FREE JOINT MULTI AIR CONDITIONER
SERVICE
INDOOR UNIT
OUTDOOR UNIT
MH026FNCA
MH035FNCA
MH052FNCA
MH026FECA
MH035FECA
MH052FECA
MH050FXCA2A
MH080FXCA4A
Manual
AIR CONDITIONER
THE FEATURE OF PRODUCT
■
Multi Inverter(Free Joint Multi) Series
– Variable Indoor Unit Combination(Free Joint Multi)
– Multi Inverter(Free Joint Multi) Series delivers
comfort to 2~4 rooms with a Single Outdoor Unit
– Smart & Low noise outdoor units in any condition.
■
Energy Saving
– High Efficiency DC inverter and BLDC Comp.
– Smart Inverter Control algorithm.
– TBR Sine-Wave Compressor & Sine Wave Controller.
■
Convenient Installation
– 485 non Polarity / Auto addressing
– Easy checking system condition by 7-segment
■
Space Saving & Environmental Friendly
– Compact & Light Outdoor Unit
– Slim and Quiet Indoor Units
Refer to the service manual in the GSPN(see the rear cover) for the more information.
Contents
1. Precautions .......................................................................................................................................... 1-1
1-1 Installing the air conditioner ..........................................................................................................
1-1
1-2 Power supply and circuit breaker
..............................................................................................
1-1
1-3 During operation ................................................................................................................................
1-1
1-4 Disposing of the unit ........................................................................................................................
1-2
Others .....................................................................................................................................................
1-2
1-5
2. Product Specifications ............................................................................................................. 2-1
2-1 The Feature of Product
.................................................................................................................
2-1
2-2 Product Specifications
...................................................................................................................
2-2
2-3 Accessory and Option Specifications
......................................................................................
2-6
..............................................................................................
3-1
3-1 Error mode and check method ...................................................................................................
3-1
3-2 Setting Option Setup Method
3-6
3. Alignment and Adjustments
.....................................................................................................
4. Disassembly and Reassembly
........................................................................................
4-1
4-1 Indoor Unit ...........................................................................................................................................
4-2
4-2 Outdoor Unit
.......................................................................................................................................
4-18
5. Exploded Views and Parts List ....................................................................................... 5-1
5-1 Indoor Unit ...........................................................................................................................................
5-1
5-2 Outdoor Unit
5-9
.......................................................................................................................................
...............................................................................................................................
6-1
6-1 Indoor Unit ...........................................................................................................................................
6-1
6-2 Outdoor Unit
6-3
6. Wiring Diagram
.......................................................................................................................................
7. Schematic Diagram ..................................................................................................................... 7-1
7-1 Indoor Unit ...........................................................................................................................................
7-1
7-2 Outdoor Unit
.......................................................................................................................................
7-3
.....................................................................................................................................
8-1
8. PCB Diagram
8-1 MAIN PCB(Indoor Unit)
.................................................................................................................
8-2 MAIN PCB(Outdoor Unit)
.............................................................................................................
8-1
8-4
Contents
9. Troubleshooting .............................................................................................................................. 9-1
9-1 Items to be checked first ................................................................................................................
9-1
9-2 Checking and Testing operations ...............................................................................................
9-2
9-3 Fault Diagnosis by Symptom ....................................................................................................... 9-12
9-4 PCB Inspection ................................................................................................................................... 9-18
10. Reference for Installation....................................................................................................... 10-1
10-1 Selecting Area for Installation .................................................................................................... 10-1
10-2 Connecting Up and Purging the Circuit................................................................................. 10-3
10-3 Refrigerant Refill.............................................................................................................................. 10-5
10-4 Refrigerant Adjustment ................................................................................................................. 10-7
10-5 Flare Nut Fixing Torque ................................................................................................................ 10-8
10-6 "Pump down" Procedure.............................................................................................................. 10-9
11. Reference Information............................................................................................................... 11-1
11-1 Index for Model Name
.................................................................................................................
11-2 Refrigerating Cycle Diagram
11-3 Pressure & Capacity mark
.....................................................................................................
11-3
.........................................................................................................
11-5
11-4 The abbreviated technology words & the definition of technology terms
11-5 Q & A for Non-trouble
11-1
..............
11-5
...................................................................................................................
11-6
11-6 Common sense of refrigeration
...............................................................................................
11-9
1. Precautions
1-1 Installing the air conditioner
● Users should not install the air conditioner by themselves.
Ask the dealer or authorized company to install the air conditioner except the window-type air conditioner in U.S.A and Canada.
● If you don’t install the air conditioner properly, it may cause a fire, a water leakage or an electric shock.
● You must install the air conditioner according to the national wiring regulations and safety regulations.
● Install the indoor unit higher than 8.2ft(2.5m) from the floor to avoid the injury caused by the operation of the fan.
(except the window-type air conditioner)
● The manufacturer is not responsible for any accidents or injury caused by an incorrect installation.
● When installing the built-in type air conditioner, keep all electric cables such as the power cable and the connection cord in pipes,
ducts, or cable channels to protect them from the danger of impact or any other incidents.
● More than 2 indoor units should be installed when you use Free Joint Multi air conditioner.
● MH050FXCA2A
- MH052FNCA and MH052FECA indoor unit cannot be connected to the MH050FXCA2A outdoor unit.
1-2 Power supply and circuit breaker
● If the power cord of the air conditioner is damaged, it must be replaced by the manufacturer or a qualified person in order to
avoid a hazard.
● The air conditioner must be plugged into an independent circuit if applicable or connect the power cable to the auxiliary circuit
breaker.
An all pole disconnection from the power supply must be incorporated in the fixed wiring with a contact opening of >0.12inch(mm).
● Do not extend an electric cord to the air conditioner.
● The air conditioner must be plugged in after you complete the installation.
1-3 During operation
● Do not repair the air conditioner at your discretion.
It is recommended to contact a service center directly.
● Never spill any kind of liquid on the air conditioner.
If this happens, turn off the air conditioner and contact an authorized service center.
● Do not insert anything between the airflow blades to prevent damage of the inner fan and consequent injury.
Keep children away from the air conditioner.
● Do not place any obstacles in front of the air conditioner.
● Do not spray any kind of liquid into the indoor unit. If this happens, turn off the air conditioner and contact a service center.
● Make sure that the air conditioner is well ventilated at all times:
Do not place a cloth or other materials over it.
● Remove the batteries if you don’t use the remote control for a long time. (If applicable)
● Use the remote control within 23ft(7m) from the indoor unit. (If applicable)
Samsung Electronics
1-1
1-4 Disposing of the unit
● Before throwing out the air conditioner, remove the batteries from the remote control.
● When you dispose of the air conditioner, consult your dealer. If pipes are removed incorrectly, refrigerant may blow out and
cause air pollution. When it contacts with your skin, it can cause skin injury.
● The package of the air conditioner should be recycled or disposed of properly for environmental reasons.
1-5 Others
●
●
●
●
1-2
Never store or load the air conditioner upside down or sideways to prevent the damage to the compressor.
Young children or infirm persons should be always supervised when they use the air conditioner.
Max current is measured according to IEC standard for safety.
Current is measured according to ISO standard for energy efficiency.
Samsung Electronics
2. Product Specifications
2-1 The Feature of Product
■ Multi Inverter(Free Joint Multi) Series delivers comfort to 2~4 rooms with a Single Outdoor Unit.
■ Inverter for High Efficiency Operation.
Thanks to inverter control, efficiency of operation of the outdoor unit is enhanced depending on the number of indoor units operated and the temperature setting.
When only one indoor unit is used, power is saved, resulting in a smaller electricity bill. When all indoor units are used, high-power operation achieves comfort quickly in all rooms.
■ Installation of indoor units on different floors is possible.
■ Convenient Installation
Auto addressing option : Automated checking of pipe connection.(Refer to the installation manual for detail)
■ Space saving & Environmental Friendly
• Compact & light outdoor unit
• Slim and quiet indoor units
• Pipe size reduction
• Ozone friendly Refrigerant(R410A)
• Lead Free controller.
■ Reliability
• Installation possibilities(Length/Height)
• Convenient installation(485 non polarity/auto-addressing)
• Intelligent control/network
• Easy checking system condition by 7-segment
■ Smart & Low Noise outdoor units in any condition
• TBR/Sine-Wave Controller/Noise Reduction Control/Dual Felt etc.
• Felt Structure : New felt has selected to reduce the noise coming out of the compressor.
Double layered felt structure absorbs noise by two times and felt is also covering top of the compressor to
reduce the noise even more.
Samsung Electronics
2-1
2-2 Product Specifications
Model
MH026FNCA
Item
INDOOR UNIT
Type
Cooling
Btu/hr
Heating
Wall-mounted
Wall-mounted
9,000
12,000
10,000
13,000
-
-
8.31
9.54
8.56
9.93
32
36
32
36
1,208~230,60
1,208~230,60
30
35
|/h
Dehumidifying
Performance
MH035FNCA
Cooling
Air Volume
m3/min
Heating
Cooling
Noise
dB
Heating
Power
ø,V,Hz
Power Consumption
Cooling
W
Heating
30
35
Cooling
0.18
0.19
0.18
0.19
mm
825x285x189
825x285x189
inch
32x11x7.4
32x11x7.4
Power
Operating Current
A
Heating
Outer Dimension
WxHxD
Weight
kg
Refrigerant Pipe
Size
OD(inch)xL(ft)
ø1/4
ø1/4
Gas
OD(inch)xL(ft)
ø3/8x24.6
ø3/8x24.6
DxL(mm)
Type
Motor
Type
Rated Output
Heat Exchanger
Refrigerant Control Unit
2-2
7.8kg
Liquid
Drain Hose
Blower
7.8kg
W
ø18x535
ø18x535
Cross-fan
Cross-fan
Resin/steel
Resin/steel
27
27
2ROW 14STEP
2ROW 14STEP
EEV
EEV
Samsung Electronics
Product Specifications(cont.)
Model
MH052FNCA
Item
INDOOR UNIT
Type
Wall-mounted
Cooling
Btu/hr
19,000
Heating
|/h
Dehumidifying
Performance
18,000
Cooling
Air Volume
m3/min
Cooling
dB
ø,V,Hz
Power Consumption
Cooling
40
40
Heating
Power
13.21
14.22
Heating
Noise
-
W
1,208~230,60
50
Heating
50
Cooling
0.30
Power
Operating Current
A
0.30
Heating
Outer Dimension
mm
1,065x298x128
inch
42x12x8.6
kg
13
Liquid
OD(inch)xL(ft)
ø1/4x24.6
Gas
OD(inch)xL(ft)
ø1/2x24.6
WxHxD
Weight
Refrigerant Pipe
Size
Drain Hose
DxL(mm)
Blower
Motor
Refrigerant Control Unit
Samsung Electronics
Resin /steel
Type
Rated Output
Heat Exchanger
ø18x600
Cross-fan
Type
W
40
2ROW 16STEP
EEV
2-3
Product Specifications(cont.)
Model
MH026FECA
Item
Cooling
Btu/hr
Heating
Cooling
Air Volume
m3/min
Heating
Cooling
Noise
dB
Cooling
Operating Current
Cooling
WxHxD
Motor
Refrigerant Control Unit
2-4
10,000
13,000
19,000
8.6
9.8
13.6
9.0
10.3
14.2
31
32
39
39
76
76
150
76
76
150
0.35
0.35
0.69
0.35
0.35
0.69
mm
900x199x600
900x199x600
1,100x199x600
inch
35.4x7.8X23.6
38.2x7.1x15.4
1,100x199x600
W
A
kg
26
26
31
OD(inch)xL(ft)
ø1/4x24.6
ø1/4x24.6
ø1/4x24.6
Gas
OD(inch)xL(ft)
ø3/8x24.6
ø3/8x24.6
ø1/2x24.6
Sirocco fan
Sirocco fan
Sirocco fan
Resin/steel
Resin/steel
Resin/steel
47
47
53
2ROW 12STEP
2ROW 12STEP
2ROW 12STEP
EEV
EEV
EEV
Type
Rated Output
Heat Exchanger
18,000
1,208~230,60
Type
Blower
12,000
Liquid
Weight
Refrigerant Pipe
9,000
32
Heating
Outer Dimension
Slim Duct
1,208~230,60
Heating
Power
Slim Duct
31
ø,V,Hz
Power Consumption
Slim Duct
1,208~230,60
Heating
Power
Size
MH052FECA
INDOOR UNIT
Type
Perfor­
mance
MH035FECA
W
Samsung Electronics
Product Specifications(cont.)
/QFGN
/*(:&#$
+VGO
176&11470+6
6[RG
(TGG,QKPV/WNVK
%CRCEKV[
2GTHQT
OCPEG
%QQNKPI
*GCVKPI
%QQNKPI
*GCVKPI
2QYGT
2QYGT%QPUWORVKQP
1RGTCVKPI%WTTGPV
5K\G
F$
Ó8*\
%QQNKPI
*GCVKPI
%QQNKPI
*GCVKPI
(WUG%CRCEKV[
&KOGPUKQP
$VWJT
O OKP
#KT8QNWOG
0QKUG
2QYGT
1WVFQQT
1PN[
9Z*Z&
9GKIJV
9
#
.WDTKECPV1KN
$NQYGT
/QVQT
`
`
`
`
`
`
`
`
`
`
ZZ
MI
6YKP4QVCT[
6YKP4QVCT[
)6(7#'9
)6(7#'9
6[RG
$.&%2GTOCPGPVOCIPGVKE/QVQT
$.&%2GTOCPGPVOCIPGVKE/QVQT
6[RG
21'
21'
%CRCEKV[
EE
6[RG
5K\G
4CVGF1WVRWV
1&
OOZ.
O
9
4GHTKIGTCPV%QPVTQN&GXKEG
Samsung Electronics
`
*GCV'ZEJCPIGT
%JCTIKPI4GHTKIGTCPV
4#
`
ZZ
2TQVGEVKQP&GXKEG
(CP/QVQT
$NQYGT
`
#
/QFGN0COG
/QVQT
(TGG,QKPV/WNVK
`
KPEJ
6[RG
%QO
RTGUUQT
/*(:%##
Q\
1.2
1.2
2TQRGNNGT
2TQRGNNGT
Ó
Ó
41956'2
41956'2
''8
''8
2-5
2-3 Accessory and Option Specifications
2-3-1 Indoor Unit Accessories
■ MH✳✳✳FNCA
+VGO
&GUETKRVKQPU
%QFG0Q
36;
4GOCTM
&$$
+PUVCNNCVKQP2NCVG
2NCVG*CPIGT
/*(0%#/*(0%#
&$#
/*(0%#
4GOQVG%QPVTQN
&$3
+PFQQT
7PKV
6+105
190'45 +05647% %+10'5
/#07#. &' +05647%
.751
+5647<+10+ 2'4
¨'5
/#07#. &' +05647š
6+10
/#07'. &76+.+5#
'+570)
)'$4#7%*5#09
#KT %QPFKVKQPGT5RNKV
5RNWVV[RG 4QQO
FQOÃUVKEQ UKUVGOC
CF WPKV´ 5GRCTCVG
#KTG CEQPFKEKQPCFQ
FCTKC RGT CODKGPVK
%QPFK\KQPCVQTGFG CT EQPFKEKQPCFQ VKRQ 5RNKV
#RCTGNJQ
V[RG UÃRCTÃ
%NKOCVKUGWT FG
)GVGKNVG TCWOMNKOCCPNCIG
7UGT/CPWCN
&$#
+PUVCNNCVKQP/CPWCN
&$#
6+105
190'45 +05647% %+10'5
/#07#. &' +05647%
.751
+5647<+10+ 2'4
¨'5
/#07#. &' +05647š
6+10
/#07'. &76+.+5#
'+570)
)'$4#7%*5#09
#KT %QPFKVKQPGT5RNKV
5RNWVV[RG 4QQO
FQOÃUVKEQ UKUVGOC
CF WPKV´ 5GRCTCVG
#KTG CEQPFKEKQPCFQ
FCTKC RGT CODKGPVK
%QPFK\KQPCVQTGFG CT EQPFKEKQPCFQ VKRQ 5RNKV
#RCTGNJQ
V[RG UÃRCTÃ
%NKOCVKUGWT FG
)GVGKNVG TCWOMNKOCCPNCIG
6JGFGUKIPCPFUJCRGECPDGEJCPIGFCEEQTFKPIVQVJGOQFGN
2-6
Samsung Electronics
Product Specifications
Indoor Unit Accessories(cont.)
■ MH✳✳✳FECA
Item
Descriptions
Code-No.
Q'TY
User Manual
DB98-29159A
1
Installation Manual
DB98-29160A
1
Pattern Sheet
DB97-03906A/B
1
Insulation-Install Outlet
DB72-00143D
1
Insulation-Install Inlet
DB72-00143E
1
Remark
TIONS
OWNER'S INSTRUC CIONES
MANUAL DE INSTRUC
L'USO
ISTRUZIONI PER
ÕES
MANUAL DE INSTRUÇ
TION
MANUEL D'UTILISA
EISUNG
GEBRAUCHSANW
Air ConditionerSplit
Splut-type Room
doméstico sistema
ad unità Separate
Aire acondicionado
d'aria per ambienti
Condizionatorede ar condicionado tipo Split
Aparelho
type séparé
Climatiseur de
Geteilte raumklimaanlage
TIONS
OWNER'S INSTRUC CIONES
MANUAL DE INSTRUC
L'USO
ISTRUZIONI PER
ÕES
MANUAL DE INSTRUÇ
TION
MANUEL D'UTILISA
EISUNG
GEBRAUCHSANW
Air ConditionerSplit
Splut-type Room
doméstico sistema
ad unità Separate
Aire acondicionado
d'aria per ambienti
Condizionatorede ar condicionado tipo Split
Aparelho
type séparé
Climatiseur de
Geteilte raumklimaanlage
Indoor
Unit
Drain Hose Joint
DB94-00758A
1
Rubber
(Grommet Hanger)
DB63-00237A
8
Insulation-Drain Out
DB62-03439H
1
Insulation-Out
DB62-03439J
2
Insulation-Drain In
DB62-03440H
1
✳ The design and shape can be changed according to the model.
Samsung Electronics
2-7
Product Specifications
Indoor Unit Accessories(cont.)
■ MH✳✳✳FECA(cont.)
Item
Descriptions
Code-No.
Q'TY
Cable-tie
DB65-10088C
8
Remark
Indoor
Unit
Drain Pipe Holder
DB90-02064A
2
✳ The design and shape can be changed according to the model.
2-8
Samsung Electronics
Product Specifications
2-3-2 Outdoor Unit Accessories
■ MH050FXCA2A/MH080FXCA4A
+VGO
&GUETKRVKQPU
%QFG0Q
36;
&TCKP2NWI1WV
&$#
6TCPUOKVVGTRQYGTECDNG
#UU[%QPPGEVQT9KTG&%2QYGT
&$#
4WDDGT.GI
&$#
1WVFQQT
7PKV
6+105
190'45 +05647% %+10'5
/#07#. &' +05647%
.751
+5647<+10+ 2'4
¨'5
/#07#. &' +05647š
6+10
/#07'. &76+.+5#
'+570)
)'$4#7%*5#09
'+570)
)'$4#7%*5#09
'+570)
)'$4#7%*5#09
#KT %QPFKVKQPGT5RNKV
5RNWVV[RG 4QQO
FQOÃUVKEQ UKUVGOC
CF WPKV´ 5GRCTCVG
#KTG CEQPFKEKQPCFQ
FCTKC RGT CODKGPVK
%QPFK\KQPCVQTGFG CT EQPFKEKQPCFQ VKRQ 5RNKV
#RCTGNJQ
V[RG UÃRCTÃ
%NKOCVKUGWT FG
)GVGKNVG TCWOMNKOCCPNCIG
)GVGKNVG TCWOMNKOCCPNCIG
4GOCTM
+PUVCNNCVKQP/CPWCN
&$#
5GTXKEG/CPWCN
&$#
0KRRNG%QPPGEVQT
&$#
/*(:%##
6+105
190'45 +05647% %+10'5
/#07#. &' +05647%
.751
+5647<+10+ 2'4
¨'5
/#07#. &' +05647š
6+10
/#07'. &76+.+5#
'+570)
)'$4#7%*5#09
'+570)
)'$4#7%*5#09
'+570)
)'$4#7%*5#09
#KT %QPFKVKQPGT5RNKV
5RNWVV[RG 4QQO
FQOÃUVKEQ UKUVGOC
CF WPKV´ 5GRCTCVG
#KTG CEQPFKEKQPCFQ
FCTKC RGT CODKGPVK
%QPFK\KQPCVQTGFG CT EQPFKEKQPCFQ VKRQ 5RNKV
#RCTGNJQ
V[RG UÃRCTÃ
%NKOCVKUGWT FG
)GVGKNVG TCWOMNKOCCPNCIG
)GVGKNVG TCWOMNKOCCPNCIG
6JGFGUKIPCPFUJCRGECPDGEJCPIGFCEEQTFKPIVQVJGOQFGN
Samsung Electronics
2-9
Product Specifications
2-3-3 Transmitter Unit Accessories
Item
Descriptions
Code-No.
Q'TY
Transmitter
(Ass'y PCB-DVM Plus I/M)
DB9303568A
1
Transmitter Power cable
(Wire Harness-DC Source)
DB39-00378E
Transmitter communication cable
(Connect Wire-COM)
DB39-00253B
(MIM-B13)
(MIM-B13)
(MIM-B13)
Remark
1
1
Transmitter
Case
(Case-Relay PCB Out)
DB61-00450B
Cable-tie
DB65-10088B
TIONS
OWNER'S INSTRUC CIONES
MANUAL DE INSTRUC
L'USO
ISTRUZIONI PER
ÕES
MANUAL DE INSTRUÇ
TION
MANUEL D'UTILISA
EISUNG
GEBRAUCHSANW
EISUNG
GEBRAUCHSANW
EISUNG
GEBRAUCHSANW
Air ConditionerSplit
Splut-type Room
doméstico sistema
ad unità Separate
Aire acondicionado
d'aria per ambienti
Condizionatorede ar condicionado tipo Split
Aparelho
type séparé
Climatiseur de
Geteilte raumklimaanlage
Geteilte raumklimaanlage
Installation Manual
(MIM-B13)
DB98-25776A
(MIM-B13)
1
3
1
✳ The design and shape can be changed according to the model.
2-10
Samsung Electronics
HECJIAJP=J@@FQOPIAJPO
"NNKNIK@A=J@?DA?GIAPDK@
&J@KKN2JEP
/*
(0%#
+PFKECVQTU
&GUETKRVKQP
12'4#6+10
6+/'4
674$1
/CKP%JGEMKPI2QKPV
+PFQQTWPKVTQQOVGORGTCVWTGUGPUQTGTTQT
QRGPQTUJQTV
+PFQQTWPKVJGCVGZEJCPIGTVGORGTCVWTGUGPUQTGTTQT
QRGPQTUJQTV
+PFQQTHCPOQVQTOCNHWPEVKQP
''241/GTTQT
1RVKQP5GVVKPI
1RVKQPGTTQT
QRVKQPYCUPVUGVWRQTQRVKQPFCVCGTTQT
1RVKQP5GVVKPI
1WVFQQTWPKVGTTQT
Samsung Electronics
4GOQVG%QPVTQNQPQHH
1WVFQQT7PKV2QYGT4GUGV
3-1
Alignment and Adjustments
■ MH✳✳✳FECA
The error indicated on the LED display of Indoor unit
Indicators
Concealed Type
Abnormal conditions
Blue
Red
Operating
Standard Type
Power reset
Error of temperature sensor in indoor unit(OPEN/SHORT)
Error of heat exchanger sensor in indoor unit
Error of heat exchanger OUT sensor in indoor unit
Error of outlet temperature sensor in indoor unit
(OPEN/SHORT): For heat pump models only
Displayed on
appropriate indoor unit
which is operating
Displayed on
appropriate indoor unit
which is operating
Error of mixed operation
Error of outdoor temperature sensor
Error of COND sensor
Error of DISCHARGE sensor
1. No communication for 2 minutes between indoor unit
and outdoor unit (communication error for more than
2 minutes)
2. Indoor unit receiving the communication error from
outdoor unit
3. Outdoor unit tracking 3 minutes error
4. When sending the communication error from outdoor
unit the mismatching of the communication numbers
and installed numbers after completion of tracking.
(communication error for more than 2 minutes)
Self-diagnostic error
(including the indoor unit not detected)
1. Error of electronic expansion valve close
2. Error of electronic expansion valve open
3. Breakaway of EVA OUT sensor
Displayed on
appropriate indoor unit
which is operating
Displayed on outdoor
unit
1. Error of indoor unit :
Displayed on the
indoor unit regardless
of operation
2. Error of outdoor unit :
Displayed on the
indoor unit which is
operating
Displayed on
appropriate indoor unit
which is operating
Displayed on outdoor
unit
4. Breakaway of EVA IN sensor
: On
: Flickering
: Off
◆ If you turn off the air conditioner when the LED is flickering, the LED is also turned off.
◆ If you re-operate the air conditioner, it operates normally at first, then detect an error again.
Samsung Electronics
3-2
Alignment and Adjustments
■ MH✳✳✳FECA(cont.)
The error indicated on the LED display of Indoor unit
Indicators
Concealed Type
Abnormal conditions
Blue
Red
Operating
Standard Type
5. Breakaway of COND MID sensor
6. 2 detection of refrigerant completely leak
nd
7. 2nd detection of high temperature COND
8. 2nd detection of high temperature DISCHARGE
Displayed on appropriate
indoor unit which is
operating
Displayed on outdoor
unit
9. COMP DOWN due to 2nd detection of low pressure
switch
10. Error of reverse phase
11. Compressor down due to 6th detection of freezing
12. Self-diagnosis of condensation sensor (G8, G9)
13. Compressor down due to condensation ratio control
Error of float switch
Error of setting option switches for optional accessories
EEPROM error
EEPROM option error
: On
: Flickering
: Off
◆ If you turn off the air conditioner when the LED is flickering, the LED is also turned off.
◆ If you re-operate the air conditioner, it operates normally at first, then detect an error again.
3-3
Samsung Electronics
Alignment and Adjustments
3-1-2 Outdoor Unit
Display
EXPLANATION(The error indicated on the PCB display of outdoor unit)
REMARK
Communication error(indoor unable to receive data)
Check electrical connection
and setting
Outdoor unit communication error
(Abnormal data from indoor unit over 60 packet)
Check electrical connection
and setting
Indoor unit room temperature sensor error (Open/Short)
Indoor unit heat exchanger in temperature sensor error (Open/Short)
Indoor unit heat exchanger out temperature sensor error (Open/Short)
Indoor unit sensor error-Evaporator pipe in sensor - Self diagnosis
Indoor unit sensor error-Evaporator pipe out sensor - Self diagnosis
Indoor Unit FAN Error
More than two indoor units cool and heat simultaneously
Indoor Unit EEPROM Error
Indoor Unit EEPROM Option Error
Failure of pipe check operation
Check electrical connection
and setting
No pipe check operation check
- occasion : try to operation after the installation through auto addressing
mode without pipe check operation.
Check setting
The number of Indoor unit mismatched
Check electrical connection
and setting
Communication error between the outdoor and indoor unit
Check electrical connection
and setting
Outdoor communication error between main PCB and sub PCB
Outside temperature sensor error(Short/Open)
- Error level: over 4.9V(-50˚C) under 0.4V(93˚C)
Condenser temperature sensor error(Short/Open)
- Error level: over 4.9V(-50˚C) under 0.4V(93˚C)
Outdoor unit sensor error - Condenser out sensor(Short/Open) - Self diagnosis
Compressor Discharge temperature sensor error
Compressor discharge sensor detached - Self diagnosis
Compressor OLP sensor error (Short/Open)
- Error condition : outdoor temperature under -20˚C
- Error level : over 4.95V(-30˚C) under 0.5V(151˚C)
Samsung Electronics
3-4
Alignment and Adjustments
Outdoor Unit(cont.)
Display
EXPLANATION(The error indicated on the PCB display of outdoor unit)
REMARK
Outdoor unit freezing(Compressor stop)
check pipe length, indoor
unit filter, refrigerant leakage/
charge and service port
Outdoor unit overload - Safety control(Compressor stop)
check pipe length, refrigerant
leakage/charge
Outdoor unit high discharge temperature - Safety control
(Compressor stop)
check pipe length, refrigerant
leakage/charge
Outdoor unit EEV open (Stopped indoor unit s) -Self diagnosis
Outdoor unit EEV open (operating indoor unit s) -Self diagnosis
High temperature(over 30˚C) of outdoor as heating mode
Low temperature(under -10˚C) of outdoor as cooling mode
Outdoor Fan Error
Communication cable mismatched between indoor and outdoor unit
Check electrical connection
Inverter compressor starting failure (5 times)
Compressor trip by input current control mode (PFC over current)
Compressor trip by OLP temperature control mode
DC peak error (IPM Over Current)
Compressor Limit Error
DC link Voltage error (under 150V, over 410V)
Abnormal compressor running
(Compressor Rotation Error)
Current sensor error
DC link Voltage sensor error
OTP Error
Inverter micom zero-crossing error
NO GAS error(self diagnosis)
3-5
Piping(gas leak)
Samsung Electronics
3-2 Setting Option Setup Method
ex) Option No. :
Step 1 : Enter the Option Setup mode.
1st
Take out the batteries of remote control.
2nd
Press the temperature
insert the battery again.
3rd
Make sure the remocon display shown as
button simultaneously and
.
Step 2 : Enter the Option Setup mode and select your option according to the following procedure.
Feature
1
Display
Setting Option SEG1.
Push the
button to set the display panel to
.
Every time you push the button, the display panel reads
...
repeatedly.
2
Setting Option SEG2.
Push the
button to set the display panel to
.
Every time you push the button, the display panel reads
...
repeatedly.
3
3
1,4
Change it into the set display of Option SEG3 and SEG4
with the
2,5
4
button.
Setting Option SEG3.
Push the
button to set the display panel to
.
Every time you push the button, the display panel reads
...
repeatedly.
5
Setting Option SEG4.
Push the
button to set the display panel to
.
Every time you push the button, the display panel reads
...
repeatedly.
Samsung Electronics
3-6
Alignment and Adjustments
Feature
Display
6
Change it into the set display of Option SEG5 and SEG6
with the
button.
7
Setting Option SEG5.
Push the
button to set the display panel to
.
Every time you push the button, the display panel reads
...
repeatedly.
8
Setting Option SEG6.
Push the
button to set the display panel to
.
Every time you push the button, the display panel reads ...
repeatedly.
6,9
7,10
9
Change it into the set display of Option SEG7 and SEG8
8,11
with the
button.
10
Setting Option SEG7.
Push the
button to set the display panel to
.
Every time you push the button, the display panel reads
...
repeatedly.
11
Setting Option SEG8.
Push the
button to set the display panel to
.
Every time you push the button, the display panel reads
...
repeatedly.
12
Change it into the set display of Option SEG9 and SEG10
with the
button.
12
13
14
13
Setting Option SEG9.
Push the
button to set the display panel to
.
Every time you push the button, the display panel reads
...
repeatedly.
14
Setting Option SEG10.
Push the
button to set the display panel to
.
Every time you push the button, the display panel reads
...
repeatedly.
3-7
Samsung Electronics
Alignment and Adjustments
Step 3 : Upon completion of the selection, check you made right selections.
Whenever you press the
button, the set Option will be displayed.
Step 4 : Pressing the ON/OFF button (
)
When pressing the operation ON/OFF key with the direction of remote controller for unit, the sound "Ding" is heard and the
OPERATION LED lamp is flickering at the same time, then the input of option is completed. (If the "ding" sound isn't heard,
try again pressing the ON/OFF button.)
Step 5 : Unit operation test-run
First, Remove the battery from the remote controller.
Second, Re-insert the battery into the remote controller.
Third, Press ON/OFF (
) key with the direction of remote controller for set.
• Error Mode
1st
If all lamps of indoor unit are flickering, Plug out, plug in power plug again and press ON/OFF key to retry.
2nd
If the unit is not working properly or all lamps are continuously flickering after setting the option code, see if the
correct option code is set up for its model.
Samsung Electronics
3-8
TECHNICAL BULLETIN
Technical Bulletins are produced to provide information not contained in the manuals or to update currently
published technical information on the Samsung line of Mini splits
This bulletin is on :
Option Code Procedure for MH Neo Forte
Know this
The Option codes shown in the Service manual have been REVISED
The correct option code sequence
sequence, and recommended procedure is shown below
Option codes are required if ALL of the Indicator lights on the Indoor unit are blinking, the PCB has
been replaced or the Indoor and Outdoor units are not communicating
Symbol
Auto
Cool
Dry
Fan
Heat
MH026FNCA
ON TIMER
OFF TIMER
2
7
0
0
4
0
0
0
2
4
1
0
2
2
0
0
1
A
0
0
MH035FNCA
ON TIMER
OFF TIMER
2
7
0
0
4
0
0
0
2
6
1
0
2
2
0
0
4
D
0
0
MH052FNCA
ON TIMER
OFF TIMER
2
6
0
0
4
0
0
0
2
9
1
0
2
2
0
0
8
F
0
0
Step 1 Make sure the Indoor unit is turned OFF. At the Outside unit turn off the power supply,
wait for 1 minute for the Outdoor unit to completely power down, then re-apply power to the system
Step 2 Remove the batteries from the remote, wait 10 secs then hold down BOTH the UP & DOWN temperature
arrow buttons. While holding down the buttons re-insert batteries
Step 3 An arrow should appear next to the Auto mode graphic, with 00 and the
ON timer icon on the screen If no display appears repeat Step 2
Step 5 Using the DOWN arrow key, press it the correct number of times to scroll
the first digit in the code
code, display will change 0
0, through 9
9, A
A, B
B, C
C, D
D, E
E, F
Once the first digit is programmed, then use the UP arrow key to program
the second digit using the same method
Step 6 Press the mode button, the arrow will move down to the next symbol, enter
the digits required. Repeat until ALL the code above is entered
Step 7 Press the MODE button again, the OFF timer icon will display, DO NOT
enter the code again, press the MODE button 5 more times to return to the
ON timer icon, then check the code entered against the above. Once
checked use the MODE button to scroll through the OFF timer section
Step 8 Point the remote at the Indoor unit, and press the POWER button 5 times
to inject the code into the unit. Unit Ding's to show code has been accepted
Remove batteries, wait 10 secs and re-insert batteries normally
Step 9 Do not turn Indoor unit on using remote, instead go to the Outdoor unit
Press the K2 Button THREE times to get the unit operating in the test mode
Once the Indoor unit is making Condensate
Press the K3 Button to take the unit out of the Test mode
Restart unit using the remote, set to the required temperature and mode
Tech Bulletin - Option Codes FJM MH FNCA Neo Forte
#1
Jun-08
Alignment and Adjustments
■ Table of the option code
MODEL
OPTION CODE
MH026FNCA
027402-14221A-200001-300000
MH035FNCA
027402-16224d-200001-300000
MH052FNCA
026402-19228F-200001-300000
'ZVGTPCN5VCVKE2TGUUWTG
OO#S
5VCPFCTF
/*('%#
&
(
)
/*('%#
)
&(
/*('%#
1&
2'
1(
OO#SKUVJGDCUKEOQFGNQHVJKURTQFWEV
4GHGTVQVJGVCDNGCDQXGFGRGPFKPIQPVJGKPUVCNNCVKQPGPXKTQPOGPV
3-9
Samsung Electronics
4. Disassembly and Reassembly
■ Necessary Tools
Item
Remark
+SCREW DRIVER
MONKEY SPANNER
Samsung Electronics
4-1
4-1 Indoor Unit
Stop operation of the air conditioner and remove the power cord before repairing the unit.
4-1-1 MH026FNCA/MH035FNCA/MH052FNCA
No
Parts
1
Front Grille
Procedure
Remark
1) Stop the air conditioner operation and
shut off the main power.
2) Open the Front Grille by pulling right and
left sides of the hook.
3) Loosen 1 of the right screw and detach
the Terminal Cover.
4) Detach the thermistor from the Front
Grille.
5) Loosen 3 fixing screws of Front Grille.
4-2
Samsung Electronics
Disassembly and Reassembly
No
Parts
Procedure
Remark
6) Unlock 3 hooks to fix Panel Front and
Tray Drain.
7) Unlock 3 hooks to fix Panel Front and
Back-Body.
2
Control-In
(Main PCB)
1) Take all the connector of PCB upper
side out. (Inclusion Power Cord)
2) Detach the outdoor unit connection
wirefrom the Terminal Block.
3) Loosen 4 fixing screws of Ass’y Control-In.
3
Tray Drain
1) Pull Tray Drain out from the Back Body.
Samsung Electronics
4-3
Disassembly and Reassembly
No
Parts
Procedure
4
Heat Exchanger
1) Loosen 2 fixing earth screws of right side.
2) Detach the Connection Pipe.
3) Detach the Holder Pipe at the rear side.
Remark
4) Loosen the 4 fixing screws of right and
left side.
5) Lifting the Heat Exchanger up a little to
push the up side for separation from the
indoor unit.
5
4-4
Fan Motor
&
Cross Fan
1) Loosen the fixing screw.
2) Detach the Fan Motor from the Fan.
3) Detach the Fan From the left Holder
Bearing.
Samsung Electronics
Disassembly and Reassembly
4-1-2 MH026FECA/MH035FECA
No
Parts
1
Motor
&
Blower
Procedure
Remark
1) Disassemble the Cabinet Top Motor.
- Unscrew 8 screws
2) Disassemble 2 Cover Blower Uppers.
- After unscrewing 2 screws
- Disassemble the Cover Blower Upper
with pushing its hook.
3) Disassemble the Cover Control.
- Unscrew 2 screws
Samsung Electronics
4-5
Disassembly and Reassembly
No
Parts
Procedure
Remark
4) Disassemble Motor Wires connected to
the inside of PCB and connected to the
Capacitor.
5) Disassemble the Motor earth wire
connected to the Partition.
- Unscrew a screw
6) Disassemble the band Motor for fixing
the Motor.
- Unscrew 2 screws
7) After disassembling the Motor and Blower
for the set, disassemble the Blower by
use of 3mm wrench.
4-6
Samsung Electronics
Disassembly and Reassembly
No
Parts
2
Drain Pan
Procedure
Remark
1) Disassemble the Cabinet Top Evap.
- Unscrew 11 screws
2) Disassemble the Bracket Outlet Sub that
fixes the Drain Pan equipped on the front
of the set.
- Unscrew 6 screws
3) Disassemble the Drain Cushion from the
set.
Samsung Electronics
4-7
Disassembly and Reassembly
No
Parts
3
Evaporator
Procedure
Remark
✳ The Evaporator should be disassembled
after disassembling the Cover Control
1-3) and the Drain Pan 2-1), 2-2), 2-3).
1) Disassemble the Cover Pipe that fixes
the high/low pressure Pipe.
- Unscrew 2 screws
2) Disassemble the refrigerant temperature
sensor, Inlet air temperature sensor, and
EEV wire that connected to the inside of
PCB.
3) Disassemble the Support Evap. LF that
fixes the Evaporator.
- Unscrew 2 screws
4) Disassemble the Support Evap RH.
- Unscrew 2 screws
4-8
Samsung Electronics
Disassembly and Reassembly
No
Parts
Procedure
Remark
5) Disassemble the Evaporator form the set.
4
Control In
✳ The Control In should be disassembled
after disassembling the Cover Control
1-3).
1) Disassemble all Control Wires connected
to the inside of PCB.
2) In case of disassembling the PCB
separately, disassemble the PCB from
the case with pushing the hook after
unscrewing the screw.
- Unscrew 1 screw
3) In case of disassembling the Capacitor
separately, disassemble the Capacitor
from the Case.
4) In case of disassembling the Case
Control, disassemble the Case Control
from the set after unscrewing the screw
connected to the direction of Blower.
- Disassemble if after disassembling the
Cabinet Top Motor 1-1).
Samsung Electronics
4-9
Disassembly and Reassembly
No
Parts
Procedure
Remark
5) In case of disassembling the Trans
Power, unscrew the screw fixing on the
Case.
✳ Disassemble if after disassembling the
case PCB 4-4).
5
Bracket Outlet
1) Disassemble the Bracket Outlet
assembled on the Cabinet.
- Unscrew 10 screws
4-10
Samsung Electronics
Disassembly and Reassembly
4-1-3 MH052FECA
No
Parts
Procedure
1
Filter
1) Pull out the Filter as picture 1 or picture 2.
Remark
2) If it is necessary, after disassembling
8 indicating screws, detach the
Bracket Filter.
Samsung Electronics
4-11
Disassembly and Reassembly
No
Parts
Procedure
Remark
3) If the Cabinet-Top Motor is assembled on
the side of the set, the procedure of
disassembling the Filter is just as the
above.
2
Blower
&
Motor
1) After disassembling 13 indicating screws,
detach Ass’y Cabinet-Top Motor.
2) After disassembling 3 indicating screws,
detach Ass’y Case Blower Upper.
_ Press the pothook of the Case Blower
and detach Ass’y Case Blower Upper.
4-12
Samsung Electronics
Disassembly and Reassembly
No
Parts
Procedure
Remark
3) After disassembling 2 indicating screws,
detach the Cover Control.
4) Detach the Motor Wire Connected to
PCB and Capacitor.
5) After disassembling the indicating screws,
detach the wire connected to the
Partition.
6) After disassembling 2 indicating screws,
detach the Ass’y Band Motor.
Samsung Electronics
4-13
Disassembly and Reassembly
No
Parts
Procedure
Remark
7) After disassembling the Motor and
Blowers, detach the Blowers from the
axis of the Motor by 3mm inner hexagon
spanner.
3
Drain Pan
1) After disassembling 15 indicating screws,
detach Ass’y Cabinet-Top Evap.
2) After disassembling 6 indicating screws,
detach the Bracket Outlet.
3) Detach the Drain Pan.
4-14
Samsung Electronics
Disassembly and Reassembly
No
Parts
4
Evaporator
Procedure
Remark
✳ After finished the procedures above,
detach the Evaporator.
1) After disassembling 2 indicating screws,
detach Ass'y Cover Pipe.
2) Detach the Sensor from the
Control Box.(including 2 Sensors)
3) After disassembling 2 indicating screws,
detach Ass'y Support Evap LF.
4) After disassembling 2 indicating screws,
detach Ass'y Support Evap RH.
Samsung Electronics
4-15
Disassembly and Reassembly
No
Parts
Procedure
Remark
5) Detach the Evaporator from the set.
5
Control In
✳ Detach the parts of Control In after
disassembling the Cover Control.
1) Detach all the wires connected to the
PCB.
2) If only the disassembly of PCB required,
press the Pothook and detach the PCB
from the set.
3) If only the disassembly of Capacitor is
required, detach it from the set.
4) If only the disassembly of Case Control is
required, detach it from the set after
disassembling 2 indicating screws.
4-16
Samsung Electronics
Disassembly and Reassembly
No
Parts
Procedure
Remark
5) Detach the Transformer after
disassembling 2 indicating screws.
✳ Work is possible after disassembling
the Case PCB.
6
Ass'y Bracket
Outlet
Samsung Electronics
1) After disassembling 16 indicating screws,
detach Ass'y Bracket Outlet.
4-17
4-2 Outdoor Unit
4-2-1 MH050FXCA2A
No
Parts
1
Common Work
&
Control Out
Procedure
Remark
1) Loosen the fixing screw and detach the
Cover-Control. (Use +Screw Driver.)
2) Detach the Cable-Connector Wire from
the Terminal-Block.
3) Loosen the fixing screw of the Ass'y
Control Out. (Use +Screw Driver.)
4) Loosen 8 fixing screws and detach the
Cabinet Upper. (Use +Screw Driver.)
5) Loosen 2 fixing screws, 5 bolts and
detach the Front Cabinet.
(Use +Screw Driver.)
6) Loosen 2 fixing screws and pull up the
Control Box. (Use +Screw Driver.)
7) Loosen 9 fixing screws and detach the
Cabinet Side. (Use +Screw Driver.)
4-18
Samsung Electronics
Disassembly and Reassembly
No
Parts
Procedure
Remark
8) Detach the Terminal and detach the
Compressor Lead Wire.
2
Fan
&
Motor
1) Loosen the fixing nut and detach the Fan.
(Use +Screw Driver.)
2) Loosen 4 fixing bolts and detach the
Motor. (Use +Screw Driver.)
3) Loosen 4 fixing bolts and detach the
Bracket Motor. (Use +Screw Driver.)
Samsung Electronics
4-19
Disassembly and Reassembly
No
Parts
Procedure
3
Heat Exchanger
&
Compressor
1) Release the refrigerant at first.
2) Disassemble the Inlet and Outlet Pipe by
welding.
3) Loosen the fixing screws of the
Heat Exchanger. (Use +Screw Driver.)
4) Detach the Heat Exchanger.
Remark
5) Loosen 3 nuts of the Compressor.
(Use Monkey Spanner.)
6) Detach the Compressor.
4-20
Samsung Electronics
Disassembly and Reassembly
4-2-2 MH080FXCA4A
No
Parts
1
Common Work
&
Control Out
Procedure
Remark
1) Loosen 7 fixing screws and detach the
Cabinet side RH. (Use +Screw Driver.)
2) Detach the Cable-Connector Wire from
the Terminal-Block.
3) Loosen 2 fixing screws of the Ass'y
Control Out. (Use +Screw Driver.)
4) Loosen 6 fixing screws and detach the
Cabinet Upper. (Use +Screw Driver.)
5) Loosen 2 fixing screws, 7 bolts and
detach the Cabinet Front.
(Use +Screw Driver.)
Samsung Electronics
4-21
Disassembly and Reassembly
No
Parts
Procedure
Remark
6) Loosen 2 fixing screw and pull up the
Control Box. (Use +Screw Driver.)
7) Pull the felt and detach it.
8) Detach the Terminal Cover and detach
the comp lead wire.
4-22
Samsung Electronics
Disassembly and Reassembly
No
Parts
Procedure
2
Fan
&
Motor
1) Loosen the fixing nut and detach the Fan.
(Use Monkey Spanner.)
Remark
2) Loosen 4 fixing bolts and detach the
Motor. (Use +Screw Driver.)
3) Loosen 4 fixing bolts and detach the
Bracket Motor. (Use +Screw Driver.)
3
Heat Exchanger
&
Compressor
1) Release the refrigerant at first.
2) Disassemble the Inlet and Outlet Pipe by
welding.
3) Loosen the fixing screw of the
Heat Exchanger. (Use +Screw Driver.)
4) Detach the Heat Exchanger.
5) Loosen 3 nuts of the Compressor.
(Use Monkey Spanner.)
6) Detach the Compressor.
Samsung Electronics
4-23
"TLHK@A@3EASO=J@-=NPO)EOP
&J@KKN2JEP
*%#+ *%#+ 5COUWPI'NGEVTQPKEU
([SORGHG9LHZVDQG3DUWV/LVW
2CTVU.KUV
0Q
%QFG0Q
&GUETKRVKQP
&$,
#55; $#%-$1&;
&$*
5RGEKHKECVKQP
36;
5# 50#
/*(0%#
/*(0%#
#55;
5#
#55; $#%-$1&;
#55;
5#
&$&
$#%-$1&;
*+25
50#
&$#
%75*+10$#%-$1&;
'25
50#
&$#
#55; 5722146 '8#2 4*
*+25
5#
&$$
#55; 5722146 '8#2 4*
*+25
5#
&$#
/1614+0
8`*\%NCUU'
5#
&$#
#55; %4155(#0
1&Z.
5#
&$#
#55; $1.6 52'%+#.
#55;
50#
&$#
#55; 47$$'4$'#4+0)
#55;
50#
&$#
#55; $'#4+0)/1614
$'#4+0)
5#
&$$
#55; '8#2 616#.
#55;
5#
&$#
%18'4$'#4+0)
#$5
50#
&$)
#55; '8#2
#55;
50#
&$,
#55; 64#; &4#+0
#55;
5#
&$#
64#; &4#+0
#$5
50#
&$%
$.#&'*
*+25
5#
&$#
$.#&'8
22
5#
&$#
64#; 56#$+.+<'4
#$5
50#
&$#
%75*+10'2564#; 4*
'25
5#
&$#
47$$'4%#2 &4#+0
)7/'2/
50#
&$#
#55; /161456'22+0)
8`*\%NCUU'
5#
&$$
#55; &4#+0*15'
#55;
5#
&$$
#55; %10641. +0
#55;
5#
&$#
#55; 2#0'. (4106
#55;
5#
&$'
2#0'. (4106
*+25
5#
&$#
#55; )4+..'#+4+0.'6
#55;
5#
&$#
#55; %18'4&+52.#;
#55;
5#
&$#
)7#4&#+4(+.6'4
22
50#
&$$
#55; 2.#6'*#0)'4
#55u«;
50#
&$$
*1.&'42+2'
25
50#
&$$
#55;%18'46'4/+0#.#66<
5#
&$2
#55; 4'/1%10
5#
5COUWPI'NGEVTQPKEU
#55;
Exploded Views and Parts List
5-1-2 MH052FNCA
6
7
1
1-2
14
1-1
15
10
12
16
2
11
13
4
2-1
9
2-2
2-3
3-8
3-6
5-1
5
3-4
5-4
3
3-1
3-7
3-2
5-2
5-3
3-5
3-3
8
5-2
5-3
5-
Samsung Electronics
&YQMPEFE7JFXTBOE1BSUT-JTU
2CTVU.KUV
0Q
%QFG0Q
&GUETKRVKQP
&$$
#55ŏ; $#%-$1&;
&$$
5RGEKHKECVKQP
36;
5# 50#
#55ŏ;
5#
$#%-$1&;
*+25
50#
&$#
%75*+10$1&; $#%
'25
50#
&$&
#55ŏ; '8#2
#55ŏ;
5#
&$#
%18'4$'#4+0)
#$5
50#
&$#
#55ŏ; 67$''8#2 +0
#55ŏ;
5#
&$#
#55ŏ; 67$''8#2 176
#55ŏ;
5#
&$'
#55ŏ; 64#; &4#+0
#55ŏ;
5#
&$#
64#; &4#+0
#$5
5#
&$%
$.#&'*
*+25
5#
&$#
$.#&'8
22
5#
&$#
64#;56#$+.+<'4
#$5
50#
&$#
%75*+1064#; 4*
'25
50#
&$#
47$$'4%#2 &4#+0
)7/'2/
50#
&$#
#55ŏ; /161456'22+0)
)5219
5#
&$$
#55ŏ; &4#+0*15'
#55ŏ;
5#
&$$
#55ŏ; %10641. +0
#55ŏ;
5#
&$#
#55ŏ; 2#0'. (4106
#55ŏ;
5#
&$%
2#0'. (4106
*+25
5#
&$#
#55ŏ; )4+..'#+4+0.'6
#55ŏ;
5#
&$%
#55ŏ; %18'4&+52.#;
#55ŏ;
5#
&$$
)7#4&#+4(+.6'4
22
5#
&$#
#55ŏ;2.#6'*#0)'4
5)%%6
5#
&$$
*1.&'42+2'
*+25
5#
&$$
#55ŏ;%18'46'4/+0#.
*+25
5#
&$2
#55ŏ; 4'/1%10
*2
5#
&$#
#55ŏ; '8#25722146 4*
*+25
5#
&$#
/1614(#0
*<
5#
&$$
#55ŏ; %4155(#0
#55ŏ;
5#
&$#
#55ŏ; $1.652'%+#.
5#
&$#
#55ŏ; $'#4+0)47$$'4
5#
&$#
#55ŏ; $'#4+0)/1614
5#
&$#
$4#%-'6'8#2
5)%%/
5#
5COUWPI'NGEVTQPKEU
Exploded Views and Parts List
5-1-3 MH026FECA/MH035FECA
1
8
20
2
17
18
19
16
21
13
15
12
11
24
25
23
4
14
3
9
5
22
10
8
6
7
23-5
23-6
23-4
23-1
23-7
23-8
23-3
23-2
5-5
Samsung Electronics
Exploded Views and Parts List
■
Parts List
0Q
%QFG0Q
&GUETKRVKQP
&$#
#55; %#$+0'6 $#5'
&$#
5RGEKHKECVKQP
36;
5#50#
#55;
5#
#55; %#$+0'6 5+&'.(
#55;
5#
&$#
#55; %#$+0'6 5+&'4*
#55;
5#
&$#
#55; %18'42+2'
#55;
5#
&$#
#55; %18'4&4#+027/2
#$56
5#
&$#
%#$+0'6 612 /1614
5)%%/6
5#
&$'
#55; %#$+0'6 612 '8#2
#55;
5#
&$#
2.#6'*#0)'4
5)%%/6
5#
&$#
#55; $4#%-'6 176.'6
#55;
5#
&$#
$4#%-'6 176.'6 57$
5)%%/6
5#
&$#
#55; %75*+10$#5'
#55;
5#
&$#
#55; '8#2 70+6
#55;
5#
&$#
#55; 5722146 '8#2 .(
#55;
5#
&$#
#55; 5722146 '8#2 4*
#55;
5#
&$#
#55; 2#46+6+10
#55;
5#
&$#
$4#%-'6 /1614
5)%%/6
5#
&$#
#55; $#0&/1614
5+0;#
50#
&$$
/1614(#0
5+0;#5542+&
5#
&$#
$.19'4
#55;#$56145+10#. $75*
5#
&$#
#55; %#5'$.19'4722'4
#55;
5#
&$#
#55; %#5'$.19'4$1661/
#55;
5#
&$%
#55; &4#+02#0
#55;
5#
&$'
#55; %10641. +0
#55;
50#
&$%
#55; %#5'%10641.
#55;
5#
&$%
%#5'2%$
#$56
5#
&$#
%18'4%10641.
5)%%/6
5#
&$$
*1.&'49+4'
22 $.#%
50#
&$.
6'4/+0#. $.1%-2
2219'4
50#
&$/
6'4/+0#. $.1%-2
2%1//70+%#6+10
50#
&$$
64#05219'4
8*<
50#
%#2#%+614
8z(
5#
&$#
#55; 6*'4/+5614
#55;
5#
&$#
6*'4/+5614'8#2
#55;
50#
Samsung Electronics
5-6
Exploded Views and Parts List
5-1-4 MH052FECA
28
27
8
2
26
22
21
1
25
20
23
18
24
19
17
16
3
33
4
11
31
5
8
12
13
14
32
30
15
10
9
6
29
30-6
30-1
30-2
30-3
7
34
30-4
30-5
35
5-7
Samsung Electronics
Exploded Views and Parts List
■
Parts List
0Q
%QFG0Q
36;
5#50#
&$#
#55; %#$+$#5'
#55;5)%%/6
5#
&$$
%#$+5+&'.(
5)%%/6
5#
&$#
#55; %#$+5+&'4*
#55;5)%%/6
5#
&$#
#55; %18'42+2'
#55;5)%%/6
5#
&$#
#55; %18'4&4#+027/2
#55;
5#
&$#
%#$+612 /1614
5)%%/6
5#
&$%
#55; %#$+612 '8#2
#55;5)%%/6
5#
&$#
2.#6'4*#0)'4
5)%%/6
5#
&$#
#55; $4#%-'6 176.'6
#55;5)%%/6
5#
&$#
$4#%-'6 176.'6 57$
5)%%/6
5#
&$#
#55; %75*+10$#5'#
#55;'25
5#
&$#
#55; %75*+10$#5'$
#55;'25
5#
&$$
#55; '8#2 70+6
#55;
5#
&$#
#55; 5722146 '8#2 .(
#55;5)%%/6
5#
&$#
#55; 5722146 '8#2 4*
#55;5)%%/6
5#
&$#
#55; 2#46+6+10
#55;5)%%/6
5#
&$#
$4#%-'6 /1614
5)%%/6
5#
&$#
#55; $#0&/1614
5+0;##55;
5#
&$&
/1614
5+0;#*<;5-2)
5#
&$#
/16145*#(6
5+0;#
5#
&$#
/1.&$'#4+0)
#55;
5#
&$#
%#2 $'#4+0)
5)%%/6
5#
&$#
47$$'45*#(6
%48
5#
&$#
%172.'4
#55;
5#
&$#
$.19'4#
#55;#$5
5#
&$#
$.19'4$
#55;#$5
5#
&$#
#55; %#5'$.19'4722'4
#55; #$5
5#
&$#
#55; %#5'$.19'4$1661/
#55; #$5
5#
&$#
#55; &4#+0
#55;
5#
&$&
#55 ; %10641. +0
#55;
5#
&$%
#55; %#5'%10641.
#55;
5#
&$%
%#5'2%$
#$586
5#
%#2#%+614
87
5#
&$.
6'4/+0#. $.1%-2
2219'4
5#
&$/
6'4/+0#. $.1%-2
2%1//70+%#6+10
5#
&$)
64#05219'4
*<
5#
&$#
#55; 6*'4/+5614
#55;
5#
&$#
6*'4/+5614'8#2
OO
5#
&$#
%.+2 $475*
0;.10$.#%
5#
&$#
#55; %18'4%10641.
#55;
5#
&$&
#55; 2%$
#55;
5#
Samsung Electronics
&GUETKRVKQP
5RGEKHKECVKQP
5-8
5-2 Outdoor Unit
5-2-1 MH050FXCA2A
8
7
11
17
6
5
4
12
3
2
1
15
9
19
10
18
1-1
5-9
Samsung Electronics
Exploded Views and Parts List
2CTVU.KUV
%QFG0Q
&$)
#55; %#$+0'6 (4106
#55;
5#
&$%
)7#4&(#0
225%4
5#
&$%
#55; $#5'176
#55;
50#
&$#
(#02412'..'4
22
5#
&$#
/1614(#0
5)%%/
5#
&$#
$4#%-'6 /1614
#55;
5#
&$#
#55; 2#46+6+10
#55;
50#
&$
#55; %10&'05'4
#55;
5#
&$$
5%4''0%10&$#4
*594
5%6
5#
&$%
#55; %#$+0'6 5+&'
#55;
5#
&$#
#55; %18'4%10641.
#55;
5#
&$#
#55; %#$+0'6 72
#55;
5#
&$#
#55; %#$+0'6 .(
5'%%2
5#
)6(7#'9
416#4; %1/24'5514
$.&%2'4/#0'06 /#)0'6+% /1614
5#
&$#
)41//'6+51.#614
04
50#
&$#
#55; 8#.8'9#;
#55;
5#
&$$
#55; 8#.8'
#55;
5#
&$&
#55; %10641. 176
#55;
5#
&$&
#55; 2%$/#+0
#55;
5#
&$%
%#5'%10641.%18'4
#55;
5#
&$$
*'#6 5+0
#$5
50#
&$$
#55; 2%$'/+
#55;
50#
&$%
%#5'%10641.$#5'
#.
5#
&$#
2.#6'%10641. 176 722'4
#$5
50#
&$$
2.#6'%10641. 176 /#+0
5)%%/
50#
&$&
6'4/+0#. $.1%
$.
5%
&$(
6'4/+0#. $.1%
$.
5%
&$#
#55;6'4/+0#. $.1%
#55;
5%
&$#
#55; 2%$&+52.#;
#55;
5#
&$#
4'#%614
/*vv8
5#
&$$
6*'4/+5614%10&'05'4
#6%6$
5#
&$#
6*'4/+5614
#6%6$
5#
Samsung Electronics
&GUETKRVKQP
5RGEKHKECVKQP
36;
0Q
/*(:%##
5# 50#
5-10
Exploded Views and Parts List
5-2-2 MH080FXCA4A
11
8
7
17
12
5
6
10
20
4
13
15
2
13-1
9
3
1
14
19
1-1
5-11
18
Samsung Electronics
Exploded Views and Parts List
■
Parts List
&GUETKRVKQP
5RGEKHKECVKQP
36;
0Q
%QFG0Q
&$#
#55ŏ; %#$+(4106616#.
#55ŏ;
50#
&$%
)7#4&(#02
225%4
5#
&$%
#55ŏ; $#5'176616#.
#55ŏ;
50#
&$#
(#0241('..'4
#5)(
50#
&$#
/1614(#0
#9&%8
5#
&$&
$#5'/1614
5)%%/
50#
&$$
#55ŏ; 2#46+6+10
#55ŏ;
50#
&$#
#55ŏ; %10&
#55ŏ;
50#
&$%
$#456''.
*594
50#
/*(:'#$
5# 50#
&$#
#55ŏ; %#$+0'65+&'4*
#55ŏ;
50#
&$#
#55ŏ; %#$+$#%-4*
#$5
50#
&$#
#55ŏ; %#$+0'6 72
#55ŏ;
50#
&$#
#55ŏ; %#$+0'65+&'.(2#+06
#55ŏ;
50#
)6(7#'9
%1/24'5514
$.&%+08'46'4
5#
&$#
)41//'6 +51.#614
04
50#
&$#
#55ŏ; 9#; 8#.8'
#55ŏ;
50#
&$$
#55ŏ; 8#.8'
#55ŏ;
50#
&$$
#55ŏ; %10641. 176
#55ŏ;
5#
&$$
#55ŏ; 2%$/#+0
#55ŏ;
5#
&$%
%#5'%10641. %18'4
#$5
5#
&$#
*'#6 5+0
50#
&$&
#55ŏ; 2%$57$'/+
#55ŏ;
50#
&$%
%#5'%10641. $#5'
#$5
50#
&$#
2.#6'%10641. 176
5)%%/
5%
&$&
6'4/+0#. $.1%
$.
5%
&$(
6'4/+0#. $.1%
$.
5%
&$#
#55ŏ;6'4/+0#. $.1%
#55ŏ;
5%
&$#
#55ŏ; 2%$57$&+52.#;
#55ŏ;
5#
&$#
4'#%614
#*\
5#
&$$
6*'4/+5614%10&
#6%6$
5%
&$%
6*'4/+56149+4'176&+5%*#4)'
#6%6$
5%
&$#$66<+$1'/(
#66<
5#
Samsung Electronics
5-12
6. Wiring Diagram
6-1 Indoor Unit
■ MH✳✳✳FNCA
This Document can not be used without Samsung's authorization.
6-1
Samsung Electronics
&J@KKN2JEPĠ?KJP
*%
#" A
This Document can not be used without Samsung's authorization.
Samsung Electronics
6-2
6-2 Outdoor Unit
■ MH050FXCA2A
This Document can not be used without Samsung's authorization.
6-3
Samsung Electronics
Wiring Diagram
■ MH080FXCA4A
This Document can not be used without Samsung's authorization.
Samsung Electronics
6-4
7. Schematic Diagram
7-1 Indoor Unit
■ MH✳✳✳FNCA
This Document can not be used without Samsung's authorization.
7-1
Samsung Electronics
Schematic Diagram
■ MH✳✳✳FECA
This Document can not be used without Samsung's authorization.
Samsung Electronics
7-2
8. PCB Diagram
8-1 MAIN PCB(Indoor Unit)
■ MH✳✳✳FNCA
The red number connecter is not used.
8-1
!
Power
&
Temperature Sensor
@
Motor RPM Feedback
*
Auto Grill
#
Remocon Module
(
HVPS(High voltage Generator)
$
Humidity Sensor
)
BLADE-H Step Motor
%
Anions
1
Display
^
MPI
2
Indoor Fan Motor
Samsung Electronics
02- Ġ&J@KKN2JEP
Ġ?KJP
■ MH✳✳✳FNCA
The red number connecter is not used.
!
@
Samsung Electronics
!
External Signal
@
MAIN PCB Connection
8-2
PCB Diagram
■ MH✳✳✳FECA
!
@ 4#
$( %
^
&
*
)
5
1
2
6
3
7
8
9
0
!
‘
+
=
Float Switch
3
COM 2
Room Temperature
4
Load Control Signal
EVA in Temperature
5
Heater
#
EVA out Temperature
6
Address Switch
$
Heater Temperature
7
Option Switch
%
Wired Remote Controller Power(12V)
8
Fan (Tap Control)
^
Control Signal
9
Ventilator
&
EEV
0
Drain Pump
*
Display
“
Hot Coil
(
Operating Check Signal
‘
Fan (SSR)
)
HALL IC
+
Trans In
1
Download
=
Main Power
2
COM 1
Q
Trans out
@
8-3
“
Q
Samsung Electronics
*&+ - Ġ,QP@KKN2JEP
*%#5 *%#5 6JGTGFPWODGTEQPPGEVGTKUPQVWUGF
2QYGT0
%10&1.2 6GORGTCVWTG5GPUQT
2QYGT.
&+5176 6GORGTCVWTG5GPUQT
$.&%(#0
''8%QPPGEVQT
#%(#0
%QOR%QPPGEVQT9KTG
%QOOWPKECVKQP
4GCEVQT%QPPGEVQT9KTG
5COUWPI'NGEVTQPKEU
9. Troubleshooting
9-1 Items to be checked first
1. The input voltage should be rating voltage ±10% range.
The air conditioner may not operate properly if the voltage is out of this range.
2. Is the link cable linking the indoor unit and the outdoor unit linked properly?
The indoor unit and the outdoor unit shall be linked by 4 wires.
2 wires are for power and other 2 wires are for communication, total 4 wires on each indoor unit. Check the terminals if the
indoor unit and outdoor unit are properly linked by the same number of cables and if connecting position on the terminal is
correct. Otherwise the air conditioner may not operate properly.
3. When a problem occurs due to the contents illustrated in the table below it is a symptom not related to the malfunction of the
air conditioner.
No
9-1
Operation of air conditioner
Explanation
1
In a COOL operation mode, the compressor does not
operate at a room temperature higher than the setting
temperature that the INDOOR FAN should operate.
In a HEAT operation mode, the compressor does not
operate at a room temperature lower than the setting
temperature that indoor fan should operate.
In happens after a delay of 3 minutes when the compressor
is reoperated. The same phenomenon occurs when a power
is on.
As a phenomenon that the compressor is reoperated after a
delay of 3 minutes, the indoor fan is adjusted automatically with
reference to a temperature of the air blew
2
Fan speed setting is not allowed in AUTO(
DRY(
) mode.
The speed of the indoor fan is set to LL in DRY mode.
Fan speed is 5 steps and is selected automatically in AUTO
mode.
3
Compressor stops operation intermittently in
DRY(
) mode.
Compressor operation is controlled automatically in DRY mode
depending on the room temperature and humidity.
4
Compressor of the outdoor unit is operating although
it is turned off in a HEAT mode.
When the unit is turned off while de-ice is activated, the
compressor continues operation for up to 12 minutes (maxi­
mum) until the deice is completed.
5
Timer LED(
) only of the indoor unit lights up and
the air conditioner does not operate.
Timer is being activated and the unit is in ready mode.
The unit operates normally if the timer operation is cancelled.
6
The compressor and indoor fan stop intermittently in
HEAT mode.
The compressor and indoor fan stop intermittently if room
temperature exceeds a setting temperature in order to protect
the compressor from overheated air in a HEAT mode.
7
Indoor fan and outdoor fan stop operation
intermittently in a HEAT mode.
The compressor operates in a reverse cycle to remove
exterior ice in a HEAT mode, and indoor fan and outdoor fan
do not operate intermittently for within 20% of the total heater
operation.
8
The compressor stops intermittently in a
COOL mode or DRY mode, and fan speed of the
indoor unit decreases.
The compressor stops intermittently or the fan speed of the
indoor unit decreases to prevent inside/outside air frozen
depending on the inside/outside air temperature.
) or
Samsung Electronics
9-2 Checking and Testing operations
To complete the installation, perform the following checks and tests to ensure that the air conditioner is operating
correctly.
1.
1.
1.
1.
1.
1.
1.
1.
1.
1.
1.
1.
1.
Review all the following elements in the installation:
• Installation site strength
• Piping connection tightness not to leak any gas
• Connection wiring
• Heat-resistant insulation of the piping
• Drainage
• Earthing wire connection
• Setting number of the indoor unit installed (Outdoor unit SW)
• Setting SW02 for addressing mode (AUTO or MANUAL)
• Address number on each indoor unit (Manual addressing mode)
• Correct operation for pipe checking connection (follow the step below)
• If the auto addressing, refer to next page.
• If the manual addressing, please do cool mode try-run or heat mode try-run.(refer to below)
2. ■ Settings of PCB Display of the Outdoor unit
2. ■ -K1 :pipe checking operation button -K2 :Function button
-K4 :View mode change button
2. ■ -K3 :Reset button
Key
K1
K2
Pipe Checking
Operation
(Display:
)
Heat Mode Try
run
(Display:
)
-
Refrigerant
Charging
(Display:
)
K3
K4
Push
1
2
SW02
K1
Switch
DIS01
Reset
Cool Mode Try
run
(Display:
)
-
3
4
View mode
change
DIS02
Indoor unit
address
K2
Pump down
(Display:
)
-
SW01
K3
K4
View data display
Outdoor PCB Display
K4 View mode Display changes
Push
Display Explanation
Push
Display Explanation
0
Present Compressor Frequency
8
Discharge temperature
1
Target Compressor Frequency
9
OLP temperature
2
Order Compressor Frequency
10
Condenser temperature
3
EEV0 current step
11
Outdoor temperature
4
EEV1 current step
12
First current
5
EEV2 current step
13
Target Discharge temperature
6
EEV3 current step
14
Total capacity of the indoor units
7
Fan RPM (H:high,L:low,Blank:of
(H:high,L:low,Blank:offf )
15
Safety control
• The EEV 2 and EEV 3 of MH050FXCA2A model is always displayed as blank.
Samsung Electronics
9-2
Troubleshooting
2.2. Apply the power to the outdoor unit.
Outdoor unit will try to communicate the number of indoor units specified by SW01 on outdoor display PCB.
Does LED show "Normal display"?
"Normal display" means, right 2 digit of
LED on Display PCB displays '00' and
left 2 digit of LED displays indoor unit
address number.
Yes
OK : This number is displayed
only while communicating,
so each number is displayed
for a short time in order.
No
Is error code started with ''
displayed on the LED?
No
''
Nothing is displayed on the LED.
Yes
Check the indoor unit, outdoor unit or wiring
according the error code table.
Check the power source,
power cable & FUSE on
the outdoor unit.
2. ■ Pipe Checking Operation (Auto Addressing Mode)
Automated checking of pipe connection (Auto addressing option)
• Turn on the outdoor unit and wait for one minute.
• During these 60 seconds,the left display DIS01 will show sequentially
• 00-01-02-03-...15-00.
• E199 is showed on the display PCB of outdoor unit.
• -It means you didn’t do “Pipe check operation “
• Push [K1 ] button on the display PCB of outdoor unit once, then begins to start “Pipe check operation ”
with displaying as below.2.
Button [K1] times
DIS 01
DIS 02
Display
[DIS 01 ] is flickering on the setting time.
Outdoor Temperature
Time duration
9-3
32˚F or more
less tha 32˚F
(Cool mode)
(Heat mode)
5min~10min
20min~50min
Samsung Electronics
Troubleshooting
✳ Expected time of 4 indoor units installation.
✳ • [DIS02 ] shows the indoor unit under searching
✳ • It could take more time depending on the indoor and outdoor temperature.
✳ • After completeing pipe check operation,it shows “ “ on the display PCB.
✳ • The left display DIS01 will show sequentially the following message:
✳ • 00 -Estabilished communication with indoor unit “A ”;
✳ • 01 -Estabilished communication with indoor unit “B ”;
✳ • 02 -Estabilished communication with indoor unit “C ”;
✳ • 03 -Estabilished communication with indoor unit “D ”;
✳ • 00 -Estabilished communication with indoor unit “A ”...
✳ • Function of Step 3
Mode
Function
Auto Addressing
Checking the connection & addressing
Manaul Addressing
Checking the connection only
- If the auto addressing does not work according to the indoor unit capacity, model or installation condition,apply the manual
addressing.
✳ When SW01 set "0"on Auto address mode,it means you install the maximum number of indoor unit.
1) Installation ID Unit Number=MAX Installation ID Unit Number of OD Unit.
➟ Don't need set SW01.
2) Installation ID Unit Number<MAX Installation ID Unit Number of OD Unit.
➟ Pls set SW01 as the number of which you install the indoor unit.
✳ On Manual address mode,you must set SW01 as the number of which you install the indoor unit.
- This mode is for finding the combination between indoor unit and each valve on the outdoor unit. Because refrigerant flow is
controlled with EEV in the outdoor, controller should know which EEV will control which indoor unit.
- Once "PIPE CHECK MODE" is done normally, each indoor unit will remember the given address number by the outdoor unit
and no need to do this checking. But in case of listed below, PIPE CHECK MODE should be done again.
2. - • Re-install the system (ie.house moving)
2. - • Remove indoor unit, Add new indoor unit, Change indoor PCB for repair.
2. - • Mode change from "manual addressing" to "auto addressing"
- On this mode the controller will ignore the manual address number set on the rotary switch on the indoor PCB.
- To confirm the indoor address number assigned by this mode, use "TEST MODE" and the address number will be displayed on
the LED display on the indoor unit.
Samsung Electronics
9-4
Troubleshooting
■ In case of MANUAL ADDRESSING mode.
Switch Setting and Testing Operation
To complete the installation, perform the following checks and tests to ensure that the air conditioner is operating correctly.
Step 1
Review all the following elements in the installation:
• Installation site strength
• Piping connection tightness to detect any gas leakage
• Connection wiring
• Heat-resistant insulation of the piping
• Drainage
• Earthing wire connection
Step 2
IMPORTANT!
Before selecting switch turn off the system power supply
- Select rotary switch “SW01 ” of outdoor unit display PCB,according to number
of indoor unit connected:
Switch
ex) connecting with
2 indoor units.
Indoor unit
address
ex) connecting with
2 indoor units.
Views data display
Advise control we are going to proceeed
with manual addressing as follow:
SW02
Manual
addressing
-Move dip switch n°1 of “SW02
-outdoor unit display PCB ” down;
Switch
Indoor unit
address
Move down the switch nß1
Views data display
Step 3
Step 4
Follow of indication reported into table below for indoor unit addressing
Turn on the system power supply and waiting for 60 seconds after estabilishing communication between outdoor and
indoor units.
During this phase,the left display of outdoor unit display PCB “DIS01 ” will count fom 00--01--02 to 15.
Estabilished communication the left display will count sequentially:
00--communication with indoor unit A;
01--communication with indoor unit B;
02--communication with indoor unit C;
03--communication with indoor unit D;
✳ In case of Manual address mode,you can do pipe check operation for check whether you connect the pipes correctly or not.
But you need set indoor address switch yourselves.
9-5
Samsung Electronics
Troubleshooting
Switch Setting and Testing Operation (cont.)
TYPE
PICTURE
MODEL
RAC
MH026FNCA
MH035FNCA
MH052FNCA
SLIM DUCT
MH026FECA
MH035FECA
MH052FECA
Samsung Electronics
TO SET ADDRESSING MANUALLY BY ROTARY
SWITCH “SW02 ”
9-6
Troubleshooting
Switch Setting and Testing Operation (cont.)
ROTARY SWITCH “SW02 ” POSITION ACCORDING TO REFRIGERANT CIRCUIT
CONNECTED (0=A;1=B;2=C;3=D )
INSTALLATION TEST MODE (with all indoor units functioning)
Please do cool mode try-run or heat mode try run.
Cool mode try-run :Push the [K2 ] button three times.
Heat mode try-run :Push the [K2 ] button once.
After 12 minutes of stationary condition check each indoor unit air treatment:
Cooling mode (indoor unit check) → Inlet air temp.-Outlet air temp : From 10°K to 12°K (indicative delta T)
Heating mode (indoor unit check) → Outlet air temp.-Inlet air temp : From 11°K to 14°K (indicative delta T)
In heating mode,the indoor fan motor can remain off to avoid cold air blown into conditioned space.
9-7
Samsung Electronics
Troubleshooting
● If Error code is displayed on indoor or outdoor LED, check as follows;
- Manaul address setting
Contents
Q1
Turn on the system. But outdoor units PCB displayed E201 or E101 Error code.
Check point
Remarks
Step 1
Check to Number of indoor unit’s SW01.
Outdoor PCB
SW01
Step 2
Check to power cable to indoor units.
Check to communication cable indoor units.
Wire connect
Contents
Q2
Turn on the system. But outdoor units PCB displayed E203 Error code.
Check point
Remarks
Step 1
Outdoor communication error between the outdoor main
PCB and sub PCB.
.Outdoor PCB
SW01
Step 2
Check to sub PCB wire and replace it.
Wirre connect
Contents
Q2
Turn on the system. But indoor unit displayed E121/122/123/154 Error
Explanation
Error code
E121
Indoor unit room temperature sensor error (open/short)
E122
Indoor unit heat exchanger in temperature sensor error (open/short)
E123
Indoor unit heat exchanger out temperature sensor error (open/short)
E154
Indoor unite fan error
Guicance
Please, all units turn off and check to indoor unit’s PCB and wire connection. E121/122/123 error detected, replace
related sensor.
Contents
Q4
Turn on the system. But indoor unit displayed E162/163 Error code.
Explanation
Error code
E162
Indoor unit EEPROM Error.
E163
Indoor unit EEPROM Option Error.
Please, all units turn off and follow guidance.
Guidance
E163 : Please reset indoor Option code.
E163 : If you don’t know about that, replace indoor unit PCB which is related.
E162 : Please replace indoor unit PCB which is related.
Contents
Q5
Turn on the system. But outdoor unit displayed E221/237/251/320 Error
Explanation
Error code
E221
Outside temperature sensor error (open/short)
E237
Indoor unit heat exchanger in temperature sensor error (open/short)
E251
Condenser temperature sensor error (open/short)
E251
Compressor Discharge temperature sensor error (open/short)
E230
Compressor OLP sensor error (open/short)
Guidance
Please, The System turn off and replace sensor which is related.
Samsung Electronics
9-8
Troubleshooting
Contents
Q1
Indoor units address SW setting correct, but outdoor unit’s PCB displayed E201 Error Code.
Check point
Analysis
Remarks
Indoor unit’s sub PCB address SW or sub PCB is
connected by mistake.
Step 1
Check to indoor unit’s sub PCB wire connecting
condition.(misconnecting or Sub PCB is out of order)
Step 2
Address setting mode change to auto address setting.
Step 3
Following auto address setting steps.
Guidance
Indoor
Sub PCB
Manual Address setting is Option in FJM PLUS A.
But we solved problem like this situation, with auto address setting.
- Auto address setting
Contents
Q1
When the pipe checking operation is finished, outdoor sub PCB display E190 Error code.
Check point
Remarks
Analysis
Outdoor unit fails to search indoor units or to check
indoor address.
The pipe checking operation
Step 1
Whether The gas and liquid pipes are crossed with
each other, check to connecting.
Pipe connecting
Step 2
Check to outdoor unit’s EEV coil being connected in
proper location.
EEV Coil
Step 3
Check to indoor unit’s sensor being connected in
proper location.
Guidance
Indoor sensor
During the pipe checking operation , system check temperature change of indoor Heat exchanger.In case, indoor
sensor defect, EEV coil connector detach, malfunction of EEV, Leakage of Refrigerant, and etc can make this case.
- Address setting another case
Contents
Q1
When the pipe checking operation is finished, outdoor sub PCB display E190 Error code.
Check point
Analysis
Outdoor unit fails to search indoor units or to check
indoor address.
The pipe checking operation
Step 1
Whether The gas and liquid pipes are crossed with
each other, check to connecting.
Pipe connecting
Step 2
Check to outdoor unit’s EEV coil being connected in
proper location.
EEV Coil
Step 3
Check to indoor unit’s sensor being connected in
proper location.
Guidance
9-9
Remarks
Indoor sensor
During the pipe checking operation , system check temperature change of indoor Heat exchanger.In case, indoor
sensor defect, EEV coil connector detach, malfunction of EEV, Leakage of Refrigerant, and etc can make this case.
Samsung Electronics
Troubleshooting
- Operation case
Contents
Q1
While using cooling or heating, indoor units display E161 Error code
Check point
Remarks
Analysis
This problem is caused by user’s fault. User’s simultaneously operate 2 more indoor units in the same time cooling
and heating mode.
Guidance
FJM is operate by just cooling or heating mode only. (Only, HR system can operate cooling and heating mode
simultaneously in the same time)
Outdoor unit will be operate by first received signal, another operation signal is not applied system.
Contents
Q2
While using cooling or heating, System turn off and display E416 Error code.
Check point
Analysis
Remarks
E416 is outdoor unit high discharge temperature safety control Error code.
After System restart automatically until 3 times, system stop and display this error.
System can be operated by remote controller signal and K3(reset) key input.
Step 1
Check outdoor units installation environment.
(air flow blocking, the halation of another outdoor air flow)
Step 2
Check refrigerant leakage.
Step 3
Check outdoor EEV operation.
Contents
Q3
While using cooling or heating, System Turn off and display E458 Error code
Check point
Analysis
Remarks
E458 Error is related with outdoor unit fan Error.
Especially, If system have a some problem in fan, in heating mode , it will be happened.
And In auto address setting, without pipe checking operation must be happened it.
Step 1
Check to outdoor fan operation.
Step 2
If outdoor fan operation is clear, start to pipe checking operation.
Guidance
When Auto address setting is finished without pipe checking operation, in heating mode, outdoor unit refrigerant
distribution control is malfunction.
It make our system to confuse it’s condition.
But, basically this error code is concerned about fan error.
Contents
Q4
While using cooling mode, outdoor unit turn off and display E401 Error code.
Check point
Analysis
Remarks
This is caused by protection mode behavior.
This is indoor Evaporator Freezing protection mode.
Step 1
Please, check indoor unit, whether inlet or outlet grill is closed.
Step 2
Please, check indoor unit, whether indoor fan is working.
Samsung Electronics
9-10
Troubleshooting
Contents
Q5
When system start in cooling mode, System don’t operate and display E441 Error code
Check point
Analysis
Remarks
FJM PLUS is able to operate by -10˚C
But we admit that minimum Cooling temperature is by -5˚C
Please, Remember cooling operation range.
Contents
Q6
While using heating, outdoor unit turn off and display E404 Error code.
Check point
Analysis
Remarks
Heating overload safety mode make this situation.
After System restart automatically until 3 times, System display this error code and stop.
System can operate by remote controller input signal or K3(reset) key input.
Step 1
Check indoor units air flow.
Step 2
Check outdoor unit air flow and installation (outdoor air flow blocking & over charging)
Contents
Q7
When system start in Heating mode, System don’t operate and display E440 Error code.
Check point
Analysis
Remarks
FJM PLUS is able to operate up to 30˚C
But we admit that Maximum Heating temperature is up to 24˚C
Please, Remember Heating operation range.
- Try-run Check Error
Contents
Q8
While the system is working try-run mode, system turn off and display E128 / 129 / 246 / 261 / 419 / 422 / 554
Error code.
Check point
Analysis
9-11
Remarks
These Error codes only apply with Try-run mode, in case of system have some defect as result of try-run operation.
✳ Refer to self-detection algorithm (Check Error Code meaning and check it out)
Samsung Electronics
9-3 Fault Diagnosis by Symptom
9-3-1 Basic Check Flow
Preparation : multimeter (AC voltage, DC voltage, Resistance)
Check point
START
Short check
for safety
Detach cable cover of the terminal blocks
(HANDLE CABI RH) on outdoor unit.
Check resistance value between
L and N of Main power terminal block.
No Good
• Outdoor unit controller (see 12-3-2)
• Indoor unit controller (see 12-3-3)
No Good
• Power cable (see 12-3-4, 12-2)
• Breaker
OK : over 180KΩ
Apply the power
Power Source
check
Check AC voltage between L and N of
MAIN power terminal block.
OK : 207-253V(50Hz)
Check AC voltage between L and N of
power terminal block for indoor unit.
Outdoor unit
No Good
Terminal block wiring
OK : 207-253V
Is there any display of LED?
No
Yes
No Good
Start operation
Any Error code on LED display?
Wait for 5 minutes to check error
code because some error judgement
needs long time.
• Main PCB,
• Display PCB,
• wiring between PCBs.
Starting by remocon or ON/OFF switch on the indoor
unit or K2 button on the Outdoor PCB display.
Yes
Error code starts in ''
''
Consult error code table
No
Indoor unit
Receiving of remote control signal ?
(Check by buzzer sound)
No
• Remote control
• Remote control battery
• Infrared signal receiving path
(front panel duct, infrared receiving module, wiring)
Yes
Check operation ON/OFF by the button
at lower right of the display module
(By buzzer sound and LED display)
Ok
Any Error code on LED display?
Wait for 5 minutes to check error code
because some error judgement
needs long time
No
• Indoor unit,
• Wiring cable to outdoor unit
Yes
Error code starts in '' ''.
Error code consists of 4 digits and displays first 2
digit and last 2 digit alternatively.
Consult error code table
Check Major parts(See 12-5)
Consult error code(Next Page)
Samsung Electronics
9-12
Troubleshooting
Basic Check Flow(cont.)
Preparation : multimeter (AC voltage, DC voltage, Resistance)
Check point
Consult Error Code
,
,
,
,
,
• Cable wiring between indoor and outdoor
• Communication wire socket check on
outdoor unit controller PCB
Is the error code related to
communication ?
No
,
Is the error code related to
cycle protection ?
• Cycle check
• Pipe matching
No
Are some of the indoor units’
operation mode (cooling/heating)
different from others ?
,
,
Each indoor unit operation mode
No
Error related to outdoor controller except
temperature sensor and communication
between indoor unit and outdoor unit ?
--
,
Consult LED pattern on wiring diagram on
outdoor controller
No
See Error Code Table and Check
“Main checking point”
9-13
Samsung Electronics
Troubleshooting
9-3-2 Checking Outdoor Controller
1. Making sure the wire connections.
2. Checking AC line
1) Checking FUSE
2) Checking resistance between 'L wire (SKY BLU)' and 'BD01
Neutral' normal value : 190 - 210Ω
If value is ∞ then check R001.
3) Checking resistance between 'N wire (BRN)' and 'BD01 Live side'
normal value : 0 - 0.1Ω
Live
Neutral
3. Checking ON/OFF pattern of LED1(Red), LED2(Green), LED3(Yellow) Apply the power then ALL LEDs are on for about 1 second. then changed to as follow.
■ LED1 (Red) : ALWAYS ON
■ LED2 (Green) : Blinking 4 times a second
(This means communication between 2 micoms IC01 and IC50 is normal)
■ LED3 (Yellow) : OFF
● In case of another pattern inverter micom detects some hardware trouble or abnormal condition.
Yellow
Green
Red
Description
Note
Status indication
OFF
OFF
OFF
Power OFF / No power (SMPS error)
ON
ON
ON
Power on reset ( 1~2 seconds )
OFF
Blink
ON
Normal operation
If always in this pattern IC01(inverter micom)
has some trouble.
Hardware trouble
OFF
OFF
ON
Communication Error between
Main micom and inverter micom
Blink
Blink
ON
Current sensor error
ON
Blink
Blink
DC-LINK sensor error
ON
ON
Blink
AC-Line zero crossing error
DC LINK capacitor discharged.(Max 20sec.)
ON
OFF
Blink
Option error (EEPROM error)
After power off this error will display until
Abnormal condition
OFF
OFF
Blink
Comp. peak current (Over Current)
OFF
Blink
OFF
Comp. starting error
ON
OFF
ON
Comp. rotation error
OFF
ON
Blink
DC-Link voltage error
Blink
ON
OFF
Comp. V Limit Error
Samsung Electronics
9-14
Troubleshooting
4. Checking Display PCB LED if Error code is displayed.
See error code table if displayed.
5. Checking DC voltage on each point
Item
Measuring point
Normal value
Q803 E(-)~D101 Cathode (+)
about 1.4 times as much as Power AC Voltage
ex) AC220V → 305~310Vdc
C803 voltage
14.5V~15.5V
Main control 12V
CN59 pin 1~pin 3
12V~15V
Main control 5V
CN59 pin 1~pin 2
4.75V~5.25V
DC LINK
inverter 15V
6. Checking PFC
6. When Input current is over 2.8A PFC circuit will work to control the harmonics of AC current.
Checking is measuring DC-LINK voltage.
PFC ON (Compressor is working) : DC LINK voltage is over 300Vdc (AC line >220V )
After starting compressor DC Link voltage is going down because of compressor load.
But in case of 2.8A above , DC link voltage will go up over 300V. This voltage is in proportion to AC input voltage.
Current can be monitored with "VIEW MODE".
Press K4 key on the outdoor display PCB for several times to change the display to sensor temperature value.
Left 1 digit of the LED is data index and Right 3 digits are the value
Index
C
9-15
Value
Estimated Primary current value from
Compressor current
Remark
The unit is 0.1A
Samsung Electronics
Troubleshooting
9-3-3 Checking Indoor controller
9-3-4 Checking Power cable and Communication cable
See 12-2 "Checking and Testing operations" and installation manual.
9-3-5 Checking Temperature sensor
See 12-5 "Fault Diagnosis of Major Parts".
In case of a sensor in outdoor unit, temperature can be monitored with "VIEW MODE".
Press K4 key on the outdoor display PCB for several time to change the display to sensor temperature value.
Left 1 digit of the LED is data index and Right 2 digits are the value.
Index
Value
8
Discharge sensor temperature
9
OLP sensor temperature
A
Condenser sensor temperature
B
Outdoor sensor temperature
Samsung Electronics
Remark
The unit is degree C
9-16
Troubleshooting
DA?GEJC""3
5GG(CWNV&KCIPQUKUQH/CLQT2CTVU
%WTTGPV''8UVGRXCNWGECPOQPKVQTGFYKVJ8+'9/1&'
2TGUU-MG[QPVJGQWVFQQTFKURNC[2%$HQTUGXGTCNVKOGVQEJCPIGVJGFKURNC[VQEWTTGPV''8XCNWG
.GHVFKIKVQHVJG.'&KUFCVCKPFGZCPF4KIJVFKIKVUKUVJGXCNWG
Index
Value
3
EEV-A step
4
EEV-B step
5
EEV-C step
6
EEV-D step
Remark
The step value range is
between Zero and 480.
-ELAI=P?DEJC
5GG %JGEMKPICPF6GUVKPIQRGTCVKQPU
9-17
Samsung Electronics
9-4 PCB Inspection
9-4-1 Cautions for Part Replacement
1. The human body carries much static electricity.
Before touching a part for repair, replacement or the
similar purpose, be sure to touch a grounded metal­
lic portion by hand to let the static electricity go
through the metallic portion to the earth.
Especially when handling any micro computer or IC,
carefully remove such static electricity before touch­
ing them.
2. When repairing any part on a work bench, be sure
to place an insulative sheet on the bench and always
keep the sheet surface neat without any metal frag­
ments. If any such fragment touches a part, a sec­
ondary trouble will possibly be caused in the part.
3. Before replacing any parts, be sure to turn off the
power supply. If such replacement is done with the
power supply kept on, an electric shock, short circuit
or destruction of a part may result.
4. During replacement or repair of a part, carefully han­
dle it : The printed circuit board has fine lead wires
(jumper wires) and glass-made parts (diode) on its
substrate.
So if a circuit board is roughly handled, such lead
wires and parts will be easily broken or damaged by
bending or shock.
5. When soldering the lead wires of any new part, be
sure to polish them using an emery paper or the like
before soldering them.
Since the lead wires of any new part are covered
with an oxide film, solder cannot adhere to the lead
wires if not polished.
6. When soldering any part, care should be exercised
not to apply any high-wattage soldering iron to the
part for a long time. Some parts are of so low a heat
resistance that they may be broken or have the
properties changed if a soldering iron is so applied
(Otherwise, the pattern may possibly be separated
and raised).
7. The heat of the soldering iron should be transferred
to the entire object to be soldered. If the solder
pieces are not well fused due to insufficient transfer
of the heat from the soldering iron, no satisfactory
electrical continuity can be assured even if the sol­
dered objects appear well connected to each other.
8. The solder used should be limited to a minimum.
If excessive solder is used, it will cause inter-pattern
contact, which may cause malfunction of the circuit.
9. Although some part of the PCB surface are coated
with coating material for protection from dust and
dirt, soldering is also available to the coating part.
Because this coating is thin and is weak for solder­
ing heat.
But coating material remaining on the solder part
should be cleaned up before soldering a new
component to prevent the solder part from becoming
bad conduction.
9-4-2 Procedure
12-4-2 The parts should be replaced in the following procedure.
Check for any faulty part.
Detach the faulty part.
Replace it with a new part.
Check the operation of the new part.
The repair is completed.
Samsung Electronics
9-18
10. Reference for Installation
10-1 Selecting Area for Installation
Select an area for installation that is suitable to customer’s needs.
10-1-1 Indoor Unit
1. Make sure that you install the indoor unit in an area providing good ventilation.
It must not be blocked by an obstacle affecting the airflow near the air inlet and the air outlet.
2. Make sure that you install the indoor unit in an area allowing good air handling and endurance of vibration of the indoor unit.
3. Make sure that you install the indoor unit in an area where there is no source of heat or vapor nearby.
4. Make sure that you install the indoor unit in an area from which hot or cool air is spread evenly in a room.
5. Make sure that you install the indoor unit in an area away from TVs, audio units, cordless phones, fluorescent lighting fixtures
and other electrical appliances (at least 3.3ft).
6. Make sure that you install the indoor unit in an area which provides easy pipe connection with the outdoor unit, and easy
drainage for condensed water.
7. Make sure that you install the indoor unit in an area which is large enough to accommodate the measurements shown in
figure on the next page.
• It is harmful to the air conditioner if it is used in the following environments: greasy areas (including areas
near machines), salty areas such as coast areas, areas where sulfuric gas is present such as hot spring
areas. Contact your dealer for advice.
10-1
Samsung Electronics
Reference for Installation
10-1-2 Outdoor Unit
1. Make sure that you install the outdoor unit in area not exposed to the rain or direct sun light.(Install a separate sunblind if
exposed to direct sun light.)
2. Make sure that you install the outdoor unit in area allowing the good air moment, not amplifying noise or vibration, especially
to avoid disturbing neighbors. (Fix the unit firmly if it is mounted in a high place.)
3. Make sure that you install the outdoor unit in area providing the good ventilation and which is not dusty. It must not be
blocked by any obstacle affecting the airflow near the air inlet and the air outlet.
4. Make sure that you install the outdoor unit in area free from animals or plants.
5. Make sure that you install the outdoor unit in area not blocking the traffic.
6. Make sure that you install the outdoor unit in area easy to drain condensed water from the indoor unit.
7. Make sure that you install the outdoor unit in area which provides easy connection within the maximum allowable length of a
coolant pipe.
If you install the excessive length of pipe, add additional refrigerant as 0.11 oz per unit ft; refer to the table below.
/QFGN
/*(:%##
/*(:%##
6QVCNEQPPGEVKPIRKRGNGPIVJ
.
.6ŭHV
.6 HV
.6ŭHV
.6 HV
#FFKPITGHTKIGTCPV
%JCTIGNGUU
.6HVZQ\
%JCTIGNGUU
.6HVZQ\
8. Make sure that you install the outdoor unit in an area which is large enough to accommodate the measurements shown in
figure on the next page.
10-1-3 Remote Control Unit
1. Make sure that you use the remote control unit in an area free from obstacles such as curtains etc, which may block signals
from the remote control unit.
2. Make sure that you put the remote control unit in an area not exposed to direct sunlight, and where there is no source of
heat.
3. Make sure that you use the remote control unit in an area away from TVs, audio units, cordless phones, fluorescent lighting
fixtures and other electrical appliances (at least 3.3ft).
Samsung Electronics
10-2
10-2 Connecting Up and Purging the Circuit
• The air in the indoor unit and in the pipe must be purged. If air remains in the refrigeration pipes, it will affect
the compressor, reduce to cooling capacity and could lead to a malfunction. Refrigerant for air purging is not
charged in the outdoor unit. Use Vacuum Pump as shown at the right figure. Each unit must be purged in turn.
■ MH050FXCA2A
1. Check the piping connections.
2. Connect the charging hose of low pressure side of manifold gauge to the
packed valve having a service port (3/8" service valve) as shown at the
figure.
3. Open the valve of the low pressure side of manifold gauge counterclockwise.
Indoor
A-unit
Indoor
B-unit
4. Purge the air from the system using vacuum pump for about 10 minutes.
• Close the valve of the low pressure side of manifold gauge clockwise.
• Make sure that pressure gauge show -0.1MPa(-76cmHg) after about 10 minutes.
• This procedure is very important in order to avoid gas leak.
• Turn off the vacuum pump
• Remove the hose of the low pressure side of manifold gauge.
5. Set valve cork of both liquid side and gas side of packed valve to the
open position.
Vacuum
Pump
Valve stem
Stem cap
6. Mount the valve stem nuts and the service port cap to the valve, and
tighten them at the torque of 183kgf•cm with a torque wrench.
Service port
7. Check for gas leakage.
• At this time, especially check for gas leakage from the 3 way valve’s
stem nuts, and from the service port cap.
10-3
Samsung Electronics
Reference for Installation
■ MH080FXCA4A
1 Check the piping connections.
2 Connect the charging hose of low pressure side of manifold gauge to the
packed valve having a service port (5/8” Packed valve)as shown at the
figure (Value stem:1/2”-20UNF).
WARNING:
Make the electrical connection and leave the system into “stand by
mode”. Do not turn on the system!.
This is necessary for better vacuum operation (full OPEN position of
Electronic Expansion Valve -EEV -).
A
B
C
Vacuum
Pump
3 Open the valve of the low pressure side of manifold gauge ounter
clockwise.
4 Purge the air from the system using vacuum pump for about 30 minutes.
- Close the valve of the low pressure side of manifold gauge clockwise.
- Make sure that pressure gauge show -0.1MPa(-76cmHg)after about
30 minutes.
This procedure is very important in order to avoid gas leak.
- Turn off the vacuum pump.
- Remove the hose of the low pressure side of manifold gauge.
5 Set valve cork of both liquid side and gas side of packed valve to the
open position.
Valve stem
Stem cap
Service port
6 Mount the valve stem nuts and the service port cap to the valve,and
tighten them at the torque of 183kgf•cm with a torque wrench.
7 Check for gas leakage.
- At this time,especially check for gas leakage from the 3-way valve ’s
stem nuts,and from the service port cap.
Samsung Electronics
10-4
10-3 Refrigerant Refill
10-3-1 MH050FXCA2A
Refill an air conditioner with refrigerant when refrigerant has been leaked at installing or using.
1) Purge air(for new installation only).
2) Turn the 3 way valve clockwise to close,
connect the pressure gauge (low pressure side)
to the service valve, and open the 3 way valve
again.
Suspension hook
Compound
gauge
High
pressure
gauge
Hand
wheel
Finger tight
fittings
3) Connect the tank to refill with refrigerant.
For mounting
other and of
hose when
not in use
4) Set the unit to cool operation mode.
Connected to
high pressure
side
Charging line
5) Check the pressure indicated by the pressure
gauge(low pressure side).
* Standard pressure should be 8.0~9.0kg/cm2
in a regular and high operation mode.
6) Open the refrigerant tank and fill with refrigerant
until the rated pressure is reached.
* It is recommended not to pour the refrigerant
in too quickly, but gradually while operating a
pressure valve.
7) Stop operation of the air conditioner.
8) Close the 3 way valve, disconnect the pressure
gauge, and open the 3 way valve again.
9) Close the cap of each valve.
10-5
Samsung Electronics
Reference for Installation
10-3-2 MH080FXCA4A
Refill an air conditioner with refrigerant when refrigerant has been leaked at installing or using.
1) Purge air(for new installation only).
2) Turn the 5/8" service valve clockwise to close,
connect the pressure gauge (low pressure side)
to the service valve, and open the 5/8" service
valve again.
Suspension hook
Compound
gauge
High
pressure
gauge
Hand
wheel
Finger tight
fittings
3) Connect the tank to refill with refrigerant.
For mounting
other and of
hose when
not in use
4) Set the unit to cool operation mode.
Connected to
high pressure
side
Charging line
5) Check the pressure indicated by the pressure
gauge(low pressure side).
* Standard pressure is should be 8.0~9.0kg/cm2
in a regular, high operation mode.
6) Open the refrigerant tank and fill with refrigerant
until the rated pressure is reached.
* It is recommended not to pour the refrigerant
in too quickly, but gradually while operating a
pressure valve.
7) Stop operation of the air conditioner.
8) Close the 5/8" service valve, disconnect the
pressure gauge, and open the 5/8" service valve
again.
9) Close the cap of each valve.
Samsung Electronics
10-6
/ABNECAN=JP@FQOPIAJP
*%5#5CA*%8#5C4A
%NCUU
%QPPGEVKQP
2KRG.GPIVJ
5VCPFCTF
616#. b O
/*(:%##
#VUGTXKEG
#VKPUVCNNCVKQP
#KT2WTIG
/GVJQF
4GHTKIGTCPV
#FLWUVOGPV
#KT2WTIG
/GVJQF
4GHTKIGTCPV
3WCPVKV[
4GHGTVQVJG
FGVCKNGF%QPPGEVKPIWR
CPFRWTIKPIVJGEKTEWKV
RCIG
7PPGEGUUCT[
2WTIGCKTWUKPIC
XCEWWORWOR
QTCPCFFKVKQPCN
TGHTKIGTCPVE[NKPFGT
TGHGTVQ
URGEKHKECVKQPUJGGV
/CZ
616#. ŭO
/*(:%##
#FFQ\QHTGHTKIGTCPV
4#HQTGXGT[HV
#FFQ\QHTGHTKIGTCPV
4#HQTGXGT[HV
+VYQWNFDGVJGDGUVEJQKEGVQWUGVJGUVCPFCTFVWDGNGPIVJVQMGGRVJGDCUKESWCNKV[QH4QQO#KTEQPFKVKQPGTHQTGZCORNGEQQNKPI
CPFJGCVKPIECRCEKV[UQWPFNGXGNXKDTCVKQPNGXGNCPFTGNKCDKNKV[
$WVCEEQTFKPIVQCEGTVCKPFKHHGTGPVKPUVCNNCVKQPEQPFKVKQPVJGEQPPGEVKQPVWDGNGPIVJEQWNFDGEJCPIGFKPVJGTGEQOOGPFCVKQP
NGPIVJVJCVKUUJQYPCDQXG
+PVJKUECUGKPUVCNNGTUJQWNFMGGRVJGKPUVCNNCVKQPEQPFKVKQPVQMGGRVJGSWCNKV[QH4QQO#KTEQPFKVKQPGT
4GHTKIGTCPVUJQWNFDGEJCTIGFCFFKVKQPCNN[CUYTKVVGPCDQXGCEEQTFKPIVQVJGEJCPIGQHVJGNGPIVJQHVJGEQPPGEVKQPVWDG
+VPGGFUVQCHHGEVVJGFGETGCUGKPEQQNKPICPFJGCVKPIECRCEKV[QTQHVJGTGNKCDKNKV[QHEQORTGUUQTVJCVOC[DGECWUGFD[CNCEMQHTGHTKIGT
CPV
+PUVCNNCVKQPRQUKVKQPFKHHGTGPEGDGVYGGPVJGKPFQQTWPKVCPFVJGQWVFQQTWPKVUJQWNFPQVGZEGGFQXGTVJCPHV
9JGPVJGEQPPGEVKQPRKRGKUDGGPGZVGPFGFNQPIGTVJCPHVKVOKIJVPGGFVQEJCPIGVJGFKCOGVGTQHVJGGNGEVTKECNYKTGVQCNCTIGTUK\G
KPQTFGTVQMGGRCXQNVCIGFTQRHQTUVCTVKPITQQOCKTEQPFKVKQPGTKUPQVNGUUVJCPQHVJGTCVGFXQNVCIG#PFVJGPCXQNVCIGOGVGTYKNN
DGWUGHWNVQEJGEMVJGTCVGQHVJGXQNVCIGFTQR
10-7
Samsung Electronics
10-5 Flare Nut Fixing Torque
orque(kg
Torque
(kg..cm)
Outer diameter
Fixing Torque
Final Torque
ø 1/4 inch
(Liquid Side)
160
200
ø 3/8 inch
(Gas Side)
300
350
ø 1/2 inch
(Gas Side)
500
550
Samsung Electronics
10-8
10-6 "Pump down" Procedure
10-6-1 MH050FXCA2A
Pump down will be carried out when an evaporator is replaced or when the unit is relocated in another area.
1) Remove the caps from the 2 way valve and
the 3 way valve.
2) Turn the 3 way valve clockwise to close and
connect a pressure gauge (low pressure side)
to the service valve, and open the 3 way valve
again.
2 way Valve
3 way Valve
3) Set the unit to cool operation mode.
(Check if the compressor is operating.)
4) Turn the 2 way valve clockwise to close.
5) When the pressure gauge indicates "0" turn the
3 way valve clockwise to close.
6) Stop operation of the air conditioner.
7) Close the cap of each valve.
Relocation of the air conditioner
• Refer to this procedure when the unit is relocated.
• 1. Carry out the pump down procedure (refer to the details of ‘pump down’).
• 2. Remove the power cord.
• 3. Disconnect the assembly cable from the indoor and outdoor units.
• 4. Remove the flare nut connecting the indoor unit and the pipe.
• 4. At this time, cover the pipe of the indoor unit and the other pipe using a cap or vinyl plug to avoid foreign
material entering.
• 5. Disconnect the pipe connected to the outdoor unit.
• 4. At this time, cover the valve of the outdoor unit and the other pipe using a cap or vinyl plug to avoid foreign
material entering.
• 6. Make sure you do not bend the connection pipes in the middle and store together with the cables.
• 7. Move the indoor and outdoor units to a new location.
• 8. Remove the mounting plate for the indoor unit and move it to a new location.
10-9
Samsung Electronics
Reference for Installation
10-6-2 MH080FXCA4A
Pump down will be carried out when an evaporator is replaced or when the unit is relocated in another area.
1) Remove the caps from the 3/8" service valve and
the 5/8" service valve.
5/8" Service Valve
2) Turn the 5/8" service valve clockwise to close and
connect a pressure gauge (low pressure side)
to the service valve, and open the 5/8" service valve
again.
3/8" Service Valve
3) Set the unit to cool operation mode.
(Check if the compressor is operating.)
4) Turn the 3/8" service valve clockwise to close.
5) When the pressure gauge indicates "0" turn the
5/8" service valve clockwise to close.
6) Stop operation of the air conditioner.
7) Close the cap of each valve.
Relocation of the air conditioner
• Refer to this procedure when the unit is relocated.
• 1. Carry out the pump down procedure (refer to the details of ‘pump down’).
• 2. Remove the power cord.
• 3. Disconnect the assembly cable from the indoor and outdoor units.
• 4. Remove the flare nut connecting the indoor unit and the pipe.
• 4. At this time, cover the pipe of the indoor unit and the other pipe using a cap or vinyl plug to avoid foreign
material entering.
• 5. Disconnect the pipe connected to the outdoor unit.
• 4. At this time, cover the valve of the outdoor unit and the other pipe using a cap or vinyl plug to avoid foreign
material entering.
• 6. Make sure you do not bend the connection pipes in the middle and store together with the cables.
• 7. Move the indoor and outdoor units to a new location.
• 8. Remove the mounting plate for the indoor unit and move it to a new location.
Samsung Electronics
10-10
11. Reference Information
11-1 Index for Model Name
FREE JOINT MULTI FOR EUROPE
M
H
052
F
P
E
A
4
A
/
O
O
O
Buyer code
Product Type
M
Capa
Multi
Rating voltage
*10Kw(3 digit)
Mode
Comp. Type
C
C/O
F
Free Inverter
H
H/P
D
Redd Digital Scroll
Combination Quantity
A
115V, 60Hz
_,12.. Indoor
B
220V, 60Hz
1,2..
C
208~230V, 60Hz
D
200~220V, 50Hz
E
220~240V, 50Hz
M
127V, 50Hz
Outdoor
FJM
Version
_,12.. Indoor
_,A,B.. Outdoor
Indoor/Outdoor Type
11-1
K
1 way
S
Slim 1 way
M
Mini 4 way
D
Silhouette
E
Slim
P
G-P
W
HB
V
Vivave
R
Moderato
N
Console
X
Outdoor
CST
Refrigerant
Z
R22
C
R407C
A
R410A
Duct
RAC
CONV
Samsung Electronics
Index for Model Name (cont.)
FREE JOINT MULTI FOR EUROPE
M
H
1
V
8
V
1
X
-
07
/
O
O
O
Buyer code
Product Type
M
Capa
Multi
Serial Version
*K BTU
Mode
1
Basic
2
MR(02R~)
Indoor Capacity
- CAP Indoor(K BTU)
FJM
_
Outdoor
Refrigerant
C
C/O
V
R410A Inverter
H
H/P
Z
R22
_
Indoor
C
R407C
X
Outdoor
P
G-P
Semi Product
Indoor Type
Samsung Electronics
W
HB
V
Vivave
R
Moderato
RAC
11-2
11-2 Refrigerating Cycle Diagram
■ MH050FXCA2A
11-3
Samsung Electronics
Reference Information
■ MH080FXCA4A
Samsung Electronics
11-4
11-3 Pressure & Capacity mark
■ Power/Heat
W
cal/s
kcal/h
Btu/h
kg . m/s
HP
ib . m/s
1
0.23885
0.85985
3.4121
0.001341
0.10197
0.73756
4.1868
1
3.6
14.286
0.0056146
0.42693
3.088
1.163
0.27778
1
3.9683
0.0015596
0.11859
0.85778
0.29307
0.06999
0.252
1
3.9302x10-4
0.029885
0.21616
745.7
178.11
641.19
2,544.4
1
76.04
550
9.8067
2.3423
8.4322
33.462
0.013151
1
7.233
1.3558
0.32383
1.1658
4.6262
0.0018182
0.13826
1
11-4 The abbreviated technology words & the definition of technology terms
Abbreviated technology words
Definition of technology terms
COMP(Full name compressor)
One that compresses, especially a machine used to compress gases.
BLOWER
One that blows, especially a mechanical device, such as fan, that produces a current of air.
FAN
A device for reeating a current of air or a breeze.
ASS’Y CONTROL BOX
(Full name : Assemble control box)
A restraining device of air-condition, measure, or limit.
MOTOR
Something, such as a machine or an engine, that produces or imparts motion.
ASS’Y EVAP/ASS’Y COND
(Full name : assemble evaporator /
assemble condenser)
Heat exchanger; A device, used to transfer heat from a fluid on one side of a barrier to a fluid
on the other side without bringing the fluids into direct contact.
11-5
Samsung Electronics
11-5 Q & A for Non-trouble
Classification
Class
Description
Q
The cooling is weak.
A
When it is hot outside, its cooling capacity decreases due to the increase of the ambient temperature.
When the dust filter gets blocked or warm outside air gets in, the cooling capacity will decrease. So,
make sure to clean the dust filter frequently, prevent heat loss by closing the doors and insulate the
cooling area by using curtains, blinds, shades or window tinting.
Q
The cooling is good generally. But, it gets weak when it is considerably hot.
A
It occurs when the outdoor unit is exposed to direct sun light and heat-up air is not ventilated well.
So, set up a sunblind over the outdoor unit and keep stuff away from the unit to increase the ventila­
tion. When the cooling capacity decreases during a heat wave, clean the heat exchanger of the out­
door unit or spray some cold water to the heat exchanger to increase the cooling capability.
Cooling
Q
The cooling is weak. Does it need refrigerant charging?
A
It is not correct charging refrigerant regularly. Except that you have moved in several times or the
connection pipes are broken, the refrigerant does not run low. So, when refrigerant is additionally
charged, it could be costly and cause a product's failure. When the refrigerant leaks, all of it will
escape in a short time resulting in cooling failure and no water coming out of the drain hose. So, if
water comes out from the drain hose, it indicates the normal operation of the product and it does not
need refrigerant charging.
Q
It fails to do cooling.
A
When the air conditioner is set to Ventilation or the desired temperature is set higher than the current
temperature, it fails to do cooling. In this case, select Cooling or set the desired temperature lower.
Q
It floods the floor.
A
Place the drain hose properly. When it is not placed properly, the drain water would flow back flooding
the floor. So, straighten out the drain hose for the water to be drained well.
Q
Water drips at the drain connection (service valve) of the outdoor unit.
A
When a glass bottle is taken out of the refrigerator, moisture gets condensed on its surface due to the
temperature differences. The same principle applies to the air conditioner. When cold refrigerant goes
through the copper tube, moisture gets condensed on the surface of the tube and the connection
areas. To prevent the water condensation, the pipes are insulated. But, the connection areas of the
Leakage
outdoor unit are not insulated for the purpose of maintenance or repair, and water gets condensed due
to the temperature differences and drips down. Generally, it evaporates right away. But, when it drips
much during muggy days, put a water pan on the floor.
Q
It leaks even though a drain pump is used.
A
It occurs when the drain pump is plugged out or it is out of order. Check the power of the drain pump
and the position of the drain hose, and when the pump is faulty, contact the drain pump manufacturer.
Samsung Electronics do not manufacture drain pumps. So, we are not able to correct the drain pump
problems.
Q
Whenever the air conditioner is turned on, it irritates my eyes and gives me a headache.
A
There are no components in the air conditioner irritating the eyes and sending out chemical smells.
Smells
But, when the air conditioner is turned on, other smell sources are sucked into the air conditioner and
get out of it. So, find and root out the smell sources. Generally, it occurs at a interior renovated place,
a pharmacy, a gasoline handling place, a tire shop, a second-hand book shop or an electronic
Samsung Electronics
11-6
Q & A for Non-trouble (cont.)
Classification
Class
Description
component handling place; when its chemical or musty smells are sucked in and sent out, it can be
misled that the air conditioner generates them. So, find and root out the problem or refresh the room
frequently.
Q
Whenever the air conditioner is turned on, it stinks.
A
There are no components in the air conditioner sending out chemical smells. But, when the air condi­
tioner is turned on, other smell sources are sucked into the air conditioner and get out of it. So, find
and root out the smell sources. Generally, when the drain hose is taken out to the washing room or
there are sources of smells such as a diaper bin, a shoe shelf or a socks bin, bad smells generate.
Also, it occurs where glass cleaners or air fresheners are used; when they are sucked in interacting
with dusts and moistures inside, bad smells generate. These kinds of organic materials noxious to
human bodies. So, we recommend against the use of them.
Q
Whenever the air conditioner is turned on, it smells sour.
A
When the room is papered recently, its paste smells would be sucked inside. Also, when the air condi­
tioner is installed in the study room of young boys loving sweat-generating activities such as the bas­
ketball, excessive sweats evaporate and get sucked into the air conditioner resulting in bad smells. So,
Smells
find and root out the problem or refresh the room frequently.
Q
Whenever the air conditioner is turned on, it smells musty.
A
It is due to the improper keeping of the product after its use. When keeping the product, dry up the
inside with the operation of Ventilation to prevent must. When the product is kept without drying up the
inside with Ventilation, mold would grow inside resulting in must. So, open the windows and switch on
the Ventilation function to get rid of the saturated smell inside.
Q
Whenever the air conditioner is turned on, it sends out bad smells such as stale smells.
A
It occurs generally when there are pet animals in the house. Their smells stay at the same place.
But, when the air conditioner is turned on, the air gets circulated resulting in the circulation of the
smells. So, find and root out the problem or refresh the room frequently.
Q
It sends out bad smells.
A
When the air filter is filthy, it could send out bad smells. So, clean the filter and ventilate the room with
the windows open while operating the Ventilation function.
Q
It won't start.
A
There is a power failure or it is plugged out. Also, check if the power distribution panel is switched off.
Q
It goes off during operation.
A
When the hot air does not escape properly, it goes off during operation. It occurs when it does not
ventilate properly because the outdoor unit is covered, the back of the outdoor unit is blocked by a
cardboard or a plywood panel, and the front of the outdoor unit is blocked by the closed window or
Operation
other obstacles. Clear the above obstacles from the outdoor unit.
Q
It generally works properly. But, when it's considerably hot, it goes off during operation.
A
It occurs when the outdoor unit is exposed to direct sunlight and the hot air does not escape properly.
Set up a sun blind over the outdoor unit and clear the neighboring obstacles from the outdoor unit to
provide good ventilation. When it goes off frequently during a heat wave, it would prevent the turn-off and
increase the cooling capacity cleaning the outdoor unit or spraying some water to the heat exchanger.
11-7
Samsung Electronics
Q & A for Non-trouble (cont.)
Classification
Class
Description
Q
The remote controller won't operate.
A
When the batteries run out or the transmitter or receiver of the remote controller is blocked by obsta­
Operation
cles, change the batteries or keep the obstacles away from the controlling area. Also, the remote con­
troller may not work under intensive light from a 3-wave length lamp or a neon sign due to the EMI.
In this case, take the remote controller closer to the receiver.
Q
Who installs the air conditioner? (Relocation/Re-installation)
A
When relocating or re-installing the air conditioner, make sure to contact Samsung Electronics Service
Center or Authorized Service Agent and have them to do the job.(If not, it could cause personal injury
or product damage.)
The cost for the relocation/re-installation of the air conditioner is subject to the customer's expense.
There is a cost table. But, our service engineer needs to visit to total up the cost correctly.
When you move in, make sure to contact Samsung Electronics Service Center or Authorized Service
Agent in advance to streamline the process.
Q
Is it possible to install the outdoor unit outside?
A
It is possible to install it at a designated place in the apartment or on the rooftop nearby.
But, it's illegal hanging an angle iron case with the outdoor unit in it outside the apartment. Also, it is
illegal obstructing passers-by with the outdoor unit installed outside.
Installation
Q
What can be done to install the outdoor unit facing the road because it is a commercial building?
A
The following is an excerpt from Building Code going into effect from JUNE 1st 2005. "The exhaust
pipe of a cooling or ventilation facility installed in a building adjacent to the streets of commercial or
residential areas shall be installed higher than 2m to prevent the exhaust air from blowing directly to
passers-by and the current facilities shall be corrected by MAY 31st 2005." So, please install it higher
than 2m or not to blow the hot exhausting air directly to passers-by.
Q
What about installing a windscreen during installation not to blow hot air directly to passers-by?
A
When the hot air from the front of the outdoor unit is blocked, the product's performance will be
affected and it will fail to operate properly. So, keep it at least 300mm away from its surrounding walls
and give it good ventilation.
Samsung Electronics
11-8
11-6 Common sense of refrigeration
11-6-1 Air supplier
■ Air supplier?
It supplies fresh air to the building or room through procedure of air circulation for fresh environment.
■ Effectiveness of air supplier
It diminishes the stress or fatigue and enhances vivid desire through fresh air circulation. Also, filthy air indoor is being
cleaned by Air-Filter and it keeps clean and fresh environment and dehumidification. Temperature, humidity, air stream,
cleanness are called for factors of air supplier and they are kept in proper condition for usage purpose.
Control the indoor air into cool or warm
Humidity
(Moisture)
Temperature
(Heat)
Remove filthy dirt in air
Remove humidity in air or humidify
Air stream
(Aircirculation)
Cleanness
(Air)
Circulate air every corner of indoor
■ Four factors of air suppliers
The human body keeps regular temperature regarding the human body's freshness. For keeping freshness, heat generated from human body should emit outside of the body by air circulation, conduction, emission, and evaporation. The human body feels freshness when the emission rate is 40~45%, which was emitted by a radiation when it is comfortable and warm, and air circulation and conduction is 20~30%, and evaporation is 20~24%. It sometimes may depends on seasonal factor, wearing condition, age, sex and mental state other than indoor environment.
But generally the value of fresh indoor temperature is that below 0.2(m/s) of indoor air circulation, the temperature is 21~28˚C
when the wall temperature is the same as the indoor's and relative humidity is 30~31% in summer, the winter temperature is
20~24˚C and relative humidity is 30~60% in winter. 11-9
Samsung Electronics
ELECTRONICS
GSPN(Global Service Partner Network)
Area
Web Site
North America
http://service.samsungportal.com
Latin America
http://latin.samsungportal.com
CIS
http://cis.samsungportal.com
Europe
http://europe.samsungportal.com
China
http://china.samsungportal.com
Asia
http://asia.samsungportal.com
Mideast & Africa
http://mea.samsungportal.com
This Service Manual is a property of Samsung Electronics Co., Ltd.
Any unauthorized use of Manual can be punished under applicable
International and/or domestic law.
© Samsung Electronics Co., Ltd. Jan. 2008.
Printed in Korea.
Code No. DB98-29161A(3)