . . . . . . . . . . . . . . . . . C-31
101BL-8-08ZE . . . . . . . . . . . . . . . . . . . . . . B-34
101BS-8-08 . . . . . . . . . . . . . . . . . . . . . . . . C-28
101BS-8-08C . . . . . . . . . . . . . . . . . . . . . . C-28
101KY-4-04 . . . . . . . . . . . . . . . . . . . . . . . . C-24
101KY-4-04C . . . . . . . . . . . . . . . . . . . . . . . C-24
101KY-4-05 . . . . . . . . . . . . . . . . . . . . . . . . C-24
101KY-6-04 . . . . . . . . . . . . . . . . . . . . . . . . C-24
101KY-6-04C . . . . . . . . . . . . . . . . . . . . . . . C-24
101KY-6-05 . . . . . . . . . . . . . . . . . . . . . . . . C-24
101LX-12-12 . . . . . . . . . . . . . . . . . . . . . . . C-41
101LX-16-16 . . . . . . . . . . . . . . . . . . . . . . . C-41
101LX-2-025 . . . . . . . . . . . . . . . . . . . . . . . C-41
101LX-2-04 . . . . . . . . . . . . . . . . . . . . . . . . C-41
101LX-4-03 . . . . . . . . . . . . . . . . . . . . . . . . C-41
101LX-4-04 . . . . . . . . . . . . . . . . . . . . . . . . C-41
101LX-4-04C . . . . . . . . . . . . . . . . . . . . . . . C-41
101LX-4-05 . . . . . . . . . . . . . . . . . . . . . . . . C-41
101LX-4-05C . . . . . . . . . . . . . . . . . . . . . . . C-41
101LX-6-04 . . . . . . . . . . . . . . . . . . . . . . . . C-41
101LX-6-05 . . . . . . . . . . . . . . . . . . . . . . . . C-41
101LX-6-05C . . . . . . . . . . . . . . . . . . . . . . . C-41
02Y5-12-12C . . . . . . . . . . . . . . . . . . . . . . . E-15
02Y5-12-16C . . . . . . . . . . . . . . . . . . . . . . . E-15
02Y5-12-4C . . . . . . . . . . . . . . . . . . . . . . . . E-15
02Y5-12-6C . . . . . . . . . . . . . . . . . . . . . . . . E-15
02Y5-12-9C . . . . . . . . . . . . . . . . . . . . . . . . E-15
02Y5-16-12C . . . . . . . . . . . . . . . . . . . . . . . E-15
02Y5-16-16C . . . . . . . . . . . . . . . . . . . . . . . E-15
02Y5-16-6C . . . . . . . . . . . . . . . . . . . . . . . . E-15
02Y5-16-9C . . . . . . . . . . . . . . . . . . . . . . . . E-15
02Y5-2-12C . . . . . . . . . . . . . . . . . . . . . . . . E-15
02Y5-2-16C . . . . . . . . . . . . . . . . . . . . . . . . E-15
02Y5-2-4C . . . . . . . . . . . . . . . . . . . . . . . . . E-15
02Y5-2-6C . . . . . . . . . . . . . . . . . . . . . . . . . E-15
02Y5-2-9C . . . . . . . . . . . . . . . . . . . . . . . . . E-15
02Y5-4-12C . . . . . . . . . . . . . . . . . . . . . . . . E-15
02Y5-4-16C . . . . . . . . . . . . . . . . . . . . . . . . E-15
02Y5-4-4C . . . . . . . . . . . . . . . . . . . . . . . . . E-15
02Y5-4-6C . . . . . . . . . . . . . . . . . . . . . . . . . E-15
02Y5-4-9C . . . . . . . . . . . . . . . . . . . . . . . . . E-15
02Y5-6-12C . . . . . . . . . . . . . . . . . . . . . . . . E-15
02Y5-6-16C . . . . . . . . . . . . . . . . . . . . . . . . E-15
02Y5-6-4C . . . . . . . . . . . . . . . . . . . . . . . . . E-15
02Y5-6-6C . . . . . . . . . . . . . . . . . . . . . . . . . E-15
02Y5-6-9C . . . . . . . . . . . . . . . . . . . . . . . . . E-15
02Y5-8-12C . . . . . . . . . . . . . . . . . . . . . . . . E-15
02Y5-8-16C . . . . . . . . . . . . . . . . . . . . . . . . E-15
02Y5-8-4C . . . . . . . . . . . . . . . . . . . . . . . . . E-15
02Y5-8-6C . . . . . . . . . . . . . . . . . . . . . . . . . E-15
02Y5-8-8C . . . . . . . . . . . . . . . . . . . . . . . . . E-15
02Y6-12-6C . . . . . . . . . . . . . . . . . . . . . . . . E-29
02Y6-12-9C . . . . . . . . . . . . . . . . . . . . . . . . E-29
02Y6-16-9C . . . . . . . . . . . . . . . . . . . . . . . . E-29
02Y6-2-4C . . . . . . . . . . . . . . . . . . . . . . . . . E-29
02Y6-2-6C . . . . . . . . . . . . . . . . . . . . . . . . . E-29
02Y6-2-9C . . . . . . . . . . . . . . . . . . . . . . . . . E-29
02Y6-4-4C . . . . . . . . . . . . . . . . . . . . . . . . . E-29
02Y6-4-6C . . . . . . . . . . . . . . . . . . . . . . . . . E-29
02Y6-4-9C . . . . . . . . . . . . . . . . . . . . . . . . . E-29
02Y6-6-4C . . . . . . . . . . . . . . . . . . . . . . . . . E-29
02Y6-6-6C . . . . . . . . . . . . . . . . . . . . . . . . . E-29
02Y6-6-9C . . . . . . . . . . . . . . . . . . . . . . . . . E-29
02Y6-8-4C . . . . . . . . . . . . . . . . . . . . . . . . . E-29
02Y6-8-6C . . . . . . . . . . . . . . . . . . . . . . . . . E-29
02Y6-8-9C . . . . . . . . . . . . . . . . . . . . . . . . . E-29
1018X-1-04 . . . . . . . . . . . . . . . . . . . B-19, B-28
Index
page
H-2
Catalogue 4462 Global Edition
H
Index of part numbers
Index
page
Part number
page
106TX-4-02W . . . . . . . . . . . . . . . . . . . . . . C-10
106TX-6-03W . . . . . . . . . . . . . . . . . . . . . . C-10
106TX-6-04W . . . . . . . . . . . . . . . . . . . . . . C-10
1078X-4-04 . . . . . . . . . . . . . . . . . . . B-22, B-31
1078X-4-04C2W . . . . . . . . . . . . . . . B-22, B-31
1078X-6-05 . . . . . . . . . . . . . . . . . . . . . . . . B-22
1078X-6-05C2W . . . . . . . . . . . . . . . . . . . . B-22
1078X-6-06 . . . . . . . . . . . . . . . . . . . B-13, B-22
1078X-6-06C . . . . . . . . . . . . . . . . . . . . . . . B-13
1078X-6-06C2W . . . . . . . . . . . . . . . B-13, B-22
1078X-8-08 . . . . . . . . . . . . . . . . . . . . . . . . B-13
1078X-8-08C . . . . . . . . . . . . . . . . . . . . . . . B-13
1078X-8-08C2W . . . . . . . . . . . . . . . . . . . . B-13
10C8X-12-06 . . . . . . . . . . . . . . . . . . . . . . . . B-8
10C8X-14-06 . . . . . . . . . . . . . . . . . . . . . . . . B-8
10C8X-16-08 . . . . . . . . . . . . . . . . . . . . . . . . B-8
10K0101-12-12C . . . . . . . . . . . . . . . . . . . . E-39
10K0101-16-16C . . . . . . . . . . . . . . . . . . . . E-39
10K0202-12-12C . . . . . . . . . . . . . . . . . . . . E-37
10K0202-16-16C . . . . . . . . . . . . . . . . . . . . E-37
10KL02-12C . . . . . . . . . . . . . . . . . . . . . . . E-37
10KL02-16C . . . . . . . . . . . . . . . . . . . . . . . E-37
10KT02-12C . . . . . . . . . . . . . . . . . . . . . . . E-38
10KT02-16C . . . . . . . . . . . . . . . . . . . . . . . E-38
10KX02-12C . . . . . . . . . . . . . . . . . . . . . . . E-38
10KX02-16C . . . . . . . . . . . . . . . . . . . . . . . E-38
1158X-8-08 . . . . . . . . . . . . . . . . . . . . . . . . B-14
115NX-20-20 . . . . . . . . . . . . . . . . . . . . . . . B-14
1178X-8-08 . . . . . . . . . . . . . . . . . . . . . . . . B-15
117NX-20-20 . . . . . . . . . . . . . . . . . . . . . . . B-15
1198X-8-08 . . . . . . . . . . . . . . . . . . . . . . . . B-15
119NX-20-20 . . . . . . . . . . . . . . . . . . . . . . . B-15
11C8X-14-06 . . . . . . . . . . . . . . . . . . . . . . . . B-8
11C8X-16-08 . . . . . . . . . . . . . . . . . . . . . . . . B-8
13B8X-4-025 . . . . . . . . . . . . . . . . . . B-11, B-23
13B8X-4-04 . . . . . . . . . . . . . . . . . . . B-23, B-32
13B8X-6-04 . . . . . . . . . . . . . . . . . . . B-23, B-32
13B8X-6-05 . . . . . . . . . . . . . . . . . . . . . . . . B-23
13B8X-6-06 . . . . . . . . . . . . . . . . . . . B-11, B-23
13B8X-8-06 . . . . . . . . . . . . . . . . . . . B-11, B-23
13B8X-8-08 . . . . . . . . . . . . . . . . . . . . . . . , B-11
13BNX-24-20 . . . . . . . . . . . . . . . . . B-11, B-23
15K0101-1-1C . . . . . . . . . . . . . . . . . . . . . . E-39
15K0101-2-2C . . . . . . . . . . . . . . . . . . . . . . E-39
15K0101-4-4C . . . . . . . . . . . . . . . . . . . . . . E-39
101LX-6-06 . . . . . . . . . . . . . . . . . . . . . . . . C-41
101LX-8-06 . . . . . . . . . . . . . . . . . . . . . . . . C-41
101LX-8-06C . . . . . . . . . . . . . . . . . . . . . . . C-41
101LX-8-08 . . . . . . . . . . . . . . . . . . . . . . . . C-41
101LX-8-08C . . . . . . . . . . . . . . . . . . . . . . . C-41
101TX-1-025W . . . . . . . . . . . . . . . . . . . . . C-12
101TX-1-02W . . . . . . . . . . . . . . . . . . . . . . C-12
101TX-2-025W . . . . . . . . . . . . . . . . . . . . . C-12
101TX-2-02W . . . . . . . . . . . . . . . . . . . . . . C-12
101TX-2-03W . . . . . . . . . . . . . . . . . . . . . . C-12
101TX-4-025W . . . . . . . . . . . . . . . . . . . . . C-12
101TX-4-03W . . . . . . . . . . . . . . . . . . . . . . C-12
101TX-4-04W . . . . . . . . . . . . . . . . . . . . . . C-12
101TX-4-05W . . . . . . . . . . . . . . . . . . . . . . C-12
101TX-6-05W . . . . . . . . . . . . . . . . . . . . . . C-12
102TX-1-025W . . . . . . . . . . . . . . . . . . . . . C-12
102TX-2-03W . . . . . . . . . . . . . . . . . . . . . . C-12
102TX-4-04W . . . . . . . . . . . . . . . . . . . . . . C-12
1038X-10-08 . . . . . . . . . . . . . . . . . . . . . . . B-12
1038X-6-06 . . . . . . . . . . . . . . . . . . . . . . . . B-12
1038X-8-06 . . . . . . . . . . . . . . . . . . . . . . . . B-12
1038X-8-08 . . . . . . . . . . . . . . . . . . . . . . . . B-12
103NX-24-20 . . . . . . . . . . . . . . . . . . . . . . . B-12
1058X-4-04 . . . . . . . . . . . . . . . . . . . B-20, B-28
1058X-6-04 . . . . . . . . . . . . . . . . . . . B-20, B-28
1063X-6-06C . . . . . . . . . . . . . . . . . . . . . . . . B-3
1068X-10-08 . . . . . . . . . . . . . . . . . . . . . . . B-12
1068X-4-025 . . . . . . . . . . . . . . . . . . . . . . . B-12
1068X-4-04C . . . . . . . . . . . . . . . . . . . . . . , B-29
1068X-4-4 . . . . . . . . . . . . . . . . . . . . , B-3, B-29
1068X-5-04 . . . . . . . . . . . . . . . . . . . , B-3, B-29
1068X-5-04C . . . . . . . . . . . . . . . . . . . . . . , B-29
1068X-6-025 . . . . . . . . . . . . . . . . . . . . . . . B-12
1068X-6-04C . . . . . . . . . . . . . . . . . . , B-3, B-29
1068X-6-05 . . . . . . . . . . . . . . . . . . . . . . . . B-20
1068X-6-05C . . . . . . . . . . . . . . . . . . . . . . . B-20
1068X-6-06 . . . . . . . . . . . . . . . . . . . . . . . , B-12
1068X-6-06C . . . . . . . . . . . . . . . . . . B-12, B-20
1068X-6-4 . . . . . . . . . . . . . . . . . . . . . . . . , B-29
1068X-8-05 . . . . . . . . . . . . . . . . . . . . . . . . B-20
1068X-8-06 . . . . . . . . . . . . . . . . . . . . . . . . B-12
1068X-8-08 . . . . . . . . . . . . . . . . . . . . . . . , B-12
1068X-8-08C . . . . . . . . . . . . . . . . . . . . . . , B-12
106NX-20-20 . . . . . . . . . . . . . . . . . . . . . . . B-12
106TX-4-025W . . . . . . . . . . . . . . . . . . . . . C-10
H-3
Catalogue 4462 Global Edition
Index
Part number
Index of part numbers
Index
Part number
page
Part number
192BS-8-08 . . . . . . . . . . . . . . . . . . . . . . . . C-28
192BS-8-08C . . . . . . . . . . . . . . . . . . . . . . C-28
192EH-12-12 . . . . . . . . . . . . . . . . . . . . C-3, C-6
192EH-16-16 . . . . . . . . . . . . . . . . . . . . C-3, C-6
192EH-20-20 . . . . . . . . . . . . . . . . . . . . C-3, C-6
192EH-8-08 . . . . . . . . . . . . . . . . . . . . . C-3, C-6
192KX-4-04W . . . . . . . . . . . . . . . . . . . . . . C-26
192KX-6-05W . . . . . . . . . . . . . . . . . . . . . . C-26
192KX-6-06W . . . . . . . . . . . . . . . . . . . . . . C-17
192KY-6-05 . . . . . . . . . . . . . . . . . . . . . . . . C-21
192LX-12-08C . . . . . . . . . . . . . . . . . . . . . . C-38
192LX-16-12 . . . . . . . . . . . . . . . . . . . . . . . C-38
192LX-16-12C4462 . . . . . . . . . . . . . . . . . . C-38
192LX-20-16 . . . . . . . . . . . . . . . . . . . . . . . C-38
192LX-4-03 . . . . . . . . . . . . . . . . . . . . . . . . C-38
192LX-4-03C . . . . . . . . . . . . . . . . . . . . . . . C-38
192LX-6-05 . . . . . . . . . . . . . . . . . . . . . . . . C-38
192LX-6-05C . . . . . . . . . . . . . . . . . . . . . . . C-38
192LX-8-06 . . . . . . . . . . . . . . . . . . . . . . . . C-38
192LX-8-06C . . . . . . . . . . . . . . . . . . . . . . . C-38
192LX-8-08 . . . . . . . . . . . . . . . . . . . C-38, B-21
192LX-8-08C . . . . . . . . . . . . . . . . . . C-38, B-21
192LX-8-08W . . . . . . . . . . . . . . . . . . . . . . C-17
1AY2X-10-05 . . . . . . . . . . . . . C-51, C-64, C-71
1AY2X-13-05 . . . . . . . . . . . . . C-51, C-64, C-71
1AY2X-6-025 . . . . . . . . . . . . . . . . . . C-51, C-64
1AY2X-6-03 . . . . . . . . . . . . . . C-51, C-64, C-71
1AY2X-8-05 . . . . . . . . . . . . . . C-51, C-64, C-71
1AY5X-11-08 . . . . . . . . . . . . . . . . . . . . . . . C-54
1AY5X-16-12 . . . . . . . . . . . . . . . . . . . . . . . C-54
1AY5X-6-03 . . . . . . . . . . . . . . . . . . . . . . . . C-54
1AY8X-6-025 . . . . . . . . . . . . . . . . . . . . . . . B-14
1AY8X-6-04 . . . . . . . . . . . . . . . . . . . B-22, B-30
1AY8X-8-05 . . . . . . . . . . . . . . . . . . . . . . . . B-22
1AY8X-8-06 . . . . . . . . . . . . . . . . . . . . . . . . B-22
1AYBL-11-06 . . . . . . . . . . . . . . . . . . . . . . . C-32
1AYBL-11-08 . . . . . . . . . . . . . . . . . . . . . . . C-32
1AYBL-11-08C . . . . . . . . . . . . . . . . . . . . . C-32
1AYBS-11-08. . . . . . . . . . . . . . . . . . . . . . . C-29
1AYBS-11-08C . . . . . . . . . . . . . . . . . . . . . C-29
1AYCX-16-16W . . . . . . . . . . . . . . . . . . . . . C-57
1AYJX-11-08W . . . . . . . . . . . . . . . . . . . . . C-51
1AYJX-16-12W . . . . . . . . . . . . . . . . C-51, C-57
1AYKX-6-04W . . . . . . . . . . . . . . . . . . . . . . C-26
1AYKX-8-05W . . . . . . . . . . . . . . . . . . . . . . C-26
15K0101-6-6C . . . . . . . . . . . . . . . . . . . . . . E-39
15K0101-8-8C . . . . . . . . . . . . . . . . . . . . . . E-39
15K0201-1-8C . . . . . . . . . . . . . . . . . . . . . . E-39
15K0201-2-8C . . . . . . . . . . . . . . . . . . . . . . E-39
15K0201-4-8C . . . . . . . . . . . . . . . . . . . . . . E-39
15K0201-6-8C . . . . . . . . . . . . . . . . . . . . . . E-39
15K0202-2-2C . . . . . . . . . . . . . . . . . . . . . . E-37
15K0202-4-4C . . . . . . . . . . . . . . . . . . . . . . E-37
15K0202-6-6C . . . . . . . . . . . . . . . . . . . . . . E-37
15K0202-8-8C . . . . . . . . . . . . . . . . . . . . . . E-37
15KL02-4C . . . . . . . . . . . . . . . . . . . . . . . . E-37
15KL02-6C . . . . . . . . . . . . . . . . . . . . . . . . E-37
15KL02-8C . . . . . . . . . . . . . . . . . . . . . . . . E-37
15KT02-4C . . . . . . . . . . . . . . . . . . . . . . . . E-38
15KT02-6C . . . . . . . . . . . . . . . . . . . . . . . . E-38
15KT02-8C . . . . . . . . . . . . . . . . . . . . . . . . E-38
15KX02-4C . . . . . . . . . . . . . . . . . . . . . . . . E-38
15KX02-6C . . . . . . . . . . . . . . . . . . . . . . . . E-38
15KX02-8C . . . . . . . . . . . . . . . . . . . . . . . . E-38
16A8X-8-08 . . . . . . . . . . . . . . . . . . . . . . . . B-16
16ANX-20-20. . . . . . . . . . . . . . . . . . . . . . . B-16
16F8X-8-08 . . . . . . . . . . . . . . . . . . . . . . . . B-16
16FNX-20-20 . . . . . . . . . . . . . . . . . . . . . . . B-16
16N8X-8-08 . . . . . . . . . . . . . . . . . . . . . . . . B-17
16NNX-20-20 . . . . . . . . . . . . . . . . . . . . . . B-17
16Y2X-4-025 . . . . . . . . . . . . . . . . . . C-52, C-64
16Y2X-4-03 . . . . . . . . . . . . . . . . . . . C-52, C-64
1922X-4-025 . . . . . . . . . . . . . . . . . . C-52, C-65
1922X-4-03 . . . . . . . . . . . . . . . . . . . C-52, C-65
1923X-8-06C . . . . . . . . . . . . . . . . . . . . . . . . B-3
1925X-4-3 . . . . . . . . . . . . . . . . . . . . . . . . . C-55
1928X-4-025 . . . . . . . . . . . . . . . . . . . B-9, B-21
1928X-4-04 . . . . . . . . . . . . . . . . . . . B-21, B-29
1928X-4-04C . . . . . . . . . . . . . . . . . . B-21, B-29
1928X-6-04C . . . . . . . . . . . . . . . . . . . . . . . . B-3
1928X-6-06 . . . . . . . . . . . . . . . . . . . . B-9, B-21
1928X-6-06C . . . . . . . . . . . . . . . . . . . . . . . B-21
1928X-8-06 . . . . . . . . . . . . . . . . . . . . B-9, B-21
1928X-8-06C . . . . . . . . . . . . . . . . . . . . . . . B-21
1928X-8-08 . . . . . . . . . . . . . . . . . . . . . . . . . B-9
192BC-8-06 . . . . . . . . . . . . . . . . . . . . . . . . C-31
192BL-16-12 . . . . . . . . . . . . . . . . . . . . . . . C-31
192BL-6-06 . . . . . . . . . . . . . . . . . . . . . . . . C-31
192BL-8-08 . . . . . . . . . . . . . . . . . . . . . . . . C-31
192BL-8-08C . . . . . . . . . . . . . . . . . . . . . . . C-31
Index
page
H-4
Catalogue 4462 Global Edition
H
Index of part numbers
Index
page
Part number
page
1C95X-25-12 . . . . . . . . . . . . . . . . . . . . . . . C-54
1C98X-10-04 . . . . . . . . . . . . . . . . . . . . . . , B-32
1C98X-10-04C . . . . . . . . . . . . . . . . , B-4, B-32
1C98X-12-04 . . . . . . . . . . . . . . . . . . . . . . . B-24
1C98X-12-05 . . . . . . . . . . . . . . . . . . . . . . . B-24
1C98X-12-06 . . . . . . . . . . . . . . . . . . . . . . . , B-7
1C98X-12-06C . . . . . . . . . . . . . . . . . . . . . B-24
1C98X-14-06 . . . . . . . . . . . . . . . . . . . . . . . , B-7
1C98X-14-06C . . . . . . . . . . . . . . . . . . . . . B-24
1C98X-16-05 . . . . . . . . . . . . . . . . . . . . . . . B-24
1C98X-16-08 . . . . . . . . . . . . . . . . . . . . . . . . B-7
1C98X-8-025 . . . . . . . . . . . . . . . . . . . . . . . , B-7
1C98X-8-025C . . . . . . . . . . . . . . . . . . . . . B-24
1C98X-8-04 . . . . . . . . . . . . . . . . . . . . . . . , B-32
1C98X-8-04C . . . . . . . . . . . . . . . . . , B-4, B-32
1C9BL-14-06 . . . . . . . . . . . . . . . . . . . . . . . C-32
1C9BL-14-08 . . . . . . . . . . . . . . . . . . . . . . . C-32
1C9BL-14-08C . . . . . . . . . . . . . . . . . . . . . C-32
1C9BL-16-06 . . . . . . . . . . . . . . . . . . . . . . . C-32
1C9BL-16-08 . . . . . . . . . . . . . . . . . . . . . . . C-32
1C9BL-16-08C . . . . . . . . . . . . . . . . . . . . . C-32
1C9BL-25-12 . . . . . . . . . . . . . . . . . . . . . . . C-32
1C9BS-14-08 . . . . . . . . . . . . . . . . . . . . . . C-28
1C9BS-14-08C . . . . . . . . . . . . . . . . . . . . . C-28
1C9BS-16-08 . . . . . . . . . . . . . . . . . . . . . . C-28
1C9BS-16-08C . . . . . . . . . . . . . . . . . . . . . C-28
1C9CX-30-16W . . . . . . . . . . . . . . . . . . . . . C-57
1C9JX-16-08W . . . . . . . . . . . . . . . . . . . . . C-51
1C9JX-25-12W . . . . . . . . . . . . . . . . C-51, C-57
1C9JX-30-16W . . . . . . . . . . . . . . . . . . . . . C-51
1C9KX-10-04W . . . . . . . . . . . . . . . . . . . . . C-26
1C9KX-14-06W . . . . . . . . . . . . . . . . . . . . . C-17
1C9KX-16-05W . . . . . . . . . . . . . . . . . . . . . C-26
1C9KY-10-04 . . . . . . . . . . . . . . . . . . . . . . . C-21
1C9KY-10-04C . . . . . . . . . . . . . . . . . . . . . C-21
1C9KY-12-05 . . . . . . . . . . . . . . . . . . . . . . . C-21
1C9KY-14-05 . . . . . . . . . . . . . . . . . . . . . . . C-21
1C9KY-16-04 . . . . . . . . . . . . . . . . . . . . . . . C-21
1C9KY-16-04C . . . . . . . . . . . . . . . . . . . . . C-21
1C9KY-16-05 . . . . . . . . . . . . . . . . . . . . . . . C-21
1C9LX-10-04 . . . . . . . . . . . . . . . . . . . . . . . C-35
1C9LX-12-05 . . . . . . . . . . . . . . . . . . . . . . . C-35
1C9LX-12-06 . . . . . . . . . . . . . . . . . . . . . . . C-35
1C9LX-14-03 . . . . . . . . . . . . . . . . . . . . . . . C-35
1C9LX-14-05 . . . . . . . . . . . . . . . . . . . . . . . C-35
1AYKX-8-06W . . . . . . . . . . . . . . . . . . . . . . C-18
1AYKY-6-04 . . . . . . . . . . . . . . . . . . . . . . . . C-22
1AYKY-6-04C . . . . . . . . . . . . . . . . . . . . . . C-22
1AYKY-8-05 . . . . . . . . . . . . . . . . . . . . . . . . C-22
1AYLX-11-08 . . . . . . . . . . . . . . . . . . C-18, C-36
1AYLX-11-08C. . . . . . . . . . . . . . . . . . . . . . C-36
1AYLX-16-12 . . . . . . . . . . . . . . . . . . . . . . . C-36
1AYLX-16-12C4462. . . . . . . . . . . . . . . . . . C-36
1AYLX-6-02 . . . . . . . . . . . . . . . . . . . . . . . . C-36
1AYLX-6-025 . . . . . . . . . . . . . . . . . . . . . . . C-36
1AYLX-6-03 . . . . . . . . . . . . . . . . . . . . . . . . C-36
1AYLX-6-03C. . . . . . . . . . . . . . . . . . . . . . . C-36
1AYLX-6-04 . . . . . . . . . . . . . . . . . . . . . . . . C-36
1AYLX-6-04C. . . . . . . . . . . . . . . . . . . . . . . C-36
1AYLX-8-05 . . . . . . . . . . . . . . . . . . . . . . . . C-36
1AYLX-8-05C. . . . . . . . . . . . . . . . . . . . . . . C-36
1AYLX-8-06 . . . . . . . . . . . . . . . . . . . . . . . . C-36
1AYLX-8-06C. . . . . . . . . . . . . . . . . . . . . . . C-36
1AYTX-6-025W . . . . . . . . . . . . . . . . . . . . . C-10
1AYTX-6-02W . . . . . . . . . . . . . . . . . . . . . . C-10
1AYTX-6-03W . . . . . . . . . . . . . . . . . . . . . . C-10
1AYTX-6-04W . . . . . . . . . . . . . . . . . . . . . . C-10
1AYTX-8-05W . . . . . . . . . . . . . . . . . . . . . . C-10
1C35X-8-03 . . . . . . . . . . . . . . . . . . . . . . . . C-54
1C38X-10-06 . . . . . . . . . . . . . . . . . . . . . . . . B-6
1C38X-10-06C2W . . . . . . . . . . . . . . . . . . . . B-6
1C38X-12-06 . . . . . . . . . . . . . . . . . . . . . . . . B-6
1C38X-12-06C2W . . . . . . . . . . . . . . . . . . . . B-6
1C38X-12-08 . . . . . . . . . . . . . . . . . . . . . . . . B-6
1C38X-12-08C2W . . . . . . . . . . . . . . . . . . . . B-6
1C38X-15-08 . . . . . . . . . . . . . . . . . . . . . . . . B-6
1C38X-15-08C2W . . . . . . . . . . . . . . . . . . . . B-6
1C38X-8-06 . . . . . . . . . . . . . . . . . . . . . . . . . B-6
1C3LX-8-025 . . . . . . . . . . . . . . . . . . . . . . . C-39
1C3LX-8-03 . . . . . . . . . . . . . . . . . . . . . . . . C-39
1C3LX-8-03C . . . . . . . . . . . . . . . . . . . . . . C-39
1C3LX-8-04 . . . . . . . . . . . . . . . . . . . . . . . . C-39
1C3LX-8-04C . . . . . . . . . . . . . . . . . . . . . . C-39
1C68X-14-06 . . . . . . . . . . . . . . . . . . . . . . . . B-7
1C68X-16-08 . . . . . . . . . . . . . . . . . . . . . . . . B-7
1C6LX-12-04 . . . . . . . . . . . . . . . . . . . . . . . C-40
1C6LX-12-05 . . . . . . . . . . . . . . . . . . . . . . . C-40
1C92X-12-05 . . . . . . . . . . . . . . . . . . C-51, C-66
1C93X-14-06C . . . . . . . . . . . . . . . . . . . . . . B-4
1C95X-16-08 . . . . . . . . . . . . . . . . . . . . . . . C-54
H-5
Catalogue 4462 Global Edition
Index
Part number
Index of part numbers
Index
Part number
page
Part number
1D9LX-4-05 . . . . . . . . . . . . . . . . . . . . . . . . C-39
1D9LX-4-06 . . . . . . . . . . . . . . . . . . . . . . . . C-39
1MR2X . . . . . . . . . . . . . . . . . . . . . . . . . . . . C-53
1MR2X-12-03 . . . . . . . . . . . . . . . . . . . . . . C-53
1MR2X-8-03 . . . . . . . . . . . . . . . . . . . . . . . C-53
1MRLX-6-03 . . . . . . . . . . . . . . . . . . . . . . . C-40
1MRLX-8-03 . . . . . . . . . . . . . . . . . . . . . . . C-40
1TM2X-8-03-HPK . . . . . . . . . C-53, C-66, C-71
1TM2X-8-05-HPK . . . . . . . . . C-53, C-66, C-71
1TMBL-9-08-HPK . . . . . . . . . . . . . . . . . . . C-32
1TMBS-8-05-HPK . . . . . . . . . . . . . . . . . . . C-24
1TMBS-9-08-HPK . . . . . . . . . . . . . . . . . . . C-29
1U08X-4-04 . . . . . . . . . . . . . . . . . . . . . . . , B-31
1U08X-4-04C2W . . . . . . . . . . . . . . . . . . . , B-31
1U08X-6-04 . . . . . . . . . . . . . . . . . . . . . . . , B-31
1U08X-6-04C2W . . . . . . . . . . . . . . . . . . . , B-31
1U08X-6-05 . . . . . . . . . . . . . . . . . . . . . . . . B-23
1U08X-6-05C2W . . . . . . . . . . . . . . . . . . . . B-23
1U08X-6-06 . . . . . . . . . . . . . . . . . . . . . . . , B-10
1U08X-6-06C2W . . . . . . . . . . . . . . . . . . . , B-10
1U08X-8-06 . . . . . . . . . . . . . . . . . . . . . . . , B-10
1U08X-8-06C2W . . . . . . . . . . . . . . . . . . . , B-10
1U08X-8-08 . . . . . . . . . . . . . . . . . . . . . . . , B-10
1U08X-8-08C2W . . . . . . . . . . . . . . . . . . . . B-10
1U0KY-4-04 . . . . . . . . . . . . . . . . . . . . . . . . C-23
1U0KY-4-04C . . . . . . . . . . . . . . . . . . . . . . C-23
1U0NX-24-20 . . . . . . . . . . . . . . . . . . . . . . B-10
1U0TX-2-02W . . . . . . . . . . . . . . . . . . . . . . C-11
1U0TX-4-025W . . . . . . . . . . . . . . . . . . . . . C-11
1U0TX-4-02W . . . . . . . . . . . . . . . . . . . . . . C-11
1U0TX-4-03W . . . . . . . . . . . . . . . . . . . . . . C-11
1U0TX-4-04W . . . . . . . . . . . . . . . . . . . . . . C-11
1U0TX-6-05W . . . . . . . . . . . . . . . . . . . . . . C-11
1Y2CX-16-16W . . . . . . . . . . . . . . . . . . . . . C-57
1Y2JX-16-12W . . . . . . . . . . . . . . . . . . . . . C-52
1Y2JX-16-16W . . . . . . . . . . . . . . . . . . . . . C-52
1Y2LX-12-08C. . . . . . . . . . . . . . . . . . . . . . C-45
1Y2LX-12-12C4462. . . . . . . . . . . . . . . . . . C-45
1Y2LX-3-04C. . . . . . . . . . . . . . . . . . . . . . . C-45
1Y2LX-6-025 . . . . . . . . . . . . . . . . . . . . . . . C-45
1Y2LX-6-03 . . . . . . . . . . . . . . . . . . . . . . . . C-45
1Y2LX-6-04 . . . . . . . . . . . . . . . . . . . . . . . . C-45
1Y2LX-9-05 . . . . . . . . . . . . . . . . . . . . . . . . C-45
1Y2LX-9-06C. . . . . . . . . . . . . . . . . . . . . . . C-45
1Y2LX-9-08 . . . . . . . . . . . . . . . . . . . . . . . . C-45
1C9LX-14-06 . . . . . . . . . . . . . . . . . . . . . . . C-35
1C9LX-14-06C . . . . . . . . . . . . . . . . . . . . . C-35
1C9LX-16-03 . . . . . . . . . . . . . . . . . . . . . . . C-35
1C9LX-16-04 . . . . . . . . . . . . . . . . . . . . . . . C-35
1C9LX-16-05 . . . . . . . . . . . . . . . . . . . . . . . C-35
1C9LX-16-05C . . . . . . . . . . . . . . . . . . . . . C-35
1C9LX-16-06 . . . . . . . . . . . . . . . . . . . . . . . C-35
1C9LX-16-06C . . . . . . . . . . . . . . . . . . . . . C-35
1C9LX-16-08 . . . . . . . . . . . . . B-24, C-17, C-35
1C9LX-16-08C . . . . . . . . . . . . . . . . . . . . . C-35
1C9LX-25-12 . . . . . . . . . . . . . . . . . . . . . . . C-35
1C9LX-25-12C4462 . . . . . . . . . . . . . . . . . C-35
1C9LX-30-16 . . . . . . . . . . . . . . . . . . . . . . . C-35
1C9LX-8-025 . . . . . . . . . . . . . . . . . . . . . . . C-35
1C9NX-38-20 . . . . . . . . . . . . . . . . . . . . . . , B-7
1C9TX-10-04W . . . . . . . . . . . . . . . . . . . . . C-11
1C9TX-12-05W . . . . . . . . . . . . . . . . . . . . . C-11
1C9TX-14-05W . . . . . . . . . . . . . . . . . . . . . C-11
1C9TX-16-025W . . . . . . . . . . . . . . . . . . . . C-11
1C9TX-16-02W . . . . . . . . . . . . . . . . . . . . . C-11
1C9TX-16-03W . . . . . . . . . . . . . . . . . . . . . C-11
1C9TX-16-04W . . . . . . . . . . . . . . . . . . . . . C-11
1C9TX-16-05W . . . . . . . . . . . . . . . . . . . . . C-11
1D28X-12-06 . . . . . . . . . . . . . . . . . . . . . . . . B-9
1D28X-14-06 . . . . . . . . . . . . . . . . . . . . . . . . B-9
1D28X-16-08 . . . . . . . . . . . . . . . . . . . . . . . . B-9
1D2NX-38-20 . . . . . . . . . . . . . . . . . . . . . . . B-9
1D98X-4-025 . . . . . . . . . . . . . . . . . . . . . . . B-21
1D98X-4-025C . . . . . . . . . . . . . . . . . . . . . B-21
1D98X-4-04C . . . . . . . . . . . . . . . . . B-21, B-30
1D98X-4-4 . . . . . . . . . . . . . . . . . . . . B-21, B-30
1D98X-6-04C . . . . . . . . . . . . . . . . . . . . . . B-21
1D98X-6-05 . . . . . . . . . . . . . . . . . . . . . . . . B-21
1D98X-6-06 . . . . . . . . . . . . . . . . . . . . . . . . B-21
1D98X-6-06C . . . . . . . . . . . . . . . . . . . . . . B-21
1D98X-8-08 . . . . . . . . . . . . . . . . . . . . . . . . B-21
1D9EH-12-12 . . . . . . . . . . . . . . . . . . . C-3, C-6
1D9EH-16-16 . . . . . . . . . . . . . . . . . . . C-3, C-6
1D9EH-20-20 . . . . . . . . . . . . . . . . . . . C-3, C-6
1D9EH-8-08 . . . . . . . . . . . . . . . . . . . . C-3, C-6
1D9KY-4-04 . . . . . . . . . . . . . . . . . . . . . . . . C-23
1D9KY-4-04C . . . . . . . . . . . . . . . . . . . . . . C-23
1D9LX-4-025 . . . . . . . . . . . . . . . . . . . . . . . C-39
1D9LX-4-03 . . . . . . . . . . . . . . . . . . . . . . . . C-39
1D9LX-4-04 . . . . . . . . . . . . . . . . . . . . . . . . C-39
Index
page
H-6
Catalogue 4462 Global Edition
H
Index of part numbers
Index
page
Part number
page
1YHTX-4-025W-LH . . . . . . . . . . . . . . . . . . C-15
1YHTX-6-03W . . . . . . . . . . . . . . . . . . . . . . C-15
1YHTX-6-03W-LH . . . . . . . . . . . . . . . . . . . C-15
1YHTX-6-04W . . . . . . . . . . . . . . . . . . . . . . C-15
1YHTX-6-04W-LH . . . . . . . . . . . . . . . . . . . C-15
1YHTX-6-05W . . . . . . . . . . . . . . . . . . . . . . C-15
1YHTX-6-05W-LH . . . . . . . . . . . . . . . . . . . C-15
1YM2X-6-025 . . . . . . . . . . . . . . . . . C-50, C-63
1YM2X-6-03 . . . . . . . . . . . . . C-50, C-63, C-70
1YM2X-6-04 . . . . . . . . . . . . . . . . . . . . . . . C-50
1YM2X-6-05 . . . . . . . . . . . . . C-50, C-63, C-70
1YMJX-11-08W . . . . . . . . . . . . . . . . . . . . . C-50
1YMJX-12-08W . . . . . . . . . . . . . . . . . . . . . C-50
1YMKY-6-05 . . . . . . . . . . . . . . . . . . . . . . . C-22
1YMLX-11-08 . . . . . . . . . . . . . . . . . . . . . . C-36
1YMLX-11-12C4462 . . . . . . . . . . . . . . . . . C-36
1YMLX-6-025 . . . . . . . . . . . . . . . . . . . . . . C-36
1YMLX-6-05 . . . . . . . . . . . . . . . . . . . . . . . C-36
1YZTX-1-025W . . . . . . . . . . . . . . . . . . . . . C-14
1YZTX-1-02WS . . . . . . . . . . . . . . . . . . . . . C-14
1YZTX-2-025W . . . . . . . . . . . . . . . . . . . . . C-14
1YZTX-2-02W . . . . . . . . . . . . . . . . . . . . . . C-14
1YZTX-2-03W . . . . . . . . . . . . . . . . . . . . . . C-14
1YZTX-4-025W . . . . . . . . . . . . . . . . . . . . . C-14
1YZTX-4-03W . . . . . . . . . . . . . . . . . . . . . . C-14
1YZTX-5-025W . . . . . . . . . . . . . . . . . . . . . C-14
1YZTX-5-04W . . . . . . . . . . . . . . . . . . . . . . C-14
1YZTX-5-05W . . . . . . . . . . . . . . . . . . . . . . C-14
2022N-04V15-10K. . . . . . . . . . . . . . . . . . . . B-2
2022N-06V15-10K. . . . . . . . . . . . . . . . . . . . B-2
216-200-18 . . . . . . . . . . . . . . . . . . . . . . . . . F-2
220-200-22 . . . . . . . . . . . . . . . . . . . . . . . . . F-2
2240D-025V32-TC . . . . . . . . . . . . . . . . . . . C-8
2240D-02V32-TC . . . . . . . . . . . . . . . . . . . . C-8
2240D-03V32-TC . . . . . . . . . . . . . . . . . . . . C-8
2240D-04V32-TC . . . . . . . . . . . . . . . . . . . . C-8
2244N-025V00 . . . . . . . . . . . . . . . . . . . . . . B-5
2244N-06V00 . . . . . . . . . . . . . . . . . . . . . . . B-5
2244N-06V10W . . . . . . . . . . . . . . . . . . . . . C-16
2244N-08V10 . . . . . . . . . . . . . . . . . . . . . . . B-5
2244N-08V10W . . . . . . . . . . . . . . . . . . . . . C-16
2244N-20V30 . . . . . . . . . . . . . . . . . . . . . . . B-5
2248D-025V32-TC . . . . . . . . . . . . . . . . . . . C-9
2248D-03V32-TC . . . . . . . . . . . . . . . . . . . . C-9
2248D-05V32-TC . . . . . . . . . . . . . . . . . . . . C-9
1Y42X-4-025 . . . . . . . . . . . . . . . . . . C-50, C-63
1Y42X-4-03 . . . . . . . . . . . . . . . . . . . C-50, C-63
1Y42X-6-025 . . . . . . . . . . . . . . . . . . C-50, C-63
1Y42X-6-03 . . . . . . . . . . . . . . C-50, C-63, C-70
1Y42X-6-04 . . . . . . . . . . . . . . . . . . . . . . . . C-50
1Y42X-6-05 . . . . . . . . . . . . . . C-50, C-63, C-70
1Y42X-9-03 . . . . . . . . . . . . . . C-50, C-63, C-70
1Y42X-9-04 . . . . . . . . . . . . . . . . . . . . . . . . C-50
1Y42X-9-05 . . . . . . . . . . . . . . C-50, C-63, C-70
1Y4KY-9-05 . . . . . . . . . . . . . . . . . . . . . . . . C-22
1Y9LX-4-03 . . . . . . . . . . . . . . . . . . . . . . . . C-38
1Y9LX-4-03C. . . . . . . . . . . . . . . . . . . . . . . C-38
1Y9LX-6-05 . . . . . . . . . . . . . . . . . . . . . . . . C-38
1Y9LX-8-08 . . . . . . . . . . . . . . . . . . . . . . . . C-38
1YA5X-1-03 . . . . . . . . . . . . . . . . . . . . . . . . C-55
1YA5X-3-03 . . . . . . . . . . . . . . . . . . . . . . . . C-55
1YALX-1-025 . . . . . . . . . . . . . . . . . . . . . . . C-37
1YALX-1-025C. . . . . . . . . . . . . . . . . . . . . . C-37
1YALX-1-03 . . . . . . . . . . . . . . . . . . . . . . . . C-37
1YALX-1-03C. . . . . . . . . . . . . . . . . . . . . . . C-37
1YALX-3-025 . . . . . . . . . . . . . . . . . . . . . . . C-37
1YALX-3-03 . . . . . . . . . . . . . . . . . . . . . . . . C-37
1YALX-3-03C. . . . . . . . . . . . . . . . . . . . . . . C-37
1YALX-3-04 . . . . . . . . . . . . . . . . . . . . . . . . C-37
1YALX-3-05C. . . . . . . . . . . . . . . . . . . . . . . C-37
1YALX-6-03 . . . . . . . . . . . . . . . . . . . . . . . . C-37
1YALX-6-03C. . . . . . . . . . . . . . . . . . . . . . . C-37
1YALX-6-04 . . . . . . . . . . . . . . . . . . . . . . . . C-37
1YALX-6-05 . . . . . . . . . . . . . . . . . . . . . . . . C-37
1YALX-6-05C. . . . . . . . . . . . . . . . . . . . . . . C-37
1YALX-6-06 . . . . . . . . . . . . . . . . . . . . . . . . C-37
1YBKY-4-04. . . . . . . . . . . . . . . . . . . . . . . . C-24
1YBKY-4-04C . . . . . . . . . . . . . . . . . . . . . . C-24
1YBKY-4-05. . . . . . . . . . . . . . . . . . . . . . . . C-24
1YBKY-6-05. . . . . . . . . . . . . . . . . . . . . . . . C-24
1YBTX-2-025W . . . . . . . . . . . . . . . . . . . . . C-15
1YBTX-2-02W . . . . . . . . . . . . . . . . . . . . . . C-15
1YBTX-2-03W . . . . . . . . . . . . . . . . . . . . . . C-15
1YBTX-2-04W . . . . . . . . . . . . . . . . . . . . . . C-15
1YBTX-4-025W . . . . . . . . . . . . . . . . . . . . . C-15
1YBTX-4-03W . . . . . . . . . . . . . . . . . . . . . . C-15
1YBTX-4-04W . . . . . . . . . . . . . . . . . . . . . . C-15
1YBTX-4-05W . . . . . . . . . . . . . . . . . . . . . . C-15
1YBTX-6-05W . . . . . . . . . . . . . . . . . . . . . . C-15
1YHTX-4-025W . . . . . . . . . . . . . . . . . . . . . C-15
H-7
Catalogue 4462 Global Edition
Index
Part number
Index of part numbers
Index
Part number
page
Part number
2740D-05V34 . . . . . . . . . . . . . . . . . . . . . . C-58
2740D-08V30 . . . . . . . . . . . . . . . . . . . . . . C-58
2741D-05V34/10 . . . . . . . . . . . . . . . . . . . . C-59
2748D-05V34 . . . . . . . . . . . . . . . . . C-60, C-61
2749D-03V34 . . . . . . . . . . . . . . . . . . . . . . C-62
2749D-05V34 . . . . . . . . . . . . . . . . . . . . . . C-62
2840D-03V34 . . . . . . . . . . . . . . . . . . . . . . C-67
2840D-05V36 . . . . . . . . . . . . . . . . . . . . . . C-67
2840D-08V30 . . . . . . . . . . . . . . . . . . . . . . C-67
2841D-05V36/17 . . . . . . . . . . . . . . . . . . . . C-68
2848D-05V34 . . . . . . . . . . . . . . . . . . . . . . C-69
2848D-08V30 . . . . . . . . . . . . . . . . . . . . . . C-69
2849D-05V34 . . . . . . . . . . . . . . . . . . . . . . C-72
292EJ-12-12 . . . . . . . . . . . . . . . . . . . . . . . . C-7
292EJ-16-16 . . . . . . . . . . . . . . . . . . . . . . . . C-7
292EJ-20-20 . . . . . . . . . . . . . . . . . . . . . . . . C-7
292EJ-8-08 . . . . . . . . . . . . . . . . . . . . . . . . . C-7
292NC-12-12. . . . . . . . . . . . . . . . . . . . . . . . C-4
292NC-16-16. . . . . . . . . . . . . . . . . . . . . . . . C-4
292NC-20-20. . . . . . . . . . . . . . . . . . . . . . . . C-4
292NC-8-08. . . . . . . . . . . . . . . . . . . . . . . . . C-4
2D9EJ-12-12 . . . . . . . . . . . . . . . . . . . . . . . . C-7
2D9EJ-16-16 . . . . . . . . . . . . . . . . . . . . . . . . C-7
2D9EJ-20-20 . . . . . . . . . . . . . . . . . . . . . . . . C-7
2D9EJ-8-08 . . . . . . . . . . . . . . . . . . . . . . . . . C-7
2D9NC-12-12 . . . . . . . . . . . . . . . . . . . . . . . C-4
2D9NC-16-16 . . . . . . . . . . . . . . . . . . . . . . . C-4
2D9NC-20-20 . . . . . . . . . . . . . . . . . . . . . . . C-4
2D9NC-8-08 . . . . . . . . . . . . . . . . . . . . . . . . C-4
508-J-500-10 . . . . . . . . . . . . . . . . . . . . . . . F-2
510-A-500-12 . . . . . . . . . . . . . . . . . . . . . . . F-2
520-A-500-26 . . . . . . . . . . . . . . . . . . . . . . . F-2
5Y01-12-12C . . . . . . . . . . . . . . . . . . . . . . . E-14
5Y01-12-16C . . . . . . . . . . . . . . . . . . . . . . . E-14
5Y01-12-2C . . . . . . . . . . . . . . . . . . . . . . . . E-14
5Y01-12-4C . . . . . . . . . . . . . . . . . . . . . . . . E-14
5Y01-12-6C . . . . . . . . . . . . . . . . . . . . . . . . E-14
5Y01-12-8C . . . . . . . . . . . . . . . . . . . . . . . . E-14
5Y01-16-12C . . . . . . . . . . . . . . . . . . . . . . . E-14
5Y01-16-16C . . . . . . . . . . . . . . . . . . . . . . . E-14
5Y01-16-2C . . . . . . . . . . . . . . . . . . . . . . . . E-14
5Y01-16-4C . . . . . . . . . . . . . . . . . . . . . . . . E-14
5Y01-16-6C . . . . . . . . . . . . . . . . . . . . . . . . E-14
5Y01-16-8C . . . . . . . . . . . . . . . . . . . . . . . . E-14
5Y01-4-12C . . . . . . . . . . . . . . . . . . . . . . . . E-14
2380M-04V30W . . . . . . . . . . . . . . . . . . . . C-25
2380M-05V30W . . . . . . . . . . . . . . . . . . . . C-25
2380N-025V10 . . . . . . . . . . . . . . . . . . . . . B-18
2380N-04V00W . . . . . . . . . . . . . . . . . . . . . C-19
2380N-04V10-MSHA. . . . . . . . . . . . . . . . . B-25
2380N-05V00 . . . . . . . . . . . . . . . . . . . . . . B-18
2380N-05V00W . . . . . . . . . . . . . . . . . . . . . C-19
2380N-06V10 . . . . . . . . . . . . . . . . . . . . . . B-18
2380N-08V10 . . . . . . . . . . . . . . . . . . . . . . B-18
2380N-20V30 . . . . . . . . . . . . . . . . . . . . . . B-18
2388N-04V00 . . . . . . . . . . . . . . . . . . . . . . B-27
2388N-04V12W . . . . . . . . . . . . . . . . . . . . . C-20
2388N-08V12W . . . . . . . . . . . . . . . . . . . . . C-27
2440D-025V32 . . . . . . . . . . . . . . . . . . . . . C-33
2440D-025V32-TC . . . . . . . . . . . . . . . . . . C-34
2440D-02V32 . . . . . . . . . . . . . . . . . . . . . . C-33
2440D-03V32 . . . . . . . . . . . . . . . . . . . . . . C-33
2440D-03V32-TC . . . . . . . . . . . . . . . . . . . C-34
2440D-04V32 . . . . . . . . . . . . . . . . . . . . . . C-33
2440D-04V32-TC . . . . . . . . . . . . . . . . . . . C-34
2440D-05V32 . . . . . . . . . . . . . . . . . . . . . . C-33
2440D-05V32-TC . . . . . . . . . . . . . . . . . . . C-34
2440N-06V30 . . . . . . . . . . . . . . . . . . . . . . C-33
2440N-06V30-TC . . . . . . . . . . . . . . . . . . . C-34
2440N-08V30 . . . . . . . . . . . . . . . . . . . . . . C-33
2440N-08V30-TC . . . . . . . . . . . . . . . . . . . C-34
2440N-12V30 . . . . . . . . . . . . . . . . . . . . . . C-33
2440N-16V30 . . . . . . . . . . . . . . . . . . . . . . C-33
2448D-025V32-TC . . . . . . . . . . . . . . . . . . C-46
2580N-06V10-MSHA. . . . . . . . . . . . . . . . . B-33
2580N-06V12 . . . . . . . . . . . . . . . . . . . . . . C-30
2580N-08V10-MSHA. . . . . . . . . . . . . . . . . B-33
2580N-08V12 . . . . . . . . . . . . . . . . . . . . . . C-30
2580N-12V12 . . . . . . . . . . . . . . . . . . . . . . C-30
2640D-025V32 . . . . . . . . . . . . . . . . . . . . . C-49
2640D-03V32 . . . . . . . . . . . . . . . . . . . . . . C-49
2640D-04V32 . . . . . . . . . . . . . . . . . . . . . . C-49
2640D-05V32 . . . . . . . . . . . . . . . . . . . . . . C-49
2640N-08V32 . . . . . . . . . . . . . . . . . . . . . . C-49
2640N-12V32 . . . . . . . . . . . . . . . . . . . . . . C-49
2640N-16V32 . . . . . . . . . . . . . . . . . . . . . . C-49
2648N-12V32 . . . . . . . . . . . . . . . . . . . . . . C-56
2648N-16V32 . . . . . . . . . . . . . . . . . . . . . . C-56
2740D-025V16 . . . . . . . . . . . . . . . . . . . . . C-58
2740D-03V34 . . . . . . . . . . . . . . . . . . . . . . C-58
Index
page
H-8
Catalogue 4462 Global Edition
H
Index of part numbers
Index
page
5Y01-4-16C . . . . . . . . . . . . . . . . . . . . . . . .
5Y01-4-2C . . . . . . . . . . . . . . . . . . . . . . . . .
5Y01-4-4C . . . . . . . . . . . . . . . . . . . . . . . . .
5Y01-4-6C . . . . . . . . . . . . . . . . . . . . . . . . .
5Y01-4-8C . . . . . . . . . . . . . . . . . . . . . . . . .
5Y01-6-12C . . . . . . . . . . . . . . . . . . . . . . . .
5Y01-6-16C . . . . . . . . . . . . . . . . . . . . . . . .
5Y01-6-2C . . . . . . . . . . . . . . . . . . . . . . . . .
5Y01-6-4C . . . . . . . . . . . . . . . . . . . . . . . . .
5Y01-6-6C . . . . . . . . . . . . . . . . . . . . . . . . .
5Y01-6-8C . . . . . . . . . . . . . . . . . . . . . . . . .
5Y01-9-12C . . . . . . . . . . . . . . . . . . . . . . . .
5Y01-9-16C . . . . . . . . . . . . . . . . . . . . . . . .
5Y01-9-2C . . . . . . . . . . . . . . . . . . . . . . . . .
5Y01-9-4C . . . . . . . . . . . . . . . . . . . . . . . . .
5Y01-9-6C . . . . . . . . . . . . . . . . . . . . . . . . .
5Y01-9-8C . . . . . . . . . . . . . . . . . . . . . . . . .
5Y02-12-12C . . . . . . . . . . . . . . . . . . . . . . .
5Y02-12-16C . . . . . . . . . . . . . . . . . . . . . . .
5Y02-12-2C . . . . . . . . . . . . . . . . . . . . . . . .
5Y02-12-4C . . . . . . . . . . . . . . . . . . . . . . . .
5Y02-12-6C . . . . . . . . . . . . . . . . . . . . . . . .
5Y02-12-8C . . . . . . . . . . . . . . . . . . . . . . . .
5Y02-16-12C . . . . . . . . . . . . . . . . . . . . . . .
5Y02-16-16C . . . . . . . . . . . . . . . . . . . . . . .
5Y02-16-2C . . . . . . . . . . . . . . . . . . . . . . . .
5Y02-16-4C . . . . . . . . . . . . . . . . . . . . . . . .
5Y02-16-6C . . . . . . . . . . . . . . . . . . . . . . . .
5Y02-16-8C . . . . . . . . . . . . . . . . . . . . . . . .
5Y02-4-12C . . . . . . . . . . . . . . . . . . . . . . . .
5Y02-4-16C . . . . . . . . . . . . . . . . . . . . . . . .
5Y02-4-2C . . . . . . . . . . . . . . . . . . . . . . . . .
5Y02-4-4C . . . . . . . . . . . . . . . . . . . . . . . . .
5Y02-4-6C . . . . . . . . . . . . . . . . . . . . . . . . .
5Y02-4-8C . . . . . . . . . . . . . . . . . . . . . . . . .
5Y02-6-12C . . . . . . . . . . . . . . . . . . . . . . . .
5Y02-6-16C . . . . . . . . . . . . . . . . . . . . . . . .
5Y02-6-2C . . . . . . . . . . . . . . . . . . . . . . . . .
5Y02-6-4C . . . . . . . . . . . . . . . . . . . . . . . . .
5Y02-6-6C . . . . . . . . . . . . . . . . . . . . . . . . .
5Y02-6-8C . . . . . . . . . . . . . . . . . . . . . . . . .
5Y02-9-12C . . . . . . . . . . . . . . . . . . . . . . . .
5Y02-9-16C . . . . . . . . . . . . . . . . . . . . . . . .
5Y02-9-2C . . . . . . . . . . . . . . . . . . . . . . . . .
5Y02-9-4C . . . . . . . . . . . . . . . . . . . . . . . . .
Part number
page
5Y02-9-6C . . . . . . . . . . . . . . . . . . . . . . . . .
5Y02-9-8C . . . . . . . . . . . . . . . . . . . . . . . . .
5Y5Y-12-12C . . . . . . . . . . . . . . . . . . . . . . .
5Y5Y-12-16C . . . . . . . . . . . . . . . . . . . . . . .
5Y5Y-16-16C . . . . . . . . . . . . . . . . . . . . . . .
5Y5Y-4-12C . . . . . . . . . . . . . . . . . . . . . . . .
5Y5Y-4-16C . . . . . . . . . . . . . . . . . . . . . . . .
5Y5Y-4-4C . . . . . . . . . . . . . . . . . . . . . . . . .
5Y5Y-4-6C . . . . . . . . . . . . . . . . . . . . . . . . .
5Y5Y-4-9C . . . . . . . . . . . . . . . . . . . . . . . . .
5Y5Y-6-12C . . . . . . . . . . . . . . . . . . . . . . . .
5Y5Y-6-16C . . . . . . . . . . . . . . . . . . . . . . . .
5Y5Y-6-6C . . . . . . . . . . . . . . . . . . . . . . . . .
5Y5Y-6-9C . . . . . . . . . . . . . . . . . . . . . . . . .
5Y5Y-9-12C . . . . . . . . . . . . . . . . . . . . . . . .
5Y5Y-9-16C . . . . . . . . . . . . . . . . . . . . . . . .
5Y5Y-9-9C . . . . . . . . . . . . . . . . . . . . . . . . .
5Y6Y-12-4C . . . . . . . . . . . . . . . . . . . . . . . .
5Y6Y-12-6C . . . . . . . . . . . . . . . . . . . . . . . .
5Y6Y-12-9C . . . . . . . . . . . . . . . . . . . . . . . .
5Y6Y-16-4C . . . . . . . . . . . . . . . . . . . . . . . .
5Y6Y-16-6C . . . . . . . . . . . . . . . . . . . . . . . .
5Y6Y-16-9C . . . . . . . . . . . . . . . . . . . . . . . .
5Y6Y-4-4C . . . . . . . . . . . . . . . . . . . . . . . . .
5Y6Y-4-6C . . . . . . . . . . . . . . . . . . . . . . . . .
5Y6Y-4-9C . . . . . . . . . . . . . . . . . . . . . . . . .
5Y6Y-6-4C . . . . . . . . . . . . . . . . . . . . . . . . .
5Y6Y-6-6C . . . . . . . . . . . . . . . . . . . . . . . . .
5Y6Y-6-9C . . . . . . . . . . . . . . . . . . . . . . . . .
5Y6Y-9-4C . . . . . . . . . . . . . . . . . . . . . . . . .
5Y6Y-9-6C . . . . . . . . . . . . . . . . . . . . . . . . .
5Y6Y-9-9C . . . . . . . . . . . . . . . . . . . . . . . . .
5YY5-12-16C . . . . . . . . . . . . . . . . . . . . . .
5YY5-12-4C . . . . . . . . . . . . . . . . . . . . . . .
5YY5-12-6C . . . . . . . . . . . . . . . . . . . . . . .
5YY5-12-9C . . . . . . . . . . . . . . . . . . . . . . .
5YY5-16-12C . . . . . . . . . . . . . . . . . . . . . .
5YY5-16-4C . . . . . . . . . . . . . . . . . . . . . . .
5YY5-16-6C . . . . . . . . . . . . . . . . . . . . . . .
5YY5-16-9C . . . . . . . . . . . . . . . . . . . . . . .
5YY5-4-12C . . . . . . . . . . . . . . . . . . . . . . .
5YY5-4-16C . . . . . . . . . . . . . . . . . . . . . . .
5YY5-4-6C . . . . . . . . . . . . . . . . . . . . . . . .
5YY5-4-9C . . . . . . . . . . . . . . . . . . . . . . . .
5YY5-6-12C . . . . . . . . . . . . . . . . . . . . . . .
E-14
E-14
E-14
E-14
E-14
E-14
E-14
E-14
E-14
E-14
E-14
E-14
E-14
E-14
E-14
E-14
E-14
E-18
E-18
E-18
E-18
E-18
E-18
E-18
E-18
E-18
E-18
E-18
E-18
E-18
E-18
E-18
E-18
E-18
E-18
E-18
E-18
E-18
E-18
E-18
E-18
E-18
E-18
E-18
E-18
H-9
E-18
E-18
E-16
E-16
E-16
E-16
E-16
E-16
E-16
E-16
E-16
E-16
E-16
E-16
E-16
E-16
E-16
E-17
E-17
E-17
E-17
E-17
E-17
E-17
E-17
E-17
E-17
E-17
E-17
E-17
E-17
E-17
E-11
E-11
E-11
E-11
E-11
E-11
E-11
E-11
E-11
E-11
E-11
E-11
E-11
Catalogue 4462 Global Edition
Index
Part number
Index of part numbers
Index
Part number
page
Index
5YY5-6-4C . . . . . . . . . . . . . . . . . . . . . . . . E-11
5YY5-6-9C . . . . . . . . . . . . . . . . . . . . . . . . E-11
5YY5-9-12C . . . . . . . . . . . . . . . . . . . . . . . E-11
5YY5-9-16C . . . . . . . . . . . . . . . . . . . . . . . E-11
5YY5-9-4C . . . . . . . . . . . . . . . . . . . . . . . . E-11
5YY5-9-6C . . . . . . . . . . . . . . . . . . . . . . . . E-11
5YY6-12-4C . . . . . . . . . . . . . . . . . . . . . . . E-12
5YY6-12-6C . . . . . . . . . . . . . . . . . . . . . . . E-12
5YY6-12-9C . . . . . . . . . . . . . . . . . . . . . . . E-12
5YY6-16-6C . . . . . . . . . . . . . . . . . . . . . . . E-12
5YY6-16-9C . . . . . . . . . . . . . . . . . . . . . . . E-12
5YY6-4-4C . . . . . . . . . . . . . . . . . . . . . . . . E-12
5YY6-4-6C . . . . . . . . . . . . . . . . . . . . . . . . E-12
5YY6-4-9C . . . . . . . . . . . . . . . . . . . . . . . . E-12
5YY6-6-4C . . . . . . . . . . . . . . . . . . . . . . . . E-12
5YY6-6-6C . . . . . . . . . . . . . . . . . . . . . . . . E-12
5YY6-6-9C . . . . . . . . . . . . . . . . . . . . . . . . E-12
5YY6-9-4C . . . . . . . . . . . . . . . . . . . . . . . . E-12
5YY6-9-6C . . . . . . . . . . . . . . . . . . . . . . . . E-12
5YY6-9-9C . . . . . . . . . . . . . . . . . . . . . . . . E-12
601LX-16-16C . . . . . . . . . . . . . . . . . . . . . . C-41
612-400-14 . . . . . . . . . . . . . . . . . . . . . . . . . F-2
620-100-18 . . . . . . . . . . . . . . . . . . . . . . . . . F-2
63ZPL-5-2A . . . . . . . . . . . . . . . . . . . . . . . . C-13
63ZPL-5-3 . . . . . . . . . . . . . . . . . . . . . . . . . C-13
63ZPL-5-3C. . . . . . . . . . . . . . . . . . . . . . . . C-13
63ZPL-5-4C. . . . . . . . . . . . . . . . . . . . . . . . C-13
65YLX-6-3 . . . . . . . . . . . . . . . . . . . . . . . . . C-44
65YLX-6-3C. . . . . . . . . . . . . . . . . . . . . . . . C-44
65YLX-6-4 . . . . . . . . . . . . . . . . . . . . . . . . . C-44
65YLX-6-4C. . . . . . . . . . . . . . . . . . . . . . . . C-44
66YLX-4-3 . . . . . . . . . . . . . . . . . . . . . . . . . C-44
66YLX-4-3C. . . . . . . . . . . . . . . . . . . . . . . . C-44
692LX-16-16C . . . . . . . . . . . . . . . . . . . . . . C-38
6AYLX-16-16C. . . . . . . . . . . . . . . . . . . . . . C-36
6AYLX-6-2AC . . . . . . . . . . . . . . . . . C-36, C-48
6AYWX-10-5C-55 . . . . . . . . . . . . . . . . . . . C-74
6C9LX-30-16C . . . . . . . . . . . . . . . . . . . . . C-35
6EZPL-1-2A . . . . . . . . . . . . . . . . . . . . . . . . C-14
6EZPL-5-2A . . . . . . . . . . . . . . . . . . . . . . . . C-14
6HYLX-4-2AC-PL . . . . . . . . . . . . . . C-43, C-47
6HYLX-4-2AC-PL-LH . . . . . . . . . . . C-43, C-47
6HYLX-4-3C-PL . . . . . . . . . . . . . . . . . . . . C-43
6HYLX-4-3C-PL-LH . . . . . . . . . . . . . . . . . C-43
6HYLX-6-2AC-PL-LH . . . . . . . . . . . C-43, C-47
Part number
page
6HYLX-6-3C-PL . . . . . . . . . . . . . . . . . . . . C-43
6HYLX-6-3C-PL-LH . . . . . . . . . . . . . . . . . C-43
6HYLX-6-4C-PL . . . . . . . . . . . . . . . . . . . . C-43
6HYLX-6-4C-PL-LH . . . . . . . . . . . . . . . . . C-43
6HYLX-9-5C-PL . . . . . . . . . . . . . . . . . . . . C-43
6HYLX-9-5C-PL-LH . . . . . . . . . . . . . . . . . C-43
6HYPL-1-2 . . . . . . . . . . . . . . . . . . . . . . . . C-13
6Y01-4-12C . . . . . . . . . . . . . . . . . . . . . . . . E-28
6Y01-4-16C . . . . . . . . . . . . . . . . . . . . . . . . E-28
6Y01-4-2C . . . . . . . . . . . . . . . . . . . . . . . . . E-28
6Y01-4-4C . . . . . . . . . . . . . . . . . . . . . . . . . E-28
6Y01-4-6C . . . . . . . . . . . . . . . . . . . . . . . . . E-28
6Y01-4-8C . . . . . . . . . . . . . . . . . . . . . . . . . E-28
6Y01-6-12C . . . . . . . . . . . . . . . . . . . . . . . . E-28
6Y01-6-16C . . . . . . . . . . . . . . . . . . . . . . . . E-28
6Y01-6-2C . . . . . . . . . . . . . . . . . . . . . . . . . E-28
6Y01-6-4C . . . . . . . . . . . . . . . . . . . . . . . . . E-28
6Y01-6-6C . . . . . . . . . . . . . . . . . . . . . . . . . E-28
6Y01-6-8C . . . . . . . . . . . . . . . . . . . . . . . . . E-28
6Y01-9-12C . . . . . . . . . . . . . . . . . . . . . . . . E-28
6Y01-9-16C . . . . . . . . . . . . . . . . . . . . . . . . E-28
6Y01-9-2C . . . . . . . . . . . . . . . . . . . . . . . . . E-28
6Y01-9-4C . . . . . . . . . . . . . . . . . . . . . . . . . E-28
6Y01-9-6C . . . . . . . . . . . . . . . . . . . . . . . . . E-28
6Y01-9-8C . . . . . . . . . . . . . . . . . . . . . . . . . E-28
6Y02-4-12C . . . . . . . . . . . . . . . . . . . . . . . . E-32
6Y02-4-16C . . . . . . . . . . . . . . . . . . . . . . . . E-32
6Y02-4-2C . . . . . . . . . . . . . . . . . . . . . . . . . E-32
6Y02-4-4C . . . . . . . . . . . . . . . . . . . . . . . . . E-32
6Y02-4-6C . . . . . . . . . . . . . . . . . . . . . . . . . E-32
6Y02-4-8C . . . . . . . . . . . . . . . . . . . . . . . . . E-32
6Y02-6-12C . . . . . . . . . . . . . . . . . . . . . . . . E-32
6Y02-6-16C . . . . . . . . . . . . . . . . . . . . . . . . E-32
6Y02-6-2C . . . . . . . . . . . . . . . . . . . . . . . . . E-32
6Y02-6-4C . . . . . . . . . . . . . . . . . . . . . . . . . E-32
6Y02-6-6C . . . . . . . . . . . . . . . . . . . . . . . . . E-32
6Y02-6-8C . . . . . . . . . . . . . . . . . . . . . . . . . E-32
6Y02-9-12C . . . . . . . . . . . . . . . . . . . . . . . . E-32
6Y02-9-16C . . . . . . . . . . . . . . . . . . . . . . . . E-32
6Y02-9-2C . . . . . . . . . . . . . . . . . . . . . . . . . E-32
6Y02-9-4C . . . . . . . . . . . . . . . . . . . . . . . . . E-32
6Y02-9-6C . . . . . . . . . . . . . . . . . . . . . . . . . E-32
6Y02-9-8C . . . . . . . . . . . . . . . . . . . . . . . . . E-32
6Y25X-12-8C. . . . . . . . . . . . . . . . . . . . . . . C-52
6Y25X-9-8C. . . . . . . . . . . . . . . . . . . . . . . . C-52
H-10
Catalogue 4462 Global Edition
H
Index of part numbers
Index
page
6Y2LX-16-12C. . . . . . . . . . . . . . . . . . . . . . C-45
6Y4HX-16-8C . . . . . . . . . . . . . . . . . C-63, C-65
6Y4LX-4-2AC . . . . . . . . . . . . . . . . . . . . . . C-48
6Y4LX-6-2AC . . . . . . . . . . . . . . . . . . . . . . C-48
6Y4WX-16-8C . . . . . . . . . . . . . . . . . . . . . . C-70
6Y4WX-9-5C-55 . . . . . . . . . . . . . . . . . . . . C-73
6Y6Y-4-4C . . . . . . . . . . . . . . . . . . . . . . . . . E-31
6Y6Y-4-6C . . . . . . . . . . . . . . . . . . . . . . . . . E-31
6Y6Y-4-9C . . . . . . . . . . . . . . . . . . . . . . . . . E-31
6Y6Y-6-6C . . . . . . . . . . . . . . . . . . . . . . . . . E-31
6Y6Y-6-9C . . . . . . . . . . . . . . . . . . . . . . . . . E-31
6Y6Y-9-9C . . . . . . . . . . . . . . . . . . . . . . . . . E-31
6YHLX-4-2AC-PL . . . . . . . . . . . . . . C-42, C-47
6YHLX-4-2AC-PL-LH . . . . . . . . . . . C-42, C-47
6YHLX-4-3C-PL . . . . . . . . . . . . . . . . . . . . C-42
6YHLX-4-3C-PL-LH . . . . . . . . . . . . . . . . . C-42
6YHLX-6-3C-PL . . . . . . . . . . . . . . . . . . . . C-42
6YHLX-6-3C-PL-LH . . . . . . . . . . . . . . . . . C-42
6YHLX-6-4C-PL . . . . . . . . . . . . . . . . . . . . C-42
6YHLX-6-4C-PL-LH . . . . . . . . . . . . . . . . . C-42
6YHLX-9-5C-PL . . . . . . . . . . . . . . . . . . . . C-42
6YHLX-9-5C-PL-LH . . . . . . . . . . . . . . . . . C-42
6YMHX-11-8C . . . . . . . . . . . . . . . . . . . . . . C-63
6YMHX-12-8C . . . . . . . . . . . . . . . . . . . . . . C-63
6YMWX-11-8C . . . . . . . . . . . . . . . . . . . . . C-70
6YMWX-12-8C . . . . . . . . . . . . . . . . . . . . . C-70
6YMWX-6-5C-55 . . . . . . . . . . . . . . . . . . . . C-73
6YY5-4-12C . . . . . . . . . . . . . . . . . . . . . . . E-13
6YY5-4-16C . . . . . . . . . . . . . . . . . . . . . . . E-13
6YY5-4-4C . . . . . . . . . . . . . . . . . . . . . . . . E-13
6YY5-4-6C . . . . . . . . . . . . . . . . . . . . . . . . E-13
6YY5-4-9C . . . . . . . . . . . . . . . . . . . . . . . . E-13
6YY5-6-12C . . . . . . . . . . . . . . . . . . . . . . . E-13
6YY5-6-16C . . . . . . . . . . . . . . . . . . . . . . . E-13
6YY5-6-4C . . . . . . . . . . . . . . . . . . . . . . . . E-13
6YY5-6-6C . . . . . . . . . . . . . . . . . . . . . . . . E-13
6YY5-6-9C . . . . . . . . . . . . . . . . . . . . . . . . E-13
6YY5-9-12C . . . . . . . . . . . . . . . . . . . . . . . E-13
6YY5-9-16C . . . . . . . . . . . . . . . . . . . . . . . E-13
6YY5-9-4C . . . . . . . . . . . . . . . . . . . . . . . . E-13
6YY5-9-6C . . . . . . . . . . . . . . . . . . . . . . . . E-13
6YY5-9-9C . . . . . . . . . . . . . . . . . . . . . . . . E-13
6YY6-4-6C . . . . . . . . . . . . . . . . . . . . . . . . E-27
6YY6-4-9C . . . . . . . . . . . . . . . . . . . . . . . . E-27
6YY6-6-4C . . . . . . . . . . . . . . . . . . . . . . . . E-27
Part number
page
6YY6-6-9C . . . . . . . . . . . . . . . . . . . . . . . . E-27
6YY6-9-4C . . . . . . . . . . . . . . . . . . . . . . . . E-27
6YY6-9-9C . . . . . . . . . . . . . . . . . . . . . . . . E-27
6ZELX-5-3C. . . . . . . . . . . . . . . . . . . . . . . . C-45
6ZEPL-5-2A . . . . . . . . . . . . . . . . . . . . . . . . C-13
ESH-08 . . . . . . . . . . . . . . . . . . . . . . . . . . . . C-2
ESH-12 . . . . . . . . . . . . . . . . . . . . . . . . . . . . C-2
ESH-16 . . . . . . . . . . . . . . . . . . . . . . . . . . . . C-2
ESH-20 . . . . . . . . . . . . . . . . . . . . . . . . . . . . C-2
ESH250Plus-08 . . . . . . . . . . . . . . . . . . . . . . C-5
ESH250Plus-12 . . . . . . . . . . . . . . . . . . . . . . C-5
ESH250Plus-16 . . . . . . . . . . . . . . . . . . . . . . C-5
ESH250Plus-20 . . . . . . . . . . . . . . . . . . . . . . C-5
HBPHM4-B . . . . . . . . . . . . . . . . . . . . . . . . E-35
HBPHM6-B . . . . . . . . . . . . . . . . . . . . . . . . E-35
HBPHM9-B . . . . . . . . . . . . . . . . . . . . . . . . E-35
HBPLM12-B . . . . . . . . . . . . . . . . . . . . . . . E-24
HBPLM16-B . . . . . . . . . . . . . . . . . . . . . . . E-24
HBPLM4-B . . . . . . . . . . . . . . . . . . . . . . . . E-24
HBPLM6-B . . . . . . . . . . . . . . . . . . . . . . . . E-24
HBPLM9-B . . . . . . . . . . . . . . . . . . . . . . . . E-24
HS-03 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . F-4
HS-05 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . F-4
HS-08 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . F-4
HS-12 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . F-4
HS-16 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . F-4
KL-03 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . F-4
KL-05 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . F-4
KL-08 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . F-4
KL-12 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . F-4
KL-16 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . F-4
L5Y-4C. . . . . . . . . . . . . . . . . . . . . . . . . . . . E-22
L5Y-6C. . . . . . . . . . . . . . . . . . . . . . . . . . . . E-22
L5Y-9C. . . . . . . . . . . . . . . . . . . . . . . . . . . . E-22
L5Y-12C. . . . . . . . . . . . . . . . . . . . . . . . . . . E-22
L5Y-16C. . . . . . . . . . . . . . . . . . . . . . . . . . . E-22
L6Y-4C. . . . . . . . . . . . . . . . . . . . . . . . . . . . E-33
L6Y-6C. . . . . . . . . . . . . . . . . . . . . . . . . . . . E-33
L6Y-9C. . . . . . . . . . . . . . . . . . . . . . . . . . . . E-33
MHDC010 . . . . . . . . . . . . . . . . . . . . . . . . . . F-2
MHDC011 . . . . . . . . . . . . . . . . . . . . . . . . . . F-2
MHDC012 . . . . . . . . . . . . . . . . . . . . . . . . . . F-2
MHDC014 . . . . . . . . . . . . . . . . . . . . . . . . . . F-2
MHDC016 . . . . . . . . . . . . . . . . . . . . . . . . . . F-2
MHDC018 . . . . . . . . . . . . . . . . . . . . . . . . . . F-2
H-11
Catalogue 4462 Global Edition
Index
Part number
Index of part numbers
Index
Part number
page
Index
MHDC020 . . . . . . . . . . . . . . . . . . . . . . . . . . F-2
MHDC022 . . . . . . . . . . . . . . . . . . . . . . . . . . F-2
MHDC024 . . . . . . . . . . . . . . . . . . . . . . . . . . F-2
MHDC026 . . . . . . . . . . . . . . . . . . . . . . . . . . F-2
MHDC032 . . . . . . . . . . . . . . . . . . . . . . . . . . F-2
MK022-03-038 . . . . . . . . . . . . . . . . . . . . . . F-3
MK022-03-039 . . . . . . . . . . . . . . . . . . . . . . F-3
MK022-03-041 . . . . . . . . . . . . . . . . . . . . . . F-3
MK022-03-042 . . . . . . . . . . . . . . . . . . . . . . F-3
MK022-03-043 . . . . . . . . . . . . . . . . . . . . . . F-3
MK022-03-045 . . . . . . . . . . . . . . . . . . . . . . F-3
MSG060 . . . . . . . . . . . . . . . . . . . . . . . . . . . F-3
MSG1006 . . . . . . . . . . . . . . . . . . . . . . . . . . F-3
MSG2006 . . . . . . . . . . . . . . . . . . . . . . . . . . F-3
MSG2106 . . . . . . . . . . . . . . . . . . . . . . . . . . F-3
MSG4113 . . . . . . . . . . . . . . . . . . . . . . . . . . F-3
MSG4120 . . . . . . . . . . . . . . . . . . . . . . . . . . F-3
MSG4125 . . . . . . . . . . . . . . . . . . . . . . . . . . F-3
MSG6020 . . . . . . . . . . . . . . . . . . . . . . . . . . F-3
PVC-S-03 . . . . . . . . . . . . . . . . . . . . . . . . . . F-4
PVC-S-05 . . . . . . . . . . . . . . . . . . . . . . . . . . F-4
PVC-S-08 . . . . . . . . . . . . . . . . . . . . . . . . . . F-4
PVC-S-12 . . . . . . . . . . . . . . . . . . . . . . . . . . F-4
PVC-S-16 . . . . . . . . . . . . . . . . . . . . . . . . . . F-4
T5Y-4C. . . . . . . . . . . . . . . . . . . . . . . . . . . . E-22
T5Y-6C. . . . . . . . . . . . . . . . . . . . . . . . . . . . E-22
T5Y-9C. . . . . . . . . . . . . . . . . . . . . . . . . . . . E-22
T5Y-12C. . . . . . . . . . . . . . . . . . . . . . . . . . . E-22
T5Y-16C. . . . . . . . . . . . . . . . . . . . . . . . . . . E-22
T6Y-4C. . . . . . . . . . . . . . . . . . . . . . . . . . . . E-33
T6Y-6C. . . . . . . . . . . . . . . . . . . . . . . . . . . . E-33
T6Y-9C. . . . . . . . . . . . . . . . . . . . . . . . . . . . E-33
UHPLABEL . . . . . . . . . . . . . . . . . . . . . . . . . F-4
X5Y-4C . . . . . . . . . . . . . . . . . . . . . . . . . . . E-23
X5Y-6C . . . . . . . . . . . . . . . . . . . . . . . . . . . E-23
X5Y-9C . . . . . . . . . . . . . . . . . . . . . . . . . . . E-23
X5Y-12C . . . . . . . . . . . . . . . . . . . . . . . . . . E-23
X5Y-16C . . . . . . . . . . . . . . . . . . . . . . . . . . E-23
X6Y-4C . . . . . . . . . . . . . . . . . . . . . . . . . . . E-34
X6Y-6C . . . . . . . . . . . . . . . . . . . . . . . . . . . E-34
X6Y-9C . . . . . . . . . . . . . . . . . . . . . . . . . . . E-34
Y2C-4C . . . . . . . . . . . . . . . . . . . . . . . . . . . E-24
Y2C-6C . . . . . . . . . . . . . . . . . . . . . . . . . . . E-24
Y2C-9C . . . . . . . . . . . . . . . . . . . . . . . . . . . E-24
Y2C-12C . . . . . . . . . . . . . . . . . . . . . . . . . . E-24
Part number
page
Y2C-16C . . . . . . . . . . . . . . . . . . . . . . . . . .
Y2N-4C . . . . . . . . . . . . . . . . . . . . . . . . . . .
Y2N-6C . . . . . . . . . . . . . . . . . . . . . . . . . . .
Y2N-9C . . . . . . . . . . . . . . . . . . . . . . . . . . .
Y2N-12C . . . . . . . . . . . . . . . . . . . . . . . . . .
Y2N-16C . . . . . . . . . . . . . . . . . . . . . . . . . .
Y4N-4C . . . . . . . . . . . . . . . . . . . . . . . . . . .
Y4N-6C . . . . . . . . . . . . . . . . . . . . . . . . . . .
Y4N-9C . . . . . . . . . . . . . . . . . . . . . . . . . . .
Y4NC-4C-AV . . . . . . . . . . . . . . . . . . . . . . .
Y4NC-6C-AV . . . . . . . . . . . . . . . . . . . . . . .
Y4NC-9C-AV . . . . . . . . . . . . . . . . . . . . . . .
Y5Y5-4-4C . . . . . . . . . . . . . . . . . . . . . . . .
Y5Y5-4-6C . . . . . . . . . . . . . . . . . . . . . . . .
Y5Y5-4-12C . . . . . . . . . . . . . . . . . . . . . . .
Y5Y5-4-16C . . . . . . . . . . . . . . . . . . . . . . .
Y5Y5-6-6C . . . . . . . . . . . . . . . . . . . . . . . .
Y5Y5-6-9C . . . . . . . . . . . . . . . . . . . . . . . .
Y5Y5-6-12C . . . . . . . . . . . . . . . . . . . . . . .
Y5Y5-6-16C . . . . . . . . . . . . . . . . . . . . . . .
Y5Y5-9-9C . . . . . . . . . . . . . . . . . . . . . . . .
Y5Y5-9-12C . . . . . . . . . . . . . . . . . . . . . . .
Y5Y5-9-16C . . . . . . . . . . . . . . . . . . . . . . .
Y5Y5-12-12C . . . . . . . . . . . . . . . . . . . . . .
Y5Y5-12-16C . . . . . . . . . . . . . . . . . . . . . .
Y5Y6-4-4C . . . . . . . . . . . . . . . . . . . . . . . .
Y5Y6-4-6C . . . . . . . . . . . . . . . . . . . . . . . .
Y5Y6-4-9C . . . . . . . . . . . . . . . . . . . . . . . .
Y5Y6-6-4C . . . . . . . . . . . . . . . . . . . . . . . .
Y5Y6-6-9C . . . . . . . . . . . . . . . . . . . . . . . .
Y5Y6-9-4C . . . . . . . . . . . . . . . . . . . . . . . .
Y5Y6-9-9C . . . . . . . . . . . . . . . . . . . . . . . .
Y5Y6-12-4C . . . . . . . . . . . . . . . . . . . . . . .
Y5Y6-12-6C . . . . . . . . . . . . . . . . . . . . . . .
Y5Y6-12-9C . . . . . . . . . . . . . . . . . . . . . . .
Y5Y6-16-4C . . . . . . . . . . . . . . . . . . . . . . .
Y5Y6-16-6C . . . . . . . . . . . . . . . . . . . . . . .
Y5Y6-16-9C . . . . . . . . . . . . . . . . . . . . . . .
Y6Y6-4-4C . . . . . . . . . . . . . . . . . . . . . . . .
Y6Y6-4-6C . . . . . . . . . . . . . . . . . . . . . . . .
Y6Y6-4-9C . . . . . . . . . . . . . . . . . . . . . . . .
Y6Y6-6-6C . . . . . . . . . . . . . . . . . . . . . . . .
Y6Y6-6-9C . . . . . . . . . . . . . . . . . . . . . . . .
Y6Y6-9-9C . . . . . . . . . . . . . . . . . . . . . . . .
Y204-0275C . . . . . . . . . . . . . . . . . . . . . . .
H-12
E-24
E-23
E-23
E-23
E-23
E-23
E-34
E-34
E-34
E-35
E-35
E-35
E-19
E-19
E-19
E-19
E-19
E-19
E-19
E-19
E-19
E-19
E-19
E-19
E-19
E-20
E-20
E-20
E-20
E-20
E-20
E-20
E-20
E-20
E-20
E-20
E-20
E-20
E-30
E-30
E-30
E-30
E-30
E-30
E-25
Catalogue 4462 Global Edition
H
Index of part numbers
Index
page
Y204-0300C . . . . . . . . . . . . . . . . . . . . . . .
Y204-0400C . . . . . . . . . . . . . . . . . . . . . . .
Y204-0600C . . . . . . . . . . . . . . . . . . . . . . .
Y204-0800C . . . . . . . . . . . . . . . . . . . . . . .
Y204-1000C . . . . . . . . . . . . . . . . . . . . . . .
Y204-1200C . . . . . . . . . . . . . . . . . . . . . . .
Y206-0300C . . . . . . . . . . . . . . . . . . . . . . .
Y206-0400C . . . . . . . . . . . . . . . . . . . . . . .
Y206-0600C . . . . . . . . . . . . . . . . . . . . . . .
Y206-0800C . . . . . . . . . . . . . . . . . . . . . . .
Y206-1000C . . . . . . . . . . . . . . . . . . . . . . .
Y206-1200C . . . . . . . . . . . . . . . . . . . . . . .
Y209-0400C . . . . . . . . . . . . . . . . . . . . . . .
Y209-0600C . . . . . . . . . . . . . . . . . . . . . . .
Y209-0800C . . . . . . . . . . . . . . . . . . . . . . .
Y209-1000C . . . . . . . . . . . . . . . . . . . . . . .
Y209-1200C . . . . . . . . . . . . . . . . . . . . . . .
Y212-0400C . . . . . . . . . . . . . . . . . . . . . . .
Y212-0600C . . . . . . . . . . . . . . . . . . . . . . .
Y212-0800C . . . . . . . . . . . . . . . . . . . . . . .
Y212-1000C . . . . . . . . . . . . . . . . . . . . . . .
Y212-1200C . . . . . . . . . . . . . . . . . . . . . . .
Y216-0600C . . . . . . . . . . . . . . . . . . . . . . .
Y216-0800C . . . . . . . . . . . . . . . . . . . . . . .
Y216-1000C . . . . . . . . . . . . . . . . . . . . . . .
Y216-1200C . . . . . . . . . . . . . . . . . . . . . . .
Y404-0275C . . . . . . . . . . . . . . . . . . . . . . .
Y404-0300C . . . . . . . . . . . . . . . . . . . . . . .
Y404-0400C . . . . . . . . . . . . . . . . . . . . . . .
Y404-0600C . . . . . . . . . . . . . . . . . . . . . . .
Y404-0800C . . . . . . . . . . . . . . . . . . . . . . .
Y404-1000C . . . . . . . . . . . . . . . . . . . . . . .
Y404-1200C . . . . . . . . . . . . . . . . . . . . . . .
Y406-0300C . . . . . . . . . . . . . . . . . . . . . . .
Y406-0600C . . . . . . . . . . . . . . . . . . . . . . .
Y406-0800C . . . . . . . . . . . . . . . . . . . . . . .
Y406-1000C . . . . . . . . . . . . . . . . . . . . . . .
Y406-1200C . . . . . . . . . . . . . . . . . . . . . . .
Y409-0275C . . . . . . . . . . . . . . . . . . . . . . .
Y409-0400C . . . . . . . . . . . . . . . . . . . . . . .
Y409-0600C . . . . . . . . . . . . . . . . . . . . . . .
Y409-0800C . . . . . . . . . . . . . . . . . . . . . . .
Y409-1000C . . . . . . . . . . . . . . . . . . . . . . .
Y409-1200C . . . . . . . . . . . . . . . . . . . . . . .
Y501-4-4C . . . . . . . . . . . . . . . . . . . . . . . . .
E-25
E-25
E-25
E-25
E-25
E-25
E-25
E-25
E-25
E-25
E-25
E-25
E-25
E-25
E-25
E-25
E-25
E-25
E-25
E-25
E-25
E-25
E-25
E-25
E-25
E-25
E-35
E-35
E-35
E-35
E-35
E-35
E-35
E-35
E-35
E-35
E-35
E-35
E-35
E-35
E-35
E-35
E-35
E-35
E-21
Part number
page
Y501-4-8C . . . . . . . . . . . . . . . . . . . . . . . . . E-21
Y501-6-4C . . . . . . . . . . . . . . . . . . . . . . . . . E-21
Y501-6-6C . . . . . . . . . . . . . . . . . . . . . . . . . E-21
Y501-6-8C . . . . . . . . . . . . . . . . . . . . . . . . . E-21
Y501-9-2C . . . . . . . . . . . . . . . . . . . . . . . . . E-21
Y501-9-4C . . . . . . . . . . . . . . . . . . . . . . . . . E-21
Y501-9-6C . . . . . . . . . . . . . . . . . . . . . . . . . E-21
Y501-9-8C . . . . . . . . . . . . . . . . . . . . . . . . . E-21
Y501-9-12C . . . . . . . . . . . . . . . . . . . . . . . . E-21
Y501-9-16C . . . . . . . . . . . . . . . . . . . . . . . . E-21
Y501-12-2C . . . . . . . . . . . . . . . . . . . . . . . . E-21
Y501-12-4C . . . . . . . . . . . . . . . . . . . . . . . . E-21
Y501-12-6C . . . . . . . . . . . . . . . . . . . . . . . . E-21
Y501-12-8C . . . . . . . . . . . . . . . . . . . . . . . . E-21
Y501-12-12C . . . . . . . . . . . . . . . . . . . . . . . E-21
Y501-12-16C . . . . . . . . . . . . . . . . . . . . . . . E-21
Y501-16-2C . . . . . . . . . . . . . . . . . . . . . . . . E-21
Y501-16-4C . . . . . . . . . . . . . . . . . . . . . . . . E-21
Y501-16-6C . . . . . . . . . . . . . . . . . . . . . . . . E-21
Y501-16-8C . . . . . . . . . . . . . . . . . . . . . . . . E-21
Y501-16-12C . . . . . . . . . . . . . . . . . . . . . . . E-21
Y501-16-16C . . . . . . . . . . . . . . . . . . . . . . . E-21
Y601-4-2C . . . . . . . . . . . . . . . . . . . . . . . . . E-30
Y601-4-4C . . . . . . . . . . . . . . . . . . . . . . . . . E-30
Y601-4-6C . . . . . . . . . . . . . . . . . . . . . . . . . E-30
Y601-4-8C . . . . . . . . . . . . . . . . . . . . . . . . . E-30
Y601-4-12C . . . . . . . . . . . . . . . . . . . . . . . . E-30
Y601-6-4C . . . . . . . . . . . . . . . . . . . . . . . . . E-30
Y601-6-6C . . . . . . . . . . . . . . . . . . . . . . . . . E-30
Y601-9-4C . . . . . . . . . . . . . . . . . . . . . . . . . E-30
Y601-9-6C . . . . . . . . . . . . . . . . . . . . . . . . . E-30
Y601-9-8C . . . . . . . . . . . . . . . . . . . . . . . . . E-30
Y601-9-12C . . . . . . . . . . . . . . . . . . . . . . . . E-30
Y601-9-16C . . . . . . . . . . . . . . . . . . . . . . . . E-30
YA01-6-2C . . . . . . . . . . . . . . . . . . . . . . . . . . E-9
YA01-6-4C . . . . . . . . . . . . . . . . . . . . . . . . . . E-9
YA01-6-6C . . . . . . . . . . . . . . . . . . . . . . . . . . E-9
YA01-6-8C . . . . . . . . . . . . . . . . . . . . . . . . . . E-9
YA01-8-4C . . . . . . . . . . . . . . . . . . . . . . . . . . E-9
YA01-8-6C . . . . . . . . . . . . . . . . . . . . . . . . . . E-9
YA01-8-8C . . . . . . . . . . . . . . . . . . . . . . . . . . E-9
YA01-8-12C . . . . . . . . . . . . . . . . . . . . . . . . . E-9
YA01-8-16C . . . . . . . . . . . . . . . . . . . . . . . . . E-9
YA01-11-6C . . . . . . . . . . . . . . . . . . . . . . . . . E-9
YA01-11-8C . . . . . . . . . . . . . . . . . . . . . . . . . E-9
H-13
Catalogue 4462 Global Edition
Index
Part number
Index of part numbers
Index
Part number
page
YA01-11-12C . . . . . . . . . . . . . . . . . . . . . . . .
YA01-11-16C . . . . . . . . . . . . . . . . . . . . . . . .
YA01-16-8C . . . . . . . . . . . . . . . . . . . . . . . . .
YA01-16-12C . . . . . . . . . . . . . . . . . . . . . . . .
YA01-16-16C . . . . . . . . . . . . . . . . . . . . . . . .
YA01-16-20C . . . . . . . . . . . . . . . . . . . . . . . .
YA01-16-24C . . . . . . . . . . . . . . . . . . . . . . . .
YA01-16-32C . . . . . . . . . . . . . . . . . . . . . . . .
YA02-6-4C . . . . . . . . . . . . . . . . . . . . . . . . . .
YA02-6-8C . . . . . . . . . . . . . . . . . . . . . . . . . .
YA02-8-8C . . . . . . . . . . . . . . . . . . . . . . . . . .
YA02-11-8C . . . . . . . . . . . . . . . . . . . . . . . . .
YA6C-CAP . . . . . . . . . . . . . . . . . . . . . . . . . .
YA6C-PLUG . . . . . . . . . . . . . . . . . . . . . . . .
YA8C-CAP . . . . . . . . . . . . . . . . . . . . . . . . . .
YA8C-PLUG . . . . . . . . . . . . . . . . . . . . . . . .
YA11C-CAP . . . . . . . . . . . . . . . . . . . . . . . . .
YA11C-PLUG . . . . . . . . . . . . . . . . . . . . . . .
YA16C-CAP . . . . . . . . . . . . . . . . . . . . . . . . .
YA16C-PLUG . . . . . . . . . . . . . . . . . . . . . . .
YAY1-8-16C . . . . . . . . . . . . . . . . . . . . . . . . .
YAY1-11-16C . . . . . . . . . . . . . . . . . . . . . . . .
YAY1-16-16C . . . . . . . . . . . . . . . . . . . . . . . .
YAY2-8-16C . . . . . . . . . . . . . . . . . . . . . . . . .
YAY2-11-16C . . . . . . . . . . . . . . . . . . . . . . . .
YAY2-16-16C . . . . . . . . . . . . . . . . . . . . . . . .
E-9
E-9
E-9
E-9
E-9
E-9
E-9
E-9
E-8
E-8
E-8
E-8
E-6
E-6
E-6
E-6
E-6
E-6
E-6
E-6
E-7
E-7
E-7
E-7
E-7
E-7
Part number
page
YAY5-6-4C . . . . . . . . . . . . . . . . . . . . . . . . . .
YAY5-6-6C . . . . . . . . . . . . . . . . . . . . . . . . . .
YAY5-6-12C . . . . . . . . . . . . . . . . . . . . . . . . .
YAY5-8-6C . . . . . . . . . . . . . . . . . . . . . . . . . .
YAY5-8-12C . . . . . . . . . . . . . . . . . . . . . . . . .
YAY5-11-6C . . . . . . . . . . . . . . . . . . . . . . . . .
YAY5-11-12C . . . . . . . . . . . . . . . . . . . . . . . .
YAY5-16-12C . . . . . . . . . . . . . . . . . . . . . . . .
YAY6-6-4C . . . . . . . . . . . . . . . . . . . . . . . . . .
YAY6-6-6C . . . . . . . . . . . . . . . . . . . . . . . . . .
YAY6-6-9C . . . . . . . . . . . . . . . . . . . . . . . . . .
YAY6-8-6C . . . . . . . . . . . . . . . . . . . . . . . . . .
YAY6-8-9C . . . . . . . . . . . . . . . . . . . . . . . . . .
YAY6-10-6C . . . . . . . . . . . . . . . . . . . . . . . . .
YAY6-10-9C . . . . . . . . . . . . . . . . . . . . . . . . .
YAY6-11-9C . . . . . . . . . . . . . . . . . . . . . . . . .
YAYA-6-6C. . . . . . . . . . . . . . . . . . . . . . . . . .
YAYA-8-6C. . . . . . . . . . . . . . . . . . . . . . . . . .
YAYA-8-8C. . . . . . . . . . . . . . . . . . . . . . . . . .
YAYA-10-6C. . . . . . . . . . . . . . . . . . . . . . . . .
YAYA-10-10C. . . . . . . . . . . . . . . . . . . . . . . .
YAYA-11-8C. . . . . . . . . . . . . . . . . . . . . . . . .
YAYA-11-11C. . . . . . . . . . . . . . . . . . . . . . . .
YAYA-16-11C. . . . . . . . . . . . . . . . . . . . . . . .
YAYA-16-16C. . . . . . . . . . . . . . . . . . . . . . . .
E-7
E-7
E-7
E-7
E-7
E-7
E-7
E-7
E-5
E-5
E-5
E-5
E-5
E-5
E-5
E-5
E-5
E-5
E-5
E-5
E-5
E-5
E-5
E-5
E-5
For Your Safety
Index
The hose assemblies listed in this catalogue are all special constructions with the hose having up to eight spiral
layers of steel wire. Due to this construction, pressures are achieved which far exceed German and international
standards. These hose types are manufactured and tested according to the Polyflex standards which have proved
to be effective over many years.
Polyflex hose assemblies are used at considerable working pressures. The critical area of a hose assembly is the
connection between flexible hose and rigid fitting (crimping area). Only the use of original Polyflex components
(hose, fittings and tooling) and full compliance with the Polyflex assembly instructions can guarantee safety and
conformity with standards. It is essential that training be given to customers in the hose assembly process in
order to make high quality Polyflex maximum pressure hose assemblies.
For the production and testing of the hose assemblies relevant to the applications, the guidelines and technical
regulations as well as the protection and hazard prevention rulings must be adhered to.
You as the manufacturer of Polyflex hose assemblies are obliged to mark these hose assemblies according to the
regulations and to verify their safety by a final pressure test.
Non-compliance with these rules can lead to the premature failure of the hose assembly and the loss of warranty.
H-14
Catalogue 4462 Global Edition
Part number
Max. working
pressure
Size
Min. burst
pressure
Min. bend
radius
Weight
Nipple ID
Ferrule OD
DF
DN3
size
mm
inch
mm
psi
mm
inch
kg/m
lbs/ft
mm
inch
mm
inch
2240D-02V32
-02
3.0
1/8
7.0
0.276 110.0 15,950 275.0
39,875
60
2.36
0.07
0.05
1.60
0.06
9.10
0.36
2.5
2240D-02V32-TC
-02
3.0
1/8
7.0
0.276 110.0 15,950 275.0
39,875
60
2.36
0.07
0.05
1.60
0.06
9.10
0.36
2.5
2440D-02V32
-02
3.0
1/8
7.9
0.311 207.0 30,000 518.0
75,000
100
3.94
0.12
0.08
1.50
0.06
9.80
0.39
2.5
DN4
size
mm
inch
mm
psi
mm
inch
kg/m
lbs/ft
mm
inch
mm
inch
2244N-025V00
-025
3.9
5/32
9.6
0.378 75.0
10,875 300.0
43,500
55
2.17
0.19
0.13
2.30
0.09 13.20 0.52
4.0
2380N-025V10
-025
3.9
5/32
9.7
0.382 75.0
10,875 300.0
43,500
55
2.17
0.16
0.11
2.30
0.09 13.00 0.51
4.0
2240D-025V32
-025
4.0
5/32
7.7
0.303 120.0 17,400 300.0
43,500
75
2.95
0.10
0.07
2.30
0.09
9.90
0.39
2.5
2240D-025V32-TC
-025
4.0
5/32
7.7
0.303 120.0 17,400 300.0
43,500
75
2.95
0.10
0.07
2.30
0.09
9.90
0.39
2.5
2380N-025V10W
-025
4.0
5/32
9.7
0.382 140.0 20,300 350.0
50,750
55
2.17
0.16
0.11
2.10
0.08 13.00 0.51
2.5
2248D-025V32
-025
4.0
5/32
7.9
0.311 150.0 21,750 375.0
54,375
75
2.95
0.11
0.07
2.30
0.09
9.80
0.39
2.5
2248D-025V32-TC
-025
4.0
5/32
7.9
0.311 150.0 21,750 375.0
54,375
75
2.95
0.11
0.07
2.30
0.09
9.80
0.39
2.5
2440D-025V32
-025
4.0
5/32
10.4 0.409 220.0 31,900 550.0
79,750
100
3.94
0.21
0.14
1.40
0.06 14.60 0.57
2.5
2440D-025V32-TC
-025
3.9
5/32
10.4 0.409 220.0 31,900 550.0
79,750
100
3.94
0.21
0.14
1.40
0.06 14.60 0.57
2.5
2640D-025V32
-025
3.9
5/32
12.0 0.472 280.0 40,600 700.0 101,500
140
5.51
0.29
0.19
1.90
0.07 15.60 0.61
2.5
2740D-025V16
-025
3.9
5/32
12.0 0.472 300.0 43,500 780.0 113,100
120
4.72
0.40
0.27
1.90
0.07 15.60 0.61
2.6
2448D-025V32-TC
-025
4.0
5/32
9.9
94,240
100
3.94
0.21
0.14
1.80
0.07 12.80 0.50
2.0
DN5
size
mm
inch
mm
psi
mm
inch
kg/m
lbs/ft
mm
inch
2240D-03V32
-03
4.7
3/16
9.5
0.374 100.0 14,500 250.0
36,250
95
3.74
0.13
0.09
2.80
0.11 12.00 0.47
2.5
2240D-03V32-TC
-03
4.8
3/16
9.5
0.374 100.0 14,500 250.0
36,250
95
3.74
0.13
0.09
2.80
0.11 12.00 0.47
2.5
2248D-03V32
-03
4.9
3/16
9.5
0.374 140.0 20,300 350.0
50,750
95
3.74
0.14
0.09
2.8
0.11
12.1
0.48
2.5
2248D-03V32-TC
-03
4.9
3/16
9.5
0.374 140.0 20,300 350.0
50,750
95
3.74
0.14
0.09
2.8
0.11
12.1
0.48
2.5
2440D-03V32
-03
4.8
3/16
11.5 0.453 180.0 26,100 450.0
65,250
130
5.12
0.28
0.19
1.40
0.06 15.30 0.60
2.5
2440D-03V32-TC
-03
4.7
3/16
11.5 0.453 180.0 26,100 450.0
65,250
130
5.12
0.28
0.19
1.40
0.06 15.30 0.60
2.5
2640D-03V32
-03
4.8
3/16
13.0 0.512 250.0 36,250 625.0
90,625
175
6.89
0.41
0.28
2.30
0.09 18.60 0.73
2.5
2740D-03V34
-03
4.8
3/16
13.2 0.520 280.0 40,600 700.0 101,500
200
7.87
0.47
0.32
2.30
0.09 18.80 0.74
2.5
2749D-03V34
-03
4.8
3/16
13.3 0.524 301.0 43,645 700.0 101,500
200
7.87
0.47
0.32
2.30
0.09 18.80 0.74
2.3
2840D-03V34
-03
4.6
3/16
15.0 0.591 400.0 58,000 800.0 116,000
200
7.87
0.66
0.44
2.30
0.09 19.60 0.77
2.0
DN6
size
mm
inch
mm
psi
mm
inch
kg/m
lbs/ft
mm
inch
2380N-04V00
-04
6.3
1/4
13.3 0.524 70.0
10,150 280.0
40,600
70
2.76
0.27
0.18
3.60
0.14 18.50 0.73
4.0
2380N-04V10
-04
6.3
1/4
13.3 0.524 70.0
10,150 280.0
40,600
70
2.76
0.27
0.18
3.60
0.14 18.10 0.71
4.0
2380N-04V10-MSHA -04
6.3
1/4
13.3 0.524 70.0
10,150 280.0
40,600
70
2.76
0.28
0.19
3.60
0.14 18.50 0.73
4.0
2388N-04V00
-04
6.3
1/4
13.3 0.524 80.0
11,600 320.0
46,400
80
3.15
0.30
0.20
3.60
0.14 18.30 0.72
4.0
2240D-04V32
-04
6.3
1/4
11.5 0.453 110.0 15,950 275.0
39,875
110
4.33
0.20
0.13
3.80
0.15 13.60 0.54
2.5
2240D-04V32-TC
-04
6.4
1/4
11.5 0.453 110.0 15,950 275.0
39,875
110
4.33
0.20
0.13
3.80
0.15 13.60 0.54
2.5
2380M-04V30W
-04
6.3
1/4
15.8 0.622 110.0 15,950 280.0
40,600
70
2.76
0.28
0.19
4.00
0.16 17.40 0.69
2.5
2380N-04V00W
-04
6.3
1/4
13.3 0.524 110.0 15,950 280.0
40,600
70
2.76
0.28
0.19
3.80
0.15 18.00 0.71
2.5
2388N-04V12W
-04
6.3
1/4
13.3 0.524 128.0 18,560 320.0
46,400
80
3.15
0.30
0.20
3.60
0.14 18.20 0.72
2.5
2440D-04V32
-04
6.4
1/4
12.5 0.492 164.0 23,780 410.0
59,450
155
6.10
0.33
0.22
2.90
0.11 17.00 0.67
2.5
2440D-04V32-TC
-04
6.3
1/4
12.5 0.492 164.0 23,780 410.0
59,450
155
6.10
0.33
0.22
2.90
0.11 17.00 0.67
2.5
DN8
size
mm
inch
mm
psi
MPa
psi
mm
inch
kg/m
lbs/ft
mm
inch
2380N-05V00
-05
8.3
5/16
15.8 0.622 62.5
9,060
250.0
36,250
90
3.54
0.35
0.24
4.80
0.19 20.10 0.79
4.0
2240D-05V32
-05
8.0
5/16
13.3 0.524 90.0
13,050 225.0
32,625
120
4.72
0.25
0.17
5.30
0.21 16.10 0.63
2.5
2240D-05V32-TC
-05
8.1
5/16
13.3 0.524 90.0
13,050 225.0
32,625
120
4.72
0.25
0.17
5.30
0.21 16.10 0.63
2.5
2248D-05V32-TC
-05
8.1
5/16
13.4 0.528 100.0 14,500 250.0
36,250
120
4.72
0.25
0.17
4.80
0.19 16.10 0.63
2.5
2380M-05V30W
-05
8.3
5/16
15.8 0.622 100.0 14,500 250.0
36,250
90
3.54
0.35
0.24
5.30
0.21 20.20 0.80
2.5
2380N-05V00W
-05
8.3
5/16
15.8 0.622 100.0 14,500 250.0
36,250
90
3.54
0.35
0.24
4.90
0.19 20.00 0.79
2.5
2440D-05V32
-05
8.1
5/16
15.1 0.594 150.0 21,750 375.0
54,375
175
6.89
0.44
0.30
3.70
0.15 21.00 0.83
2.5
2440D-05V32-TC
-05
8.0
5/16
15.1 0.594 150.0 21,750 375.0
54,375
175
6.89
0.44
0.30
3.70
0.15 21.00 0.83
2.5
2640D-05V32
-05
8.0
5/16
16.9 0.665 210.0 30,450 525.0
76,125
225
8.86
0.68
0.46
3.70
0.15 22.00 0.87
2.5
inch
inch
MPa
MPa
psi
psi
MPa
MPa
0.39 325.0 47,120 650.0
inch
inch
inch
MPa
MPa
MPa
psi
psi
MPa
MPa
mm
mm
mm
inch
inch
inch
Part number
DN8
Max. working
pressure
Size
Ferrule OD
inch
mm
psi
mm
inch
kg/m
lbs/ft
mm
inch
7.8
5/16
17.2 0.677 250.0 36,250 625.0
90,625
200
7.87
0.83
0.56
3.70
0.15 22.80 0.90
2.5
2741D-05V34/10
-05
7.7
5/16
21.2 0.835 250.0 36,250 625.0
90,625
200
7.87
0.95
0.64
3.70
0.15 22.80 0.90
2.5
2748D-05V34
-05
7.8
5/16
17.3 0.681 280.0 40,600 700.0 101,500
230
9.06
0.83
0.56
3.70
0.15 22.80 0.90
2.5
2748D-05V34/16
-05
7.8
5/16
21.8 0.858 280.0 40,600 700.0 101,500
230
9.06
0.99
0.67
3.70
0.15 22.80 0.90
2.5
2840D-05V36
-05
7.8
5/16
19.5 0.768 300.0 43,500 700.0 101,500
250
9.84
1.10
0.74
3.70
0.15 24.00 0.94
2.3
2841D-05V36/17
-05
7.7
5/16
23.5 0.925 300.0 43,500 700.0 101,500
250
9.84
1.38
0.93
3.70
0.15 24.00 0.94
2.3
2749D-05V34
-05
7.8
5/16
17.3 0.681 301.0 43,645 700.0 101,500
230
9.06
0.83
0.56
3.70
0.15 22.80 0.90
2.3
2848D-05V34
-05
7.8
5/16
19.6 0.772 320.0 46,400 800.0 116,000
280
11.02
1.10
0.74
3.60
0.14 24.00 0.94
2.5
2849D-05V34
-05
7.8
5/16
19.6 0.772 380.0 55,000 800.0 116,000
280
11.02
1.10
0.74
3.60
0.14 24.00 0.94
2.1
DN10
size
mm
inch
mm
psi
MPa
psi
mm
inch
kg/m
lbs/ft
mm
inch
2244N-06V00
-06
9.8
3/8
18.0 0.709 53.5
7,755
215.0
31,175
120
4.72
0.50
0.34
6.80
0.27 23.80 0.94
4.0
2380N-06V10
-06
9.8
3/8
17.9 0.705 57.5
8,337
230.0
33,350
120
4.72
0.44
0.30
6.80
0.27 23.40 0.92
4.0
2022N-06V15-10K
-06
9.7
3/8
19.0 0.748 69.0
10,000 276.0
40,000
100
3.94
0.24
0.16
5.30
0.21 23.20 0.91
4.0
2580N-06V10-MSHA -06
9.8
3/8
21.6 0.850 70.0
10,150 280.0
40,600
95
3.74
0.94
0.63
5.50
0.22 28.50 1.12
4.0
2244N-06V10W
-06
9.7
3/8
18.0 0.709 86.0
12,470 215.0
31,175
120
4.72
0.50
0.34
7.00
0.28 23.50 0.93
2.5
2440N-06V30
-06
9.7
3/8
19.4 0.764 140.0 20,300 350.0
50,750
190
7.48
0.73
0.49
5.80
0.23 26.90 1.06
2.5
2580N-06V12
-06
9.8
3/8
21.6 0.850 160.0 23,200 400.0
58,000
95
3.74
0.94
0.63
5.50
0.22 28.50 1.12
2.5
DN12
size
mm
inch
mm
2244N-08V10
-08
12.9
1/2
22.7 0.894 55.0
2380N-08V10
-08
12.9
1/2
2022N-08V15-10K
-08
12.9
1/2
2580N-08V10-MSHA -08
12.9
2244N-08V10W
-08
2380N-08V10W
-08
2388N-08V12W
2440N-08V30
mm
inch
psi
MPa
psi
mm
inch
kg/m
lbs/ft
mm
inch
220.0
31,900
150
5.91
0.80
0.54
8.80
0.35 29.50 1.16
4.0
22.9 0.902 55.0
7,975
220.0
31,900
150
5.91
0.68
0.46
6.60
0.26 30.00 1,18
4.0
23.0 0.906 69.0
10,000 276.0
40,000
100
3.94
0.34
0.23
6.50
0.26 30.50 1.20
4.0
1/2
25.0 0.984 70.0
10,150 280.0
40,600
110
4.33
1.19
0.80
6.90
0.27 30.00 1.18
4.0
12.8
1/2
22.7 0.894 88.0
12,760 220.0
31,900
150
5.91
0.80
0.54
9.30
0.37 29.00 1.14
2.5
13.0
1/2
22.9 0.900 88.0
12,760 220.0
31,900
150
5.91
0.68
0.46
6.60
0.26 30.20 1.19
2.5
-08
13.0
1/2
23.0 0.906 110.0 15,950 275.0
39,875
100
3.94
0.80
0.54
7.50
0.30 28.50 1.12
2.5
-08
12.8
1/2
22.5 0.886 140.0 20,300 350.0
50,750
200
7.87
0.94
0.63
6.70
0.26 30.70 1.21
2.5
2580N-08V12
-08
12.9
1/2
25.0 0.984 140.0 20,300 350.0
50,750
110
4.33
1.19
0.80
7.50
0.30 30.50 1.20
2.5
2640N-08V32
-08
12.8
1/2
24.5 0.965 180.0 26,100 450.0
65,250
290
11.42
1.36
0.91
6.80
0.27 34.00 1.34
2.5
2740D-08V30
-08
12.7
1/2
27.0 1.063 200.0 29,000 500.0
72,500
300
11.81
1.85
1.24
7.50
0.30 31.80 1.25
2.5
2748D-08V30
-08
13.0
1/2
27.1 1.067 250.0 36,250 625.0
90,625
300
11.81
1.85
1.24
7.50
0.30 31.90 1.26
2.5
2840D-08V30
-08
12.7
1/2
29.8 1.173 250.0 36,250 625.0
90,625
350
13.78
2.50
1.68
7.60
0.30 34.20 1.35
2.5
2848D-08V30
-08
13.0
1/2
29.9 1.177 300.0 43,500 625.0
90,625
350
13.78
2.50
1.68
7.50
0.30 33.80 1,33
2.1
DN20
size
mm
inch
mm
psi
mm
inch
kg/m
lbs/ft
mm
inch
2440N-12V30
-12
19.6
3/4
30.0 1.181 100.0 14,500 250.0
36,250
250
9.84
1.39
0.93
12.70 0.50 38.50 1.52
2.5
2580N-12V12
-12
19.8
3/4
32.6 1.283 120.0 17,400 300.0
43,500
170
6.69
1.76
1.18
12.50 0.49 39.80 1.57
2.5
2640N-12V32
-12
19.6
3/4
33.0 1.299 140.0 20,300 350.0
50,750
350
13.78
2.10
1.41
12.50 0.49 40.60 1.60
2.5
2648N-12V32
-12
19.8
3/4
33.7 1.327 160.0 23,200 400.0
58,000
350
13.78
2.28
1.53
12.50 0.49 41.10 1.62
2.5
DN25
size
mm
inch
mm
psi
mm
inch
kg/m
lbs/ft
2440N-16V30
-16
25.0
1
37.0 1.457 90.0
13,050 225.0
32,625
300
11.81
2.00
1.34
17.20 0.68 45.30 1.78
2.5
2640N-16V32
-16
25.0
1
40.0 1.575 120.0 17,400 300.0
43,500
400
15.75
2.90
1.95
17.30 0.68 49.00 1.93
2.5
2648N-16V32
-16
25.0
1
40.8 1.606 150.0 21,750 375.0
54,375
400
15.75
3.10
2.08
16.50 0.65 49.00 1.93
2.5
DN32
size
mm
inch
mm
psi
MPa
psi
mm
inch
kg/m
lbs/ft
2244N-20V30
-20
31.8
1 1/4
44.0 1.732 27.5
3,990
110.0
15,950
400
15.75
1.83
1.23
25.30 1.00 50.00 1.97
4.0
2380N-20V30
-20
31.8
1 1/4
44.0 1.732 27.5
3,990
110.0
15,950
400
15.75
1.83
1.23
24.90 0.98 49.40 1.94
4.0
inch
inch
MPa
MPa
MPa
psi
psi
MPa
MPa
General remark on column DF in the tables:
Ultra high pressure hoses are normally used with a design factor of 2.5:1 according to ISO 7751.
For hydraulic hoses, a design factor of 4:1 applies.
mm
mm
inch
inch
mm
inch
7,975
inch
MPa
mm
DF
mm
inch
MPa
Nipple ID
-05
MPa
psi
Weight
size
inch
MPa
Min. bend
radius
2740D-05V34
cont.
inch
Min. burst
pressure
mm
mm
mm
inch
inch
inch
inch
Parker’s Motion & Control Technologies
!Tå0ARKERåWEREåGUIDEDåBYå
AåRELENTLESSåDRIVEåTOåHELPå
OURåCUSTOMERSåBECOMEåMOREå
PRODUCTIVEåANDåACHIEVEå
HIGHERåLEVELSåOFåPROlTABIL
!EROSPACE
#LIMATEå#ONTROL
%LECTROMECHANICAL
&ILTRATION
+EYå-ARKETS
+EYå-ARKETS¬
+EYå-ARKETS
+EYå-ARKETS
!FTERMARKET¬SERVICES¬
#OMMERCIAL¬TRANSPORTS
%NGINES
'ENERAL¬¬BUSINESS¬AVIATION
(ELICOPTERS
,AUNCH¬VEHICLES
-ILITARY¬AIRCRAFT
-ISSILES
0OWER¬GENERATION¬
2EGIONAL¬TRANSPORTS
5NMANNED¬AERIAL¬VEHICLES
!GRICULTURE
!IR¬CONDITIONING
#ONSTRUCTION¬-ACHINERY
&OOD¬¬BEVERAGE
)NDUSTRIAL¬MACHINERY
,IFE¬SCIENCES
/IL¬¬GAS
0RECISION¬COOLING
0ROCESS
2EFRIGERATION
4RANSPORTATION¬¬
!EROSPACE
&ACTORY¬AUTOMATION
,IFE¬SCIENCE¬¬MEDICAL
-ACHINE¬TOOLS
0ACKAGING¬MACHINERY
0APER¬MACHINERY
0LASTICS¬MACHINERY¬¬CONVERTING
0RIMARY¬METALS
3EMICONDUCTOR¬¬ELECTRONICS
4EXTILE
7IRE¬¬CABLE
!EROSPACE
&OOD¬¬BEVERAGE
)NDUSTRIAL¬PLANT¬¬EQUIPMENT
,IFE¬SCIENCES
-ARINE
-OBILE¬EQUIPMENT
/IL¬¬GAS
0OWER¬GENERATION¬¬
RENEWABLE¬ENERGY
0ROCESS
4RANSPORTATION¬
7ATER¬0URIlCATION
+EYå0RODUCTS
+EYå0RODUCTSå
+EYå0RODUCTS
#ONTROL¬SYSTEMS¬¬
ACTUATION¬PRODUCTS
%NGINE¬SYSTEMS¬
¬COMPONENTS
&LUID¬CONVEYANCE¬SYSTEMS
¬COMPONENTS
&LUID¬METERING¬DELIVERY¬
¬ATOMIZATION¬DEVICES
&UEL¬SYSTEMS¬¬COMPONENTS
&UEL¬TANK¬INERTING¬SYSTEMS
(YDRAULIC¬SYSTEMS¬
¬COMPONENTS
4HERMAL¬MANAGEMENT
7HEELS¬¬BRAKES
!CCUMULATORS
!DVANCED¬ACTUATORS
#/¬CONTROLS
%LECTRONIC¬CONTROLLERS
&ILTER¬DRIERS
(AND¬SHUTOFF¬VALVES
(EAT¬EXCHANGERS¬
(OSE¬¬lTTINGS
0RESSURE¬REGULATING¬VALVES
2EFRIGERANT¬DISTRIBUTORS
3AFETY¬RELIEF¬VALVES
3MART¬PUMPS
3OLENOID¬VALVES
4HERMOSTATIC¬EXPANSION¬VALVES
!#$#¬DRIVES¬¬SYSTEMS
%LECTRIC¬ACTUATORS¬GANTRY¬ROBOTS¬
¬SLIDES
%LECTROHYDROSTATIC¬ACTUATION¬SYSTEMS
%LECTROMECHANICAL¬ACTUATION¬SYSTEMS
(UMAN¬MACHINE¬INTERFACE
,INEAR¬MOTORS
3TEPPER¬MOTORS¬SERVO¬MOTORS¬
DRIVES¬¬CONTROLS
3TRUCTURAL¬EXTRUSIONS
+EYå0RODUCTSå
&LUIDåå'ASå(ANDLING
(YDRAULICS
+EYå-ARKETSå
0NEUMATICS
0ROCESSå#ONTROL
+EYå-ARKETS¬
3EALINGåå3HIELDING
!ERIAL¬LIFT
!GRICULTURE
!LTERNATIVE¬ENERGY
#ONSTRUCTION¬MACHINERY
&ORESTRY
)NDUSTRIAL¬MACHINERY
-ACHINE¬TOOLS
-ARINE
-ATERIAL¬HANDLING
-INING
/IL¬¬GAS
0OWER¬GENERATION
2EFUSE¬VEHICLES
2ENEWABLE¬ENERGY
4RUCK¬HYDRAULICS
4URF¬EQUIPMENT
+EYå-ARKETS
+EYå-ARKETSå
!ERIAL¬LIFT
!GRICULTURE
"ULK¬CHEMICAL¬HANDLING
#ONSTRUCTION¬MACHINERY
&OOD¬¬BEVERAGE
&UEL¬¬GAS¬DELIVERY
)NDUSTRIAL¬MACHINERY
,IFE¬SCIENCES¬
-ARINE
-INING
-OBILE
/IL¬¬GAS
2ENEWABLE¬ENERGY
4RANSPORTATION
+EYå-ARKETSå
!EROSPACE
#ONVEYOR¬¬MATERIAL¬HANDLING
&ACTORY¬AUTOMATION
,IFE¬SCIENCE¬¬MEDICAL
-ACHINE¬TOOLS
0ACKAGING¬MACHINERY
4RANSPORTATION¬¬AUTOMOTIVE
!LTERNATIVE¬FUELS
"IOPHARMACEUTICALS
#HEMICAL¬¬RElNING
&OOD¬¬BEVERAGE
-ARINE¬¬SHIPBUILDING
-EDICAL¬¬DENTAL
-ICROELECTRONICS
.UCLEAR¬0OWER
/FFSHORE¬OIL¬EXPLORATION
/IL¬¬GAS
0HARMACEUTICALS
0OWER¬GENERATION
0ULP¬¬PAPER
3TEEL
7ATERWASTEWATER
!EROSPACE
#HEMICAL¬PROCESSING
#ONSUMER
&LUID¬POWER
'ENERAL¬INDUSTRIAL
)NFORMATION¬TECHNOLOGY
,IFE¬SCIENCES
-ICROELECTRONICS
-ILITARY
/IL¬¬GAS
0OWER¬GENERATION
2ENEWABLE¬ENERGY
4ELECOMMUNICATIONS
4RANSPORTATION
ITYåBYåENGINEERINGåTHEåBESTå
SYSTEMSåFORåTHEIRåREQUIRE
MENTSå)TåMEANSåLOOKINGåATå
CUSTOMERåAPPLICATIONSåFROMå
MANYåANGLESåTOålNDåNEWå
WAYSåTOåCREATEåVALUEå7HAT
EVERåTHEåMOTIONåANDåCONTROLå
TECHNOLOGYåNEEDå0ARKERåHASå
THEåEXPERIENCEåBREADTHåOFå
PRODUCTåANDåGLOBALåREACHå
TOåCONSISTENTLYåDELIVERå.Oå
COMPANYåKNOWSåMOREåABOUTå
MOTIONåANDåCONTROLåTECHNOL
OGYåTHANå0ARKERå&ORåFURTHERå
INFOåCALLåååå
+EYå0RODUCTSå
#HECK¬VALVES¬
#ONNECTORS¬FOR¬LOW¬PRESSURE¬
mUID¬CONVEYANCE
$EEP¬SEA¬UMBILICALS
$IAGNOSTIC¬EQUIPMENT¬
(OSE¬COUPLINGS
)NDUSTRIAL¬HOSE
-OORING¬SYSTEMS¬¬
POWER¬CABLES
04&%¬HOSE¬¬TUBING¬
1UICK¬COUPLINGS
2UBBER¬¬THERMOPLASTIC¬HOSE¬
4UBE¬lTTINGS¬¬ADAPTERS
4UBING¬¬PLASTIC¬lTTINGS
+EYå0RODUCTSå
!CCUMULATORS
#ARTRIDGE¬VALVES
%LECTROHYDRAULIC¬ACTUATORS
(UMAN¬MACHINE¬INTERFACES
(YBRID¬DRIVES
(YDRAULIC¬CYLINDERS¬
(YDRAULIC¬MOTORS¬¬PUMPS
(YDRAULIC¬SYSTEMS
(YDRAULIC¬VALVES¬¬CONTROLS
(YDROSTATIC¬STEERING
)NTEGRATED¬HYDRAULIC¬CIRCUITS
0OWER¬TAKEOFFS¬
0OWER¬UNITS
2OTARY¬ACTUATORS
3ENSORS
+EYå0RODUCTS
!IR¬PREPARATION
"RASS¬lTTINGS¬¬VALVES
-ANIFOLDS
0NEUMATIC¬ACCESSORIES
0NEUMATIC¬ACTUATORS¬¬GRIPPERS
0NEUMATIC¬VALVES¬¬CONTROLS
1UICK¬DISCONNECTS
2OTARY¬ACTUATORS
2UBBER¬¬THERMOPLASTIC¬HOSE¬
¬COUPLINGS
3TRUCTURAL¬EXTRUSIONS
4HERMOPLASTIC¬TUBING¬¬lTTINGS
6ACUUM¬GENERATORS¬CUPS¬¬SENSORS
+EYå0RODUCTS
!NALYTICAL¬)NSTRUMENTS¬
!NALYTICAL¬SAMPLE¬CONDITIONING
PRODUCTS¬¬SYSTEMS
#HEMICAL¬INJECTION¬lTTINGS
¬VALVES
&LUOROPOLYMER¬CHEMICAL
DELIVERY¬lTTINGS¬VALVES¬
¬PUMPS
(IGH¬PURITY¬GAS¬DELIVERY¬
lTTINGS¬VALVES¬REGULATORS
¬DIGITAL¬mOW¬CONTROLLERS
)NDUSTRIAL¬MASS¬mOW¬METERS
CONTROLLERS
0ERMANENT¬NOWELD¬TUBE¬lTTINGS
0RECISION¬INDUSTRIAL¬REGULATORS
¬mOW¬CONTROLLERS
0ROCESS¬CONTROL¬DOUBLE¬
BLOCK¬¬BLEEDS
0ROCESS¬CONTROL¬lTTINGS¬VALVES¬
REGULATORS¬¬MANIFOLD¬VALVES
!NALYTICAL¬GAS¬GENERATORS
#OMPRESSED¬AIR¬lLTERS¬¬DRYERS
%NGINE¬AIR¬COOLANT¬FUEL¬¬OIL¬lLTRATION¬SYSTEMS
&LUID¬CONDITION¬MONITORING¬SYSTEMS
(YDRAULIC¬¬LUBRICATION¬lLTERS
(YDROGEN¬NITROGEN¬¬ZERO¬
AIR¬GENERATORS
)NSTRUMENTATION¬lLTERS
-EMBRANE¬¬lBER¬lLTERS
-ICROlLTRATION
3TERILE¬AIR¬lLTRATION
7ATER¬DESALINATION¬¬PURIlCATION¬lLTERS¬¬
SYSTEMS
+EYå0RODUCTSå
$YNAMIC¬SEALS
%LASTOMERIC¬ORINGS
%LECTROMEDICAL¬INSTRUMENT
DESIGN¬¬ASSEMBLY
%-)¬SHIELDING
%XTRUDED¬¬PRECISIONCUT
FABRICATED¬ELASTOMERIC¬SEALS
(IGH¬TEMPERATURE¬METAL¬SEALS
(OMOGENEOUS¬¬INSERTED
ELASTOMERIC¬SHAPES
-EDICAL¬DEVICE¬FABRICATION¬
¬ASSEMBLY
-ETAL¬¬PLASTIC¬RETAINED
COMPOSITE¬SEALS
3HIELDED¬OPTICAL¬WINDOWS
3ILICONE¬TUBING¬¬EXTRUSIONS
4HERMAL¬MANAGEMENT
6IBRATION¬DAMPENING
Parker Worldwide
Europe, Middle East, Africa
AE – United Arab Emirates,
Dubai
Tel: +971 4 8127100
parker.me@parker.com
AT – Austria, Wiener Neustadt
Tel: +43 (0)2622 23501-0
parker.austria@parker.com
AT – Eastern Europe, Wiener
Neustadt
Tel: +43 (0)2622 23501 900
parker.easteurope@parker.com
HU – Hungary, Budaörs
Tel: +36 23 885 470
parker.hungary@parker.com
ZA – South Africa, Kempton Park
Tel: +27 (0)11 961 0700
parker.southafrica@parker.com
IE – Ireland, Dublin
Tel: +353 (0)1 466 6370
parker.ireland@parker.com
North America
IT – Italy, Corsico (MI)
Tel: +39 02 45 19 21
parker.italy@parker.com
KZ – Kazakhstan, Almaty
Tel: +7 7273 561 000
parker.easteurope@parker.com
AZ – Azerbaijan, Baku
Tel: +994 50 2233 458
parker.azerbaijan@parker.com
NL – The Netherlands, Oldenzaal
Tel: +31 (0)541 585 000
parker.nl@parker.com
BE/LU – Belgium, Nivelles
Tel: +32 (0)67 280 900
parker.belgium@parker.com
NO – Norway, Asker
Tel: +47 66 75 34 00
parker.norway@parker.com
BG – Bulgaria,
Tel: +359 2 980 1344
parker.bulgaria@parker.com
PL – Poland, Warsaw
Tel: +48 (0)22 573 24 00
parker.poland@parker.com
BY – Belarus, Minsk
Tel: +48 (0)22 573 24 00
parker.poland@parker.com
PT – Portugal, Leca da Palmeira
Tel: +351 22 999 7360
parker.portugal@parker.com
CH – Switzerland, Etoy
Tel: +41 (0)21 821 87 00
parker.switzerland@parker.com
RO – Romania, Bucharest
Tel: +40 21 252 1382
parker.romania@parker.com
CZ – Czech Republic, Klecany
Tel: +420 284 083 111
parker.czechrepublic@parker.com
RU – Russia, Moscow
Tel: +7 495 645-2156
parker.russia@parker.com
DE – Germany, Kaarst
Tel: +49 (0)2131 4016 0
parker.germany@parker.com
SE – Sweden, Spånga
Tel: +46 (0)8 59 79 50 00
parker.sweden@parker.com
DK – Denmark, Ballerup
Tel: +45 43 56 04 00
parker.denmark@parker.com
SK – Slovakia, Banská Bystrica
Tel: +421 484 162 252
parker.slovakia@parker.com
ES – Spain, Madrid
Tel: +34 902 330 001
parker.spain@parker.com
SL – Slovenia, Novo Mesto
Tel: +386 7 337 6650
parker.slovenia@parker.com
FI – Finland, Vantaa
Tel: +358 (0)20 753 2500
TR – Turkey, Istanbul
Tel: +90 216 4997081
parker.turkey@parker.com
FR – France, Contamine s/Arve
Tel: +33 (0)4 50 25 80 25
parker.france@parker.com
UA – Ukraine, Kiev
Tel: +48 (0)22 573 24 00
parker.poland@parker.com
GR – Greece, Athens
Tel: +30 210 933 6450
parker.greece@parker.com
UK – United Kingdom, Warwick
Tel: +44 (0)1926 317 878
parker.uk@parker.com
© 2015 Parker Hannifin Corporation. All rights reserved. Subject to technical modification and error.
CA – Canada, Milton, Ontario
Tel: +1 905 693 3000
US – USA, Cleveland
Tel: +1 216 896 3000
Asia Pacific
AU – Australia, Castle Hill
Tel: +61 (0)2-9634 7777
CN – China, Shanghai
Tel: +86 21 2899 5000
HK – Hong Kong
Tel: +852 2428 8008
IN – India, Mumbai
Tel: +91 22 6513 7081-85
JP – Japan, Tokyo
Tel: +81 (0)3 6408 3901
KR – South Korea, Seoul
Tel: +82 2 559 0400
MY – Malaysia, Shah Alam
Tel: +60 3 7849 0800
NZ – New Zealand, Mt Wellington
Tel: +64 9 574 1744
SG – Singapore
Tel: +65 6887 6300
TH – Thailand, Bangkok
Tel: +662 186 7000
TW – Taiwan, Taipei
Tel: +886 2 2298 8987
South America
AR – Argentina, Buenos Aires
Tel: +54 3327 44 4129
BR – Brazil, Sao Jose dos Campos
Tel: +55 800 727 5374
CL – Chile, Santiago
Tel: +56 2 623 1216
MX – Mexico, Toluca
Tel: +52 72 2275 4200
CAT_4462_UHP_Hose_UK 07/2015
hsh / Zalsman Zwolle bv
Parker Hannifin Manufacturing Germany GmbH & Co. KG
polyflex Division
An der Tuchbleiche 4
68623 Lampertheim (Hüttenfeld)
Tel.: +49 (0)6256 81-0
Fax: +49 (0)6256 81-123
www.parker.com/polyflex
polyflex@parker.com