Dissertation MQ

INAUGURAL-DISSERTATION
zur
Erlangung der Doktorwürde
der
Naturwissenschaftlich – Mathematischen Gesamtfakultät
der
Ruprecht-Karls-Universität
Heidelberg
vorgelegt von
Diplom-Biologin Kerstin Weigl
aus Mannheim
2001
Systematische Analyse der
Genexpressionsmuster in epithelialen
Ovarialkarzinomen durch Differential Display
Gutachter:
Prof. Dr. Ekkehard K. F. Bautz
Prof. Dr. Herwig Ponstingl
Die vorliegende Arbeit wurde im Deutschen Krebsforschungszentrum Heidelberg, Abteilung
„Molekulare Biologie der Mitose“ in der Zeit von April 1998 bis März 2001 unter Anleitung von
Prof Dr. Herwig Ponstingl ausgeführt.
Bei Herrn Prof. Dr. Ponstingl bedanke ich mich ganz herzlich für die interessante
Themenstellung, die Bereitstellung des Arbeitsplatzes und der Materialien sowie für die
gewährte Freiheit bei der Durchführung dieser Arbeit.
Besonderer Dank gilt Herrn Prof. Dr. Bautz, der sich freundlicherweise bereit erklärt hat,
diese Arbeit vor der Fakultät zu vertreten.
Vielen Dank für die Asservation der Gewebe an die klinischen Kooperationspartner der
Universitäts Frauenkliniken in Heidelberg und Tübingen, insbesondere an Herrn Dr. U. Hahn
(Heidelberg), Herrn Dr. R. Kurek (Tübingen), Herrn Dr. A. Marmé (Heidelberg), Herrn Prof.
Dr. G. Bastert (Heidelberg) und Herrn Prof. Dr. D. Wallwiener (Tübingen).
Auch bei Herrn PD Dr. H.-P. Sinn möchte ich mich für die Aufarbeitung der histologischen
Präparate herzlich bedanken.
Für die immerwährende und oft genutzte Diskussionsbereitschaft, für zahlreiche Anregungen
und die sehr hilfreiche Unterstützung bei der Erstellung der Arbeit möchte ich mich in
besonderer Weise bei Herrn Dr. Hans-Peter Zimmermann bedanken.
Danke auch an Olga Mezler und Claudia Müller für ihre Hilfsbereitschaft, die den Laboralltag
erleichtert hat.
Herr PD Dr. Ralf Bischoff gab mir viele Tips in Fragen der Proteinchemie und Jürgen
Kretschmer half mir bei deren Umsetzung. Vielen Dank dafür.
Herrn Andreas Hunziker danke ich für die schnelle und genaue Sequenzierung der DNAs
und Herrn Dr. Rüdiger Pipkorn für die Herstellung meiner Peptide.
Für die kritische und konstruktive Durchsicht des Manuskripts und viele hilfreiche
Anregungen danke ich Sandra Kneißel und Herrn Dr. Hans-Peter Zimmermann.
Danke allen anderen Mitarbeitern des Labors. Die angenehme Arbeitsatmosphäre und die
gute Zusammenarbeit waren stets sehr hilfreich.
An dieser Stelle möchte ich mich auch bei Hagen und seinen Eltern bedanken, die mich
während der gesamten Zeit in jeder erdenklichen Weise unterstützten.
Für Hagen
Inhaltsverzeichnis
1 Einleitung ..........................................................................................................................1
1.1 Risikofaktoren für die Entstehung von Ovarialkarzinomen ...........................................1
1.1.1 Genetische Faktoren ............................................................................................1
1.1.2 Endokrine Faktoren ..............................................................................................2
1.1.3 Umweltfaktoren ....................................................................................................2
1.1.4 Molekulare Risikofaktoren ....................................................................................3
1.2 Metastasierung und Therapie ......................................................................................5
1.3 Zielsetzung ..................................................................................................................6
2 Material .............................................................................................................................9
2.1 Chemikalien.................................................................................................................9
2.2 Reaktions-Kits, Bibliotheken und Fertiglösungen .......................................................10
2.3 Verbrauchsmaterial ...................................................................................................11
2.4 Laborgeräte ...............................................................................................................11
2.5 Enzyme und Marker ..................................................................................................12
2.6 E.coli-Stämme ...........................................................................................................12
2.7 cDNA-Bibliotheken ....................................................................................................13
2.8 Phagen......................................................................................................................13
2.9 Vektoren....................................................................................................................13
2.10 Zellinien .................................................................................................................15
2.11 Histologische Befunde von Patientengeweben.......................................................16
2.12 Primer ....................................................................................................................17
3 Methoden ........................................................................................................................19
3.1 Gewebeentnahme .....................................................................................................19
3.2 Isolierung von Gesamt-RNA ......................................................................................19
3.3 Konzentrationsbestimmung und Überprüfung der Qualität von RNA..........................20
3.3.1 UV-Photometrische Bestimmung der Konzentration von RNA und DNA.............20
3.3.2 Spektrofluorometrische Bestimmung der RNA-Konzentration.............................20
3.3.3 Überprüfung der Qualität von RNA durch Agarose-Gelelektrophorese ...............21
3.4 Hydrolyse von DNA mittels DNaseI ...........................................................................21
3.5 Reverse Transkription (RT) von mRNA- und cDNA- Amplifikation mit
SMARTTM PCR Synthese Kit .....................................................................................21
3.5.1 Reverse Transkription von mRNA ......................................................................21
3.5.2 cDNA-Amplifikation.............................................................................................22
3.6 Reverse Transkription der mRNA ..............................................................................22
3.6.1 Reverse Transkription für unmodifizierte Differential Display-PCR......................22
3.6.2 Reverse Transkription für modifizierte Differential Display-PCR
oder (semi)quantitative PCR...............................................................................23
3.7 Subtraktive Hybridisierung.........................................................................................23
3.7.1 Adapter-Ligation, erste und zweite Hybridisierungsreaktion................................23
3.7.2 Erste und zweite Amplifikation der subtrahierten Proben ....................................24
3.8 Differential Display-PCR ............................................................................................26
3.8.1 Differential Display-PCR vor Modifikation ...........................................................27
3.8.2 Differential Display-PCR nach Modifikation.........................................................28
3.9 Denaturierende Polyacrylamid-Gelelektrophorese.....................................................29
3.10 Ausschneiden signifikanter Banden .......................................................................29
3.11 Reamplifikation von cDNA-Fragmenten .................................................................30
3.12 Agarose-Gelelektrophorese ...................................................................................30
3.13 Reinigung von DNA-Fragmenten aus Agarosegelen ..............................................30
3.14 TA-Klonierung ........................................................................................................31
3.15 Bakterienkulturen ...................................................................................................31
3.16 Minipräparation von Plasmid-DNA mittels Säulenchromatographie........................31
3.17 Midipräparation von Plasmid-DNA mittels Säulenchromatographie........................32
3.18 Automatische Sequenzierung von DNA .................................................................32
3.19 Sequenzvergleich mit publizierten Daten ...............................................................32
3.20 (Semi)quantitative RT-PCR-Analyse ......................................................................33
3.21 Northern Blot-Analyse ............................................................................................33
3.21.1
Herstellung radioaktiv markierter DNA-Sonden ...............................................33
3.21.2
mRNA-Isolierung aus Gesamt-RNA ................................................................34
3.21.3
Herstellung eines Northern Blots.....................................................................34
3.21.4
Northern-Hybridisierung ..................................................................................35
3.22 Aufreinigung markierter Sonden.............................................................................36
3.23 Aufreinigung von PCR-Produkten ..........................................................................36
3.24 RACE’s ..................................................................................................................36
3.25 Phagen Screening .................................................................................................37
3.25.1
Präparation von Phagen DNA .........................................................................37
3.25.2
Durchführung eines Phagen-Screens .............................................................38
3.26 Herstellung von peptidspezifischen polyklonalen Antikörpern ................................39
3.27 Spaltung von DNA mit Restriktionsendonukleasen ................................................40
3.28 Ligation von DNA ...................................................................................................40
3.29 Herstellung kompetenter DH5α-Zellen ...................................................................40
3.30 Transformation chemisch kompetenter Zellen........................................................41
3.31 Einfrieren von Bakterienkulturen ............................................................................41
3.32 in vitro Transkription/Translation ............................................................................41
3.33 SDS-Polyacrylamid-Gelelektrophorese (SDS-PAGE).............................................42
3.34 Nachweis von Proteinen durch Coomassie-Färbung..............................................43
3.35 Immunblot-Analyse ................................................................................................43
3.36 Digoxigenin-Markierung von RNA für in situ Hybridisierung ...................................44
3.36.1
Markierung der RNA .......................................................................................44
3.36.2
Überprüfung der Digoxigenin-Markierung mittels Dot Blot...............................45
4 Ergebnisse ......................................................................................................................47
4.1 Materialasservation, histologische Aufarbeitung und Qualitätskontrolle .....................47
4.2 Vergleich der verwendeten Gewebe bezüglich ihrer embryonalen Entwicklung .........51
4.3 Vergleich unterschiedlicher Methoden zur Erfassung der
Expressionsmuster von Geweben .............................................................................52
4.4 Durchführung der subtraktiven Hybridisierung mit Ovarialkarzinomzellinien ..............53
4.5 Analyse der Genexpression mittels Differential Display .............................................59
4.5.1 Isolierung der RNA aus Geweben ......................................................................59
4.5.2 Hydrolyse der DNA und reverse Transkription der mRNA von Patientin 26 ........60
4.5.3 Differential Display-PCR mit cDNA von Patientin 26...........................................60
4.5.4 Reamplifikation unterschiedlich exprimierter Fragmente.....................................62
4.5.5 Klonierung von cDNA-Fragmenten .....................................................................62
4.5.6 Datenbankanalyse der differentiell exprimierten Fragmente und Zusammenfassung der wichtigsten Unterschiede aus Geweben von Patientin 26 ...............64
4.5.7
Etablierung der Methode der semiquantitativen bzw. quantitativen PCR
zur Überprüfung der Unterschiede......................................................................66
4.6 Modifikation der Differential Display-Methode............................................................71
4.7 Charakterisierung von 26C/C9/2................................................................................78
4.7.1 Verlängerung der Sequenz des 26C/C9/2-Transkripts durch
Datenbankanalyse..............................................................................................79
4.7.2 Northern Blot-Analyse ........................................................................................80
4.7.3 5‘-RACE .............................................................................................................81
4.7.4 Phagen-Screening..............................................................................................82
4.7.5 Auswertung der RACE-Sequenzen ....................................................................83
4.7.6 Struktur des 26C/C9/2-Gens ..............................................................................87
4.7.7 Herstellung peptidspezifischer Antikörper ...........................................................89
4.7.8 in vitro Transkription und Translation von 26C/C9/2 im Retikulozyten-Lysat .......91
4.7.9 Eigenschaften des 26C/C9/2-Proteins ................................................................93
4.7.10
Homologe Proteine zu 26C/C9/2.....................................................................95
4.8 Charakterisierung von 26C/G8/2 ...............................................................................96
4.8.1 in situ Hybridisierung von 26C/G8/2 und 26C/C9/2.............................................96
4.8.2 Struktur des 26C/G8/2-Gens ..............................................................................97
4.8.3 Eigenschaften des 26C/G8/2-Proteins..............................................................101
5 Diskussion.....................................................................................................................105
5.1 Problematik der Probengewinnung und Lösungsansätze ........................................105
5.1.1 Gewebe von Patientinnen.................................................................................105
5.1.2 Primärzellkulturen.............................................................................................109
5.2 Vor- und Nachteile der subtraktiven Hybridisierung und des Differential Displays....109
5.3 Ergebnisse des Differential Displays........................................................................112
5.3.1 Unterschiedlich exprimierte Zelloberflächenproteine und extrazelluläre
Signalproteine in Ovarialkarzinomzellinien........................................................112
5.3.2 Komponenten von Signalübertragungswegen, die in Tumoren
differentiell exprimiert sind ................................................................................114
5.3.3 26C/G8/2, ein Protein mit doppelsträngigen RNA Bindungs-Motiven................125
5.3.4 Ausblick............................................................................................................128
6 Zusammenfassung........................................................................................................131
7 Literatur.........................................................................................................................133
verwendete Abkürzungen:
APS
AS
bp
BSA
CHCl3
DEPC
DTT
EDTA
EST
EtBr
EtOH
kb
KCl
kDa
KOAc
MgCl2
MgSO4
MOPS
nxg
NaCl
NaOAc
NaOH
NBT
OD
pfu
rpm
SDS
TEMED
Tris
X-Gal
Ammoniumpersulfat
Aminosäuren
Basenpaare
Rinderserumalbumin (Bovine Serum Albumin)
Chloroform
Diethylpyrocarbonat
1,4-Dithiothreitol
Ethylendiamintetraacetat
Expressed Sequence Tags
Ehidiumbromid
Ethanol
Kilobasen
Kaliumchlorid
Kilodalton
Kaliumacetat
Magnesiumchlorid
Magnesiumsulfat
2-(N-Morpholino)propansulfonsäure
nfache Erdbeschleunigung
Natriumchlorid
Natriumacetat
Natriumhydroxid
Nitroblau Tetrazolium
optische Dichte
plaque forming units
Umdrehungen pro Minute
Natriumdodecylsulfat (Sodiumdodecylsulfate)
N,N,N’,N’-Tetramethylethylendiamin
Tris(hydroxymethyl)aminomethan
5-Bromo-4-chloro-3-indolylphosphat
EINLEITUNG
1
Einleitung
Mit der Zunahme der Lebenserwartung in den vergangenen 50 Jahren veränderte sich die
Altersstruktur der Gesellschaft. So gibt es zum heutigen Zeitpunkt sehr viel mehr ältere
Menschen als in der Vergangenheit. Aufgrund dieser Veränderung stieg auch die absolute
Zahl der an Krebs erkrankten Personen, da vom Kindes- bis zum hohen Alter die
Krebssterblichkeit erheblich zunimmt (Alberts et al., 1990). Eine der häufigsten Krebsarten,
die bei Frauen zum Tode führt, ist der Ovarialtumor.
In West- und Nord-Europa, aber auch in den USA repräsentiert dieser Tumortyp den
häufigsten Krebs des weiblichen Genitaltrakts mit weltweit etwa 200.000 neuen Fällen pro
Jahr (Runnebaum und Stickeler, 2001). Da in etwa 70% der Fälle eine Krebsdiagnose erst in
einem
späten
Stadium
gestellt
wird,
ist
der
Eierstocktumor
die fünft
häufigste
Krebstodesursache bei Frauen. Für die Entstehung dieses Tumortyps sind bislang erst
wenige Risikofaktoren identifiziert worden. Dazu gehören genetische Faktoren, die eine
familiäre Häufung von Eierstocktumoren bewirken, endokrine Faktoren, bei denen die
Reproduktion eine Rolle spielt, Umweltfaktoren, die noch weitgehend unerforscht sind, und
molekulare Risikofaktoren, zu denen somatische Mutationen unterschiedlicher Gene gezählt
werden.
1.1 Risikofaktoren für die Entstehung von Ovarialkarzinomen
1.1.1
Genetische Faktoren
Lediglich etwa 10% aller epithelialer Ovarialkarzinome werden mit erblichen Faktoren in
Verbindung gebracht (Runnebaum und Stickeler, 2001). Dabei ist das Erkrankungsrisiko auf
etwa das 3,5fache erhöht (Claus und Schwartz, 1995). Die erblichen Tumoren können in drei
verschiedene Typen unterteilt werden:
Bei dem häufigsten Typ handelt es sich um das Brust- und Ovarialkarzinom-Syndrom, das
im Zusammenhang mit Keimzellmutationen der BRCA1- und BRCA2-Gene steht. BRCA1
wird hauptsächlich in Brust-, Ovar- und Hodengeweben exprimiert. Das 100 kb große Gen
liegt auf dem Chromosomenabschnitt 17q21 und wurde von Miki et al. (1994) kloniert. Es
besteht aus 24 Exons und kodiert für ein Protein von 1863 Aminosäureresten, das zellzyklusabhängig exprimiert und phosphoryliert wird (Chen et al., 1996). Die aminoterminale Region
zeigt eine hohe Homologie zu einer Zinkfinger-Domäne, wie sie in zahlreichen
Transkriptionsfaktoren vorkommt. BRCA1 spielt vermutlich eine Rolle bei der ZellzyklusRegulation und der DNA-Reparatur (Monteiro, 2000). Wie BRCA1 ist auch BRCA2 an der
Regulation der Transkription und der DNA-Reparatur beteiligt (Venkitaraman, 2001). BRCA2
ist jedoch bislang weniger gut untersucht als BRCA1.
1
EINLEITUNG
Bei dem zweiten Tumortyp, der ebenfalls zu einer Erhöhung des Ovarialtumor- und
Brustkrebs-Risikos bei Frauen und zu colorektalem Krebs bei Männern führt, handelt es sich
um das (hereditary non-polyposis colorectal cancer) HNPCC- oder auch LynchII-Syndrom.
Hierbei erzeugen Keimzellmutationen Defekte bei Enzymen, die in der DNA-MismatchReparatur eine Rolle spielen (Lynch et al., 1998), was zu einer Anhäufung von Mutationen
führt. In 90% der Fälle sind davon die Proteine von hMSH2 oder hMLH1 betroffen.
Der dritte Tumortyp wird als seltenes organspezifisches Ovarialtumor-Syndrom bezeichnet
und betrifft die Ovarien. Auch in diesem Fall spielen Mutationen des BRCA1-Gens eine Rolle
bei der Tumorentstehung (Chuaqui et al., 1997).
1.1.2
Endokrine Faktoren
Neben den genetischen Faktoren spielen auch endokrine Faktoren eine Rolle bei der
Tumorentstehung in den Ovarien. Am deutlichsten wird dabei das Risiko durch die Anzahl
der Schwangerschaften und die Länge der Stillzeit beeinflußt. Mit steigender Zahl an
Schwangerschaften und zunehmender Länge der Stillzeit sinkt die Wahrscheinlichkeit, an
diesem Tumortyp zu erkranken. Dies beruht vermutlich auf dem Einfluß der GonadotropinSekretion während der Schwangerschaft (Banks et al. 1997; Daly und Obrams, 1998). Nach
der „Gonadotropin“-Hypothese beschleunigen große Mengen zirkulierenden Gonadotropins
die Transformation von Ovarepithelzellen. Pro Schwangerschaft nimmt das Risiko um
13-19% ab, wobei jedoch eine Schwangerschaft bei sehr jungen Frauen das Risiko erhöht
(Runnebaum und Stickeler, 2001).
Ebenso zeigen orale Kontrazeptiva eine positive Wirkung. Bei einer Einnahme über einen
Zeitraum von fünf Jahren und länger kann das Risiko bis auf die Hälfte reduziert werden
(Runnebaum und Stickeler, 2001). Der positive Effekt der „Pille“ beruht wahrscheinlich auf
der Unterdrückung des Eisprungs und der somit entfallenden ständigen Reparaturprozesse
des Oberflächenepithels (Fathalla, 1971).
1.1.3
Umweltfaktoren
Auch Umweltfaktoren beeinflussen die Entstehung der Ovarialtumoren. Dabei stehen
hauptsächlich Asbest und die Verwendung von Talkum-Pudern in der Diskussion. Dies
spiegelte sich in den erhöhten Ovarialtumorerkrankungen bei Arbeiterinnen, die ständig in
Kontakt mit Asbest waren, und bei Frauen wieder, die Talkum-Puder-Produkte im Bereich
des Perineums verwendeten (Ness und Cottreau, 1999).
Zum Einfluß der Ernährung liegen kaum Daten vor. Die vorliegenden Studien sprechen
jedoch für einen positiven Effekt bei hohem Konsum an Früchten und Gemüse. Im
Gegensatz dazu scheint der Verzehr großer Mengen an gesättigten tierischen Fetten und
Fleisch mit einem erhöhten Krebsrisiko zu korrelieren (Becker und Wahrendorf, 1997).
2
EINLEITUNG
1.1.4
Molekulare Risikofaktoren
Die maligne Transformation der nicht erblichen Ovarialtumoren ist durch eine Vielzahl
genetischer Veränderungen gekennzeichnet. Dazu zählen die Hochregulation von ProtoOnkogenen und die Mutation oder Deletion von Tumorsuppressor-Genen.
Zur Analyse von Genexpressionsveränderungen stehen zahlreiche Methoden zur Verfügung.
Dazu gehört neben dem relativ neu entwickelten Verfahren der cDNA Microarrays (EmmertBuck et al., 1996; Welsh et al., 2001) und der subtraktiven Hybridisierung (Rouvier et al.,
1993; Hubank und Schatz, 1994) auch das Differential Display (Liang und Pardee, 1992;
Liang und Pardee, 1995; Liang und Pardee, 1997).
Die Analyse von unterschiedlich exprimierten Genen mit cDNA Microarrays bietet den
großen Vorteil, nahezu einhunderttausend cDNAs gleichzeitig zu analysieren und zu
identifizieren. Aufgrund der Probenanzahl ist eine Normalisierung der zu untersuchenden
Proben gewährleistet. Ein deutlicher Nachteil dieses Verfahrens besteht darin, daß große
Mengen an RNA eingesetzt werden müssen. Weitere Nachteile gegenüber den Methoden
der
subtraktiven
Hybridisierung
und
des
Differential
Displays
sind
die
höhere
Nachweisgrenze und eine geringere Sensitivität. Durch die höhere Nachweisgrenze können
mit dem Verfahren der cDNA Arrays niedrig exprimierte mRNAs nicht erfaßt werden, durch
die geringere Sensitivität können lediglich sehr deutlich ausgeprägte Unterschiede
identifiziert werden. Diese Einschränkungen, vor allem aber die notwendigen großen
Mengen an RNA, führten dazu, daß das Verfahren der Microarrays nicht in der vorliegenden
Arbeit eingesetzt werden konnte.
Im Rahmen dieser Arbeit wurden die Methoden der subtraktiven Hybridisierung und des
Differential Displays getestet und bewertet. Vor- und Nachteile beider Methoden werden in
Kapitel 5.2 diskutiert. Letztendlich fiel die Entscheidung zugunsten der Methode des
Differential Displays. Bei dieser Methode reichen sehr geringe Mengen an Geweben für die
Untersuchungen aus und eine Vielzahl an Gewebeproben können gleichzeitig betrachtet
werden (Sagerström et al., 1997). Somit erlaubt das Differential Display die Identifizierung
der mRNAs, die in Tumorzellen des Ovars stärker oder geringer repräsentiert sind als in den
entsprechenden normalen Zellen (Mok et al., 1994; Mok et al., 1996). Für die systematische
Analyse der Genexpressionsunterschiede mit Hilfe des Differential Displays wird zunächst
die RNA aus den Geweben isoliert und die mRNA in cDNA umgeschrieben. Diese dient als
Matrize in einer PCR, bei der Fragmente mit unterschiedlichen Primerkombinationen
amplifiziert werden. Nach gelelektrophoretischer Auftrennung der cDNA-Fragmente werden
die im Vergleich zu den Normalzellen über- oder unterrepräsentierten Fragmente isoliert, in
einer PCR amplifiziert, in einen Vektor kloniert und schließlich bakteriell vermehrt. Die
Ermittlung der Sequenz der Amplifikate ermöglicht eine Datenbankanalyse, bei der
Expressed Sequence Tags (ESTs) und cDNA-Bibliotheken nach homologen Klonen
3
EINLEITUNG
durchsucht werden, die evtl. die Verlängerung der Fragmente ermöglichen. Abschließend
erfolgt die Überprüfung der ermittelten Unterschiede durch eine PCR.
Einige der bereits aus der Literatur bekannten Proto-Onkogene, deren veränderte
Expression in Ovarialtumoren beschrieben ist, stehen im Zusammenhang mit Ergebnissen
einer Analyse des Differential Displays mit Geweben einer Patientin. Zu diesen ProtoOnkogenen zählen das Akt2, K-Ras und c-Myc.
Das Gen von Akt2 ist ein im Menschen vorkommendes Homolog des viralen Onkogens v-akt
(Cheng et al., 1992; Staal., 1987). Akt2 kodiert für ein 56 kDa großes Protein, welches zu
den Serin/Threonin-Kinasen gezählt wird und auch die Bezeichnung PKBβ trägt. Dieses
Protein kann grob in vier Domänen eingeteilt werden. Am aminoterminalen Ende befindet
sich eine pleckstrin-homologe Domäne, in zentraler Position sitzen eine helikale- und eine
Kinase-Domäne, der C-terminale Abschnitt ist reich an Serinen und Threoninen
(siehe Abb.: 1.1)
Abb.: 1.1 Schematische Darstellung des AKT2-Proteins.
Das Protein kann grob in vier Bereiche unterteilt werden. Der Amino-Terminus trägt eine pleckstrinhomologe Domäne, gefolgt von einer helikalen Region, der sich eine Kinase Domäne anschließt. Den
carboxy-terminalen Abschnitt bildet eine Serin/Threonin reiche Domäne.
Über die pleckstrin-homologe Domäne, die einer Vielzahl von Proteinen, wie beispielsweise
einigen Regulatoren kleiner GTP bindender Proteine (ras-GAP, cdc24), Kinasen (ARK1/2)
und allen bekannten Säuger-Phospholipasen (PLC-β, -δ, -γ), die am Transduktions-Weg
teilnehmen (Haslam et al., 1993; Mayer et al., 1993), gemein ist, wird Akt2 durch die
Phosphoinositol-3-Kinase (PI3K) aktiviert. Die PI3K wird ihrerseits von einer Vielzahl an
Stimuli, wie Wachstumsfaktoren (Mitsuuchi et al., 1998), Proteinphosphatase-Inhibitoren und
Streß, beeinflußt (Liu et al., 1998). AKT2 ist in etwa 10-20% aller ovariellen Tumoren
überexprimiert (Bellacosa et al., 1995), wobei seine Wirkungsweise jedoch noch nicht
vollständig aufgeklärt ist. Eines der bisher bekannten Ziele, die durch AKT2 phosphoryliert
werden, ist das Protein BAD, ein Mitglied der BCL-2 Familie. Diese Phosphorylierung
reduziert die Bindungsfähigkeit von BAD zu Bcl-xL, was zur Suppression der Apoptose und
somit zum Überleben der Zellen führt (Datta et al., 1997).
Wie Akt2 zählt K-Ras zu den Proto-Onkogenen. Es gehört zur Superfamilie der kleinen
GTPasen und kodiert für ein Protein mit etwa 21 kDa. Dieses ist ein Knotenpunkt zahlreicher
Signalübertragungswege und vermittelt Informationen zwischen Zelloberflächenrezeptoren
4
EINLEITUNG
wie dem epidermalen Wachstumsfaktor, dem Cytokin-, Integrin- und PDGF-Rezeptor und
den Transkriptions-Faktoren bzw. Zellzyklus-Proteinen des Zellkerns (Ellis und Clark, 2000).
Im Zusammenhang mit Tumoren des Ovars sind überwiegend Mutationen im K-Ras-Gen
beschrieben (Mok et al., 1993; Gallion et al., 1995). Nur in wenigen Fällen wird über
veränderte Expressionsraten von K-RAS berichtet (Filmus und Buick, 1985).
c-MYC ist ein Mitglied der Helix-Loop-Helix/Leuzin Zipper Superfamilie. In ruhenden Zellen
werden nur geringe Mengen an c-MYC exprimiert. Dies ändert sich jedoch nach mitotischer
Stimulation. In proliferierenden Zellen bilden c-MYC und das sogenannte Max-Protein ein
Heterodimer und binden an die Konsensus-Sequenz 5‘-CACGTG-3‘ der DNA (Knippers,
1997).
Die
DNA-gebundenen
Heterodimere
rekrutieren
Koaktivator-
und
Korepressorkomplexe, die Veränderungen in der Chromatin Struktur bewirken. Somit wird
die Transkriptionsrate von Genen, die an der Differenzierung und der Apoptose beteiligt sind,
verändert (Grandori et al., 2000).
Zu
den
wichtigsten
Vertretern
der
Tumorsuppressor-Gene,
die
an
der
Ovarialtumorentstehung beteiligt sind, gehören BRCA1 und 2. Wie bereits erwähnt werden
sie hauptsächlich mit dem erblich bedingten Brust- und Ovarialkarzinom-Syndrom in
Verbindung gebracht. Neben diesen Proteinen ist p53 das bekannteste TumorsuppressorGen. Das humane p53-Gen liegt am Ende des kurzen Arms von Chromosom 17. Es umfaßt
ca. 20 kb und codiert für ein 2,8 kb langes Transkript. Bei mehr als der Hälfte aller
menschlichen Krebszellen ist das p53-Gen geschädigt. So führt der Verlust eines Allels und
eine korrespondierende Mutation im zweiten Allel in über 55% aller Ovarialtumoren zu einer
vollständigen Inaktivierung von p53 (Runnebaum und Stickeler, 2001). Dies wird verständlich
wenn die vielfältigen und wichtigen Aufgaben des p53-Proteins betrachtet werden. So
übernimmt es Aufgaben, die zur Regulation der Transkriptionsaktivität zahlreicher Proteine,
der Aufrechterhaltung der Genomintegrität und des programmierten Zelltods beitragen.
1.2 Metastasierung und Therapie
Nach
heutigem
Wissensstand
leiten
sich
Ovarialtumoren
hauptsächlich
vom
Oberflächenepithel der Eierstöcke ab. Dabei erfolgt die Metastasierung vermutlich durch
Abschuppung der Zellen vom malignen Herd des Ovars. Anschließend wandern die Zellen
durch die peritoneale Höhle und siedeln sich an beliebigen Stellen an (Menzin et al., 1998).
Je nachdem, welche Organe vom Tumor betroffen sind, erfolgt eine Stadieneinteilung nach
den Richtlinien der FIGO (Federation International of Gynecology and Obstetrics) oder TNM
(Tumor Nodes Metastasis). In FIGO-Stadium I ist der Tumor auf die Ovarien begrenzt. Bei
FIGO-Stadium II breitet sich der Tumor bereits im Beckenraum aus. Damit sinkt auch die 5Jahres-Überlebensrate von 90% (FIGO I) auf 70%. FIGO III kennzeichnet das Stadium, bei
5
EINLEITUNG
dem auch außerhalb des Beckens Metastasen nachgewiesen werden, die Krankheit jedoch
auf das Abdomen beschränkt ist. Hier ist die 5 Jahres Überlebensrate statistisch auf 15%
gesunken. Im vierten FIGO-Stadium existieren Fernmetastasen, wobei die Chance, fünf
Jahre zu überleben, 1-5% beträgt.
Im FIGO-Stadium I ist eine fertilitätserhaltende Operation bei jungen Frauen möglich. Bei
allen anderen Stadien steht an erster Stelle die radikale Operation mit der Entfernung der
beiden Eierstöcke, der Gebärmutter und der beiden Eileiter sowie betroffener Lymphknoten.
Sind aufgrund eines fortgeschrittenen Stadiums bei der Erstdiagnose noch weitere Organe
betroffen, werden auch diese, soweit möglich, entfernt. Das Ziel der Operation ist es, alle
Tumoranteile zu entfernen. Zusätzlich erfolgt in der Regel eine Chemotherapie mit einer
cisplatinhaltigen Zweierkombination. Nach Auersperg et al. (1998) schlägt die Behandlung in
60-80% aller Fälle zunächst an, jedoch entwickeln die meisten Patienten in kurzer Zeit
Vielfach-Resistenzen gegen Chemotherapeutika. Dieses Phänomen wird als Multiple Drug
Resistance (MDR) bezeichnet. Bisher wurden zahlreiche molekulare Veränderungen
identifiziert, die zur MDR beitragen. Beispiele dafür sind ein veränderter Transportefflux, der
Zellgifte aus den Zellen befördert, Inaktivierung der Therapeutika durch Bindung an
bestimmte Proteine, Einlagerung der Substanzen in Organellen, wodurch diese ihre Ziele
nicht erreichen können, Erhöhung der Toleranz der Zellen gegenüber Giften oder einer
erhöhten DNA-Reparatur-Aktivität, die das Überleben der Zelle sichert, obwohl sie unter
normalen Bedingungen sterben würde.
Da bereits in Phase I nur eine begrenzte Heilungschance besteht, ist es um so wichtiger,
einen Ovarialtumor so früh wie möglich zu erkennen.
1.3 Zielsetzung
Da das epitheliale Ovarialkarzinom aufgrund mangelnder Frühsymptome und geeigneter
Screening-Marker unter den gynäkologischen Tumoren die schlechteste Prognose hat,
könnte die Identifikation eines oder mehrerer Marker die Diagnostik und Therapierung
bedeutend verbessern und damit zahlreiche Menschenleben retten. Deshalb besteht das
langfristige Ziel der Forschung darin, relevante Genprodukte aufzufinden und ihre Rolle bei
der Entstehung und Progression der Ovarialtumoren zu untersuchen.
Das Ziel der vorliegenden Arbeit bestand darin, Genexpressionsmuster epithelialer
Ovarialkarzinome systematisch zu analysieren.
Unabhängig von der verwendeten Methode ist es notwendig, Tumorgewebe mit
entsprechendem Referenzgewebe zu vergleichen. Gerade bei Ovargewebe ist es schwierig,
entsprechendes gesundes Normalgewebe zu erhalten, da entweder gesundes Ovar nicht
6
EINLEITUNG
entnommen werden kann, da noch ein Kinderwunsch besteht, oder das Gewebe bereits
aufgrund zahlreicher Ovulationen stark vernarbt ist und somit nicht zum Vergleich
herangezogen werden kann. Als Kompromiß bietet sich daher der Vergleich mit Geweben
gleichen embryonalen Ursprungs an. Nach eingehender Literaturrecherche erwies sich das
Infundibulum des Oviducts als geeignete Normalprobe (siehe Kapitel 5.1.1).
Ebenso wichtig ist, daß die verwendeten Gewebeproben möglichst ausschließlich aus Zellen
des entsprechenden Gewebetyps bestehen und nicht durch die anhaftende Basalschicht
oder Blut verunreinigt sind. Solche Verunreinigungen würden bei Vergleich von Geweben zu
nicht epithelspezifischen Unterschieden führen (Martin und Pardee, 1999). Lösungsansätze
dazu sind in Kapitel 4.1 beschrieben.
Wenn beide notwendigen Voraussetzungen erfüllt werden, kann durch eine geeignete
Methode, wie subtraktive Hybridisierung oder Differential Display, der Gewebevergleich
erfolgen. Wie sich im Verlauf der Arbeit zeigte, ist für das untersuchte Gewebe die Methode
des Differential Displays geeignet, da nur mit dieser Methode die zur Verfügung stehende
Menge an RNA aus den Geweben sinnvoll analysiert werden konnte.
Anschließend sollten Unterschiede bei der Expression identifiziert und die entsprechenden
cDNAs kloniert werden. Nach Sequenzierung konnten Homologien zu bereits bekannten
Proteinen oder ESTs ermittelt werden. Soweit möglich, wurden die ermittelten Unterschiede
durch PCR verifiziert, wovon einige besonders wichtig erscheinende in weiteren
Experimenten untersucht wurden.
7
M ATERIAL
2
Material
2.1 Chemikalien
Die nicht gesondert aufgeführten Chemikalien wurden bei Merck, Darmstadt in einem
möglichst hohen Reinheitsgrad erworben. In Klammern angegebene Abkürzungen werden
im folgenden stellvertretend für die vollständigen Namen verwendet.
α-32P-desoxy-Adenosintriphosphat
α-32P-desoxy-Cytosintriphosphat
α-33P-desoxy-Adenosintriphosphat
1,4-Dithiothreitol (DTT)
2-(N-Morpholino)propansulfonsäure (MOPS)
5-Bromo-4-chloro-3-indolylphosphat (X-Gal)
Acrylamid
Acrylamid/Bisacrylamid
Agarose
Ammoniumpersulfat (APS)
Ammoniumsulfat
Ampicillin trihydrat
Bacto-Agar
Bacto-Tryptone
Bacto-Yeast-Extract
Bindsilan-Lösung
Bisacrylamid
Blueslick
Bovine Serum Albumin (BSA)
Bromphenolblau
Chloroform (CHCl3)
Diethylpyrocarbonat (DEPC)
Dimethylformamid
Dinatriumhydrogenphosphat
Ehidiumbromid (EtBr)
Eisessig p.a.
Ethanol (EtOH) p.a.
Ethylendiamintetraacetat (EDTA)
Formamid deionisiert
Gel-Blotting-Papier
Glucose
Glycerol 86%
Harnstoff p.a.
Isopropanol p.a.
Kaliumacetat (KOAc)
Kaliumchlorid (KCl)
Lachssperma
Magnesiumchlorid (MgCl2)
Magnesiumsulfat (MgSO4)
Mercaptoethanol
Milchpulver (Skim Milkpowder)
Mineralöl
Mowiol
Amersham, Braunschweig, D
Amersham, Braunschweig, D
Amersham, Braunschweig, D
Sigma, Deisenhofen, D
Gerbu, Gaiberg, D
Sigma, Deisenhofen, D
Serva, Heidelberg
Roth, Karlsruhe, D
Apligene/Oncor, Heidelberg, D
Serva, Heidelberg, D
Merck, Darmstadt, D
Boehringer Bioproducts, Ingelheim, D
Difco Laboratories, Detroit, USA
Difco Laboratories, Detroit, USA
Difco Laboratories, Detroit, USA
Pharmacia, Freiburg, D
Serva, Heidelberg, D
Serva, Heidelberg, D
Roche, Mannheim, D
Serva, Heidelberg, D
Baker, Deventer, NL
Sigma, Deisenhofen, D
Merck, Darmstadt, D
Merck, Darmstadt, D
Gibco BRL, Eggenstein, D
Ridel de Haen, Seelze, D
Baker, Deventer, NL
Merck, Darmstadt, D
Merck, Darmstadt, D
Schleicher & Schüll, Dassel, D
Merck, Darmstadt, D
Merck, Darmstadt, D
Merck, Darmstadt, D
Baker, Deventer, NL
Merck, Darmstadt, D
Merck, Darmstadt, D
Gibco BRL, Eggenstein, D
Merck, Darmstadt, D
Merck, Darmstadt, D
Merck, Darmstadt, D
Fluka, Neu-Ulm, D
Sigma, Deisenhofen, D
Calbiochem, Schwalbach, D
9
M ATERIAL
Natriumacetat (NaOAc)
Natriumchlorid (NaCl)
Natriumdihydrogenphosphat
Natriumdodecylsulfat (SDS)
Natriumhydroxid (NaOH)-Plätzchen
Nitroblau Tetrazolium (NBT)
Phenol
Ponceau S-Rot
RNase A
Saccharose
Salzsäure, rauchend
Tetracyclin
N,N,N’,N’-Tetramethylethylendiamin (TEMED)
Trichloressigsäure
Tris(hydroxymethyl)aminomethan (Tris)
Triton X-100
Tween 20
Ultrapure dNTP Set
Xylen-Cyanol FT
Merck, Darmstadt, D
Merck, Darmstadt, D
Merck, Darmstadt, D
Serva, Heidelberg, D
Roth, Karlsruhe, D
Biomol, Hamburg, D
Roth, Karlsruhe, D
Sigma, Deisenhofen,D
Sigma, Deisenhofen, D
Merck, Darmstadt, D
Merck, Darmstadt, D
Boehringer Bioproducts, Ingelheim, D
Sigma, Deisenhofen, D
Roth, Karlsruhe, D
Sigma, Deisenhofen, D
Serva, Heidelberg, D
Serva, Heidelberg, D
Amersham-Pharmacia, Braunschweig, D
Serva, Heidelberg, D
2.2 Reaktions-Kits, Bibliotheken und Fertiglösungen
λ TripleEX Ovar Bibliothek
DIG RNA Labeling Kits
dNTP-Mix
ECL-System
Marathon-Ready cDNA RACE-Bibliotheken
NonaPrimer Kit II
Nucleotide Removal Kit
Oligotex-Kit
PCR-Purification Kit
PCR-SELECTTM cDNA Subtraktion Kit
PicoGreenTMds DNA Quantifizierung-Kit
Plasmid Midi Kits
Qiaprep Spin Miniprep Kit
QIAquick Gel Extraction Kit
QIAquick PCR Purification Kit
QIAshredder-Säulen
RiboGreenTM RNA Quantifizierung-Kit
RNeasy Mini-Kit
Sequagel complete
Sequagel XR extender range
SMARTTM PCR cDNA Synthesis Kit
TNT® gekoppeltes Retikulozyten-Lysat
Translations System RTS 500
Uni-ZAP XR Ovar Bibliothek
10
Clontech, Heidelberg, D
Roche, Mannheim, D
Amersham, Cleveland, USA
Amersham-Pharmacia, Braunschweig, D
Clontech, Heidelberg, D
Appligene/Oncor, Cambridge, USA
Qiagen, Hilden, D
Qiagen, Hilden, D
Qiagen, Hilden, D
Clontech, Heidelberg, D
Molecular Probes, Leiden, NL
Qiagen, Hilden, D
Qiagen, Hilden, D
Qiagen, Hilden, D
Qiagen, Hilden, D
Qiagen, Hilden, D
Molecular Probes, Leiden, NL
Qiagen, Hilden, D
Biozym, Hess. Oldendorf, D
Biozym, Hess. Oldendorf, D
Clontech, Heidelberg, D
Promega, Madison, USA
Roche, Mannheim, D
Stratagene, La Jolla, USA
M ATERIAL
2.3 Verbrauchsmaterial
ECL-Reagenz (enhanced chemoluminescence)
Eppendorf-Reaktionsgefäße
Faltenfilter 3 hw
Injektionsspritzen, 10 ml und 50 ml
Hybond+
Kodak Röntgenfilm BIOAXTMMR-1
3MM Gel Blotting Papier GB002
MTN Blots I und II
Ni-NTA-Agarose
Nitrozellulose Hybond M+
Nitrozellulose Filter Hybond M+ (132 mm)
Nona Primer KitII
Objektträger
0,5 ml PCR Tubes
Petrischalen (9-15 cm Duchmesser)
Pipettenspitzen mit Filter
RNase freie Eppendorf-Reaktionsgefäße
1 x Sterilfilterhalter 0,2 µm
Toppits Frischhaltefolie
Zentrifugenröhrchen, 15 ml und 50 ml
Amersham Pharmacia, Braunschweig, D
Eppendorf, Hamburg, D
Neolab Migge, Heidelberg, D
Terumo, Tokio, Japan
Amersham Pharmacia, Braunschweig, D
Kodak-Aldrich, Steinheim, D
Schleicher & Schüll, Dassel, D
Clontech, Heidelberg, D
Qiagen, Hilden, D
Amersham, Braunschweig, D
Amersham, Braunschweig, D
Appligene/Oncor, Heidelberg, D
Langenbrinck, Emmendingen, D
Biozym, Hess. Oldendorf, D
Greiner, Frickenhausen, D
Greiner, Frickenhausen, D
Biozym, Hess. Oldendorf, D
Schleicher & Schuell, Dassel, D
Melitta, Minden, D
Greiner, Frickenhausen, D
2.4 Laborgeräte
Agfa Filmentwickler, Typ Curix 242
Agilent 2100 Bioanalyzer
Analytische Feinwaage, Typ Toledo PB 60Z
Eagle Eye II, Typ 230 VAC
Elektrophoresis Power Supply, Typ PS3002
Expositionskassette 35,6 x 43,2 cm
Fluoroskan Ascent
Forma Scientific –86°C Freezer
Geltrockner BIO-RAD, Modell 583
Hybridisierungsröhre, Par No FHB11
Leuchtplatte
LKB Biochrom Powerd Supply
LKB Bromma constant Power Supply
Mains Power Supply Unit 500/100
Microcomputer elektrophoresis Power Supply
Micromat AEG 135 –Typ EEH8633
Mikrokühlzentrifuge, Typ 5402
Mikrozentrifuge, Typ 5417
pH-Meter, Typ Toledo MP220
Sepatech Varifuge 3,0R
DNA-Sequencing System, Modell S2
Spektrophotometer, Typ DU 7400
Speed Vac Concentrator, Typ SVC 1004
Speed Vac Plus SC110A
Sterilwerkbank
Agfa, Westfalen, D
Agilent Technologies, Waldbronn, D
Mettler, Gießen, D
Stratagene, La Jolla, USA
GIBCO BRL, Eggenstein, D
Rego, Heidelberg, D
Labsystems, Frankfurt, D
Life Sciences International, Frankfurt, D
Bio-Rad, Martinsried, D
Techne, Cambridge, GB
Rex, Heidelberg, D
Grant, Cambridge, GB
Grant, Cambridge, GB
DESAGA, Heidelberg, D
Grant, Cambridge, GB
Eppendorf, Hamburg, D
Eppendorf, Hamburg, D
Eppendorf, Hamburg, D
Mettler, Gießen, D
Heraeus, Hanau, D
GIBCO BRL, Eggenstein, D
Beckman, Fullerton, USA
Bachhofer, Reutlingen, D
Thermo Quest, Egelsbach, D
Baker, Sanford, USA
11
M ATERIAL
Szintillationszähler LS1801
Techne Hybridiser HB-1D
Thermocycler, Typ PTC-200
Thermomixer, Typ 5436
Thermoschüttler, Typ Certomat HK
UV-Stratalinker 2400
Waage, Typ Mettler P 1000
Wasserbad Julabo SW-200
Beckman, Fullerton, USA
Techne, Cambridge, GB
Biozym, Hess. Oldendorf, D
Eppendorf, Hamburg, D
Braun, Melsungen, D
Stratagene, La Jolla, USA
Mettler, Gießen, D
Buddeberg, Mannheim, D
2.5 Enzyme und Marker
Restriktionsenzyme, Ligasen, Phosphatasen und Kinasen wurden von den Firmen GIBCO
BRL (Eggenstein), MBI Fermentas (St.Leon-Roth) oder NEB (Schwalbach) bezogen und
nach Angaben der Hersteller verwendet. Für die reversen Transkriptionen wurde die
SuperScript II RNaseH- Reverse Transcriptase der Firma Gibco BRL (Eggenstein)
eingesetzt. Ebenso wurde die Desoxyribonuclease I von dieser Firma bezogen. Für
Standard-PCR-Reaktionen wurde ein Advantage cDNA-Polymerase-Mix der Firma Clontech
(Heidelberg) oder die Goldstar DNA Polymerase der Firma Eurogentec (Seraing, Belgien)
verwendet. In einigen Fällen wurde die Pfu-Polymerase der Firma Stratagene (La Jolla,
USA) eingesetzt. Die RNase und Proteinase-Inhibitoren wurden von Roche (Mannheim)
geliefert. Der RNA-Größenmarker 0,24-9,5 kb RNA I stammte von der Firma Gibco BRL
(0,24 kb, 1,35 kb, 2,37 kb, 4,4 kb, 7,46 kb und 9,49 kb). Als DNA-Größenstandard wurden
die GeneRuler 100 bp (100 bp, 200 bp, 300 bp, 400 bp, 500 bp, 600 bp, 700 bp, 800 bp,
900 bp, 1031 bp, 1200 bp, 1500 bp, 2000 bp, 3000 bp ) oder 1kb (0,5 bp, 0,75 bp, 1,0 bp,
1,5 bp, 2,0 bp, 2,5 bp, 3,0 bp, 3,5 bp, 4,0 bp, 5,0 bp, 6,0 bp, 8,0 bp, 10,0 bp) Leitern der
Firma MBI Fermentas eingesetzt. Die entsprechenden Protein-Größenmarker waren SDS-7
(14, 20, 29, 36,45 und 66 kDa) und SDS-6H (29, 45, 66, 97, 116 und 205 kDa) von Sigma
(Deisenhofen).
2.6 E.coli-Stämme
BL21(DE)pLYS: F-ompThsdSB(rB-mB-) gal dcm (DE3) pLysS.
DH5α: (F‘/endA1 hsdR17(rk-mk+) supE44 thi-1 recA1 gyrA (Nalr) relA1 ∆(lacZYA-argF)U169
deoR (Ф80dlac∆(lacZ) M15).
Top10F‘: F‘ (lacIq Tn10 (TetR) mcrA ∆(mrr-hsdRMS-mcrBC) Ф80lacZ∆M15 ∆lacX74 recA1
deoR araD139 ∆(ara-leu)7697 galU galK rpsL (StrR) endA1 nupG
(Invitrogen, Groningen, NL).
XL1-Blue MRF‘:∆(mcrA)183 ∆(mcrCB-hsdSMR-mrr)173 endA1 supE44 thi-1 recA1 gyrA96
relA1 lac(F‘ proAB lacIqZ∆M15Tn10 (Tetr))
(Stratagene, La Jolla, USA).
12
M ATERIAL
2.7 cDNA-Bibliotheken
Ovarbibliothek im Uni-ZAP XR Vektor (Stratagene, La Jolla, USA)
λTriplEx Ovarbibliothek (Clontech, Heidelberg)
Marathon-Ready cDNA Bibliotheken von Eierstöcken, Brustgeweben, Hoden, Gehirn und
Föten (Clontech, Heidelberg)
2.8 Phagen
ExAssist Helfer Phage (Stratagene, La Jolla, USA)
2.9 Vektoren
pCRII (Invitrogen, Groningen, NL) siehe Abb.: 2.1
Abb.: 2.1 pCRII Vektor
®
Der pCRII -TOPO Vektor wurde für TA-Klonierungen verwendet (siehe Kapitel 3.14).
13
M ATERIAL
pIVEX 2.4a (Roche, Mannheim) siehe Abb.: 2.2
Abb.: 2.2 pIVEX2.4a Vektor
Der pIVEX2.4a Vektor wurde zur in vitro Transkription/Translation der cDNA von 26C/C9/2 eingesetzt
(siehe Kapitel 3.32).
14
M ATERIAL
Uni-ZAP XR (Stratagene, La Jolla, USA) siehe Abb.: 2.3
Abb.: 2.3 Uni-Zap XR Vektor
Mit Hilfe der in den Uni-Zap XR Vektor klonierten cDNA-Bibliothek erfolgte ein Phagen-Screening zur
Verlängerung der cDNA-Sequenz von 26C/C9/2 (siehe Kapitel 3.25.2).
2.10 Zellinien
Die Kultivierung der Zellinien wurden im wesentlichen von Olga Mezler und Jürgen
Kretschmer
durchgeführt.
Dabei
handelte
es
sich
um
HeLa-Zellen
(epitheliales
Cervixkarzinom; human) und Ovarialkarzinomzellinien.
Die Ovarialkarzinomzellinien Caov-3, ES-2, MDAH2774, NIH:OVCAR-3 und SK-OV-3
wurden bei der American Type Culture Collection (Rockville, USA) erworben. Die Zellinien
Caov-3,
MDAH2774
und
NIH:OVCAR-3
wurden
ursprünglich
aus
ovariellen
Adenokarzinomen gewonnen. Sie weisen eine epitheliale Morphologie auf und wachsen
15
M ATERIAL
adhärent. NIH:OVCAR-3 exprimiert einen Androgen-, Östrogen- und Progesteron-Rezeptor
und besitzt Resistenzen gegen klinisch relevante Konzentrationen von Adriamycin,
Melphalan und Cisplatin. Auch die Zellinie SK-OV3, die aus Ascites gewonnen wurde, ist
resistent gegen Cisplatin und Adriamycin. Zusätzlich zeigt sie eine Resistenz gegen das
Diphterie-Toxin. Die Zellinien GG, HEST und MT wurden freundlicherweise von den
klinischen Kooperationspartnern der Frauenklinik Heidelberg zur Verfügung gestellt. Sie
wurden dort aus Ascites gewonnen und kultiviert.
2.11 Histologische Befunde von Patientengeweben
Patientin
Histologische Befunde von asservierten Patientengeweben
18
Patientin 18 war zum Zeitpunkt der Operation 33 Jahre alt. Ein histologischer
Befund des Tumors liegt nicht vor.
21
In den Abstrichen des Tubenepithels lagen besonders viele Zellen vor. Bei dem
Ovarialtumor handelte es sich um ein Zweitkarzinom, das nach einem
histologisch gesicherten Borderline-Tumor auftrat, der etwa ein Jahr zuvor
operiert wurde. Die Patientin war zum Zeitpunkt der zweiten Operation 25 Jahre
alt.
22
Von dieser Patientin (73 Jahre alt) wurden Abstriche einer muzinösen Zyste und
des Tubenepithels asserviert. Ebenso wurden ein solider Brenner-Tumor und
gesundes Ovar für weitere Untersuchungen asserviert.
26
Bei Patientin 26 handelte es sich um eine 56 jährige Frau, deren histologischer
Befund ergab, daß es sich bei ihrem Tumor um ein mittelgradig differenziertes,
seröses, papilläres Adeno-Karzinom handelte, das beide Ovarien betraf und
Netzmetastasen gebildet hatte. Darüber hinaus waren jedoch zum Zeitpunkt der
Operation keine weiteren Organe vom Tumor befallen. Während der Operation
wurden auch Proben von den Netzmetastasen für die in situ Hybridisierung
entnommen.
30
Patientin 30 (77 Jahre alt) wurde vor mehr als 10 Jahren an einem Brustkarzinom
operiert. Bei dem hier vorliegenden Tumorgewebe des Ovars handelte es sich
jedoch eindeutig um keine Brustkrebsmetastasen, sondern um einen davon
unabhängiges Ovarialkarzinom.
31
Bei Patientin 31 handelte es sich um eine 69 jährige Frau, bei der ein mittelgradig
differenziertes Adeno-Karzinom entfernt und dessen Typ nicht festgelegt wurde.
Eine Tumoreinstufung ergab die Zuordnung zu GII. Das TNM-Stadium wurde auf
T1c festgelegt. Dieses entspricht dem FIGO-Stadium I und bedeutet, daß der
Tumor auf ein oder beide Ovarien beschränkt ist, sich jedoch maligne Zellen im
Aszites oder bei einer Peritonealspülung nachweisen lassen.
46
Das Karzinom von Patientin 46 war mittelgradig differenziert, das bereits zum Teil
nekrotisch und mit Teilinfiltrationen des linken Ovars versetzt war. Eine
Tumoreinstufung ergab die Zuordnung zu GII. Das TNM-Stadium wurde auf T3b
(FIGO-Stadium III) festgelegt. Bei diesem Stadium hat der Tumor ein oder beide
Ovarien befallen, zusätzlich können Peritonealmetastasen jenseits des Beckens
histologisch nachgewiesen werden, deren Ausdehnung größer als 2 cm sind
und/oder regionäre Lymphknotenmetastasen aufweisen.
16
M ATERIAL
2.12 Primer
Primer für den SMARTTM PCR Synthese Kit:
CDS-Primer
PCR Primer
AAG CAG TGG TAA CAA CGC AGA GTA CT(30)N-1N
(N= A, C, G, T; N = A, G, C)
AAGCAGTGGTAACAACGCAGAGT
Primer für die subtraktive Hybridisierung:
Adapter Primer 1
Adapter Primer 2R
PCR Primer 1
nested PCR Primer 1
nested PCR Primer 2R
CTA
GGG
CTA
CGA
CTA
TCG
AGC
ATA
CAG
ATA
GGT
ATA
AGC
GTG
CGA CTC ACT ATA GGG CTC GAG CGG CCG CCC
GT
CGA CTC ACT ATA GGG CAG CGT GGT CGC GGC
CGA CTC ACT ATA GGG C
GGC CGC CCG GGC AGG T
GTC GCG GCC GAG GT
Primer für Differential Display und modifiziertes Differential Display:
Die Primer wurden, soweit nicht anders angegeben, bei SIGMA (Deisenhofen) oder
Eurogentec (Köln) synthetisiert.
Die Arbitraryprimer (die Erläuterung des Begriffs ist in Kapitel 4.5.3 beschrieben) des
modifizierten Differential Display besitzen die selben Sequenzen wie die unten genannten
Primer, haben jedoch in 5‘-Richtung die zusätzlichen Basen: CGT GAA TTC.
Die Ankerprimer G und C weisen im modifizierten DD zusätzlich die Basen: GAA TTC GCC
in 5‘-Richtung auf.
Ankerprimer G
Ankerprimer C
Arbitraryprimer 1
Arbitraryprimer 2
Arbitraryprimer 3
Arbitraryprimer 4
Arbitraryprimer 5
Arbitraryprimer 6
Arbitraryprimer 7
Arbitraryprimer 8
Arbitraryprimer 9
Arbitraryprimer 10
Arbitraryprimer 11
Arbitraryprimer 12
Arbitraryprimer 13
Arbitraryprimer 14
Arbitraryprimer 15
Arbitraryprimer 16
Arbitraryprimer 17
Arbitraryprimer 18
Arbitraryprimer 19
Arbitraryprimer 20
TTT
TTT
GTG
CAA
AGG
TCC
CGG
AGG
TCC
GGA
AGA
CCA
AAA
GTC
CTA
CAT
CTA
AGT
ACG
TTT
ATG
AAT
TTT
TTT
CAA
TGC
ATA
CTT
ATA
TTC
GAC
AGA
AGC
TTT
TCG
CAT
CTA
AGC
CTA
GAA
ATT
ACG
GTG
CAC
TTT
TTT
TGA
GTC
CGT
TAG
ACT
TAG
GTA
CAA
GAT
ACG
GAG
AGC
GGG
CCT
GGG
TGC
CCT
GTG
TAG
ACC
TTT VG
TTT VC
G
T
G
C
G
C
T
C
G
C
C
A
T
T
T
G
G
G
C
C
Primer für 26C/C9/2:
17
M ATERIAL
26C/C9/2-lower1360
26C/C9/2-upper124
26C/C9/2/5‘-RACE533
26C/C9/2/5‘-nested RACE145
26C/C9/2p-endProt-u
26C/C9/2p-Prot-l
CCA
GTA
TAT
GGG
ATG
TGC
AGC
CTG
GCT
ATT
AAA
TTC
CCC
GCT
TCG
CTG
TTG
GGA
ATG
GCT
GAT
TCA
ACC
TTC
ACC
CGG
TCT
TGC
TTT
TGC
AGC
GCT
GCG
GGA
TTT
GCC
TGT
ATT
CCT
AGA
CTT
TCT
GCT
CAT
CTA
TGT
CTT
ATG
GAC
TCC
TCT
CAT
CGC
AGA
CGT
GTG
GCT
GGC
CCA
ACT
CAC
ACC
ACA
CTC
ATA
TAT
GAA
TTG
GGG
CAC
TCC
CAC
AGT
ACC
ATG
TTG
GCC
TTC
TTC
TCC
CAA
TGG
TAA
TAT
CCA
CTG
AGC
CTC
CTT
TAG
GAG
TCG
TGT
TCC
TAC
AGG
TGC
TTG
TGC
GAA
TGC
GCA
TGA
GGT
GTT
AAT
GAC
GCT
CAT
CTG
GTG
GTC
TCT
ATT
ATG
TAC
TGT
CAC
TCA
CGA
CAC
TAG
TG
C
GGA
ACT
CGG
CAG
CAT
TCG
CTA
GCG
T
TC
AAC
TGT
TAT
TTC
TTC
A
T
G
TTC C
Sonstige Primer:
G3PDH-upper
G3PDH-lower
β-Aktin-upper
β-Aktin-lower
Fibronectin-uppper
Fibronectin-lower
SemaphorinE-upper
SemaphorinE-lower
CD53-upper
CD53-lower
RACE Primer 1
RACE nested Adaptor Primer 2
18
GGA AG
AGG ATC A
TCA GAA C
CGT GGG
TGC CAT T
TAG GGC
GC
METHODEN
3
Methoden
3.1 Gewebeentnahme
Die Entnahme von Tumorproben des Ovars und des normalen Epithels der Tube erfolgte
während der Operationen bei den erkrankten Patientinnen durch die Kooperationspartner in
den Universitätsfrauenkliniken Heidelberg und Tübingen. Für die Isolierung von GesamtRNA wurden die Gewebe unverzüglich in 350 µl RLT-Puffer (ohne Angaben des Herstellers
zur Pufferzusammensetzung), einen Guanidin-Isothiocyanat-haltigen Puffer, überführt. Die
verbleibenden Gewebe wurden sofort in einem 4%igen Paraformaldehydpuffer für eine sich
anschließende in situ Hybridisierung fixiert.
3.2 Isolierung von Gesamt-RNA
Die Gesamt-RNA von Ovarialkarzinomzellinien bzw. der Gewebe der an Krebs erkrankten
Patientinnen wurde mittels RNeasy Mini-Kit (Qiagen, Hilden) isoliert.
Das sich in 350 µl RLT-Puffer (ohne Angaben des Herstellers zur Pufferzusammensetzung)
befindende Gewebe bzw. eine Million Zellen von Ovarialkarzinomzellinien wurde bei -80°C
über längere Zeiträume gelagert. Für die Aufbereitung der RNA wurden die Proben aufgetaut
und anschließend unter leichtem Schütteln 30 min bei 37°C inkubiert. Um die vollständige
Lyse des Gewebes zu gewährleisten, wurden die Proben zusätzlich mittels QIAshredderSäulen (Qiagen, Hilden) homogenisiert. Dies geschah durch Zentrifugation bei 8000 x g
innerhalb von 2 min. Dabei blieben die Zellfragmente auf der Säule, Proteine, RNA und DNA
gelangten in das Eluat. Dieses wurde mit einem Volumanenteil 70%igem Ethanol versetzt
und anschließend auf eine RNeasy-Minispin-Säule aufgetragen. Nach Zentrifugation bei
8000 x g während 15 sec band die RNA an die Säule und konnte durch Waschen mit 700 µl
RW1-Puffer (ohne Angaben des Herstellers zur Pufferzusammensetzung) und 500 µl RPEPuffer (ohne Angaben des Herstellers zur Pufferzusammensetzung) aufgereinigt werden. Für
die RNA-Elution wurden 2 x 30 µl RNase-freies DEPC-Wasser verwendet, das zur Erhöhung
der RNA-Ausbeute 1 min auf die Säule einwirkte. Die Elution erfolgte bei 8000 x g während
1 min.
19
METHODEN
3.3 Konzentrationsbestimmung und Überprüfung der Qualität von RNA
3.3.1
UV-Photometrische Bestimmung der Konzentration von RNA und DNA
Die Bestimmung der Konzentration von Nukleinsäuren in wäßriger Lösung erfolgte durch die
Messung der optischen Dichte bei einer Wellenlänge von 260 nm. Dabei entsprach ein Wert
von 1 etwa 50 µg/ml doppelsträngiger DNA, 40 µg/ml RNA und 33 µg/ml einzelsträngiger
DNA.
3.3.2
Die
Spektrofluorometrische Bestimmung der RNA-Konzentration
Zugabe
fluoreszierender
Nukleinsäurefarbstoffe
zu
wäßrigen
Lösungen
von
Nukleinsäuren und anschließende Messung der Anregungs- und Emissionswellenlänge
ermöglicht die Konzentrationsbestimmung mit geringeren Nukleinsäuremengen, als dies bei
der direkten Messung, wie in Kapitel 3.3.1 beschrieben, nötig sind. Dazu wurden die
RiboGreenTM RNA bzw. PicoGreenTMds DNA Quantifizierung-Kits (Molecular Probes, Leiden,
NL) verwendet.
Zunächst wurde nach Isolierung der RNA aus den Gewebeproben die DNA durch DNase I
abgebaut (siehe Kapitel 3.4). Damit sollten Wechselwirkungen zwischen DNA und dem
Farbstoff verhindert werden, da diese die Messung der RNA-Konzentration beeinträchtigen
würden. Anschließend wurde aus einer 20fachen TE Stammlösung eine 1fach Lösung mit
H2ODEPC hergestellt und damit die ribosomale RNA und die aus den Geweben isolierte RNA
verdünnt. Für die erste (high-range) Standard-Kurve wurde die rRNA auf 4, 10, 20, 40, 100,
160 und 200 ng pro 200 µl, für die zweite (low-range) Standard-Kurve auf 0,2, 0,5, 1, 2, 5, 8
und 10 ng pro 200 µl verdünnt. Da die Konzentrationsbestimmung mit Hilfe dieser Methode
ab etwa 4 ng/ml belastbar ist, wurde die RNA aus den Gewebeproben 1:100 und 1:200
verdünnt, so daß man davon ausgehen konnte, in einem Konzentrationsbereich zu liegen,
bei der eine Messung reproduzierbare Ergebnisse liefert.
Zusätzlich mußte der Farbstoff vor Zugabe zu den RNA-Proben für den Hihg-range Assay
1:200 und für den Low-range Assay 1:2000 verdünnt werden. Jeweils 100 µl der verdünnten
RNA Proben wurden mit 100 µl des entsprechend verdünnten Farbstoffs versetzt,
durchmischt und schließlich 5 min im Dunkeln inkubiert, bevor die spektrofluorometrische
Messung vorgenommen wurde.
20
METHODEN
3.3.3
Überprüfung der Qualität von RNA durch Agarose-Gelelektrophorese
Die Überprüfung der RNA erfolgte durch horizontale Gelelektrophorese („Qualitätskontrolle“).
RNasen auf Gelkammern, -schlitten und -kämmen wurden durch 30 minütige Behandlung
mit 0,05 M NaOH entfernt. In der mit H2ODEPC gereinigten Kammer wurde ein 1%iges
Agarosegel gegossen. Die Lösung für das Gel und den Elektrophoresepuffer (1 x MOPSLösung) bestand aus 200 mM MOPS, 50 mM Natriumacetat, 10 mM EDTA und war auf
pH 6,5 eingestellt. Dem Agarosegel wurden 2 µl EtBr (10mg/ml) zugesetzt. Pro Geltasche
wurde 1 µg RNA mit 2 µl RNA-Probenpuffer (0,25% (w/v) Bromphenolblau, 0,25% (w/v)
Xylen Cyanol FT, 40% (w/v) Saccharose) versetzt und aufgetragen. Die elektrophoretische
Auftrennung erfolgte innerhalb von 30 min durch Anlegen einer Spannung von 100 Volt.
Anschließend wurde das Gel auf einem UV-Flächenstrahler photographiert.
3.4 Hydrolyse von DNA mittels DNaseI
Die restliche DNA, die in einem 0,5 µg Gesamt-RNA Ansatz verblieb, wurde in einem
Volumen von 50 µl mit 0,5 Units Desoxyribonuklease I (Gibco BRL, Eggenstein) in
Anwesenheit des entsprechenden Puffers (20 mM Tris-HCl pH 8,4, 2 mM MgCl2, 50 mM KCl)
innerhalb von 15 min bei 25°C verdaut. Durch Zugabe von 1/10 Volumenanteil 25 mM EDTA
wurde die DNase I bei einer Temperatur von 65°C innerhalb von 10 min denaturiert.
3.5 Reverse Transkription (RT) von mRNA- und cDNA- Amplifikation mit
SMARTTM PCR Synthese Kit
3.5.1
Reverse Transkription von mRNA
In einigen Fällen wurde die reverse Transkription mittels des SMARTTM PCR (Switch
Mechanism At the 5’-ends of RNA Template) cDNA Synthese Kit der Firma Clontech,
Heidelberg, durchgeführt. Im Gegensatz zur reversen Transkription mit anschließender
Differential Display-PCR erfolgte nach der RNA-Isolierung keine Hydrolyse der DNA durch
DNase I.
Pro RT wurden 100 ng Gesamt-RNA verwendet. Zusätzlich enthielt der Ansatz 2 µM CDSPrimer sowie 2 µM SMARTII Oligonukleotid. Der Ansatz wurde mit H2ODEPC auf 5 µl
aufgefüllt, gemischt, kurz bei 13000 x g zentrifugiert und anschließend bei 72°C für 2 min
inkubiert. Danach wurden die Proben für 2 min auf Eis gestellt und folgende Reagenzien
zugesetzt: 1 x Erststrang-Puffer (50 mM Tris-HCl pH 8,3, 75 mM KCl, 6 mM MgCl2), 4 mM
DTT, 2 mM dNTP-Mix und 200 U Superscript II Reverse Transcriptase (Gibco BRL,
Eggenstein). Die Proben wurden für 1 h bei 42°C inkubiert, danach wurden 40 µl H2O
zugesetzt. Vor der Lagerung der cDNAs bei -20°C erfolgte die Inaktivierung der reversen
Transkriptase durch Hitze (7 min bei 70°C).
21
METHODEN
3.5.2
cDNA-Amplifikation
In die SMART-PCR wurden 0,2 ng der Ansätze der reversen Transkription, dies entsprach
10 µl cDNA, eingesetzt. Zusätzlich enthielten die 100 µl Ansätze 1 x KlenTaq PCR Puffer
(40 mM Tricine-KOH pH 9,2, 15 mM KOAc, 3,5 mM Mg(OAc)2, 3,75 µg BSA), 0,2 mM dNTPMix, 0,2 µM PCR Primer sowie 1 x Advantage KlenTaq Polymerase Mix (Clontech,
Heidelberg). Die Proben wurden durchmischt und bei 13000 x g kurz zentrifugiert. Die PCRs
erfolgten in einem PCR-Gerät PTC-200 Peltier Thermal Cycler (Biozym, Hess. Oldendorf).
Die PCR-Bedingungen wurden wie folgt gewählt: Zunächst wurden die Proben bei 95°C
während 1 min denaturiert, anschließend wurden 15 Zyklen durchlaufen. Diese enthielten
einen Denaturierungsschritt bei 95°C für 15 sec, die Anlagerung der Primer bei 65°C für
30 sec und die Verlängerung der DNA bei 68°C für 6 min. Nach 15 Zyklen wurden von jedem
Ansatz 15 µl entnommen und auf Eis aufbewahrt. Der jeweils verbliebene Inhalt durchlief drei
weitere Zyklen unter den selben Bedingungen. Danach wurden erneut 15 µl pro Ansatz
abgenommen. Dieses Verfahren wurde bis zu einer Gesamtzyklenzahl von 24 Zyklen
wiederholt. Mit 5 µl der entnommenen Proben wurde die optimale Zellzyklenanzahl durch
Gelelektrophorese
festgestellt
(siehe
Kapitel
3.12).
Die
während
der
PCR
herausgenommenen Proben wurden daraufhin zusätzlichen Zyklen ausgesetzt, bis diese der
optimalen Zyklenanzahl entsprachen. Die DNA wurde mit dem PCR Purification Kit der Firma
Qiagen, Hilden, aufgereinigt (siehe Kapitel 3.23) und für die anschließende DD-PCR auf eine
Konzentration von 0,1 ng/µl eingestellt (siehe Kapitel 3.8.1). Für die Verwendung in einem
subtraktiven Hybridisierungs-Experiment mußte die DNA mit RsaI verdaut (siehe
Kapitel 3.27) und erneut mit Hilfe des PCR Purification Kits gereinigt werden.
3.6 Reverse Transkription der mRNA
3.6.1
Reverse Transkription für unmodifizierte Differential Display-PCR
Die reverse Transkription von 0,5 µg Gesamt-RNA erfolgte in einem 20 µl Ansatz. Dieser
enthielt 6,25 µM Ankerprimer, 1 x RT-Puffer (50 mM Tris-HCl pH 8,3, 75 mM KCl, 3 mM
MgCl2), 10 mM DTT (Sigma, Deisenhofen), 500 µM dNTP-Mix (Amersham, Cleveland), 20 U
RNase-Inhibitor (Boehringer, Mannheim) und 100 U SuperSCRIPT II RNase H+ Reverse
Transkriptase (Gibco BRL, Eggenstein). Vor Zugabe des Enzyms wurden alle Bestandteile
auf 42°C erwärmt und nach Zugabe 1 h bei 42°C inkubiert. Danach wurde die reverse
Transkriptase 15 min bei 70°C hitzeinaktiviert, die cDNA mit 30 µl H2O verdünnt und bis zur
Verwendung bei -20°C gelagert.
22
METHODEN
3.6.2
Reverse
Transkription
für
modifizierte
Differential
Display-PCR
oder
(semi)quantitative PCR
Für die reverse Transkription von 0,5 µg Gesamt-RNA wurde ein Ansatz von 20 µl
hergestellt. Darin enthalten waren 1 µM Ankerprimer, 1 x RT-Puffer (50 mM Tris-HCl pH 8,3,
75 mM KCl, 3 mM MgCl2), 10 mM DTT (Sigma, Deisenhofen), 500 µM dNTP-Mix
(Amersham, Cleveland), 20 U RNase-Inhibitor (Boehringer, Mannheim) und 100 U
SuperSCRIPT II RNase H+ Reverse Transkriptase (Gibco BRL, Eggenstein). Nach 1 h
Inkubation bei 42°C wurde die reverse Transkriptase hitzeinaktiviert (15 min bei 70°C), die
cDNA 1:1,5 mit Wasser verdünnt und bis zur Verwendung bei -20°C gelagert.
3.7 Subtraktive Hybridisierung
Die subtraktive Hybridisierung (siehe auch Abb.: 3.1) wurde mit Hilfe des CLONTECH PCRSELECTTM cDNA Subtraktion Kits der Firma Clontech (Heidelberg) durchgeführt.
Hierfür wurde mRNA mit Hilfe des SMART PCR cDNA Synthese Kits revers transkribiert
(siehe
Kapitel
3.5.1)
und
amplifiziert
(Kapitel
3.5.2).
Die
cDNA
wurde
säulenchromatographisch aufgereinigt, mit RsaI Endonuklease verdaut und erneut
aufgereinigt. Die so gewonnene cDNA wurde in Wasser aufgenommen, so daß die
Endkonzentration 50 ng/µl betrug.
3.7.1
Adapter-Ligation, erste und zweite Hybridisierungsreaktion
Zu 100 ng „Tester“ cDNA wurden jeweils 1 µM Adapter 1 bzw. 1 µM Adapter 2R, 1 x
Ligationspuffer (50 mM Tris-HCl pH 7,8, 10 mM MgCl2, 2 mM DTT und 0,05 mg/ml BSA) und
400 U T4 DNA Ligase (Clontech, Heidelberg) zugegeben. Dieser Ansatz (insgesamt 10 µl)
wurde bei 16°C und 15 h inkubiert. Die Ligase wurde anschließend durch Zugabe von
10 mM EDTA sowie 50 µg/ml Glycogen und Erhitzen auf 72°C während 5 min inaktiviert. Die
Proben wurden bei -20°C bis zur weiteren Verwendung eingefroren.
Für die erste Hybridisierungsreaktion wurden jeweils 450 ng der RsaI verdauten „Driver“
cDNA
mit
1
x
Hybridisierungspuffer
(ohne
Angaben
des
Herstellers
zur
Pufferzusammensetzung) und 1,5 µl der Adapter 1 ligierten Tester (Hybridisierungsprobe 1)
bzw. 1,5 µl der Adapter 2R ligierten Tester DNA (Hybridisierungsprobe 2), was einem etwa
33fachen Überschuß an „Driver“ entspricht, versetzt. Die Proben wurden mit einem Tropfen
Mineralöl überschichtet und kurz zentrifugiert. Nach Erhitzen (90 sec) auf 98°C wurden die
Proben 8 h bei 68°C inkubiert.
Für die zweite Hybridisierungsreaktion wurden 300 ng RsaI verdaute, aufgereinigte „Driver“
cDNA mit 1 x Hybridisierungspuffer und Wasser auf 4 µl aufgefüllt. 1 µl dieser Mischung
wurde in ein 0,5 ml Reaktionsgefäß überführt, mit einem Tropfen Mineralöl überschichtet und
bei 98°C für 1 1/2 min denaturiert. Während dessen wurde eine Mikropipette auf 15 µl
23
METHODEN
eingestellt und die Hybridisierungsprobe 2 vollständig aufgezogen. Danach wurde etwas Luft
in die Spitze eingezogen und, getrennt durch das Luftkissen, der frisch denaturierte „Driver“
aufgezogen.
Beide
in
der
Spritze
befindlichen
Reaktionsansätze,
„Driver“
und
Hybridisierungsprobe 2, konnten so gleichzeitig mit Hybridisierungsprobe 1 vermischt
werden. Die Reaktion wurde bei 68°C während 15 h inkubiert, mit 200 µl Verdünnungspuffer
(20 mM HEPES-HCl pH 8,3, 50 mM NaCl, 0,2 mM EDTA pH 8) versetzt und bei 68°C für
7 min erwärmt. Der Reaktionsansatz konnte bei -20°C gelagert werden.
3.7.2
Erste und zweite Amplifikation der subtrahierten Proben
Die ausschließlich im Tester exprimierten Proben wurden in zwei PCRs amplifiziert. Eine
schematische Übersicht der ersten und zweiten Amplifikation ist in Abb.: 3.1 dargestellt.
Die Hybridisierungsreaktionen liefern dabei unterschiedliche Produkte. Im Einzelnen
handelte es sich um einzelsträngige Tester cDNA mit den jeweiligen Adaptoren 1 bzw. 2 (a),
die doppelsträngigen Tester cDNAs mit einem (c) oder zwei gleichen Adaptoren an beiden
5‘-Enden (b), die einzel- und doppelsträngige Driver DNA (d) sowie die doppelsträngigen
Tester cDNAs mit unterschiedlichen Adaptoren (e).
Zunächst
wurden
die
Enden
der
Adaptoren
durch
die
Polymerase
aufgefüllt
(„Auffüllreaktion“) und für die erste Amplifikation, bei der nur doppelsträngige cDNAs mit
unterschiedlichen Adaptorsequenzen an beiden Enden exponentiell amplifiziert werden,
vorbereitet. In einer zweiten PCR wurde der Hintergrund vermindert und die differentiell
exprimierten Sequenzen angereichert. Eine Mischung aus 1 µl der verdünnten, subtrahierten
cDNA, 1 x KlenTaq PCR Puffer (40 mM Tricine-KOH pH 9,2, 15 mM KOAc, 3,5 mM
Mg(OAc)2, 3,75 µg BSA), 0,2 mM dNTP-Mix, 0,4 µM PCR Primer 1 und 1 x Advantage cDNA
Polymerase Mix (Clontech, Heidelberg) wurden bei 75°C für 5 min inkubiert und so die
Adaptoren
„aufgefüllt“.
Die
anschließende
PCR
bestand
aus
folgenden
Zyklen:
Denaturierung bei 94°C für 25 sec, darauffolgend 27 Zyklen mit einem Temperaturverlauf
von 94°C für 10 sec, 66°C 30 sec und 72°C für 1,5 min. 3 µl des primären PCR-Produkts
wurden mit 27 µl H2O versetzt, wovon für die zweite PCR lediglich 1 µl eingesetzt wurde.
Zusätzlich wurden 1 x KlenTaq PCR Puffer, 0,4 µM nested PCR Primer 1, 0,4 µM nested
PCR Primer 2R, 0,2 mM dNTP-Mix und 1 x Advantage cDNA Polymerase Mix zugesetzt. Die
Bestandteile wurden durchmischt, kurz zentrifugiert und folgender PCR unterzogen: 12
Zyklen bei 94°C für 10 sec, 30 sec bei 68°C und 1,5 min bei 72°C. Die Proben wurden -20°C
gelagert.
24
METHODEN
Abb.: 3.1 Schematische Übersicht der subtraktiven Hybridisierungs-PCRs.
25
METHODEN
3.8 Differential Display-PCR
Die Durchführung der Differential Display Methode ist in der Abfolge der Arbeitsschritte in
Abb.: 3.2 schematisch dargestellt. Die Isolierung von RNA aus Geweben und Zellinien, die
Hydrolyse von DNA und die reverse Transkription von mRNA ist auch für andere Methoden,
beispielsweise
für
(semi)quantitative
PCRs,
relevant
und
wurde
bereits
in
den
vorangegangenen Kapiteln beschrieben. Sie sind hier für einen vollständigen Überblick
nochmals mit aufgenommen.
Abb.: 3.2 Schematische Darstellung der Differential Display Methode.
26
METHODEN
3.8.1
Differential Display-PCR vor Modifikation
Das Prinzip der reverse Transkription der mRNA und der Differential Display-PCR mit Ankerund Arbitraryprimern ist in Abb.: 3.3 dargestellt.
Abb.: 3.3 Schematische Darstellung der reversen Transkription, der Differential Display-PCR
und der Auswahl signifikanter Banden.
27
METHODEN
Für die DD-PCR Ansätze wurden 0,2 ng cDNA und 2 µM Arbitraryprimer (siehe Kapitel 2.12)
eingesetzt. Zusätzliche Bestandteile waren 1 x Goldstar DNA Polymerase Puffer (75 mM
Tris-HCl, pH 9, 20 mM (NH4)2SO4, 0,01% (v/v) Tween20), 1,875 mM MgCl2, (Eurogentec,
Köln), 2 µM dNTP-Mix (Amersham, Cleveland, USA), 50 µM Ankerprimer, 1 µCi [α-33P] dATP
(Amersham, Cleveland, USA) sowie 0,002 U Goldstar DNA Polymerase (Eurogentec, Köln).
Die DD-PCRs wurden im PTC-200 Peltier Thermal Cycler (Biozym, Hess. Oldendorf) bei
folgenden PCR-Bedingungen durchgeführt:
Eine erste Denaturierung erfolgte innerhalb von 5 min bei 96°C, danach wurde 40 mal der
Temperaturverlauf 1 min bei 94°C, 2 min bei 42°C und 30 sec bei 70°C wiederholt.
Abschließend erfolgte eine Elongation für 3 min bei 70°C, damit die Polymerase zusätzliche
Adenine anfügt, die Voraussetzung für die TA-Klonierung sind. 10 µl der PCR-Produkte
wurden unter Vakuum getrocknet und in 6 x DNA-Probenpuffer (0,3% (w/v) Bromphenolblau,
0,3% (w/v) Xylen Cyanol FT, 10 mM EDTA pH 7,5, 97,5% (v/v) Formamiddeionisiert)
aufgenommen. Nach Denaturierung der Proben für 10 min bei 96°C wurden die PCRProdukte in einem 6%igen denaturierenden PAGE-Gel aufgetrennt.
3.8.2
Differential Display-PCR nach Modifikation
Pro Differential Display-PCR Ansatz wurden 0,5 ng cDNA und 1 µM Arbitraryprimer
eingesetzt. Weitere Bestandteile des Ansatzes waren 1 x Goldstar DNA Polymerase Puffer
(75 mM Tris-HCl, pH 9, 20 mM (NH4)2SO4, 0,01% (v/v) Tween20), 1 mM MgCl2 (Eurogentec,
Köln), 5 µM dNTP-Mix (Amersham, Cleveland, USA), 1 µM Ankerprimer (Eurogentec, Köln),
1 µCi [α-33P] dATP (Amersham, Cleveland, USA) sowie 0,05 U Goldstar DNA Polymerase
(Eurogentec, Köln). Die DD-PCRs wurden in einem PCR-Gerät „PTC-200 Peltier Thermal
Cycler“ (Biozym, Hess. Oldendorf) mit 2 unspezifischen und 35 spezifischen Zyklen
durchgeführt. Die PCR-Bedingungen wurden wie folgt gewählt: Zunächst erfolgte eine
Denaturierung innerhalb von 5 min bei 94°C, danach wurde zweimal der Temperaturverlauf
1 min bei 94°C, 2 min bei 37°C und 5 min bei 72°C wiederholt. Damit waren die
unspezifischen Zyklen durchlaufen. Die spezifischen 35 Zyklen begannen mit einem
Denaturierungsschritt bei 94°C 1 min, anschließend hybridisierten die Primer 1 min bei 55°C,
die Verlängerung geschah bei 72°C in 1 min. Abschließend erfolgte eine Elongation für 3 min
bei 70°C, damit die Polymerase zusätzliche Adenine anfügt, die Voraussetzung für die TAKlonierung sind. 10 µl der PCR-Produkte wurden unter Vakuum getrocknet und in 6 x DNAProbenpuffer (0,3% (w/v) Bromphenolblau, 0,3% (w/v) Xylen Cyanol FT, 10 mM EDTA
pH 7,5, 97,5% (v/v) Formamiddeionisiert) aufgenommen. In einem 6%igen denaturierenden
PAGE-Gel wurden die PCR-Produkte aufgetrennt.
28
METHODEN
3.9 Denaturierende Polyacrylamid-Gelelektrophorese
Vor der Herstellung des PAGE-Gels wurden die Glasplatten (40 x 33 x 0,04 cm) mit Seife,
Ethanol und Aceton gereinigt und mit Hilfe von Blueslick (Serva, Heidelberg) silanisiert. Die
ausgesparte Platte wurde zusätzlich an dem Ende, an dem der Kamm eingeführt wurde, mit
62,5 µl Bindsilan-Lösung (80% (v/v) Bindsilan/EtOH-Lösung, (Pharmacia, Freiburg) 20%
(v/v) Essigsäure) behandelt. Zwischen die, mit Spacern versehenen, abgedichteten
Glasplatten wurde das Gemisch der Polymerisationskomponenten zur Herstellung eines
6%igen denaturierenden PAGE Gels (48 ml Sequagel XR extender range, 12 ml Sequagel
complete (Biozym, Hess. Oldendorf) 450 µl 10% APS) gefüllt und die Gelkämme (0,4 mm x
10 mm x 2 mm) eingeführt. Bis zur vollständigen Polymerisation des Gemisches wurde das
Gel horizontal gelagert. Danach wurden die Kämme gezogen, für 30 min eine Leistung von
40 Watt angelegt und anschließend die denaturierten Proben aufgetragen. Während 2,5 h
bei 60 W erfolgte die Auftrennung in 1 x TBE-Puffer (89 mM Tris, 89 mM Borsäure, 2 mM
EDTA, pH 8,3). Das Gel wurde auf ein 3 MM Gel-Blotting-Papier (Schleicher & Schüll,
Dassel) transferiert und bei 80°C für 2 h getrocknet. Die Exposition eines Biomax™ MR
Films (Kodak-Aldrich, Steinheim) erfolgte bei 25°C etwa 24 h lang.
3.10 Ausschneiden signifikanter Banden
Nach Entwicklung eines Biomax™ Films, der über 24 h auf einem PAGE-Gel exponiert war,
konnten signifikante Banden ausgeschnitten werden. Bei diesen handelte es sich um
Unterschiede zwischen der cDNA aus Normal- und Tumorgeweben einer Patientin bzw.
unterschiedlichen Ovarialkarzinomzellinien. Auf das PAGE waren pro Gewebetyp vier
parallele DD-PCR-Ansätzen, die mit cDNA aus zwei parallelen reversen Transkriptionen
hergestellt wurden, aufgetragen. Dies bedeutet, daß pro Anker-/Arbitraryprimer Kombination
insgesamt acht Spuren (jeweils vier von einem Gewebetyp) auf einem PAGE zu sehen
waren.
Bei
Identifikation
von
Unterschieden
in
den
Viererblöcken
wurden
die
entsprechenden Banden auf dem Film markiert. Das getrocknete Gel und der Film wurden
an den Markierungspunkten zur Deckung gebracht und fixiert. Mit einem sterilen Skalpell
wurde die markierte Bande möglichst knapp ausgeschnitten, da der Harnstoff in den
verwendeten Gellösungen die nachfolgende PCR stört. Nach Überführung der Banden in
100 µl steriles, deionisiertes Wasser konnte die cDNA durch 15 min Erhitzen bei 100°C aus
dem Gel eluiert werden.
Ein Beispiel für die Nomenklatur der signifikanten Banden ist 26C/C9/2. Dabei kennzeichnet
26 die Nummer der Patientin, C steht für den Gewebetyp (normales Eileiterepithelium erhält
ein N, Ovarialtumorgewebe ein C), C liefert die Information welcher Ankerprimer eingesetzt
wurde (VG oder VC), die darauffolgende Zahl 9 steht für die Nummer des verwendeten
Arbitraryprimers (1-20), die letzte Zahl 2 kennzeichnet schließlich die Zahl der
29
METHODEN
aufgefundenen Genexpressionsunterschiede bei einer Primerkombination (von oben
gerechnet).
3.11 Reamplifikation von cDNA-Fragmenten
Die Reamplifikation erfolgte unter den gleichen Bedingungen wie die DD-PCRs und diente
der Vermehrung der cDNAs der aus einem PAGE geschnittenen Banden.
Dabei wurden die selben Primer in den gleichen Konzentrationen, wie sie bereits in den
jeweiligen DD-PCRs verwendet wurden, eingesetzt. Für die Reamplifikation war 1 µl der
extrahierten DNA ausreichend. Weitere Bestandteile waren 1 x Goldstar DNA-Polymerase
Puffer (75 mM Tris-HCl pH 9, 20 mM (NH4)2SO4, 0,01% Tween20), 1,875 mM bzw. 1 mM
MgCl2 (Eurogentec, Köln), 2 µM bzw. 5 µM dNTP-Mix (Amersham, Cleveland, USA), Primer
in der entsprechenden Form und Konzentration und 0,02 U bzw. 0,05 U Goldstar DNA
Polymerase (Eurogentec, Köln). Die PCR-Zyklen der Reamplifikation und der DD-PCR
waren identisch (siehe Kapitel 3.8.1 und 3.8.2), jedoch entfielen bei der modifizierten DDPCR die unspezifischen Zyklen.
3.12 Agarose-Gelelektrophorese
Bei der horizontalen Agarose-Gelelektrophorese wurden in der Regel 0,8-2%ige Gele
verwendet. Diese wurden mit dem Puffer hergestellt, in dem auch die Elektrophorese
stattfand (1x TAE (2 M Tris-HCl pH 8, 2 M Eisessig, 0,05 M EDTA-NaOH pH 8)). Pro
Geltasche wurde die DNA, meist 0,1-2 µg, mit 1/6 Volumenanteil DNA-Probenpuffer (6 x
Probenpuffer (30% Saccharose, 60 mM EDTA-NaOH pH 8, 0,6% (w/v) SDS, 0,15% (w/v)
Bromphenolblau) versetzt und aufgetragen. Der Gellauf erfolgte während 1-2 h bei 25°C und
einer angelegten Spannung von 30-100 Volt (0,07-2,5 V/cm2). Nach der Gelelektrophorese
wurde das Gel 15 min in eine Ethidiumbromid-Lösung gelegt (2 µg/ml EtBr), wobei das EtBr
in der DNA interkalierte. Das Gel wurde auf einem UV-Flächenstrahler bei 254 nm
photographiert.
3.13 Reinigung von DNA-Fragmenten aus Agarosegelen
Die Rückgewinnung der DNA aus Agarosegelen erfolgte mit dem QIAquick Gel Extraction Kit
der Firma Qiagen, Hilden.
Nach elektrophoretischer Auftrennung der Fragmente in einem Agarosegel wurde das zu
isolierende DNA-Fragment mit Hilfe eines Skalpells auf einem UV-Flächenstrahler
ausgeschnitten. Das Gelstück wurde gewogen und pro mg mit 3 Volumenteilen Puffer QG
(ohne Angaben des Herstellers zur Pufferzusammensetzung) versetzt. Mit Hilfe dieses
Puffers wurde die Agarose während 10 min Inkubation bei 50°C aufgelöst. Anschließend
wurden 100 µl Isopropanol pro 100 mg Gel zugegeben, gemischt und diese Lösung auf eine
30
METHODEN
„QIAquick“-Säule transferiert. Nach 1 minütiger Zentrifugation bei 10000 x g wurde der
Durchfluß verworfen und die Säule mit 0,5 ml Puffer QG von Agaroseresten gereinigt. In
einem Waschschritt mit 750 µl Puffer PE (ohne Angaben des Herstellers zur
Pufferzusammensetzung), die Zentrifugation erfolgte wie oben, wurden Salze entfernt. Zur
Elution der DNA wurden 50 µl Puffer EB (10 mM Tris-HCl pH 8,5) auf die Säule gegeben und
bei 10000 x g 1 min zentrifugiert.
3.14 TA-Klonierung
Für TA-Klonierungen wurde der pCR®II-TOPO Klonierungsvektor der Firma Invitrogen
(Groningen) verwendet. Dieser Vektor ist bereits linearisiert und mit einem 3’-ThymidinÜberhang und einer kovalent gebundenen Topoisomerase versehen. Der Klonierungsansatz
setzte sich aus etwa 20 ng (2 µl) PCR-Produkt, 3 µl sterilem Wasser und 1 µl pCR®II-TOPO
Vektor (25 ng) zusammen. Nach 5 min Inkubation bei 25°C wurde der Ansatz auf Eis gestellt
und diente der Transformation von chemisch kompetenten Zellen (siehe Kapitel 3.30).
3.15 Bakterienkulturen
Die verwendeten Bakterienstämme wurden als Suspensionskultur in LB-Medium (1% (w/v)
Bacto-Tryptone, 0,5% (w/v) Bacto-Yeast-Extract, 1% (w/v) NaCl, pH 7,5) oder auf LBAgarplatten (LB-Medium inklusive 1,5% (w/v) Bacto-Agar) kultiviert. Durch Zugabe von
Antibiotika, z.B. Ampicillin (100 µg/ml) oder Tetracyclin (50 µg/ml), erfolgte die Selektion
transformierter Bakterien.
3.16 Minipräparation von Plasmid-DNA mittels Säulenchromatographie
Bis zu etwa 20 µg Plasmid-DNA konnten mit Hilfe des QIAprep Spin Miniprep Kits der Firma
Qiagen, Hilden, gewonnen werden. Dazu wurden 3 ml LB-Medium inklusive des
entsprechenden Antibiotikums mit einer E.coli Kolonie angeimpft und über 15 h bei 37°C
geschüttelt. Die Bakterien wurden bei 2000 x g für 3 min zentrifugiert und der
Bakterienniederschlag in 250 µl P1-Puffer (50 mM Tris-HCl, 10 mM EDTA, pH 8) inklusive
100 µg/ml RNase A resuspendiert. Durch Zugabe von 250 µl P2-Puffer (200 mM NaOH,
1% (w/v) SDS) und nach 6-maligem über Kopf drehen, wurden die Zellen alkalisch lysiert.
Die Neutralisierung des Lysats erfolgte durch Zugabe von 350 µl N3-Puffer (ohne Angaben
des
Herstellers
zur
Pufferzusammensetzung)
und
6 maligem
Invertieren
des
Reaktionsgefäßes. Danach wurde 10 min bei 10000 x g zentrifugiert. Der Überstand wurde
abgezogen und auf die QIAprep Säule gegeben. Nach Zentrifugation wurde die Säule
zunächst mit 0,5 ml Puffer PB (ohne Angaben des Herstellers zur Pufferzusammensetzung)
und
anschließend
mit
0,75 ml
Puffer
PE
(ohne
Angaben
des
Herstellers
zur
31
METHODEN
Pufferzusammensetzung) gewaschen. Die DNA konnte schließlich mit 50 µl 10 mM Tris-HCl,
pH 8,5 von der Säule eluiert werden.
3.17 Midipräparation von Plasmid-DNA mittels Säulenchromatographie
Durch die Verwendung des Plasmid Midi Kits der Firma Qiagen, Hilden, konnten pro Säule
(tip 100) bis etwa 100 µg Plasmid-DNA isoliert werden.
Hierzu wurde zunächst eine E.coli-Bakterienvorkultur mit einem Volumen von 3 ml 8 h bei
37°C inkubiert. Die Vorkultur wurde 1 zu 1000 in 100 ml LB Medium inklusive des
entsprechenden Antibiotikums verdünnt und für 15 h bei 37°C geschüttelt. Anschließend
konnten die Bakterien nach Zentrifugation bei 6000 x g während 15 min „geerntet“ werden.
Das Bakteriensediment wurde in 4 ml P1-Puffer (50 mM Tris-HCl pH 8,0, 10 mM EDTA, pH 8
und 100 µg/ml RNase A) resuspendiert. Durch Zugabe von 4 ml P2-Puffer (200 mM NaOH,
1% SDS) und 5 min Inkubation bei 25°C wurden die Zellen lysiert. Danach erfolgte die
Neutralisierung des Lysats mit 4 ml eisgekühltem P3-Puffer (3 M KOAc pH 5,5). Nach 15 min
Inkubation auf Eis wurde bei 4°C 30 min bei 20000 x g zentrifugiert, der Überstand
abgezogen und auf die bereits mit 4 ml (Äquilibrierungspuffer: 750 mM NaCl, 50 mM MOPS
pH 7,0, 15% Isopropanol, 0,15% Triton X-100) äquilibrierte Qiagen-tip 100 Säule gegeben.
Die Säule wurde mit 2 x 10 ml Puffer QC (1 M NaCl, 50 mM MOPS pH 7,0, 15%
Isopropanol) gewaschen, die DNA mit 5 ml Puffer QF (1,25 M NaCl, 50 mM Tris-HCl pH 8,5,
15% Ethanol) von der Säule eluiert und schließlich durch Zugabe von 0,7 Volumenanteilen
(3,5 ml) Isopropanol p.a. gefällt. Durch Zentrifugation (30 min, 4°C bei 15000 x g)
sedimentierte die DNA. Nach Dekantieren des Überstands konnte das Sediment mit 2 ml
70% Ethanol p.a. gewaschen, zentrifugiert, luftgetrocknet und schließlich in 100 µl 10 mM
Tris-HCl (pH 8,5) aufgenommen werden. Um die Ausbeute an DNA festzustellen wurde eine
UV-spektrophotometrische Messung (siehe Kapitel 3.3.1) durchgeführt. Die Formel zur
Berechnung der DNA-Menge lautet OD260 x Verdünnungsfaktor x 50 = Ausbeute an DNA
(ng/µl).
3.18 Automatische Sequenzierung von DNA
Alle Sequenzierungen wurden von Andreas Hunziker in der Abteilung von Prof. Franke
(DKFZ, Heidelberg) mit Hilfe einer automatischen Sequenziereinheit „Applied Biosystems
automated Sequencer 373 A“ nach der „Dye Terminator Chemistry“ von Perkin Elmer
durchgeführt. Pro Sequenzierungsreaktion wurden 400-1000 ng DNA verwendet.
3.19 Sequenzvergleich mit publizierten Daten
Sequenzvergleiche von eigenen mit publizierten Sequenzdaten wurden hauptsächlich mit
HUSAR (Heidelberg Unix Sequence Analysis Resources (Release 4.0)) durchgeführt.
32
METHODEN
3.20 (Semi)quantitative RT-PCR-Analyse
Die (semi)quantitativen PCRs wurde mit etwa 0,5 ng der cDNA durchgeführt. Ein 50 µl
Ansatz bestand aus 1 x PCR Reaktionspuffer (40 mM Tricine-KOH pH 9,2, 15 mM KOAc,
3,5 mM Mg(OAc)2, 3,75 µg/ml BSA), 200 mM dNTP-Mix (Amersham, Cleveland), 1 x
Advantage cDNA Polymerase Mix (Clontech, Heidelberg) sowie 10 pmol der beiden
genspezifischen und gegebenenfalls der internen Standard Primer. Als interne Standards
wurden beispielsweise die Haushaltsgene β-Actin oder G3PDH verwendet. Die PCRs
wurden in dem PCR-Gerät PTC-200 Peltier Thermal Cycler (Biozym, Hess. Oldendorf) nach
einer ersten Denaturierung bei 96°C für 4 min innerhalb von etwa 21-30 Zyklen,
entsprechend der exponentiellen Vervielfältigung, durchgeführt.
Die PCR-Bedingungen wurden wie folgt gewählt: 30 sec bei 94°C, 30 sec bei 55°C bis 60°C
und 1 min bei 72°C. Als Kontrollen dienten Proben, die entweder nur die beiden
genspezifischen Primer oder solche, die nur die internen Standard Primer enthielten. Nach
den ersten 21-24 Zyklen und nach jeweils drei sich daran anschließenden Zyklen wurden
10 µl der PCR-Produkte entnommen. Daran schloß sich entweder die Auftrennung der
Proben mit Agilent Bioanalayzer (Agilent Technologies, Waldbronn) an oder die Auftrennung
über ein 2% Agarosegel. Bei der Analyse mit dem Agilent Bioanalyzer wurde ein Chip, der
bereits mit der Gelmatrix und einem entsprechenden Puffer versehen war, mit 1 µl Probe
beladen. Die cDNA-Proben durchliefen die Gelmatrix und wurden wie in einem
herkömmlichen Gel entsprechend ihrer Größe aufgetrennt. Die Resultate (ein virtuelles Gel,
die Konzentration und Größe der entprechenden cDNA) wurden als Datei am Computer
ausgegeben. Für die Auftrennung mit einem 2% Agarose/1 x TAE-Gel werden die Proben
mit 2 µl 6 x DNA-Probenpuffer (30% Saccharose, 60 mM EDTA-NaOH pH 8, 0,6% (w/v)
SDS, 0,15% (w/v) Bromphenolblau), versetzt und in 1 h bei einer angelegten Spannung von
100 Volt (2,5 V/cm2) aufgetrennt. Nach Interkalation von Ethidiumbromid in die DNA (10 min
im Färbebad mit 0.5 µg/ml EtBr) konnte das Gel mit Hilfe des Eagle Eye II photographiert
werden.
3.21 Northern Blot-Analyse
3.21.1 Herstellung radioaktiv markierter DNA-Sonden
Radioaktiv markierte DNA kann als Hybridisierungssonde für komplementäre DNA- oder
RNA-Stränge dienen. Sämtliche Bestandteile, d.h. Oligonukleotide, Klenow-Fragment und
dNTPs, wurden aus dem „NonaPrimer Kit II“ der Firma Appligene/Oncor verwendet.
Etwa 25 bis 100 ng eines in 7 µl Wasser gelösten DNA-Fragments wurde bei 100°C
innerhalb von 10 min denaturiert, auf Eis gestellt und kurz zentrifugiert. 4 µl des NonaPrimer
33
METHODEN
Mixes (ohne Angaben des Herstellers zur Pufferzusammensetzung), je 1 µl der unmarkierten
desoxyribonukleotid Triphosphate dATP (50 µM), dTTP (50 µM) und dGTP (50 µM) sowie
50 µCi α-32P-dCTP (30000 Ci/mmol) wurden zugegeben. Die Elongation erfolgte sofort nach
Zugabe von 1 µl Klenow Enzym (1U). Nach 1 h wurden die nicht eingebauten Nukleotide mit
Hilfe des „PCR-Purification Kits“ (siehe Kapitel 3.23) abgetrennt.
3.21.2 mRNA-Isolierung aus Gesamt-RNA
Aus 200 µg Gesamt-RNA (Isolierung in Kapitel 3.2 beschrieben) konnten etwa 2,0 µg mRNA
isoliert werden. Hierfür wurde der Oligotex-Kit der Firma Qiagen, Hilden, eingesetzt.
Zunächst wurde die RNA auf ein Volumen von 500 µl mit H2ODEPC aufgefüllt, mit 500 µl
Puffer OBB (20 mM Tris-HCl pH 7,5, 1 M NaCl, 2 mM EDTA, 0,2% (w/v) SDS) und 30 µl
Oligotex Suspension (10% (w/v) Oligotex Partikel, 10 mM Tris-HCl pH 7,5, 500 mM NaCl,
1 mM EDTA, 0,1% (w/v) SDS, 0,1% (w/v) NaN3) versetzt und die Suspension durchmischt.
Nach 3 minütiger Inkubation bei 70°C im Heizblock (Thermomixer 5436, Eppendorf), bei der
die Sekundärstrukturen der RNA zerstört wurden, inkubierten die Proben 10 min bei etwa
25°C. Durch 2 minütige Zentrifugation bei 14000 x g konnte der Oligotex-mRNA-Komplex als
Niederschlag erhalten werden, der in 400 µl OW2 Puffer (10 mM Tris-HCl pH 7,5, 150 mM
NaCl, 1 mM EDTA) aufgenommen wurde. Die Suspension wurde in einen Säulenkorpus
überführt und 1 min bei 14000 x g zentrifugiert. Nach Transfer der Säule in ein neues
Reaktionsgefäß konnte mit auf 70°C erwärmtem Puffer OEB (5mM Tris-HCl pH 7,5) die
mRNA von der Säule gewaschen werden. Um den maximalen Gehalt an mRNA zu erzielen,
wurde mit 50 µl warmem OEB-Puffer nachgespült.
3.21.3 Herstellung eines Northern Blots
Für die Herstellung eines Northern Blots wurden etwa 200 µg Gesamt-RNA isoliert (Kapitel
3.2). Damit konnte die für den Blot gewünschte Menge von 2 µg mRNA gewonnen werden.
Die Vorgehensweise bei der Isolierung von mRNA ist in Kapitel 3.21.2 beschrieben.
Die Proben wurden so vorbereitet, daß etwa 2 µg mRNA in 3,5 µl H2ODEPC (0,1% (v/v)
DEPC) gelöst waren. Zusätzlich enthielten sie 1 x Laufpuffer (50 mM MOPS-Puffer pH 7,
10 mM EDTA pH 8), 6,5% (v/v) Formaldehyd, 25% (v/v) deionisiertes Formamid, 0,05 mg/ml
Ethidiumbromid, 0,02% (w/v) Xylen Cyanol sowie 0,02% (w/v) Bromphenolblau. Die so
vorbereitete mRNA wurde bei 70°C 10 min denaturiert und anschließend auf ein
entsprechendes Gel aufgetragen. Dieses setzte sich aus 1,2% (w/v) Agarose, 2,2 M
Formaldehyd, 50 mM MOPS-Puffer pH 7 (200 mM MOPS, 50 mM NaOAc, 10 mM EDTA)
und 1 mM EDTA pH 8 zusammen. Der Laufpuffer bestand aus 50 mM MOPS-Puffer pH 7
und 1 mM EDTA pH 8; der Gellauf erfolgte bei einer angelegten Spannung von 100 Volt, bis
das Bromphenolblau im letzten Drittel des Gels angelangt war. Anschließend konnte das Gel
34
METHODEN
im UV-Licht (300 nm) betrachtet werden. Waren die mRNA-Mengen der Proben
vergleichbar, konnte die RNA auf die Nitrozellulose (Hybond+, Amersham Pharmacia
Biotech, Braunschweig) geblottet werden. Hierzu wurde der Blot in folgender Weise
aufgebaut:
Abb.: 3.4 Blotaufbau.
An die Apparatur wurde Vakuum angelegt und DEPC-Wasser auf das Gel pipettiert. Dieses
verblieb dort für 5 min. Anschließend wurde ein alkalischer Puffer (50 mM NaOH, 10 mM
NaCl) verwendet. Es erfolgte ein 5 minütiger Waschschritt (0,1 M Tris-HCl pH 7,4), dann
wurde 20 x SSC (3M NaCl, 300 mM Tri-Natriumcitrat-di-hydrat) für etwa 1 h aufgetragen.
Nach dem Blotten wurde das Gel entfernt, die Nylonmembran kurz in 20 x SSC gewaschen
und dann bei 120 mJ für 30 sec UV-vernetzt.
3.21.4 Northern-Hybridisierung
Die Hybridisierung eines RNA-Blots mit radioaktiv markierten RNA- oder DNA-Sonden wird
als Northern-Hybridisierung bezeichnet.
Eingesetzt wurden die als „H“ und „H2“ bezeichneten multiple Tissue Northern Blots der
Firma Clontech, Heidelberg, bzw. selbsthergestellte RNA-Nitrozelluloseblots (siehe Kapitel
3.21.3) aus Ovarialkarzinomzellinien.
Zur Absättigung unspezifischer Bindungsstellen wurden die Nitrozelluloseblots 1 h bei 62°C
in Hybridisierungspuffer (0,5 M NaH2PO4/Na2HPO4 pH 7,5, 7% (w/v) SDS, 1 mM EDTA pH
7,5 und 100 µg/ml Lachs-Sperma-DNA) (Church und Gilbert, 1984) inkubiert. Daraufhin
erfolgte die Zugabe der bereits denaturierten, radioaktiv markierten DNA-Sonde (1-2 x 106
cpm/ml). Inkubiert wurde ca. 15 h bei 62°C. Danach wurde die Hybridisierungslösung
verworfen. Anschießend wurde zweimal mit Waschpuffer 1 (2 x SSC (0,3 M NaCl, 30 mM
Tri-Natriumcitrat-di-hydrat), 0,05% (w/v) SDS) für 20 min bei 50°C und einmal mit
Waschpuffer 2 (0,1 x SSC, 0,1% (w/v) SDS) für 20 min bei 50°C gewaschen. Nach dem
Einschweißen der Blots in PVC-Folie und Auflegen eines Biomax MR Films (Kodak-Aldrich,
Steinheim), erfolgte die Exposition für mehrere Tage bei -70°C.
35
METHODEN
3.22 Aufreinigung markierter Sonden
Mit Hilfe des Nucleotide Removal Kit der Firma Qiagen, Hilden, kann radioaktiv-, biotin- oder
Digoxigenin-markierte DNA aufgereinigt werden.
Zu dem aufzureinigenden Reaktionsansatz wurden 10 Volumenanteile Puffer PN (ohne
Angaben des Herstellers zur Pufferzusammensetzung) zugesetzt und durchmischt. Das
Gemisch wurde auf eine „QIAquick“-Säule appliziert und bei 2000 x g 1 min zentrifugiert. Der
Durchfluß wurde mit dem Reaktionsgefäß entsorgt, die Säule in ein neues Gefäß transferiert.
Durch
Zugabe
von
500
µl
Puffer
PE
(ohne
Angaben
des
Herstellers
zur
Pufferzusammensetzung) und anschließender 1 minütiger Zentrifugation bei 2000 x g wurde
die Säule gewaschen. Störende Ethanolrückstände wurden durch erneute Zentrifugation bei
gleichen Bedingungen entfernt. Der Durchfluß wurde wieder mit dem Reaktionsgefäß
entsorgt und die Säule in ein neues Gefäß transferiert. Zur Elution der DNA wurden 2 x 100
µl Puffer EB (10 mM Tris-HCl pH 8,5) eingesetzt.
3.23 Aufreinigung von PCR-Produkten
Von PCR-Produkten wurden mit Hilfe des QIAquick PCR Purification Kits der Firma Qiagen,
Hilden, Oligonukleotide <100 bp, Primer, Polymerasen und Salze abgetrennt.
Hierzu
wurden
5
Volumenteile
Puffer
PB
(ohne
Angaben
des
Herstellers
zur
Pufferzusammensetzung) der PCR-Reaktion zugesetzt und durchmischt. Dieses Gemisch
wurde auf eine „QIAquick“-Säule appliziert und bei >10000 x g zentrifugiert. Durch Zugabe
von 750 µl Puffer PE (ohne Angaben des Herstellers zur Pufferzusammensetzung) auf die
Säule und anschließende Zentrifugation bei 10000 x g wurde diese gewaschen. Zur Elution
der DNA wurden 50-100 µl Puffer EB (10 mM Tris-HCl pH 8,5) eingesetzt.
3.24 RACE’s
Mit Hilfe von RACE (Rapid Amplification of cDNA Ends) ist es möglich, cDNA-Fragmente in
5’- oder 3’-Richtung spezifisch zu verlängern. Die cDNA aus bereits vorgefertigten RACEBibliotheken (cDNA von Eierstöcken, Hoden, Gehirn, Föten und Brustgeweben) verfügt über
Adaptoren am 5‘- und 3‘-Ende. Diese dienen der Anlagerung von PCR-Primern (AP 1 und
AP2, siehe Kapitel 2.12). Als Gegenstrang-Primer werden genspezifische Primer
ausgewählt. In jeweils zwei aufeinanderfolgende RACE-Reaktionen kann die Amplifikation
der entsprechenden cDNA erfolgen. Ausgangsprodukt für die zweite, auch nested RACEReaktion genannt, ist die cDNA aus der ersten Reaktion (amplifiziert mit AP1- und
genspezifischem Primer), was die Spezifität der Reaktion erheblich steigert. Die Primer der
zweiten RACE-Reaktion müssen bezüglich des gewünschten RACE-Produkts eine weiter in
Richtung 5‘-orientierte Position einnehmen (AP2 und genspezifischer Primer). Pro 50 µl
Reaktion wurden 2 µl cDNA (0,2 ng), 1 µl AP1-Primer (10 µM) sowie 1 µl des
36
METHODEN
genspezifischen Primers (20 µM) eingesetzt. Die nested RACE-Reaktion enthielt 5 µl des
RACE-Produkts, 1 µl AP2-Primer (10 µM) und 1 µl des nested Primers (20 µM) zusammen.
Folgendes Protokoll wurde für die RACE’s verwendet:
Es wurde zunächst bei 96°C für 4 min denaturiert. Die nächsten Schritte wurden 30 mal
wiederholt und begannen mit einem Denaturierungsschritt bei 96°C für 1 min, gefolgt von der
Anlagerung für 30 sec bei der optimalen Annealingtemperatur und der Verlängerung der
Primer bei 72°C während 6 min. Abschließend wurden von der Polymerase während 7 min
bei
72°C
Desoxyadenosine
angehängt,
die
die
TA-Klonierung
ermöglichten.
Die
Bedingungen für das nested RACE waren mit denen des ersten RACE’s identisch.
3.25 Phagen Screening
3.25.1 Präparation von Phagen DNA
Die Präparation der Phagen DNA bietet zwei Möglichkeiten:
- Bevor ein zeit- und materialaufwendiger Phagen Screen durchgeführt wird, kann mit
Hilfe von PCR überprüft werden, ob ein Teil einer bestimmten DNA in der PhagenBibliothek vorhanden ist.
- Durch Verwendung von zwei genspezifischen Primern (Primer und nested Primer)
und einem Primer aus der λ-Region kann wie bei RACE zusätzliche Sequenzinformation gewonnen werden.
Zunächst wurden XL1-Blue MRF’-Zellen mit etwa 1 x 106 Phagen infiziert, mit NZY-Agar
versetzt, auf 20 Platten (150 mm) verteilt und 15 h bei 37°C inkubiert. Das Vorgehen ist in
Kapitel 3.25.2 beschrieben. Anschließend wurde der Ansatz mit 6 ml SM Puffer (100 mM
NaCl, 8,1 mM MgSO4 x 7H2O, 50 mM Tris-HCl, pH 7,5, 0,01% (w/v) Gelatine) überschichtet.
Nach 4 h Inkubation bei 25°C unter leichtem Schütteln wurde der Überstand gesammelt und
mit 1 ml Chloroform ausgeschüttelt. Die wäßrige Phase wurde mit 20 mM EDTA pH 8,
50 µg/ml Proteinase K, 50 µg/ml RNase A und 0,5% (w/v) SDS versetzt. Nach Inkubation bei
37°C während 30 min wurde 1 Volumenanteil Phenol zugegeben, durchmischt und für
15 min bei 4°C und 1000 x g zentrifugiert. Der wäßrige Überstand wurde mit einem
Volumenanteil Phenol/Chloroform (1:1) versetzt, durchmischt und unter den selben
Bedingungen wie oben zentrifugiert. Nach Abnehmen des wäßrigen Überstandes wurde ein
letztes Mal Chloroform zugegeben und erneut zentrifugiert. Die Fällung der Phagen-DNA
geschah innerhalb von 15 h bei -20°C nach Zugabe von 1/10 Volumenanteil 3 M NaOAc
pH 4,8 und 2,5 Volumenteilen EtOH. Zentrifugiert wurde 30 min bei 4°C mit 15000 x g. Der
DNA-Niederschlag wurde in 1 ml TE aufgenommen und photometrisch die Konzentration
bestimmt.
37
METHODEN
3.25.2 Durchführung eines Phagen-Screens
Es wurden mit der Uni-ZAP XR Ovar Bibliothek (Stratagene, La Jolla) und λ TripleEX
Bibliothek (Clontech, Heidelberg) Screens durchgeführt. Hierfür wurden zunächst die
Wirtszellen amplifiziert und verdünnt sowie die Titer der Helferphagen und Phagen bestimmt.
Lediglich in der Uni-ZAP XR Ovar Bibliothek wurden positive Phagen detektiert.
Amplifikation der Wirtszellen
Die Amplifikation der Wirtszellen erfolgte durch Ausstreichen der bei -80°C eingefrorenen
XL1-Blue MRF’ und SOLR-Zellen auf antibiotikahaltigen Platten. Nach Inkubation bei 37°C in
etwa 15 h waren einzelne Kolonien sichtbar, mit denen 50 ml LB Medium/10 mM MgSO4
Kulturen angeimpft wurden. Die Kulturen wurden 15 h bei 30°C mit 220 rpm geschüttelt.
Nach dem Schütteln wurden die Zellen bei 2000 rpm innerhalb von 10 min zentrifugiert. Der
Überstand wurde verworfen und die Zellen durch Auf- und Abpipettieren in 10 mM MgSO4
aufgenommen, bis die OD600nm 0,5 betrug.
Bestimmung des Phagen- und Helferphagen-Titers
Die Titer der Phagen und Helferphagen ließen sich durch Herstellen von Verdünnungsreihen
und Infektion der Wirtszellen bestimmen. Die Phagen wurden mit SM-Puffer (100 mM NaCl,
8,1 mM MgSO4 x 7H2O, 50 mM Tris-HCl pH 7,5, 0,01% (w/v) Gelatine) auf 10-4-10-7 pfu/ml
verdünnt und 600 µl der sich in MgSO4 befindenden XL1-Blue MRF’-Zellen infiziert. Nach
15 min Inkubation bei 37°C, in der sich die Phagen an die Bakterien anhefteten, wurden
7,5 ml NZY Top Agar zugegeben und die Platten (15 mm) mit diesem Gemisch
überschichtet. Die Inkubation bei 37°C erfolgte für 15 h. Mit nachfolgender Formel konnte der
Titer bestimmt werden:
Anzahl von Plaques x Verdünnungsfaktor/ausplattiertes Volumen [ml] x 1000 µl/ml = Titer
Phagen-Screening
Für den Phagen-Screen wurden 50000 pfu pro 15 mm Platte, dies entspricht 1 x 106 pfu
insgesamt, eingesetzt. XL1-Blue MRF’-Zellen wurden, wie oben beschrieben, infiziert,
inkubiert und mit NZY-Agarose auf die Platten aufgebracht. Nach etwa 12-15 h Inkubation
bei 37°C war der Bakterienrasen deutlich von den Phagen angegriffen. Um das Abziehen der
Bakterien durch den Abklatsch der Nitrozellulose-Filter zu verhindern, wurden die Platten bei
4°C für 2 h gelagert. Die Filter wurden in trockenem Zustand für 2 min auf den Platten
exponiert, je 10 min mit Denaturierungs- (1,5 M NaCl, 0,5 M NaOH), Neutralisierung- (1,5 M
NaCl, 0,5 M Tris-HCl pH 8,0) und Waschpuffer (0,2 M Tris-HCl pH 7,5, 2 x SSC) durchtränkt.
Anschließend konnte die Phagen DNA durch UV-Vernetzung (120 mJ für 30 sec, (UVVernetzer: Stratagene, La Jolla)) an die Membran gebunden werden.
38
METHODEN
Hybridisieren
Die Hybridisierung erfolgte bei 42°C für 15 h in einem formamidhaltigen Puffer (50% (v/v)
Formamiddeionisiert, 5 x SSC (0,75 M NaCl, 75 mM Tri-Natriumcitrat-di-hydrat, pH 7), 5 x
Denhardt’s (0,5 g Ficoll Typ 400; 0,5 g Polyvinylpyrrolidon, 0,5 g BSA Fraktion V ad 500 ml),
1% (w/v) SDS, 100 µg/ml Hefe Gesamt-RNA) mit einer, wie in Kapitel 3.21.1 beschrieben,
radioaktiv markierten und aufgereinigten Probe.
Waschen
Zunächst wurde 3 x 15 min bei 25°C, anschließend 2 x 30 min bei 55°C mit einem Puffer,
bestehend aus 0,1 x SSC und 0,1% (w/v) SDS, gewaschen.
Positive Phagen-Plaques wurden mittels eines Röntgenfilms (BiomaxTM MR Film (KodakAldrich, Steinheim)) nachgewiesen, der während mehrerer Tage bei -70°C auf den
Membranen exponiert wurde. Entsprechende Phagen wurden durch Ausstechen der Blöcke
aus den Platten gewonnen. Zu diesem Zweck wurden die Blöcke in 500 µl SM Puffer
überführt und 4 h bei 25°C inkubiert. In einer weiteren Screening-Runde wurden 40 µl einer
1:1000 Verdünnung eingesetzt. Die weitere Vorgehensweise ist bereits oben beschrieben.
Eine dritte und letzte Screening-Runde war im Ablauf eine Wiederholung der zweiten Runde.
Gewinnung von Einzelklonen
Es wurden 300 µl XL1-Blue MRF’-Zellen mit 5 µl Phagen in SM-Puffer aus der dritten
Screening-Runde und 1 µl ExAssist Helfer Phage (>1 x 106 pfu/µl) infiziert. Nach Inkubation
bei 37°C für 15 min wurden 3 ml LB-Medium zu dem Gemisch zugegeben und für 3 h bei
37°C bei 250 rpm inkubiert. Die Proben wurden anschließend bei 70°C für 2 min erhitzt und
zentrifugiert (150 x g, 10 min, RT). 10 µl des Phagen-Überstandes wurden zu 200 µl XL1Blue MRF’-Zellen gegeben, 15 min bei 37 °C inkubiert und 100 µl davon auf LBampicillinhaltigen Platten ausgebracht. Am nächsten Tag konnten einzelne Kolonien gepickt
und die Plasmide inklusive Insert isoliert werden.
3.26 Herstellung von peptidspezifischen polyklonalen Antikörpern
Zur Immunisierung wurden zwei unterschiedliche synthetische Peptide aus der Sequenz
verwendet, die an Keyhole Limpet Haemocyanin (KLH) gekoppelt waren. Die Auswahl der
Peptide geschah unter zu Hilfenahme des Programms „Peptidestructure“ aus HUSAR
(Heidelberg Unix Sequence Analysis Resources (Release 4.0)). Kriterien hierfür waren
Immunogenität,
Wahrscheinlichkeit
der
Beteiligung
an
der
Proteinoberfläche
und
Sequenzposition des Peptides im Gesamtprotein. Im Einzelnen wurden folgende Peptide
ausgewählt:
- 26C/C9/2-471-492: Ac-TEFLDQNRGSRRTNPFGETEDEC-KLH
- 26C/C9/2-655-676: KLH-CNDQPDDDDGNPNEHRGAESEA
39
METHODEN
Die Peptide wurden von Dr. Pipkorn (DKFZ, Heidelberg) synthetisiert. Die Kopplung an
„Imject Maleinide Activated KLH“ erfolgte nach Angaben des Herstellers. Dabei wurden
während 2 h bei 25°C 2 mg KLH an 2 mg Peptid gekoppelt. Durch Dialyse (in
Dialyseschläuchen der Firma Spectra-Por) wurden störende Substanzen wie EDTA aus dem
Kopplungspuffer entfernt. Die Immunisierungen der Kaninchen wurden von der Firma
Eurogentech, Serain/Belgien, durchgeführt. Es wurden pro Immunisierung 200 µg KLH
gekoppeltes Peptid eingesetzt. Immunisierungen fanden nach 1, 14, 28 und 42 Tagen statt.
3.27 Spaltung von DNA mit Restriktionsendonukleasen
Bei einer Restriktionsendonuklease-Verdauung wurde DNA mit der entsprechenden
Enzymmenge in dem dafür geeigneten Reaktionspuffer inkubiert. Meist erfolgte die
Hydrolyse während 1-2 h bei 37°C (z.B. BamHI, EcoRI). Für einige Enzyme wurden
Reaktionspuffer, Inkubationszeit und -temperatur, entsprechend kommerziell erhältlicher
Tabellen, variiert. Die Reaktion wurde durch Zugabe von 1/6 Volumenanteil 6 x DNAProbenpuffer (0,2% (w/v) Bromphenolblau, 0,2% (w/v) Xylen Cyanol FF, 60% (v/v) Glycerol,
60 mM EDTA pH 8,0) beendet. Die Restriktionsenzyme wurden von den Firmen GIBCO
BRL, Eggenstein, und MBI Fermentas, St. Leon Roth, bezogen
3.28 Ligation von DNA
Bei der Ligation wurden Ansätze zu 10 µl hergestellt, die 50-200 ng linearisierte PlasmidDNA enthielten. Die DNA des Inserts sollte in einem 1- bis 3fachen molaren Überschuß zur
Plasmid-DNA eingesetzt werden. Pro Ansatz wurden 1-2 Enzymeinheiten der T4 DNALigase verwendet. Die Ligationsreaktion verlief während 1 h bei 25°C.
3.29 Herstellung kompetenter DH5α-Zellen
Für die Herstellung chemisch kompetenter DH5α-Zellen wurden 25 ml LB-Medium (1% (w/v)
Bacto-Tryptone, 0,5% (w/v) Bacto-Yeast-Extract, 1% (w/v) NaCl pH 7,0) mit 0,1 ml einer
Vorkultur von E.coli angeimpft und etwa 15 h bei 37°C inkubiert. 0,5 ml dieser Kultur wurden
verwendet, um 50 ml SOB-Medium/10 mM MgCl2 (2% (w/v) Bacto-Tryptone, 0,5% (w/v)
Bacto-Yeast-Extract, 10 mM NaCl, 2,5 mM KCl, 10 mM MgCl2) anzuimpfen. Die
Bakteriensuspension wurde bei 37°C geschüttelt, bis die OD600nm bei 0,6 lag. Nach 15 min
Inkubation auf Eis wurde bei 4°C für 12 min mit 1500 x g zentrifugiert. Der Niederschlag
wurde in 15 ml vorgekühltem Medium RF 1 (100 mM RbCl, 50 mM MnCl2, 30 mM
Essigsäure, 10 mM CaCl2, 15% (w/v) Glycerol pH 5,8) resuspendiert und 15 min auf Eis
gekühlt. Es wurde erneut für 12 min bei 4°C und 1500 x g zentrifugiert, bevor der
Niederschlag in 4 ml RF 2 Medium (10 mM MOPS-NaOH pH 6,8, 10 mM RbCl, 75 mM
40
METHODEN
CaCl2, 15% (w/v) Glycerol) aufgenommen wurde. Die kompetenten Zellen wurden in 100 µl
Portionen aliquotiert, in flüssigem Stickstoff schockgefroren und bei -70°C gelagert.
3.30 Transformation chemisch kompetenter Zellen
Zu chemisch kompetenten DH5α-Zellen (Herstellung siehe Kapitel 3.29) wurden 1 µl 0,5 M
β-Mercaptoethanol und etwa 2 µl Ligationsansatz zugegeben. Nach 30 min Inkubation auf
Eis wurde der Ansatz 60 sec bei 42°C erwärmt und anschließend für 2 min auf Eis gekühlt.
Nach Zugabe von 100 µl LB-Medium wurden die Zellen 45 min bei 37°C kultiviert. In dieser
Zeit konnten sie in antibiotikafreiem Medium die transferierte Antibiotika-Resistenz ausbilden.
Um Transformanten zu selektionieren, wurde etwa die Hälfte der Bakteriensuspension auf
antibiotikahaltigen Agarplatten ausgestrichen. Nach Inkubation bei 37°C für 15 h bildeten nur
diejenigen Bakterien, die Antibiotikaresistenz trugen, Kolonien auf der Agaroberfläche aus.
3.31 Einfrieren von Bakterienkulturen
Je
500
µl
einer
Bakterien-Suspensionskultur,
die
sich
in
der
logarithmischen
Wachstumsphase befand, wurden in ein autoklaviertes Eppendorf-Reaktionsgefäß überführt.
Durch Zufügen des gleichen Volumenanteils an 50%igem autoklaviertem Glycerol erhielt
man ein Gemisch, das für mindestens 1 h auf Eis belassen wurde. Danach konnten die
Zellen
bei
-70°C
eingefroren
werden.
Diese
behalten
über
Jahre
hinweg
ihre
Lebensfähigkeit.
3.32 in vitro Transkription/Translation
Eine in vitro Transkription/Translation wurde mit verschiedenen Systemen durchgeführt. Das
kommerziell erhältliche TNT® gekoppelte Retikulozyten-Lysat System der Firma Promega,
Madison/USA, bietet eine Alternative zur eukaryontischen in vitro Translation, liefert jedoch
eine geringere Ausbeute. Das Translations-System RTS 500 der Firma Roche, Mannheim,
basiert auf E.coli Lysat, weshalb Versuche, die in Zusammenhang mit posttranslationalen
Modifikationen des Proteins in Verbindung stehen, nicht möglich sind; es liefert jedoch
Proteinmengen von 100 bis zu 500 µg pro Ansatz.
Bei der Durchführung mit dem TNT® gekoppelten Retikulozyten-Lysat befand sich der offene
Leseraster des Gens 26C/C9/2 in dem pCR®II-TOPO Klonierungsvektor der Firma Invitrogen
(siehe Kapitel 4.7.8) bzw. in dem pIVEX2.4a Klonierungsvektor der Firma Roche. Für die
nicht radioaktive Proteinsynthese wurden zu 1 µg DNA 25 µl Kaninchen-Retikulozyten-Lysat,
2 µl Reaktionspuffer (ohne Angaben des Herstellers zur Pufferzusammensetzung), 1 µl SP6
Polymerase (ohne Angaben der Einheiten), 0,5 µl 1 mM Aminosäure-Mischung ohne Leucin
(ohne Angaben des Herstellers zur Pufferzusammensetzung), 0,5 µl 1 mM AminosäureMischung ohne Methionin (ohne Angaben des Herstellers zur Pufferzusammensetzung)
41
METHODEN
sowie 40 U RNase-Inhibitor zugesetzt. Nach 90 min Inkubation bei 30°C war die Translation
abgeschlossen und die Ergebnisse konnten analysiert werden.
Für die radioaktive Markierung der synthetisierten Proteine mit
35
S-Methionin wurden zu 1 µg
DNA 25 µl Kaninchen-Retikulozyten-Lysat, 2 µl Reaktionspuffer (ohne Angaben des
Herstellers zur Pufferzusammensetzung), 1 µl SP6 Polymerase (ohne Angaben der
Einheiten), 1 µl 1 mM Aminosäure-Mischung ohne Methionin (ohne Angaben des Herstellers
zur Pufferzusammensetzung), 4 µl
35
S-Methionin sowie 40 U RNase-Inhibitor zugesetzt.
Nach 90 min Inkubation bei 30°C wurden 3 µl der Probe mit 3 µl Probenpuffer versetzt, auf
ein 10% SDS-PAGE aufgetragen und elektrophoretisch getrennt. Nach Überprüfung der
Proteinsynthese durch eine Coomassie-Färbung wurde das SDS-PAGE 10 min in einem 1 M
Natriumsalicylat-Bad inkubiert, das der Fixierung der Banden diente. Anschließend wurde ein
Film für etwa 3 h auf dem Gel exponiert.
Für die in vitro Transkription/Translation mit dem Translations-System der Firma Roche
befand sich der offene Leseraster des Gens 26C/C9/2 in dem pIVEX2.4a Vektor (Roche,
Mannheim). Die lyophilisierten Puffer 1, 2, 3, 4 (ohne Angaben des Herstellers zur
Pufferzusammensetzung) wurden in dem Rekonstitutions-Puffer 5 (Puffer 1: 250 µl, Puffer 2:
800 µl, Puffer 3: 10,5 ml, Puffer 4: 600 µl) gelöst. Aus diesen Lösungen wurde das
Nährmedium (500 µl Lösung 4, 10,5 ml Lösung 3) und das Reaktionsmedium (250 µl
Lösung 1, 750 µl Lösung 2, 50 µl Lösung 4, sowie 10 µg DNA) zusammengesetzt. Das
Reaktionskompartiment wurde entsprechend den Herstellerangaben befüllt und in das RTS
500 Instrument (Roche, Mannheim) eingesetzt. Nach 24 h konnte das Translationsprodukt
analysiert werden.
3.33 SDS-Polyacrylamid-Gelelektrophorese (SDS-PAGE)
Die Auftrennung von Proteinen erfolgte auf SDS-Polyacrylamidgelen (Thomas und Kornberg,
1975), die entsprechend dem Molekulargewicht der Proteine hergestellt wurden. Für die
Gelherstellung wurden Glasplatten (120 x 60 x 0,5 mm) mit Seife und Ethanol gereinigt.
Nach dem Zusammenbau der Platten wurde die Trenngellösung (Beispiel für ein 10%iges
Gel: 10% (w/v) Acrylamid, 0,05% (w/v) Bisacrylamid, 750 mM Tris-HCl pH 8,8, 0,1% (w/v)
SDS, 0,1% (w/v) Ammoniumpersulfat, 0,03% (v/v) N,N,N’,N’-Tetramethylethylendiamin) bis
etwa 2 cm unterhalb des oberen Rands eingefüllt und mit 2-Butanol überschichtet. Nach
vollständiger Polymerisation konnte das 2-Butanol entfernt, die Kämme eingesetzt und die
Sammelgellösung (3,4% (w/v) Acrylamid, 0,09% (w/v) N,N’-Methylen-Bisacrylamid, 0,1%
(w/v) SDS, 178 mM Tris-HCl pH 6,8, 0,26% (w/v) Ammoniumpersulfat, 0,086% (v/v)
N,N,N’,N’,-Tetramethylethylendiamin) eingefüllt werden. Die Proteinproben wurden in SDSProbenpuffer (10% (v/v) Glycerol, 10% (v/v) β -Mercaptoethanol, 5% (w/v) SDS, 0,3% (w/v)
Bromphenolblau, 60 mM Tris-HCl pH 6,8) aufgenommen und für 5 min auf 96°C erhitzt. Die
42
METHODEN
Gelelektrophorese wurde in Elektrophoresepuffer (0,05 M Tris pH ca. 8,3, 0,38 M Glycin,
0,1% (w/v) SDS) bei einer Stromstärke von zunächst 22 mA bzw. 32 mA nach Erreichen des
Sammelgelendes durchgeführt. Als Proteinstandard diente eine Mischung verschiedener
Proteine mit bekanntem Molekulargewicht (SDS-7 oder SDS-6H, Sigma Deisenhofen). An
die SDS-PAGE schloß sich entweder eine Coomassie-Färbung oder der Blot des Gels an.
3.34 Nachweis von Proteinen durch Coomassie-Färbung
Beim Anfärben mit Coomassie-Blau-Färbelösung (0,06% (w/v) Serva Blue R, 50% (v/v)
Ethanol,
10%
(v/v)
Eisessig)
wurden
SDS-Gele
in
einer
sauren
alkoholischen
Farbstofflösung inkubiert. Die Proteine wurden durch Denaturierung im Gel fixiert und
bildeten einen Komplex mit dem Farbstoff. Überschüssiger Farbstoff wurde durch intensives
Waschen mit einer sauren Lösung entfernt (5% (v/v) Ethanol, 7,5% (v/v) Eisessig).
3.35 Immunblot-Analyse
Proteintransfer
Die in SDS-Polyacrylamidgelen aufgetrennten Proteine wurden auf Nitrozellulosemembranen
(Protran BA85) transferiert (Towbin et al., 1979). Hierzu wurden die Gele zwischen passend
geschnittene 3 MM Gel Blotting Papiere und Nitrozellulose, die zuvor mit Transferpuffer
(25 mM Tris-HCl pH 8,3, 192 mM Glycin) befeuchtet wurden, gelegt. Der Blotaufbau geschah
nach folgendem Schema:
Abb.: 3.5 Aufbau eines Immunblots
Die Bestandteile des Immunblots sind in der Legende neben der Abbildung dargestellt.
Der Transfer geschah üblicherweise bei 300 mA und 4°C in einer Blot Apparatur innerhalb
von 15 h.
43
METHODEN
Nachweis von Antigenen
Um den Transfer der Proteine zu überprüfen, erfolgte eine reversible PonceauS-Färbung
(0,02% (w/v) PonceauS), bei der die Nitrozellulose in die Färbelösung getaucht und
überschüssige Färbelösung durch Hin- und Herbewegen der Zellulose in vollentsalztem
Wasser entfernt wurde. Freie Bindungsstellen der Nitrozellulose wurden nach vollständigem
Entfärben durch Blockierlösung aus 5% Magermilchpulver (Skim Milk Powder, Fluka) in TBS
(150 mM NaCl, 10 mM Tris-HCl pH 7,6) abgesättigt. Nach 30 min wurde die Blockierlösung
entfernt
und
für
eine
weitere
Stunde
der
verdünnte
Erstantikörper
in
0,4% Milchpulver/TBS/0,1% Tween 20 aufgetragen. Um unspezifisch gebundene Antikörper
zu entfernen, wurde 5 x 1 min in TBS/0,1% Tween 20 (TBST) gewaschen. Anschließend
wurde ebenfalls für 1 h der in Blockierlösung verdünnte Zweitantikörper aufgetragen.
Unspezifisch gebundene sekundäre Antikörper wurden wie beim Erstantikörper mit TBSTWaschpuffer entfernt. Der Nachweis des gebundenen sekundären Antikörpers erfolgte
entweder mit dem ECL-System (Amersham) nach Protokoll des Herstellers oder durch
Zugabe von alkalischer Phosphatase-Entwicklerlösung (0,33% (w/v) BCIP, 0,66% (w/v) NBT
in 100 mM Tris-HCl pH 9,5, 100 mM NaCl, 5 mM MgCl2), bei der in einer Farbreaktion das
Substrat durch den 2. Antikörper umgesetzt wird. Die Reaktion wurde durch Entfernen der
Entwicklerlösungen und Waschen mit vollentsalztem Wasser gestoppt.
3.36 Digoxigenin-Markierung von RNA für in situ Hybridisierung
3.36.1 Markierung der RNA
Mit Hilfe von SP6 und T7-Polymerasen konnte klonierte DNA durch in vitro Transkription in
DIG-markierte RNA umgeschrieben werden. Diese sollte als Sonde in einer in situ
Hybridisierung verwendet werden.
Zunächst wurde das Insert mittels TA-Klonierung in den pCRII-TOPO Vektor der Firma
Invitrogen, Groningen/NL, kloniert. Dieser Vektor besitzt sowohl einen Sp6 als auch T7
Promotor. Durch Restrikitonsendonukleaseverdau von jeweils 5 µg Insert/Vektor mit den
Restriktionsenzymen BamHI oder aber EcoRV in den entsprechenden Puffern (1 x React 3:
5 mM Tris-HCl pH 8, 1 mM MgCl2, 10 mM NaCl bzw. 1 x React 2: 5 mM Tris-HCl pH 8, 1 mM
MgCl2, 5 mM NaCl) wurde der Vektor innerhalb 1 h bei 37°C hinter dem Insert geschnitten.
Die linearisierte DNA wurde mit dem PCR Nucleotide Removal Kit der Firma Qiagen, Hilden,
(siehe Kapitel 3.23) aufgereinigt und mit Hilfe des DIG RNA Labeling Kits der Firma Roche,
Mannheim, nach Vorschrift mit Digoxigenin markiert.
Pro Reaktionsansatz befanden sich neben 1 µg aufgereinigtem Template, 1 x Labeling Mix
(ohne Angaben des Herstellers zur Pufferzusammensetzung) 1 x Transkriptionspuffer (ohne
Angaben des Herstellers zur Pufferzusammensetzung), RNase-Inhibitor (20U) und 40 U Sp6
44
METHODEN
bzw. T7 Polymerase. Die Reaktion inkubierte 2 h bei 37°C. Anschließend wurde durch
Zugabe von 20 U RNase-freier DNaseI die DNA innerhalb von 15 min bei 37°C fragmentiert.
Durch Zugabe von 2 µl 0,2 M EDTA pH 8 wurde die DNaseI Reaktion abgestoppt. Da die
markierten Proben kleiner als 600 bp waren, muß laut Aussage von erfahrenen Kollegen
keine RNA-Hydrolyse durchgeführt werden. Die Proben wurden bezüglich ihres Labelings
mittels Dot-Blot überprüft (siehe Kapitel 3.36.2) und bei - 70°C bis zur weiteren Verwendung
eingefroren.
3.36.2 Überprüfung der Digoxigenin-Markierung mittels Dot Blot
Eine Hybond N+-Membran (Amersham-Pharmacia Biotech, Braunschweig) wurde auf die
erforderliche Größe zurechtgeschnitten, 5 min in Puffer 1 (100 mM Tris-HCl pH 7,5, 150 mM
NaCl in H2ODEPC) geschwenkt und für kurze Zeit getrocknet. Die bereits von 1 ng/µl bis
10 pg/µl verdünnten DIG-markierten Proben und ein RNA-Standard (im DIG RNA Labeling
Kit enthalten) wurden auf die Membran pipettiert und bei 120 mJ für 30 sec UV-quervernetzt
(UV-Crosslinker: Stratagene, La Jolla). Die Membran inkubierte 1 min in Puffer 1 und 30 min
in Blockingreagenz (1% (w/v) BSA, 0,1% (v/v) Tween 20 in Puffer 1), bevor die Lösung
verworfen und durch Puffer 1 inklusive 1,5 U Anti-Digoxigenen-AP (Fab Fragment
(Boehringer, Mannheim)) ersetzt wurde. Die Inkubation mit dem Antikörper erfolgte während
30 min bei 25°C auf einem Schüttler. Überschüssiger Antikörper wurde durch 3 maliges
Waschen je 5 min mit Puffer 1 entfernt. Danach wurde die Membran für 2 min in einen
weiteren Puffer (100 mM Tris-HCl pH 9,5, 100 mM NaCl, 50 mM MgCl2 in H2ODEPC) gelegt.
Der Nachweis der Digoxigenin-markierten Nukleinsäure geschah durch Zugabe eines NBT(45 µl NBT-Lösung: 75 mg/ml Nitro-blau-Tetrazoliumchlorid in 70% (v/v) Dimethylformamid)
BCIP-Lösungsgemisches (35 µl: 50 mg/ml 5-Brom-4-chlor-3-indolylphosphat in 100%
Dimethylformamid). Nach Ablaufen der Farbreaktion wurde die Membran mit vollentsalztem
Wasser gewaschen, um die Reaktion abzustoppen.
45
ERGEBNISSE
4
Ergebnisse
In den vergangenen Jahren wurden bereits vielversprechende therapeutische Fortschritte im
Hinblick auf die Behandlung des Ovarialkarzinoms gemacht. Dennoch besitzt dieser
Tumortyp zur Zeit noch die größte Mortalitätsrate unter den gynäkologischen Tumoren. Um
eine frühe Diagnostik und spezifischere Therapiemaßnahmen zu ermöglichen, wären
spezifische Marker-Proteine für einzelne Tumortypen und –stadien hilfreich. Auch der Verlust
von Tumorsuppressoren könnte nachgewiesen werden. Dazu müssen die Ovarialkarzinome
auf molekularer Ebene untersucht werden. Dies kann z.B. durch den Vergleich der
Expressionsprofile verschiedener Tumoren mit ihren korrespondierenden gesunden
Geweben geschehen.
Das Ziel dieser Arbeit war die systematische Analyse der Genexpressionsmuster von
epithelialen Ovarialkarzinomen. Dafür standen wie bereits in der Einleitung unter Kapitel
1.1.4 beschrieben mehrere Methoden, wie beispielsweise die subtraktive Hybridisierung und
das Differential Display, zur Diskussion. Beide Methoden wurden zunächst getestet und nach
Auswahl
einer
Methode,
des
Differential
Displays,
der
Versuch
unternommen,
unterschiedlich exprimierte Gene auf cDNA-Ebene zu identifizieren und zu verifizieren.
Einige der interessantesten differentiell exprimierten Fragmente wurden in weiterführenden
Experimenten genauer charakterisiert.
4.1 Materialasservation, histologische Aufarbeitung und Qualitätskontrolle
An der Universitätsfrauenklinik Heidelberg und Tübingen werden neben Operationen wegen
benigner proliferierender Veränderungen der Ovarien und Borderline-Tumoren auch
zahlreiche Operationen aufgrund des Verdachts auf Ovarialkarzinome durchgeführt. Dort
sind sowohl die notwendigen apparativen als auch die logistischen Voraussetzungen
vorhanden,
um
die
Asservation
vitaler
Tumorgewebeproben
durchzuführen.
Freundlicherweise wurden diese Gewebeproben von Herrn Dr. U. Hahn (Heidelberg), Herrn
Dr. R. Kurek (Tübingen), Herrn Dr. A. Marmé (Heidelberg), Herrn Prof. Dr. G. Bastert
(Heidelberg) und Herrn Prof. Dr. D. Wallwiener (Tübingen) unserer Arbeitsgruppe zur
Verfügung gestellt.
Voraussetzung für die systematische Analyse der Genexpressionsmuster in epithelialen
Ovarialkarzinomen ist eine hohe Qualität der verwendeten Gewebe. Dies bedeutet
einerseits, daß die bei der Operation entnommenen Gewebeproben sofort in einen
entsprechenden Puffer überführt werden müssen, um endogene RNase–Aktivität zu
verhindern; andererseits dürfen die Gewebeproben nicht durch Fremdgewebe verunreinigt
sein, da diese Verunreinigungen beim Vergleich von Geweben zu nichtepithelspezifischen
Unterschieden führen würden (Martin und Pardee, 1999).
47
ERGEBNISSE
Bei der Gewebeentnahme werden analog zum Papanicolaou-Test mit einer Metall- oder
Plastiköse Abstriche vom Infundibulum des Oviducts und dem Tumorgewebe des Ovars
hergestellt und unverzüglich in einen Guanidin-Isothiocyanat haltigen Puffer überführt. Der
Grund für die Asservation des Infundibulums anstelle des gesunden Ovarepithels ist, die
Unzugänglichkeit des Ovarepithels (siehe Kapitel 5.1.1). Das verbleibende Tumorgewebe
sowie Teile des Eileiters und des tumorfreien Ovars werden sofort in einem 4%igen
Paraformaldehydpuffer fixiert und für eine sich eventuell anschließende in situ Hybridisierung
aufbewahrt.
In der morphologischen Abteilung der Frauenklinik Heidelberg erfolgte die histologische
Aufarbeitung
von
OP-Präparaten
durch
einen
Pathologen.
Die
Bewertung
nach
morphologischen Kriterien zeigte, daß dabei in der Regel mehr als 98% der Zellen im
Ausstrich Tumorzellen waren. So war es möglich, Verunreinigungen unter morphologischen
Gesichtspunkten abzuschätzen. Neben der in der Frauenklinik Heidelberg etablierten
Methode wurde von mir nach einer zusätzlichen Möglichkeit gesucht, die Verunreinigungen
auf molekularer Ebene zu verfolgen. Dazu wurde in den Literaturdatenbanken nach
bestimmten, gewebetypspezifischen Markern recherchiert, die in einer quantitativen PCR
Verwendung finden können. Damit sollte weitgehend sichergestellt werden, daß nur Gewebe
ohne starke Verunreinigungen durch Blut und Basalmembranbestandteile untersucht
werden. Die Auswahl der entsprechenden Marker gestaltete sich jedoch schwierig, da das
Ovarepithel außer epithelialen auch mesenchymale Charakteristika zeigt, die eine
Unterscheidung zur Basalmembran erschwert.
Aufgrund der Versorgung der Gewebe mit Blut, in das Tumorgewebe eingedrungene
Makrophagen und Lymphozyten und des Anhaftens der Epithelien an der darunterliegenden
Basalschicht sind häufig auch Blut und Bestandteile der Basalmembran in den Abstrichen
auszumachen. Dies gilt insbesondere für das Tubenepithel, bei dem die Anhaftung um
einiges stärker ist als beim Tumorgewebe. Aus diesem Grund sollte ein Marker für
Verunreinigungen durch Blut verwendet werden. Dieser Marker ist CD53.
CD53 befindet sich im Gegensatz zu anderen Proteinen der Tetraspanin Superfamilie fast
ausschließlich auf Zelloberflächen von lymphatischen und myeloiden Zellen (Maecker et al.,
1997; Okochi et al., 1999), die in großer Anzahl im Blut vorhanden sind (Janeway und
Travers, 1995; Alberts et al.,1995).
Falls in den Abstrichen durch PCR große Mengen an CD53 nachgewiesen werden können,
sollte auf die Verwendung des entsprechenden Gewebes verzichtet werden. Als
Positivkontrolle für CD53 diente die B-Lymphomzellinie Jok-1, die CD53 in größerem
Umfang exprimiert. HeLa-Zellen und die Ovarialkarzinomzellinien GG und ES-2 tragen wenig
CD53 und dienten als Negativkontrollen.
48
ERGEBNISSE
Abb.: 4.1 zeigt das Ergebnis einer solchen Test-PCR mit cDNA von Patientin 30. Die cDNA
wurde zur Bestätigung von differentiell exprimierten Genen in quantitativen PCRs eingesetzt
(siehe Kapitel 4.5.6). Auf dem virtuellen Gel konnten keine Signale in den Spuren der PCRProdukte von HeLa, GG und ES-2 nachgewiesen werden. Ein äußerst schwaches Signal trat
bei dem Tubenepithel (P30N), ein stärkeres bei dem Tumorgewebe (P30C) auf. Das stärkste
Signal war bei der Positivkontrolle zu verzeichnen (Jok-1). Dieses Ergebnis deutet auf leichte
Verunreinigungen, insbesondere des Tumorgewebes, hin.
49
ERGEBNISSE
Abb.: 4.1 PCR als Kontrolle auf Verunreinigungen der Gewebe durch Blut.
Exemplarisch wird hier das Ergebnis der Kontroll-PCR mit cDNA von Patientin 30, die auch zur
Bestätigung von differentiell exprimierten Genen in quantitativen PCRs eingesetzt wurde (siehe
Kapitel 4.5.6), dargestellt. Da CD53 fast ausschließlich auf lymphatischen und myeloiden Zellen
präsentiert wird, konnte durch die Vermehrung eines CD53-Fragments mittels PCR das Maß der
Verunreinigung der Gewebe durch Blut abgeschätzt werden. Auf dem virtuellen Gel wurden die PCRProdukte der Zellinien HeLa, GG und ES-2 aufgetragen. Sie fungierten als Negativ-Kontrollen und
wiesen wie erwartet keine Bande auf entsprechender Höhe auf. In dem Tubenepithel von Patientin 30
(P30N) und dem Tumorgewebe des Ovars derselben Patientin (P30C) waren sehr schwache Banden
zu erkennen, was besonders im Tumorgewebe auf Verunreinigungen hindeutete. Als Positiv-Kontrolle
fungierte cDNA der B-Lymphomzellinie Jok-1, bei der das stärkste Signal auftrat.
Für die Untersuchungen der verwendeten Gewebe auf Verunreinigungen mit Bestandteilen
der Basalmembran konnte bislang kein hinreichender Marker identifiziert werden.
Hauptgrund dafür ist in den mesenchymalen Charakteristika des Ovarepithels (Auersperg et
al., 1999) zu sehen. Ein sonst häufig verwendeter Marker für fibroblastische Zellen, wie
beispielsweise das Vimentin, kann nicht eingesetzt werden um Verunreinigungen im
Tumorgewebe des Ovars nachzuweisen, da er sowohl im normalen Oberflächenepithel des
Ovars als auch im Tumorgewebe des Ovars vorkommt (Kupryjanczyk und Karpinska, 1998;
van Niekerk et al., 1997; Czernobilsky et al., 1985).
Auch als Kontrolle für das Tubenepithel, bei dem der Test auf Basalschichtbestandteile
besonders wichtig wäre, ist Vimentin als Marker umstritten, da es in Tubengeweben
nachgewiesen werden konnte (Woolnough et al., 2000).
Durch diese Überlegungen wurde deutlich, daß bereits bei der Präparation des zu
verwendenden Gewebes durch möglichst genaue Auswahl der Zellen eine Verunreinigung
minimiert werden muß. Der einfachste Weg, um definierte Einzelzellen oder ganze
Zellverbände auszuwählen, ist die Mikrodissektion. Dafür wurde zu Ende meiner Arbeit ein
laser-gestützter Mikrodissektor angeschafft, welcher durch rein physikalische Methoden
50
ERGEBNISSE
extrem saubere Proben liefert. Dabei wird ein Gewebeschnitt, der auf einen Objektträger
aufgebracht wurde, mit einer speziellen Folie abgedeckt. Die Folie zeichnet sich dadurch
aus, daß sie bei Erwärmung durch den Laser an den darunterliegenden Zellen haftet. Der
Laser ermöglicht durch die präzise Positionierung eine punktgenaue lokale Erwärmung der
Folie. Durch die definierte Energiezufuhr wird die thermische Belastung des Gewebes nieder
gehalten. Sind die Zellen durch den Laserbeschuß an die Folie fixiert, kann diese abgezogen
werden. Nur dort, wo der Laserstrahl zuvor auf die Folie getroffen ist, haftet die Zellschicht
des Gewebeschnitts auf der Folie und wird aus dem Zellverband gelöst. Durch Spülen der
Folie mit einem entsprechenden Puffer lassen sich die Zellen wieder ablösen und stehen für
weitere Experimente zur Verfügung.
4.2 Vergleich der verwendeten Gewebe bezüglich ihrer embryonalen
Entwicklung
Neben der Notwendigkeit, die Reinheit der Proben zu gewährleisten, besteht die größte
Schwierigkeit darin, die korrespondierenden Gewebe, das heißt Ovarialkarzinomgewebe und
gesundes Ovarepithel einer Patientin, zu erhalten.
Die gewünschten „gesunden“ Gewebe können nicht bereitgestellt werden, da bei den
Patientinnen entweder der potentielle Wunsch nach Kindern besteht oder aber die Ovarien
bereits stark vernarbt sind.
Wird das Ovarialkarzinom beispielsweise in einem sehr frühen Stadium festgestellt, kommt
nur eine eingeschränkt radikale Operation in Betracht, bei der das gesunde Ovar nicht
entnommen wird. Dies trifft besonders dann zu, wenn es sich um junge Frauen handelt, bei
denen ein Kinderwunsch vorhanden ist.
Erfolgt die Operation in einem späteren Stadium, werden neben dem Uterus beide Ovarien
und Tuben sowie alle weiteren befallenen Nachbarorgane wie Darm oder Blase entfernt.
Da es sich jedoch bei den von diesem Tumortyp betroffenen Patientinnen in der Regel um
Frauen im fortgeschrittenen Alter handelt, bei denen das Epithel des gesunden Eierstocks
durch kontinuierliche Ovulationen stark geschädigt ist, so daß keine Abstriche hergestellt
werden können, ist auch in diesem Fall kein verwertbares gesundes Gewebe erhältlich.
Um dennoch das Genexpressionsmuster dieses Karzinomtyps untersuchen zu können,
wurde ein Kompromiß eingegangen, bei dem Gewebe gleicher embryonaler Abstammung
miteinander
verglichen
werden.
Hierzu
wurde
in
Absprache
der
klinischen
Kooperationspartner bereits vor Beginn meiner Arbeit das Epithel der Tube als Referenz zum
Ovarialkarzinomgewebe hinzugezogen.
Nach eingehender Literaturrecherche konnte ich jedoch feststellen, daß die embryologische
Entwicklung von Ovar und Ovidukt teilweise voneinander abweicht (siehe Kapitel 5.1).
51
ERGEBNISSE
Für unsere Arbeitet bedeutet dies, daß nur der oberste Teil des Oviducts, der vom
Coelomepithel abstammt, mit dem Ovar verglichen werden kann. Der untere Teil, der ein
Verschmelzungsprodukt von Müllerschem- mit Wolffschem Gang ist, also auch Züge des
Mesonephros trägt, darf nicht mit dem Oberflächenepithel des Ovars verglichen werden.
Nachdem diese Tatsache und die Konsequenz für unsere Arbeit aufgezeigt waren, wurde
nur der oberste Teil des Eileiters, der ausschließlich vom Coelomepithel abstammt, von
unseren klinischen Kooperationspartnern der Universtitäts-Frauenkliniken Heidelberg und
Tübingen asserviert.
4.3 Vergleich unterschiedlicher Methoden zur Erfassung der Expressionsmuster von Geweben
Für die Erfassung der Genexpressionsmuster bei der Karzinogenese des Ovars ist neben
der Wahl der Vergleichsgewebe auch die Methode für die Feststellung einer Veränderung im
Expressionsmuster von entscheidender Bedeutung. Als Methoden stehen dazu die
subtraktive Hybridisierung und das Differential Display zur Verfügung.
Die subtraktive Hybridisierung zweier Zell- oder Gewebepopulationen ist auf unterschiedliche
Weise
möglich.
Man
unterscheidet
zwischen
physikalischen
Trenntechniken,
wie
beispielsweise durch Biotin/Streptavidin, und positiver PCR-Selektion. Die positive PCRSelektion liefert etwas verläßlichere Ergebnisse (Lisitsyn et al., 1993) und erlaubt das
Arbeiten mit geringen Mengen an Ausgangsmaterial (Sagerström et al., 1997). Aus diesen
Gründen fiel meine Entscheidung zugunsten der Arbeit mit der positiven PCR-Selektion als
der subtraktiven Hybridisierungsmethode der Wahl, die im folgenden vereinfacht als
subtraktive Hybridisierung bezeichnet wird, und der Arbeit mit dem Differential Display.
Zu Beginn ist die Vorgehensweise bei beiden Methoden zunächst identisch. Aus zwei
unterschiedlichen Gewebe- oder Zellpopulationen, hier als Tester und Driver bezeichnet,
wird die Gesamt-RNA isoliert. Danach erfolgt die reverse Transkription der mRNAs, wobei
die daraus resultierenden cDNAs in einer anschließenden PCR amplifiziert werden. Ab
diesem Schritt unterscheiden sich beide Methoden.
Bei der subtraktiven Hybridisierung (siehe Kapitel 3.7) werden die cDNAs beider
Zellpopulationen denaturiert. Die einzelsträngigen DNAs von Tester und Driver werden
vereinigt, wobei die Driver cDNA im Überschuß vorliegt, so daß die Sequenzen, die beiden
Populationen gemein sind, miteinander hybridisieren können. Die einzelsträngigen Tester
DNAs, die in der Driver-Population kein Gegenstück finden, werden amplifiziert und kloniert.
Beim Differential Display hingegen erfolgt nach der Amplifikation durch eine PCR die
Auftrennung der markierten cDNA-Populationen in einem denaturierenden Sequenzgel.
52
ERGEBNISSE
Signifikante Banden beider Populationen werden aus dem Gel ausgeschnitten und die darin
enthaltene DNA vermehrt und kloniert.
Da beide Methoden deutliche Vor- und Nachteile besitzen, aber die Methode des Differential
Displays bereits im Arbeitskreis etabliert war, beschäftigte ich mich zunächst mit der
subtraktiven Hybridisierung.
4.4 Durchführung der subtraktiven Hybridisierung mit
Ovarialkarzinomzellinien
Aufgrund der Limitierung geeigneter, zur Verfügung stehender Gewebeproben wurden in
Vorversuchen zwei Ovarialkarzinomzellinien (ES-2 und GG) eingesetzt, die mittels des PCRSELECT cDNA Subtraction Kits der Firma Clontech verglichen werden sollten. Dabei wurden
die Zellinien in gleicher Weise aufbereitet, wie es später mit den Patientenproben geschehen
sollte.
Die Durchführung der Subtraktion ist in Kapitel 3.7 beschrieben. Für eine Subtraktion werden
ca. 0,5-2 µg cDNA benötigt. Aus diesem Grund mußte vor der eigentlichen Subtraktion, wie
es später bei den Patientenproben erforderlich geworden wäre, die RNA anhand des
SMART PCR cDNA Synthesis Kits der Firma Clontech (siehe Kapitel 3.5) amplifiziert
werden. Dabei zeigte sich, daß die Herstellerangaben bezüglich der zu verwendenden RNAMengen nach oben korrigiert werden mußten. Statt der angegebenen 0,5 µg mußten etwa
0,6-0,8 µg Gesamt-RNA pro Zellinie für die SMART PCR eingesetzt werden, da aus 500 ng
Gesamt-RNA nicht 1-3 µg, sondern lediglich etwa 850-1000 ng doppelsträngige cDNA
gebildet wurde.
Pro Zellinie wurden für die Subtraktion in einer Richtung jeweils acht Ansätze mit 100 ng
RNA eingesetzt. In der „Erststrang Synthese“ wurde die mRNA in cDNA umgeschrieben und
anschließend in der „long Distance“ PCR amplifiziert. Das Ergebnis ist in Abb.: 4.2 zu sehen.
Bei den stellvertretend für alle Ansätze, exemplarisch abgebildeten PCR-Produkten war eine
Zunahme der Intensität bei Erhöhung der Zyklenanzahl zu verzeichnen, wobei etwa bei 20
Zyklen das Optimum für die Subtraktion erreicht war. Weiterhin waren die Intensitäten der
Signale bei gleicher Zyklenanzahl in den Proben ES-2 und GG gleich. Dies bedeutete eine
vergleichbare Effizienz der PCR der beiden Ansätze, die das Ergebnis aller Ansätze
widerspiegelte.
53
ERGEBNISSE
Abb.: 4.2 Elektrophoretische Auftrennung von PCR-Produkten, die in der subtraktiven
Hybridisierung eingesetzt wurden.
Die mRNAs der Ovarialkarzinomzellinien ES-2 und GG waren mit Hilfe des SMART PCR cDNA
Synthesis Kits revers transkribiert und ihre cDNAs in einer PCR vermehrt worden. Die PCR verlief
über 15, 18, 21 und 24 Zyklen, damit eine für die subtraktive Hybridisierung optimale Amplifikation
bestimmt werden konnte. Das Optimum war bei etwa 20 Zyklen erreicht. Die Intensitäten der Signale
waren in allen Proben gleich, was für die vergleichbare Effizienz der PCR in den Ansätzen sprach.
Aufgrund des Optimums bei 20 Zyklen wurden die restlichen Proben der gleichen
Zyklenanzahl unterworfen und nach der PCR die cDNA der Zellinien miteinander vereinigt.
Die Aufreinigung der DNA erfolgte mit Hilfe von CHROMA-SPINTM-1000 Säulen, von denen
drei Stück pro Zellinie eingesetzt wurden. Anschließend wurden die Proben erneut vereinigt
und für die Ligation mit den entsprechenden Adaptoren mit RsaI hydrolysiert. Das Ergebnis
des Restriktionsansatzes wurde durch Agarose-Gelelektrophorese überprüft und ist in Abb.:
4.3 dargestellt. Beim Vergleich der über die Säulen gereinigten, nicht fragmentierten DNA mit
der fragmentierten DNA war eine deutliche Verschiebung der DNA-Größe nach unten zu
beobachten.
54
ERGEBNISSE
Abb.: 4.3 Überprüfung der Restriktionsendonuklease-Hydrolyse mit RsaI.
Bei den unfragmentierten Proben (ES-2 cDNA und GG cDNA) befand sich die DNA hauptsächlich in
einem Bereich von etwa 500-1500 bp, in den mit RsaI fragmentierten Ansätzen überwiegend in einem
Bereich von 400-1000 bp.
Mittels des QIAquick PCR Purification Kits der Firma Qiagen wurde die RsaI hydrolysierte
DNA gereinigt (Kapitel 3.23).
Anschließend konnten die entsprechenden Adaptoren 1 und 2 mit der Tester DNA (hier
Zellinie GG) ligiert werden. An dieser Stelle erfolgte keine Ligation der Adaptoren mit Zellinie
ES, da lediglich in einer Richtung subtrahiert wurde.
Die Überprüfung der Ligationseffizienz erfolgte, nach Inaktivierung der Ligase, durch PCR.
Beide Tester-Populationen wurden in jeweils zwei PCR-Ansätzen eingesetzt. In einem
Ansatz wurden Primer, die mit Sequenzen eines Haushaltsgens, der Glyceraldehyd-3Phosphat-Dehydrogenase (G3PDH), hybridisierten, zugesetzt. Man erwartete in diesem Fall
ein Signal bei etwa 0,5 kb. In dem anderen Ansatz amplifizierten Primer ein Fragment,
welches von dem G3PDH 3‘-Primer und dem PCR Primer 1, der zu dem 5‘-Ende der
Adaptoren komplementär ist, erkannt wurde. Dort sollte ein Signal auf Höhe von 0,75 kb
sichtbar werden, dessen Intensität ähnlich dem des Haushaltsgens sein sollte, falls die
Ligationseffizienz etwa 25% betrug. In Abb.: 4.4 ist das Ergebnis der PCR zu sehen.
55
ERGEBNISSE
Abb.: 4.4 Überprüfung der Ligationseffizienz durch PCR.
PCR-Produkte, die bei Verwendung des 3‘- und 5‘-G3PDH-Primers entstanden, zeigten eine Bande
bei etwa 0,5 kb. Durch den Vergleich der Intensität dieser Bande mit der Bande bei etwa 0,75 kb in
den Ansätzen mit dem G3PDH 3‘-Primer und dem Primer 1 bzw. 2 konnte die Ligationseffizienz
abgeschätzt werden. Das Auftreten einer zusätzlichen Bande bei etwa 430 bp blieb ungeklärt.
Erwartungsgemäß war bei der PCR mit den beiden G3PDH-Primern eine Bande auf der
entsprechenden Höhe zu erkennen. Völlig überraschend erschien jedoch zu dem bei 0,75 kb
erwarteten Signal ein zusätzliches bei etwa 430 bp. Auch nach Anfrage bei der
Herstellerfirma ließ sich nicht klären, weshalb dieses weitere Fragment amplifiziert wurde.
Laut Firmenauskunft trat dieses Phänomen häufiger auf, die Ursache dafür wurde aber bis
dato nicht untersucht. Eine eigene Datenbankanalyse mit Husar erbrachte keine Klärung des
Sachverhalts.
Aufgrund der vergleichbaren Intensitäten des Haushaltsgen- und des 750 bp-Fragments
erfolgten erste und zweite Hybridisierung von Tester und Driver cDNA. Zuvor wurde eine
geringe Menge aus beiden Ligationsansätzen entnommen und vermischt. Diese Mischung
diente im späteren Verlauf als unsubtrahierte Tester-Kontrolle. Die Methode ist in Kapitel 3.7
detailliert beschrieben, eine schematische Übersicht der subtraktiven Hybridisierungs-PCRs
ist in Abb.: 3.1 dargestellt.
In der, sich an die zweite Hybridisierung anschließenden, ersten PCR wurden die Enden der
doppelsträngigen cDNAs durch die Polymerase aufgefüllt und die doppelsträngigen Tester
cDNAs amplifiziert. Dabei handelte es sich hauptsächlich um Tester cDNA mit zwei
56
ERGEBNISSE
verschiedenen Adaptoren, d.h. die in Zellinie ES und GG unterschiedlich exprimierten
cDNAs. Die zweite, nested, PCR diente der Anreicherung der differentiell exprimierten
Sequenzen und der Verminderung des Hintergrundes.
Die Ergebnisse von erster und zweiter PCR wurden durch Agarose-Gelelektrophorese
überprüft. Abb.: 4.5 zeigt das Ergebnis der zweiten PCR.
Abb.: 4.5 Elektrophoretische Trennung der Produkte von erster und zweiter PCR.
Deutliche Unterschiede waren zwischen den PCR-Produkten der subtrahierten bzw. unsubtrahierten
Tester-Kontrolle zu sehen. Dies sprach für eine erfolgreiche Subtraktion. Die Negativkontrolle zeigte
kein Signal, in der Positivkontrolle waren mehrere Banden zu sehen. Sie diente lediglich zur
Überprüfung der PCR-Bestandteile.
Die deutlich erkennbaren Unterschiede zwischen der subtrahierten Zellinien DNA und der
unsubtrahierten Tester-Kontrolle (cDNA von GG ligiert mit beiden Adaptoren) wiesen auf
erfolgreiche Subtraktionen und PCRs hin. Eine zusätzliche Probe, die alle PCRKomponenten mit Ausnahme von DNA enthielt, fungierte als Negativkontrolle und zeigte kein
Signal. Als PCR-Positivkontrolle diente die gelieferte subtrahierte cDNA. Im Vergleich
zeigten subtrahierte DNA und Positivkontrolle Signale im höhermolekularen Bereich, was für
die Qualität der Ausgangs-RNAs sprach. Ebenso war der Gehalt der experimentell
gewonnenen subtrahierten DNA vergleichbar mit der Kontrolle.
Die Anreicherung von unterschiedlich exprimierten Genen nach Subtraktion kann durch PCR
analysiert werden. Dabei geht man von der Annahme aus, daß nach erfolgreicher
Subtraktion alle DNAs, die in beiden Zellinien in vergleichbaren Mengen vorkommen,
reduziert werden. Im Gegensatz dazu sollen Tester DNAs, die keine komplementären
Sequenzen im Driver besitzen, exponentiell vermehrt werden und deshalb in größeren
Mengen vorliegen. Werden nun sowohl subtrahierte als auch unsubtrahierte DNA in einer
PCR eingesetzt, bei der Primer für eine Matrize verwendet werden, die ursprünglich in
57
ERGEBNISSE
beiden Zellinien in gleicher Menge vorliegen, erwartet man bei der subtrahierten DNA sehr
viel später ein Signal als bei der unsubtrahierten.
Die Abschätzung der Effizienz der Subtraktion erfolgte in diesem Versuch anhand des
Haushaltsgens
Glyceraldehyd-3-Phosphatdehydrogenase.
Aufgrund
mangelnder
Informationen, welche Gene in beiden Zellinien unterschiedlich exprimiert sind, wurden keine
Analysen diesbezüglich durchgeführt. Das Ergebnis der PCR ist in Abb.: 4.6 gezeigt.
Abb.: 4.6 Abschätzung der Subtraktionseffizienz.
Die cDNAs von subtrahierten und unsubtrahierten Proben waren mit den 5‘- und 3‘-G3PDH-Primern in
einer PCR eingesetzt worden. Die PCR verlief über 18, 23, 28 und 33 Zyklen. Bei der subtrahierten
cDNA war ein Signal bei 33 Zyklen zu erkennen, in der unsubtrahierten cDNA dagegen bereits bei 23
Zyklen. Geht man von der Annahme aus, daß nach erfolgreicher Subtraktion alle DNAs, die in beiden
Zellinien in vergleichbaren Mengen vorkommen, reduziert werden, ist dies ein Beweis für die
erfolgreiche Subtraktion. Bei 33 Zyklen erschien in der unsubtrahierten Probe eine zusätzliche
unspezifische Bande.
Bei der Agarose-Gelelektrophorese waren in den unsubtrahierten Proben mit geringerer
Anzahl an Zyklen Banden entsprechender Größe zu verzeichnen, was für die erfolgreiche
Durchführung der Subtraktion sprach.
Trotz dieses Erfolges zeigten sich Probleme und Kritikpunkte bereits während der Arbeit mit
dieser Methode. Zunächst bestand das Hauptproblem darin, die exakte Ausgangsmenge an
Gesamt-RNA zu bestimmen.
Wird die Menge der einzusetzenden RNA vor Beginn der Subtraktion unzureichend
bestimmt, kann dies zu falschen Ergebnissen führen. So verhindert die zweifach höhere
Expression
eines
Haushaltsgens
dessen
effiziente
Subtraktion.
Im
Fall
der
Ovarialkarzinomzellinien war die verläßliche Mengenbestimmung kein größeres Problem, da
ausreichende Mengen an RNA zur Verfügung standen. Sie konnte ohne weiteres UVphotometrisch und durch Abschätzen nach Auftragen auf ein Agarosegel bestimmt werden.
58
ERGEBNISSE
Bei den Patientenproben war die Anwendung dieser Verfahren nicht möglich. Die isolierten
RNA-Mengen waren insbesondere beim Tubenepithel so gering (häufig etwa 1-2 µg), daß
nach Bestimmung mit den herkömmlichen Methoden nichts mehr für die eigentliche
Subtraktion verblieben wäre.
Nach eingehender Suche fand ich eine Möglichkeit, die Konzentration mit geringen RNAMengen zu bestimmen. Dabei war es ausreichend, wenn der RNA ein Fluoreszenzfarbstoff
zugesetzt und spektrofluorometrisch vermessen wurde. Die Vorgehensweise ist unter Kapitel
3.3.2 beschrieben. Die Detektionsgrenze lag dabei bei ca. 4 ng/ml und somit deutlich unter
der bei den oben genannten Verfahren. Damit war es möglich, auch mit geringsten Mengen
an RNA verläßliche Mengenbestimmungen durchzuführen.
Der größte Kritikpunkt, der letztendlich die Entscheidung zugunsten der Methode des
Differential Displays lieferte, liegt in der Notwendigkeit, die cDNA vor Subtraktion zusätzlich
zu amplifizieren. Zwar kann die cDNA in ausreichenden Mengen vermehrt und so die
subtraktive Hybridisierung prinzipiell durchgeführt werden, doch relativiert die Selektivität der
Methode diese Vorgehensweise. Aspekte dazu werden in Kapitel 5.2 diskutiert.
Aus diesem Grund wurde im weiteren Verlauf der Arbeit diese Methode nicht weiter
verwendet.
4.5 Analyse der Genexpression mittels Differential Display
Da aufgrund bedeutender Nachteile die Methode der subtraktiven Hybridisierung nicht
angewandt wurde, war die bereits im Arbeitskreis etablierte Methode des Differential
Displays die Methode der Wahl. Die Vorgehensweise des Differential Displays ist in Abb.: 3.2
schematisch dargestellt.
Beim Differential Display erfolgt als erstes die Isolierung der Gesamt-RNA aus den
Zellysaten. Die genaue Vorgehensweise der RNA-Isolierung ist in Kapitel 3.2 beschrieben.
4.5.1
Isolierung der RNA aus Geweben
Während meiner Arbeit wurde RNA aus Geweben von Patientin 21, 22 und 26 isoliert. Die
Mengen an Gesamt-RNA bei Patientin 21 und 22 betrugen weniger als 0,4 µg, weshalb mit
diesen Proben kein Differential Display durchgeführt werden konnte.
Aus den Geweben von Patientin 26 konnten größere Mengen an RNA gewonnen werden. Im
Tumorgewebe des Ovars waren dies 19 µg, im Epithel der Tube etwa 4,5 µg. Die
Bestimmung der RNA-Konzentrationen erfolgte mit Hilfe der Spektrofluorometerie (siehe
dazu Kapitel 3.3.2).
59
ERGEBNISSE
Um die Integrität der RNA zu überprüfen, wurde 1 µg der aus dem Tumorgewebe
extrahierten RNA auf einem Agarosegel aufgetrennt. Das Ergebnis der elektrophoretischen
Trennung zeigt Abb.: 4.7.
Abb.: 4.7 Überprüfung der Integrität der RNA aus dem
Tumorgewebe.
1µg der aus dem Tumorgewebe isolierten RNA wurde
elektrophoretisch getrennt. Auf Höhe von etwa 5 kb befand sich die
28S rRNA, auf Höhe von 1,9 kb die 18S rRNA. Es waren keine
Anzeichen einer Degradation wahrnehmbar.
Neben der erwarteten 28S und der 18S rRNA, die auf Höhe von 5,0 kb und 1,9 kb liefen,
waren keine Spuren von Degradation zu erkennen. Der Abbau hochmolekularer RNA wäre
durch eine Verschiebung der RNA in den unteren Gelbereich gekennzeichnet, der als diffuse
Bande wahrgenommen wird.
4.5.2
Hydrolyse der DNA und reverse Transkription der mRNA von Patientin 26
Nach Isolierung der RNA wurde die in den Proben enthaltene DNA durch DNase I abgebaut.
Damit wurde die Bildung falsch positiver Fragmente, die aufgrund von DNA-Rückständen
während einer Differential Display-PCR (DD-PCR) entstehen, verhindert. Pro Gewebetyp
wurden 4 µg RNA eingesetzt.
Anschließend erfolgte die reverse Transkription der mRNA in jeweils vier parallelen Ansätzen
mit den Ankerprimern VC und VG (siehe Kapitel 3.6.1). Dies half, zufällige Abweichungen in
der reversen Transkription zu erkennen und Fehlerquellen bei der DD-PCR auszuschließen.
Die
Sequenz
der
Ankerprimer
Desoxythymidinphosphaten,
die
(Kapitel
sich
an
2.12)
den
besteht
für
die
hauptsächlich
mRNA
der
aus
zwölf
Eukaryonten
charakteristischen Poly-Adenylierungsschwanz anlagern und der reversen Transkriptase als
Primer zur Verfügung stehen. Anschließend konnte die cDNA verlängert werden.
4.5.3
Differential Display-PCR mit cDNA von Patientin 26
Ziel der DD-PCR ist es, mit den Anker-/Arbitraryprimerkombinationen möglichst alle
exprimierten mRNAs der Ovarzellen und somit auch alle unterschiedlich exprimierten
mRNAs des Tumors zu erfassen. Bei den Arbitraryprimern handelt es sich um synthetische
Oligonukleotide mit einer Länge von 10 bp und einem Gehalt von etwa 50% GC, was in etwa
60
ERGEBNISSE
der Zusammensetzung der humanen DNA entspricht. Die Basen-Abfolge der Arbitraryprimer
wurde unter Wahrung der oben aufgeführten Voraussetzungen von der Firma Genosys,
Ismaning,
statistisch
ausgewählt
(„willkürliche
Primer“).
Damit
alle
unterschiedlich
exprimierten mRNAs erfaßt werden können, sollten theoretisch etwa 50-60 verschiedene
Arbitrary-/Ankerprimerkombinationen ausreichen. In der Praxis zeigte sich jedoch, daß diese
Primer bei weitem nicht das gesamte Spektrum abdecken (Ledakis et al., 1998) und die
Diskussion, wie viele Arbitraryprimer tatsächlich für die Untersuchung der gesamten
Information der Ovarzellen benötigt werden, bisher rein theoretischer Natur war. Bislang
konnten in keinem Fall ausreichende Mengen an RNA isoliert werden, um annähernd die
theoretische Anzahl der Primer zum Einsatz zu bringen.
Bei den Proben von Patientin 26 erfolgte die Differential Display-PCR mit beiden
Ankerprimern und jeweils 20 Arbitraryprimern in 4 parallelen Ansätzen. Das heißt, insgesamt
wurden 40 Primerkombinationen verwendet. Für jede Probe wurden vier parallele Ansätze
durchgeführt, um zufällige Veränderungen und Kontaminationen von der Analyse
auszuschließen.
Das Expressionsmuster wurde autoradiographisch bestimmt. Hierzu wurde die Hälfte der
PCR-Produkte auf ein 6%iges denaturierendes Polyacrylamidgel (PAGE) aufgetragen und
elektrophoretisch aufgetrennt (siehe Kapitel 3.9). Nach Exposition eines Röntgenfilms für
etwa 24 h konnten Veränderungen im Genexpressionsmuster beobachtet werden.
Signifikante Banden wurden aus den Gelen ausgeschnitten und die cDNA eluiert (Kapitel
3.10). Zwei Beispiele sind in Abb.: 4.8 zu sehen. Bei beiden Fragmenten schlossen sich
weitere Experimente an, die in späteren Kapiteln beschrieben werden. Insgesamt wurden
etwa 35 Banden ausgeschnitten und weiterverfolgt.
Abb.: 4.8 Ausschnitte von PAGEs mit signifikanten Unterschieden.
Aus jeweils zwei von vier Spuren wurden die markierten Banden ausgeschnitten. Es handelte sich um
die Fragmente von 26C/C9/2 und 26C/G8/2. Die Nomenklatur, die bereits in Kapitel 3.10 erwähnt ist,
erklärt sich für die hier abgebildeten Unterschiede mit: Nummer der Patientin (Patientin 26),
Gewebetyp (in beiden befanden sich die Banden nur im Tumorgewebe des Ovars), Ankerprimer (VC
bzw. VG), Arbitraryprimer (9 bzw. 8), Bandennummer von oben gesehen (in beiden Fällen die zweite).
61
ERGEBNISSE
4.5.4
Reamplifikation unterschiedlich exprimierter Fragmente
Es konnten zahlreiche cDNA-Fragmente durch PCR vermehrt werden. Das Ergebnis einer
Reamplifikation ist anhand der bereits oben genannten Beispiele in Abb.: 4.9 zu sehen.
Abb.: 4.9 Reamplifikationsprodukte der Fragmente 26C/C9/2 und 26C/G8/2.
Bei der Reamplifikation der DNA aus den eluierten Banden konnten beim 26C/C9/2-Fragment zwei
verschiedene DNAs nachgewiesen werden, wobei die Bande bei ca. 320 bp mit der erwarteten Größe
aus der DD-PCR übereinstimmte. Die zweite Bande von etwa 180 bp war unspezifisch. Auf Höhe von
etwa 380 bp befand sich bei der entsprechenden Reamplifikation eine Bande, die dem Fragment
26C/G8/2 aus der DD-PCR entsprach.
Bei den Fragmenten, bei denen eine Reamplifikation nicht gelang, waren häufig zu hohe
Harnstoff-Konzentrationen oder geringe cDNA-Mengen der Grund. Die Menge des
Harnstoffs ist von der Größe der ausgeschnittenen Banden abhängig. Deshalb sollte darauf
geachtet werden, daß von der Umgebung der Bande so wenig wie möglich in den Ansatz
gelangt, was nicht immer möglich war. Die zweite Annahme, nach der zuwenig cDNA eluiert
wurde, konnte durch erneutes Ausschneiden der verbliebenen Banden überprüft werden,
brachte aber nicht immer den gewünschten Erfolg.
Trotz dieser Einschränkungen konnten bei etwa 30 ausgeschnittenen Banden die cDNAs
durch PCR vermehrt werden.
4.5.5
Klonierung von cDNA-Fragmenten
Die Voraussetzung für die Klonierung in den pCRII Topo TA Vektor wurde durch die in der
PCR verwendeten Taq-DNA-Polymerase geschaffen. Diese verursacht 3‘-AdenosinÜberhänge, die zur Klonierung in einen Vektor mit 3‘-Thymidin-Überhang genutzt werden
können. Obwohl die Voraussetzung durch die Reamplifikations-PCR geschaffen waren,
konnten einige interessant erscheinende cDNAs nicht kloniert werden. Dies war teilweise mit
62
ERGEBNISSE
dem Auftreten mehrerer Banden in einem PCR-Ansatz zu erklären. Dabei ließen sich einige
der als Mehrfachbanden auftretenden Proben aufgrund ihrer schwachen Intensität auf dem
Agarosegel nicht als Einzelbande ausschneiden. Bei anderen Mehrfachbanden war das
Ausschneiden aus dem Gel möglich, die Mengen nach Aufreinigung waren jedoch zu gering,
um für eine Klonierung erfolgreich eingesetzt zu werden.
Von den etwa 30 reamplifizierten DNA-Fragmenten wurden 25 erfolgreich in den pCRII
Vektor kloniert und in Bakterien vermehrt.
Pro cDNA-Fragment wurden fünf bis zehn Bakterienklone vereinzelt und deren Plasmid-DNA
isoliert. Insgesamt waren es etwa 300 Plasmid-Minipräparationen. Die Durchführung ist in
Kapitel 3.16 nachzulesen. Nach Restriktionsanalyse mit der Endonuklease EcoRI, die eine
Sequenz in der Umgebung der Klonierungsstelle erkennt und schneidet, wurden Fragmente
mit gleicher Größe wie auf dem DD-PAGE erwartet. Einige Klone, die diese Merkmale
zeigten, wurden an Andreas Hunziker (Abteilung Prof. Franke) zur Sequenzierung
weitergeleitet. Exemplarisch für die EcoRI geschnittenen Plasmid-Minipräparationen sind
hier Klone des Fragments 26C/G8/2 in Abb.: 4.10 dargestellt.
Abb.: 4.10 Restriktionsverdauung des rekombinanten pCRII Topo TA Vektors mit EcoRI.
In den Spuren der Klone 1-5 (#1-5) wurden die rekombinanten pCRII Topo TA Vektoren, auf die zuvor
die Restriktionsendonuklease EcoRI einwirkte, aufgetragen. Alle Inserts entsprachen mit etwa 380 bp
der Größe des ursprünglichen DD-PCR Fragments von 26C/G8/2.
63
ERGEBNISSE
Wie sich zu diesem Zeitpunkt herausstellte, enthielten nur sehr wenige Banden einheitliche
cDNA-Fragmente. Diese Beobachtung wurde auch von anderen Forschergruppen
beschrieben (Smith et al., 1997). Da die geringen mRNA-Mengen die sofortige Überprüfung
der Unterschiede durch Northern Blot Hybridisierung mit RNA derselben Patientin nicht
ermöglichten, sollte ursprünglich nur mit den Ergebnissen von einheitlichen Banden
weitergearbeitet werden. Dies hätte die zu untersuchenden Fragmente zu stark
eingeschränkt und wäre darüber hinaus keine Garantie dafür gewesen, daß diese DNA an
der Entstehung der Unterschiede im Sequenzgel beteiligt war. Deshalb wurden alle 120
unterschiedlichen Sequenzen in den Datenbanken mit Hilfe des BLASTN-Algorithmus des
HUSAR (Heidelberg Unix Sequence Analysis Resources) untersucht.
4.5.6
Datenbankanalyse der differentiell exprimierten Fragmente und Zusammenfassung der wichtigsten Unterschiede aus Geweben von Patientin 26
Nach Datenbankanalyse konnten die Sequenzen in vier Klassen eingeteilt werden:
Bei der ersten Klasse handelte es sich um Sequenzen, die in einer cDNA enthalten waren,
die für ein bereits bekanntes Protein codierten. Dazu gehörten beispielsweise das K-ras, ein
c-myc bindendes Protein oder eine kleine GTPase, zu der bislang keine weiteren
Publikationen vorliegen (siehe Tab.: 4.1 Fragment 26C/C1/1 und 26C/C9/1). In einer zweiten
Klasse konnten Sequenzen, die homolog zu Expressed Sequence Tags (ESTs) waren, das
Protein aber noch unbekannt war, zusammengefaßt werden. Zu diesen zählte die
überwiegende Zahl aller Sequenzen (beispielsweise 26C/C9/2 oder 26C/G10/1 in Tab.: 4.1).
Alle, bei denen noch keine Sequenzen in den Datenbanken vorlagen oder es nur schwach
homologe Strukturen zu anderen Spezies gab, wurden in einer dritten Klasse
zusammengefaßt. Neben Sequenzen, die diesen drei vorstehenden Gruppen zugeteilt
wurden, gab es zahlreiche Sequenzen, die Homologien zu ribosomalen oder mitochondrialen
Proteinen aufwiesen. Diese Sequenzen wurden der vierten Klasse zugeordnet und nicht
weiter verfolgt.
Eine Zusammenstellung der wichtigsten Ergebnisse des Differential Displays mit Geweben
von Patientin 26 liefert Tab.: 4.1
64
ERGEBNISSE
Fragment-
Anzahl der se-
Primerkombi-
Homologien mit Proteinen/ESTs
bezeichnung
quenzierten Klone
nation
26C/C1/1
insgesamt 8:
Anker C mit
Klon 2+4+8:
Klon 2+4+8
Arbitrary 1
bzw. Klon 6+10
humane mRNA für ein c-myc bindendes
Protein
identisch
Klon 6+10:
humane K-ras Onkongen-mRNA
26C/C9/1
insgesamt 7:
Anker C mit
Klon 3+5:
Klon 3+5
Arbitrary 9
bzw. 8+9
mRNA mit Homologien zu einer bislang
unpublizierten kleinen GTPase
identisch
Klon 8+9:
BAC-Klone
Klon 16:
humane Kinectin mRNA
26C/C9/2
insgesamt 4:
Anker C mit
Klon 1+4+22+24:
alle identisch
Arbitrary 1
zahlreiche ESTs
Arbitrary 8 mit
Arbitrary 8
Klon 1+2:
Die Unterschiede
wurden zusätzlich in
Geweben von Patientin
18 gefunden
26C/G8/2
insgesamt 9:
davon 6 identisch
Die Unterschiede
wurden zusätzlich in
Geweben von Patientin
31 gefunden
26C/G10/1
insgesamt 5:
Klon 1+3+7+8 identisch
genomische Sequenz
Klon 3:
ESTs mit schwacher Homologie zum
maternalen Effekt Protein STAUFEN
Anker G mit
Arbitrary 10
Klon 1+3+7+8:
Anker G mit
Arbitrary 16
Klon 1+3+4:
zahlreiche ESTs
Die Sequenz von Klon
1+3+7+8 wurde
zusätzlich in Geweben
von Patientin 31
gefunden
26N/G16/1
insgesamt 3,
alle identisch
ESTs mit schwacher Homologie zu hRabin3
Tab.: 4.1 Zusammenfassung der wichtigsten Ergebnisses des Differential Displays mit
Geweben von Patientin 26.
65
ERGEBNISSE
4.5.7
Etablierung der Methode der semiquantitativen bzw. quantitativen PCR zur
Überprüfung der Unterschiede
Da die cDNA-Fragmente einer Bande in den überwiegenden Fällen sehr heterogen waren
und eine Überprüfung der Unterschiede durch die Northern Blot Hybridisierung mit RNA
derselben Patientin, wie oben erwähnt, nicht möglich war, mußte eine andere Möglichkeit
eingesetzt werden, um die richtige cDNA zu ermitteln. Die Methode der Wahl fiel auf die
semiquantitative PCR, die von mir in Zusammenarbeit mit Dr. Hans-Peter Zimmermann in
unserer Arbeitsgruppe etabliert wurde (siehe Kapitel 3.20).
In einer semiquantitativen bzw. quantitativen PCR werden von beiden Gewebetypen
äquivalente Mengen an cDNA verwendet. Für die Reaktion werden die beiden
genspezifischen Primer eingesetzt, die für die Vermehrung der gesuchten cDNA benötigt
werden. Die Intensitäten der Banden des Tumor- und Normalgewebes können anschließend
entweder in einem Agarosegel miteinander verglichen und abgeschätzt oder mit Hilfe des
Agilent 2100 Bioanalyzers der Firma Agilent Technologies (Waldbronn) quantifiziert werden.
Im allgemeinen werden bestimmte Haushaltsgene wie ß-Actin oder G3PDH zur
Normalisierung der Proben herangezogen, d.h. die Menge der eingesetzten cDNA richtet
sich nach den Intensitäten der Signale nach PCR. Sind die Signale in beiden Ansätzen
vergleichbar, kann in der Regel davon ausgegangen werden, daß die Mengen der
eingesetzten Matrizen gleich sind. Im unserem speziellen Fall war eine Normalisierung der
cDNA-Mengen aus Tumor- und Normalgewebe nicht möglich, da bislang kein Gen gefunden
wurde, bei dem mit Sicherheit die Mengen der exprimierten Haushaltsgene gleich sind.
Insofern war zunächst die Bestimmung der äquivalenten Mengen an cDNA problematisch.
In
einigen
anderen
Fällen
wird
über
die
Gesamt-RNA
normalisiert,
wobei
die
Signalintensitäten verschiedener Gewebe auf einem Agarosegel miteinander verglichen
werden. Da in unserem Fall die RNA-Mengen extrem niedrig waren, kam auch diese
Möglichkeit nicht in Betracht. Prinzipiell lag jedoch das Ergebnis eines solchen Vergleichs
auf cDNA-Ebene durch die DD-Gele vor. Daraus konnte geschlossen werden, daß keine
Normalisierung über Haushaltsgene erforderlich war, wenn die Proben im gleichen
Verhältnis wie bei der DD-PCR eingesetzt wurden.
Drei der interessantesten Proben wurden durch PCR mit cDNA mehrerer Patientinnen und
Ovarialkarzinomzellinien auf differentielle Expression hin untersucht und mit dem Agilent
2100 Bioanalyzer quantitativ ausgewertet. Ein Beispiel für die Auswertung ist in Abb.: 4.11 zu
sehen. Dabei handelt es sich um das Fragment 26C/C9/2, das ursprünglich in Patientin 26
und 18 im Tumorgewebe mit dem Ankerprimer C und dem Arbitraryprimer 9 amplifiziert
wurde.
66
ERGEBNISSE
67
ERGEBNISSE
Abb.: 4.11 Quantitative PCR zur Verifizierung der differentiellen Expression von 26C/C9/2.
In der Mitte oben ist ein virtuelles Gel (siehe Kapitel 3.20) mit den PCR-Produkten des 26C/C9/2Fragments dargestellt. Erwartungsgemäß wies die „Normalprobe“ von Patientin 18 (18N) in den
vergleichbaren Zyklen zur „Tumorprobe“ (18C) ein deutlich schwächeres Signal auf. Die zur
Quantifizierung herangezogenen Werte sind unter den „Peak-Abbildungen“ aufgeführt.
68
ERGEBNISSE
Neben einem virtuellen Gel lieferte das Gerät Daten zur Größe der Fragmente und zur
Konzentration, die für die Berechnung von Expressionsunterschieden herangezogen werden
können (siehe Tab.: 4.2).
Anzahl
der
Zyklen
Konzentration des
vermehrten Fragments in
der „Normalprobe“ von
Patientin 18 (18N)
Konzentration des
vermehrten Fragments in
der „Tumorprobe“ von
Patientin 18 (18C)
berechnetes Verhältnis
von „Tumor“- zu
„Normalprobe“
22
0,36 ng/µl
5,00 ng/µl
14
24
1,50 ng/µl
13,10 ng/µl
8,7
26
5,30 ng/µl
27,90 ng/µl
5,3
28
14,10 ng/µl
39,80 ng/µl
2,8
30
28,40 ng/µl
56,70 ng/µl
2,0
Tab.: 4.2 Berechnung der Expressionsunterschiede des Fragments 26C/C9/2 aus Geweben von
Patientin 18.
Wie erwartet, nahm die Konzentration der cDNA mit steigender Zyklenzahl zu, wobei in der
„Normalprobe“ eine exponentielle Zunahme bis zu etwa 5 ng/µl zu verzeichnen war.
Anschließend wurde die Konzentration der Fragmente nur noch verdoppelt, was auf das
allmähliche Erreichen der Plateau-Phase hindeutete. Diese Beobachtung konnte nicht durch
die Daten der „Tumorprobe“ unterstützt werden, da bereits im 22. Zyklus 5 ng/µl erreicht
waren. Bei dieser Zyklenanzahl konnten auch die größten Unterschiede zwischen beiden
Proben ermittelt werden. Die Konzentration des Amplifikats war in der „Tumorprobe“ um
etwa das 14fache erhöht und verifizierte damit die Ergebnisse der Differential Display PCR,
die mit den Proben von Patientin 18 erzielt wurden (vergleiche Kapitel 4.5.6).
Die Ergebnisse der quantitativen PCRs mit den drei Fragmenten 26C/C9/2, 26C/G8/2 und
26C/G10/1 sind in Tab.: 4.3 zusammengestellt.
a)
26C/C9/2
Patientin
18
Patientin
24
Patientin
26
Patientin
30
Patientin
31
Patientin
46
Patientin
48
[T : N]
[T : N]
[T : N]
[T : N]
[T : N]
[T : N]
[T : N]
14
1,0
1,0
1,9
1,0
5,0
1,0
1,0
1,0
26C/G8/2
26C/G10/1
9,3
10
9,9
2,5
3,3
69
ERGEBNISSE
b)
Expressionsspiegel der Fragmente in Ovarialkarzinomzellinien
Zyklen
GG
ES-2
HEST
MDAH
2774
SK-OV-3
MT
NIH:
OVCAR-3
Caov-3
26C/C9/2
31
1,6
1,8
1,4
4,0
3,5
4,6
7,0
4,8
26C/G8/2
31
1,5
1,0
5,9
0,8
6,6
5,5
3,5
1,5
26C/G10/1
28
2,3
2,0
2,2
2,4
3,7
2,5
7,5
5,5
Tab.: 4.3 Ergebnisse der quantitativen PCRs der Fragmente 26C/C9/2, 26C/G8/2 und 26C/G10/1.
Die quantitativen PCRs dienten der Verifizierung der DD-PCR. a) Aufgelistet sind die Verhältnisse von
Tumor- zu Normal-cDNA aus den Geweben von Patientin 18, 24, 26, 30, 31, 46 und 48. Leere Felder
kennzeichnen nicht durchgeführte PCRs. Grund dafür war mangelnde cDNA aus Gewebeproben.
b) Bei dem Fragment 26C/C9/2 ist der größte Unterschied (5fach) zwischen den
Ovarialkarzinomzellinien HEST und NIH:OVCAR-3 zu verzeichnen. Zwischen MDAH2774 und
SK-OV-3 liegt ein etwa 8,3facher Unterschied in der Expression des Fragments 26C/G8/2 vor. Der
Expressionsspiegel von 26C/G10/1 ist in den Zellinien GG, ES-2, HEST, MDAH2774 und MT etwa
gleich hoch. Dagegen ist die Expression in SK-OV-3 leicht erhöht, in Caov-3 ist sie doppelt und in
NIH:OVCAE3 ist sie 3fach so hoch.
Im Gegensatz zu den Ergebnissen der DD-PCR konnte kein Expressionsunterschied bei
dem Fragment 26C/C9/2 in Geweben von Patientin 26 festgestellt werden. Bei Patientin 18,
bei der dieses Fragment ebenfalls im Vorfeld in einer DD-PCR auffällig geworden war, ließ
sich der Unterschied anhand der quantitativen PCR bestätigen. Ebenso wiesen die
Gewebeproben von Patientin 30 und 46 veränderte Expressionen bezüglich 26C/C9/2 auf,
so daß ich im weiteren Verlauf Daten über dieses Fragment sammelte (siehe Kapitel 4.7).
Das Interesse an diesem Fragment verstärkte sich nach Durchführung weiterer PCRs mit
Ovarialkarzinomzellinien, bei denen ebenfalls Unterschiede bezüglich 26C/C9/2 auftraten.
Der deutlichste Unterschied bestand zwischen den Zellinien HEST und NIH:OVCAR-3
(5fach). Hintergrund für die Untersuchungen der Expression der Zellinien ist zum einen das
Interesse an dem spezifischen, im Patientengewebe gefundenen Unterschied (wird die
Matrize in allen Zellinien exprimiert?), zum anderen ist es aber auch der Versuch, ermittelte
Unterschiede mit einem bestimmten Tumortyp zu korrelieren. Dies würde es ermöglichen die
Tumoren einer Kategorie zuzuordnen und damit evtl. die Medikamentation der Patienten zu
optimieren.
Um
eine
solche
Typisierung
vornehmen
zu
können,
müssen
die
Hintergrunddaten der verwendeten Zellinien zugänglich sein. Dazu zählen beispielsweise,
welcher Art der Tumorbefall war, ob er stark oder schwach metastasierte, welche Organe
betroffen waren und ähnliches. Aus diesem Grund wurden zusätzlich zu den bei ATCC
erworbenen Zellinien auch Zellinien aus der Universitätsfrauenklinik Heidelberg, die dort aus
Ascites von Patientinnen mit Ovarialkarzinom gewonnen und kultiviert wurden, untersucht.
Bisher liegen unserer Arbeitsgruppe allerdings noch zu wenige Daten vor, um eine
eventuelle Korrelation herzustellen.
70
ERGEBNISSE
Deutliche Unterschiede in der quantitativen PCR waren auch bei Fragment 26C/G8/2
zwischen dem normalen Tubenepithel und dem veränderten Ovargewebe bei Patientin 26
und 31 zu erkennen. Dieses Ergebnis bestätigte die in der DD-PCR gewonnenen
Erkenntnisse, bei der in den Patientinnen 26 und 31 Unterschiede entdeckt wurden. Laut
quantitativer PCR handelte es sich um Expressionsunterschiede in einem Bereich von einer
Größenordnung (Faktor 10), weshalb wie bei 26C/C9/2 weiterführende Versuche gemacht
wurden (siehe Kapitel 4.8). Auch bei 26C/G8/2 lagen deutliche Unterschiede zwischen den
Zellinien vor. Die Ovarialkarzinomzellinie SK-OV-3 besaß eine ca. 9fach höhere Expression
als die Zellinie MDAH2774.
Bei Patientin 31, bei der wie in Patientin 26 ein Unterschied in 26C/G10/1 mit Hilfe einer DDPCR ermittelt worden war, lagen noch ausreichende cDNA-Mengen vor, so daß die
Überprüfung der Expression des Fragments 26C/G10/1 durch eine quantitative PCR erfolgen
konnte. Diese ergab eine etwa 3fach höhere Expression in der „Tumorprobe“, als dies bei
der Referenz der Fall war. Analog dieses Ergebnisses konnten in der cDNA von Patientin 18
und 30 Unterschiede ermittelt werden. Diese betrugen im Vergleich mit den Referenzen das
10- bzw. das 2,5fache. Die Zellinie NIH:OVCAR3 wies im Gegensatz zu der Mehrzahl der
übrigen Zellinien (GG, ES-2, HEST, MDAH2774 und MT) eine 3fach höhere Expression auf.
Aufgrund der Tatsache, daß sich von 25 erfolgreich klonierten Fragmenten nur ein Teil als
tatsächlich stärker differentiell exprimiert erwies, es sich also in den anderen Fällen um
falsch positive Klone handelte, wurde von mir in Abstimmung mit Dr. Hans-Peter
Zimmermann der Versuch unternommen, die Methode des bis dato angewandten Differential
Display zu modifizieren. Ziel der Modifizierung war, die Anzahl der falsch positiven Klone zu
vermindern. Zusätzlich sollte die Modifikation eine Verlängerung der cDNA-Fragmente und
eine Verminderung der Anker-Anker geprimten Banden bewirken.
4.6 Modifikation der Differential Display-Methode
Über die Optimierungsversuche der Methode des Differential Displays existierten zu diesem
Zeitpunkt zahlreiche Artikel, wovon einige ausgewählte Ansatzpunkte zur Verbesserung der
Methode als Anregung übernommen wurden. Dazu gehörten beispielsweise die Überprüfung
der Vollständigkeit der DNA-Hydrolyse (Liang et al.,1994) sowie die Veränderung der
Bedingungen der reversen Transkription und der DD-PCR (von der Kammer et al., 1999;
Linskens et al. 1998; Liang, 1998; Frost und Guggenheim 1999).
Im Einzelnen wurden wichtige Teilschritte der Differential Display Methode auf ihre
Zielsetzung, den theoretischen Ansatz der Arbeitsschritte und den bei der Etablierung der
Methoden zugrundeliegenden Annahmen überprüft. Anschließend wurde das Vorgehen im
Detail den speziellen Rahmenbedingungen angepaßt. In Summe ergab sich ein modifiziertes
71
ERGEBNISSE
Protokoll der Durchführung des Differential Displays, das in den Kapiteln 3.6.2 und 3.8.2
beschrieben ist. Durch dieses Vorgehen werden weniger falsch positive Klone gefunden, die
cDNA-Fragmente verlängert und die Zahl der Anker-Anker geprimten Banden verringert.
Die Vollständigkeit
der
DNA-Hydrolyse ist
eine
wichtige Voraussetzung,
da bei
unzureichender Degradation der DNA falsch positive Fragmente während der PCR
entstehen. Die Überprüfung der Hydrolyse erfolgte durch das Einsetzen der Gesamt-RNA
nach DNA-Verdau in die DD-PCR, ohne diese vorher revers zu transkribieren. Da auf dem
DD-Gel keine Banden zu beobachten waren (Daten hier nicht gezeigt), bestand kein
Handlungsbedarf bezüglich einer Veränderung der Hydrolysebedingungen.
Die Modifikation der reversen Transkription betraf ausschließlich die Primer-Konzentration
der Ankerprimer, von denen zuvor 6,25 µM eingesetzt und jetzt auf 2,5 µM reduziert wurden.
Diese Verminderung sollte auch die Häufigkeit der Anker-Anker geprimten cDNAs in der sich
anschließenden DD-PCR verringern.
In der DD-PCR wurden zahlreiche Komponenten verändert. Hierzu zählte die beliebig
gewählte Verlängerung der Anker- und der Arbitraryprimer um die Sequenzen GAATTCGCC
bzw. CGTGAATTC an ihrem 5‘-Ende, was den Vorteil erhöhter Annealingtemperaturen
(ursprünglich 42°C, nun 55°C) und damit größerer Spezifität bei der PCR begünstigen sollte.
Zusätzlich zur Erhöhung der Temperatur wurden die Elongationszeiten der unspezifischen
Zyklen von 1 min auf 5 min und der spezifischen Zyklen von 30 sec auf 1 min erhöht, um
eine Verlängerung der PCR-Produkte zu bewirken.
Aus dem selben Grund, wie bei der reversen Transkription, wurden die AnkerprimerKonzentrationen von 2,5 µM auf 1 µM reduziert, die Konzentrationen der Arbitraryprimer
wurden im Gegensatz dazu verdoppelt (von 0,5 µM auf 1 µM). Die Steigerung der dNTPKonzentration um das 2,5fache sollte die Limitierung der Reaktionen wegen der längeren
Elongationszeiten durch die dNTPs ausschließen. Zusätzlich wurde die Anzahl der PCRZyklen von 40 unspezifischen auf insgesamt 37 Zyklen (2 unspezifische und 35 spezifische)
reduziert. Dies sollte ebenfalls die Spezifität erhöhen.
Die Ausschnitte von zwei DD-Gelen vor und nach Modifikation sind in Abb.: 4.12 gezeigt.
Hierbei handelt es sich um den Vergleich von „Tumor“- und „Normalproben“ der Patientin 26,
die mit dem Ankerprimer G und dem Arbitrayprimer 13 amplifiziert wurden (vor Modifikation)
und um den Vergleich der Ovarialkarzinomzellinien GG und MT, der in der PCR mit dem
gleichen Primer angestellt wurde (nach Modifikation).
72
ERGEBNISSE
Abb.: 4.12 Vergleich der DD-PCR Produkte vor und nach Modifikation.
In dem ersten Block sind DD-PCR Produkte aus Geweben von Patientin 26 aufgetragen. Dabei
handelte es sich in den Spuren 1-4 um cDNA aus „Tumor“- in den Spuren 5-8 aus „Normal“-Gewebe.
Im zweiten Block wurden die DD-PCR Produkte der Zellinie GG (Spur 1-4) und MT (Spur 5-8)
aufgetragen. Anker-Anker geprimte Banden, die auf den vollständigen Gelen (hier sind nur
Ausschnitte gezeigt) in allen Spuren mit verschiedenen Primerkombinationen zu sehen waren, sind
mit Pfeilspitzen gekennzeichnet.
73
ERGEBNISSE
Dabei konnte auf den vollständigen Gelen als Ergebnis der durchgeführten Änderungen
beobachtet werden (aus dem Ausschnitt nicht ersichtlich), daß die Anzahl der Anker/Anker
geprimten Banden, die durchweg mit allen Anker-/Arbitraryprimerkombinationen auftraten,
deutlich verringert werden konnten. Eine weitere Beobachtung war die Verlängerung der
cDNA-Fragmente (RNA Größenmarker hier nicht abgebildet). Betrug die Größe der
Fragmente im oberen Drittel der Gele mit der herkömmlichen Methode etwa 450-600 bp, so
konnten nach Modifikation Fragmente mit einer Größe von 650-850 bp aus diesem Bereich
ausgeschnitten werden. Dies wurde als bedeutender Fortschritt gewertet, da die differentiell
exprimierten Fragmente häufig aus der 3‘-UTR eines Gens stammen und die Verlängerung
der Sequenz in 5‘-Richtung nicht selten mit einem enormen Aufwand verbunden ist. Durch
den Vergleich der beiden Ausschnitte der DD-Gele ließen sich bereits einige Veränderungen
rein optisch erkennen. Darüber hinaus lag aber das Ziel der Modifikation in der Reduktion
falsch positiver Klone. Um die Methode im Hinblick auf diesen Punkt zu untersuchen, wurden
einige interessante Banden aus den Gelen ausgeschnitten, deren cDNA wurde eluiert,
reamplifiziert und kloniert sowie zuletzt sequenziert. Mit Hilfe der semiquantitativen PCR und
Northern blot Hybridisierung wurden die Expressionsunterschiede der modifizierten DD-PCR
bei Zellkulturen verifiziert.
Die Experimente bestätigten, daß durch die vorgenommene Anpassung die gesteckten Ziele
der modifizierten Differential Display Methode erreicht worden waren.Von insgesamt sieben
Fragmenten, die in der modifizierten DD-PCR Unterschiede aufwiesen, ließen sich drei mit
semiquantitativer PCR als differentiell exprimiert bestätigen. Bei den Fragmenten handelte
es sich um Fibronectin, Semaphorin E/3C und ein drittes Fragment (GG/G18/1), über dessen
Funktion noch nichts bekannt war und das im folgenden hier nicht weiter betrachtet wird. Die
semiquantitativen PCRs mit Primern für Fibronectin und Semaphorin E/3C sind in den
Abb.: 4.13 und Abb.: 4.14 dargestellt.
Bei beiden PCRs konnten deutliche Unterschiede im Hinblick auf die Signalintensitäten der
Amplifikate eines Zyklus beobachtet werden. Dabei war in den höchsten Zyklen die jeweils
höhere Expression in Zellinie GG am besten zu beobachten.
74
ERGEBNISSE
Abb.: 4.13 Überprüfung der differentiellen Expression des Fibronectin-Fragments durch eine
semiquantitative PCR.
Von den Ovarialkarzinomzellinien GG (Spuren 1 und 2) und MT (Spuren 3 und 4) wurde cDNA als
Matrize für eine PCR mit den spezifischen Primern zur Amplifikation eines Fragments von Fibronectin
(Spur 1 und 3) bzw. von G3PDH (Spur 2 und 4) eingesetzt. G3PDH diente bei den
Ovarialkarzinomzellinien, zusätzlich zur gelelektrophoretischen RNA-Mengen Bestimmung, der
Normalisierung der eingesetzten Matrize. Das Fibronectin-Fragment lief knapp unterhalb des G3PDHFragments und wurde deshalb in einem gesonderten Ansatz verwendet.
Abb.: 4.14 Überprüfung der differentiellen Expression des Semaphorin E/3C-Fragments durch
eine semiquantitative PCR.
Von den Ovarialkarzinomzellinien GG (Spurt 1) und MT (Spuren 2) wurde cDNA verwendet, die als
Matrize für eine PCR mit den spezifischen Primern zur Amplifikation eines Fragments von
Semaphorin E/3C und G3PDH eingesetzt wurde. G3PDH diente bei den Ovarialkarzinomzellinien,
zusätzlich zur gelelektrophoretischen RNA-Mengen-Bestimmung, der Normalisierung der eingesetzten
Matrize. Das Semaphorin E/3C-Fragment läuft unterhalb des G3PDH-Fragments.
75
ERGEBNISSE
Die Expressionsunterschiede von Fibronectin und Semaphorin E/3C in den Zellinien MT und
GG konnten auch mit Northern blot Hybridisierung bestätigt werden. Dazu waren jedoch
einige Vorarbeiten erforderlich. Zunächst wurde aus zahlreichen Ovarialkarzinomzellinien
RNA isoliert, die mRNA aufgereinigt und diese auf Nitrozellulosemembranen geblottet (siehe
Kapitel 3.21.3). Die Normalisierung der mRNA erfolgte über den Vergleich der
Signalintensitäten der mit Ethidiumbromid „angefärbten“ mRNA. Die Hybridisierungssonden
von Fibronectin und Semaphorin E/3C wurden hergestellt, wie in Kapitel 3.21.1 beschrieben.
Die Ergebnisse dieser Northern Blot Hybridisierungen und zusätzlicher semiquantitativer
PCRs mit Ovarialkarzinomzellinien sind in Abb.: 4.15 und Abb.: 4.16 zu sehen.
Abb.: 4.15 Verifizierung der Expressionsunterschiede von Fibronectin durch Northern Blot32
Analyse mit P-markierter Fibronectin-Sonde und sqPCR.
Jeweils 2 µg mRNA aus den aufgeführten Zellinien befanden sich auf dem Northern Blot. Die
gleichmäßige Beladung der Spuren mit mRNA ist der Darstellung (A) zu entnehmen, bei der die
32
Nitrozellulose nach Transfer der RNA zu sehen ist. (B) Der Northern Blot wurde mit einer Pmarkierten Fibronectin-Sonde inkubiert, anschließend wurde eine Autoradiographie durchgeführt (24 h
Exposition). In der Darstellung sind in allen Zellinien mehrere Transkripte nachweisbar. Dabei sind die
Transkripte in Zellinie GG deutlich stärker exprimiert als in den anderen Zellinien. Die zusätzlichen
Banden, zu der bei 8 kb erwarteten, lassen sich evtl. auf Spleißvarianten zurückführen. Eine
semiquantitative PCR (C) mit den Zellinien SV80, ES-2, Caov-3, SK-OV-3 und NIH:OVCAR-3
(NIH:OVCAR-3 als NIH abgekürzt) unterstreicht die Ergebnisse der Northern Blot-Analyse.
76
ERGEBNISSE
Abb.: 4.16 Verifizierung der Expressionsunterschiede von Semaphorin E/3C durch Northern
32
Blot-Analyse mit P-markierter Semaphorin E/3C-Sonde und sqPCR.
Auf den Northern Blot wurden pro Zellinien jeweils 2 µg mRNA transferiert. Die gleichmäßige
Beladung der Spuren mit mRNA ist in der Darstellung oben links zu sehen (A). Sie zeigt die
32
Nitrozellulose nach Transfer der RNA. Der Northern Blot wurde mit einer
P-markierten
Semaphorin E/3C-Sonde inkubiert, danach wurde ein Röntgenfilm bei –80°C für 24 h exponiert (B). In
der Darstellung rechts oben ist in allen Zellinien ein mehr oder minder deutliches Transkript bei etwa
5,5 kb nachweisbar. Dabei ist das Transkript in Zellinie GG höher exprimiert als in Zellinie MT. In
diesen beiden Ovarialkarzinomzellinien ist das Signal jedoch bedeutend stärker als in den anderen
Zellinien. (C) Eine semiquantitative PCR mit den Zellinien Caov-3, GG, MT, ES-2, SK-OV-3 und SV80
unterstreicht die Ergebnisse der Northern Blot-Analyse.
77
ERGEBNISSE
Dabei wurden die Resultate von DD- und semiquantitativer PCR besonders durch die
Hybridisierungsergebnisse des Fibronectin-Fragments unterstrichen. Die auf Höhe von etwa
8 kb erwartete Bande (Romberger, 1997) war in der Spur von Zellinie GG bedeutend stärker
exprimiert als in der von Zellinie MT. Zusätzliche Banden im unteren Bereich werden evtl. auf
Spleißvarianten zurückgeführt.
Werden die Signalintensitäten der weiteren Ovarialkarzinomzellinien mit den Ergebnissen
der korrespondierenden semiquantitativen PCR verglichen, so zeigt sich deutlich die
Übereinstimmung zwischen Northern Blot-Analyse und semiquantitativer PCR.
Ein Vergleich der „konventionellen“ Differential Display-Methode mit der modifizierten
Methode unterstreicht die Wirksamkeit der Veränderungen. Diese bestanden erstens in der
Verminderung von Anker-Anker geprimten Banden, die sich in allen Primerkombinationen
auf gleicher Höhe befinden. Zweitens wurden die Längen der cDNA-Fragmente durch die
veränderten PCR-Bedingungen, insbesondere der Elongationszeit, erheblich vergrößert und
drittens verminderte sich zumindest bei den Zellinien (die modifizierte Methode wurde von
mir nicht mehr an Patientengeweben angewandt) das Verhältnis von falsch positiven zu
echten Unterschieden. Dies bedeutet, daß die modifizierte DD-PCR deutlich bessere
Ergebnisse bei der Suche nach differentiell exprimierten Fragmenten bietet als die
herkömmlich verwendete Differential Display Methode.
Nach Überprüfung der modifizierten Methode wurden die bereits in Kapitel 4.5.3 erwähnten
Fragmente 26C/C9/2 und 26C/G8/2 weiter untersucht.
4.7 Charakterisierung von 26C/C9/2
Aufgrund der vielfachen Überexpression des Fragments 26C/C9/2 in Tumorgeweben der
Ovarien der Patientinnen 18, 30 und 46 wurden weitere Experimente durchgeführt. Dazu
zählten die Lokalisation des Transkripts in unterschiedlichen Geweben mittels Northern BlotAnalyse, die Ermittlung der genomischen Struktur, die Amplifikation und Expression des
offenen Leserasters, die Herstellung peptidspezifischer Antikörper und die Schaffung der
Voraussetzungen für die Überprüfung der Expression in den zu untersuchenden Geweben
durch in situ Hybridisierung.
Da zu Beginn lediglich die kurze cDNA-Sequenz von 26C/C9/2 aus der DD-PCR vorlag
(insgesamt 306 bp), bestand das Ziel darin, die Sequenz des offenen Leserasters zu
verlängern. Eine schematische Übersicht über diese Versuche gibt Abb.: 4.21.
78
ERGEBNISSE
4.7.1
Verlängerung der Sequenz des 26C/C9/2-Transkripts durch Datenbankanalyse
Durch Datenbankanalyse konnte die cDNA zunächst in Richtung des 3‘-Endes verlängert
werden,
so
daß
die
bekannte
Sequenz
etwa
1500
bp
umfaßte
und
ein
Polyadenylierungssignal (AATAAA) sowie einen kurzen Teil des poly(A)-Schwanzes
beinhaltete. Der Hauptteil dieser Sequenz wurde durch eine PCR überprüft. Dabei kamen
cDNAs verschiedener Ovarialkarzinomzellinien mit Primern, die einerseits aus der Sequenz
des ursprünglichen DD-Klons stammten und andererseits aus der Sequenz, die durch
Datenbankanalyse ermittelt werden konnte, zum Einsatz. Das Ergebnis dieser PCR ist in
Abb.: 4.17 zu sehen. Die entsprechende Bande der Zellinie ES-2 wurde ausgeschnitten,
kloniert und sequenziert. Die Sequenz des PCR-Produkts entsprach den Erwartungen und
stimmte mit der ermittelten Datenbanksequenz überein.
Abb.: 4.17 Elektrophoretische Auftrennung von PCR-Produkten, die der Überprüfung der
hypothetischen Sequenz von 26C/C9/2 dienten.
Die cDNAs verschiedener Ovarialkarzinomzellinien (ES-2, SK-OV3, Caov3 und MT) waren das
Ausgangsmaterial für die PCR-Reaktionen, bei der die folgenden sequenzspezifischen PCR-Primer
für die Reaktionen verwendet wurden: Primer 26C/C9/2-upper124 und 26C/C9/2-lower1360. Die PCRProdukte wurden auf einem 1% Agarosegel elektrophoretisch aufgetrennt. Dabei war
erwartungsgemäß in allen Spuren eine Bande bei 1260 bp zu beobachten, die hier durch einen Pfeil
gekennzeichnet ist. Zusätzliche Banden in den Zellinien SK-OV-3 und MT stammten vermutlich von
alternativen Spleißvarianten.
Dieses klonierte PCR-Fragment diente als Ausgangspunkt für die folgenden Versuche:
In einer Northern Blot-Analyse wurde die Größe der messenger RNA und deren Expression
in verschiedenen Geweben untersucht. Ebenso bot die zusätzliche Sequenz die Möglichkeit,
das 26C/C9/2 Transkript durch RACE oder andere Methoden zu verlängern.
79
ERGEBNISSE
4.7.2
Northern Blot-Analyse
Für die Northern Blot-Analyse wurde das 1260 bp lange, klonierte PCR-Produkt, wie in
Kapitel 3.21.1 beschrieben, mit α-32P-dCTP radioaktiv markiert und säulenchromatographisch aufgereinigt. In die Hybridisierungsreaktion wurden 11 x 107 cpm eingesetzt. Die
Größe des Transkripts und seine Verteilung in verschiedenen humanen Geweben und
Tumorzellinien wurden mit Hilfe der kommerziell erhältlichen „H“ und „H2“ multiple Tissue
Northern Blots der Firma Clontech, Heidelberg, sowie eines selbsthergestellten RNANitrozelluloseblots
von
Ovarialkarzinomzellinien
ermittelt.
Das
Ergebnis
der
Hybridisierungsreaktion zeigt Abb.: 4.18.
32
Abb.: 4.18 Hybridisierung von Northern Blots mit einer P-markierten 26C/C9/2-Sonde.
Pro Gewebe und Ovarialkarzinomzellinie befanden sich jeweils 2µg mRNA auf den Northern Blots.
32
Die Northern Blots wurden mit einer α- P-dCTP-markierten Sonde von 26C/C9/2 inkubiert,
anschließend wurde eine Autoradiographie durchgeführt (48 h Exposition auf einem Röntgenfilm). In
allen Geweben war ein etwa 3,2 kb großes Transkript nachweisbar. Auf dem Blot „H“ (links) waren die
Signale aller Gewebe in etwa gleich stark, die Signale auf Blot „H2“ (Mitte) in Milz, Thymus, Dünndarm
und den peripheren Blutleukozyten waren dagegen schwächer. Auch in allen verwendeten
Ovarialkarzinomzellinien konnte ein Signal bei 3,2 kb detektiert werden.
Die Northern Blot-Analyse zeigte, daß 26C/C9/2 in allen untersuchten Geweben und
Ovarialkarzinomzellinien transkribiert wird. Dabei handelte es sich um ein etwa 3,2 kb großes
Transkript.
Die
mRNA-Menge
in
Milz,
Thymus,
Dünndarm
und
den
peripheren
Blutleukozyten war im Gegensatz zu den meisten anderen Geweben vermindert. Auch im
Ovar und dem Darm waren die mRNA-Mengen etwas geringer als in der überwiegenden
Anzahl der Gewebe. Das Transkript von 26C/C9/2 konnte in allen verwendeten
Ovarialkarzinomzellinien nachgewiesen werden.
80
ERGEBNISSE
4.7.3
5‘-RACE
Durch RACE (Rapid Amplification of cDNA Ends) und nested RACE (siehe Abb.: 4.19) mit
cDNA der Marathon Ready Ovar Bibliothek und entsprechenden Primer konnte die Sequenz
des Transkripts um weitere 1124 bp in 5‘-Richtung verlängert werden. Das 5‘-Ende des
offenen Leserasters wurde jedoch durch dieses RACE nicht vervollständigt.
Abb.: 4.19 Gelelektrophoretische Auftrennung des nested RACEProdukts von 26C/C9/2.
Das nested RACE-Produkt zeigte wider Erwarten keine distinkte Bande.
Die erneute Suche in den Datenbanken lieferte zusätzliche Informationen von etwa 580 bp in
5‘-Richtung, wobei erst die contig-Sequenz ab Position 230 als belastbar galt, da sie durch
mehrere ESTs untermauert wurde (AA451733, AI69486, AI275114; AK001521), die zudem
noch mit den RACE-Klonen überlappten. Die vorderen 250 bp wurden lediglich aus den
Sequenzen zweier Klone (AW408144 und AK001521) generiert.
Da auch die zusätzliche hypothetische Sequenz von 580 bp nicht ausreichend war, um das
5‘-Ende des offenen Leserasters zu vervollständigen, wurden neue Primer innerhalb der
hypothetischen Sequenz (an den Positionen 330-302 und 258-230) ausgewählt, mit denen
weitere RACEs und nested RACEs mit Hilfe zahlreicher cDNA-Bibliotheken erfolgte. Die
Ergebnisse der nested RACEs waren ausgesprochen kontrovers. Obwohl alle RACEProdukte einen kompletten genspezifischen sowie einen vollständigen AP2-Primer besaßen,
wichen die Sequenzen bereits kurz hinter dem nested Primer (in 5‘-Richtung) von der
hypothetischen Sequenz ab. In dem selben Maß waren auch die Sequenzen der einzelnen
Klone untereinander verschieden. Wie sich herausstellte, befindet sich in dieser Region
vermutlich eine Spleißstelle, bei der unterschiedlich prozessierte Templates in den cDNABibliotheken vorliegen.
81
ERGEBNISSE
Mit dem Ziel, die Sequenz des offenen Leserasters von 26C/C9/2 zu vervollständigen, wurde
der von mir im Arbeitskreis etablierte Phagen-Screen mit der Uni-ZapXR Ovar cDNA
Bibliothek der Firma Stratagene, La Jolla, durchgeführt.
4.7.4
Phagen-Screening
Für den Phagen-Screen mit der Uni-ZAP XR Ovar Bibliothek (Stratagene, La Jolla) wurde
das cDNA-Fragment, das bereits durch PCR überprüft und sequenziert war (siehe
Abb.: 4.17), verwendet. Die Durchführung des Screens ist in Kapitel 3.25.2 ausführlich
beschrieben.
Bei der ersten Screening-Runde konnten nach Hybridisierung mit der radioaktiv markierten
Sonde und der Exposition der Filter auf einem Röntgenfilm drei Signale nachgewiesen
werden (Daten hier nicht gezeigt). Die betreffenden Phagen wurden isoliert und in
entsprechender Verdünnung für eine weitere Screening-Runde eingesetzt (Daten hier nicht
gezeigt). Bereits nach der zweiten Screening-Runde zeichnete sich ab, daß einer der drei
isolierten Phagen ein falsch positives Signal geliefert hatte. Die dritte Screening-Runde
diente hauptsächlich der Vermehrung und der leichteren Isolierung der zwei verbliebenen
Phagen. Ein Filter ist in Abb.: 4.20 zu sehen.
Abb.: 4.20 Nitrozellulose-Filter mit Hybridisierungssignalen nach der dritten Phagen-ScreeningRunde.
Nach der Infektion von XL1-Blue MRF‘ Wirtszellen mit einer λ-Phagen cDNA Ovarbibliothek (im UniZAP XR Vektor) wurden Nitrozellulose-Filter im „Abklatschverfahren“ hergestellt und mit der
radioaktiv markierten Sonde hybridisiert. Schwärzungen des Filters deuten auf Stellen hin, bei denen
eine Hybridisierung stattfand.
82
ERGEBNISSE
Bei dem Phagen-Screen wurden letztendlich zwei positive Klone isoliert. Im Gegensatz zu
den Erwartungen stellten die Sequenzen jedoch Bereiche dar, die bereits ausreichend durch
RACEs abgedeckt waren. Einer der Klone besaß eine Länge von etwas über 1300 bp und
stimmte mit der Region des bereits bekannten 3‘-Endes überein. Der andere Klon war mit
790 bp kürzer und lag in der selben Region.
Da auch ein weiteres Screening der λTriplEx Ovar Bibliothek mit einem cDNA-Fragment aus
einem
weiter
5‘-Richtung
gelegenen
Bereich
der
Sequenz
keine
zusätzliche
Sequenzinformation lieferte, sondern nur die durch RACE erhaltene bestätigte, wurde das
Phagen-Screening eingestellt. Auch der Versuch, durch eine Hybridisierung mit zwei
verschiedenen Blots (Ovar 370.1.101 und Testis 176.1.104) des „Ressource Center of the
German Human Genome Project“ (RZPD), auf die jeweils 2,7 x 104 verschiedene cDNAs
transferiert waren, zusätzliche Sequenzinformation zu erhalten (Daten hier nicht gezeigt),
blieben erfolglos.
4.7.5
Auswertung der RACE-Sequenzen
Wie bereits in Kapitel 4.7.3 dargelegt wurde, konnten die Sequenzen der RACEs zunächst
nicht mit denen der Datenbanken in Einklang gebracht werden. Nach einer weiteren
eingehenden
Analyse
der genomischen,
ungeordneten
Sequenz
von
RP1161E11
(AC016257) und einigen RACE-Klonen konnten jedoch Übereinstimmungen ermittelt
werden. Bei den RACE-Klonen handelte es sich um drei Klone der Ovar- und um einen Klon
der Testis-cDNA-Bibliothek. Mit Hilfe dieser Sequenzinformationen konnte ein 2999 bp
langes Transkript erstellt werden, das einen offenen Leseraster von 1971 bp aufwies. Die
Länge des Transkripts und die durch Northern Blot-Analyse ermittelten Längen waren
übereinstimmend, wenn ein Poly-A Schwanz von etwa 200 bp miteingerechnet wurde.
Es wurde deutlich, daß das ursprüngliche 5‘-Ende, das durch Datenbankanalyse mit Hilfe der
Klone AW408144 und Ak001521 ermittelt wurde, sehr wahrscheinlich ein nichtprozessiertes
Transkript darstellte. Dies würde auch die zahlreichen uneinheitlichen RACE-Produkte in
dieser Region, die von mir analysiert wurden, erklären. Das Contig, das zur vollständigen
Sequenz des Transkripts von 26C/C9/2 führte, ist in Abb.: 4.21, die daraus ermittelte
Sequenz ist in Abb. 4.22 dargestellt.
83
ERGEBNISSE
Abb.: 4.21 Übersicht über die Versuche zur Vervollständigung von 26C/C9/2.
Das Contig wurde mit Hilfe des Programm SeqManII des DNASTAR-Pakets erstellt. Die Abkürzung
5R steht für 5‘-RACE-Klone, die Abkürzung DD steht für ursprüngliche Differential Display-Produkte.
Die übrigen Bezeichnungen sind Zugangsnummern für Datensätze in den EMBL- und GenbankDatenbanken.
1
|
|
|
|
|
|60
cttttccacttagaaATGAAATTGACCTTTTTTCTTCTTTTCTTCCAGACTCGCTCTTTA
|
|
|
|
|
|120
61
CTGAGCGTGTTTGAAGAAGATGCTGGCACCCTCACAGACTATACCAACCAGCTGCTCCAG
121
|
|
|
|
|
|180
GCAATGCAGCGCGTCTATGGAGCCCAGAATGAGATGTGCCTGGCCACACAACAGCTTTCT
181
|
|
|
|
|
|240
AAGCAACTGCTGGCATATGAAAAACAGAACTTTGCTCTTGGCAAAGGTGATGAAGAAGTA
241
|
|
|
|
|
|300
ATTTCAACACTCCACTATTTTTCCAAAGTGGTGGATGAGCTTAATCTTCTCCATACAGAG
301
|
|
|
|
|
|360
CTGGCTAAACAGTTGGCAGACACAATGGTTCTACCTATCATACAATTCCGAGAAAAGGAT
361
|
|
|
|
|
|420
CTCACAGAAGTAAGCACTTTAAAGGATCTATTTGGACTCGCTAGCAATGAGCATGACCTC
421
|
|
|
|
|
|480
TCAATGGCAAAATACAGCAGGCTGCCTAAGAAAAAGGAGAATGAGAAGGTGAAGACCGAA
84
ERGEBNISSE
481
|
|
|
|
|
|540
GTCGGAAAAGAGGTGGCCGCGGCCCGGCGGAAGCAGCACCTCTCCTCCCTTCAGTACTAC
|
|
|
|
|
|600
541
TGTGCCCTCAACGCGCTGCAGTACAGAAAGCAAATGGCCATGATGGAGCCCATGATAGGC
601
|
|
|
|
|
|660
TTTGCCCATGGACAGATTAACTTTTTTAAGAAGGGAGCAGAGATGTTTTCCAAACGTATG
661
|
|
|
|
|
|720
GACAGCTTTTTATCCTCCGTTGCAGACATGGTTCAAAGCATTCAGGTAGAACTGGAAGCC
|
|
|
|
|
|780
721
GAGGCGGAAAAGATGCGGGTGTCCCAGCAAGAATTACTTTCTGTTGATGAATCTGTTTAC
781
|
|
|
|
|
|840
ACTCCAGACTCTGATGTGGCCGCACCACAGATCAACAGGAACCTCATCCAGAAGGCTGGT
841
|
|
|
|
|
|900
TACCTTAATCTTAGAAACAAAACAGGGCTGGTCACCACCACCTGGGAGAGGCTTTATTTC
|
|
|
|
|
|960
901
TTCACCCAAGGCGGGAATCTCATGTGTCAGCCCAGGGGAGCCGTGGCTGGAGGTTTGATC
961
|
|
|
|
|
|1020
CAGGACCTGGACAACTGCTCAGTGATGGCCGTGGATTGCGAAGACCGGCGCTACTGCTTC
1021
|
|
|
|
|
|1080
AGATCACCACGCCCAATGGAAAATCGGGAATAATCCTCCAGGCTGAGAGCAGAAAGGAAA
|
|
|
|
|
|1140
1081
ATGAAGAGTGGATATGTGCAATAAACAACATCTCCAGACAGATCTACCTGACCGACAACC
1141
|
|
|
|
|
|1200
CTGAGGCAGTCGCGATCAAGTTGAATCAGACCGCTCTGCAAGCAGTGACTCCCATTACAA
1201
|
|
|
|
|
|1260
GTTTTGGAAAAAAACAAGAAAGCTCATGCCCCAGCCAGAACCTGAAAAATTCAGAGATGG
1261
|
|
|
|
|
|1320
AAAATGAAAATGACAAGATTGTTCCCAAAGCAACAGCCAGTCTACCTGAAGCAGAGGAGC
1321
|
|
|
|
|
|1380
TGATCGCGCCTGGAACGCCGATTCAATTCGATATTGTGCTTCCTGCTACAGAATTCCTTG
1381
|
|
|
|
|
|1440
ATCAGAACAGAGGGAGCAGGCGTACCAACCCTTTTGGTGAAACTGAGGATGAATCATTTC
1441
|
|
|
|
|
|1500
CAGAAGCAGAAGATTCTCTTTTGCAGCAGATGTTTATAGTTCGGTTTTTGGGATCAATGG
1501
|
|
|
|
|
|1560
CAGTTAAAACAGACAGCACTACTGAAGTGATTTATGAAGCGATGAGACAAGTATTGGCTG
1561
|
|
|
|
|
|1620
CTCGGGCTATTCATAACATCTTCCGCATGACAGAATCCCATCTGATGGTCACCAGTCAAT
1621
|
|
|
|
|
|1680
CTTTGAGGTTGATAGATCCACAGACTCAAGTATCAAGGGCCAATTTTGAACTTACCAGTG
1681
|
|
|
|
|
|1740
TCACACAATTTGCTGCTCATCAAGAAAACAAGAGACTGGTTGGTTTTGTCATCCGTGTTC
1741
|
|
|
|
|
|1800
CTGAATCCACTGGAGAAGAATCTCTGAGTACATACATTTTTGAAAGCAACTCAGAAGGCG
1801
|
|
|
|
|
|1860
AAAAGATATGTTATGCTATTAAAAAGAAATTATTGAGGTTCAGAAGGATCCAGAAGCACT
|
|
|
|
|
|1920
1861
GGCTCAATTAATGCTGTCCATACCACTAACCAATGATGGAAAATATGTACTGTTAAACGA
1921
|
|
|
|
|
|1980
TCAACCAGATGACGATGATGGAAATCCAAATGAACATAGAGGCGCAGAATCCGAAGCATA
1981
|
|
|
|
|
|2040
Actcacttgcgcctgtgggggaagagcaaacaggaaggagagctacctcctaagggtttt
|
|
|
|
|
|2100
2041
aacgtctctgacatacaggcacactgacctgatttccgaaggctgacaatcgtttgtgga
2101
|
|
|
|
|
|2160
atgtaatcttgatgccttgatactgagacttgggagggaaactaagaaatggttgacagc
85
ERGEBNISSE
2161
|
|
|
|
|
|2220
gttcccacccatctacaatgttattttaggtgctttgtggtaagtcttttttcttagatt
2221
|
|
|
|
|
|2280
gcgctaaaatttcttagattgttcagcgctcagaacaaaagtttgaaaaatgcattgttc
2281
|
|
|
|
|
|2340
atatgaatgtcatctcttttcagtttccagtatcctttttaaaaaatggcaaaagcctag
2341
|
|
|
|
|
|2400
atttacaatttgatgaacactaaatatttcttattaatataatctatttttgtattttac
2401
|
|
|
|
|
|2460
ttaatgagctttaagtgcctgtcgttctgaaaattgtgtatttataattcagcttatctc
2461
|
|
|
|
|
|2520
aaattggacctaatagcatttctttgtgcagttaggtgacgagcactgctttgaggccca
2521
|
|
|
|
|
|2580
agcactagtagagatgcgcgatacaggtctagtttcggtaactgttccagacatcaagca
2581
|
|
|
|
|
|2640
ataaaaaaatgaataccacaaaagatgtttgattttacagtggagccttactgaaccagc
2641
|
|
|
|
|
|2700
attcagaagtttaaggtcctcctaggtatgagtatttttagtagtggatcactgtggaca
2701
|
|
|
|
|
|2760
gggtgcagctctaccagttcctgtttcttctgagccagaccctcttcagggaagggacca
2761
|
|
|
|
|
|2820
attaattttaaaactcacttgaagcacagctggtcatggggcttggtataaagttcctat
2821
|
|
|
|
|
|2880
ttccaccctgatacttccaattcctggaaccccagcccactcccccatccctcctcccta
2881
|
|
|
|
|
|2940
tcaaactagtataatgattttgaatcggtacagtgtgtttaactgtaactaagttcaaca
|
|
|
|
|
|3000
2941
gactattattatctttgtaataaattaacctagcaataaaaattattctgtttctttaaa
3001
|3010
aaaaaaaaaa
Abb. 4.22 Contig-Sequenz des Transkripts von 26C/C9/2.
Insgesamt umfaßt die ermittelte Sequenz 2999 bp. Die ursprüngliche Sequenz des 26C/C9/2 DD-PCR
Produkts ist gelb unterlegt. Das Polyadenylierungssignal AATAAA ist rot, ein Teil des poly(A)Schwanzes ist unterstrichen, der offene Leseraster ist durch Großbuchstaben gekennzeichnet. Für die
Amplifikation des offenen Leserasters wurden die Primer 26C/C9/2p-endProt-u und 26C/C9/2p-Prot-l
(hier fett gekennzeichnet) verwendet.
Die Amplifikation des offenen Leserasters erfolgte durch eine PCR-Reaktion. Dabei diente
zunächst die cDNA der Ovar-Bibliothek als Matrize. Die verwendeten Primer lagen im
Bereich des ermittelten 5‘-Endes des offenen Leserasters, beginnend mit dem Start-ATG,
und des 3‘-Endes des offenen Leserasters. Das PCR-Produkt (hier nicht dargestellt) wurde
anschließend in den pCRII Vektor (Invitrogen, Groningen/NL) kloniert und sequenziert und
diente später in einem Retikulozyten-Lysat als Matrize einer in vitro-Tanskription und
-Translation.
86
ERGEBNISSE
Die Überprüfung der mit Hilfe von RACE ermittelten Sequenz von 26C/C9/2 erfolgte mit den
selben Primern, die bereits für die Klonierung verwendet wurden. Wie in Abb. 4.23 zu sehen
ist, konnte die Expression der ermittelten Sequenz 26C/C9/2 in allen verwendeten Zellinien
nachgewiesen werden, weshalb das von mir bestimmte Transkript aller Wahrscheinlichkeit
nach korrekt ist.
Abb. 4.23 Elektrophoretische Auftrennung der PCR-Produkte von 26C/C9/2. Die PCR diente der
Überprüfung der ermittelten Sequenz.
cDNAs verschiedener Ovarialkarzinomzellinien (ES-2, GG, MT, SK-OV3, NIHOVCAR-3 und Caov3)
wurden in PCR-Reaktionen eingesetzt. Hierbei wurden die folgenden sequenzspezifischen PCRPrimer für die Reaktionen verwendet Primer 26C/C9/2p-endProt-u und 26C/C9/2p-Prot-l. Die PCRProdukte wurden auf einem 1% Agarosegel elektrophoretisch aufgetrennt. Dabei ist erwartungsgemäß
in allen Spuren eine Bande bei etwa 1970 bp zu beobachten.
4.7.6
Struktur des 26C/C9/2-Gens
Durch Datenbankanalyse mit der cDNA-Sequenz von 26C/C9/2 gelang es, die gesamte
Struktur des Gens anhand der sequenzierten BAC-Klone RP11-61E11 (AC016257) und
RP11-781C15 (AC078874), die seit Februar bzw. April dieses Jahres in geordneter Form
vorliegen, zu ermitteln (siehe Abb. 4.24). Mit Hilfe des „Electronic PCR“-Programms von
NCBI konnte gezeigt werden, daß sich das Gen für 26C/C9/2 auf dem langen Arm des
Chromosoms 12, genauer auf 12q23-24.1 befindet. Dabei kennzeichnen zwei „Sequence
Tagged Sites“ (STSs) die Position im Chromosom. Es handelt sich um HS065YE9 (Z23320)
und SHGC-130923 (G60233), die sich in Intron 8 bzw. 4 kb hinter dem terminalen Exon
befinden. Das Gen besteht aus mindestens 20 Exons, wobei die Exons 2-19 Teil der beiden
BAC-Klone sind, Exon 1 jedoch nur Teil von RP11-781C15 ist. Vor Ordnung der Sequenz
87
ERGEBNISSE
des Klons RP11-61E11 konnte Exon 1 auch diesem Klon zugeordnet werden (Position
36484-36572 bp). Die 5‘- und 3‘-Spleißstellen der Exon-Intron-Übergänge sind in Tab. 4.4
dargestellt.
Exon
Größe
(bp)
Position in
AC078874
cDNA
Position
5‘-Spleiß-Donor
Intron Größe
(kb)
3‘-SpleißAkzeptor
1
147
26673 - 26819
1 -
147
CCAGGTATGC
1
11,4
CCACAGAATG
2
60
38221 - 38280
148 -
207
ACAGGTAACT
2
0,6
TCTTAGAACT
3
72
38806 - 38877
208 -
279
TGAGGTAAGA
3
5,8
TTTCAGCTTA
4
88
44631 - 44718
280 -
367
ACAGGTAAAG
4
3,0
TTTCAGAAGT
5
43
47749 - 47791
368 -
410
AATGGTAGGC
5
0,1
TTAGAGCATG
6
57
47922 - 47978
411 -
467
GAAGGTAAGA
6
0,8
AACCAGGTGA
7
147
48742 - 48888
468 -
614
ACAGGTAGGG
7
3,3
TTTCAGATTA
8
83
52164 - 52246
615 -
697
AAAGGTAATG
8
4,1
CTTAAGCATT
9
159
56390 - 56548
698 -
856
GAAAGTGAGA
9
1,4
TCACAGCAAA
10
189
57968 - 58156
857 - 1045
AATCGTATGT
10
2,1
TTTCAGGGGA
11
43
60293 - 60335 1046 - 1088
AGAGGTAAAA
11
0,1
CTACAGTGGA
12
57
60419 - 60475 1089 - 1145
TGAGGTAATT
12
0,1
TTTTAGGCAG
13
89
60571 - 60659 1146 - 1234
CCAGGTAACT
13
5,1
CTTCAGCCAG
14
165
65764 - 65928 1235 - 1399
GCAGGTATGG
14
0,2
CCCTAGGCGT
15
53
66095 - 66147 1400 - 1452
GAAGGTAAGT
15
1,3
TTCCAGATTC
16
175
67472 - 67646 1453 - 1627
TGAGGTACGT
16
11,0
TTTCAGGTTG
17
37
78677 - 78713 1628 - 1664
CAATGTAAGT
17
0,2
CCCCAGTTTG
18
141
78923 - 79063 1665 - 1805
AAAGGTCTCT
18
0,8
TTGCAGATAT
19
48
79857 - 79904 1806 - 1853
GAAGGTAAGA
19
1,5
CTTCAGGATC
20
1148
81492 - 82643 1854 - 2999
Tab. 4.4 Struktur des 26C/C9/2-Gens.
Die Exongrößen variieren von 37 bp bei Exon 17 bis 1148 bp bei Exon 20. Bei Intron 5, 11
und 12 handelt es sich mit 0,1 kb um die kleinsten, mit 11,4 kb und 11,0 kb bei Intron 1 und
16 um die größten Introns des Gens. Die genomische Sequenz von 26C/C9/2 umfaßt etwa
165 kb. Die Struktur des 26C/C9/2 Gens, das zu dem Transkript von 26C/C9/2 führt, ist in
Abb. 4.24 dargestellt.
88
ERGEBNISSE
Abb. 4.24 Organisation des 26C/C9/2-Gens und seines Transkripts.
Das 26C/C9/2-Gen ist Teil der BAC-Klone RP11-61E11 (AC016257) und RP11-781C15 (AC078874),
die auf Chromosom 12q23-24.1 lokalisiert sind. Der offene Leseraster von 26C/C9/2 erstreckt sich bis
etwa 10% des Exons 20. Es resultiert hieraus ein Molekulargewicht von etwa 74 kDa.
4.7.7
Herstellung peptidspezifischer Antikörper
Nach Vervollständigung der Sequenz des offenen Leserasters von 26C/C9/2 konnte die
Aminosäuresequenz des Proteins abgeleitet werden. Diese ist 657 Aminosäurereste lang
und besitzt eine Größe von 73937 Da. In Abb. 4.25 ist die Aminosäuresequenz dargestellt.
|
|
|
|
|
|60
1
MKLTFFLLFFQTRSLLSVFEEDAGTLTDYTNQLLQAMQRVYGAQNEMCLATQQLSKQLLA
|
|
|
|
|
|120
61
YEKQNFALGKGDEEVISTLHYFSKVVDELNLLHTELAKQLADTMVLPIIQFREKDLTEVS
121
|
|
|
|
|
|180
TLKDLFGLASNEHDLSMAKYSRLPKKKENEKVKTEVGKEVAAARRKQHLSSLQYYCALNA
181
|
|
|
|
|
|240
LQYRKQMAMMEPMIGFAHGQINFFKKGAEMFSKRMDSFLSSVADMVQSIQVELEAEAEKM
|
|
|
|
|
|300
241
RVSQQELLSVDESVYTPDSDVAAPQINRNLIQKAGYLNLRNKTGLVTTTWERLYFFTQGG
301
|
|
|
|
|
|360
NLMCQPRGAVAGGLIQDLDNCSVMAVDCEDRRYCFQITTPNGKSGIILQAESRKENEEWI
360
|
|
|
|
|
|420
CAINNISRQIYLTDNPEAVAIKLNQTALQAVTPITSFGKKQESSCPSQNLKNSEMENEND
89
ERGEBNISSE
421
|
|
|
|
|
|480
KIVPKATASLPEAEELIAPGTPIQFDIVLPATEFLDQNRGSRRTNPFGETEDESFPEAED
481
|
|
|
|
|
|520
SLLQQMFIVRFLGSMAVKTDSTTEVIYEAMRQVLAARAIHNIFRMTESHLMVTSQSLRLI
541
|
|
|
|
|
|600
DPQTQVSRANFELTSVTQFAAHQENKRLVGFVIRVPESTGEESLSTYIFESNSEGEKICY
601
|
|
|
|
|
|657
AINLGKEIIEVQKDPEALAQLMLSIPLTNDGKYVLLNDQPDDDDGNPNEHRGAESEA
Abb. 4.25 Aminosäuresequenz des 26C/C9/2-Proteins.
Die beiden Peptidsequenzen, die für die Herstellung von polyklonalen Antikörpern ausgewählt
wurden, sind gelb unterlegt.
Nach Bestimmung der Aminosäuresequenz wurde nach geeigneten Regionen gesucht, auf
deren Grundlage peptidspezifische Antikörper erzeugt werden konnten. Die Bereiche der
hydrophilen Peptid-Epitope lagen am unmittelbaren C-Terminus bzw. im zweiten Drittel des
Proteins (in Abb. 4.25 gelb unterlegt), also in einer mehrfach verifizierten Region. In Kapitel
3.26 ist die Herstellung beschrieben und die Aminosäureabfolge der verwendeten Peptide
aufgelistet.
Für den Nachweis des 26C/C9/2-Proteins wurden vier Kaninchen mit insgesamt zwei
verschiedenen synthetischen Peptiden, die von Dr. Pipkorn hergestellt und an Hämocyanin
gekoppelt wurden, immunisiert. Das Ergebnis eines Dot-Blots, der zur Überprüfung der
Kaninchenseren hergestellt wurde, ist in Abb. 4.26 gezeigt. Dazu wurden die hämocyaninund nichtgekoppelten Peptide in unterschiedlichen Verdünnungen aufgetragen und mit den
verdünnten Seren inkubiert. Die Stärke der Reaktionen, d.h. die Zunahme bei den
Signalintensitäten, korrelierte mit der Anzahl der vorgenommen Immunisierungen. Bei den
gebildeten Antikörpern handelte es sich im wesentlichen um Antikörper, die nicht gegen den
Träger Hämocyanin gebildet wurden, sondern gegen das gewünschte Peptid. Dies ist daran
zu erkennen, daß sowohl bei den gekoppelten, als auch ungekoppelten Peptiden Reaktionen
mit den Seren zu beobachten sind.
90
ERGEBNISSE
Abb. 4.26 Nachweis der Reaktivität eines peptidspezifischen Antikörpers mit dem
zugrundeliegenden Peptid.
Auf die Nitrozellulosemembranen wurden gekoppelte und nicht gekoppelte Peptide in Mengen von
3,5 µg bis 0,05 µg aufgetragen. Die Membranen wurden mit 1:1000 verdünnten Seren, die nach
erster, zweiter, dritter und vierter Immunisierung gewonnen wurden, inkubiert. Immunisierungen
fanden nach 1, 14, 28 und 42 Tagen statt. Erst nach dritter Immunisierung sind ausreichend affine
Antikörper in den Seren vorhanden um deutliche Reaktionen hervorzurufen. Danach ist selbst eine
Peptidmenge von 0,05 µg nachweisbar. Die Antikörperreaktionen richten sich nicht gegen das
gekoppelte Hämocyanin, sondern gegen das gewünschte Peptid.
4.7.8
in vitro Transkription und Translation von 26C/C9/2 im Retikulozyten-Lysat
Die in vitro Transkription und Translation mit Hilfe des TNT®-gekoppelten RetikulozytenLysats
(Promega,
Madison/USA)
ermöglicht
die
Herstellung
von
RNA
und
die
Proteinsynthese im zellfreien System. Ein Vorteil bei der Verwendung des RetikulozytenLysats ist in den posttranslationalen Modifikationen zu sehen, die in eukaryontischen
Systemen stattfinden und die hier auch auf das Syntheseprodukt übertragen werden. Der
Nachteil besteht in einer relativ geringen Proteinausbeute, die nicht für alle Anwendungen,
wie beispielsweise die Herstellung von Antikörpern, ausreichend ist.
Mit Hilfe dieses Systems wurde überprüft, ob das Protein die erwartete Größe von 74 kDa
besaß. Nach Klärung dieses Sachverhalts erfolgte die Bestimmung des für einen Immunblot
am besten geeigneten Peptidantikörpers.
Zunächst wurde die Sequenz des offenen Leserasters von 26C/C9/2 in den Vektor pCRII
kloniert und anschließend sequenziert (siehe Kapitel 4.7.5). Der pCRII Vektor besitzt sowohl
einen Sp6 als auch T7-Promotor, wobei die Orientierung der 26C/C9/2 cDNA im Vektor die
Verwendung des T7-Promotors erforderte. Einer der in vitro Transkriptions/TranslationsAnsätze mit
35
S-markiertem Methionin wurde in Zusammenarbeit mit Sandra Kneißel
(Abteilung Prof. Franke, DKFZ) hergestellt. Das Ergebnis einer Reaktion ist in Abb. 4.27 zu
sehen.
91
ERGEBNISSE
Abb. 4.27 Analyse der Größe des 26C/C9/2-Proteins.
Nach in vitro Transkription/Translation wurden 3 µl des Ansatzes auf einem
10%igen Kornberg SDS-PAGE aufgetrennt, Coomassie gefärbt und nach
10 min Natriumsalicylat-Bad, das der Fixierung der Banden diente, ein Film
exponiert. Die Größe der signalstärksten Bande zwischen 66 und 97 kDa
stimmte mit der vorhergesagten Größe von 74 kDa überein.
Dabei stimmte die Größe der signalstärksten Bande (zwischen 66 und 97 kDa) sehr gut mit
dem berechneten Molekulargewicht des 26C/C9/2-Proteins von 74 kDa überein.
Aufgrund positiver Erfahrungen mit dem zellfreien RTS-System wurde der Versuch
unternommen, 26C/C9/2 mit diesem System zu exprimieren.
Bevor das RTS-System zum Einsatz kommen konnte, mußte zunächst die cDNA des
offenen Leserasters von 26C/C9/2 in den Vektor pIVEX2.4a umkloniert und sequenziert
werden. Die Funktion des Konstrukts wurde erneut mit Hilfe des Retikulozyten-Lysats
überprüft. Nach in vitro Transkription/Translation des offenen Leserasters von 26C/C9/2 und
einer Negativkontrolle (Vektor ohne Insert) wurde ein SDS-Polyacrylamidgel mit einem Teil
des Reaktionsansatzes beladen und die Proteine wurden elektrophoretisch getrennt. Nach
Blotten der Proteine (siehe Kapitel 3.35) wurden diese mit PonceauS angefärbt und der Blot
wurde je mit einem der vier Seren inkubiert. In Abb. 4.28 ist das Resultat abgebildet.
Zwischen den in vitro Transkriptions/Translations-Produkten der Negativkontrolle und Vektor
inklusive 26C/C9/2 cDNA war ein deutlicher Unterschied im Bereich von etwa 80 kDa zu
erkennen. Dabei handelte es sich um das exprimierte Protein von 26C/C9/2, das ein
Molekulargewicht von 74 kDa besitzt. Nachdem geklärt war, daß der Vektor für die
Expression geeignet ist, wurde im folgenden das RTS-System verwendet (die Ergebnisse
sind hier nicht dargestellt).
Die Expression des 26C/C9/2-Proteins in Lysaten von Hela- und Ovarialkarzinomzellinien
wurde von Jürgen Kretschmer im Arbeitskreis von Prof. Ponstingl überprüft. Dabei entsprach
das Molekulargewicht des Proteins in etwa der erwarteten Größe.
92
ERGEBNISSE
Abb. 4.28 Nachweis der in vitro Transkription und Translation von 26C/C9/2 cDNA in Vektor
pIVEX2.4a.
Nach in vitro Transkription/Translation einer Negativkontrolle (pIVEX2.4a ohne Insert) und 26C/C9/2
cDNA, mittels Retikulozyten-Lysat, wurden 3 µl Probe auf ein 10%iges Kornberg PAGE aufgetragen,
die Proben elektrophoretisch getrennt und auf Nitrozellulose geblottet. Der Blot wurde nach
PonceauS-Färbung (A) mit einem peptidspezifischen Antikörper (24-2, weiter N-terminal gelegenes
Peptid) inkubiert (B) mit dem Ziel, das Protein von 26C/C9/2 nachzuweisen. Dabei war im Gegensatz
zur Negativkontrolle eine Bande bei etwa 74 kDa zu erkennen, die für die Expression des 26C/C9/2Proteins spricht. Eine unspezifische Bande befindet sich in beiden Proben knapp oberhalb der
spezifischen Bande.
4.7.9
Eigenschaften des 26C/C9/2-Proteins
Die Sekundär-Struktur von 26C/C9/2 wurde mit dem Programm Protean des DNASTARPakets vorhergesagt (Abb. 4.29). Das Protein besteht demnach überwiegend aus
zahlreichen α-Helices, die durch Schleifen verbunden oder von wenigen β-Faltblatt-Einheiten
durchsetzt sind. Der vorhergesagte isolelektrische Punkt des Proteins liegt bei 4,79. Das
Protein ist nicht membranständig und besitzt eine globuläre Struktur.
93
ERGEBNISSE
50
100 150 200 250 300 350 400 450 500 550 600 650
A
Alpha, Regions - Garnier-Robson
A
Alpha, Regions - Chou-Fasman
B
Beta, Regions - Garnier-Robson
B
Beta, Regions - Chou-Fasman
T
Turn, Regions - Garnier-Robson
T
Turn, Regions - Chou-Fasman
C
Coil, Regions - Garnier-Robson
3.07
0
Hydrophilicity Plot - Kyte-Doolittle
-2.04
*
Alpha, Amphipathic Regions - Eisenberg
*
Beta, Amphipathic Regions - Eisenberg
F
Flexible Regions - Karplus-Schulz
3.4
0
Antigenic Index - Jameson-Wolf
6
1
Surface Probability Plot - Emini
Abb. 4.29 Sekundärstruktur des 26C/C9/2-Proteins nach Vorhersage mit dem Programm
Protean des DNASTAR-Pakets.
Die Datenbankrecherche mit „SMART“ (Simple Modular Architecture Research Tool des
EMBL)
zeigte
eine
pleckstrin-homologe
Domäne
(Position
271-370)
und
eine
Phosphotyrosin-Bindungs-Domäne (482-615). Die Proteinstruktur ist in Abb. 4.30 dargestellt.
Abb. 4.30 Aufbau der Proteinstruktur des 26C/C9/2-Proteins nach Vorhersage mit dem SMARTProgamm des EMBL.
Das Protein zeigt eine pleckstrin-homologe Domäne (PH, Position 271-370) und eine PhosphotyrosinBindungs-Domäne (PTB, 482-615).
Phosphotyrosin-Bindungs-Domänen besitzen eine ähnliche Struktur wie die Pleckstinhomologen und IRS-1 ähnlichen PTB-Domänen. Pleckstrin-homologe Domänen werden
gewöhnlich in eukaryontischen Signal-Proteinen gefunden. Die Struktur und die Funktion der
Phosphotyrosin-Bindungs-Domäne und der pleckstrin-homologen Domäne werden in Kapitel
5.3.2 diskutiert.
94
ERGEBNISSE
4.7.10 Homologe Proteine zu 26C/C9/2
Bei dem Vergleich des offenen Leserasters von 26C/C9/2 mit Sequenzen der Datenbanken
konnten Homologien zu teilweise bereits bekannten Proteinen ermittelt werden. Dabei weist
das Adaptor Protein APPL (AF169797) mit über 60% die größte Homologie zu dem
26C/C9/2-Protein auf. Ein Vergleich der Nukleotid-Sequenz der beiden homologen Proteinen
ist in Abb. 4.31 zu sehen.
10
20
30
40
50
60
1
1
M - - - - K L T F F L L F F - - - Q T R S L L S V F E E D A G T L T D Y T N Q L L Q A M Q R V Y G A Q N E M C L A T Q Q 26C/C9/2Protein300600.Edit
M P G I D K L P I E E T L E D S P Q T R S L L G V F E E D A T A I S N Y M N Q L Y Q A M H R I Y D A Q N E L S A A T H L AF169797APPLProtein.Edit
54
61
L S K Q L L A Y E K Q N F A L G K G D E E V I S T L H Y F S K V V D E L N L L H T E L A K Q L A D T M V L P I I Q F R E 26C/C9/2Protein300600.Edit
T S K L L K E Y E K Q R F P L G G D D E V M S S T L Q Q F S K V I D E L S S C H A V L S T Q L A D A M M F P I T Q F K E AF169797APPLProtein.Edit
70
130
80
140
90
150
100
160
110
170
120
180
114 K D L T E V S T L K D L F G L A S N E H D L S M A K Y S R L P K K K E N E K V K T E V G K E V A A A R R K Q H L S S L Q 26C/C9/2Protein300600.Edit
121 R D L K E I L T L K E V F Q I A S N D H D A A I N R Y S R L S K K R E N D K V K Y E V T E D V Y T S R K K Q H Q T M M H AF169797APPLProtein.Edit
190
200
210
220
230
240
174 Y Y C A L N A L Q Y R K Q M A M M E P M I G F A H G Q I N F F K K G A E M F S K R M D S F L S S V A D M V Q S I Q V E L 26C/C9/2Protein300600.Edit
181 Y F C A L N T L Q Y K K K I A L L E P L L G Y M Q A Q I S F F K M G S E N L N E Q L E E F L A N I G T S V Q N V R R E M AF169797APPLProtein.Edit
250
260
270
280
290
300
234 E A E A E K M R V S Q Q E L L S V D E S V Y T P D S D V A A P Q I N R N L I Q K A G Y L N L R N K T G L V T T T W E R L 26C/C9/2Protein300600.Edit
241 D S D I E T M Q Q T I E D L E V A S D P L Y V P D P D P T K F P V N R N L T R K A G Y L N A R N K T G L V S S T W D R Q AF169797APPLProtein.Edit
310
320
330
340
350
360
294 Y F F T Q G G N L M C Q P R G A V A G G L I Q D L D N C S V M A V D C E D R R Y C F Q I T T P N G K S G I I L Q A E S R 26C/C9/2Protein300600.Edit
301 F Y F T Q G G N L M S Q A R G D V A G G L A M D I D N C S V M A V D C E D R R Y C F Q I T S F D G K K S S I L Q A E S K AF169797APPLProtein.Edit
370
380
390
400
410
420
354 K E N E E W I C A I N N I S R Q I Y L T D N P E A V A I K L N Q T A L Q A V T P I T S F G K K Q E S - - S C P S Q N L K 26C/C9/2Protein300600.Edit
361 K D H E E W I C T I N N I S K Q I Y L S E N P E E T A A R V N Q S A L E A V T P S P S F Q Q R H E S L R P A A G Q S R P AF169797APPLProtein.Edit
430
440
450
460
470
480
412 N S E M E N E N D K I V P K A T A S L P E A - E E L I A P G T P I Q F D I V L P A T E F L D Q - - - - - - - N R G S R R 26C/C9/2Protein300600.Edit
421 P T A R T S S S G S L G S E S T N L A A L S L D S L V A P D T P I Q F D I I S P V C E - - D Q P G Q A K A F G Q G G R R AF169797APPLProtein.Edit
490
500
510
520
530
540
464 T N P F G E T E D E S F P E A E D S L L Q Q M F I V R F L G S M A V K T D S T T E V I Y E A M R Q V L A A R A I H N I F 26C/C9/2Protein300600.Edit
479 T N P F G E S G G S T K S E T E D S I L H Q L F I V R F L G S M E V K S D D H P D V V Y E T M R Q I L A A R A I H N I F AF169797APPLProtein.Edit
550
560
570
580
590
600
524 R M T E S H L M V T S Q S L R L I D P Q T Q V S R A N F E L T S V T Q F A A H Q E N K R L V G F V I R V P E S T G E E S 26C/C9/2Protein300600.Edit
539 R M T E S H L L V T C D C L K L I D P Q T Q V T R L T F P L P C V V L Y A T H Q E N K R L F G F V L R T S S G R S E S N AF169797APPLProtein.Edit
610
620
630
640
650
660
584 L S T - - Y I F E S N S E G E K I C Y A I N L G K E I I - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - E 26C/C9/2Protein300600.Edit
599 L S S V C Y I F E S N N E G E K I C D S V G L A K Q I A L H A E L D R R A S E K Q K E I E R V K E K Q Q K E L N K Q K Q AF169797APPLProtein.Edit
670
680
690
700
710
611 V Q K D P E A L A Q L M L S I P - - - - L T N D G K Y V L L N D Q P D D D D G N P N E H R G A E S E A Z
659 I E K D L E E Q S R L I A A S S R P N Q A S S E G Q F V V L S S S Q S E E S D L G E G G K K R E S E A
26C/C9/2Protein300600.Edit
AF169797APPLProtein.Edit
Decoration 'Decoration #1': Shade (with solid bright yellow) residues that match the consensus named 'Consensus #1' exactly.
Abb. 4.31 Vergleich der Nukleotidsequenz von 26C/C9/2 mit APPL.
Durch Datenbankanalyse der Nukleotidsequenz von 26C/C9/2 konnten homologe Proteine identifiziert
werden. Das Protein mit der höchsten Homologie wird als APPL bezeichnet. Seine Nukleotidsequenz
wurde mit der von 26C/C9/2 verglichen und stimmte zu über 60% damit überein.
95
ERGEBNISSE
4.8 Charakterisierung von 26C/G8/2
Auch das 26C/G8/2 cDNA Fragment wies einen Unterschied bei der Differential Display-PCR
auf, der in einer quantitativen PCR bestätigt werden konnte. Dabei war das Fragment im
Tumorgewebe des Ovars von Patientin 26 und 31 etwa um den Faktor 10 höher exprimiert
als in der Referenzprobe. Aus diesem Grund bestimmte ich die genomische Struktur, das
vollständige Transkript und die sich daraus ableitende Aminosäuresequenz. Ferner habe ich
eine Klonierungsstrategie entwickelt, die es ermöglicht, das entsprechende Protein in
zahlreichen bakteriellen- und Säugerzellen zu exprimieren. Zusätzlich erfolgte die
Digoxigenin-Markierung eines cDNA-Fragments für die in situ Hybridisierung, damit die
Überprüfung der Expression in den zu untersuchenden Geweben durchgeführt werden kann.
4.8.1
in situ Hybridisierung von 26C/G8/2 und 26C/C9/2
Nachdem durch quantitative PCR die Ergebnisse der Differential Display-PCR der
Fragmente von 26C/C9/2 und 26C/G8/2 verifiziert worden waren, bei denen größere mRNAMengen in den Tumorgeweben der Ovarien als im Eileiterepithel nachgewiesen wurden,
muß mit einer weiteren Methode bestimmt werden, ob diese Verhältnisse auch für
Tumorgewebe der Ovarien und normales Ovarepithel zutreffen. Die einfachste Methode
dafür ist die in situ Hybridisierung. Für die in situ Hybridisierung wurde von mir das Protokoll
zur Digoxigenin-Markierung von DNA-Fragmenten standardisiert und auf die beiden Proben
angewandt. Die Markierung der Proben ist in Kapitel 3.36 beschrieben. Ein Beispiel dafür ist
in Abb. 4.32 dargestellt.
Abb. 4.32 Dot Blot zur Überprüfung der Effizienz der Digoxigenin-Markierung.
Auf die Nitrozellulose wurden die Digoxigenin-markierten sense- (26C/G8/2 EcoRV) und antisenseRNAs (26C/G8/2 BamHI) eines Fragments von 26C/G8/2 und einer gebrauchsfertigen Kontrolle
(Digoxigenin-markierte antisense Neo-RNA) aufgetragen. Die Menge der RNA betrug jeweils 10 ng,
1 ng, 0,5 ng, 0,1 ng, 0,01 ng, 0,005 ng und 0,001 ng. Mit dem Anti-Digoxigenin-AP Antikörper (Roche,
Mannheim) erfolgte die Nachweisreaktion. In dieser Darstellung sind die Signale der Kontrolle etwas
stärker als die der 26C/G8/2-Fragmente. Der Dot Blot ermöglicht die Abschätzung der Effizienz der
Markierungs-Reaktion.
Da diese Durchführung der in situ Hybridisierung erst vor kurzem in dem Arbeitskreis von
Prof. Ponstingl etabliert wurde, war es noch nicht möglich, eine komplette Hybridisierung
durchzuführen.
96
ERGEBNISSE
4.8.2
Struktur des 26C/G8/2-Gens
Der größte Teil des 26C/G8/2-Gens konnte anhand der drei humanen genomischen DNASequenzen der Klone RP11-464D19 (AC027018), RP11-181D18 (AC018620) und RP11353G20 (AC021897) bestimmt werden. Aufgrund der Chromosomenlokalisation der Klone
konnte das Gen der Bande 8q13 auf dem langen Arm des Chromosoms 8 zugeordnet
werden. Es besteht aus mehr als 14 Exons, wovon die Exons e1–e12 Teile des Klones
RP11-464D19, Exon ey und ez Teile der Klone RP11-181D18 und RP11-353G20 sind.
Zusätzlich zu dem Gen auf 8q13 befindet sich in der Chromosomenbande Xq21.31 ein
Pseudogen. Dieses wird durch die Klone RP13-140E4 (AL121877) und RP13-436D9
(AL590041) repräsentiert. Die 5‘- und 3‘-Spleißstellen der Exon-Intron-Übergänge sowie
weitere Daten zu den einzelnen Exons sind aus Tab. 4.5 zu entnehmen.
Exon Größe
(bp)
Position RP11464D19 bzw.
5‘-Spleiß-Donor
cDNA
Position
Intron Größe
(kb)
3‘-SpleißAkzeptor
RP11-181D18
e1
58
168432 -
168375
1 -
58
GAAGGTAAAT
i1
7,1
TGTTAGAGGC
e2
113
161461 -
161349
59 -
171
GAAGGTAATC
i2
1,6
TTCCAGTTTT
e3
66
159942 -
159877
172 -
237
TCAGGTGAGT
i3
29,3
TTACAGCTTC
e4
131
130755 -
130625
238 -
368
AAAGGTAAGG
i4
20,5
TCTAAGATGT
e5
160
110406 -
110247
369 -
528
CCAGGTATGG
i5
15,7
AAACAGGCAG
e6
136
94834 -
94699
529 -
664
AGAGGTTTGT
i6
56,0
TTTTAGGTAT
e7
160
39041 -
38882
665 -
824
TCAGGTGTGG
i7
1,8
ATTTAGAATG
e8
108
37372 -
37265
825 -
932
TGAGGTATGT
i8
2,0
TAATAGGTTA
e9
213
35546 -
35334
933 - 1145
AAAGGTAAGT
i9
10,2
TTTTAGGCCG
e10
138
25453 -
25316 1146 - 1283
GCAGGTATTT
i10
8,7
TATCAGGTGA
e11
132
16887 -
16756 1284 - 1415
GAAGGTAAGA
i11
12,5
TTTCAGACAG
e12
61
4421 -
4361 1416 - 1476
AATAGTAAGT
i12
4,4
?
?
?
TTTTAGGCAG
AAAAGTGAGT
iy
1,1
CTTTAGACAA
308
ey
89
95181 -
95269 1719 - 1808
ez
1095
96418 -
97512 1809 - 2903
?
Tab. 4.5 Struktur des 26C/G8/2-Gens.
Die oben genannten 5‘- und 3‘-Spleißstellen der Exon-Intron-Übergänge entsprechen dem
konservierten Sequenzmuster. Die Organisation des Gens, das zu dem Transkript von
26C/G8/2 führt, ist in Abb. 4.33 dargestellt.
97
ERGEBNISSE
Abb. 4.33 Organisation des 26C/G8/2-Gens und seines Transkripts.
Das 26C/G8/2-Gen ist Teil der Klone RP11-464D19 (AC027018), RP11-181D18 (AC018620) und
RP11-353G20 (AC021897). Aufgrund der mangelnden Sequenzüberlappung (fehlende(s) Exon(s))
zwischen Klone RP11-464D19 mit den Klonen RP11-181D18 bzw. RP11-353G20 konnte die Größe
des/der Introns nicht bestimmt werden. Das Gen befindet sich in der Chromosomenbande 8q13. Ein
Pseudogen konnte der Chromosomenbande Xq21.31 zugeordnet werden. Der offene Leseraster von
26C/G8/2 erstreckt sich zu etwa 20% in Exon ez hinein. Es resultiert hieraus ein Molekulargewicht von
etwa 63 kDa.
Das Contig, das zur vollständigen Sequenz des Transkripts führt ist in Abb. 4.34, die daraus
resultierende Sequenz ist in Abb. 4.35 dargestellt. Der ursprüngliche DD-Klon ist gelb, der
offene Leseraster durch Großbuchstaben gekennzeichnet.
Abb. 4.34 Contig von 26C/G8/2.
Das Contig wurde mit Hilfe des Programms SeqManII des DNASTAR-Pakets erstellt.
98
ERGEBNISSE
1
|
|
|
|
|
|60
agttctctgtagtgtttgccaatgttggagccgtctgcaaagtgtccccggcaagaagag
|
|
|
|
|
|120
61
gctgcctaccacaaggactttagcttactttttaaagattgaagaaaaaaaagaagacag
121
|
|
|
|
|
|180
aaaaagaagaactcaaagatacacaaagtaatttgaaccaaggctcagaagtttttggag
181
|
|
|
|
|
|240
ccgtgagggatacagcagtttggtcaatattgtcttaacatgcttcaaataaatcagctt
241
|
|
|
|
|
|300
ctctccaagataaaATGGCAAACCCAAAAGAGAAAACTGCAATGTGTCTGGTAAATGAGT
301
|
|
|
|
|
|360
TAGCCCGTTTCAATAGAGTCCAACCCCAGTATAAACTTCTGAATGAAAGAGGGCCTGCTC
361
|
|
|
|
|
|420
ATTCAAAGATGTTCTCAGTGCAGCTGAGTCTTGGTGAGCAGACATGGGAATCCGAAGGCA
421
|
|
|
|
|
|480
GCAGTATAAAGAAGGCTCAGCAGGCTGTTGCCAATAAAGCTTTGACTGAATCTACGCTTC
481
|
|
|
|
|
|540
CCAAACCAGTTCAGAAGCCACCCAAAAGTAATGTTAACAATAACCCAGGCAGTATAACTC
541
|
|
|
|
|
|600
CAACTGTGGAACTGAATGGGCTTGCTATGAAAAGGGGAGAGCCTGCCATCTACAGGCCAT
601
|
|
|
|
|
|660
TAGATCCAAAGCCATTCCCAAATTATAGAGCTAATTACAACTTTCGGGGCATGTACAATC
661
|
|
|
|
|
|720
AGAGGTATCATTGCCCAGTGCCTAAGATCTTTTATGTTCAGCTCACTGTAGGAAATAATG
721
|
|
|
|
|
|780
AATTTTTTGGGGAAGGAAAGACTCGACAAGCTGCTAGACACAATGCTGCAATGAAAGCCC
781
|
|
|
|
|
|840
TCCAAGCACTGCAGAATGAACCTATTCCAGAAAGATCTCCTCAGAATGGTGAATCAGGAA
841
|
|
|
|
|
|900
AGGATATGGATGATGACAAAGATGCAAATAAGTCTGAGATCAGCTTAGTGTTTGAAATTG
901
|
|
|
|
|
|960
CTCTGAAGCGAAATATGCCTGTCAGTTTTGAGGTTATTAAAGAAAGTGGACCACCACATA
961
|
|
|
|
|
|1020
TGAAAAGCTTTGTTACTCGAGTGTCAGTAGGAGAGTTCTCTGCAGAAGGAGAAGGAAATA
|
|
|
|
|
|1080
1021
GCAAAAAACTCTCCAAGAAGCGCGCTGCGACCACCGTCTTACAGGAGCTTAAAAAACTTC
1081
|
|
|
|
|
|1140
CACCTCTTCCTGTGGTGGAAAAGCCAAAACTATTTTTTAAAAAACGCCCTAAAACAATAG
1141
|
|
|
|
|
|1200
TAAAGGCCGGACCAGAATATGGCCAAGGGATGAACCCTATTAGCCGCCTGGCGCAAATTC
|
|
|
|
|
|1260
1201
AACAGGCCAAAAAGGAAAAGGAGCCGGATTATGTTTTGCTTTCAGAAAGAGGAATGCCTC
1261
|
|
|
|
|
|1320
GACGTCGAGAATTTGTGATGCAGGTGAAGGTAGGCAATGAAGTTGCTACAGGAACAGGAC
1321
|
|
|
|
|
|1380
CTAATAAAAAGATAGCCAAAAAAAATGCTGCAGAAGCAATGCTGTTACAACTTGGTTATA
|
|
|
|
|
|1440
1381
AAGCATCCACTAATCTTCAGGATCAACTTGAGAAGACAGGGGAAAACAAAGGATGGAGTG
1441
|
|
|
|
|
|1500
GTCCAAAGCCTGGGTTTCCTGAACCAACAAATAATACTCCAAAAGGAATTCTTCATTTGT
1501
|
|
|
|
|
|1560
CTCCTGATGTTTATCAAGAGATGGAAGCCAGCCGCCACAAAGTAATCTCTGGCACTACTC
1561
|
|
|
|
|
|1620
TAGGCTATTTGTCACCCAAAGATATGAACCAACCTTCAAGCTCTTTCTTCAGTATATCTC
99
ERGEBNISSE
1621
|
|
|
|
|
|1680
CCACATCGAATAGTTCAGCTACAATTGCCAGGGAACTCCTTATGAATGGAACATCTTCTA
|
|
|
|
|
|1740
1681
CAGCTGAAGCCATAGGTTTAAAAGGAAGTTCTCCTACTCCCCCTTGTTCTCCAGTACAAC
1741
|
|
|
|
|
|1800
CTTCAAAACAACTGGAATATTTAGCAAGGATTCAAGGCTTTCAGGCAGCCTTAAGTGCCT
1801
|
|
|
|
|
|1860
TGAAACAATTTTCTGAACAAGGACTGGATCCAATCGATGGAGCAATGAATATCGAAAAAG
|
|
|
|
|
|1920
1861
GTTCTCTTGAAAAACAAGCCAAGCATCTGAGAGAGAAAGCGGACAATAACCAGGCACCCC
1921
|
|
|
|
|
|1980
CGGGCTCCATCGCTCAGGACTGCAAGAAATCAAACTCGGCCGTCTAGcagctcccagaac
1981
|
|
|
|
|
|2040
ccgcggctgccaccgcatccttataaacctgtcagcacgcatgagggtgtctgtgttcag
|
|
|
|
|
|2100
2041
ggaaatgaatgactaataccattatttgagtcttatgtgaagacaacactattctaacac
2101
|
|
|
|
|
|2160
gagagataatatacatggtactgtttattcaactggggaaaaataaaactttgagcattt
2161
|
|
|
|
|
|2220
cccttggaactcgagatcagatcataactcatttgcctagaggcagcagaaatctgatcc
|
|
|
|
|
|2280
2221
tgctactggagcttaaaataacaagtaaagaaaagtgttagaaacaaagctaaaatttta
2281
|
|
|
|
|
|2340
acatgattaataatagagaagttgggtttggttctgttgttatgattgttttgtcgtggt
2341
|
|
|
|
|
|2400
gcttgtgttcagttatattctctctctctctcatttcaaatactgcttgacaattcgaaa
2401
|
|
|
|
|
|2460
atgaaccaatgatgtgctgtggaatgtgatggttgtcttcctatagagtcacatggtttc
2461
|
|
|
|
|
|2520
tctttttatgcagatatttataatcttcatcctatatcagtaggaataactataaggtgc
2521
|
|
|
|
|
|2580
actacaaaaagatgtatgcaaacaaacatgttttaaatcaggtcagatatctgatgaaaa
2581
|
|
|
|
|
|2640
atacgaactaatgttaagagcaagtagtttcaacatactccaggaactgagaaacaaaac
2641
|
|
|
|
|
|2700
aaagcaattgtgggttttgagctccatatactcttagcaagtaagggggcgtcttgcccc
2701
|
|
|
|
|
|2760
tatatatcatcttcccggattccactccctgttgtgggaatcgcgcccacccccatccgt
2761
|
|
|
|
|
|2820
gtgttgtagccactcacggtttgcatcaagagtgttttttgtaactgcctctggacttgg
2821
|
|
|
|
|
|2880
gacagtgagtaggatcaaaaataaataatgtacatgacggggaagggaaaaacctgttgg
2881
|
|
|
|
|
|2940
agttgcttccagccagccacgctccgggccagcatgttggaatccagcgtggagcagatg
2941
|
|
|
|
|
2993
cagtaaaaatgtggttggtttctgtgtgaaaaaaaaaaaaaaaaaaaaaaaaaa
Abb. 4.35 Sequenz des Transkripts von 26C/G8/2.
Insgesamt umfaßte die durch Datenbankanalyse ermittelte Sequenz 2968 bp. Die ursprüngliche
Sequenz des 26C/G8/2 DD-PCR Produkts ist gelb unterlegt, die beiden Arbitraryprimer 8, mit denen
es geprimt wurde, sind fett gedruckt. Es existiert kein konserviertes Polyadenylierungssignal der Form
AATAAA oder ATTAAA in der in Frage kommenden Region. Ein Teil des poly(A)-Schwanzes ist mit
unterstrichener Linie, der offene Leseraster durch Großbuchstaben gekennzeichnet.
100
ERGEBNISSE
Durch die Bestimmung der Sequenz des offenen Leserasters von 26C/G8/2 konnte die
Aminosäuresequenz
des
Proteins
abgeleitet
werden.
Sie
umfaßt
insgesamt
570
Aminosäurereste und ist in Abb. 4.36 dargestellt.
1
|
|
|
|
|
|60
MANPKEKTAMCLVNELARFNRVQPQYKLLNERGPAHSKMFSVQLSLGEQTWESEGSSIKK
61
|
|
|
|
|
|120
AQQAVANKALTESTLPKPVQKPPKSNVNNNPGSITPTVELNGLAMKRGEPAIYRPLDPKP
|
|
|
|
|
|180
121
FPNYRANYNFRGMYNQRYHCPVPKIFYVQLTVGNNEFFGEGKTRQAARHNAAMKALQALQ
181
|
|
|
|
|
|240
NEPIPERSPQNGESGKDMDDDKDANKSEISLVFEIALKRNMPVSFEVIKESGPPHMKSFV
241
|
|
|
|
|
|300
TRVSVGEFSAEGEGNSKKLSKKRAATTVLQELKKLPPLPVVEKPKLFFKKRPKTIVKAGP
301
|
|
|
|
|
|360
EYGQGMNPISRLAQIQQAKKEKEPDYVLLSERGMPRRREFVMQVKVGNEVATGTGPNKKI
361
|
|
|
|
|
|420
AKKNAAEAMLLQLGYKASTNLQDQLEKTGENKGWSGPKPGFPEPTNNTPKGILHLSPDVY
421
|
|
|
|
|
|480
QEMEASRHKVISGTTLGYLSPKDMNQPSSSFFSISPTSNSSATIARELLMNGTSSTAEAI
481
|
|
|
|
|
|540
GLKGSSPTPPCSPVQPSKQLEYLARIQGFQAALSALKQFSEQGLDPIDGAMNIEKGSLEK
541
|
|
|570
QAKHLREKADNNQAPPGSIAQDCKKSNSAV
Abb. 4.36 Aminosäuresequenz des 26C/G8/2 Proteins.
4.8.3
Eigenschaften des 26C/G8/2-Proteins
In Abb. 4.37 ist das Ergebnis der Sekundärstrukturanalyse von 26C/G8/2 abgebildet. Das
etwa 63 kDa schwere Protein weist überwiegend α-Helices auf, die mit wenigen βFaltblattstrukturen durchsetzt sind. Es werden nur wenige aperiodische Bereiche
vorhergesagt. Der theoretisch bestimmte isoelektrische Punkt liegt bei etwa 10,4. Durch
Datenbankanalyse konnten keine Transmembran-Regionen oder ER-Retentionsmotive
nachgewiesen werden. Laut PSORT-Analyse befindet sich das Protein wahrscheinlich im
Kern.
101
ERGEBNISSE
50
100
150
200
250
300
350
400
450
500
550
A
Alpha, Regions - Garnier-Robson
A
Alpha, Regions - Chou-Fasman
B
Beta, Regions - Garnier-Robson
B
Beta, Regions - Chou-Fasman
T
Turn, Regions - Garnier-Robson
T
Turn, Regions - Chou-Fasman
C
Coil, Regions - Garnier-Robson
2.83
0
Hydrophilicity Plot - Kyte-Doolittle
-2.34
*
Alpha, Amphipathic Regions - Eisenberg
*
Beta, Amphipathic Regions - Eisenberg
F
Flexible Regions - Karplus-Schulz
3.4
0
Antigenic Index - Jameson-Wolf
6
1
Surface Probability Plot - Emini
Abb. 4.37 Sekundärstruktur des 26C/G8/2-Proteins nach Vorhersage mit dem Programm
Protean des DNASTAR-Pakets.
Das 26C/G8/2-Protein besitzt 4 doppelsträngige RNA Bindungs-Motive (Position 9-74, 96180, 208-273 und 308-374). Eine Darstellung des Aufbaus des Proteins ist in Abb. 4.38 zu
sehen.
Abb. 4.38 Aufbau der Proteinstruktur des 26C/G8/2-Proteins nach Vorhersage mit SMART,
einem Progamm des EMBL.
Die Abkürzung dsRNA-BM steht für doppeltsträngiges RNA Bindungs-Motiv.
Zahlreiche Proteine besitzen eine ähnliche Domänen-Organisation wie das 26C/G8/2Protein. Die doppelsträngigen RNA Bindungs-Motive sind nicht nur in eukaryontischen,
sondern auch in zahlreichen bakteriellen und viralen Proteinen anzutreffen. In insgesamt 70
102
ERGEBNISSE
verschiedenen Spezies sind Proteine mit dieser Domäne vertreten. Beispiele für diese
Spezies sind Homo sapiens (in 56 verschiedenen Proteinen), Mus musculus, Drosophila
melanogaster,
Musca
domestica,
Caenorhabditis
elegans,
Arabidopsis
thaliana,
Saccharomyces cerevisiae, Escherichia coli und Bacillus subtilis. In Abb. 4.39 sind fünf
Proteine der am nächsten verwandten Proteine zum 26C/G8/2-Protein, zu sehen. Dies sind
Proteine von Drosophila melanogaster, Drosophila virilis, Homo sapiens und Musca
domestica.
Abb. 4.39 Proteine mit Ähnlichkeiten zur Proteinstruktur von 26C/G8/2.
103
DISKUSSION
5
Diskussion
Eine Krebserkrankung der Ovarien führt bei den meisten Patientinnen zum Tod. Gründe
dafür sind mangelnde Beschwerden der betroffenen Frauen während der Entstehungsphase
des Krebses, in der eine Therapie noch relativ gute Aussichten hätte und das Fehlen von
diagnostischen Markern, um die Krankheit rechtzeitig zu identifizieren, wie sie heute bereits
für Cervix- oder Colonkarzinome zur Verfügung stehen.
Damit eine frühe Diagnose möglich wird und bessere Therapien angewandt werden können,
muß an der Identifizierung neuer Marker gearbeitet werden. Auch diese Arbeit beschäftigt
sich mit der Entstehung ovarieler Karzinome. Hierzu wurde die Veränderung des
Genexpressionsmusters des Ovarepithels bei Tumoren untersucht. Die Betrachtung des
Epithels ist deshalb von entscheidender Bedeutung, da die überwiegende Anzahl der
Ovartumoren epithelialen Ursprungs sind. Im Zusammenhang mit der Asservation der
Epithelien sind einige Punkte zu beachten.
5.1 Problematik der Probengewinnung und Lösungsansätze
5.1.1
Gewebe von Patientinnen
Wie bereits in Kapitel 4.1 gezeigt wurde, müssen die zu untersuchenden Gewebe eine hohe
Qualität aufweisen. Kriterien für die Qualität sind die Integrität und die Reinheit der Proben.
Die Integrität der Gewebe kann nur gewährleistet werden, wenn die Gewebeproben nach der
operativen Entnahme unverzüglich in einen geeigneten Puffer überführt werden, um die
endogene RNase-Aktivität zu minimieren. Die Reinheit der Probe muß gesichert sein, damit
beim Vergleich der Gewebeexpression der Einfluß nichtepithelspezifischer Unterschiede
vermieden wird.
Die in dieser Arbeit verwendeten Zellen wurden durch Abstrich gewonnen. Sowohl was die
Integrität als auch die Reinheit der Proben betrifft, mußten wir uns zunächst auf die
Fähigkeiten und Erfahrungen unserer klinischen Kooperationspartner verlassen, da die
Überprüfung dieser Kriterien unsererseits nur eingeschränkt möglich war. Es gelang, den
Zustand der RNA der Tumorproben des Ovars aufgrund der RNA-Verteilung nach
elektrophoretischer Trennung zu analysieren. Die Überprüfung der Integrität der RNA aus
dem Tubenepithel und die Prüfung der Gewebe auf nichtepitheliale Verunreinigungen war
uns
jedoch
nicht
möglich.
Der
mesenchymale
Anteil
der
Zellen
konnte
mit
molekularbiologischen Methoden nicht abgeschätzt werden, da ich selbst nach intensiver
Datenbankrecherche keinen hinreichenden Marker identifizieren konnte, der nur in der
Basalschicht, nicht aber im Ovarepithel vorkommt. Der Grund dafür liegt in der
105
DISKUSSION
Entwicklungsgeschichte der Ovarien, bei der sich die Gonaden aus dem Coelomepithel, dem
darunterliegenden Mesenchym und den primordialen Keimzellen entwickeln (Moor, 1973).
Die Untersuchung der Gewebe auf Kontaminationen durch Blutzellen gelang im Gegensatz
dazu durch den Einsatz von Primern für ein CD53-Fragment zusammen mit cDNA aus den
Gewebeproben. Da CD53 fast ausschließlich auf lymphatischen und myeloiden Zellen
nachgewiesen werden kann, würde der Nachweis größerer Mengen an CD53 für eine
Verunreinigung sprechen. Es ist dann ratsam, auf die Untersuchung solcher Gewebe zu
verzichten.
Doch selbst geringe Spuren an nichtepithelialen Bestandteilen, wie sie oft nicht vermeidbar
sind und auch z.B. in den Geweben von Patientin 30 vorkamen, kann zu falsch positiven
Ergebnissen bei der Analyse der Genexpression führen, die durch weitere Experimente, wie
z.B. die in situ Hybridisierung, überprüft werden müssen.
Das Problem der Gewebeverunreinigungen, das gerade im Verlauf meiner Arbeit immer
deutlicher wurde, konnte durch eine geeignete Mikrodissektions-Methode gelöst werden. Seit
kurzem
verfügt
der
Arbeitskreis
Mikrodissektionsapparatur,
bei
von
der
Prof.
Ponstingl
entsprechende
über
eine
Zellverbände
laser-gestützte
aus
einzelnen
Gewebeschnitten herausgelöst und somit reinere Proben gewonnen werden können (siehe
Kapitel 4.1). Ein Nachteil dabei besteht sicherlich in einem bedeutenden zeitlichen
Mehraufwand bei der Probengewinnung, der aber in jedem Fall in Anbetracht der folgenden
Schritte und der Bedeutung für das gesamte Projekt unerläßlich ist.
Große Bedeutung muß auch der Asservation der zu vergleichenden Gewebe zugemessen
werden. Wie bereits in Kapitel 4.2 erwähnt, ist es uns nicht möglich, Abstriche des gesunden
Ovarepithels und des Tumorgewebes des Ovars derselben Patientin zu erhalten, da das
gesunde Ovar entweder nicht entnommen werden darf oder aber das Epithel durch
kontinuierliche Ovulationen stark geschädigt ist. Deshalb wurde bereits vor Beginn meiner
Arbeit, in Absprache mit den klinischen Kooperationspartnern, der Kompromiß eingegangen,
Gewebe gleicher embryologischer Abstammung zu vergleichen. Dazu wurde das Epithel der
Tube als Pendant zum Karzinomgewebe asserviert. Wie ich später jedoch feststellen konnte,
weicht die embryologische Entwicklung der beiden Gewebe voneinander ab.
Die undifferenzierten Gonaden, bei denen es sich um die Vorläufer der Testis und Ovarien
handelt, entwickeln sich vollständig aus dem Coelomepithel, dem sich darunter befindenden
Mesenchym und den primordialen Keimzellen (Moor, 1973). Im Gegensatz dazu ist die
Abstammung der Eileiter umstritten. Es gibt dazu zwei unterschiedliche Hypothesen.
106
DISKUSSION
Die erste besagt, daß der gesamte Eileiter vollständig vom Coelomepithel abstammt. Hierbei
soll eine massive epitheliale Proliferation vom Trichter ausgehend in das darunterliegende
Mesenchym hineinwandern und sich zu einer tubulären Struktur ausbilden. Die massive
Spitze wird so nahe mit dem Wolffschen Gang verbunden, daß keine basale Membran beide
Epithelien voneinander trennt. Laut dieser Theorie dient der Wolffsche Gang lediglich als
eine „Führungshilfe“ für den Müllerschen Gang, um den Sinus urogenitalis zu erreichen
(Ludwig, 1998).
Der zweiten Hypothese nach ist nur das ursprüngliche Segment des Müllerschen Gangs, das
später das Infundibulum und zu einem gewissen Grad die Ampulle bildet, eine unabhängige
Formation aus dem Coelomepithel. In der Gegend des Mesonephros (Urniere) fusioniert der
Müllersche- mit dem Wolffschen Gang; der Wolffsche Gang schwillt zur Ampulle und zum
Isthmus an. Unterhalb des caudalen Pols des Mesonephros entwickelt sich der Müllersche
Gang als Auswuchs des Wolffschen Gangs und nicht länger als unabhängige Struktur.
Die zweite Hypothese, die von der Fusion von Müllerschem- mit Wolffschem Gang ausgeht,
wurde von Ludwig (1998) belegt. Dazu wurden Gewebeschnitte von Embryonen
unterschiedlichen Alters und Entwicklungsstadien verglichen. In Abb. 5.1 ist ein Diagramm
dargestellt, das die Entwicklung des Müllerschen Gangs zeigt. Dabei entspricht der mit MDt
(grau unterlegt) gekennzeichnete Teil des Eileiters der Region, die aus dem Coelomepithel
gebildet
wurde. Der mit MDw bezeichnete (nicht
unterlegte)
Bereich
zeigt
das
Verschmelzungsprodukt von Wolffschem- und Müllerschem Gang.
Abb. 5.1 Diagramm der Entwicklung des Müllerschen Gangs (Ludwig, 1998).
Der mit MDt bezeichnete Bereich entwickelt sich aus dem Coelomepithel ohne die Mitwirkung des
Wolffschen Gangs (WD). Der mit MDw bezeichnete Müllersche Gang proliferiert vom Wolffschen Gang
aus. Mit Me ist der Mesonephros, mit G die Gonade, mit GL das caudale Gonaden-Ligament, mit I das
inguinale Ligament des Mesonephros, mit Cu der Canalis Uterovaginalis und mit S der Sinus
Urogenitalis gekennzeichnet.
107
DISKUSSION
Für diese Hypothese sprechen nicht nur Gewebeschnitte, auch eine Krankheit, das MayerRokitansky-Küster-Syndrom, das verschiedene Ausprägungen besitzt, läßt sich durch die
Nichtverschmelzung beider Gänge erklären (Ludwig, 1998). Bei dieser Krankheit ist der
Müllersche Gang lediglich bis zum caudalen mesonephritischen Ligament, dem runden
Ligament, ausgebildet, das in einer muskulären Verdickung endet. So liegt beispielsweise
beim Bilateralen MRK-Syndrom der Uterus als Rudiment vor, eine Verbindung zur Vagina
fehlt (uterus bispartitus rudimentarius solidus seu partim excavatus, Vagina rudimentaria).
Beim Unilateralen MRK-Syndrom ist der Uterus ausgebildet, die Verbindung besteht jedoch
nur zu einem Eileiter (uterus unicornis cum cornu rudimentario, Vagina simplex).
Da die embryologische Entwicklung von Tube und Ovar voneinander abweicht, darf lediglich
der oberste Teil, das Infundibulum, des Eileiters mit dem Tumorgewebe des Ovars
verglichen werden.
Nur durch den Vergleich von Gewebe gleicher Abstammung kann ausgeschlossen werden,
daß aufgezeigte Unterschiede nicht von vorneherein auf unterschiedlicher embryonaler
Entwicklung beruhen. Damit ist als Referenzgewebe in unserem Fall das Infundibulum die
geeignetste Probe für die Untersuchungen. Dies konnte experimentell bestätigt werden. So
erwiesen sich die mit Differential Display untersuchten Proben aus Tumoren des Ovars und
Infundibulumepithelien als sehr ähnlich. Die Genexpression von Tubenepithel und
Tumorgewebe des Ovars mit den verschiedenen Primerkombinationen waren bei fast allen
Banden identisch. Nur in Ausnahmefällen wurden differentiell exprimierte Gene gefunden.
Die Vergleichbarkeit, speziell bei krankhafter Veränderung, wird durch Erkenntnisse
untermauert, die zeigen, daß Tumoren des Ovidukts denen von Ovarien molekularbiologisch
sehr ähnlich sind (Pere et al., 1998).
Da die ermittelten Genexpressionsunterschiede zwischen Tumorgewebe und Tubenepithel
zwei unterschiedlich differenzierte Gewebe betreffen, müssen sie mit einer weiteren
Methode, beispielsweise der in situ Hybridisierung, überprüft werden. Bei dieser Methode
werden Gewebeproben von gesundem Ovar, bei dem fast immer auch Bereiche mit Resten
des Epithels erhalten sind und Infundibulum von einer Patientin, sowie Tumorprobe einer
anderen Patientin eingesetzt. Die markierten Sonden können mit den entsprechenden
mRNAs
aller
Gewebeproben
hybridisieren.
Somit
werden
Unterschiede
in
der
Genexpression zwischen Eileiter- und Tumorepithel, die nicht mit der Tumorentstehung in
Zusammenhang stehen, sondern durch die Verwendung verschiedener Gewebetypen
bedingt sind, ermittelt. Erst wenn die Ergebnisse der derzeit im Arbeitskreis durchgeführten
in situ Hybridisierung vorliegen, sind die Daten von 26C/C9/2 und 26C/G8/2 im
Zusammenhang mit der Ovarialtumorentstehung belastbar, so daß die vorliegenden Daten
publiziert werden können.
108
DISKUSSION
Die geringen Mengen an asserviertem Gewebe der Patientinnen führten zu einer
zusätzlichen Einschränkung. Üblicherweise waren die Gewebeproben des Tumors völlig
ausreichend, um die Mehrzahl der Primerkombinationen anzuwenden. Limitierend waren
jedoch die Zellen des normalen Tubenepithels, bei dem die Probenentnahme aus dem
geschlossenen Zellverband schwierig ist. Aus diesem Grund konnten bei Patientin 26 sehr
viel weniger Primerkombinationen verwendet werden, als es zu Beginn geplant war. Damit
wurden die ursprünglichen Erwartungen, alle mRNAs zu erfassen, zwar nicht erfüllt, es
konnten dennoch einige sehr interessante Unterschiede ermittelt und weiterverfolgt werden.
5.1.2
Primärzellkulturen
Ein völlig anderer Ansatzpunkt in der Bereitstellung von Referenzgewebe geht von
Ovaroberflächenepithel selbst aus. So könnten Primärkulturen von Oberflächenepithel als
alternative Refernz zur Tube verwendet werden (Hough et al., 2001). Diese Zellkulturen
besitzen jedoch neben einem anderen Hormonstatus auch eine andere Histokompatibilität
als die ursprünglichen Oberflächenepithelzellen. Selbst Haushaltgene wie G3PDH oder βActin, die für das Überleben der Zellen essentiell sind, weisen bei Zellkulturzellen gegenüber
den ursprünglichen Zellen ein anderes Expressionsmuster auf (Daten hier nicht gezeigt). Ein
weiterer Grund, der gegen die Verwendung von Primärkulturen als Refernz spricht ist, daß
die Zellinien aus Geweben verschiedener Patientinnen gewonnen wurden. Die Gewebe
haben somit eine andere Vorgeschichte, die beispielsweise das Alter der Patientin oder die
Therapierung angeht. Aus den genannten Gründen wurde in der Arbeitsgruppe von Prof.
Ponstingl auf die Verwendung von Primärkulturen als Referenz verzichtet.
5.2 Vor- und Nachteile der subtraktiven Hybridisierung und des Differential
Displays
Für die Erfassung von Genexpressionsunterschieden zwischen zwei Zellpopulationen stehen
mehrere Methoden zur Verfügung (siehe auch Kapitel 1.1.4). Dazu gehören beispielsweise
die cDNA Microarrays (Emmert-Buck et al., 1996; Welsh et al., 2001), die subtraktive
Hybridisierung (Rouvier et al., 1993; Hubank und Schatz, 1994) und das Differential Display
(Liang und Pardee, 1992; Liang und Pardee, 1995; Liang und Pardee, 1997). Im Rahmen
meiner Dissertation verwendete ich zwei dieser Verfahren, die subtraktive Hybridisierung
mittels positiver PCR-Selektion und das Differential Display. Beide Methoden wiesen Vorund Nachteile auf, die hier kurz gegenübergestellt werden:
109
DISKUSSION
Der bedeutendste Vorteil bei der subtraktiven Hybridisierung liegt darin, selbst sehr selten
vorkommende mRNAs nachweisen zu können. Beim Differential Display liegt laut
Literaturaussage die Nachweisgrenze um etwa den Faktor 10 höher (Sagerström et al.,
1997; Matz und Lukyanov, 1998). Dies würde für mRNAs, die in geringer Anzahl vorliegen
bedeuten, daß sie vom Differential Display im Gegensatz zur subtraktiven Hybridisierung
nicht erfaßt werden und Unterschiede in der Expression unbemerkt bleiben. Eigene
Erfahrungen haben jedoch gezeigt, daß dies hier nicht der Fall war (siehe hierzu Kapitel 5.3).
Ein Nachteil bei der subtraktiven Hybridisierung besteht in der Notwendigkeit, in „beide
Richtungen“ subtrahieren zu müssen, damit in beiden Zellpopulationen erhöhte Mengen an
mRNAs ausfindig gemacht werden können. In „beide Richtungen“ subtrahieren bedeutet,
daß beide Zellpopulationen sowohl einmal Tester als auch einmal Driver sein müssen. Dies
ist ein deutlicher zeitlicher und materieller Mehraufwand im Gegensatz zum Differential
Display, bei dem gleichzeitig auf einem Gel reprimierte und induzierte mRNAs zu erfassen
sind. Ein weiterer Nachteil ist in der Unvollständigkeit der Subtraktion zu sehen. Zu viele
Subtraktionsrunden wären erforderlich, um sämtliche Unterschiede komplexer Gewebe zu
erfassen (Sagerström et al., 1997).
Vorteile des Differential Displays sind die rasche Durchführbarkeit der Methode, die geringe
Menge an mRNA die benötigt wird und die Möglichkeit, gleichzeitig auf einem Gel induzierte
und reprimierte mRNAs mehrerer Zellpopulationen zu identifizieren.
Nachteile sind die große Anzahl der Primer, die benötigt werden, um das Genspektrum eines
Gewebes abzudecken und die Häufigkeit der falsch positiven Ergebnisse (Callard et al.,
1994). Ursachen für falsch positive Ergebnisse können beispielsweise die PCR-Bedingungen
oder eine mangelnde elektrophoretische Auftrennung unterschiedlicher cDNAs einer Bande
sein.
Da nicht abzusehen war, welche Methode für unsere Zwecke die geeignete ist, testete ich
zunächst die Methode der subtraktiven Hybridisierung an Ovarialkarzinomzellinien. Die
eigentliche Subtraktion konnte erfolgreich durchgeführt werden. Da dazu jedoch entgegen
der Herstellerangaben mehr RNA eingesetzt werden muß, als vom Hersteller des Kits
angegeben
worden
war,
ist
eine
vorherige
Amplifikation
der
cDNA
aus
den
Patientengeweben unumgänglich. Wie in jeder PCR werden dabei einige Matrizen
bevorzugt, andere nur schlecht vermehrt (Luce and Burrows, 1998; Graf et al., 1997;
Ledakis et al., 1998; von Stein et al., 1997). Davon betroffen sind insbesondere niedrig
exprimierte DNAs, was dazu führt, daß diese nach PCR in der Gesamt-DNA vermindert
vorliegen. Somit ist die entstandene cDNA Population hinsichtlich der relativen Verhältnisse
110
DISKUSSION
der Einzelspezies zueinander mit der Ausgangspopulation nicht vergleichbar. Wird die auf
diese Art bereits selektierte DNA-Population bei den subtraktiven Hybridisierungs-PCRs
eingesetzt, entsprechen die Ergebnisse nicht mehr der ursprünglichen Verteilung.
Die Zweifel an der Reproduzierbarkeit der mit SMART amplifizierten DNA wurden durch
Ergebnisse anderer Arbeitsgruppenmitglieder bestätigt. In ihren Versuchen war die
vervielfältigte DNA in einer Differential Display PCR eingesetzt worden. Aus diesen Gründen
wurde auf die subtraktive Hybridisierung verzichtet und die Methode des Differential Displays
gewählt.
Wie auch bei der subtraktiven Hybridisierung zeigten sich bald Unzulänglichkeiten bei dieser
Methode. Einige der Probleme, wie z.B. das Vorkommen zahlreiche Anker/Anker geprimten
Banden, kurze cDNA-Fragmente und viele falsch positive Klone konnte ich durch
Modifikationen der Methode spürbar verbessern (siehe Kapitel 4.6).
Andere Schwierigkeiten blieben nach wie vor bestehen. Dazu zählt beispielsweise die
Zuordnung eines Fragments zu einem Unterschied in dem DD-PAGE, wenn mehrere
Fragmente gleicher Größe existieren. Hier bleibt nur die Möglichkeit, die sequenzierten
Inserts in Gruppen einzuteilen und alle Gruppen über eine semiquantitative PCR auf
differentielle Expression hin zu überprüfen. Dies dauert nicht nur sehr lange, sondern
erfordert zusätzlich sehr viel der limitierten cDNA. So mußte etwa die Hälfte der gesamten
zur Verfügung stehenden cDNA alleine für die Überprüfung der Unterschiede eingerechnet
werden.
Obwohl durch die Modifikation der Differential Display Methode bereits längere cDNAFragmente amplifiziert werden als mit der unmodifizierten Methode, entsprechen aufgrund
der Verwendung der Ankerprimer die cDNAs in der Regel der 3‘-untranslatierten Region
eines Gens. Für die Ermittlung der vollständigen Sequenz muß teilweise sehr viel Zeit
investiert werden, was doch als großer Nachteil der Methode anzusehen ist.
Trotz des Mankos, daß die Methode des Differential Displays mit zahlreichen Nachteilen
behaftet ist, muß sie jedoch unter den gegebenen Umständen für die Untersuchung der
subtraktiven Hybridisierung vorgezogen werden. Neben der raschen Durchführbarkeit besitzt
diese Methode den großen Vorteil geringe Mengen an mRNA zu benötigen und gleichzeitig
auf einem Gel induzierte und reprimierte mRNAs mehrerer Zellpopulationen zu identifizieren.
111
DISKUSSION
5.3 Ergebnisse des Differential Displays
Im Rahmen dieser Dissertation sollten mit Hilfe der Methode des Differential Displays
Genexpressionsunterschiede von Ovarialkarzinomen identifiziert werden. Es gelang mir,
mehrere Unterschiede zu ermitteln. Einige konnten einem bereits bekannten Protein
zugeordnet werden, andere besaßen zu dem Zeitpunkt der Sequenzierung nur sehr schwach
homologe ESTs in den Datenbanken. Im Laufe meiner Arbeit wurden jedoch sehr viele ESTs
veröffentlicht, die mit diesen cDNAs nun eine sehr hohe Übereinstimmung aufweisen. Dies
spricht dafür, daß im Gegensatz zur allgemeinen Auffassung niedrig exprimierte mRNAs mit
der Methode des Differential Displays erfaßt werden können.
Einige der bereits bekannten Unterschiede in Geweben von Patientinnen betrafen cDNAFragmente, die einem Teil der Transkripte von K-ras, dem Prefoldin5/c-Myc bindenden
Protein MM-1, einer kleinen GTPase oder Rabin2 entsprachen. Bislang nicht beschriebene
Unterschiede betrafen unter anderem die mRNAs von 26C/C9/2 oder 26C/G8/2.
5.3.1
Unterschiedlich
exprimierte
Zelloberflächenproteine
und
extrazelluläre
Signalproteine in Ovarialkarzinomzellinien
Um die Methode des Differential Displays zu verbessern, wurden einige Modifikationen bei
der reversen Transkription und der DD-PCR vorgenommen (siehe Kapitel 4.6). Bevor die
veränderte Methode an Geweben von Patientinnen angewandt wurde, erfolgte zunächst ein
Testlauf mit Hilfe von Ovarialkarzinomzellinien. Die folgenden Genexpressionsunterschiede,
wurden zwischen den Ovarialkarzinomzellinien GG und MT ermittelt.
Fibronectin
Durch das modifizierte Differential Display wurden relativ große Unterschiede bezüglich der
Fibronectin-Genexpression (X02761) zwischen den Ovarialkarzinomzellinien GG und MT
festgestellt. Die differentielle Expression in den Zellinien GG und MT und in weiteren
Ovarialkarzinomzellinien konnte ich mit Hilfe einer semiquantitativen PCR und Northern BlotAnalyse verifizieren (siehe Kapitel 4.6). Dabei traten besonders große Unterschiede
zwischen den Zellinien GG, bei der Fibronectin sehr stark exprimiert ist, und beispielsweise
den Zellinien Caov3 und NIH:OVCAR-3 auf, bei denen sehr viel schwächere Signale zu
verzeichnen sind.
Neben dem löslichen Plasma-Fibronectin, das im Blut und anderen Körperflüssigkeiten kreist
und vermutlich bei der Blutgerinnung, Wundheilung und Phagozytose mitwirkt, spielen
Fibronectin-Filamente als Bestandteile der extrazellulären Matrix eine wichtige Rolle. Sie
112
DISKUSSION
wirken bei der Anheftung der Zellen an die Matrix mit und dirigieren beispielsweise in der
Wirbeltierembryoentwicklung die Wanderung von Zellen (Alberts et al., 1995).
Im Zusammenhang mit dem Krebsgeschehen ist Fibronectin von besonderem Interesse, da
es an der Zelladhäsion, Migration und Proliferation beteiligt ist (Hynes, 1986).
Semaphorin E/3C
Ein weiterer Genexpressionsunterschied zwischen den Ovarialkarzinomzellinien GG und MT
konnte durch Analyse der NCBI Genbank als Teil der Semaphorin E (jetzt Semaphorin 3C)mRNA (AB000220) identifiziert werden. Das Differential Display cDNA-Fragment besaß eine
Länge von 624 bp und entsprach der Region 1177-1800 bp, die im offenen Leseraster des
Semaphorin E/3C (Sema 3C) Transkripts liegt.
Semaphorine sind extrazelluläre oder Transmembranproteine, die in der Entwicklung von
Geweben als chemoattraktive und repulsive Signale wirken. Semaphorin E/3C wird von den
Zellen
ausgeschieden,
es
besitzt
eine
Sema-Signaldomäne,
gefolgt
von
einer
immunglobulinartigen Domäne und einem kurzen basischen Bereich.
Martín-Satué und Blanco (1999) konnten experimentell eine Erhöhung des metastatischen
Potentials von menschlichen Lungen-Adenokarzinomzellinien bei Überexpression von
Semaphorin E/3C nachweisen. Auch Versuchsdaten von Yamada et al. (1997) sprechen für
eine Beteiligung von Semaphorin E/3C an der Cisplatin-Resistenz menschlicher Tumoren. In
Versuchen
konnte
eine
6fach
höhere
Expression
des
Proteins
in
resistenten
Ovarialkarzinomzellinien als in den nichtresistenten Ausgangszellinien nachgewiesen
werden.
Auf der Grundlage der experimentellen Daten, die auf Fibronectin und Semaphorin E/3C bei
der Krebsentstehung hinweisen, sollten durch unsere Kooperationspartner weitere
Informationen gesammelt werden. Durch Korrelation der Ergebnisse der Differential Display
Analyse mit Informationen zu den betroffenen Organen, wie schnell oder langsam der Tumor
metastasiert, welche Therapie angewandt wurde, und neue Details der pathologischen
Befunde für die Tumor-Diagnose, wäre dies möglich. Damit ließe sich das Bild bezüglich der
Eigenschaften und genetischen Charakterisierung der einzelnen Ovarialkarzinomzellinien
vervollständigen.
113
DISKUSSION
5.3.2
Komponenten von Signalübertragungswegen, die in Tumoren differentiell
exprimiert sind
Aus den Geweben von Patientin 26 konnten mit Hilfe der unmodifizierten DD-PCR mehrere
differentiell exprimierte cDNA-Fragmente isoliert werden, die Komponenten verschiedener
Signalübertragungswege darstellen. Dabei handelte es sich um cDNA-Fragmente mit der
Bezeichnung 26C/C1/1, 26C/C9/1, 26N/G16/1 und 26C/C9/2.
K-ras
Nach Reamplifikation des cDNA-Fragments 26C/C1/1 wurden zwei unterschiedliche DNAPopulationen ermittelt. Dabei besaßen zwei der Klone (26C/C1/1-6,10) eine Homologie zur
K-ras (M54968) mRNA und drei Klone (26C/C1/1-2,4,8) ein Insert mit einer Homologie zu
einer mRNA, die sowohl die Bezeichnung Prefoldin5 als auch MM-1 (D89667) trägt (siehe
unten).
Wie bereits in der Einleitung unter Kapitel 1.1.4 beschrieben ist, zählt K-ras zu den ProtoOnkogenen, das einen Knotenpunkt bei zahlreichen Signalübertragungswegen darstellt. So
vermittelt es unter anderem Informationen des epidermalen Wachstumsfaktors- oder des
Cytokin-Rezeptors auf Transkriptions-Faktoren des Zellkerns (Ellis und Clark, 2000).
In zahlreichen Veröffentlichungen sind Mutationen des K-ras Onkogens beschrieben, die in
Tumoren des Ovars auftreten (Mok et al., 1993; Gallion et al., 1995). Es liegen jedoch nur
wenige Daten vor, die eine erhöhte Genexpression von K-ras im Zusammenhang mit der
Tumorentstehung bei Adenokarzinomen des Ovars beschreiben (Filmus und Buick, 1985).
Bei Patientin 26 wurde die vermehrte Expression eines cDNA-Fragments im Tumorgewebe
und keine Mutation beobachtet.
26C/C9/1
Ein weiterer Genexpressionsunterschied wurde als 26C/C9/1 bezeichnet. Im Gegensatz zum
gesunden Tubenepithel war die Expression im Tumorgewebe des Ovars von Patientin 26
erhöht. Zwei Klone (26C/C9/1-3 und –5) waren zur mRNA einer bislang in der Literatur noch
nicht beschriebenen kleinen GTPase homolog. Es liegen keine weiteren Informationen über
dieses Protein vor.
Rabin3
Eine Komponente eines Signalübertragungsweges stellt das cDNA-Fragment 26N/G16/1, mit
Homologie zur mRNA des Ratten Rabin3 (RN19181) dar. Im Gegensatz zu den bislang
genannten Fragmenten, bei denen eine erhöhte Expression im Tumorgewebe von Patientin
114
DISKUSSION
26 festgestellt wurde, war die Expression von 26N/G16/1 im Tumorgewebe der selben
Patientin vermindert (siehe Kapitel 4.5.6).
Ursprünglich wurde Rabin3 (Rab3-interagierendes Protein) durch das Hefe-Zwei-HybridSystem als Bindungspartner zu Rab3A, einer kleinen GTPase, identifiziert. Rab3A wurde
bislang ausschließlich in neuroendokrinen Zellen nachgewiesen. Dort ist es mit den
sekretorischen Vesikelmembranen assoziiert. Mutationsanalysen zeigten, daß Rab3A eine
wichtige Rolle bei der regulierten Sekretion einnimmt. Möglicherweise kontrolliert das Protein
den Zusammenbau und die Auflösung inhibitorischer Komplexe, die eine VesikelVerschmelzung mit der Plasmamembran verhindern (Brondyk et al., 1995).
Das Rabin3-Protein hat eine molekulare Masse von 50 kDa und bildet in der Zelle
wahrscheinlich einen Komplex mit zusätzlichen Polypeptidketten, so daß ein etwa 200 kDaKomplex entsteht (Brondyk et al., 1995). Die N-terminale Region dieses Proteins ist mit einer
großen Gruppe von Proteinen verwandt, die hauptsächlich strukturelle Aufgaben bei der
Zytoskelettausbildung übernehmen. Zwei Regionen des Rabin3-Proteins zeigen jedoch
starke Homologien zu Sec2p, einem zytosolischen Protein von S.cerevisiae. Sec2p
interagiert mit Sec4p, einer kleinen GTPase, die zu 53% mit der Rab3A-Sequenz identisch
ist.
Dabei scheinen die Funktionen von Sec4p und Rab3a sehr ähnlich zu sein. Wie Rab3A ist
auch Sec4p eine essentielle Komponente des gerichteten sekretorischen Transports.
Obwohl die Daten von Rabin3 dafür sprechen, daß es eine Aufgabe beim Guanin-NukleotidAustausch von Rab3a übernimmt, konnten dafür noch keine Beweise geliefert werden
(Brondyk et al., 1995).
Ob die Überexpression von Rabin3 mit der Tumorentstehung in Zusammenhang steht, ist
noch unbekannt. Es gibt jedoch Befunde, die für einen veränderten Vesikeltransport bei
Tumoren sprechen. So trägt der erhöhte Auswärtstransport, wie bereits in Kapitel 1.2
beschrieben, der vermehrten Ausscheidung von Zellgiften und Chemotherapeutika aus den
Zellen bei, so daß diese trotz zytotoxischer Bedingungen überleben.
Prefoldin5/c-myc-bindendes Protein MM-1
Wie bereits oben erwähnt, wurden nach Reamplifikation des 26C/C1/1 cDNA-Fragments
zwei unterschiedliche DNA-Populationen ermittelt. Zwei Klone waren homolog zu einem Teil
der K-ras mRNA, drei Klone (26C/C1/1-2,4,8) hatten ein Insert mit einer Homologie zu einer
mRNA (D89667), die sowohl die Bezeichnung Prefoldin5 (dies ist eine Untereinheit des
Prefoldin-Chaperons) als auch MM-1 (ein c-Myc bindendes Protein) trägt.
115
DISKUSSION
Die Funktion dieses Fragments kann in der Unterstützung der Faltung von nicht nativen
Proteinen und/oder der Regulierung des c-Myc Onkogens bestehen.
Prefoldin ist ein Chaperon-Protein, das sich aus sechs verschiedenen Polypeptidketten
zusammensetzt. Die Untereinheiten drei, vier, fünf und sechs wurden zuvor als cDNAs eines
VHL (von Hippel-Lindau Tumorsuppressor Gen) bindenden Proteins (U56833), eines
Transkriptionsfaktors C1 (U41816), des c-Myc bindenden Proteins MM-1 (D89667) und eines
Proteins unbekannter Funktion mit Namen KE2 (Q03958) identifiziert. Untersuchungen
zeigten, daß eukaryontische Prefoldin-Proteine (H.sapiens, M.musculus, C.elegans,
S.cerevisiae) untereinander und auch zu dem Archaebakterium M.jannaschii stark homolog
sind (Vainberg et al., 1998). Das Chaperon Prefoldin unterstützt die Faltung von Proteinen,
indem es an nicht native Proteine bindet und es einem weiteren Chaperon zuführt. Am
besten untersucht ist die Interaktion von Prefoldin mit nicht nativem β-Aktin und dem
cytosolischen Chaperon c-cpn. Dabei überträgt Prefoldin β-Aktin auf c-cpn ohne die
Verwendung von Nukleotiden wie ATP oder ADP, die von anderen Chaperonen wie
beispielsweise von GroEL/GroES benötigt werden. Weitere Proteine, denen Prefoldin zur
Ausbildung
der
nativen
Struktur
verhilft
sind
beispielsweise
α- und β-Tubulin, oder Transducin (Vainberg et al., 1998).
Neben der allgemein anerkannten Funktion des Prefoldins als Chaperon-Protein ist es
grundsätzlich auch denkbar, daß eine Untereinheit des Chaperons, das Prefoldin5,
eigenständig neben dem Gesamtprotein aktiv werden kann. Prefoldin5 wurde auch als c-Myc
bindendes Protein, MM-1 bezeichnet (Mori et al. 1998).
Dementsprechend lassen sich für die Mitwirkung des Prefoldin5/MM-1 Proteins in der
Entstehung von Tumoren zwei Arbeitshypothesen aufstellen.
Steht die Funktion des Gesamt-Proteins im Vordergrund, ist die Aufgabe des Chaperons im
Tumorgewebe für seine Überexpression ausschlaggebend. Ist hingegen die Ursache der
Überexpression in der Funktion des c-Myc bindenden Proteins MM-1 zu suchen, so kann
dies mit der Entstehung des Tumors im Zusammenhang gesehen werden.
Im ersten Fall ist die Überexpression als Sekundär-Wirkung zu sehen. Dabei können
wiederum zwei Mechanismen unterschieden werden. Zum einen werden aufgrund der
schnellen Proliferation der Tumorgewebe vermehrt Proteine gebildet, die ihrerseits in
Abhängigkeit von Chaperonen ihre native Konfiguration erhalten. Dementsprechend nimmt
auch die Zahl der Chaperone im Tumorgewebe zu. Fehlerhafte Proteine, die aufgrund
veränderter Tumorsuppressoren nicht mehr zur Apoptose der Zellen führen, könnten
ebenfalls zu einer Häufung von Chaperonen im Tumorgewebe führen, wenn man unterstellt,
116
DISKUSSION
daß es durch diese Proteine zu einer vermehrten Belastung der Chaperone kommt. Besitzen
Proteine nach ihrer Faltung nicht die native Konformation und werden dementsprechend von
Chaperonen erneut gefaltet, belegen sie zum wiederholten mal das Chaperon und verringern
so die Produktivität der Chaperone. Diese wird durch eine vermehrte Expression der
Chaperone ausgeglichen, womit Chaperonen eine passive Rolle zuzuschreiben wäre.
Zum anderen ist es aber auch denkbar, daß eine Überexpression des Prefoldin-Chaperons
aktiv zur Tumorentstehung beiträgt. Wie bereits oben erwähnt wurde, sind Interaktionen
zwischen Prefoldin und α- und β-Tubulin beschrieben. Diese wiederum können mit c-Myc,
einem Proto-Onkogen interagieren. So beschreibt Alexandrova (Alexandrova et al., 1995) die
Interaktion von α-Tubulin mit c-MYC.
c-Myc gehört zu den Proto-Onkogenen (siehe Kapitel 1.1.4). Das Gen umfaßt drei Exons,
wobei Exon eins untranslatiert ist, Exon zwei und drei dagegen von zwei verschiedenen Start
ATGs für ein 2,2 bzw. ein 2,4 kb großes Transkript kodieren. Je nach Gewebetyp wird somit
ein 67 bzw. 64 kDa Protein hergestellt (Facchini und Penn, 1998). Das Protein kann grob in
drei Domänen unterteilt werden. Domäne eins (Aminosäurerest 1 bis 203) nimmt eine
globuläre Struktur ein und beeinhaltet die Myc-Boxen 1 (MB1, Position 45-63) und 2 (MB2,
Position 129-141). Domäne zwei (Reste 204 bis 237) weist eine unstrukturierte Region auf.
Domäne drei (Reste 238 bis 439) enthält den α-helicalen Carboxy-Terminus mit einer
basischen Region (BR, Position 355-368), einem Helix-Loop-Helix Motiv (HLH, Position 369410) und einem Leucin-Zipper (Zip, Position 411-439).
Abb.: 5.2 Struktur des c-MYC-Proteins.
Das Proteins erstreckt sich über 439 Aminosäurereste und kann grob in drei Domänen eingeteilt
werden. Die aminoterminale Domäne (Position 1-203) mit den Myc-Boxen 1 (MB1, Position 45-63)
und 2 (MB2, Position 129-141) nimmt eine globuläre Struktur ein. Die Aminosäurereste 204-237
weisen eine unstrukturierte Region auf. Die carboxyterminale Region zeigt eine α-helicale Struktur und
beinhaltet eine basische Region (BR, Position 355-368), ein Helix-Loop-Helix Motiv (HLH, Position
369-410) und einen Leucin-Zipper (Zip, Position 411-439).
117
DISKUSSION
Die Interaktion zwischen α-Tubulin und c-MYC findet an der aminoterminalen Region des cMYC-Proteins in der Region der Myc-Boxen 1 und 2, genauer zwischen Postion 48-135 statt
(Alexandrova et al., 1995). Durch die Interaktion wird das c-MYC-Protein an dem Cytoskelett
verankert. Dies führt dazu, daß c-MYC im Zytoplasma bleibt, statt in den Kern zu wandern,
womit der Kernimport von c-MYC reguliert werden könnte. Niklinski et al. (2000)
beobachteten eine erhöhte zytoplasmatische Lokalisation des c-MYC in ruhenden normalen
humanen Vorhaut-Fibroblasten verglichen mit wachsenden Zellen, bei denen c-MYC
vermehrt in der Kernfraktion nachgewiesen wurde. Dieser Befund würde dafür sprechen, daß
erhöhte Konzentrationen von c-MYC im Kern dazu führen, daß sich die Zellen häufiger teilen
und proliferieren.
Würde das Chaperon Prefoldin aufgrund eines Signals überexprimiert, so könnte dies dazu
führen, daß das normal exprimierte α-Tubulin von den Chaperonen in stärkerem Maß
aufgegriffen wird und so das Gleichgewicht zwischen α- und β-Tubulin gestört wäre. Als
Folge würden weniger Mikrotubuli gebildet werden, die c-MYC als Verankerungsstellen am
Zytoskelett fehlen. c-Myc würde in den Zellkern importiert werden und dort zu einer
veränderten
Transkription
führen.
Die
veränderte
Transkription
könnte
zur
Verstärkung/Ausbildung der Tumorentstehung beitragen.
Nach der zweiten Hypothese beruht die Wirkung der Überexpression von MM-1 auf seiner
Funktion als c-Myc bindendes Protein MM-1. Dieses Protein wird als mögliche Ursache in
der Tumorentstehung diskutiert. Bislang lassen sich dazu erst wenige Informationen aus der
Literatur entnehmen.
Mori et al. (1998) isolierten durch das Hefe Zwei-Hybrid-System einen Bindungspartner von
c-MYC, den sie als c-Myc bindendes Protein (MM-1) bezeichneten. Das MM-1-Protein
besteht nach ihren Untersuchungen aus 167 Aminosäureresten und interagiert über die
gesamte Sequenz hinweg mit der Myc-Box 2 des c-MYC-Proteins. Da das MM-1-Protein in
Luziferase-Aktivitäts-Analysen die transkriptionelle Aktivität von c-MYC reprimierte, schlugen
Mori et al. als Wirkungsweise die eines Repressors vor, schränkten diese Hypothese aber
insofern ein, als das p107-Protein, ein weiteres Protein, das die Transaktivator-Domäne von
c-MYC erkennt, die gleichen Bindungseigenschaften wie das MM-1-Protein aufweist und es
die transkriptionelle Aktivität von c-MYC in Lymphomzellen nicht beeinflußt.
Da sowohl bei K-ras als auch bei dem Prefoldin5/c-Myc bindenden Protein MM-1, die ich in
Geweben von Patientin 26 fand, eine Mitwirkung bei der Tumorentstehung denkbar ist,
aufgrund der limitierten cDNA aus Patientengewebe aber keine PCR zur Verifizierung der
118
DISKUSSION
Ergebnisse der DD-PCR durchgeführt werden konnte, wurden bislang keine weiteren
Untersuchungen in diesem Kontext durchgeführt. Im Arbeitskreis von Prof. Ponstingl ist
jedoch geplant, eine Reihe von cDNAs auf Mikrochips zu transferieren und diese mit
markierten cDNA-Proben aus Geweben von tumorerkrankten Patientinnen zu hybridisieren.
Dabei werden zusätzlich zu den cDNAs von K-ras und dem Prefoldin5/c-Myc bindenden
Protein MM-1 auch cDNAs von Fibronectin und Semaphorin E/3C (siehe Kapitel 5.3.1)
verwendet. Damit sollte es möglich sein, die hier zusammengefaßten Befunde zu
überprüfen.
26C/C9/2, ein möglicher Kinase-Bindungspartner
Ein ursprünglich in den Geweben der Patientinen 26 und 18 mit einer DD-PCR entdeckter
Genexpressionsunterschied zwischen Tumorgewebe des Ovars und Tubenepithel wurde als
26C/C9/2 bezeichnet. Nach quantitativer PCR ließ sich der Unterschied in Geweben der
Patientinnen 18, 30 und 46, nicht aber in Patientin 26 verifizieren. Das cDNA-Fragment war
in Tumorgeweben von Patientin 18 etwa 14fach stärker, von Patientin 30 2fach und von
Patientin 46 5fach höher exprimiert als in dem jeweils korrespondierenden Normalgewebe.
Durch eine Kombination von RACE-Sequenzen und Datenbankanalysen gelang es mir, die
Struktur des zugrundeliegenden Gens zu ermitteln. Die Gensequenz wird durch die BACKlone RP11-61E11 (AC016257) und RP11-781C15 (AC078874) abgedeckt. Aufgrund dieser
BAC-Klone konnte das Gen auf dem langen Arm des Chromosoms 12 in der Region 12q2324.1 lokalisiert werden. Es umfaßt 165 kb mit 20 Exons. Die Exons 2-19 sind Teil beider
BAC-Klone, das erste Exon ist nur in RP11-781C15 vertreten.
Die Expression des Transkripts wurde in Ovarialkarzinomzellinien überprüft (siehe
Abb. 4.23). Eine Northern Blot-Analyse mit einem 26C/C9/2 cDNA-Fragment (in Abb.: 4.18
dargestellt) erbrachte eine ungefähre Größe des Transkripts von etwa 3,2 kb. Die mRNAMenge in Milz, Thymus, Dünndarm, Ovar, Darm und den peripheren Blutleukozyten ist im
Vergleich zu den anderen Geweben vermindert. Zusätzlich kann ein 3,2 kb großes Transkript
auch in allen verwendeten Ovarialkarzinomzellinien nachgewiesen werden. Wird ein Poly-ASchwanz von etwa 200 bp zu dem Transkript von 2999 bp hinzugerechnet, stimmt die Länge
mit der in der Northern Blot-Analyse ermittelten Länge von 3,2 kb überein.
Für den Nachweis von 26C/C9/2, das ich in E.coli rekombinant herstellte, wurden Seren mit
peptidspezifischen Antikörpern generiert. Zwei Regionen hoher Antigenizität, die sich
unmittelbar am C-Terminus bzw. im zweiten Drittel des Proteins befanden (siehe Kapitel
3.26), wurden dazu ausgewählt. Die Seren der Kaninchen zeigen eine Korrelation zwischen
der Anzahl der Immunisierungen und der Zunahme der Signalintensitäten gegen die Peptide
119
DISKUSSION
(Kapitel 4.7.7), was für die Spezifität der Antikörper spricht. Auch die Reaktion der Seren mit
dem durch das TNT®-Retikulozyten-Lysat transkribierten Protein spricht dafür.
Das Protein von 26C/C9/2 weist eine bemerkenswerte Struktur auf, die eine Rolle in der
intrazellulären Signalübermittlung nahelegt. Wie durch die „SMART“-Analyse ermittelt
werden konnte, besitzt das 26C/C9/2-Protein eine pleckstrin-homologe Domäne (AS 482615) und eine Phosphotyrosin-Bindungs-Domäne (AS 271-370). Beide Domänen zeigen
sehr ähnliche dreidimensionale Strukturen, die evolutionär konserviert sind (Rebecchi und
Scarlata,
1998),
haben jedoch
unterschiedliche
Funktionen.
Eine
der
bekannten
Eigenschaften der Phosphotyrosin-Bindungs-Domäne (PTB), die nicht von der pleckstrinhomologen Domäne (PH) geteilt wird, ist die Bindung an Liganden mit einem
Phosphotyrosin-X-Asparagin-Bindungs-Motiv.
Die besser untersuchte und in der Literatur ausführlich beschriebene Domäne ist die
pleckstrin-homologe Domäne.
Aufbau der pleckstrin-homologen Domäne
Eine strukturelle Einheit des 26C/C9/2-Proteins ist eine pleckstrin-homologe Domäne. Dabei
handelt es sich um eine etwa 100 Aminosäurereste lange Domäne, die in fast 100
eukaryontischen Proteinen, nicht jedoch in Pflanzen, entdeckt wurde (Bottomley et al., 1998).
Der Name der PH-Domäne leitet sich von dem Protein ab, in dem zwei solcher Domänen
zuerst charakterisiert wurden, dem „Platelet and Leukocyte C Kinase Substrate Protein
(Haslam et al., 1993). Obwohl die dreidimensionale Struktur der PH-Domäne sehr stark
konserviert ist, sind die Sequenzhomologien in den Domänen der einzelnen Proteine mit
etwa 10-20% minimal. Dies steht im Gegensatz zu anderen bekannten, weit verbreiteten
Domänen wie der SH2-Domäne, bei der die Sequenz relativ stark konserviert ist (Ingley und
Hemmings, 1994) und führt bei den PH-Domänen zu einer höheren Funktionsdiversität. Die
Vielfalt der möglichen Aufgaben verhinderte in der Vergangenheit die Zuordnung einer PHDomäne eines Proteins zu einer bestimmten Aufgabe.
Die Struktur einer PH-Domäne ist in Abb. 5.3 am Beispiel des Pleckstrin-Proteins dargestellt.
Die mit Hilfe der NMR-Methode ermittelte Struktur der Domäne zeigt einen Kern, bestehend
aus sieben antiparallelen β-Faltblatt-Strängen und einer langen C-terminalen Helix. Vier der
Faltblattstrukturen stehen nahezu orthogonal zu den anderen drei antiparallelen Strängen
und bilden eine faß-ähnliche Struktur aus, die von der α-Helix stabilisiert ist. Die N- und CTermini der Domäne liegen auf der selben Seite des Proteins, weisen jedoch in
unterschiedliche Richtungen.
120
DISKUSSION
Abb. 5.3 Raumstruktur der PH-Domäne des Pleckstrin-Proteins (Lemmon und Ferguson, 2000).
Die Faltblattstränge der PH-Domäne sind mit 1-7 bezeichnet, die α-Helix ist blau gekennzeichnet.
Eine der bemerkenswertesten Eigenschaften der PH-Domäne ist in der elektrostatischen
Polarisation ihrer Oberfläche zu sehen. Auf der positiv geladenen Seite der Domäne
befinden sich zahlreiche Lysine, Arginine und Histidine. Die andere Seite mit der
C-terminalen α-Helix ist durch saure Aminosäurereste negativ geladen. Durch die
Polarisation können die Proteine mit ihren Liganden in Wechselwirkung treten, so daß die
positiv geladenen Aminosäuren beispielsweise an die nach Zellstimulation auftretenden
Plasmamembranbestandteile
Phosphatidylinositol-4,5-bisphosphosphat
(PIP2)
und
Phosphatidylinositol-3,4,5-triphosphat (PIP3) (Carpenter und Cantley, 1996) oder an das
wasserlösliche Inositol-1,4,5-triphosphat (IP3) binden. Daneben werden noch weitere
Interaktionen mit bisher nicht untersuchten Phosphoinositiden vermutet, die ebenfalls hoch
spezifische Signalfunktionen in den Zellen ausüben könnten (Rameh et al., 1997; Dove et
al., 1997).
Da das 26C/C9/2-Protein ebenfalls eine PH-Domäne trägt, ist auch für dieses Protein
anzunehmen, daß es an einer Singalübertragungskaskade beteiligt ist.
121
DISKUSSION
Funktionen der PH-Domäne
Ebenso zahlreich wie die Bindungspartner sind auch die Funktionen der PH-Domänen.
Deshalb ist die tatsächliche Funktion der PH-Bindungsdomäne des 26C/C9/2-Proteins nicht
von vorneherein zuzuordnen. Modelle für die Rolle der PH-Domäne einiger Proteine wurde
von Bottomley et al. (1998) aufgestellt (siehe Abb. 5.4).
Abb. 5.4 Modelle für unterschiedliche Funktionen der PH-Domänen (Bottomley et al., 1998).
Phospholipide sind mit PL, Proteine mit E, Substrate mit S und die PH-Domänen mit PBD
gekennzeichnet. In der Abbildung sind vier Varianten der Funktionen (A-D) einer pleckstrin-homologen
Domäne dargestellt (siehe Text).
Bei der ersten Modellvariante (siehe Abb. 5.4, A) ermöglicht die Bindung der PH-Domäne
(PBD) eines Proteins (E) an ein spezifisches Phosphatidylinositol (PL) die Translokation an
ein membrangebundenes Substrat. Als Beispiel für dieses Modell dient die Phospholipase Cδ1. Sie bindet mit ihrer PH-Domäne an PIP2. Dabei schneidet die Phospholipase die
Phosphodiester-Bindung von PIP2 und setzt die Botenstoffe IP3 und Diacylglycerol frei
(Rebecchi und Scarlata, 1998).
Wie bereits oben erwähnt, binden einige Proteine mit PH-Domäne auch an IP3. Sind die
Affinitäten der PH-Domänen zu PIP2 und IP3, gleich stark, könnte das bei der Spaltung
freigesetzte wasserlösliche IP3 mit dem PIP2 konkurrieren, so daß sich das Protein von der
Membran lösen könnte.
Bei der zweiten diskutierten Variante (siehe Abb. 5.4, B) verändert die Bindung eines
Proteins mit PH-Domäne an ein membranständiges Phospholipid die Konformation des
Proteins, so daß durch ein regulatorisches Protein (K) die Aktivität des Proteins verändert
und somit eine Signalübertragung ermöglicht wird. Ein Beispiel dafür ist Akt2, eine
122
DISKUSSION
Serin/Threonin-Kinase der PKB Familie, die bereits in Kapitel 1.1.4 erwähnt wurde. Sie ist
hier von besonderem Interesse, da sie auch mit APPL, dem Protein mit der höchsten
Homologie zum 26C/C9/2-Protein, interagiert.
Akt2 wird durch die Phosphoinositol-3-Kinase aktiviert, wenn Säugerzellen durch Insulin und
Wachstumsfaktoren stimuliert werden. Zusätzlich ist die Aktivität von Akt2 unter anderem
auch abhängig von der Phosphorylierung eines Threoninrestes an Position 308 durch eine
zweite Protein-Kinase, PDK1. Die Phosphorylierungsstelle bleibt für PDK1 solange
unzugänglich, bis die PH-Domäne von Akt an PIP3 gebunden hat und eine Änderung der
Proteinkonformation bewirkt. Interessant dabei ist, daß auch PDK1 eine PH-Domäne besitzt,
die zusammen mit der Akt2 PH-Domäne eine Co-Lokalisation an der Plasmamembran
bewirkt und somit für eine Orientierung sorgt, die die Wechselwirkung der beiden Proteine
bevorzugt.
Die dritte Modellvariante (siehe Abb. 5.4, C) geht von der Verstärkung der Affinität eines
Proteins zur Plasmamembran durch Kooperation mehrerer PH-Domänen oder einer PHDomäne mit verschiedenen anderen Domäne, wie einer SH2- oder PTB-Domäne, aus.
In der vierten Modellvariante (siehe Abb. 5.4, D) interagiert die PH-Domäne zusätzlich zu
den membranständigen Phospholipiden mit Proteinen, die an die Membran gebunden sind,
was schließlich zu einer synergistischen Membrantranslokation und Enzymaktivierung führt.
Ein Beispiel für die dritte und vierte Modellvariante ist die Phospholipase C-δ1. Die
Phospholipase C-δ1 besitzt neben der PH- eine SH2-Domäne. Diese Domäne bindet an ein
Phosphotyrosin-X-Asparagin-Motiv,
synergistischen
das
Membrantranslokation
in
membranständigen
führen
könnte.
Sie
Proteinen
bindet
aber
zu
auch
einer
an
Phosphoinositide (Rameh et al., 1995) und erhöht somit die Affinität zur Plasmamembran.
Dies könnte auch für das 26C/C9/2-Protein gelten. Es besitzt neben der PH- eine PTBDomäne, die wie die SH2-Domäne das Phosphotyrosin-X-Asparagin-Motiv erkennt und
ebenso zu einer Translokation beitragen könnte. Damit passen die Voraussetzungen auf die
dritte und vierte Modellvariante.
Bei dem Zusammenspiel mehrerer Domänen ist aber auch eine regulatorische Rolle der
einzelnen Domänen denkbar. Dies ist der Fall, wenn bei einer Domäne eine hohe Affinität zu
PIP2 vorliegt, bei der anderen Domäne jedoch lediglich eine geringe Affinität vorhanden ist.
Eine der beiden Domänen könnte für die Lokalisation, die andere für eine enzymatische
Aktivierung verantwortlich sein. (Bottomley et al., 1998).
123
DISKUSSION
Für das Protein 26C/C9/2 ist eine gesicherte Zuordnung zu einer der Modellvarianten bislang
nicht möglich. Auch bei dem APPL-Protein, das mit über 60% Übereinstimmung die höchste
Homologie zu 26C/C9/2 besitzt, ist nicht geklärt, welche Funktion die PH-Domäne tatsächlich
übernimmt. Dennoch deuten, wie im folgenden Abschnitt erläutert, alle Daten auf eine
Mitwirkung bei der Tumorentstehung hin.
Homologie von 26C/C9/2 zu APPL
Das 26C/C9/2-Protein zeigt nach Datenbankrecherchen die höchste Homologie zu dem
APPL-Protein. Mitsuuchi et al. (1999) konnten durch das Hefe-Zwei-Hybrid System einen
Bindungspartner der Serin/Threonin-Kinase Akt2 (siehe 1.1.4) identifizieren, den sie APPL
(„Adaptor Protein Containing PH-Domain, PTB- Domain and Leucine Zipper Motif“) nannten.
Das Gen für APPL besitzt ein 57 bp untranslatiertes 5‘-Ende, einen offenen Leseraster von
2127 bp, eine 3786 bp lange 3‘-untranslatierte Region und kodiert für ein Protein mit einer
molekularen Masse von etwa 80 kDa. In Experimenten wiesen Mitsuuchi et al. eine
Interaktion zwischen der PTB-Domäne des APPL und der katalytischen Domäne des
inaktiven Akt2 nach. Gleichzeitig konnten sie eine hohe Affinität von APPL für die p110αUntereinheit der Phosphoinositol-3-Kinase (PI3K) zeigen. Aufgrund dieser Befunde stellten
die Autoren eine Hypothese auf, die besagt, daß APPL als Adaptor zwischen Akt2 und PI3K
im Zytoplasma fungiert. Nach Stimulation durch Wachstumsfaktoren oder Insulin vermag die
p110α-Untereinheit der PI3K Akt2 zu phosphorylieren. Das phosphorylierte Akt2 bindet mit
seiner PH-Domäne an das, nach Stimulation vermehrt auftretende, Phosphatidylinositol-4,5bisphosphat oder Phosphatidylinositol-3,4,5-triphosphat und wird nach der bereits vorne
beschriebenen zusätzlichen Phosphorylierung eines Threoninrestes an Position 308 durch
die PDK1-Protein-Kinase aktiviert. Die Phosphorylierung von Akt2 an einer weiteren Stelle ist
bislang noch nicht vollständig aufgeklärt. In den beschriebenen Versuchen konnte weder
eine Bindung der PH-Domäne von APPL an die zytoplasmatische Membran, noch der
gemeinsame Transport von APPL zusammen mit Akt2 zur Membran nachgewiesen werden.
Da das 26C/C9/2-Protein eine große Homologie zu APPL aufweist, was insbesondere
aufgrund der hohen Varianz der PH- und PTB-Domänen bemerkenswert ist, liegt die
Vermutung nahe, daß auch 26C/C9/2 am Signaltransport, evtl. im Zusammenhang mit der
Kinase Akt2, an der Informationsübertragung beteiligt ist. Diese Vermutung ist umso
näherliegend, als die mRNA von 26C/C9/2 im Tumorgewebe von Patientin 18, 30 und 46
vermehrt auftrat, was die Phosphorylierung und damit die Aktivität von Akt2 erhöht hätte.
Eine Erhöhung der Aktivität führt ebenso wie eine vermehrte Expression zu einem
veränderten Ausmaß der Phosphorylierung. Da von Akt2 bekannt ist, daß es bei einigen
Tumortypen überexprimiert wird, darunter auch in Ovarialtumoren (Bellacosa at al., 1995),
kann dem 26C/C9/2-Protein eine analoge Wirkung zugeschrieben werden. Andererseits
124
DISKUSSION
spielt Akt2 auch bei der Induktion der Apoptose eine Rolle (Yuan et al., 2000; Page et al.,
2000).
5.3.3
26C/G8/2, ein Protein mit doppelsträngigen RNA Bindungs-Motiven
Eine differentiell exprimierte cDNA, die als 26C/G8/2 bezeichnet wurde, konnte durch DDPCR bei den Patientinnen 26 und 31 identifiziert werden. Durch quantitative PCR ließ sich
der Unterschied verifizieren. Dabei war die cDNA von 26C/G8/2 etwa 10fach höher im
Ovarialkarzinomgewebe exprimiert als im korrespondierenden Normalepithel des Eileiters.
Durch Datenbankanalyse gelang es, zunächst das vollständige Transkript und den größten
Teil des zugrundeliegenden Gens zu ermitteln. Die Sequenz des Gens ist durch die drei
humanen genomischen Sequenzen der Klone RP11-464D19 (AC027018), RP11-181D18
(AC018620)
und
RP11-353G20
(AC021897)
abgedeckt.
Aufgrund
der
Chromosomenlokalisation dieser Klone konnte das Gen der Bande 8q13 auf dem langen
Arm des Chromosoms 8 zugeordnet werden. Das vollständige Gen besteht aus mehr als 14
Exons, wovon die Exons e1-e12 Teile des Klons RP11-464D19, Exon ey und ez Teile der
Klone RP11-181D18 und RP11-353G20 sind. Zusätzlich zu diesem Gen befindet sich in der
Chromosomenbande Xq21.31 ein Pseudogen, das durch die Klone RP13-140E4 (AL121877)
und RP13-436D9 (AL590041) repräsentiert wird. Die 5‘- und 3‘-Spleißstellen der ExonIntron-Übergänge sind konserviert und in Tab. 4.5 dargestellt. Zur Zeit wird im Arbeitskreis
von Prof. Ponstingl das Protein entsprechend meiner Vorgaben kloniert und exprimiert. Wie
bei 26C/C9/2 wurde auch von 26C/G8/2 ein Teilstück der cDNA von mir mit Digoxigenin
gelabelt und wird bei einer in situ Hybridisierung eingesetzt.
Aufbau und Funktion der doppelsträngigen RNA Bindungs-Domäne
Das 26C/G8/2-Protein beinhaltet vier Domänen, die evolutionär stark konserviert sind. Diese
umfassen je 65-70 Aminosäurereste und sind homolog zu den RNA Bindungs-Motiven des
Drosophila-Staufen-Proteins, das mit doppelsträngiger RNA interagiert (St. Johnston et al.,
1991). Durch NMR-Analysen von Bycroft et al. (1995) oder Kharrat et al. (1995) wurde die
Struktur isolierter dsRBS von E.coli RNase III und des Drosophila Staufen-Proteins in
Lösung bestimmt. Die Proteinstruktur zeigte eine α-β-β-β-α Topologie, bei der die N- und Cterminalen α-Helices gegen die drei antiparallelen β-Stränge gerichtet sind.
125
DISKUSSION
Abb.: 5.5 Die Struktur einer doppelsträngigen RNA Bindungs-Domäne ist am Beispiel der
dritten dsRBD des Drosophila Staufen-Proteins gezeigt (Perez-Canadillas und Varani, 2001).
Bislang wurde keine Konsensus-Sequenz der RNA ermittelt, die die Proteine zur Bindung an
die RNA veranlaßt. Vielmehr scheint die Spezifität von der Konformation der RNA
abzuhängen. In diesem
Zusammenhang konnten Ryter
und Schultz
(1998)
die
Kristallstruktur eines Komplexes zwischen der zweiten dsRBD des RNA-bindenden
Proteins A von Xenopus laevis mit doppelsträngiger RNA (dsRNA) bestimmen. Dabei
umspannte das Protein 16 bp der dsRNA, indem es mit zwei kleinen Taschen über die eine
Seite der großen Tasche hinweg interagierte. Da lediglich die eine Seite der großen Tasche
beteiligt ist, könnte die verbliebene Seite weiteren Bindungspartnern offen stehen und damit
z.B. ein Umwinden der RNA durch ein Protein mit mehreren Bindungsdomänen ermöglichen.
Zahlreiche Proteine besitzen mehrere dsRBDs. Beispielsweise hat ein humanes Poly(A)bindendes Protein (PABP, U68104) vier, Drosophila Staufen fünf doppelsträngige RNABindungs-Domänen. Die Art der Interaktion zwischen der dsRNA und den dsRBDs macht
deutlich,
weshalb
die
dsRBDs
keine
einzelsträngige
RNA,
einzelsträngige
oder
doppelsträngige DNA erkennt.
Das 26C/G8/2-Protein besitzt ebenfalls vier dsRBDs, die mit doppelsträngiger RNA
interagieren können, so daß auch in diesem Fall eine verstärkende Wirkung auf die RNABindung denkbar ist.
126
DISKUSSION
Homologe Proteine zu 26C/G8/2 und deren Funktion
Das bekannteste Protein der dsRBD-Familie ist das Staufen-Protein von Drosophila
melanogaster. Es besitzt insgesamt fünf Kopien des dsRBD-Motivs, wobei drei der Kopien
die vollständige und zwei Kopien verkürzte Domänen aufweisen (St. Johnston et al., 1991;
St. Johnston et al., 1992). In Experimenten wurde die Interaktion des Staufen-Proteins mit
den mRNAs des „bicoid“ und „oscar“ sowie der „prospero“ mRNA in Neuroblasten
nachgewiesen. Dabei bindet das Staufen-Protein direkt an die mRNAs und organisiert in
einem mehrstufigen Mechanismus deren Transport im Zytoplasma, der zudem von
Zytoskelettbestandteilen abhängig ist (Broadus et al., 1998; Erdelyi et al., 1995;
St. Johnston, 1995). Die mRNA von „bicoid“ gelangt auf diese Weise ins anteriore, die von
„oscar“ ins posteriore Zytoplasma der Oocyten und die von „prospero“ in den basalen Cortex
von Neuroblasten (Broadus et al., 1998).
Die einzelnen dsRNA bindenden Domänen haben offenbar verschiedene Funktionen, so ist
dsRBD2 für die mikrotubuli-abhängige Lokalisation von „oscar“ notwendig, dsRBD5 dagegen
für den actin-abhängigen Transport von „prospero“ (Micklem et al., 2000).
Die bei Drosophila gewonnenen Erkenntnisse legen den Schluß nahe, daß Proteine mit
dsRBDs für den Transport von mRNA im allgemeinen verantwortlich sind. Auch das
26C/G8/2-Protein weist doppelsträngige RBDs auf. Deshalb ist vermutlich auch dieses
Protein am Transport von mRNA beteiligt. Der dabei zugrundeliegende Mechanismus ist
nicht geklärt, hängt aber von der 3‘-untranslatierten Region der gebundenen mRNAs und von
den Proteinen ab, die an diese Signale binden.
Die Hypothese über die Vermittlung des Transportes von mRNA durch Proteine mit dsRBDs
in Abhängigkeit mit dem Zytoplasma wurde durch experimentelle Daten von Wickham et al.
(1999) untermauert. Das humane Staufen-Protein bindet mit zwei seiner dsRBDs an
doppelsträngige RNA und gleichzeitig an Tubulin. Weiterhin konnte das humane Staufen am
rauhen endoplasmatischen Reticulum (rER) lokalisiert werden. Da dieses Protein keine
Transmembran-Domäne besitzt und sich dennoch am rER befindet, sind folgende
Hypothesen denkbar:
(a) Proteine mit dsRBDs können mRNAs zum rER transportieren und eine unmittelbare
Nachbarschaft zu Signalerkennungspartikeln (Signal recognition Partikels) ergeben, was die
Translation und Translokation ermöglicht.
(b) Proteine könnten mit dsRBD am rER gelagert werden, bis sie zu einem bestimmten
Zeitpunkt benötigt werden. Zusammen mit den mRNAs und Cofaktoren könnten sie RNPKomplexe bilden, die entlang der Mitkrotubuli transportiert werden.
127
DISKUSSION
Die Interpretationsmöglichkeiten ergeben bislang kein klares Bild für die Funktion. Doch
weisen sie auf eine Störung des mRNA-Transports durch die Überexpression des 26C/G8/2Gens hin und können so mit der Tumorentstehung in Verbindung gebracht werden. Seine
Überexpression in den Ovarialkarzinomen der Patientinnen 26 und 31 könnte unter anderem
zur vermehrten Translokation und Translation einzelner mRNAs führen, die an der
Zellregulation beteiligt sein könnten und somit zur Turmorentstehung beitragen.
5.3.4
Ausblick
Die Ergebnisse dieser Arbeit können möglicherweise zu Einblicken in die Entstehung von
Ovarialkarzinomen auf molekularer Ebene führen. Zunächst aber handelt es sich nicht um
kausale Zusammenhänge, sondern um die Korrelation von Expressionsunterschieden mit
dem Tumorwachstum in einzelnen Patientinnen.
Die gefundenen Ergebnisse müssen noch an weiteren Gewebeproben von Patientinnen
überprüft und durch andere experimentelle Methoden untermauert werden.
Neben der Differtial Display Methode, mit der die hier gezeigten Ergebnisse erhalten wurden,
besteht die Möglichkeit, weitere Tumorgewebeproben von Ovarien hinsichlich der
Genexpressionsunterschiede durch den Einsatz von cDNA Microarrays zu analysieren. Als
weiterer Schritt bietet sich die Untersuchung auf Proteinebene an. So können Antikörper
gegen die oben genannten differentiell exprimierten Proteine hergestellt werden, um die
Genexpressionsunterschiede in Gewebeschnitten zahlreicher Tumorproben schnell und
effektiv zu überprüfen. Mit diesen Ergebnissen könnten im nächsten Schritt von den
klinischen Kooperationspartnern die Befunde auf molekularer- und Proteinebene mit den
morphologischen Tumortypen korreliert werden. Mit Kenntnis dieser Zusammenhänge
besteht unter Umständen die Möglichkeit, die Überlebenschancen zu bestimmen, eventuell
die Therapie zu verbessern und als Fernziel eine deutlich verbesserte Diagnostik im
Frühstadium
der
Tumorentstehung
zu
ermöglichen.
Könnten
aus
erkannten
Genexpressionsunterschieden Marker abgeleitet werden, die bereits zu einem Zeitpunkt eine
Diagnose
eines
Ovartumors
ermöglichen,
zu
dem
mit
konventionellen
Untersuchungsmethoden noch keinerlei Aussage möglich ist, kann eine Therapie in sehr
frühem Stadium erfolgen und damit die Heilungschanchen der betroffenen Patientin
erheblich verbessern.
Ausgehend
von
den
gefundenen
Genexpressionsunterschieden
werden
sich
Untersuchungen zur Funktion der kodierten Proteine auf molekularer Ebene anschließen.
Nach der Expression der entsprechenden cDNAs können die rekombinanten Proteine auf
ihre Funktion hin untersucht werden. Eine geeignete Methoden dazu ist beispielsweise die
128
DISKUSSION
regulierte Überexpression in Zellen oder die Einführung von antisense-Oligonukleotiden in
den Zellkern von Zellkulturzellen, um die Expression des Proteins einzuschränken. Ein
neues, sehr effektives Verfahren ist die sequenzspezifische posttranskriptionelle Stillegung
(Silencing) durch RNA-Interferenz mit doppelsträngigen RNA-Stücken von 21 Nukleotiden,
die zum untersuchten Gen homolog sind (Elbashir et al., 2001).
Auswirkungen von Mutationen und Deletionen können detailliertere Aufschlüsse über die
Wirkungsweise des Gens liefern. Die Wechselwirkung des Proteins mit anderen Proteinen
kann durch Hefe-Zwei-Hybrid-Systeme analysiert und zusätzlich durch Immunpräzipitationen
untersucht werden.
129
ZUSAMMENFASSUNG
6
Zusammenfassung
Durch den Vergleich der Genexpression in Tumorgewebe und Normalepithel von
Patientinnen mit epithelialen Ovarialkarzinomen gelang es, mit dem Verfahren des
Differential Displays, unterschiedlich exprimierte Gene zu identifizieren, die an der
Entstehung von Ovarialtumoren beteiligt sein könnten. Die gefundenen Unterschiede wurden
durch quantitative PCR mit genspezifischen Primern an mehreren Patientinnen bestätigt.
Eine Gruppe dieser Gene kodiert für Komponenten von Signalübertragungswegen. Dazu
gehören die kleine GTPase K-ras, Prefoldin5/c-Myc bindendes Protein MM-1, eine kleine
GTPase, die in der Literatur noch nicht beschrieben wurde, Rabin3 und ein neues Protein,
das vermutlich Bindungspartner einer Kinase ist.
Der offene Leseraster des vermutlichen Kinase- Bindungspartners wurde durch Amplifikation
von cDNA-Enden und Datenbankvergleich vervollständigt. Das Gen besteht aus mindestens
20 Exons und umfaßt etwa 165 kb. Es liegt in der Chromosomenbande 12q23-24.1 und
kodiert für ein Transkript von 2999 bp. Durch Northern Blot-Analyse konnte die mRNA in
allen untersuchten Geweben und Ovarialkarzinomzellinien nachgewiesen werden. Das
Protein ist 657 Aminosäurereste lang und besitzt eine Größe von etwa 74 kDa. Der
vorhergesagte isolelektrische Punkt des Proteins liegt bei 4,79. Das Protein wurde
rekombinant exprimiert. Es besitzt eine globuläre Struktur und verfügt über eine pleckstrinhomologe- und eine Phsophotyrosin-Bindungs-Domäne, die eine Interaktion mit der
Plasmamembran und mit Kinasen wahrscheinlich erscheinen lassen.
Ein weiteres Gen kodiert für ein Protein mit vier doppelsträngigen RNA Bindungs-Domänen.
Das Gen liegt in der Chromosomenbande 8q13 und besteht aus mehr als 14 Exons. Es
kodiert für ein Transkript von 2968 bp. Aus der Nukleotidsequenz des 1710 bp langen
offenen Leserasters konnte die Aminosäuresequenz des Proteins abgeleitet werden. Das
Protein umfaßt demnach 570 Aminosäurereste und besitzt ein Molekulargewicht von etwa
63 kDa sowie einen isoelektrischen Punkt von 10,4. Es könnte, wie das Staufen-Protein, das
ebenfalls solche Domänen trägt, am Transport und der Lokalisation von mRNA beteiligt sein.
131
LITERATUR
7
Literatur
Alberts, B., Bray, D., Lewis, J., Raff, M., Roberts, K. und Watson, D. (1995).
Molekularbiologie der Zelle, 3. Auflage (VCH, Weinheim).
Alexandrova, N., Niklinski, J., Bliskovsky, V., Otterson, G. A., Blake, M., Kaye, F. J. und
Zajac-Kaye, M. (1995). The N-terminal domain of c-Myc associates with α-Tubulin and
Microtubules in vivo and in vitro, Mol. Cell. Biol. 15, 5188-5195.
Auersperg, N., Edelson, M. I., Mok, S. C., Johnson, S. W. und Hamilton, T. C. (1998). The
biology of ovarian cancer, Semin. Oncol. 25, 281-304.
Auersperg, N., Pan, J., Grove, B. D., Peterson, T., Fisher, J., Maines-Bandiera, S., Somasiri,
A. und Roskelley, C. D. (1999). E-cadherin induces mesenchymal-to-epithelial transition in
human ovarian surface epithelium, Proc. Natl. Acad. Sci. USA 96, 6249-6254.
Banks, E., Beral, V. und Reeves, G. (1997). The epidemiology of epithelial ovarian cancer a
Review, Int. J. Gynecol. Cancer 7, 425-438.
Becker, N. und Wahrendorf, J. (1997). Krebsatlas der Bundesrepublik Deutschland 19811990, 3. Auflage (Springer, Berlin).
Bellacosa, A., de Feo, D., Godwin, A. K., Bell, D. W., Cheng, J. Q., Altomare, D. A., Wan, M.,
Dubeau, L., Scambia, G., Masciullo, V. und et al. (1995). Molecular alterations of the AKT2
oncogene in ovarian and breast carcinomas, Int. J. Cancer 64, 280-285.
Bottomley, M. J., Salim, K. und Panayotou, G. (1998). Phospholipid-binding protein domains,
Biochim. Biophys. Acta 1436, 165-183.
Broadus, J., Fuerstenberg, S. und Doe, C. Q. (1998). Staufen-dependent localization of
prospero mRNA contributes to neuroblast daughter-cell fate, Nature 391, 792-795.
Brondyk, W. H., McKiernan, C. J., Fortner, K. A., Stabila, P., Holz, R. W. und Macara, I. G.
(1995). Interaction cloning of Rabin3, a novel protein that associates with the Ras-like
GTPase Rab3A, Mol. Cell. Biol. 15, 1137-1143.
Bycroft, M., Grunert, S., Murzin, A. G., Proctor, M. und St Johnston, D. (1995). NMR solution
structure of a dsRNA binding domain from Drosophila staufen protein reveals homology to
the N-terminal domain of ribosomal protein S5, Embo J. 14, 3563-3571.
Callard, D., Lescure, B. und Mazzolini, L. (1994). A method for the elimination of false
positives generated by the mRNA differential display technique, Biotechniques 16, 10961097, 1100-1093.
Carpenter, C. L. und Cantley, L. C. (1996). Phosphoinositide kinases, Curr. Opin. Cell. Biol.
8, 153-158.
Chen, Y., Farmer, A. A., Chen, C. F., Jones, D. C., Chen, P. L. und Lee, W. H. (1996).
BRCA1 is a 220-kDa nuclear phosphoprotein that is expressed and phosphorylated in a cell
cycle-dependent manner, Cancer Res. 56, 3168-3172.
133
LITERATUR
Cheng, J. Q., Godwin, A. K., Bellacosa, A., Taguchi, T., Franke, T. F., Hamilton, T. C.,
Tsichlis, P. N. und Testa, J. R. (1992). AKT2, a putative oncogene encoding a member of a
subfamily of protein- serine/threonine kinases, is amplified in human ovarian carcinomas,
Proc. Natl. Acad. Sci. USA 89, 9267-9271.
Chuaqui, R. F., Zhuang, Z. und Merino, M. J. (1997). Molecular genetic events in the
development and progression of ovarian cancer in humans, Mol Med Today 3, 207-213.
Church, G. M. und Gilbert, W. (1984). Genomic sequencing, Proc. Natl. Acad. Sci. USA 81,
1991-1995.
Claus, E. B. und Schwartz, P. E. (1995). Familial ovarian cancer. Update and clinical
applications, Cancer 76, 1998-2003.
Czernobilsky, B., Moll, R., Levy, R. und Franke, W. W. (1985). Co-expression of cytokeratin
and vimentin filaments in mesothelial, granulosa and rete ovarii cells of the human ovary,
Eur. J. Cell Biol. 37, 175-190.
Daly, M. und Obrams, G. I. (1998). Epidemiology and risk assessment for ovarian cancer,
Semin. Oncol. 25, 255-264.
Datta, S. R., Dudek, H., Tao, X., Masters, S., Fu, H., Gotoh, Y. und Greenberg, M. E. (1997).
Akt phosphorylation of BAD couples survival signals to the cell- intrinsic death machinery,
Cell 91, 231-241.
Dove, S. K., Cooke, F. T., Douglas, M. R., Sayers, L. G., Parker, P. J. und Michell, R. H.
(1997). Osmotic stress activates phosphatidylinositol-3,5-bisphosphate synthesis, Nature
390, 187-192.
Elbashir, S. M., Harborth, J., Lendeckel, W., Yalcin, A., Weber, K. und Tuschl, T. (2001).
Duplexes of 21-nucleotide RNAs mediate RNA interference in cultured mammalian cells,
Nature 411, 494-498.
Ellis, C. A. und Clark, G. (2000). The importance of being K-Ras, Cell Signal 12, 425-434.
Emmert-Buck, M. R., Bonner, R. F., Smith, P. C., Chuaqui, R. F., Zhuang, Z., Goldstein, S.
R., Weiss, R. A. und Liotta, L. A. (1996). Laser capture microdissection, Science 274, 9981001.
Erdelyi, M., Michon, A. M., Guichet, A., Glotzer, J. B. und Ephrussi, A. (1995). Requirement
for Drosophila cytoplasmic tropomyosin in oskar mRNA localization, Nature 377, 524-527.
Facchini, L. M. und Penn, L. Z. (1998). The molecular role of Myc in growth and
transformation recent discoveries lead to new insights, Faseb J. 12, 633-651.
Fathalla, M. F. (1971). Incessant ovulation--a factor in ovarian neoplasia?, Lancet 2, 163.
Filmus, J. E. und Buick, R. N. (1985). Stability of c-K-ras amplification during progression in a
patient with adenocarcinoma of the ovary, Cancer Res. 45, 4468-4472.
Frost, M. R. und Guggenheim, J. A. (1999). Mammalian polyadenylation sites implications for
differential display, Nucleic Acids Res. 27, 1386-1391.
Gallion, H. H., Pieretti, M., DePriest, P. D. und van Nagell, J. R., Jr. (1995). The molecular
basis of ovarian cancer, Cancer 76, 1992-1997.
134
LITERATUR
Graf, D., Fisher, A. G. und Merkenschlager, M. (1997). Rational primer design greatly
improves differential display-PCR (DD- PCR), Nucleic Acids Res. 25, 2239-2240.
Grandori, C., Cowley, S. M., James, L. P. und Eisenman, R. N. (2000). The Myc/Max/Mad
network and the transcriptional control of cell behavior, Annu. Rev. Cell Dev. Biol. 16, 653699.
Haslam, R. J., Koide, H. B. und Hemmings, B. A. (1993). Pleckstrin domain homology,
Nature 363, 309-310.
Hough, C. D., Cho, K. R., Zonderman, A. B., Schwartz, D. R. und Morin, P. J. (2001).
Coordinately up-regulated genes in ovarian cancer, Cancer Res. 61, 3869-3876.
Hubank, M. und Schatz, D. G. (1994). Identifying differences in mRNA expression by
representational difference analysis of cDNA, Nucleic Acids Res. 22, 5640-5648.
Hynes, R. O. (1986). Fibronectins, Sci. Am. 254, 32-41.
Ingley, E. und Hemmings, B. A. (1994). Pleckstrin homology (PH) domains in signal
transduction, J. Cell Biochem. 56, 436-443.
Janeway, C.A. und Travers, P. (1995). Immunologie, 1. Auflage (Spektrum, Heidelberg).
Kharrat, A., Macias, M. J., Gibson, T. J., Nilges, M. und Pastore, A. (1995). Structure of the
dsRNA binding domain of E. coli RNase III, Embo J. 14, 3572-3584.
Knippers, R. (1997). Molekulare Genetik, 7. Auflage (Thieme, Stuttgart).
Kupryjanczyk, J. und Karpinska, G. (1998). Desmin expression in reactive mesothelium a
potential aid in evaluation of gynecologic specimens, Int. J. Gynecol. Pathol. 17, 123-128.
Ledakis, P., Tanimura, H. und Fojo, T. (1998). Limitations of differential display, Biochem.
Biophys. Res. Commun. 251, 653-656.
Lemmon, M.A. und Ferguson, K.M. (2000). Signal-dependent membrane targeting by
pleckstrin homology (PH) domains, Biochem. J. 350, 1-18.
Liang, P. (1998). Factors ensuring successful use of differential display, Methods 16, 361364.
Liang, P. und Pardee, A. B. (1992). Differential display of eukaryotic messenger RNA by
means of the polymerase chain reaction, Science 257, 967-971.
Liang, P. und Pardee, A. B. (1995). Recent advances in differential display, Curr. Opin.
Immunol. 7, 274-280.
Liang, P. und Pardee, A. B. (1997). Differential display. A general protocol, Methods Mol.
Biol. 85, 3-11.
Liang, P., Averboukh, L.. und Pardee, A. B. (1994). Method of Differential Display, Methods
Mol. Genetics 5, 3-16.
Linskens, M. H. K., Tonkin, L. A. und Saati, S. M. (1998). Enhanced Differential Display a
reproducible method for the analysis of differential gene expression, Cell Biol. 4, 275-280.
135
LITERATUR
Lisitsyn, N. und Wigler, M. (1993). Cloning the differences between two complex genomes,
Science 259, 946-951.
Liu, A. X., Testa, J. R., Hamilton, T. C., Jove, R., Nicosia, S. V. und Cheng, J. Q. (1998).
AKT2, a member of the protein kinase B family, is activated by growth factors, v-Ha-ras, and
v-src through phosphatidylinositol 3-kinase in human ovarian epithelial cancer cells, Cancer
Res. 58, 2973-2977.
Luce, M. J. und Burrows, P. D. (1998). Minimizing false positives in differential display,
Biotechniques 24, 766-768, 770.
Ludwig, K. S. (1998). The Mayer-Rokitansky-Kuster syndrome. An analysis of its morphology
and embryology. Part I Morphology, Arch. Gynecol. Obstet. 262, 1-26.
Ludwig, K. S. (1998). The Mayer-Rokitansky-Kuster syndrome. An analysis of its morphology
and embryology. Part II Embryology, Arch. Gynecol. Obstet. 262, 27-42.
Lynch, H. T., Casey, M. J., Lynch, J., White, T. E. und Godwin, A. K. (1998). Genetics and
ovarian carcinoma, Semin. Oncol. 25, 265-280.
Maecker, H. T., Todd, S. C. und Levy, S. (1997). The tetraspanin superfamily molecular
facilitators, Faseb J. 11, 428-442.
Martin, K. J. und Pardee, A. B. (1999). Principles of differential display, Methods Enzymol.
303, 234-258.
Martin-Satue, M. und Blanco, J. (1999). Identification of semaphorin E gene expression in
metastatic human lung adenocarcinoma cells by mRNA differential display, J. Surg. Oncol.
72, 18-23.
Matz, M. V. und Lukyanov, S. A. (1998). Different strategies of differential display areas of
application, Nucleic Acids Res. 26, 5537-5543.
Mayer, B. J., Ren, R., Clark, K. L. und Baltimore, D. (1993). A putative modular domain
present in diverse signaling proteins, Cell 73, 629-630.
Menzin, A. W., Loret de Mola, J. R., Bilker, W. B., Wheeler, J. E., Rubin, S. C. und Feinberg,
R. F. (1998). Identification of oncofetal fibronectin in patients with advanced epithelial ovarian
cancer detection in ascitic fluid and localization to primary sites and metastatic implants,
Cancer 82, 152-158.
Micklem, D. R., Adams, J., Grunert, S. und St. Johnston, D. (2000). Distinct roles of two
conserved Staufen domains in oskar mRNA localization and translation, Embo J. 19, 13661377.
Miki, Y., Swensen, J., Shattuck-Eidens, D., Futreal, P. A., Harshman, K., Tavtigian, S., Liu,
Q., Cochran, C., Bennett, L. M., Ding, W. und et al. (1994). A strong candidate for the breast
and ovarian cancer susceptibility gene BRCA1, Science 266, 66-71.
Mitsuuchi, Y., Johnson, S. W., Moonblatt, S. und Testa, J. R. (1998). Translocation and
activation of AKT2 in response to stimulation by insulin, J. Cell. Biochem. 70, 433-441.
136
LITERATUR
Mitsuuchi, Y., Johnson, S. W., Sonoda, G., Tanno, S., Golemis, E. A. und Testa, J. R.
(1999). Identification of a chromosome 3p14.3-21.1 gene, APPL, encoding an adaptor
molecule that interacts with the oncoprotein-serine/threonine kinase AKT2, Oncogene 18,
4891-4898.
Mok, S. C., Bell, D. A., Knapp, R. C., Fishbaugh, P. M., Welch, W. R., Muto, M. G.,
Berkowitz, R. S. und Tsao, S. W. (1993). Mutation of K-ras protooncogene in human ovarian
epithelial tumors of borderline malignancy, Cancer Res. 53, 1489-1492.
Mok, S. C., Chan, W. Y., Wong, K. K., Muto, M. G. und Berkowitz, R. S. (1996). SPARC, an
extracellular matrix protein with tumor-suppressing activity in human ovarian epithelial cells,
Oncogene 12, 1895-1901.
Mok, S. C., Wong, K. K., Chan, R. K., Lau, C. C., Tsao, S. W., Knapp, R. C. und Berkowitz,
R. S. (1994). Molecular cloning of differentially expressed genes in human epithelial ovarian
cancer, Gynecol. Oncol. 52, 247-252.
Monteiro, A. N. A. (2000). BRCA1 exploring the links to transcription, TIBS 25, 469-474.
Moore, K.L. (1973). The developing Human, (Saunders Company).
Mori, K., Maeda, Y., Kitaura, H., Taira, T., Iguchi-Ariga, S. M. und Ariga, H. (1998). MM-1, a
novel c-Myc-associating protein that represses transcriptional activity of c-Myc, J. Biol.
Chem. 273, 29794-29800.
Ness, R. B. und Cottreau, C. (1999). Possible role of ovarian epithelial inflammation in
ovarian cancer, J. Natl. Cancer Inst. 91, 1459-1467.
Niklinski, J., Claassen, G., Meyers, C., Gregory, M. A., Allegra, C. J., Kaye, F. J., Hann, S. R.
und Zajac-Kaye, M. (2000). Disruption of Myc-Tubulin interaction by hyperphosphorylation of
c-Myc during mitosis or by constitutive hyperphosphorylation of mutant c-Myc in Burkitt’s
Lymphoma, Mol. Cell. Biol. 20, 5276-5284.
Okochi, H., Mine, T., Nashiro, K., Suzuki, J., Fujita, T. und Furue, M. (1999). Expression of
tetraspans transmembrane family in the epithelium of the gastrointestinal tract, J. Clin.
Gastroenterol. 29, 63-67.
Page, C., Lin, H. J., Jin, Y., Castle, V. P., Nunez, G., Huang, M. und Lin, J (2000).
Overexpression of Akt/AKT can modulate chemotherapy-induced apoptosis, Anticancer Res.
20, 407-416
Pere, H., Tapper, J., Seppala, M., Knuutila, S. und Butzow, R. (1998). Genomic alterations in
fallopian tube carcinoma: comparison to serous uterine and ovarian carcinomas reveals
similarity suggesting likeness in molecular pathogenesis, Cancer Res. 58, 4274-4276.
Perez-Canadillas, J. M. und Varani, G. (2001). Recent advances in RNA-protein recognition,
Curr. Opin. Struct. Biol. 11, 53-58.
Rameh, L. E., Chen, C. S. und Cantley, L. C. (1995). Phosphatidylinositol (3,4,5)P3 interacts
with SH2 domains and modulates PI 3-Kinase association with tyrosin-phosphorylated
proteins, Cell 83, 821-830.
Rameh, L. E., Tolias, K. F., Duckworth, B. C. und Cantley, L. C. (1997). A new pathway for
synthesis of phosphatidylinositol-4,5-bisphosphate, Nature 390, 192-196.
137
LITERATUR
Rebecchi, M. J. und Scarlata, S. (1998). Pleckstrin homology domains a common fold with
diverse functions, Annu. Rev. Biophys. Biomol. Struct 27, 503-528.
Romberger, D. J. (1997). Fibronectin, Int. J. Biochem. Cell Biol. 29, 939-943.
Rouvier, E., Luciani, M. F., Mattei, M. G., Denizot, F. und Golstein, P. (1993). CTLA-8,
cloned from an activated T cell, bearing AU-rich messenger RNA instability sequences, and
homologous to a herpesvirus saimiri gene, J. Immunol. 150, 5445-5456.
Runnebaum, I. B. und Stickeler, E. (2001). Epidemiological and molecular aspects of ovarian
cancer risk, J. Cancer Res. Clin. Oncol. 127, 73-79.
Ryter, J. M. und Schultz, S. C. (1998). Molecular basis of double-stranded RNA-protein
interactions structure of a dsRNA-binding domain complexed with dsRNA, Embo J. 17, 75057513.
Sagerstrom, C. G., Sun, B. I. und Sive, H. L. (1997). Subtractive cloning past, present, and
future, Annu. Rev. Biochem. 66, 751-783.
Smith, N. R., Li, A., Aldersley, M., High, A. S., Markham, A. F. und Robinson, P. A. (1997).
Rapid determination of the complexity of cDNA bands extracted from DDRT-PCR
polyacrylamide gels, Nucleic Acids Res 25, 3552-3554.
St Johnston, D. (1995). Developmental biology. New role for tropomyosin, Nature 377, 483.
St Johnston, D., Beuchle, D. und Nusslein-Volhard, C. (1991). Staufen, a gene required to
localize maternal RNAs in the Drosophila egg, Cell 66, 51-63.
St Johnston, D., Brown, N. H., Gall, J. G. und Jantsch, M. (1992). A conserved doublestranded RNA-binding domain, Proc. Natl. Acad. Sci. USA 89, 10979-10983.
Staal, S. P. (1987). Molecular cloning of the akt oncogene and its human homologues AKT1
and AKT2 Amplification of AKT1 in a primary human gastric adenocarcinoma, Proc. Natl.
Acad. Sci. USA 84, 5034-5037.
Thomas, J. O. und Kornberg, R. D. (1975). An octamer of histones in chromatin and free in
solution, Proc. Natl. Acad. Sci. USA 72, 2626-2630.
Towbin, H., Staehelin, T. und Gordon, J. (1979). Electrophoretic transfer of proteins from
polyacrylamide gels to nitrocellulose sheets procedure and some applications, Proc. Natl.
Acad. Sci. USA 76, 4350-4354.
Vainberg, I. E., Lewis, S. A., Rommelaere, H., Ampe, C., Vandekerckhove, J., Klein, H. L.
und Cowan, N. J. (1998). Prefoldin, a chaperone that delivers unfolded proteins to cytosolic
chaperonin, Cell 93, 863-873.
van Niekerk, C. C., Vooijs, P., Casparie-van Velsen, I. J. und Poels, L. G. (1997).
Differentiation margins of ovarian tumor pathology first incidences of epithelial ovarian
tumors monitored by marker antibodies, Cancer Detect. Prev. 21, 247-257.
Venkitaraman, A. R. (2001). Chromosome stability, DNA recombination and the BRCA2
tumour suppressor, Curr. Opin. Cell. Biol. 13, 338-343.
138
LITERATUR
von der Kammer, H., Albrecht, C., Mayhaus, M., Hoffmann, B., Stanke, G. und Nitsch, R. M.
(1999). Identification of genes regulated by muscarinic acetylcholine receptors application of
an improved and statistically comprehensive mRNA differential display technique, Nucleic
Acids Res. 27, 2211-2218.
von Stein, O. D., Thies, W. G. und Hofmann, M. (1997). A high throughput screening for
rarely transcribed differentially expressed genes, Nucleic Acids Res. 25, 2598-2602.
Welsh, J.B., Zarrinkar, P.P., Sapinoso, L.M., Kern, S.G., Behling, C.A., Monk, B.J., Lockhart,
D.J., Burger, R.A. und Hampton, G.M. (2001). Analysis of gene expression profiles in normal
and neoplastic ovarian tissue samples identifies candidate molecular markers of epithelial
ovarian cancer, Proc. Natl. Acad. Sci. USA 98, 1176-1181.
Wickham, L., Duchaine, T., Luo, M., Nabi, I. R. und DesGroseillers, L. (1999). Mammalian
staufen is a double-stranded-RNA- and tubulin-binding protein which localizes to the rough
endoplasmic reticulum, Mol. Cell Biol. 19, 2220-2230.
Woolnough, E., Russo, L., Khan, M. S. und Heatley, M. K. (2000). An immunohistochemical
study of the rete ovarii and epoophoron, Pathology 32, 77-83.
Yamada, T., Endo, R., Gotoh, M. und Hirohashi, S. (1997). Identification of semaphorin E as
a non-MDR drug resistance gene of human cancers, Proc. Natl. Acad. Sci. USA 94, 1471314718.
Yuan, Z. Q., Sun, M., Feldman, R. I., Wang, G., Ma, X., Jiang, C., Coppola, D., Nicosia, S. V.
und Cheng, J. Q. (2000). Frequent activation of AKT2 and induction of apoptosis by inhibition
of phosphoinositide-3-OH kinase/Akt pathway in human ovarian cancer, Oncogene 19, 23242330.
139
Hiermit erkläre ich an Eides statt,
daß ich die vorliegende Arbeit selbständig
und ohne unerlaubte Hilfsmittel
durchgeführt habe.
Heidelberg, im Juni 2001