Stationery
y
r
e
n
o
i
t
a
t
S
Binding Products
698
Calculators
690
Computer Accessories
709
Cutting & Shredding
699
Filing
692
General
Adhesives
Bins for Recycling
Cash Boxes & Accessories
Desk Accessories
Hole Punches
Key Boxes & Tags
Label Printing
Paper Fasteners
Rubber Bands
Rulers
Self-adhesive Notes
Stamps & Ink Pads
Visitor Books
Whiteboard (Personal)
680
724
708
683
686
708
717
681
681
684
685
681
682
673
Laminating
705
Markers & Erasers
663
Paper, Pads, Envelopes & Labels 677
Packing Materials
707
Pencils, Erasers & Sharpeners
668
Pens & Correction
657
Presentation
696
Staplers, Staples & Removers
687
Whiteboards & Accessories
663
17
www.leitz.com/wow
SHOW YOUR
TRUE WOW
COLOURS
WOW A
.SVZZ`SHT
^PKL
TTZWP
A4 80mm
A
Code
06-9738
06-9739
Stand out from the crowd. Introducing WOW,
[OLIYPSSPHU[YHUNLMYVT3LP[a8\HSP[`VѝJL
products in a palette of vibrant colours to
WLYMLJ[S`YLÅLJ[`V\YWLYZVUHSP[`
06-9740
WOW 2
Glossy me
binders. 2
B
10 YEAR
GUARANTEE
WOW Metal Stapler
High quality, metal construction.
Punches up to 30 sheets of 80gsm
paper at a time. Hinged translucent
waste box.
Modern design, capacity up to 30
sheets, comes in 3 metallic colours.
Covered by a 10 year guarantee.
Takes 24/6 and 26/6 staples.
Colour
Price
06-9796
Pink
£5.95
06-9797
Blue
£5.95
+7
30
06-9735
WOW Metal 2 Hole Punch
Code
06-9798
Green
£5.95
10 YEAR
+7
GUARANTEE
30
Code
06-9736
06-9737
Code
Colour
Price
WOW M
06-9793
Pink
£9.19
4HKLMYVT
06-9794
Blue
£9.19
06-9795
Green
£9.19
Magazin
C
Code
06-9779
06-9780
10 YEAR
GUARANTEE
WOW Mini Hole Punch
WOW Mini Stapler
06-9781
High quality, metal construction.
Punches up to 10 sheets of 80gsm
paper at a time.
High quality, metal construction.
Staples up to 10 sheets of 80gsm
paper at a time.
06-9782
Code
Colour
Price
Code
Colour
Price
WOW W
06-9802
Pink
£4.29
06-9799
Pink
£5.99
06-9803
Blue
£4.29
06-9800
Blue
£5.99
9VI\Z[^H
Stackable
06-9804
Green
£4.29
06-9801
Green
£5.99
10 YEAR
GUARANTEE
Stapler & Punch Set
NeXXt WOW Mini
E
Code
06-9783
Code
Colour
Price
06-9805
Pink
£9.99
06-9807
Blue
£9.99
06-9808
Green
£9.99
10 YEAR
GUARANTEE
For Punch, Staplers** & Pliers**:
06-9784
**10 year guarantee when using Leitz staples
06-9785
06-9786
WOW A4 and A5 Hardcover
Casebound Notebooks
WOW D
ZOLL[ZVM NZTWHWLY>VVKMYLLHUK5VYKPJ:^HUJLY[PÄLK
paper. Stitch bound to prevent paper loss.
A4 Ruled
Stylish, du
4 or 5 eas
A4 Squared
Desk Cu
F
Code
Colour
Price
Code
Colour
Price
06-9744
Pink
£3.85
06-9750
Pink
£3.89
06-9787
Code
06-9745
Blue
£3.85
06-9751
Blue
£3.89
06-9788
06-9746
Green
£3.85
06-9752
Green
£3.89
06-9789
www.leitz.com/wow
WOW A4 Lever Arch File Folder
.SVZZ`SHTPUH[LKWHWLYVUIVHYKSL]LYHYJOÄSLZ<UPX\LWH[LU[LK‡SL]LYHYJOTLJOHUPZTMVY
^PKLYVWLUPUNMHZ[LYÄSPUNTTZWPUL^P[OZOLL[JHWHJP[`NZTWHWLYHUK
TTZWPUL^P[OZOLL[JHWHJP[`NZTWHWLY`LHYN\HYHU[LLVUSL]LYHYJOTLJOHUPZT
A4 80mm
A
g WOW,
VѝJL
rs to
Code
A4 50mm
Colour
Price
Code
Colour
Price
06-9738
Pink
£2.89
06-9741
Pink
£2.79
06-9739
Blue
£2.89
06-9742
Blue
£2.79
06-9740
Green
£2.89
06-9743
Green
£2.79
+7
A
5 YEAR
GUARANTEE
WOW 2 Ring Binders
Glossy metallic laminated paper on board ring
binders. 25mm 2 D ring mechanism in A4 Maxi size.
B
pler
y up to 30
allic colours.
uarantee.
aples.
r
Price
06-9735
Pink
£1.89
06-9736
Blue
£1.89
06-9737
Green
£1.89
B
WOW Magazine File and Letter Tray
£9.19
4HKLMYVTYVI\Z[WSHZ[PJ(ZPaLZÄUPZOLK^P[OHZ[`SPZOTL[HSSPJLќLJ[
£9.19
Magazine File
C
er
truction.
of 80gsm
C
Letter Tray
D
Code
Colour
Price
Code
Colour
Price
06-9779
Pink
£3.19
06-9776
Pink
£2.19
06-9780
Blue
£3.19
06-9777
Blue
£2.19
06-9781
Green
£3.19
06-9778
Green
£2.19
06-9782
Assorted pack of 6
£18.95
Price
WOW Waste Bin
£5.99
9VI\Z[^HZ[LIPUPU]PIYHU[>6>JVSV\YZ[VTH[JO`V\YVѝJL
Stackable for storage with a large 15 litre capacity.
£5.99
£5.99
E
Pliers**:
g Leitz staples
Code
Colour
Price
06-9783
Pink
£3.39
06-9784
Blue
£3.39
06-9785
Green
£3.39
06-9786
Assorted pack of 6
£19.95
E
Stylish, durable storage, helps keep your items organised and within reach.
4 or 5 easy gliding drawers including an additional sorting tray.
Desk Cube 4 Drawer
Price
F
Desk Cube 5 Drawer
Code
Colour
Price
Code
Colour
Price
£3.89
06-9787
Pink
£39.99
06-9790
Pink
£42.99
£3.89
06-9788
Blue
£39.99
06-9791
Blue
£42.99
06-9789
Green
06-9792
Green
£42.99
£3.89
D
WOW Desk Cube
HUJLY[PÄLK
ur
Colour
Price
£9.19
r
Code
£39.99
F
www.leitz.com/wow
WOW Divider and Display Books
ÅHWZPUZPKL[OLIHJRJV]LYMVYZ[VYPUNHKKP[PVUHSKVJ\TLU[Z
Index pocket enables fast access to content
A
A
Code
Colour
Price
06-9877
Pink
£2.99
06-9878
Blue
£2.99
06-9879
Purple
£2.99
06-9880
Green
£2.99
VYJSLHYWSHZ[PJWVJRL[ZÄ_LKPUZPKL[OLZWPUL
Click &
20 Plastic Pockets
B
B
Code
Colour
Price
06-9869
Pink
£1.75
06-9870
Blue
£1.75
06-9871
Purple
£1.75
06-9872
Green
£1.75
A stylish
PU[OLVѝ
and unli
CD Bo
Capacity
160 pap
352 mm
40 Plastic Pockets
C
C
D
A
Code
Colour
Price
06-9873
Pink
£2.45
06-9874
Blue
£2.45
06-9875
Purple
£2.45
06-9876
Green
£2.45
06-9770
06-9771
06-9772
Small
A5 size a
WOW Document File
B
(ZPaL3HTPUH[LKJHYKMVYHNSVZZ`>6>ÄUPZO^P[O
contrasting white interior
D
Code
Colour
Price
06-9758
Pink
£0.69
06-9759
Blue
£0.69
06-9760
Green
£0.69
06-9765
06-9766
Mediu
A4 size a
C
Code
Colour
Price
06-9809
Pink
£5.49
06-9810
Blue
£5.49
06-9811
Green
£5.49
06-9768
06-9769
Maga
A4 size,
dimensio
D
WOW 3 Flap Folder
FF
Code
Colour
Price
06-9865
Pink
£1.75
06-9866
Blue
£1.75
06-9867
Purple
£1.75
06-9868
Green
£1.75
06-9774
06-9775
Mediu
Adaptab
Perfect f
E
06-9858
6 expanding compartments with index labels for easy
PKLU[PÄJH[PVUVMJVU[LU[0UJS\KLZMYVU[MHZ[LUPUNJSPWHUK
ÄUPZOLKPULTIVZZLK77
G
Code
06-9857
WOW Project File
G
Code
06-9773
(ZPaLÅHWMVSKLYZ,TIVZLK77^P[OMYVU[LSHZ[PJH[LK
closure to keep papers secure.
F
Code
06-9767
Titanium coated scissors made from German stainless
steel. Comfortable ergonomic grip in striking dual colour.
TTZPaLPKLHSMVYIV[OOVTLHUKVѝJL\ZL
E
Code
06-9764
WOW Titanium Scissors
E
Code
Code
Colour
Price
06-9861
Pink
£4.69
06-9862
Blue
£4.69
06-9863
Purple
£4.69
06-9864
Green
£4.69
06-9859
06-9860
1
www.leitz.com/wow
KVJ\TLU[Z
Price
£2.99
£2.99
£2.99
£2.99
L
Click & Store Range
A stylish and practical design storage solution with a contemporary design that looks great at home or
PU[OLVѝJL3LP[aZ[VYHNLIV_LZHYLTHKLMYVTHSHTPUH[LKZ\YMHJLMVYIL[[LYSVUNSHZ[PUNWYV[LJ[PVU
and unlike other boxes they can be collapsed and rebuilt many times to save space when not in use.
Price
£1.75
£1.75
CD Box
£1.75
Capacity of 30 standard jewel cases, 60 slim cases or
160 paper sleeves. Assembled dimensions 143 x 136 x
352 mm.
£1.75
A
Price
£2.45
£2.45
£2.45
Code
Colour
06-9770
Pink
£3.39
06-9771
Blue
£3.39
06-9772
Green
£3.39
A
B
Price
Small Box
£2.45
A5 size assembled dimensions 220 x 160 x 282 mm
B
^P[O
Price
£0.69
Code
Colour
Price
06-9764
Pink
£4.95
06-9765
Blue
£4.95
06-9766
Green
£4.95
D
C
Medium Box
£0.69
A4 size assembled dimensions 281 x 200 x 370mm
£0.69
C
nless
colour.
Price
Code
Colour
Price
06-9767
Pink
£5.95
06-9768
Blue
£5.95
06-9769
Green
£5.95
Magazine File
£5.49
A4 size, collapsible storage for documents. Assembled
dimensions 103 x 330 x 253mm
£5.49
£5.49
D
[PJH[LK
Price
Code
Colour
Price
06-9773
Pink
£3.89
06-9774
Blue
£3.89
06-9775
Green
£3.89
K
Medium Organiser Box
£1.75
E
Adaptable compartments that can be added or removed.
Perfect for keeping items organised.
£1.75
£1.75
E
£1.75
easy
PWHUK
Code
Colour
06-9857
Pink
Price
£4.95
06-9858
Blue
£4.95
06-9859
Purple
£4.95
06-9860
Green
£4.95
Quick and easy
- thanks to snap
fastener
Reinforced
edges
3
Sturdy metal
handles for easy
transportation
High quality metal
label holder for
indexing
Price
£4.69
£4.69
£4.69
£4.69
1
2
652
The best selling
original Show-me®
boards.
everything
you need in
one pack!
Show-me® boards are one
of the most cost-effective teaching aids
available. No other teaching aid is as versatile
– Show-me® boards can be used across all
curriculum subjects, all age ranges and in all
situations. In hard wearing high gloss finish they are easy
clean and virtually indestructible. A4 size is ideal for
photocopying, all class and bulk packs now come with
a FREE bottle of Show-me MAGIX advanced Cleaner &
Conditioner, and a Teachers Resources Booklet.
BU
FREE 100ml MAGIX Cleaner/
conditioner with every Class or
Bulk Pack
Show-me® A4 Plain Boards
Virtually indestructible mini drywipe boards for
individual pupil use
Sets come with boards, pens, erasers, teachers
resource book and a 100ml bottle of Magix
Cleaner & Conditioner.
652
ORDER CODE DESCRIPTION
PACK SIZE
52-0786 Plain
52-9778 Plain
Pack of 35 Sets
Pack of 100 Sets
Show
FREE
Additi
interv
Sets c
resou
& Con
PRICE
ORDER CODE
£46.99
£114.99
98-0786
98-0790
653
IMPROVE INTERACTION
INCREASE ENGAGEMENT
BUILD CONFIDENCE
STIMULATE CREATIVITY
HAVE FUN
Show-me® A4 Lined Boards
FREE
PRICE
ORDER CODE DESCRIPTION
PACK SIZE
98-0786 Lined
98-0790 Lined
Pack of 35 Sets
Pack of 100 Sets
Show-me Boards are
used from Nursery
all the way through to
Universities and Higher
Education?
Show-me® A4 Gridded Boards FREE
Additional feature of light blue grid forming
20mm squares on one side only (plain on
reverse)
Sets come with boards, pens, erasers, teachers
resource book and a 100ml bottle of Magix Cleaner
& Conditioner.
Additional feature of light blue lines at 20mm
intervals on one side only (plain on reverse)
Sets come with boards, pens, erasers, teachers
resource book and a 100ml bottle of Magix Cleaner
& Conditioner.
£46.99
114.99
Did you know?
PRICE
£52.95
£132.95
ORDER CODE DESCRIPTION
PACK SIZE
52-0778 Gridded
52-9782 Gridded
Pack of 35 Sets
Pack of 100 Sets
PRICE
£59.99
£132.95
653
654
Show-me® Slim Barrel
Drywipe Pens
Easy-fit lid - ideal
for children
Extra-hard nib - will not
quickly splay out
Low odour xylene-free ink
with safety air-flow cap
Medium
Fine
24 hour cap-off
time
Nib-stop to prevent tip from
being pushed into barrel
High capacity ink reservoir:
writes for longer
ORDER CODE DESCRIPTION
PACK SIZE
52-0772
34-5742
34-5746
34-5744
Pack of 10
Pack of 100
Pack of 10
Pack of 100
Medium Tip Drywipe Pens
Medium Tip Drywipe Pens
Fine Tip Drywipe Pens
Fine Tip Drywipe Pens
One piece
capless barrel
PRICE
£2.89
£27.99
£2.89
£27.99
Show-me® Slim Barrel
Drywipe Pens
Show-me® Classtray of 200 Pens,
MAGIX Cleaner and Erasers
• 4 Assorted Colours - Black, Blue, Red and Green
• FREE 250ml bottle of Show-me® MAGIX cleaner/conditioner
and 6 Show-me® Mini Foam Erasers also included
• Available in 2 handy pack sizes
ORDER CODE
DESCRIPTION
PACK SIZE
52-0774
34-5740
Medium Tip Drywipe Pens
Medium Tip Drywipe Pens
Wallet of 4
Box of 48
PRICE
£1.79
£19.99
ShowORDER CODE
52-9796
52-9798
• Premium quality pens have 24 hour cap-off time, pressureresistant tips and low odour, xylene-free ink
• Top quality Show-me® MAGIX cleaner/conditioner is the most
advanced whiteboard cleaner available
ORDER CODE
DESCRIPTION
34-9804
MEDIUM Tipped Pens,
CLASSTRAY OF 200
250ml Bottle of Cleaner/Conditioner
and 6 Mini Foam Erasers
MEDIUM Tipped Pens,
CLASSTRAY OF 200
250ml Bottle of Cleaner/Conditioner
and 6 Mini Foam Erasers
34-9806
PACK SIZE
PRICE
£61.49
£61.49
MED
TIP
Show-me® Slim Barrel Drywipe
Pens in 10 Assorted Colours
• 10 Vibrant Assorted Colours - Black, Yellow, Orange, Red,
Light Blue, Blue, Brown, Green, Pink and Purple
FINE
TIP
ShowORDER CODE
654
ORDER CODE
DESCRIPTION
PACK SIZE
PRICE
98-0118
98-0119
Medium Tip Drywipe Pens
Fine Tip Drywipe Pens
Pack of 10
Pack of 10
£3.89
£3.89
34-9776
34-9778
655
Show-me® SUPERTOUGH Boards
A4 size is ideal for photocopying, all class
and bulk packs now come with a FREE bottle
of Show-me® MAGIX advanced Cleaner &
Conditioner, and a Teachers Resources Booklet.
ece
arrel
THAN THE STANDARD
BOARDS
· The ultimate, frameless
Show-me® boards
· Thick, semi rigid board
made of solid plastic
· Will not chip or crack virtually indestructible
· Use without a desk
- even outside
· Totally water resistant
Show-me® SUPERTOUGH boards can be used
when there is no desk surface available, making
the board far more versatile than standard
flexible boards. These rigid boards can be used
for ‘Carpet Time’, out in the playground, on a
field trips, wherever, whenever.
85%
THICKER
ervoir:
r
85%
THICKER
85%
THICKER
85%
THICKER
SOLID
SUPERTOUGH
PLASTIC
SOLID
SUPERTOUGH
PLASTIC
SOLID
SUPERTOUGH
PLASTIC
PRICE
£2.89
£27.99
£2.89
£27.99
ens,
oner
Show-me® SUPERTOUGH Plain
Show-me® SUPERTOUGH Gridded
Show-me® SUPERTOUGH Lined
ORDER CODE DESCRIPTION
PACK SIZE
PRICE
ORDER CODE DESCRIPTION
PACK SIZE
52-9796 A4 Plain
52-9798 A4 Plain
Pack of 35 Sets
£73.99
Pack of 100 Sets £179.99
98-0806 A4 Lined
98-0808 A4 Lined
Pack of 35 Sets
£79.95
Pack of 100 Sets £194.99
PRICE
ORDER CODE DESCRIPTION
PACK SIZE
52-0779 A4 Gridded
52-9783 A4 Gridded
Pack of 35 Sets
£79.95
Pack of 100 Sets £199.95
PRICE
re-
Show-me® RIGID Boards
most
Why Rigid boards?
PRICE
£61.49
Rigid Show-me® boards can be used
when there is no desk surface available,
making the board far more versatile than
standard flexible boards. These rigid
boards can be used for ‘Carpet Time’,
out in the playground, on a field trips,
wherever, whenever. There are two
materials to choose from...
£61.49
RIGID
Show-me® MDF Plain
ORDER CODE DESCRIPTION
· The traditional, rigid lapboard
· Fully rigid board made of solid
MDF core with premium drywipe
surface on both sides
· Does not bend or flex - no desk
needed
· Strong, rigid whiteboards
manufactured from MDF
RIGID
Show-me® MDF Lined
PACK SIZE
34-9776 A4 Plain Drywipe Lapboards
10
34-9778 297 x 104mm Drywipe Flashcard 10
PRICE
£12.69
£8.95
ORDER CODE DESCRIPTION
34-9780 A4 Lined Drywipe Lapboards
RIGID
Show-me® MDF Gridded
PACK SIZE
10
PRICE
£13.64
ORDER CODE DESCRIPTION
PACK SIZE
52-9785 A4 Gridded Drywipe Lapboards 10
PRICE
£14.99
655
656 Stationery
EXPERT EDUCATIONAL™
HEAVY DUTY LAMINATOR
• Engineered for high volume use
• Ultra tough, heavy duty body and
chassis
• Very easy to use – unique operating
instructions label is displayed
on the front of the machine for
inexperienced users
• Anti-jam reverse button
• Ideal for high quality photo
lamination
• Fast, 4 roller machine laminates
550mm/minute
• Digital display for accurate
temperature selection
• Many built-in features, ensuring
that your lamination needs are
trouble free
• Efficient, variable temperature
laminating giving superior quality
finish with all pouches up to 500
micron (2x250)
• Comes with Expert Pouch Jacket
and Laminating Do’s and Don’ts
Guide
Education
ORDER CODE DESCRIPTION
34-9940
34-9942
Expert A3 Laminator
Expert A2 Laminator
Cristal
with St
This clever
Classic BiC
pen incorp
all your to
• No need
separate
take not
devices
• Black in
• Integral
• Supplied
OUR PRICE
£219.99
£324.99
Type
Cristal pen +
SMART
and Le
Stationery
17
These Stab
Touch-Scre
and those
ƁPIGTRTKPV
pen; the o
devices.
• Touch sc
tablet co
• The ultim
analogu
• Relaxed
grip zon
• Special
• Docume
• Line wid
• Clip can
• Pen des
Type
Right-Hande
Black/Cyan
Black/Kiwi
Black/Orange
Left-Handed
Black/Cyan
EXPERT POUCH JACKET
• The revolutionary new way to prevent laminator jams
• Insert your laminating pouch into the pouch jacket and start
laminating
• Recommended when laminating small or irregular shaped items
or when the pouch is not completely filled with your document
• Also recommended when using thin, lightweight laminating
pouches
• Made from a special lightweight, similar to saucepan coating
• Much more effective than traditional card carriers, which need
excessive heat to work effectively
• A3 size - for use with all A3 and A2 pouch laminators
• Durable – can be used over and over again
ORDER CODE DESCRIPTION
34-9944
656
Expert Pouch Jacket A3
OUR PRICE
£11.49
Tel: 01206 751166 Fax: 01206 751188
B
Cristal
A range of
quality sm
ƂQYKPIRNC
ballpoint p
with a ligh
hexagonal
that provid
• 5WKVCDNG
• Durable
not skip
• Medium
• Cap colo
Stationery 657
• 1.0mm tip gives a line width of 0.4mm
• Available in black, blue, red and green ink colours
• A security black version is also available with
Stylus Pens
•
•
Cristal Ball Pen
with Stylus
Type
Black (50)
Blue (50)
Red (50)
Green (50)
Security Black (50)
Black (90 + 10 FREE!)
Blue (90 + 10 FREE!)
This clever variation on the
Classic BiC Cristal Ballpoint
pen incorporates a stylus for
all your touch-screen devices.
• No need to hunt for a
separate stylus and pen to
take notes from your digital
devices
• Black ink
• Integral stylus
• Supplied in singles
1+
7.39
7.39
7.39
7.39
7.49
13.49
13.49
Orange Fine Writing Ball Point Pens
Order code 1+
34-7191 1.29
524984
SMARTball Right-Handed
and Left-Handed Pens
Cristal Large Fashion Colours
Ball Pens
Bic Large Cristal ballpoint pens with new funky
HCUJKQPKPM
• Funky colours - lime green, pink, purple and turquoise
• Large tip stick ballpoint with extra smooth ink
• Highly legible vivid lines
• Excellent writing quality
• Large point: 1.6mm, line width 0.6mm
• Hexagonal barrel for comfortable handling
• Clear tinted barrel for visible ink supply
• Cap and plug colour matches ink colour
• 8GPVKNCVGFECREQORNKCPVYKVJ+51
BS 7272-1 standard
• PVC free
• Available in assorted packs of 4 and boxes of 20
Type
Pack of 4
Box of 20
Order code 1+
34-7198 1.25
34-7199 3.69
525513
These Stabilo SMARTball Right-Handed and Left-Handed
Touch-Screen Pens are ideal for Smartphone owners
and those who love technology, but hate the unsightly
ƁPIGTRTKPVOCTMU1PGGPFKUCEQPXGPVKQPCNDCNNRQKPV
pen; the other end is a stylus for navigating touchscreen
devices.
• Touch screen pen for operating smartphones and
tablet computers
• The ultimate ballpoint pen, which connects the
analogue and digital worlds
• Relaxed writing comfort thanks to the ergonomic soft
grip zone
• Special versions for left- and right-handers
• Document-proof blue ink
• Line width 0.5mm
• Clip can be rotated 360°
• Pen design in 4 colour combinations
Type
Right-Handed
Black/Cyan
Black/Kiwi
Black/Orange
Left-Handed
Black/Cyan
Order code
1+
34-0023
34-0024
34-0025
3.99
3.99
3.36
34-0026
3.36
525097
Ballpoint Pens
Cristal Ballpoint Pens
A range of
quality smooth
ƂQYKPIRNCUVKE
ballpoint pens
with a lightweight
hexagonal barrel
that provides comfortable and controlled writing.
• 5WKVCDNGHQTUEJQQNUQHƁEGQTVJGJQOG
• Durable tungsten carbide ball writes consistently, will
not skip or blob
• Medium point
• Cap colour denotes ink colour
Type
Black
Blue
Red
Green
Order code
34-7204
34-7205
34-7206
34-7207
17
Stationery
$K%oUENCUUKE1TCPIGDCNNRQKPVRGPUKPCTCPIGQHEQNQWTU
• Fine point ball pens
• 'CUKN[KFGPVKƁGFD[VJGKTQTCPIGDCTTGNU
• 0.8mm tip produces line width of 0.35mm
• Cap and end plug match ink colour
• Available in black, blue, red and green ink
• Supplied in boxes of 20 of a single colour
Education
Type
Cristal pen + stylus
Order code
34-8076
34-8081
34-8086
34-8091
34-7138
34-7126
34-7128
080830
CE
99
99
tamperproof, waterproof and fadeproof ink, ideal for
UKIPKPINGICNCPFƁPCPEKCNFQEWOGPVU
Supplied in packs of 50
Black and Blue are also available in cost-effective
packs of 90 plus 10 FREE!
Pointball 79% Recycled
Ballpoint Pens
1+
3.39
3.39
3.39
3.39
524985
+++ BEST SELLER +++
Purple Round Stic Grip Ballpoint
Homework Assessment Pens
Research shows that comments written in red ink
can be perceived by students as like being shouted
at, demotivating, discouraging, upsetting, harsh,
confrontational, threatening, and could even be
TGURQPUKDNGHQTYGCMGPKPIVGCEJGTUVWFGPVTGNCVKQPU
Many educational authorities now recommend
that teachers no longer use red ink pens for pupil
assessment.
A less harsh colour like the ink in this Purple Round Stic
pen from BIC could be the perfect answer to the problem.
6JGRWTRNGKPMUVKNNUVCPFUQWVUWHƁEKGPVN[HTQODNCEMCPF
blue to be noticeable, but is much less likely to cause
distress or offence.
From the teacher’s point of view, the pen has a
comfortable grip-zone and smooth writing ink, both
bound to reduce the stress of marking endless homework
into the small hours.
• Purple ink
• Smooth writing
• Medium point 1mm
• Line width 0.4mm
• Slim barrel with cap and clip
• Comfortable grip zone
• Supplied in packs of 40
Type
Purple homework pen
Order code 1+
34-0327 6.49
530457
+++++++++++
A range of Stabilo Pointball 79% Recycled Ballpoint Pens
designed for environmentally-aware school children,
UVWFGPVUVGCEJGTUCPFQHƁEGYQTMGTU
• Manufactured from 79% recycled plastic
• $CNNRQKPVRGPKPVJGUV[NGQHVJGYQTNFHCOQWU56#$+.1
point 88
• Extremely soft ballpoint pen ink for fast writing
• Line width 0.5mm
• Non-slip grip zone
• Click retracting mechanism
• Available singly in Black, Blue, Green and Lilac
• Also available in an assorted wallet of 6 containing
Black, Blue, Green, Lilac, Red and Light Blue
Type
Black
Blue
Lilac
Assorted Wallet of 6
Order code
34-0032
34-0033
34-0035
34-0036
1+
0.99
0.66
0.88
5.95
525102
Exam Grade Ball Point Pen
Stabilo Exam Grade Ball Point Pens - the pens that won’t
let you down when you really need them.
6JG56#$+.1'ZCO)TCFGKUVJGDCNNRQKPVRGPHQT
GXGT[QPGYJQYCPVUVQEQOGQWVQPVQR
• Black ink
• 5OQQVJKPMƂQYHQTEQOHQTVCDNGYTKVKPI
• Designed for school children and students
• Especially for exam situations
• Line width 0.4mm
• Elastic grip zone for a relaxed hold
Type
Black Ballpoint
Order code 1+
34-0038 0.42
www.rapidonline.com sales@rapidonline.com
525103
657
658 Stationery
RVFM
No minimum order value
Premier Ballpoint Pens
Handw
EASYball Right-Handed
and Left-Handed Pens
UK mainland only
Energel XM Retractable Pen
#TCPIGQHSWCNKV[UOQQVJƂQYKPIRNCUVKEDCNNRQKPVRGPU
VJCVCTGUWKVCDNGHQTUEJQQNUQHƁEGQTVJGJQOG
• Solid silver nickel tip with tungsten carbide ball
• Finger grip area
• Medium point - line width 0.7mm
• Available in black, blue and red ink colours
• Supplied in packs of 20 of a single colour
Type
Black
Blue
Red
Order code 1+
34-8045 2.75
34-8050 2.75
34-8055 2.75
Education
074006
The best qualities of liquid ink and gel ink are blended
together by the Energel XM Retractable Pen into a superUOQQVJKPMFGNKXGTGFXKCCPGZENWUKXGKPMVKRVGEJPQNQI[
• Vivid, acid-free ink dries quickly without smearing or
blotting
• Great for left-handed writers
• 0.7mm medium metal tips
• Futuristic barrel accents indicate ink color
• Supplied in packs of 2
• Pentel type XBL77/2
Type
Black
RVFM
Order code 1+
34-5886 2.35
081074
5 Star Clear Ballpoint Pens
Stabilo EASYball Right-Handed and Left-Handed Pens
are great for school children aged 12 and over with high
standards.
• Available in left- and right-handed versions
• Document-proof blue ink
• 5KVURGTHGEVN[KPVJGJCPFCPFIWCTCPVGGUƂWKFYTKVKPI
with minimal pressure
• Innovative moulded grip provides stability, even when
the pen is twisted
• Tip disappears with one click
• Extremely soft and comfortable feeling whilst writing
• Pocket clip
• Line width 0.5mm
Type
Right-Handed
Dark Olive / Ice Blue
Left-Handed
Dark Olive / Petrol
4 Coloured Pens
Order code
1+
34-0021
2.99
34-0020
2.99
525095
Stationery
17
A range of plastic ballpoint pens that are suitable for
UEJQQNUQHƁEGQTVJGJQOG
• Shatterproof body
• Medium point
• Cap colour denotes ink colour
• 1.0mm tip gives a line width of 0.4mm
• Available in black, blue and red ink colours
• Supplied in packs of 50
Type
Black
Blue
Red
Order code 1+
34-8060 3.24
34-8065 3.24
34-8070 3.24
Premium Ballpens
High-quality Swash-branded ballpoint pens, ideal for use
in schools and colleges.
• Good quality, low-viscosity ink for blob-free
performance
• Ventilated caps and comfortable hexagonal barrel
• Premium tamper-resistant design prevents parts being
removed – ideal for use in schools and colleges
• Supplied in boxes of 50
Order code 1+
34-9820 2.83
34-9828 2.83
122426
EQNQWTUKPQPGRGP6JGUG%QNQWTUvDCNNRQKPV
RGPUHTQO$+%EQPVCKPOGFKWORQKPVTGƁNNUQH
different colours which can be selected by pressing the
appropriate coloured slider on the top of the pen. No
need for 4 different pens to add colour to your reports or
mark homework, etc. Ideal for commuters and other busy
people on the move.
• Choice of black, blue, red and green or pink, blue,
purple and green ink from one pen
• Medium point
• 1mm tip gives 0.4mm line width
• Supplied in packs of 12
Barrel
Black, Blue, Red, Green Ink
Blue
Purple, Blue, Pink, Green Ink
Purple
Order code
1+
34-7100
14.99
34-7106
18.99
517588
A variation on the classic BIC Cristal ballpoint pens,
these Cristal Grip pens have all the features of the
standard pens with the addition of a comfortable
cushioned zone for improved grip and comfort, even with
hot or wet hands.
• Cushioned grip
• Medium point 1mm tip produces a 0.4mm line width
• Cap and end plug matches ink colour
• Supplied in boxes of 20
Order code
34-7130
34-7132
34-7134
34-7136
1+
4.49
4.49
4.49
4.49
Handwriting Pens
658
Handw
These traditional Handwriting Pens have been specially
designed for educational use, but are also ideal for
IGPGTCNQHƁEGCPFJQOGWUG6JG[CTGCXCKNCDNGYKVJ
either black or washable blue ink. The hard wearing tips
CNNQYCUOQQVJWPKPVGTWRVGFƂQYQHKPMQPVQVJGRCRGT
while presenting the correct amount of resistance for
good letter formation.
• Smooth action
• Black or blue ink
• Blue ink is washable
• Available in packs of 10 and class packs of 200
Order code
34-1304
34-1306
34-1308
34-1310
1+
2.49
2.49
45.95
54.60
6JGUGƁDTG
can be left
• Availabl
• Availabl
• Suitable
Type
Pack 10 Blue
Pack 50 Blac
Pack 50 Blue
RV
Triangu
517221
EASYoriginal Right-Handed
Handwriting Pens
Stabilo EASYoriginal Right-Handed are ideal for those
learning to write and school children aged 6 and over.
Praised by teachers, approved by parents, loved by
EJKNFTGP
• A new interpretation of the fountain pen: an
ergonomically designed rollerball
• Grip zone made from non-slip material
• New larger cap protects the tip better and is less likely
to be lost
• Doesn’t blot or scratch
• All colour combinations feature a space for a name tag
• Relaxed hold whilst writing - prevents muscle fatigue
• Easy, comfortable handling means neat and tidy
handwriting
Type
Right-Handed
Blue/ Dark Blue
Orange / Anthracite
517594
Economy Handwriting Pens
Type
Blue - pack of 10
Black - pack of 10
Blue - pack of 200
Black - pack of 200
Medium Cristal Grip Pens
Type
Black (20)
Blue (20)
Green (20)
Red (20)
Type
Black pack o
Light blue pa
Black pack o
Light blue pk
Dark blue pa
RVFM
074009
Type
Medium black
Fine blue
These Bero
Handwritin
have hardplastic nib
are ideal f
developme
good hand
styles.
• Medium
- line wi
0.6mm
• Useful fo
helping
to devel
• Features
resistan
formulat
• Ventilate
• Washab
• Remova
• Availabl
• Availabl
• Suitable
Order code
34-0001
34-0003
1+
These handwriting pens have a durable tip that are ideal
for practising handwriting skills.
• Colours: black, blue and green ink
• Available in packs of 12 and class packs of 48
• Suitable for Key Stages 1 & 2 (ages 5 to 11)
Type
Pack 12 Black
Pack 12 Blue
Pack 12 Green
Pack 48 Black
Pack 48 Blue
Order code
06-6640
06-6642
06-6646
06-6648
06-6650
1+
4.49
4.49
4.49
17.99
17.99
079806
Order online
Save time, and place your order at:
www.rapidonline.com
3.95
4.39
24 hours a day
525093
Tel: 01206 751166 Fax: 01206 751188
These trian
designed t
handwritin
make the
specially d
resistance
cadence a
• Availabl
• Supplied
Type
Blue - pack o
Black - pack
KOMFI
Handw
Top-quality
RGPUYKVJ
triangular
posture.
• Washab
cap-off t
• Hardwea
resistan
Stationery 659
• Universal clear ventilated lids, so no frustration with
Gel Pens
different coloured caps
• High quality ink has virtually no bleed-through and is
Handwriting Pens
d Pens
with high
FYTKVKPI
en when
525095
These Berol
Handwriting pens
have hard-wearing
plastic nibs and
are ideal for the
development of
good handwriting
styles.
• Medium nib
- line width
0.6mm
• Useful for
helping children
to develop better writing control and letter formulation
• Features a hard wearing plastic tip, which has a slight
resistance to paper giving more controlled letter
formulation
• Ventilated safety cap
• Washable ink
• Removable from most non-porous surfaces
• Available with black, light blue or dark blue ink
• Available in packs of 12 or packs of 200
• Suitable for Key Stages 1 & 2 (ages 5 to 11)
Type
Black pack of 12
Light blue pack of 12
Black pack of 200
Light blue pk of 200
Dark blue pack of 200
Order code
06-0344
06-7766
06-7768
06-7770
06-0555
1+
3.89
3.89
59.99
59.99
69.99
Type
Pack of 12 blue
Pack of 12 black
Order code 1+
34-9808 3.29
34-9810 3.29
122417
KOMFIGRIP™
Organiser
Innovative classroom
organiser with 6
brightly coloured
removable triangular
pots and a convenient
carry handle.
• Each organiser
comes complete
with top
quality Swash
-1/(+)4+2v
handwriting pens
• Available in blue ink
Type
Pack of 180 blue
Order code 1+
34-9816 39.95
122424
071808
Many educational authorities now recommend that
teachers no longer use red ink pens to mark students’
work because research shows that comments in red ink
can be seen by students as discouraging, upsetting,
harsh, confrontational, threatening, like being shouted at,
and can even be responsible for weakening teacherUVWFGPVTGNCVKQPU
A much calmer colour like this Violet Energel pen from
Pentel provides the perfect solution. It still stands out
HTQODNCEMCPFDNWGKPMUWHƁEKGPVN[VQDGPQVKEGCDNG
while being much less likely to cause offence or distress.
The pen is also kind to teachers, with the comfortable
grip and smooth writing ink bound to reduce the stress of
marking endless homework into the small hours.
• Violet ink
• Smooth writing
• Quick drying
• Comfort grip
• Medium line width - 0.7mm
• Pentel type BL117W-V
Type
Homework pen - violet
Order code 1+
06-0279 0.87
530135
Handwriting Pens
pecially
for
YKVJ
ring tips
JGRCRGT
ce for
Gel Writers
6JGUGƁDTGVKRJCPFYTKVKPIRGPUJCXGCFWTCDNGRQKPVCPF
can be left uncapped for days without drying up.
• Available in black and blue
• Available in packs of 10 or packs of 50
• Suitable for Key Stages 1 & 2 (ages 5 to 11)
Type
Pack 10 Blue
Pack 50 Black
Pack 50 Blue
Order code 1+
06-6800 6.54
06-6802 23.59
06-6804 21.75
079755
200
RVFM
Triangular Handwriting Pens
517221
Excellent value classtrays of 300 handwriting pens.
• Washable ink with 14-day cap-off time
• Hardwearing pressure-resistant tips
• Universal clear ventilated lids, so no frustration with
different coloured caps
• High quality ink has virtually no bleed-through and is
rapid drying - ideal for left-handed users
• Excellent value classtrays of 300 pens
• Tray made from 80% recycled corrugated board with
HQNFFQYPECTT[JCPFNGUHQTGCU[RQTVCDKNKV[
ƁVUKPVQ
Gratnell’s tray if required)
Type
Classtray of 300 blue
17
Stationery
Classtrays
Teacher’s Homework Pen
EnerGel 0.7mm Violet Ink
Education
writing
rapid drying - ideal for the left handed
These smooth Edding gel roller writing pens have metalframed tips and a comfortable rubber grip zone.
• Water-based gel ink
• Width of stroke: approx. 0.7mm
• Available in black, blue, red and green
• Supplied in packs of 10
Type
Black
Blue
Red
Green
Order code
34-5816
34-5818
34-5820
34-5822
1+
5.69
5.69
5.69
5.69
080951
BeGreen Super Gel Pens
Order code 1+
34-9812 64.99
122421
are ideal
48
These triangular bodied handwriting pens have been
designed to assist in the creation of better and effortless
handwriting skills. The triangular shape and grip zone
make the pens more comfortable and controllable. The
specially designed tips allow just the right amount of
resistance across the paper to develop the correct writing
cadence and aids letter formation.
• Available with blue or black ink
• Supplied in packs of 12
Type
Blue - pack of 12
Black - pack of 12
Order code 1+
34-1312 2.69
34-1314 2.69
517222
079806
r at:
m
KOMFIGRIP™
Handwriting Pens
Top-quality handwriting
RGPUYKVJ-1/(+)4+2v
triangular grip for correct
posture.
• Washable ink with 14 day
cap-off time
• Hardwearing pressureresistant tips
Calligraphy Pens
Edding 1255
Calligraphy Pens, in
sets of three stroke
widths, in a range
of ink colours. Each
wallet contains a
2mm, 3.5mm and
a 5mm pen in a
single colour. The
ink is pigmented,
permanent and is
very lightfast and
waterproof on almost
all surfaces.
• Calligraphy Pens in sets of three stroke widths
• Range of ink colours
• Each wallet contains a 2mm, 3.5mm and a 5mm pen
in a single colour
• Ink is pigmented, permanent and is very lightfast and
waterproof on almost all surfaces
• Supplied in packs of 3 of a single colour
Type
Black
Order code 1+
06-9299 2.99
This unique ink injection gel stick pen provides the user
with a smooth writing experience.
93.3% recycled material.
• Available in black or blue ink
• Supplied in packs of 10
Percentage refers to rate of recycled material excluding
replaceable parts.
Type
Black
Order code 1+
34-5614 5.79
079787
Page 642
A4 Exercise
Book
Ruled 8mm
& Margin
80 Page
Red
Box of 50
516970
www.rapidonline.com sales@rapidonline.com
659
660 Stationery
Education
Energel Plus Liquid Gel Ink Pens
Bionic Worker Rollerball Pens
The EnerGel Plus range from Pentel are smooth writing
liquid gel ink pens. The writing instrument has a 0.7mm
metal ball tip that gives an approximate 0.35mm
medium line width and the ink lasts longer than ordinary
gel compared to standard gel ink pens.
Additional features such as quick drying ink (ideal
HQTNGHVJCPFGFWUGTUITQQXGFTWDDGTƁPIGTITKRCPF
extra-strong pocket clip make these pens ideal for all
occasions.
• Available with black, green and violet ink
• Stylish metallic silver look barrel with colour-accent
• Contains 53% recycled material
• Supplied in packs of 12
Type
Black
Green
Violet
Order code 1+
34-5937 11.95
34-5939 11.95
34-5935 11.95
Bionic Worker Rollerball Pens are
designed for professional, demanding
users with particularly high usage
requirements, who rely on their pen to
give its best at all times.
• High quality rollerball with nickelsilver tip for extremely smooth
performance
• Latest bionic ink technology
• Ergonomic design with non-slip
surface over entire length
• Distinctive bright orange colour
scheme
• Promotes relaxed, fatigue-free
writing
• Assorted wallet of 4 contains 1
each of black, blue, red and green
• Black supplied in wallets of 10
Type
Assorted pack of 4
Black pack of 10
Order code 1+
34-9028 6.11
34-9084 14.73
079323
06-6284
Type
Wallet of 6
Wallet of 10 (A)
Wallet of 25
Rollerset (25)
06-6286
•
•
•
•
•
•
•
•
•
•
•
•
•
•
•
•
Order code
06-6284
06-6286
06-6290
06-6292
06-6290
•
•
•
•
•
•
•
•
•
•
•
•
•
•
•
•
•
•
•
•
•
•
•
•
•
06-6292
•
•
•
•
•
•
•
•
•
•
•
•
•
•
•
•
•
•
•
•
•
•
•
•
•
1+
2.49
3.59
8.78
8.95
Gel
Rollerball Pens
6JG'FFKPI
with a met
RTQFWEGC
• Fineline
• Metal-fr
• Water-b
• 2TQFWEG
• Supplied
Type
Black
Red
Blue
Green
079302
Edding
Point 88 Neon Colour Fineliner Pens
These Edd
drawing, s
They have
based Bla
• Ink colo
• Line wid
• Supplied
PointVisco
Stabilo Point 88 Neon Colour
Fineliner Pens are the universal
PGQPƁPGNKPGTHQTUEJQQN
children to professionals.
• Europe’s number one
ƁPGNKPGT
• Unmistakable hexagonal
striped design
• Metal-enclosed tip for a long
lifespan
• Suitable for use with rulers
and stencils
• Long cap-off time
• Ventilated cap
• Supplied in a wallet of 5
bright neon colours
Rollerball pens with a new gel
formulation for faster, smudge and
blot-free writing.
• New interpretation of the classic
Point88 pen
• Non-slip grip zone
• Pocket clip
• Robust tip
• Supplied in a wallet of 4
containing black, blue, red and
green
Gel pens with stylish metallic-look chunky barrels.
• 5OQQVJTWDDGTƁPIGTITKR
• 6TCPUNWEGPVEQNQWTƁPKUJ
• Metal pocket clip
• 1.0mm tip gives approx. 0.5mm line width
• Available in Black, red and blue
• Pentel type BL60
Type
Black
Red
Blue
Order code 1+
34-5936 1.11
34-5938 1.59
34-5940 1.59
Type
Fineliner Blac
'FFKPI
081157
Type
Wallet of 4
Rollerball Pens
Order code 1+
34-9032 3.19
079325
Type
Neon Wallet of 5
Order code 1+
34-0037 1.99
525105
Fineliner Pens
FriXion Erasable Rollerball Pens
Point 88 Fineline Pens
This unique pen erases cleanly by friction-generated heat
and leaves no debris. It then uses the same ink to write
and over-write.
• Unique erasable ink, the ink erases cleanly from
friction-generated heat
• Eraser on end of pen
• 9TKVG&GNGVG4GRGCV
• Tungsten carbide tip for precise, blob-free writing
• Soft rubber grip for comfort without slippage
• 4GƁNNCDNGGEQPQOKECNGPXKTQPOGPVHTKGPFN[
• High durability erasing stud that leaves no debris and
does not need replacing
• Available in Black, Red and Blue ink
• Supplied in packs of 12
Type
Black
Red
Blue
Order code 1+
34-5686 19.99
34-5688 19.99
34-5690 19.99
079802
Phone
01206 751166
660
'FFKPI
500660
17 EnerGel Xm Pens
Stationery
6GEJPKECNURGEKƁECVKQP
Colour
Ice green
13
Nightblue 22
Apricot
26
Ultramarine 32
Apple green 33
Green
36
Red
40
Blue
41
Leaf green 43
Yellow
44
Brown
45
Black
46
Crimson
50
Turquoise 51
Pine green 53
1TCPIG
54
Violet
55
Pink
56
Azure
57
Lilac
58
Light lilac 59
1NKXGITGGP 63
Dark ochre 89
Light grey 94
Dark grey
96
Type
0.25mm
0.35mm
0.5mm
Sensor Fineliner Pens
*KIJSWCNKV[ƁPGNKPGTRGPUYKVJCVVTCEVKXG
aluminium look.
• Metal-encased tip withstands writing
pressure
• Well suited for use with a ruler
• Fine (0.3mm) tip widths
• Black, blue, red and green
• Supplied in assorted wallets of 4
Type
ƁPG
F
All-in-O
Founta
Order code 1+
34-9038 2.85
079326
Page 283
#WPKXGTUCNƁPGNKPGTRGPUWKVCDNGHQTCNNWUGTUHTQOUEJQQN
children to professionals.
• 25 brilliant colours
• 0.4mm tips
• Metal-enclosed tip for long life
• Suitable for use with rulers and stencils
• Long cap-off time without drying up
• Ventilated safety caps
• Available in a range of sets
Alphabet
Stencil
Set (Upper
and lower
cases)
Tel: 01206 751166 Fax: 01206 751188
'FFKPI
and are id
ƁPGUMGVEJ
• Waterpr
• Fine writ
• Availabl
$K%oU#NNKP
Disposabl
to go as so
needs no
TGƁNNKPI
• Disposa
ƁNNGFYKV
• Stainles
• Does no
cartridge
• Long las
• Supplie
Type
Disp. Fountai
Stationery 661
06-6292
•
•
•
•
•
•
•
•
•
•
•
•
•
•
•
•
•
•
•
•
•
•
•
•
•
Disposable Fountain Pens
containing 1 each of yellow, orange, green and pink
Type
Yellow
Assorted Wallet of 4
525101
6JG'FFKPI1HƁEG.KPGT2GPUCTG(KPGNKPGTYTKVKPIRGPU
with a metal-framed round tip and water-based ink that
RTQFWEGCƁPGOONKPG
These disposable fountain pens have a medium nib and
• Fineliner writing pens
are ideal for right or left handed people.
• Metal-framed round tips
• Available with black, red or blue ink
Water-based
ink
•
• Precision made alloy nib, suitable for right or left
• 2TQFWEGƁPGOONKPGU
handed use
• Supplied in packs of 10 of a single colour
• +PMƂQYEQPVTQNNGTGPUWTGUCEQPUKUVGPVKPMUWRRN[
Type
Order code 1+
• Erasable ink using an ink eradicator
Black
06-9290 4.25
• Ink reservoir window
Red
06-9291 4.25
• Pure liquid ink for a smooth, dense and long lasting ink
Blue
06-9292 4.25
• ‘Air tight and through’ cap (pat) to ensure the tip is
Green
06-9293 4.25
always ready to use with no blotching
516967
• Supplied in packs of 12
Type
Black
Red
Blue
Edding 55 Fineliner Pens
Order code 1+
34-5698 22.99
34-5700 22.99
34-5702 22.99
079804
r Pens
Order code 1+
06-0273 0.79
Highlighters
Mini Highlighter Pens – Tub of 50
Boss Original Highlighter Pens
The original classic
highlighter pen.
• Water based ink for
paper, copy or fax
• Long cap-off time
without drying out
• Assorted wallet of 4
contains yellow, green,
orange and pink
• Assorted wallet of
6 also contains blue
and red
• Assorted wallet of 8
also contains turquoise and lilac
• Also available in red packs of 4
'FFKPI2TQƁRGP(KDTGRGPUWUGYCVGTUQNWDNGKPM
and are ideal for writing, signing documents and creating
ƁPGUMGVEJGUCPFVGEJPKECNFTCYKPIU
• Waterproof, fade-resistant pigment black ink
• Fine writing tip in metal holder
• Available in a range of thicknesses
521586
Fountain Pens
50 superb value mini highlighters in a handy tub with a
screw-top lid.
• Length approx. 90mm
• Wedge tip for producing thin or thick lines
• Water-based bleed-resistant ink
• Suitable for use on paper, photocopies and faxes
• XKDTCPVEQNQWTU2KPM1TCPIG;GNNQY)TGGPCPF$NWG
• Supplied in an assorted colour tub of 50
Type
Mini highlighter pens
Order code 1+
98-0121 12.99
528351
All-in-One Ready-to-Use Disposable
Fountain Pen
079326
$K%oU#NNKP1PG4GCF[VQ7UG
Disposable Fountain Pen is ready
to go as soon as you get it and it
needs no ink cartridges or messy
TGƁNNKPI
• Disposable fountain pen preƁNNGFYKVJ$NCEMKPM
• Stainless steel medium nib
• Does not require an ink
cartridge
• Long lasting
• Supplied singly
Type
Disp. Fountain Pen
Green Boss 83% Recycled
Highlighters
Order code 1+
34-7208 1.29
524986
17
Order code 1+
34-9040 2.99
079327
'FFKPI2TQƁRGP(KDTGRGPU
Order code 1+
51-1142 2.64
51-1143 2.64
51-1144 1.41
A mini version of the classic
Boss original highlighter pens.
• Same high quality
workmanship
• %QORCEVFGUKIPƁVUKPVQ
smallest pockets and pencil
cases
• Water based ink for paper,
copy or fax
• Long cap-off time without
drying out
• Yellow, blue, green, orange
and pink
• Supplied as an assorted
pack of 5
Type
Boss Minipop
525438
Type
0.25mm
0.35mm
0.5mm
Boss Minipop Highlighter Set
Stabilo Green Boss
83% Recycled
Highlighters have
been designed with
environmentallyaware school
children, students,
VGCEJGTUCPFQHƁEG
workers in mind.
• Manufactured
from 83% recycled
plastic
• Anti-Dry1WVVGEJPQNQI[JQWTUFT[QWVRTQVGEVKQPHQT
concentrated work
Type
Wallet of 4 assorted
Wallet of 6 assorted
Wallet of 8 assorted
Wallet of 4 red
Order code
34-9042
34-9044
34-9046
34-9052
Stationery
These Edding 55 Fineliner Pens are ideal for writing,
drawing, sketching and line illustrations.
They have metal-framed plastic tips dispensing waterbased Black ink.
• Ink colour: Black
• Line width approx. 0.3mm
• Supplied in singles
Type
Fineliner Black
525105
Order code 1+
34-0030 0.73
34-0031 2.95
Education
079302
'FFKPI1HƁEG.KPGT2GPU
• Highlights for approx. 375m
• Water-based ink
• Two line widths: 2 & 5mm
• Available singly in yellow and in a 4-colour wallet
1+
2.45
3.79
4.92
2.45
079328
Luminator Highlighter Pens
Highlighter pens with larger
ink capacity for heavy usage
applications.
• Ideal for frequent users
• Ink level indicator
• Water based ink for paper,
copy or fax
• Uniform application without
fading, right down to the
last drop
• Assorted wallet of 4 contains
yellow, green, orange and pink
Type
Wallet of 4
Order code 1+
34-9054 6.29
079329
Free Delivery*
on all orders over £30 (excl. VAT)
(UK mainland only)
* See Terms & Conditions for full details
www.rapidonline.com sales@rapidonline.com
661
662 Stationery
Type
Pack of 10 assorted
Yellow
Violet
Pack of 48 assorted
Swing Cool Highlighter Pens
Education
Attractively styled pocket
highlighter pens with a cool
glossy and striped look.
• Ideal for fashion-conscious
school children and students
• Flat pocket-sized with
practical clip
• Glossy striped look
• Water based ink for paper,
copy or fax
• Ventilated cap
• 0QPUNKROCVVƁPKUJITKR\QPG
• Assorted wallet of 4
contains yellow, blue, green
and pink
• Assorted wallet of 6 also contains royal blue
and orange
Stationery
17
Type
Wallet of 4
Wallet of 6
Order code
34-9854
34-9856
34-9864
34-9870
1+
3.69
3.19
3.19
17.99
Correction Pen
122443
Correction
Type
Correction pen
Highlighter pens with larger
ink capacity for heavy
usage applications, in an
attractive and ergonomic
desk stand.
• Ideal for frequent users
• Ink level indicator
• Water based ink for
paper, copy or fax
• Uniform application
without fading, right
down to the last drop
• Set of 4 contains yellow,
green, royal blue and pink
This correction roller has
a ultra-smooth dry white
tape the covers mistakes
instantly. A thumb grip and
TWDDGTƁPIGTRCFIWCTCPVGG
maximum accuracy and
EQOHQTV1PEGCRRNKGFVJG
tape is ready immediately for
re-writing.
Type
0.5mm Walle
0.5mm Walle
1mm Wallet o
1mm Wallet o
Overhe
6JKUXCNWGRCEMKPNEWFGUDQVVNGU(4''
Tipp-Ex Rapid Correction Fluid has a quick drying time
for easy re-writing. The unique wedge-shaped foam
applicator makes application very precise and gives
superb coverage.
• Quick-drying formula - ideal for all types of paper
• *KIJSWCNKV[EQTTGEVKQPƂWKF
• Foam wedge applicator for precise and clean use
• Value pack of 15+5 20ml bottles
Order code 1+
34-9058 7.29
079338
Type
Value pack 15+5x 20ml
Boss Original Highlighter Pens
Class Pack
Correction Fluid
The original classic
highlighter pen.
• Water based ink for
paper, copy or fax
• Long cap-off time
without drying out
• Assorted class pack
of 48 contains 24x
yellow, 6x green, 6x
blue, 6x orange and
6x pink
Type
Correction roller
Order code 1+
34-9372 1.48
079923
10m Pocket Mouse – Box of 10
Order code 1+
34-7218 14.99
524991
6JKUEQTTGEVKQPƂWKFKUUWKVCDNGHQTPGCTN[
all surfaces and the unique quick-drying
formula covers most everyday inks
inlcuding handwriting, laser print, inkjet
text, faxes and photocopies.
• Contains 20mlƂWKF
The Tipp-Ex Pocket
Mouse dispenses
high coverage tape
for correcting writing
errors. The translucent
mouse-shaped body
holds 10m of 4.2mm
wide tape that can be written on straight away.
A protective cap helps prevent damage to the tip.
• Tear-resistant polyester backing tape
• Hinged tip protector cap
• Supplied in display boxes of 10
Type
10m Pocket Mouse (10)
Lumocolou
inks speci
QH1*2ƁNO
• Projects
and drie
• Line wid
• Permane
• Availabl
6GEJPKECNURGE
Type
Permanent Ink
Permanent Ink
Order code 1+
34-7186 18.79
517603
Order code 1+
34-9082 27.49
079339
Type
%QTTGEVKQPƂWKF
Order code 1+
34-9374 0.39
These top quality
vibrant coloured
highlighter pens
have a wedge tip
for producing thin
or thick lines.
• Waterbased
bleed-resistant
ink
• Handy pocket
clip
• Available in packs of 10 of a single colour,
or assorted packs of 10 or 48
• Assorted pack of 10 contains: 2x yellow, 2x orange,
2x green, plus 1 each of red, blue, violet and red
• Assorted pack of 48 contains 6 each of yellow,
orange, pink, purple, dark green, light green, red
and blue
Correct Express 7ml
Pentel has developed an innovative correction ink with
CPGYHQTOWNCYJKEJFTKGUKPUVCPVN[CPFRTQXKFGUCƂCV
surface for easy re-writing. Using the advanced Easy
Evaporating SystemVJGEQTTGEVKQPƂWKFFTKGUKPJCNHVJG
VKOGQHEQPXGPVKQPCNEQTTGEVKQPƂWKF
• Even evaporating system
• 2TQXKFGUCƂCVUWTHCEGHQTYTKVKPIQP
• Can be written over immediately
• 'TIQPQOKECNN[UJCRGFDQVVNGHQTRTGEKUGƂWKFEQPVTQN
• Bottle capacity 7ml
Type
Correct express
Type
4 Permanent
8 Permanent
5m Mini Pocket Mouse – Box of 10
079924
662
6JGUGRGTO
SWKEMFT[KP
• Bright, v
• 2QN[GUVG
• $GUVHQT
• #XCKNCDN
• Supplied
Mini Correction Roller
Order code 1+
34-9066 2.34
34-9068 3.49
Premium Highlighters
Order code 1+
34-9370 0.69
079922
Luminator Desk Set
Type
Class pack of 48
Perma
Rapid Correction Fluid Value Pack
079332
Type
Desk set
This
correction
pen with
extra fast
FT[KPIƂWKF
is ideal for accurate corrections.
• Contains 7mlQHƂWKF
Order code 1+
34-9371 1.49
500664
The compact Tipp-Ex
Mini Pocket Mouse
dispenses high
coverage correction
tape for your little
writing errors. The
fun, transparent
mouse-shaped body
holds 5m of 5mm wide tape that can be written on
straight away.
• Paper-based backing tape
• Supplied in display boxes of 10
Type
5m Pocket Mouse (10)
E-140
Order code 1+
34-7188 12.99
517604
Fast Delivery
All orders for in-stock items received
by 7pm – Monday to Friday
are despatched the same day
Tel: 01206 751166 Fax: 01206 751188
Edding E-1
QP1XGT*G
as glass, s
dispensing
• Colours:
• Line wid
• Supplied
• Edding
Type
OHP pens (4)
Stationery 663
OHP Markers
Whiteboard Markers
•
Permanent OHP Markers
•
•
Teacher Whiteboard Markers
•
•
079922
Type
0.5mm Wallet of 4
0.5mm Wallet of 8
1mm Wallet of 4
1mm Wallet of 8
Order code
06-1024
06-1026
06-1028
06-1030
1+
3.27
6.27
2.85
6.27
Full size drywipe markers ideal for use by teachers.
• Bullet tip with xylene-free, low odour ink
• Ventilated caps for maximum safety
• 24 hour cap-off time to prevent drying out
• Available in packs of 4, 10 or 50
• Pack of 4 assorted colours: black, blue, red and green
Type
Pack of 10 black
Classpack of 50 black
Pack of 4 assorted
Order code 1+
34-9794 3.89
34-9796 15.99
34-9798 1.89
fresh supply of liquid ink, right to the last drop, giving
long-lasting value, out performing standard types
Unique push-button pump operation allows the ink
supply to be refreshed as required and restores the tip
even when the cap has been temporarily left off
Ink simply wipes off whiteboards with a dry cloth
Available in packs of 4 assorted colours, 1
each: black, blue, red and green, or as a set of 4
(conveniently housed in a whiteboard eraser)
Also available singly
Pentel types YMWL5M-4, MWL5M-4E, MWL5M-A,
MWL5M-B, MWL5M-C and MWL5M-D
Type
Single black
Single blue
Single red
Single green
Set of 4 assorted markers
4 markers with eraser
Set of 4 and eraser
Order code
34-5416
34-9964
34-9968
34-9966
34-5418
06-0297
34-5417
1+
1.86
1.47
1.47
1.47
5.22
5.99
5.63
061103
Education
6JGUGRGTOCPGPV1*2OCTMGTUCTGJGCVTGUKUVCPVYKVJ
SWKEMFT[KPIKPMVJCVNGCXGUPQTGUKFWGQPƁNOUQTJCPFU
• Bright, vivid colours that project clearly
• 2QN[GUVGTƁDTGVKR
• $GUVHQTWUGQPRTQLGEVKQPƁNO
• #XCKNCDNGKPOOƁPGNKPGQTOOOGFKWONKPG
• Supplied in wallets of 4 and 8
Jumbo Drywipe Board Markers
122409
071607
Velleda 1701 White Board Markers
Big, broad markers producing
bold strokes for effect.
• Particularly well suited for
headings and underlining
• For use on whiteboards
CPFƂKREJCTVU
• Easily removed from all
whiteboard surfaces
• Black, blue, red and green
• Supplied in an assorted
pack of 4
Type
Jumbo board markers
17
Order code 1+
34-5846 10.95
080957
Stationery
Overhead Projector Pens
079923
0
Lumocolour overhead projection pens contain translucent
inks specially formulated for use on the smooth surface
QH1*2ƁNO
• Projects a clear line image, does not bleed or feather
and dries in seconds
• Line width 0.8-1.0mm
• Permanent ink (317 series)
• Available in sets of 4 and 8 colours
p.
6GEJPKECNURGEKƁECVKQP
Type
Permanent Ink
Permanent Ink
517603
Colours
1TFGTEQFG
Red, blue, green and black34-1875
Red, blue, green, black,
violet, orange, yellow
34-1880
and brown
These BiC Velleda 1701 White Board Markers use a low
odour, alcohol-based ink and are available in black, blue,
red and green.
• Low odour, alcohol-based ink
• Tough tip will not bend or retract under pressure
• Good erasability immediately and after a few days
• Acrylic bullet tip produces line width of 1.5mm
• Available in black, blue, red and green in boxes of 12
• An assorted pack of 4 is also available
Type
Assorted pack of 4
Black box of 12
Blue box of 12
Red box of 12
Green box of 12
Order code
34-7210
34-7211
34-7212
34-7213
34-7214
Whiteboard Markers
1+
2.39
6.99
6.99
6.99
6.99
524988
Type
Order code 1+
4 Permanent ink OHP pens 34-1875 3.59
8 Permanent ink OHP pens 34-1880 7.09
029096
/CZKƂQ.KSWKF+PM9JKVGDQCTF
Markers
of 10
E-140 S OHP Marker Set – 4x 0.3mm
Whiteboard markers with 5mm chisel tips.
• Cap can be left off for 48 hours without drying out
• Dense colours
• Low odour
• Suitable for electronic whiteboards
• Easily wiped with cloth, tissue or Artline erasers
• Pack of four contains blue, black, red and green
• Pack of six also contains orange and brown
Type
W/board markers pk of 4
W/board markers pk of 6
Order code 1+
34-8035 4.94
34-8040 7.28
073771
Page 633
n on
517604
eived
y
• 7UGU2GPVGNoU/CZKƂQNKSWKFKPMU[UVGOVQRTQXKFGC
Edding E-140 S markers are especially made for writing
QP1XGT*GCF2TQLGEVQT
1*2VTCPURCTGPEKGUCUYGNN
as glass, slide frames, etc. The markers have round tips
dispensing brilliant coloured permanent, waterproof ink.
• Colours: Black, Red, Blue, Green
• Line width: 0.3mm
• Supplied as a set of 4
• Edding type E-140 S
Type
OHP pens (4)
Order code 1+
57-4582 3.02
545225
Metroplan Lola
Reception
Furniture
A range of high quality whiteboard markers with bullet
tips and a unique push-button pump that allows the ink
supply to be refreshed as required even when the cap
has been temporarily left off.
www.rapidonline.com sales@rapidonline.com
663
664 Stationery
Retract 12 Retractable Whiteboard
Marker Pens
Education
BeGreen V Board Markers
Stationery
17
These innovative board markers require no pumping, no
shaking and do not leak. With replacement cartridges
available these are the only board markers you will ever
need.
• Dry wipe whiteboard ink
• Unique twin pipe feeder that requires no pumping or
shaking
• 5OQQVJCPFEQPUKUVGPVKPMƂQY
• 2WTGNKSWKFKPMECTVTKFIGTGƁNNU[UVGORTQXKFGUUWRGTKQT
brightness and contrast
• 3WKEMVQTGƁNNQPN[VCMGUUGEQPFU
• Made from 91% of recycled plastic
• Markers are supplied in packs of 10
• 4GƁNNUCTGUWRRNKGFKPpacks of 12
• Classpack contains 30 markers and TGƁNNU
Type
Black
Red
Blue
Green
Orange
4GƁNNU$NCEM
4GƁNNU4GF
4GƁNNU$NWG
4GƁNNU)TGGP
4GƁNNU1TCPIG
Classpack
Order code
34-5704
34-5706
34-5708
34-5710
34-5712
34-5714
34-5716
34-5718
34-5720
34-5722
34-5724
1+
9.99
9.99
9.99
9.99
9.99
8.99
8.99
8.99
8.99
8.99
45.95
The Edding Retract
12 is a Retractable
Whiteboard Marker
Pen with a pushbutton mechanism
for single-handed
operation. The tip is
revealed by simply
pressing the pushbutton at the end
of the marker and
retracted by pressing
the catch in the clip or by raising the clip slightly.
A retractable seal system prevents the marker from
drying out when the tip is retracted.
• Line width 1.5mm
• Retractable
• 4GƁNNCDNG
• Push-button mechanism for single-handed operation
• Retractable seal system
• Assorted pack of 4 contains 1 each of black, blue,
red and green
• Black also available separately in packs of 10
Type
Assorted Pack of 4
Black Pack of 10
Order code 1+
06-9284 6.49
34-5826 14.89
These round-tipped Berol
drywipe marker pens are
ideal for both teachers and
children to use on nonabsorbent whiteboards.
• 2mm line width
• Colour-coded caps for easy
EQNQWTKFGPVKƁECVKQP
• Toughened tips
• Low odour
• Easy to clean
• Suitable for use on most
non absorbent dry wipe
boards
• Available in Black, Blue
and Assorted inks
• Available in packs of 8, 12, 48 and 96
Whiteboard Markers
High quality whiteboard markers with a choice of tip style.
• No xylene or toluene
• Available in black, red and blue
• Pentel types MW85 (bullet), MW86 (chisel)
Tip style
Bullet
Bullet
Bullet
Chisel
Chisel
Chisel
Colour
Black
Blue
Red
Black
Red
Blue
Order code
34-5874
34-5892
34-5890
34-5876
34-5894
34-5896
1+
0.59
0.54
0.54
0.59
0.54
0.54
Order code
06-9279
06-9278
06-9310
06-9280
1+
4.49
10.99
18.99
18.99
516964
Type
$NCEMƁPGRCEMQH
$NCEMƁPGRCEMQH
Black broad pack of 12
Black broad pack of 200
Order code
34-9474
34-9476
34-9478
34-9446
1+
5.79
66.95
5.85
69.99
080173
Slim Barrel Drywipe Pens
081070
1+
6.59
6.59
19.95
4.99
19.95
44.95
These Staedtler
whiteboard pens
are equipped with
bullet tips and have
instant drying, special
pigmented ink which
is easily removed.
Ideal for small
whiteboards, year
planners and surfaces
such as glass and
porcelain, these markers produce a line width of 1.0mm.
• Supplied in packs of 6 (red, blue, green, black, orange
and violet)
Order code 1+
34-2725 6.94
029247
These chisel tip drywipe marker pens are ideal for
teachers and children.
• 2mm and 5mm line width
• Ideal for teachers and pupils
• Suitable for use on most non absorbent dry wipe
boards
• Available in black, blue and assorted coloured packs
Type
Black pack of 12
Blue pack of 12
Black pack of 48
Assorted pack of 8
Assorted pack of 48
Order code
34-9462
34-9464
34-9466
34-9470
34-9468
1+
6.59
6.59
22.95
5.19
22.95
080171
'ZEGNNGPVX
slim drywi
• Premium
resistan
• Supplied
ENGCPGT
• #XCKNCDN
Type
Pack of 200
2CEMQH
Velleda
BIC Velled
alcohol-ba
and good
days. Their
don’t bend
• Acrylic b
• Availabl
assorted
• Class pa
orange,
• BIC type
Type
Black (24)
Blue (24)
Green (24)
Red (24)
Class pack 7
Drywipe Marker Pens with Chisel Tips
Lumocolor 351 Whiteboard
Marker Pens
664
Type
Assorted pack of 4
Black pack of 10
Assorted pack of 50
Black pack of 50
These versatile pens have ink coloured caps for easy
EQNQWTKFGPVKƁECVKQPVQWIJGPGFVKRUNQYQFQWTCPFCTG
easy to clean. Suitable for use on most non absorbent
dry wipe boards.
• Available with black or assorted inks
• Assorted packs of 8 contain black, blue, green, red,
yellow, orange, purple and brown
• $NCEMCXCKNCDNGYKVJƁPGQTDTQCFVKRUKPpacks of 12
or 200
080170
Type
6 colour pen set
Classt
Edding 361 Board Markers have bullet tips and produce
1mm thick lines. They use low-odour pigment ink and
CTGTGƁNNCDNG
• Bullet tips
• Produce 1mm thick lines
• Low-odour pigment ink
• 4GƁNNCDNG
• Black pens are available in packs of 10 and 50
• Assorted packs of 4 and 50 are also available
Drywipe Pens
Drywipe Whiteboard Marker Pens
Round Tip
Order code
34-9452
34-9454
34-9456
34-9460
34-9458
06-0567
Edding 361 Board Marker Pens
516966
079805
Type
Black pack of 12
Blue pack of 12
Black pack of 48
Assorted pack of 8
Assorted pack of 48
Assorted pack of 96
Fine tip
#UUQTVGFƁPG
$NCEMƁPG
$NCEMƁPG
These Show-me drywipe markers have a slim barrel
making them ideal for smaller hands.
• Developed especially for pupils
• 24 hour cap-off time prevents drying out
• Extra-hard nib – will not quickly splay out
• Internal nib-stop prevents tip from being pushed back
• Low odour xylene-free ink
• 'CU[ƁVECRYKVJUCHGV[CKTƂQYECRKPECUGQH
swallowing
• Assorted colour packs of 4 contains 1 each of black,
blue, red and green
• Assorted colour packs of 10 contain 10 vibrant
EQNQWTUCPFCTGCXCKNCDNGYKVJGKVJGTƁPGQTOGFKWO
points
• Assorted colour packs of 48 contain 12 each of black,
blue, red and green, with medium points
• $NCEMRGPUCTGCXCKNCDNGKPOGFKWOCPFƁPGRQKPVCPF
in packs of 10 and 100
Type
Medium tip
Assorted, medium
Assorted, medium
Assorted, medium
Black, medium
Black, medium
Tel: 01206 751166 Fax: 01206 751188
Pack size
Order code
4
10
48
10
100
52-0774
98-0118
34-5740
52-0772
34-5742
1+
1.79
3.89
15.69
2.89
27.99
Mini B
Smaller bo
markers p
ƁPGTNKPGU
• Width of
approx.
• Alcohollow odo
• Blue ava
packs o
• Black an
Assorted
available
class pa
Type
Blue pk of 10
Black class p
Assorted clas
…
Stationery 665
Fine tip
#UUQTVGFƁPG
$NCEMƁPG
$NCEMƁPG
s
10
10
100
98-0119
34-5746
34-5744
RVFM
3.89
2.89
27.99
Economy Dry Wipe Pens
071854
Classtray of 200 Pens
produce
k and
50
le
en, red,
ks of 12
080173
arrel
hed back
H
of black,
ant
OGFKWO
h of black,
RQKPVCPF
Order code 1+
34-9804 61.49
34-9806 61.49
Type
Bag of 30
Order code 1+
34-9450 25.99
080169
Wooden Handled Erasers
Order code 1+
34-5843 6.95
34-5845 6.95
34-5847 30.95
500486
Whiteboard Erasers
17
122413
Traditional, wooden-handled erasers with a soft, washable
felt surface for use on whiteboards or chalkboards.
• 5JCRGFJCPFNGUKPPCVWTCNYQQFƁPKUJ
• Available in small or large
• Small supplied in packs of 30
• Large supplied in packs of 12
Whiteboard Erasers
Velleda 1721 Whiteboard Markers
BIC Velleda 1721 Whiteboard Markers use a low-odour,
alcohol-based ink that gives excellent writing properties
and good erasability both immediately and after a few
days. Their soft, yet rugged acrylic tips write smoothly, but
don’t bend or retract under pressure.
• Acrylic bullet tip gives line width of 1.5mm
• Available in single colour boxes of 24 and in an
assorted coloured class pack of 72
• Class pack contains black, blue, light blue, red, green,
orange, purple and brown
• BIC type 1721
Type
Black (24)
Blue (24)
Green (24)
Red (24)
Class pack 72
Order code
34-7172
34-7174
34-7176
34-7178
34-7170
1+
8.79
8.79
8.79
8.79
25.45
Type
Medium eraser
Large eraser
Type
Pack of 30 small erasers
Pack of 12 large erasers
Mini Board Markers
Smaller board
markers producing
ƁPGTNKPGU
• Width of stroke
approx. 1mm
• Alcohol-based,
low odour ink
• Blue available in
packs of 10
• Black and
Assorted
available in
class packs of 100
Magic Wipe Board Eraser
Order code 1+
34-8005 3.52
34-8010 4.45
073761
A whiteboard eraser with
built-in magnet for easy
storage.
• Dense contoured foam
backing for good grip
• Fibre erasing surface
• Sticks to any steel object
for storage
• Colour may vary
• Size 110 x 55 x 22mm
Type
Magnetic eraser
Order code 1+
34-9892 12.95
34-9894 13.95
122465
Magnetic Whiteboard Eraser
517601
Type
Blue pk of 10
Black class pack
Assorted class pack
High quality
plastic-backed
whiteboard
erasers.
• Soft velvet-like
erasing surface
• Can be reversed
for extra life
• Suitable for electronic whiteboards
• Firm foam backing
• Medium 110 x 50 x 35mm
• Large 160 x 60 x 37mm
The Edding Magic
Wipe Board Eraser
is an innovative
and unique product
that can return
your whiteboard to
an almost unused
condition.
• Thoroughly cleans
whiteboards
• Removes
permanent
marker ink
• Requires only
water
• Wash at 60° to re-use
• Environmentally friendly
• Supplied as a pack of 2 wipes plus one drying cloth
Type
Magic Wipe Eraser
Order code 1+
34-8000 2.62
Order code 1+
06-9294 8.39
516968
073760
Safecloths Cleaning Cloths
Budget Whiteboard Eraser
An extra strong, wet laid,
non-woven cleaning cloth for
general cleaning applications
such as equipment casings,
furniture and whiteboards.
• Size 320 x 340mm
• Lint-free
• Ideal for use with AF screen
and surface cleaning
products
• Electrolube Part No. SCH050
• Supplied in a pack of 50
A whiteboard eraser
with a large plastic
handle and woven
felt pad.
• 1XGTCNNFKOGPUKQPU
120 x 60 x 40mm
• Replacement felt
RCFTGƁNNUCTG
available separately
Order code 1+
34-5842 4.91
34-5836 34.95
34-5840 34.95
080955
…where price meets quality
Type
Whiteboard eraser
4GƁNNHGNVRCF
Stationery
easy
CPFCTG
sorbent
Type
Pack of 200 medium pens
2CEMQHƁPGRGPU
Type
Black pack of 36
Assorted pack of 36
Assorted pack of 144
Compact drywipe
eraser, ideal for
children. The plastic
cap can be removed
for easy cleaning.
• Supplied in bags
of 30
Education
516964
'ZEGNNGPVXCNWG)TCVPGNNUVTC[ƁNNGFYKVJ5JQYOG
slim drywipe pens.
• Premium quality pens have 24 cap-off time, pressureresistant tips and low odour, xylene-free ink
• Supplied with 250ml bottle of Show-me MAGIX
ENGCPGTEQPFKVKQPGTCPF5JQYOGOKPKHQCOGTCUGTU
• #XCKNCDNGKPƁPGQTOGFKWOVKR
Mini Drywipe Erasers
These high quality
pen-size dry-wipe
markers have bullet
tips, vivid colours and
are easy to erase.
They are available in
packs of 36 in either
black or assorted
colours. An assorted
class pack of 144
(including Class Tray)
is also available.
• High quality dry
wipe markers
• Pen-size
• Bullet tips
• Vivid colours
• Easy to erase
Order code 1+
34-5726 1.69
34-5728 0.85
Type
50 cleaning pads
Order code 1+
87-0935 8.80
079567
www.rapidonline.com sales@rapidonline.com
6+
8.35
12+
7.79
030108
665
666 Stationery
• Anti-ghosting agent keeps boards in tip-top condition
• Ideal for use with Show-me Wizard Wipes, 34-5751
• Supplied in a 250ml bottle
Whiteboard Cleaning Cloths
Type
Whiteboard cleaner
Non-woven cleaning cloths
ideal for use on whiteboards.
• Supplied in resealable
packs of 25
• AF type WBC025
Type
Cloths pack of 25
080030
Lumocolor Permanent Laundry
Marker Pen
Liquid Whiteboard Cleaner
Removes ghosts and smudges from most
whiteboards.
• Removes accumulations of unsightly
marks and grit
• Spray nozzle
• Supplied in 237ml bottles
Order code 1+
87-4436 5.02
Education
Stationery
Interactive Whiteboard
Wipes
Type
Whiteboard cleaner
Impregnated wipes for cleaning
interactive whiteboards.
• 0QPƂCOOCDNG
• Extremely safe, quick and easy to use
• Resealable tub keeps each wipe fresh
• Supplied in tubs of 100 wipes
• AF type WBW100T
Type
Tub of 100 wipes
Order code 1+
87-4438 5.02
Edding
Marke
Order code 1+
34-5748 6.39
118299
17
Marker Pens
Order code 1+
06-5466 1.63
078267
Whiteboard Cleaner – 500ml
6+
4.40
118300
Super Absorbent Wizard Wipes
Show-me Whiteboard Cleaner removes
drywipe ink from all whiteboards.
• Super value
• Large trigger spray bottle
• 0QPƂCOOCDNG
• Alcohol-free
• Safe formula
• Supplied in a 500ml spray bottle
Staedtler Lumocolor permanent
Laundry Markers are ideal for
identifying school clothing like PE
kits and uniforms. In industrial
applications they are great for
marking overalls and other protective
clothing. They are also suitable for
marking and labelling almost all
surfaces such as glass, plastic,
metal, porcelain, wood, overhead
ƁNOYJKVGDQCTFUCPFƂKREJCTVUGVE
Where ordinary marker inks bead
and smudge, for example, on glass,
Staedtler Lumocolor permanent
marker inks adhere perfectly.
• Ideal for PE Kits, school uniforms
and industrial protective clothing
• Adheres to many special surfaces
YJKEJQVJGTƁPGOCTMGTUFQPQV
adhere to
• Can also be used for a variety of
outdoor applications, e.g. as a
‘garden marker’
• Excellent smudge-proof and waterproof qualities
on almost all surfaces
• Dries in seconds
• Extremely lightfast
• Black ink colour
• Line width: 0.6mm
• Supplied singly
Type
Laundry Marker Pen
Edding 20
permanen
materials
containers
waterproof
create a va
• Durable
resistan
• Useable
• Stroke w
• Bullet ti
• Availabl
• Assorte
Blue, Re
• Edding
Type
Black
Blue
Red
Assorted
Sharpie
Twin Ti
Order code 1+
34-7196 1.34
518036
Type
500ml spray bottle
Edding 400 Permanent Markers
Order code 1+
98-0120 4.25
528348
Edding 400 Permanent Markers are perfect for any
situation where markers are in high demands. Their very
fast drying, light-resistant, smudgeproof and waterproof
ink makes these markers great for writing, marking,
painting and labelling all kinds of material including
metal, glass and plastic.
• Line width 1mm
• Available in choice of blue, red and black
• Multipack also includes green marker
Whiteboardclene Pump Spray
Super thick embossed wipes for erasing drywipe ink
from all whiteboards.
• Large size – approx. 320 x 360mm
• Ultra-high quality – can be used several times before
disposal
• Useful for many other cleaning jobs
– mopping spills, etc.
• Ideal for use with Show-me MAGIX whiteboard
cleaner and conditioner, 34-5748
• Supplied in packs of 30
Pump spray for cleaning whiteboards
thoroughly.
• 0QPƂCOOCDNG
• Pleasant lemon fragrance
• Use with Safetiss or Safecloths
• Supplied in a 250ml pump spray bottle
• AF type BCL250
Order code 1+
50-2410 1.09
50-2412 1.83
50-2413 6.36
Type
Boardclene spray
Order code 1+
87-4434 3.90
6+
3.32
118298
300416
Whiteboard Foamclene
Double-action
whiteboard cleaner
that cleans and
conditions in one go.
• Leaves a silky
coating making
boards easier to
write on
• Removes all ink
residues with ease
– even permanent
marker
666
Perma
Pentel Per
free and a
• Ventilate
BS7272
• Speciall
maintain
• Suitable
metal, v
• Hard we
(6mm li
• Supplie
• Pentel t
(Chisel t
Edding 300 Bullet-Tip Permanent
Marker Pens
Order code 1+
34-5751 6.95
MAGIX Whiteboard Cleaner/
Conditioner
Type
Twin tip black
520174
Whiteboard cleaner not included.
Type
Wizard wipes (30)
Colour
Blue
Black
Multipack
Two heads
Markers ha
• Ink colo
• +PETGCUG
in one m
• Permane
• Quick-d
• Supplied
Foaming cleaner for use on whiteboards.
• Suitable for removing most types of ink
• 0QPƂCOOCDNG
• Pleasant lemon perfume
• Use with cloths or tissues
• Supplied in a 400ml aerosol
• AF type WBF400ML
Type
Whiteboard cleaner
Order code 1+
87-4432 4.40
6+
3.90
118297
No minimum order value
UK mainland only
Type
Black bullet t
Black chisel t
Edding 300 Bullet-Tip Permanent Marker Pens with
low-odour ink.
• Low-odour ink
• Bullet tip
• Line width approx. 1.5 to 3mm
• Available in a range of colours
• Supplied singly
Type
Black
Blue
Red
All or
Order code 1+
06-0007 0.72
06-0005 0.72
06-0006 0.72
a
525433
Tel: 01206 751166 Fax: 01206 751188
Stationery 667
Permanent Markers
Edding 2000 C Permanent
Marker Pens
Gold and Silver Permanent Markers
y
High quality permanent markers with a choice of tip style.
• No xylene or toluene
• Available in black, red and blue
• Black available with bullet tips and chisel tips
• Pentel types N850 (bullet tip) & N860 (chisel tip)
ies
Order code
06-0259
06-0263
06-0261
06-0008
1+
0.99
0.77
0.77
4.15
525434
Colour
Black
Black
081071
Wetrite Marker Pens
General purpose permanent black marker pens that can
write on wet surfaces.
• Ideal for non-porous wet surfaces like metal, plastic,
styrene foam, etc.
• Useful for plumbing, building trades, fresh food
packaging, marine services, etc.
• Fine 1.5mm tips
• Permanent and waterproof
• Xylene free
• Low odour
Type
Black marker pens
Sharpie
Order code 1+
34-5878 0.59
34-5880 0.59
any
heir very
terproof
ng,
ding
Type
Twin tip black
Order code 1+
06-0471 11.79
530569
Permanent Marker Pens
Pentel Permanent Marker Pens are Xylene and Toluenefree and are available with either bullet or chisel tips.
• Ventilated clic-seal safety caps which conform to
BS7272/ ISO 11540 cap safety
• Specially formulated permanent waterproof ink
maintains high performance and provides extended life
• Suitable for most surfaces including glass, wood,
metal, vinyl and plastic
• Hard wearing bullet tip (1.1mm line width) or chisel tip
(6mm line width)
• Supplied singly
• Pentel types NN50-A (Bullet tip) and NN60-A
(Chisel tip)
Type
Black bullet tip
Black chisel tip
with
Order code 1+
34-2900 0.99
34-2920 0.99
029252
Fast Delivery
All orders for in-stock items received
by 7pm – Monday to Friday
are despatched the same day
525433
Edding 8407 Cable Marker Pens
Type
Assorted Wallet of 4
Never lose your marker pen lids again! Edding Retract 11
Permanent Markers have no cap to lose - the tip is drawn
in and out at the press of a button. Modern protection
techniques ensure the marker will not dry out.
• Choice of red, black and blue
• Line width 1.5 to 3mm
• Ideal for labelling, painting and marking on almost any
kind of material including metal, glass and plastic
• Quick-drying, smudgeproof and waterproof
• Light-resistant
• Does not contain Toluol or Xylol
Order code 1+
51-0322 1.25
51-0323 2.99
06-0004 1.79
521421
ent
17
Edding 8407 Cable Marker Pens have been especially
FGUKIPGFHQTKFGPVKH[KPIECDNGU6JG[JCXGWNVTCƁPGDWNNGV
tips and permanent, waterproof ink.
• Line width approx. 0.3mm
• Supplied in an assorted wallet of 4 containing 1 each
of Black, Red, Blue and Green
Retract 11 Permanent Markers
Colour
Red
Black
Blue
520174
524987
073756
518036
rs
Order code 1+
34-7209 1.85
Order code 1+
34-5444 1.23
Twin Tip Black Permanent Markers
Two heads are better than one! These Sharpie Permanent
Markers have two tips for dual degrees of precision.
• Ink colour: Black
• +PETGCUGFHWPEVKQPCNKV[YKVJDQVJƁPGCPFWNVTCƁPGVKRU
in one marker
• Permanent on most surfaces
• Quick-drying, non-toxic, fade and water-resistant ink
• Supplied in packs of 12
Type
Gold & Silver Markers
Marking Color Assorted Permanent
Markers
These BIC Marking
Color Assorted
Permanent Markers
contain low odour,
quick-drying
permanent ink,
enabling you to make
your mark on a wide
variety of surfaces.
• Suitable for use on
glass, metal, coated
paper, photos and
plastic
• Acrylic bullet tips produce 1.1mm wide lines
• Comfortable, textured, rubber grip
• Assorted colours
• Supplied in pot of 10
Type
Pot of 10
Stationery
Type
Black
Blue
Red
Assorted
Tip style
Bullet
Chisel
Education
Edding 2000 C Permanent Marker Pens are ideal for
permanent lettering and marking on almost all everyday
materials and surfaces like boxes, plastic lids and glass
containers. Their low-odour, quick-drying ink is both
waterproof and smudge proof and their bullet tips can
create a variable line width between 1.5 and 3mm.
• Durable, low-odour, waterproof, fast drying ink is
resistant to abrasion
• Useable immediately
• Stroke width: 1.5 to 3mm
• Bullet tip
• Available singly in a range of colours
• Assorted colour pack of 4 contains 1 each of Black,
Blue, Red and Green
• Edding 2000 C range
BiC Gold and Silver Marker
Pens are ideal for all sorts
of arts and crafts projects.
With low-odour water-based
KPMUCPFCƁDTGVKRPKDVJGTG
is no need to click or shake,
they write like a normal
permanent marker pen.
Great for Christmas cards
and adding a bit of glitter
to your craft projects! Use
on card, paper, glass, metal,
photos and plastics.
• Gold and Silver Metallic
Permanent Marker Pens
• Ideal for arts and crafts
• Write on paper, glass,
metal, photos and plastics
• Low-odour, water-based
ink
• Comfortable rubber grip
• Supplied in a pack of 2,
1 Gold, 1 Silver
Order code 1+
06-0267 2.95
525435
CD/DVD Markers
CD/DVD Markers
Toluene-free permanent markers, especially formulated
for safe labelling of CDs, DVDs and other optical data
disks.
• Fine point
• Range of colours
• Pentel type NMS51
Do not write on the recording side of disks.
Type
Black
Order code 1+
34-5948 0.99
081073
CD Markers
Fine tipped permanent marker pens formulated for safe
use on CDs.
• Won’t damage data on CDs or DVDs
• Solid, dense colour
• OOVKRHQTƁPGYTKVKPI
• Available in black
Order code 1+
34-7122 5.49
Type
Black marker 1mm
Order code 1+
34-7054 1.38
517591
www.rapidonline.com sales@rapidonline.com
073759
667
668 Stationery
Write-4-all Permanent Marker Pens
Education
General-purpose permanent markers
for anything from labelling CDs and
DVDs through to joiners, bricklayers and
gardeners who have to write on unusual
surfaces or in extreme conditions.
• Suitable for almost all surfaces
• Quick drying
• Light and frost-resistant
• Non-corrosive ink save for CDs and
DVDs
• Long cap-off time without drying out
• 1FQWTNGUUYCVGTRTQQHCNEQJQNDCUGF
ink writes on wet surfaces
• Available in 3 tip widths
• Black, blue, red and green
• Supplied in assorted wallets of 4
Stationery
17
Type
5WRGTƁPGRQKPV
Fine point
Medium point
Automatic Pencils
& Leads
079341
The Pentel GraphGear 1000 Premium Quality Draughting
Auto Pencil is a high quality auto pencil with a brushed
steel barrel and rubber grip ‘pips’ for added comfort and
control.
• Sliding sleeve to advance and retract lead
• Lead grade indicator
• 5WRRNKGFYKVJ5WRGT*K2QN[OGT*$TGƁNNNGCFU
• Trim colour: black
• 6CMGU<0TGƁNNGTCUGT
• Pentel type PG1015
Type
GraphGear 1000
Order code 1+
06-0295 9.39
530137
Set of 4 CD/DVD Marker Pens
#UGVQHƁPGVKROCTMGTRGPU
for labelling CDs and DVDs.
• Permanent ink
• Fast drying
• Non-toxic
• 1PGGCEJQHTGFDNWGITGGP
and black
0.7mm BIC Matic Classic
Mechanical Pencils – Pack of 12
Type
Pencils box o
The BIC Matic mechanical pencil writes for twice as long
as a standard pencil, needs no sharpening and has a
built-in eraser.
• 0.7mm diameter lead
• Translucent barrel and coloured tip
• Includes 3x 9cm long HB leads
• Supplied in packs of 12
GraphGear 1000 Premium Quality
Draughting Auto Pencil 0.5mm
Order code 1+
34-9090 2.69
34-9092 2.69
34-9094 2.69
• Soft, int
• Can still
JKIJGHƁ
• Improve
• Pencils
Type
Mech. Pencils 0.7mm
Order code 1+
34-7124 3.59
517592
Pencils
Maxi B
These thic
and the th
• Availabl
• Suitable
4 to 11)
Type
Box of 12
School
EASYgraph Right-Handed
and Left-Handed Pencils
0.5 & 0.7mm Staedtler Fineline
Clutch Pencils
Standard
the hardes
producing
grade.
• Supplied
• The HB
5VCGFVNGT((KPGNKPGNGCFJQNFGTUYKVJƁZGFNGCF
protector sleeve.
• Precision mechanism feeds spare leads to pencil tip
• 2NCUVKEMPWTNGFƁPIGTITKR
• Metal push button and clip
• Eraser with cleaning pin
• Available in 0.5 and 0.7mm lead diameters
Type
2B box of 72
B box of 72
HB box of 72
H box of 72
2H box of 72
HB box of 15
Type
0.5mm Fineline
0.7mm Fineline
Order code 1+
34-1055 2.95
34-1060 2.95
029092
Type
CD Marker pens
Order code 1+
45-2000 2.69
071627
Edding 8280 Securitas UV Security
Marker Pen
The Edding 8280
Securitas UV Marker
is ideal for security
marking on almost
all materials. Your
message is only
clearly visible when
viewed under Ultra Violet light.
• Ink only visible under UV light
• Normal colour: transparent
• Line width: 1.5 to 3mm
• Tip shape: Round (bullet)
• Edding type 8280
Type
UV security marker
Mars Micro Carbon Replacement
HB Pencil Leads
Staedtler Micrograph
Super 250 Fineline
drawing leads for all
lead holders.
• Hi-polymer Fineline leads
• Extraordinarily high resistance to breakage
• Maximum elasticity and opacity
• Supplied in tubes of 12 leads
Type
0.5mm HB
0.7mm HB
Order code 1+
34-1220 0.65
34-1240 0.65
029093
Order code 1+
57-4581 3.32
545224
0.5mm Pentel Automatic Pencil
with Hi-Polymer leads
Type
40x Right + 8x Left
Page 714
CD-R
Spindle
(80 Min
700Mb)
Pack of 50
Stabilo EASYgraph Right-Handed and Left-Handed
Pencils have been designed for school children,
especially those learning to write.
6JG[CTGVJGƁTUVGTIQPQOKEITCRJKVGRGPEKNUGURGEKCNN[
designed for left- and right-handers. Their triangular
design and unique non-slip grip moulds ensure a correct
and relaxed hand posture.
• Ergonomic graphite pencils especially for left- and
right-handers
• Triangular design and unique non-slip grip moulds
ensure relaxed hand posture
• Even with sharpening, the staggered grip zone
encourages children to hold the pencil in the correct
YC[WPVKNVJGRGPEKNKUƁPKUJGF
• Yellow or Red colour-coded tips indicate left- or righthanded version
• HB-grade lead equally suitable for both writing and
sketching
• Wood sourced from responsibly managed forests
• Each pencil has a space for the pupil’s name
• Supplied in a class pack of 48, containing 40 righthand and 8 left-hand pencils
525096
The clear choice for writing comfort and convenience.
• Convenient click-action side advance button propels
pencil lead
• Metal pocket clip
• Black lead
• 0.5mm lead diameter
• Supplied complete with a pack of 12 Super Hi-Polymer
leads
• Pentel type XPD305TA
Type
Automatic pencil
Order code 1+
34-5888 1.84
Exam-Grade 2B Pencils
High quality 2B
pencils especially
formulated for
multiple-choice
exams that use
forms marked by
1/4
1RVKECN/CTM
Recognition).
081075
668
Order code 1+
34-0022 28.49
Tel: 01206 751166 Fax: 01206 751188
Handw
HB handw
QHƁEGCPF
• Indespe
• Hardwea
• Supplied
• Suitable
Type
Class pack of
Eco-Fr
Pencils
These env
friendly, re
pencils are
manufactu
tightly wra
of old new
saving tree
using nonbleached w
paper, hel
the planet
• Standar
• Ultra ec
• Easy to
• Break-re
• Availabl
• Supplied
Type
Newspaper p
Newspaper p
Stationery 669
• Soft, intense 2B black lead for clear marks
• Can still be erased totally for amended answers using
JKIJGHƁEKGPE[GTCUGTU
• Improves accuracy of recognition
• Pencils available in boxes of 12
12
Type
Pencils box of 12
1+
0.46
5.29
0.46
4.87
518035
079335
Maxi Blacklead Pencil
These thick barreled pencils are ideal for younger children
and the thick lead is perfect for smudge free work.
• Available in a box of 12
• Suitable for Foundation and Key Stages 1 & 2 (ages
4 to 11)
Type
Box of 12
HB Pencils
Order code
34-7192
34-7193
34-7194
34-7195
Order code 1+
34-9074 1.69
e as long
has a
517592
Type
Medium - Single
Medium - Pack of 12
Hard - Single
Hard - Pack of 12
These Classmaster HB grade graphite pencils offer
excellent value for money.
• +FGCNHQTUEJQQNQTQHƁEGWUG
• Robust and hard wearing
• Available in wallets of 12 or class boxes of 144
and 500
• An eraser-tipped version is available in wallets of 12
Type
Wallet of 12
Class box of 144
Class box of 500
Eraser tipped (12)
Order code
52-0908
34-9924
52-0910
52-0912
Rembrandt Art Design Pencils
Metal Box of 12
1+
0.49
6.39
21.79
0.59
072594
Order code 1+
06-6786 3.21
Education
079750
Oxford HB Pencils
School Pencils
Type
2B box of 72
B box of 72
HB box of 72
H box of 72
2H box of 72
HB box of 150
Order code
34-1280
34-1282
34-1284
34-1286
34-1288
34-1260
1+
8.99
8.99
8.99
8.99
8.99
13.59
Order code 1+
34-5912 1.35
Handwriting Pencils
17
081094
Robinson HB Pencil with Eraser Tip
061994
ed
Type
Oxford HB
Lyra Robinson Eraser Tipped Pencils are wood-cased,
hexagonal HB pencils with a convenient eraser tip. they
CTGKFGCNHQTIGPGTCNQHƁEGQTUEJQQNWUG.[TC4QDKPUQP
Eraser Tipped Pencils are supplied in boxes of 12.
• Strong, break-resistant graphite lead
• 100% real wood casing
• Convenient eraser tip
• Supplied in boxes of 12
Type
HB + eraser (12)
Order code 1+
06-5337 1.35
A metal box containing a selection of 12 premium-grade
Lyra Rembrandt Art Design Pencils that meet the high
FGOCPFUQHƁPGCTVFGUKIPITCRJKEUCPFCTEJKVGEVWTG
• Graphite pencils
• High break-resistance
• 12 grades: 4H, 3H, 2H, H, F, HB, B, 2B, 3B, 4B, 5B & 6B
• Metal box containing 12 pencils
Type
Art design pencils
Stationery
Standard Noris pencils in a range of grades. 2H being
the hardest, producing light lines, 2B being the softest,
producing dark, heavy lines. HB is the normal writing
grade.
• Supplied in boxes of 72
• The HB grade is also available in boxes of 150
*KIJSWCNKV[RGPEKNUYKVJVTCFKVKQPCN1ZHQTFDTCPFKPI
• Rubber tipped
• Supplied in boxes of 12
Order code 1+
06-0467 5.39
531258
Rembrandt Art Specials Pencils
Metal box of 12
500484
RGEKCNN[
ular
a correct
and
HB handwriting pencils, ideal for everyday classroom,
QHƁEGCPFJQOGWUG
• Indespensable for school handwriting
• Hardwearing HB leads
• Supplied in class packs of 200
• Suitable for Key Stages 1 & 2 (ages 5 to 11)
Type
Class pack of 200
oulds
Neon HB Pencils
Order code 1+
06-2008 12.49
074725
e
correct
Wood-cased, round HB pencils with eraser tip for general
QHƁEGQTUEJQQNWUG
• 5KZƂWQTGUEGPVEQNQWTUYKVJEQNQWTOCVEJGFGTCUGT
• Strong, break-resistant graphite lead
• Easy to sharpen
• Supplied in boxes of 12
or right-
g and
Eco-Friendly Recycled Newspaper
Pencils
ests
0 right-
525096
Type
Neon HB pencils (12)
These environmentally
friendly, recycled
pencils are
manufactured using
tightly wrapped layers
of old newspapers,
saving trees and, by
using non-chemically
bleached waste
paper, helping to save
the planet.
• Standard HB grade leads
• Ultra eco-friendly
• Easy to sharpen
• Break-resistant
• Available with or without eraser tips
• Supplied in packs of 12
Type
Newspaper pencils
Newspaper pencils + erasers
Order code 1+
06-5340 1.09
078234
Carpenter’s Pencils
A metal box containing a selection of 12 premium-grade
Lyra Rembrandt Art Special Pencils including Carbon,
Woodless, Grease-free, Aquarelle, Chalk, and Charcoal.
• Assorted special pencils
• Metal box containing 12 pencils
Type
Art specials pencils
Order code 1+
06-0577 9.99
531261
Order code 1+
06-8526 0.94
06-8530 1.14
122687
These high quality graphite tradesman’s pencils are
manufactured with a high volume of quality German
lead for long life, less sharpening and superior breaking
strength.
• Colour-coded with industry standard colours
• Red:- general purpose, medium grade for all surfaces
• Green:- hard grade for stone and all hard surfaces
• Available singly and in packs of 12
New products
…added daily, check our website
www.rapidonline.com
www.rapidonline.com sales@rapidonline.com
669
670 Stationery
Erasers
Rembrandt Titan Woodless Artists
Pencils - Box of 12
Pe
Oxford Small Sleeved
Erasers
Lyra Rembrandt Titan Woodless Artists Pencils are
suitable for all drawing techniques and are available in 5
grades of hardness.
• Woodless
• For all drawing techniques
• Supplied in boxes of 12 of a single grade
Type
HB box of 12
2B box of 12
6B box of 12
Order code 1+
06-0579 10.49
06-0581 10.49
06-0585 10.49
Education
531262
Stationery
17
Stabilo Legend 1198
Erasers are made
from plasticiser-free
PVC and are suitable
for effective erasing
on a huge variety of
papers.
• PVC erasers without
plasticiser
• Effective on a huge variety of papers
• Size 18 x 11 x 35mm
• Supplied in boxes of 20
• Stabilo type: Legend 1198
Type
Box of 20
Type
Small eraser
Type
Graphite pencils (36)
Stabilo Legacy 1186
Erasers are made
from plasticiser-free
PVC and are suitable
for effective erasing
on a huge variety of
papers.
• PVC erasers without
plasticiser
• Effective on a huge variety of papers
• Size 18 x 11 x 35mm
• Supplied in boxes of 20
• Stabilo type: Legacy 1186
Order code 1+
34-0028 3.59
Raso Plast Vinyl Erasers
Type
Single eraser
Order code 1+
34-1270 0.25
061356
This Lyra Pro Natura high quality Beechwood Pencil
Lengthener lets you use your favourite pencils and
colours right down to the stub.
• Economic and environmentally friendly - use the whole
pencil, re-use the handle
• Ideal for snapped pencils
• Suitable for hexagonal and triangular pencils from
7 to 10mm diameter
• Sliding collar holds the pencil securely in place
Motivational Erasers
These high
performance plastic
erasers are made
from environmentallyfriendly thermoplastic
rubber, giving best
quality erasing
performance with
minimum wear.
• 8 assorted colours
in each box
• Extra large size: 65 x 23 x 13mm
• Made from environmentally-friendly TPR
• PVC-free, phthalates-free and latex-free
• Superior erasing performance with minimum residue
Order code 1+
34-9846 5.29
122438
Metal
& Dou
These met
pencil sha
have a sha
CPFCƁPI
sharpening
(8mm) dia
pencils. Th
hole penc
also sharp
(10.5mm)
• Supplied
Type
Single
Double
RV
Plastic
& Dou
RVFM
Contract Pencil Erasers
531264
Page 43
Reward children for their achievements with these brightly
coloured erasers made from environmentally friendly TPR.
• Handy tub with screwtop lid
• Cellophane wrapped for extra protection
• 10 each of Good Work, Happy Birthday, Special Award,
Excellent and Very Neat
• Supplied in a tub of 50
Type
Tub of 50
Order code 1+
34-9922 4.95
122484
670
Order code 1+
34-5917 1.02
Plastic Erasers
Type
Classbox of 32 assorted
Order code 1+
06-0609 1.95
Graduate Hardback Jumbo
Spiral Sketch Books
Type
Single hole m
Double hole
500199
High quality vinyl, pencil erasers.
• Individually wrapped for perfect
cleanliness
Pro Natura Beechwood Pencil
Lengthener
Type
Pencil lengthener
Type
Sharpener + eraser
525099
531263
Tubs of me
ideal for c
• High qu
double
• Single h
• Double
large siz
• Single h
• Double
Pencil Sharpener
and Helix Oxford Eraser
A convenient and cost-saving
sharpener and eraser set. The
perfect companion for any
pencil.
• Metal-bodied pencil
sharpener
• *KIJSWCNKV[*GNKZ1ZHQTF
pencil eraser, with card
UNGGXGKPFKXKFWCNN[ƁNO
wrapped, size 41 x 17 x 12mm, Helix type YS3020
Legacy 1186 Erasers
Order code 1+
06-0599 13.29
Order code 1+
34-5916 0.26
RVFM
Order code 1+
34-0027 3.49
Ferby Trangular Graphite Writing and
Drawing Pencils – Pot of 36
Type
Box of 20
Metal
Single
081096
525098
Chunky triangular
pencils particularly
suitable for younger
artists including
left-handers. These
chunky triangular
pencils help children
VQƁPFVJGEQTTGEV
three-point grip for
fatigue-free writing
and drawing.
• Chunky triangular
pencils
• 10mm diameter
• 12cm long
• Extra-thick 6.25mm
lead
• Wood-sealed end
• Supplied in pots
of 36
RV
A high quality pencil
eraser, with card
sleeve.
• +PFKXKFWCNN[ƁNO
wrapped
• Size 41 x 17 x
12mm
• Helix type
YS3020
• Supplied singly
Legend 1198 Erasers
Good quality pencil
erasers in small,
medium and large
sizes. They are
supplied in bulk
without sleeves or
cellophane wrappers.
• Small erasers (30
x 21 x 6mm) are
supplied in boxes
of 72
• Medium erasers
(40 x 25.5 x
12.8mm) are
supplied in boxes of 20
• Large erasers (55 x 40 x 10mm) are supplied in boxes
of 10
• Boxes all contain 454g (1lb) weight
Type
Small - pack of 72
Medium - pack of 20
Large - pack of 10
Tel: 01206 751166 Fax: 01206 751188
Tubs of pla
• High qu
double
• Single h
• Double
large siz
• Single h
• Double
Type
Single hole p
Double hole
Order code 1+
34-1298 1.59
34-1300 1.19
34-1302 1.09
517220
Stationery 671
Pencil Sharpeners
RVFM
Plastic Canister Pencil Sharpener Single and Double hole
RVFM
Metal Pencil Sharpeners
Single & Double Hole
Single and double hole pencil sharpeners with built-in
collecting canisters for shavings.
• Shavings are neatly collected in the canister
• Tough plastic barrels
• Available singly or in packs of 12
• Colours vary
081096
076851
Supersafe Single-Hole Pencil
Sharpeners
MM8DS Blue Metal Desk Sharpener
A robust sharpener for
ENCUUTQQOQTQHƁEGWUG
• Tough metal body
• Durable long-life cutter
• Triple jaw clutch grip
• Self-feeding function with
auto-stop
• Supplied with desk clamp
• Takes all standard pencils
up to 8mm diameter
076849
500199
Metal Pencil Sharpener – Single
& Double Hole – Pack of 20
Type
Desktop sharpener
These metal wedge
pencil sharpeners
have a sharp blade
CPFCƁPIGTITKRHQT
sharpening standard
(8mm) diameter
pencils. The double
hole pencil sharpeners
also sharpen large
(10.5mm) pencils.
• Supplied in packs of 20
Type
Single
Double
122438
Order code 1+
06-7552 2.59
06-7554 5.19
RVFM
Plastic Pencil Sharpener – Single
& Double Hole – Packs of 25 & 50
Unique patented canister-type pencil sharpeners which
MGGRVJGDNCFGYGNNCYC[HTQOƁPIGTUCPFEQNNGEVUVJG
shavings to prevent mess.
• Unique auto-stop feature to prevent pencils being
oversharpened
• 1HHGTUOCZKOWORTQVGEVKQPHQTVJGWUGTsKFGCNHQT
classroom use, especially by younger children
• Protective neck where pencil is inserted prevents
ƁPIGTUHTQOIGVVKPIVQQENQUGVQVJGDNCFGU
• Top cover permanently on, preventing access to the
sharpener inside
• Child-resistant locking bottom cover – twist to unlock
and empty shavings
• $WKNVKPRQKPVUVQRsUJCTRGPUVQCnƂCVoRQKPVKPUVGCFQH
a sharp point, making pencils safer
• +FGCNHQTEQNQWTKPIRGPEKNUYJGTGƂCVVGTRQKPVKU
required
• Flip-shut lid
• Supplied in assorted colours – packs of 12
Type
Pack of 12
Order code 1+
34-9908 11.89
517639
Page 683
in boxes
Tubs of plastic pencil sharpeners, ideal for class use.
• High quality plastic pencil sharpeners with single or
double holes
• Single hole sharpeners have one regular size hole
• Double hole sharpeners have one regular size and one
large size hole
• Single hole sharpeners supplied in tubs of 50
• Double hole sharpeners supplied in tubs of 25
Type
Single hole plastic
Double hole plastic
17
Order code 1+
39-1318 5.99
082674
079935
residue
Order code 1+
06-0623 8.99
06-0625 8.99
531269
Order code 1+
06-3100 5.99
06-3102 5.99
S3020
Type
Single - box of 24
Twin - box of 12
Stationery
Type
Single hole metal
Double hole metal
Order code 1+
06-3108 0.32
06-7604 3.99
06-7606 17.29
Lyra Pro Natura
Single-Hole and TwinHole Wooden Pencil
Sharpeners are made
from lightweight wood
with steel blades.
• High quality
wooden pencil
sharpeners with
one or two holes
• Single hole sharpeners have one regular size
(8mm) hole
• Twin hole sharpeners have one regular size (8mm) and
one large size (11mm) hole
• Single hole sharpeners supplied in boxes of 24
• Twin hole sharpeners supplied in boxes of 12
Education
Tubs of metal pencil sharpeners made from aluminium,
ideal for class use.
• High quality metal pencil sharpeners with single or
double holes
• Single hole sharpeners have one regular size hole
• Double hole sharpeners have one regular size and one
large size hole
• Single hole sharpeners supplied in tubs of 50
• Double hole sharpeners supplied in tubs of 25
Type
Single hole sharpener
Single hole shar. pk 12
Double hole shar. pk 24
Pro Natura Single-Hole and TwinHole Wooden Pencil Sharpeners
Order code 1+
06-3104 2.59
06-3106 2.89
Desk Tidies
Manual Desktop Pencil Sharpener
8mm Swash ‘Ellie Elephant’
A fun but sturdy desktop
sharpener for classroom
use.
• Robust ABS casing and
durable long-life cutter
• Triple jaw clutch grip
• Self-feeding with autostop
• Takes all pencils up to
8mm
Type
Ellie Elephant sharpener
Order code 1+
34-9842 6.49
122435
RVFM
Desktop Pencil Sharpener
7 to 12mm
A versatile desktop
sharpener ideal for
regular use with all
pencils from 7 to
12mm diameter
including writing and
colouring pencils with
round, triangular and
hexagonal styles.
• Takes pencils
from 7 to 12mm
diameter
• Suitable for writing and coloured pencils
• Use with hexagonal, triangular or round pencils
• Self-feeding with automatic stop
• Strong ABS casing
• Complete with desk clamp
Type
Desktop sharpener
Order code 1+
39-1212 10.95
076859
516973
517220
www.rapidonline.com sales@rapidonline.com
671
672 Stationery
Electric Desktop Pencil Sharpener
8mm Heavy duty Swash 3252A
A powerful mains operated
sharpener for high volume
applications. Ergonomic
design, ideal for classroom
QTQHƁEGWUGYKVJCUCHGV[
switch that cuts power
when the shavings tray is
removed. The sharpener starts
automatically when a pencil
is inserted and has a red
light that indicates when the
pencil is sharpened.
• Suitable for all standard 8mm pencils
Type
Electric sharpener
Triplus Colouring Pens
Trio Pencils
Triangular coloured pencils, ideal
for children just starting to draw
and all fans of rich colours.
• Thin design
• Ergonomic triangular shape for
relaxed grip
• Brilliant colours and rich colour
application
• Available in assorted wallets
of 12
Type
Wallet of 12
Order code 1+
06-6358 2.39
079311
Order code 1+
06-7602 38.99
Type
Wallet of 10
Education
080080
Stationery
17
These user
friendly
triangular
shaped
ƁDTGVKRRGF
colouring
pens are
ideal for
writing and
drawing.
• Dry safe
feature
means
pens can be left uncapped for days without drying up
• Supplied in packs of 10
Order code 1+
06-6794 4.95
The Swash HeavyDuty Electric Desktop
Pencil Sharpener is
the ultimate, mainspowered electric
sharpener. With its
ultra-safe features it
is ideal for constant
use for people of all
ages.
• Sharpens all pencils from 7 to 11.5mm diameter
• 3-position size selector
• Shape adjuster for coloured or normal pencils
• Safety switch cuts power when shavings tray is removed
• Auto thermal cut out system prevents damage due to
overheating
• For all pencil types including triangular
6GEJPKECNURGEKƁECVKQP
Power supply
1RGTCVKPIEWTTGPV
Dimensions: (W x D x H)
Mains cord length
Weight
1XGTJGCVEWVQWV
Maximum pencil diameter
Type
H/D electric sharpener
8#%*\
Approx. 2.0A
150 x 160 x 180mm
1.75m
1.4kg
105°C
11.5mm
Nylon pen
• Availabl
• Helix ty
Individual ca
Type
200 x 100mm
330 x 125mm
079751
Duo Medium Coloured Pencils
Box of 12
Heavy-Duty Electric Desktop
Pencil Sharpener
Nylon P
These Lyra Duo Medium
Coloured Pencils have 2 colours
of lead - Red and Blue in the
same pencil.
• Red lead one end, blue the
other
• 1HVGPWUGFD[GFKVQTU
teachers, architects, etc.,
where one colour is used for
drafting or notes and the other
colour is used for corrections,
marking, dimensions, etc.
• OOCETQUUƂCVUKFGU
• 3.8mm diameter lead
• Made with wood from FSC
managed forests
• Supplied in boxes of 12
Type
Duo pencils box of 12
The Pentel Arts Studio
Set is a handy seethrough acetate carry
case containing 40
Arts products. It holds
SWCNKV[5ƁDTG
tipped pens which
are ideal for graphics
and illustrations, and
5 vivid highlighter
pens. The S360 Colour pen is a superior general purpose
CTVCPFITCRJKEURGPYKVJCSWCNKV[FWTCDNGƁDTGVKRCPF
vivid water-based ink. The set contains 35 mixed colours
YKVJCƁPGRQKPVYKVJCNKPGYKFVJQHCRRTQZKOCVGN[
1.2mm. The 5 different coloured water based Highlighter
pens compliment the pack making this set ideal for
graphics, sketching, illustrations or general arts and
crafts.
• SWCNKV[5ƁDTGVKRRGFRGPU
• 5 vivid highlighter pens
• See-through acetate carry-case
• Ideal for graphics, sketching, illustrations or general
arts and crafts
• Pentel type S360PP/35A
Order code 1+
06-0611 1.89
531265
Order code 1+
34-9840 69.95
Ringbi
Studio Set
Type
Studio set
Nylon and
in ring bin
• Size 225
• Helix ty
Individual ca
Type
Ringbinder p
Order code 1+
34-5643 10.99
500663
122433
Coloured Gel Pens
Coloured Pencils
Plain D
Pencil Cases
Giotto Turbo Colour Fibre Pens
Clear Pencil Cases
Coloured Pencils
Ideal for detailed drawing as well as shading, blending
and texturing. These pencils are made from high quality
smooth grained wood for easy sharpening.
• Available in packs of 12, 24, 36 or 288
Type
Pack of 12
Pack of 24
Pack of 36
Pack of 288
Order code
06-7102
06-7104
06-7106
06-7108
1+
1.79
3.19
4.59
34.99
079770
672
#TCPIGQHƁDTGRGPUWUKPIYCUJCDNGPQPVQZKEKPM
• Ventilated cap and security plug
• 2QN[GUVGTƁZGFPKD
• Long-lasting super-resistant nib
• Available in packs of 24 and 96
• Also available in a class pack of 144
• CE approved
Clear vinyl pencil cases with zip tops.
• Ideal for use in examinations and tests, where visibility
of contents is demanded
• Useful for general purpose storage of test leads,
cables, probes, accessories, etc.
• Available in 20 and 30cm widths
• Helix types M77040 & M78040
Type
Pack of 24
Pack of 96
Class pack of 144
Type
Pencil case 20cm
Pencil case 30cm
NOTE: Colours may vary.
Order code 1+
06-4158 1.59
06-4162 6.59
06-4164 12.89
076887
Tel: 01206 751166 Fax: 01206 751188
A class pa
in a Gratn
resources
• 30x A4
• Z5JQ
• 30x Sho
• 30x Sho
• Suitable
Type
Class pack
ww
Order code 1+
34-2530 0.82
34-2532 1.19
061871
Stationery 673
Nylon Pencil Cases
A4 Mini Whiteboard Packs
with Pens and Erasers
Nylon pencil cases with colour co-ordinated zips.
• Available in 200 x 100mm and 330 x 125mm sizes
• Helix types Q65040 and QH7040
rying up
Individual case colour may be black, blue or purple.
Type
200 x 100mm
330 x 125mm
Order code 1+
34-5930 0.92
34-5932 1.29
081103
079751
Type
Standard class pack of 35
Supertough class pack of 35
Standard bulk box of 100
Supertough bulk box of 100
Nylon and PVC pencil cases with holes for easy storage
in ring binders.
• Size 225 x 150mm
• Helix type R82040
Individual case colour may be black, blue or purple.
Type
Ringbinder pencil case
Order code 1+
34-5934 1.49
081105
Whiteboards
(Personal)
eneral
1+
46.99
73.99
114.99
179.99
071866
Velleda School Whiteboard
This BiC Velleda
Whiteboard is small
and convenient and
is ideal for use in
schools.
• Double-sided: plain
white and gridded
• Size: 19 x 26cm
• Supplied in
packs of 26
500663
Plain Drywipe Boards with Tray
Type
19 x 26cm
Order code 1+
34-7217 33.95
524990
Type
Write ‘n’ wipe A3
Order code 1+
52-9678 7.98
078744
Boards with Squares
A4 drywipe boards
manufactured
from 650 and
1500 micron, antivandal, grade A
PVC.Includes FREE
48-page teachers’
resources booklet,
packed full of
ideas, tips and
games.
• Virtually
impossible to
bend out of
shape or break
• Double-sided
high gloss
drywipe surface
• 20mm square grid printed with scratch-resistant ink
• Pupils can form characters in the squares
• +FGCNHQTITCRJUEJCTVUUJCRGUCPFƂQYFKCITCOU
• Reverse side is plain for ordinary use
• Includes drywipe pens and mini foam erasers
• Available in standard 650 micron and supertough
1500 micron thicknesses
• Suitable for Key Stages 1, 2 & 3 (ages 5 to 14)
• Available in class packs of 35 and bulk boxes of 100
Type
Standard pack of 35
Supertough pack of 35
Standard bulk box of 100
Supertough bulk box of 100
Order code
52-0778
52-0779
52-9782
52-9783
17
Stationery
l purpose
GVKRCPF
d colours
GN[
ghlighter
l for
and
Order code
52-0786
52-9796
52-9778
52-9798
These Ed Tech
Write ‘n’ Wipe
blank A3 drywipe
boards are
suitable for a wide
variety of uses.
• Made from high
quality no-tear
plastic
• Accepts a
dry-wipe or wet
marker pen
• Dimensions 420 x 300mm
• Suitable for Key Stages 1 & 2 (ages 5 to 11)
• Supplied in packs of 5
Education
Ringbinder Pencil Case
A4 drywipe boards
manufactured
from 650 and
1500 micron, antivandal, grade A
PVC.Includes FREE
48-page teachers’
resources booklet,
packed full of
ideas, tips and
games.
• Virtually
impossible to
bend out of
shape or break
• Double-sided
high gloss drywipe surface
• Plain both sides for general purpose and drawing
• Available in standard 650 micron and supertough
1500 micron thicknesses
• Includes drywipe pens and mini foam erasers
• Suitable for Key Stages 1, 2 & 3 (ages 5 to 14)
• Available in class packs of 35 and bulk boxes of 100
Write ‘n’ Wipe Blank A3 Drywipe
Boards
1+
59.99
79.95
132.95
199.95
071860
Velleda Whiteboards
with Pen and Eraser
A class pack of the popular Show-me boards supplied
in a Gratnells tray.Includes FREE 48-page teachers’
resources booklet, packed full of ideas, tips and games.
• 30x A4 650 micron Show-me plain whiteboards
• Z5JQYOGƂCUJECTFU
• 30x Show-me black, slim drywipe pens
• 30x Show-me mini foam erasers
• Suitable for Key Stages 1 & 2 (ages 5 to 11)
e visibility
Type
Class pack
Order code 1+
52-9780 55.95
080088
ds,
New products
www.rapidonline.com
These BiC Velleda
Whiteboards come
complete with a Pen
and Eraser that clip to
the board and are ideal
for individual use by
students.
• Small and convenient
size
• Ideal for use in
schools
• 2 useful surfaces:
plain white and grid
• Available in 19 x
26cm and 24 x
33cm sizes
• Supplied in packs
of 12
Type
24 x 33cm
Write ‘n’ Wipe Grid Boards
These drywipe
boards have
a 10mm grid,
making them ideal
for numeracy use.
• Made from high
quality no tear
plastic
• Accepts a dry
wipe or wet
marker pen
• Dimensions 280
x 230mm
• Suitable for Key Stages 1 & 2 (ages 5 to 11)
• Supplied in packs of 30
Type
Write ‘n’ wipe grid boards
Order code 1+
34-7216 61.49
Order code 1+
52-9682 13.49
524989
078745
061871
www.rapidonline.com sales@rapidonline.com
673
674 Stationery
Double-Sided Matrix Board
Write ‘n’ Wipe XY Axis Boards
These drywipe
boards have a grid
and an XY axis,
making them ideal
for graph and
numeracy use.
• Made from high
quality no tear
plastic
• Accepts a dry
wipe or wet
marker pen
• Dimensions 280 x 230mm
• Suitable for Key Stages 1 & 2 (ages 5 to 11)
• Supplied in packs of 30
Type
Write ‘n’ wipe XY boards
Order code 1+
52-9680 11.99
Education
078746
Stationery
17
A3 Drywipe Board with Squares
A3 drywipe boards
manufactured
from 1000 micron,
anti-vandal, grade
A PVC.
• Virtually
impossible to
bend out of
shape or break
• Double-sided
high gloss drywipe surface
• 20mm square grid printed with scratch-resistant ink
• Pupils can form characters in the squares
• +FGCNHQTITCRJUEJCTVUUJCRGUCPFƂQYFKCITCOU
• Reverse side is plain for ordinary use
• Includes slim drywipe pens and erasers
• Suitable for Key Stages 1 & 2 (ages 5 to 11)
• Supplied in packs of 5
Type
Pack of 5
Type
Class pack of 35
Bulk box of 100
082540
A4 drywipe boards
manufactured
from 650 micron,
anti-vandal,
grade A PVC.
Includes FREE
48-page teachers’
resources booklet,
packed full of
ideas, tips and
games.
• Virtually
impossible to
bend out of shape or break
• Double-sided high gloss drywipe surface
• Isometric grid one side, ‘square’ dots on the reverse
• Ideal for numeracy, science and geography
• Uses include drawing shapes, objects and showing
areas
• Includes 1x drywipe pen and 1x mini foam eraser for
each board
• Suitable for Key Stages 1 & 2 (ages 5 to 11)
• Available in class packs of 35 and bulk boxes of 100
Type
Class pack of 35
Bulk box of 100
Order code 1+
52-9058 64.99
52-9060 169.99
082538
Double-Sided Magnetic Drywipe A2
Easel and Flipchart Pads
080090
The Show-me Double-Sided Magnetic A2 Drywipe Easel
is manufactured from grade A PVC with a multi-coloured,
rigid frame for extra strength.
• Double-sided A2 magnetic drywipe easel
• *QQMUKPENWFGFHQTJCPIKPI#ƂKREJCTVRCFU
• Durable, coloured metal frame with anti-scuff feet
• (QNFUƂCVYJGPPQVKPWUG
• #ƂKREJCTVRCFUEQPVCKPKPIUJGGVUCTGCXCKNCDNG
separately in packs of 5
Type
Double-sided easel
Flipchart pads (5)
Order code 1+
52-9800 59.95
52-9802 17.95
080094
Class pack of the original Show-me® whiteboards packed
in a Gratnell’s tray. Each pack now includes a Teachers’
Resources Booklet, packed full of ideas, tips and games.
• 2CVGPVGFVTC[ƁVUOQUVENCUUTQQOUVQTCIGWPKVU
• All whiteboards are double-sided (plain on reverse)
• Suitable for Key Stages 1 & 2 (ages 5 to 11)
Each pack includes: 30 x Show-me® A4 650 micron whiteboards,
Z5JQYOGŠ#ƂCUJECTFYJKVGDQCTFUZ5JQYOGŠ
slim drywipe pens black, 30 x Show-me® mini foam erasers.
Type
Class pack
Order code 1+
52-9784 59.99
080089
Page 665
Magnetic
Whiteboard
Eraser
674
Magnetic Framed Boards
Drywipe boards
manufactured from
grade A PVC with
a multi-coloured,
rigid frame for extra
strength.
• Double-sided high
gloss drywipe
surface
• 1PGUKFGKUUWKVCDNGHQTWUGYKVJOCIPGVKENGVVGTUCPF
numbers and has a 20mm square grid printed with
scratch-resistant ink
• Pupils can form or align characters in the squares
• +FGCNHQTITCRJUEJCTVUUJCRGUCPFƂQYFKCITCOU
• Reverse side is plain for ordinary use
• Available in A4, A3, A2 and A1 sizes
• A4 size is available singly and in packs of 10
• A3 size is available singly and in packs of 5
• Suitable for Key Stages 1 & 2 (ages 5 to 11)
Type
A4 Single
A4 Pack of 10
A3 Single
A3 Pack of 5
A2 Single
A1 Single
Order code
52-0788
52-0790
52-0792
52-9790
52-9792
52-9794
1+
4.99
39.99
8.99
34.99
12.99
22.95
071867
Plain Dry Wipe Boards 650 Micron
Order code 1+
52-9786 18.90
Boards with Squares and Tray
Order code 1+
52-9066 64.99
52-9068 169.99
Multiplication Gridded Boards
A4 drywipe boards
manufactured
from 650 micron,
anti-vandal,
grade A PVC.
Includes FREE
48-page teachers’
resources booklet,
packed full of
ideas, tips and
games.
• Virtually
impossible to
bend out of
shape or break
• Double-sided high gloss drywipe surface
• 1PGUKFGJCUCRTKPVGFUSWCTGOWNVKRNKECVKQPITKF
• Reverse side has blank 100 square grid
• Includes 1x drywipe pen and 1x mini foam eraser for
each board
• Suitable for Key Stages 1 & 2 (ages 5 to 11)
• Available in class packs of 35 and bulk boxes of 100
This original
Show-me® drywipe
board is ideal for
individual pupil use.
This excellent value
combination pack
includes 10 A4
whiteboards, medium
tip pens and erasers.
• A4 size – ideal for
photocopying
• Double-sided
• Type 650 micron
• Manufacturer’s part
SMB10A
Type
Pack of 10
These stro
rigid Show
whiteboard
for use in
where no d
surface is
• Manufac
MDF
• Glossy s
gives go
• Complet
• Plain on
• Supplied
Type
Pack of 30
Pack of 60
Time D
A4 drywip
manufactu
from 650
anti-vanda
A PVC.
• Virtually
impossi
bend ou
shape o
• Doublehigh glo
drywipe
• Tradition
face plu
readout
• Pupils c
JCPFUQ
the digit
• Printed w
• Reverse
• Class pa
erasers
• Suitable
• Supplied
Type
Class pack of
Order code 1+
52-9787 15.95
Time D
550293
Lined Dry Wipe Boards,
Pens and Erasers
This Show-me®
drywipe board has
light blue lines at
20mm intervals
and encourages
neat handwriting
and straight lines.
This excellent value
combination pack
includes 10 A4
whiteboards, medium
tip pens and erasers.
• Ideal for individual
pupil use
• Plain reverse side for standard Show-me® activities
• A4 size
• Manufacturer’s part LIB10A
Type
Pack of 10
A4 Rig
This Show
4-panel cl
board inco
traditional
plus a dig
block and
for telling
activities.
• Plain rev
• Iinclude
whitebo
medium
and eras
• Supplied
pack of
• Manufac
Type
Pack of 100
Pag
Order code 1+
52-9789 18.25
550294
No minimum order value
Tel: 01206 751166 Fax: 01206 751188
UK mainland only
Slim
Dryw
Stationery 675
082540
A4 Rigid MDF Plain Dry Wipe Boards Telling-The-Time Boards with Tray
These strong and
rigid Show-me® A4
whiteboards are ideal
for use in classrooms
where no desk
surface is available.
• Manufactured from
MDF
• Glossy surface
gives good erasability
• Completely rigid
• Plain on both sides
• Supplied in packs of 30 or 60
VGTUCPF
d with
Type
Pack of 30
Pack of 60
Order code 1+
52-9791 39.99
52-9793 79.95
550295
ares
ITCOU
cron
Type
Class pack of 35
A4 Venn Diagram Whiteboards
Time Dry Wipe Boards
These Venn diagram
boards from Showme® are ideal for
use both in Science
and Maths lessons
for comparing two
sets of data. Large
overlapping circles
give adequate space
for complete data comparison and the top line provides
space for a title. Each pack comes complete with Showme® drywipe markers and mini foam erasers.
• Size A4
• Plain reverse side
• Supplied in packs of 100
• Manufacturer’s part B/VEN
Type
Pack of 100
Order code 1+
52-9795 139.99
550296
Slim Barrel
Drywipe Pens
Order code 1+
98-0107 17.69
98-0108 42.85
…where price meets quality
17
A4 Mind Map Whiteboards
These Showme® Mind Map
whiteboards provide
an excellent way for
pupils to formulate
ideas for a story,
gather facts around
a particular subject
or for anything
which requires
“brainstorming”. These boards are highly versatile – they
can be used for almost all subjects on the curriculum.
• A4 size – ideal for photocopying
• Plain reverse side
• Each pack comes complete with Show-me® drywipe
markers and mini foam erasers
• Supplied in packs of 100
• Manufacturer’s part B/MMB
Type
Pack of 10
Order code 1+
52-9805 139.95
550328
A3 & A4 Periodic Table Whiteboards
A4 Venn Diagram Whiteboards,
Pens and Erasers
550297
550294
Order code 1+
98-0105 17.69
98-0106 59.95
528341
Order code 1+
52-9797 139.99
Page 664
Show-me A4
Whiteboard Venn
Diagram Boards are
A4 drywipe boards
manufactured from
650 micron, antivandal, grade A PVC,
printed with 2 large
overlapping circles
giving plenty of space
for data comparison,
plus a line at the top
for the title.
Ideal for both Science and Maths environments when
comparing 2 sets of data.
• Virtually impossible to bend out of shape or break
• Double-sided high gloss drywipe surface
• Printed with scratch-resistant ink
• Reverse side is plain for ordinary use
• Packs include drywipe pens, mini foam erasers and
FREE Teachers’ Resource Booklet full of ideas, tips
and games
• Available in packs of 10 and class packs of 35
Type
Pack of 10
Pack of 35
This Show-me®
4-panel clockface
board incorporates a
traditional clock face
plus a digital readout
block and is ideal
for telling-the-time
activities.
• Plain reverse side
• Iincludes
whiteboards,
medium tip pens
and erasers
• Supplied in class
pack of 100
• Manufacturer’s part B-CFB
Type
Pack of 100
Type
Pack of 10
Pack of 35
528342
071863
550293
Order code 1+
52-9788 59.99
080091
Order code 1+
52-0782 49.99
tivities
lue
Type
Class pack
Stationery
071867
A4 drywipe boards
manufactured
from 650 micron,
anti-vandal, grade
A PVC.
• Virtually
impossible to
bend out of
shape or break
• Double-sided
high gloss
drywipe surface
• Traditional clock
face plus digital
readout block
• Pupils can draw
JCPFUQTƁNNKP
the digital segments
• Printed with scratch-resistant ink
• Reverse side is plain for ordinary use
• Class packs include drywipe pens and mini foam
erasers
• Suitable for Key Stages 1 & 2 (ages 5 to 11)
• Supplied in class packs of 35
A class pack of the popular Show-me boards supplied
in a Gratnells tray.Includes FREE 48-page teachers’
resources booklet, packed full of ideas, tips and games.
Pack includes:
• 30x A4 650 micron Show-me clockfaced whiteboards
• Z5JQYOGƂCUJECTFU
• 30x Show-me black, slim drywipe pens
• 30x Show-me mini foam erasers
• Suitable for Key Stages 1 & 2 (ages 5 to 11)
Show-me A4
Whiteboard Mind
Map Boards are
A4 drywipe boards
manufactured
from 650 micron,
anti-vandal, grade
A PVC, printed with
a large central oval
with radiating lines
to link to your related
thoughts.
The Mind Map boards are ideal for students to formulate
ideas for stories, gather facts around a certain subject or
simply general brainstorming.
• Virtually impossible to bend out of shape or break
• Double-sided high gloss drywipe surface
• Printed with scratch-resistant ink
• Reverse side is plain for ordinary use
• Packs include drywipe pens, mini foam erasers and
FREE Teachers’ Resource Booklet full of ideas, tips
and games
• Available in packs of 10 and class packs of 35
Education
Time Drywipe Boards
0
A4 Mind Map Whiteboards
Show-me A3 and A4
Whiteboard Periodic
Table Boards are
A3 and A4 drywipe
boards manufactured
from 650 micron,
anti-vandal, grade A
PVC, printed with the
framework, but not
the symbols, of the
periodic table.
$[ƁNNKPIKPVJG
symbols, students can learn both the location and the
symbol of each element. An ideal accessory for every
science classroom or lab.
• Virtually impossible to bend out of shape or break
• Double-sided high gloss drywipe surface
• Printed with scratch-resistant ink
• Reverse side is plain for ordinary use
• Packs include drywipe pens, mini foam erasers and
FREE Teachers’ Resource Booklet full of ideas, tips
and games
• A4 size is available in packs of 10 and class packs
of 35 or 100
• A3 size is supplied in packs of 5
Type
A4 pack of 10
A4 pack of 35
A4 pack of 100
A3 pack of 5
Order code
98-0109
98-0110
52-9809
98-0111
www.rapidonline.com sales@rapidonline.com
1+
17.95
59.95
139.95
24.99
528343
675
676 Stationery
Education
A4 Human Skeleton Whiteboards
Stationery
17
Show-me A4 Whiteboard
Human Skeleton Boards are A4
drywipe boards manufactured
from 650 micron, anti-vandal,
grade A PVC, printed with an
‘x-ray’ representation of the
human body, showing the
major bones of the skeleton.
The boards are ideal for
teaching the names of bones,
then testing the student’s
memory.
• Virtually impossible to bend out of shape or break
• Double-sided high gloss drywipe surface
• Printed with scratch-resistant ink
• Reverse side is plain for ordinary use
• Packs include drywipe pens, mini foam erasers and
FREE Teachers’ Resource Booklet full of ideas, tips
and games
• Available in packs of 10 and class packs of 35
Type
Pack of 10
Pack of 35
Order code 1+
98-0112 17.69
98-0113 59.95
Type
Human body
Human muscle
Human skeleton
Pack size
100
100
100
Show-me A4
Whiteboard Human
Muscle Boards are
A4 drywipe boards
manufactured from
650 micron, antivandal, grade A PVC,
printed with an ‘x-ray’
representation of the
human body, showing
the major muscles of
the body.
The boards are ideal in both PE and Science
environments for teaching the names of the muscles,
then testing the student’s memory.
• Printed both sides to show front and back muscles
• Virtually impossible to bend out of shape or break
• Double-sided high gloss drywipe surface
• Printed with scratch-resistant ink
• Packs include drywipe pens, mini foam erasers and
FREE Teachers’ Resource Booklet full of ideas, tips
and games
• Available in packs of 10 and class packs of 35
Type
Pack of 35
Pack of 100
Type
Pack of 10
Pack of 35
Order code 1+
52-9799 139.99
52-9801 169.95
52-9803 139.95
Magnetic Glass Dry Wipe Boards
Slim Barrel Drywipe Pens
These high quality
Show-me®
whiteboard pens
have brightly coloured
barrels and have
been designed
URGEKƁECNN[HQT
educational use with
smaller hands in
mind.
• Slim barrel for smaller hands
• Ideal for use with all drywipe boards,
• 24-hour cap-off time to prevent drying out
• Extra-hard anti-splay nib
• .QYQFQWTZ[NGPGHTGGKPMYKVJUCHGV[CKTƂQYECR
• Nib-stop to prevent tip from being pushed into barrel if
pushed too hard
• 'CU[ƁVNKF
• Supplied in pack of 50 assorted colours
• Manufacturer’s part SDP50A
Order code 1+
52-9811 16.95
Type
35 x 35cm
50 x 50cm
35 x 35cm
50 x 50cm
35 x 35cm
50 x 50cm
35 x 35cm
50 x 50cm
Order code
06-0325
06-0327
06-0329
06-0331
06-0333
06-0337
06-0339
06-0341
A range of
Cathedral
Glass Wip
• Drywipe
white
• Magnets
notes
Type
Marker pen Merker pen Pack of 4 ma
1+
8.89
20.00
8.89
20.00
13.34
20.00
13.34
20.00
RV
Pocket
Magnetic Glass Wipe Board
Weekly Planners
'ZEGNNGPVXCNWG)TCVPGNNUVTC[ƁNNGFYKVJ5JQYOG
slim drywipe pens.
• Premium quality pens have 24 cap-off time, pressureresistant tips and low odour, xylene-free ink
• Supplied with 250ml bottle of Show-me MAGIX
ENGCPGTEQPFKVKQPGTCPF5JQYOGOKPKHQCOGTCUGTU
• #XCKNCDNGKPƁPGQTOGFKWOVKR
These Cathedral
Weekly Planner
Dry Wipe Boards
can be used like
conventional dry
wipe planners, but
add an extra touch
of elegance to
[QWTQHƁEGYKVJVJG
DGCWVKHWNƁPKUJQH
glass.
A hidden metal backing allows magnets to used for
holding paper messages and notes.
• Glass panels with metal backing
• Use dry wipe pens and magnets to display your
messages
• Size 50 x 50cm
• Available in black or white
Type
Pack of 200 medium pens
2CEMQHƁPGRGPU
Type
50 x 50cm
50 x 50cm
A4 Human Body Whiteboards
Order code 1+
34-9804 61.49
34-9806 61.49
Black
White
Free Delivery*
on all orders over £30 (excl. VAT) – (UK mainland only)
* See Terms & Conditions for full details
Tel: 01206 751166 Fax: 01206 751188
These valu
money wh
envelopes
blue opaq
interiors fo
security.
• Flap on
side
• Availabl
and C4
• C5: 229
162mm
• C4: 324
• 90gsm
• Availabl
• C5 supp
• C4 supp
Type
C5
C4
C4 with wind
RV
Wallet
Order code 1+
06-0359 20.00
06-0361 20.00
122413
528346
676
Black
Black
White
White
Red
Red
Grey
Grey
Access
Wipe B
550300
Classtray of 200 Pens
Order code 1+
98-0116 17.69
98-0117 59.95
These Cathedral Dry Wipe
Boards can be used like
conventional dry wipe
boards, but add an extra
touch of elegance to your
QHƁEGYKVJVJGDGCWVKHWN
ƁPKUJCPFRGTHGEVUWTHCEG
of glass.
A hidden metal backing
allows the boards to also
use magnets for securing
paper messages and notes for an additional air
of mystery.
• Glass panels with metal backing
• Use dry wipe pens and magnets to display your
messages
• Range of stylish colours
• Available in 35 x 35cm and 50 x 50cm sizes
530055
528345
Type
Pack of 10
Pack of 35
These Cath
Wipe Boar
convention
boards an
QHGNGICPE
VJGDGCWVK
A hidden m
magnets t
paper mes
• Glass pa
• Use dry
message
• Size 50
• Availabl
Type
50 x 20cm
50 x 20cm
Order code 1+
98-0114 19.99
98-0115 69.95
Show-me A4
Whiteboard Human
Body Boards are
A4 drywipe boards
manufactured
from 650 micron,
anti-vandal, grade A
PVC, printed with a
representation of the
human body.
The boards are ideal
for use in a wide
variety of subjects,
including foreign
languages, for
teaching the names of the parts of the body, then testing
the student’s memory.
• Virtually impossible to bend out of shape or break
• Double-sided high gloss drywipe surface
• Printed with scratch-resistant ink
• Reverse side is plain for ordinary use
• Packs include drywipe pens, mini foam erasers and
FREE Teachers’ Resource Booklet full of ideas, tips
and games
• Available in packs of 10 and class packs of 35
Order code 1+
34-5736 7.64
34-5738 19.99
071899
550298
Type
Box of 50
Magne
Mini foam erasers
suitable for
whiteboards and
Show-me drywipe
boards.
• Wipes away
drywipe ink
quickly and
easily
• Ideal for small hands – approx. 75 x 50 x 25mm
• Supplied in packs of 35 and 100
These versatile Showme® whiteboards
make an ideal
resource for a variety
of subjects from
science to PE.
• Choice of boards
- human body,
human skeleton
and human
muscles
• A4 size – ideal for
photocopying
• Each pack comes
complete with
Show-me® drywipe
markers and mini foam erasers
• Supplied in packs of 100
528344
A4 Human Muscle Whiteboards
Whiteboard Erasers
A4 Human Biology Whiteboards
530056
These whit
have a blu
additional
• Flap on
• DL size:
• Takes A4
• 80gsm
• Self sea
• Availabl
• Supplied
Type
DL
DL with windo
Stationery 677
Labels
Type
1 Label per sheet
8 Labels per sheet
14 Labels per sheet
16 Labels per sheet
21 Labels per sheet
Magnetic Glass Wipe Memo Boards
mm
071899
These Cathedral Memo Dry
Wipe Boards can be used like
conventional dry wipe memo
boards and add an extra touch
QHGNGICPEGVQ[QWTQHƁEGYKVJ
VJGDGCWVKHWNƁPKUJQHINCUU
A hidden metal backing allows
magnets to used for holding
paper messages and notes.
• Glass panels with metal backing
• Use dry wipe pens and magnets to display your
messages
• Size 50 x 20cm
• Available in black or white
Type
50 x 20cm
50 x 20cm
Black
White
Order code
34-9168
34-9170
34-9172
34-9174
34-9176
1+
5.00
5.00
5.00
5.00
5.00
079996
Computer Label Sheets
RVFM
Address Labels
A box of self-adhesive
white labels on a
continuous roll in a
convenient dispenser
box.
• 89 x 36mm
• Supplied in Boxes
of 250
Order code 1+
06-0363 13.34
06-0365 13.34
530057
Accessories for Magnetic Glass
Wipe Boards
A range of accessories for
Cathedral Products Magnetic
Glass Wipe Boards.
• Drywipe pens in black and
white
• Magnets for securing paper
notes
Type
Marker pen - White
Merker pen - Black
Pack of 4 magnets
ur
Order code 1+
06-0367 1.25
06-0371 1.25
06-0373 2.09
530058
Envelopes
RVFM
Pocket Envelopes
530055
d for
Qty per sheet
2
4
8
8
14
16
16
18
21
24
30
Order code
34-0273
34-0288
34-0275
34-0286
34-0281
34-0283
34-0277
34-0284
34-0287
34-0279
34-0285
Qty per
sheet
2
4
8
8
14
16
16
18
21
24
30
1+
3.49
3.49
3.49
3.49
3.49
3.49
3.49
3.49
3.49
3.49
3.49
Multipurpose A4 Printer Labels
Order code 1+
34-9160 10.83
34-9164 9.79
34-9166 10.29
RVFM
These white wallet envelopes
have a blue opaque interior for
additional security.
• Flap on long side
• DL size: 110 x 220mm
• Takes A4 sheets folded into 3
• 80gsm
• Self seal
• Available with or without window
• Supplied in boxes of 1000
Type
DL
DL with window
199.6 x 143.5mm
99.1 x 139mm
99.1 x 67.8mm
105 x 74mm
99.1 x 38.1mm
100 x 34mm
105 x 35mm
63.5 x 46.6mm
63.5mm x 38.1mm
70 x 35mm
70 x 29.7
RVFM
Wallet Envelopes
530056
Size
Rounded corners
Rounded corners
Rounded corners
Square corners
Rounded corners
Rounded corners
Square corners
Rounded corners
Rounded corners
Square corners
Square corners
RS270218
RS272717
RS270812
RS272014
RS271413
RS271611
RS270911
RS271819
RS272113
RS271314
RS271918
530464
079994
ur
Style
34-0273
34-0288
34-0275
34-0286
34-0281
34-0283
34-0277
34-0284
34-0287
34-0279
34-0285
Size
199.6 x 143.5mm
99.1 x 139mm
99.1 x 67.8mm
105 x 74mm
99.1 x 38.1mm
100 x 34mm
105 x 35mm
63.5 x 46.6mm
63.5 x 38.1mm
70 x 35mm
70 x 29.7mm
These value-formoney white
envelopes have
blue opaque
interiors for added
security.
• Flap on short
side
• Available in C5
and C4 sizes
• C5: 229 x
162mm takes A4 folded in half
• C4: 324 x 229mm takes A4 unfolded
• 90gsm
• Available with or without window
• C5 supplied in boxes of 500
• C4 supplied in boxes of 250
Type
C5
C4
C4 with window
6GEJPKECNURGEKƁECVKQP
1TFGTEQFG Blick type
Order code 1+
34-9156 11.60
34-9158 14.94
080015
These multipurpose
labels are compatible
with all laser copier
and inkjet machines.
The range of sizes
supplied make these
A4 label sheets ideal
for a number of uses
including address
labels, labelling storage
containers,arts and
crafts, and many more.
• A4 sheets
• 1, 8, 14, 16 or 21
labels per sheet
• Supplied in boxes
of 100 sheets
• compatible with all laser, coppier, and inkjet machines
6GEJPKECNURGEKƁECVKQP
Size (mm)
199.6 x 289.1
99.1 x 67.7
99.1 x 38.1
99.1 x 34.0
63.5 x 38.1
Labels per sheet
1
8
14
16
21
1TFGTEQFG
34-9168
34-9170
34-9172
34-9174
34-9176
Type
Address labels
Order code 1+
34-9178 0.96
079997
17
Copy & Printer
Paper
Stationery
These high quality self-adhesive labels from Blick give
optimum processing reliability with all printing systems.
• Suitable for:
• Laser printers
• Inkjet printers
• Dot-matrix printers
• Colour laser pinters
• Colour copiers
• Multifunctional machines
• A4 sheets
• 5GG6GEJPKECN5RGEKƁECVKQPHQTHWNNFGVCKNU
• Supplied in packs of 100 sheets
Education
rds
RVFM
Everyday A4 75gsm Laser/Inkjet
Printer/Copier Paper
This Everyday A4
paper is designed
and developed to
meet all your colour
printing and copying
requirements.
• A4 paper, suitable
for all general
purpose copying
and printing
• 75gsm
• Works in all home
CPFQHƁEGRTKPVGTU
• Perfect for use in
high volume high
speed copying and
printing
• Consistent quality from a leading brand
• Colour: brilliant white
• Supplied in single ream of 500 sheets
Type
White copy paper
Order code 1+
34-3123 2.25
080796
HP
Everyday A4 Laser/Inkjet Printer/
Copier Paper
A high quality A4, 80gsm paper
suitable for general purpose
copying and printing.
• 9QTMUKPCNNJQOGCPFQHƁEG
printers
• Consistent quality from
leading brand
• 100% chlorine free bleached
• Supplied in single reams of
500 sheets
Please note that if this paper is
temporarily unavailable, we will
substitute a paper of equivalent or
superior quality.
Type
1 Ream (500 sheets)
Order code 1+
34-3124 2.77
www.rapidonline.com sales@rapidonline.com
071340
677
678 Stationery
Size
A4 (297 x 210mm)
A5 (210 x 148mm)
Pocket (146 x 89mm)
Education
Rainbow Pastel Coloured Printer
Copier Paper
Stationery
17
530051
Add colour to your
printing and copying
with the addition of
these superb pastel
shades that work in
CNNJQOGCPFQHƁEG
printers and copiers.
Whether you are a
small business or
a global enterprise,
Xerox offers products
and services that can
help your company improve its business processes. Xerox
will help you create documents that get you noticed.
• High quality A4, 80gsm paper suitable for general
purpose copying and printing
• 9QTMUKPCNNJQOGCPFQHƁEGRTKPVGTU
• Perfect for use in high volume high speed copying and
printing
• +FGCNHQTEQNQWTEQFKPIQHƁEGRCRGTUCPFCFFKPI
impact and interest to everday documents
• Consistent quality from a leading brand
• Available in pastel shades of yellow, green, blue, pink
and salmon
• Supplied in single reams of 500 sheets; 100 sheets
QHGCEJQHVJGƁXGEQNQWTURGTRCEM
Type
Pastel
Order code 1+
06-0379 1.49
06-0381 0.99
06-0377 0.65
Order code 1+
34-3126 5.47
080795
Note Books & Pads
Casebound – Hardcover Notebooks
Notebooks with
polypropylene cases
from the nuco Craze
Range.
• Side spiral bound
• 160 pages
• 80gsm
• Colours may vary
• Available in A5 and
A4 sizes
Type
A5
A4
Order code 1+
06-8754 0.908
06-8753 1.60
523671
Two series of hardback notebooks suitable for home,
QHƁEGGFWECVKQPGVE'CEJPQVGDQQMHGCVWTGUCRCFFGF
hardback cover and 192 pages of high quality lined
paper. The notebooks are available in the ‘black&white’
series in both A4 and A5, white and black and also in the
‘raindrop’ series in A4 and A5 with an attractive raindrop
design colour scheme.
• Stitched and glued binding with contrasting head and
tail bands
• Silk page marker
• Personal index and information pages
• 192 pages
Type
A4 Notebook
A5 Notebook
A4 Notebook
A5 Notebook
A4 Notebook
A5 Notebook
Colour
White
White
Black
Black
Rain Drops
Rain Drops
Order code
25-1039
25-1040
25-1041
25-1042
25-1043
25-1044
1+
2.90
1.90
6.90
1.90
2.90
1.90
3+
2.85
1.85
6.75
1.85
2.85
1.85
516934
Spiral Bound – Craze PP Project
Books
Spiral
4GƁNN2
Project books with
polypropylene cases
from the nuco Craze
Range.
• Side black spiral
bound
• 200 pages
• 80gsm
• Colours may vary
• Available in A5 and
A4 sizes
Type
A5
A4
Type
A4
A5
Reporter’s
A7
These pun
TGƁNNRCFU
and margi
perforated
removal.
• A4
• Ready p
• 150 per
• 8mm ru
• Wirebou
• Supplied
Order code 1+
06-8756 1.32
06-8755 2.46
Type
Pack of 5
523672
Elite PU Casebound Notebooks
Casebound – Elite PU Jotters
Nu-co Elite PU
Casebound Books
are note books with
a polyurethane case
from the nuco Elite
range.
• Side bound
• 160 pages
• 100gsm
• Premium quality
wood-free paper
• Ruled and margin
• B5 available in
black; A4 available in pink or black
Size
B5
A4
A4
Colour
Black
Pink
Black
Order code 1+
06-8738 3.29
06-8735 3.97
06-8736 3.97
Size
A7
A7
Colour
Pink
Black
Casebound – Sweet Shop Perfect
Bound Notebooks 160 Pages
These bound notebooks from Silvine look good enough
VQGCV'CEJPQVGDQQMJCUCEQXGTRKEVWTGKPXQNXKPI
products straight from the sweet shop - from jelly beans
to dolly mixture.
• Available in a choice of 3 sizes
• 80 Sheets, 160 lined pages
• Quality 75g paper
• Perforated
• Flexible binding
• Durable laminated covers featuring “sweet shop”
designs
Order code 1+
06-8741 1.34
06-8742 1.34
Assorted covers selected at random.
Colour of notebook covers
supplied will be selected at random.
Size
A4
A6
Spiral Bound – Elite PP Notebook
Order code 1+
06-0383 1.49
06-0387 0.59
530052
A range of note books
with polypropylene
cases from the nuco
Elite Range.
• Side spiral bound
• Ruled and margin
• Perforated
• 160 pages
• 100gsm
Colour
Pink
Black
Pink
Good prep
is the secr
success a
lead a bus
To Do Toda
from Silvin
be just the
get you org
+FGCNHQTVJ
home, sch
workplace
A4 pad co
80 lined a
sheets to e
you to prio
workload.
• 80 white
• Each pa
• Column
Complet
• Easy tea
These Twinwire
Notebooks from Silvine
have polypropylene
covers making them
more robust and
resistant to damage
than regular notebooks.
The covers are available
in a range of pastel
shades - blue, purple,
pink, green and orange
- and in three sizes.
• 80 sheets, 160 pages
• Lined
• Twin wire bound
523667
Size
A7
A7
A4
Pad – T
Spiral Bound – Twinwire Polyprop
Notebooks
A7 Jotter Pads with
polyurethane cases
from the nuco Elite
Range.
• Header bound
• 100 pages
• 100gsm
• Available in pink
and black
523666
678
Spiral Bound – Craze PP Notebooks
• Paper m
• 100% w
• Wipeab
• Great fo
• Tough a
• Very sm
• Environm
and alka
• Uses no
• Recycla
• Ruled a
• Hard co
• 160 pag
• Availabl
Spiral Bound – Tradie Tough Paper
made from Stone Notebooks
Order code 1+
06-8749 0.39
06-8750 0.428
06-8743 2.08
523668
New products
www.rapidonline.com
These Tradie
notebooks and
notepads contain
exceptionally tough
‘paper’ made from
stone bonded with
a small amount of
plastic. The bonding
process forms an
exceptionally strong,
water-resistant paper
able to withstand the rigors of outdoor and industrial use,
making it ideal for use by tradesmen.
This unique, innovative paper is made from ground
limestone, the world’s 4th most plentiful mineral and is
EQORNGVGN[VTGGHTGG6QWIJGPQWIJHQTVJGLQDDWVGCU[
on the environment.
Tel: 01206 751166 Fax: 01206 751188
Type
80 sheets
Pad – A
4GƁNN2
These Silv
'EQPQO[4
offer great
for money
ideal for u
ENCUUTQQO
workplace
Available i
narrow line
versions.
• A4 size
• 200 dou
sheets
• Punched
JQNGUVQ
UVCPFCTF
Stationery 679
books
523671
• Paper made from stone
• 100% water-proof
• Wipeable
• Great for writing outdoors
• Tough and durable - resistant to tearing
• Very smooth writing surface
• Environmentally friendly - free from bleaches, acids
and alkalis
• Uses no water and 50% less energy in manufacture
• Recyclable and biodegradable
• Ruled and perforated
• Hard covers
• 160 pages
• Available in A4, A5, A7 sizes and a reporter’s notebook
Type
A4
A5
Reporter’s
A7
Order code
06-0089
06-0090
06-0093
06-0091
1+
4.07
3.05
2.03
1.28
525314
#TGƁNNRCFUYKVJOO
squared ruling.
• Each sheet ruled with 5mm
squares
• 80gsm high quality white
paper
• Perforated for easy tear
• 4-hole punched
• Headbound
• 80 sheets per pad (160
pages)
• Supplied in packs of 6
Type
2:10:20mm - pack of 6
Order code 1+
06-0463 1.49
Order code 1+
34-9440 4.99
079856
These punched A4
TGƁNNRCFUCTGOO
ruled with margin
and are available
with binding at the
top or at the side.
• Ready punched
• 8mm lined with
margin
• 80 leaf pads are available in packs of 10 of either
sidebound or headbound format
• A 200 leaf sidebound pad is also available, supplied
in packs of 5
Type
Headbound 80 leaf
Sidebound 80 leaf
Sidebound 200 leaf
Good preparation
is the secret to
success and if you
lead a busy life this
To Do Today Pad
from Silvine could
be just the thing to
get you organised.
+FGCNHQTVJGQHƁEG
home, school or
workplace, this handy
A4 pad contains
80 lined and ruled
sheets to enable
you to prioritise your
workload.
• 80 white A4 sheets
• Each page headed Things To Do
• Column headings: Priority, Task, Deadline and
Completed
• Easy tear
Order code 1+
34-9422 7.69
34-9424 6.59
34-9420 7.79
079851
17
Flipchart – Numeracy
#ƂKREJCTVUYKVJOO
square ruling ideal for
aligning numbers in
hundreds, tens and units, etc.
• Perforated sheets for tidy
removal
• 30 sheets
• 50mm squares
• Blank on reverse
• Supplied in packs of 5
Type
0WOGTCE[ƂKREJCTVU
Stationery
Order code 1+
34-9428 11.49
079853
Type
80 sheets
#6QRDQWPF4GƁNN2CF
5mm Squares
Flip Chart Paper
Pad – To Do Today Pad 80 Sheets
530052
These Rhino premium
grade A4 headbound
graph paper pads are
ideal for technical
drawing as well use in
mathematics.
• Ruling 2 : 10 : 20mm
squared
• 75gsm
• 50 sheets
• Each sheet has graph
ruling on one side
and is plain on the
other
• Supplied in packs
of 6
• Rhino type HAG2
2CFs2WPEJGF#2CRGT4GƁNN2CFU
523672
rop
A4, 2:10:20mm Graph Paper Pads
530448
These punched wirebound
TGƁNNRCFUJCXGOOTWNKPI
and margin. Each leaf is
perforated for easy and tidy
removal.
• A4
• Ready punched
• 150 perforated leaves
• 8mm ruling with margin
• Wirebound
• Supplied in packs of 5
Type
Pack of 5
530048
Type
5mm squared pad
Spiral Bound – Wirebound A4
4GƁNN2CFU
Order code 1+
06-0347 1.59
06-0357 1.59
Education
ct
Type
Lined
Plain
Order code 1+
34-9410 22.19
079979
2CFsUJGGV#4GƁNN2CFU
Flipchart – Music
These premium quality
4JKPQ#TGƁNNRCFU
meet the BSI standard
educational quality.
• 320 pages (160 sheets)
• Sidebound
• Supplied in packs of 3
#ƂKREJCTVUYKVJOWUKE
manuscript ruling.
• Perforated sheets for
tidy removal
• 30 sheets
• 5 staves per sheet
• Blank on reverse
• Supplied in packs
of 5
Order code 1+
06-0321 8.29
530045
Type
Pack of 3
aper
strial use,
und
l and is
DWVGCU[
Order code 1+
34-9432 4.99
Type
/WUKEƂKREJCTVU
Order code 1+
34-9406 22.19
079854
Pad – A4 Topbound Super Economy
4GƁNN2CFU
These Silvine Super
'EQPQO[4GƁNN2CFU
offer great value
for money and are
ideal for use in the
ENCUUTQQOQHƁEG
workplace or home.
Available in lined,
narrow lined or blank
versions.
• A4 size
• 200 double-sided
sheets
• Punched with 4
JQNGUVQƁVOQUV
UVCPFCTFƁNGU
079977
Page 696
+++ BEST SELLER +++
White Presentation
Ring Binder Folders
+++++++++++
www.rapidonline.com sales@rapidonline.com
679
680 Stationery
Adhesives
1HƁEG)NWG2GP
Paper Glu – Sponge Tipped Pen
Education
Twin Tip Clear Glue
Stationery
17
Snopake general purpose clear paper glue in a handy
twin-tip dispenser.
The glue is ideal for sticking paper and card as it is
RGTHGEVN[ENGCT(QTDGUVTGUWNVUUGNGEVVJGƁPGVKRYJGP
precise application of a small amount of glue is required.
For larger areas, select the broad tip. The amount of glue
dispatched can be controlled by squeezing the barrel.
• General purpose paper glue
• Handy twin-tip dispenser
• Sticks paper and card
• 5GNGEVVJGƁPGVKRHQTUOCNNCOQWPVUQHINWG
• Select the broad tip for larger areas
• Washable, safe and non-toxic
• Contains 28ml
• Also available as a classpack of 64 in a shallow
Gratnells Tray.
Type
Twin tip clear
Classpack of 64
Order code 1+
06-7079 0.39
06-7075 23.18
518238
These glue sticks
offer excellent value
for money and are
suitable for use in
the home, school or
QHƁEG
• Manufactured in
Europe using PVP
– this gives a shelflife approximately
3 times longer
than standard PVA
gluesticks
• Ideal for children – non-toxic, acid-free, solvent-free
and completely washable
• Suitable for sticking paper, card and photos
• Available in 10g, 20g and 40g size – supplied singly
Type
10g Gluestick
20g Gluestick
40g Gluestick
Type
Paper glue
Order code 1+
52-0754 0.19
52-0758 0.34
52-0762 0.54
071604
Type
Glue pen 60g
Order code 1+
06-0276 1.61
525440
Order code 1+
52-1054 1.35
6+
1.01
Mini Pritt Stick Glue Sticks
Pritt Stick is the ideal glue adhesive
for a clean, quick and accurate way of
sticking paper, cardboard and photos,
and a host of art and craft materials.
• The world market leader and the
originator of the glue stick
• The small size is well-suited for
children and for glueing smaller
areas, edges, and corners
• Supplied in packs of 10x 11g tubes
This pen-style glue dispenser from Uhu is ideal
for use by children.
• Sticks paper and cardboard fast
• Solvent-free
• Ideal for collages, scrapbooking and much
more
• Clean and convenient
• CE marked
• Contents 50ml
• Available singly and in packs of 20
Type
Single
Pack of 20
R
Rubbe
A handy p
bands on
• Display
to see s
• 5 sizes:
& 18
• Helix ty
• Approxi
Order code 1+
34-5805 0.89
34-5804 15.74
080947
Type
Band pack
Order code 1+
06-7719 6.25
080255
Adhesive
Glue Sticks
The original stick of solid glue adhesive, for
sticking paper and card.
• Washable
• Non-toxic
• Solvent free
• Dries clear
• Supplied singly in 11g, 20g, 40g and
90g sticks
Type
Pritt Stick 11g
Pritt Stick 20g
Pritt Stick 40g
Pritt Stick 90g
Order code
87-6013
87-6026
87-6028
87-6030
RV
Copydex is a strong water based
adhesive, which is solvent free and
safe for crafts, fabrics, carpets and
DIY.
• Ideal glue for use on paper, card,
metal, cork and fabric
• Great for art, craft and technology
projects
• Available in 125 and 250ml
bottles
Rubbe
A choice o
IGPGTCNWU
• Supplied
1+
0.598
1.10
1.40
2.79
Type
125ml
250ml
Order code 1+
87-6032 2.68
87-6033 5.34
066894
White PVA Glue
Type
White PVA glue
Power Pritt Glue Sticks
Type
Power Pritt 20g
077494
680
Glue Rollers
A new addition to the Pritt stick range, Power
Pritt is designed for use when a powerful
bond is required.
• Ideal uses: paper, card, metal, plaster,
wood and plastics
• 20g stick
• Supplied singly
Order code 1+
52-1084 1.34
Use this U
Roller for f
precise pe
paper, car
to each ot
smooth su
has an int
standing s
The roller (
plastic and
recycled c
• For fast,
• Tape ca
Glue Pen
066893
Bostik White PVA Glue is an
all-purpose PVA adhesive.
• Dries clear to a permanent,
colourless bond
• Non toxic
• Re-sealable top
• Designed to bond a variety
for surfaces such as wood,
fabrics, and paper
• Ideal for models, masks and
other craft work
• Particularly easy for children
to use.
• Water based, cleans up with
warm soapy water
• Supplied in 118ml bottles
Dry &
Perma
Type
Roller Glue
077413
Type
10x 11g
Glue Sticks
The UHU Solvent-free
QHƁEGRGPEQPVCKPU
fast drying paper glue
for economical and
clean application. The environmental-friendly, solvent free
glue bonds paper and cardboard without wrinkling and
washes out in cold water.
• Solvent-free adhesive with a practical and economical
applicator
• Fast drying - does not wrinkle paper
• Glues paper, cardboard, labels, photos, etc.
• Pen contains 60g of glue
Blu-Tack Paper Glu is a
sponge-tipped pen containing
solvent-free paper glue and is
ideal for paper and card.
• Water-based polyvinyl
alcohol solution
• Glue is characterised by its
safe, non-toxic nature and is
PQPƂCOOCDNG
• Does not settle and has easy
application
• 1WVUVCPFKPIYGVCPFFT[
adhesive
• Easy to use and easy to
clean up
• Washes out of fabric even
when dry
• Supplied in 50ml tubes
• CE approved
These novel glue
dispensers lay down a
strip of adhesive as they
are dragged against a
surface.
• For permanent glueing of paper, card, etc.
• Ideal for photos, scrapbooking and wrapping presents
• 2GTHGEVHQTQHƁEGUEJQQNCPFJQOG
• Compact design
• Clean and easy to use
• Solvent and acid free
Order code 1+
87-6038 1.20
066911
Type
Permanent
2GTOCPGPVTGƁNN
Tel: 01206 751166 Fax: 01206 751188
Order code 1+
06-7706 2.62
06-7710 1.87
Size
No 10
No 14
No 16
No 18
No 19
No 22
No 24
No 30
No 32
No 33
No 34
No 35
No 36
No 38
No 63
No 64
No 65
No 69
No 75
No 89
…a
ww
080253
Stationery 681
RVFM
Dry & Clean Glue Roller
Permanent
olvent free
ing and
onomical
525440
Use this UHU Dry & Clean
Roller for fast, clean and
precise permanent gluing of
paper, cardboard and photos
to each other and to many
smooth surfaces. The roller
has an integrated cap for protection of the tape, a selfstanding support and a tape tightening screw.
The roller (excluing the tape) is made from 80% recycled
plastic and the packaging is made from more than 85%
recycled cardboard. The glue is solvent-free.
• For fast, clean and precise permanent gluing
• Tape can be tensioned using the adjusting screw
Type
Roller Glue
Order code 1+
06-0275 1.75
525439
Type
Tags
066929
RVFM
Foldback Clips
Neutral coloured rubber bands in assorted sizes and
thickness.
• 1HHGTKPIDQVJCHHQTFCDKNKV[CPFSWCNKV[
• 9KFGTCPIGQHUK\GU
UGGVGEJPKECNURGEKƁECVKQP
• Supplied in bags of 450g
Type
Rubber bands
Size
63mm x 1.5mm
76mm x 1.5mm
89mm x 1.5mm
76mm x 3.0mm
89mm x 3.0mm
102mm x 3.0mm
127mm x 3.0mm
152mm x 3.0mm
76mm x 6.0mm
89mm x 6.0mm
152mm x 6.0mm
#PGUUGPVKCNKVGOHQTCP[QHƁEGVJGUGHQNFDCEMENKRUCTG
useful in any situation.
• Available in 19mm or 32mm
• Available in either black or multicoloured packs
• Supplied in packs of 10
Order code 1+
34-3700 3.02
075633
Type
19mm black
19mm multicoloured
32mm black
32mm multicoloured
Order code
34-9230
34-9232
34-9234
34-9236
1+
0.293
0.394
0.596
0.899
080013
RVFM
Rubber Band Pack
080947
Order code 1+
34-5926 0.82
081101
RVFM
Rubber Bands
A handy pack of rubber
bands on a display dispenser.
• Display card makes it easy
to see sizes
• 5 sizes: 10, 12, 14, 16
& 18
• Helix type Q85040
• Approximately 75 bands
32mm Round Plain Paper Clips
General use, round, plain paper clips
of superior quality, ideal for home,
QHƁEGCPFUEJQQN
• Standard, plain round paper clips
• Made from durable, strong wire
• Superior gripping power
• Length: 32mm
• Supplied in boxes of 1000
Type
Large paper clips
Type
Band pack
17
Stationery
A handy pack of rubber
bands on a display dispenser.
• Display card makes it easy
to see sizes
• 5 sizes: 10, 12, 14, 16
& 18
• Helix type Q85040
• Approximately 75 bands
Order code 1+
06-0908 1.61
Education
Rubber Band Pack
Treasury Tags
Green cord, metal
ended treasury tags,
102mm.
• Supplied in packs
of 100
6GEJPKECNURGEKƁECVKQP
Type
No. 16
No. 18
No. 19
No. 32
No. 33
No. 34
No. 36
No. 38
No. 63
No. 64
No. 69
Rubber Bands
Type
Band pack
RVFM
Assorted rubber bands
Order code 1+
34-3980 1.60
066083
Order code 1+
34-5926 0.82
081101
A choice of popular sizes of rubber bands, ideal for
IGPGTCNWUGKPVJGJQOGQHƁEGUEJQQNQTYQTMUJQR
• Supplied in boxes weighing 454g
4+
066894
presents
Size
No 10
No 14
No 16
No 18
No 19
No 22
No 24
No 30
No 32
No 33
No 34
No 35
No 36
No 38
No 63
No 64
No 65
No 69
No 75
No 89
Dimensions (mm)
31.75 x 1.6
50.8 x 1.6
63.5 x 1.6
76.2 x 1.6
88/9 x 1.6
127 x 1.6
152.4 x 1.6
50.8 x 3.2
76.2 x 3.2
88.9 x 3.2
101.6 x 3.2
114.3 x 3.2
127 x 3.2
152.4 x 3.2
76.2 x 6.3
88.9 x 6.3
101.6 x 6.3
152.4 x 6.3
101.6 x 9.5
152.4 x 12.7
Order code
34-9970
34-9972
34-9973
34-9974
34-9975
34-3990
34-9977
34-9978
34-9979
34-9980
34-9981
34-9982
34-9983
34-9984
34-9985
34-9986
34-9987
34-9988
34-9989
34-9990
1+
3.02
3.02
3.02
3.02
3.02
3.32
3.02
3.02
3.02
3.02
3.02
3.02
3.02
3.02
3.02
3.02
3.02
3.02
2.72
3.02
…added daily, check our website
www.rapidonline.com
080253
RVFM
RVFM
Paper Fasteners
Self Inking Date Stamp
A press-down-action, selfinking date stamp.
• Date format DD MMM YYYY
• Text size approximately
4mm high
• 12-year date band
• Supplied complete with
replaceable black ink pad
066084
New products
Stamps & Ink
Pads
Paper Fasteners
These paper fasteners have been manufactured from
high quality brassed steel.
• Spear points for paper piercing
• Ideal for paper, card and corrugated sheet
• Available in 13, 19 and 25mm lengths
• Supplied in boxes of 200
Type
13mm Fasteners
19mm Fasteners
25mm Fasteners
Type
Self-inking date stamp
Order code 1+
34-9744 4.10
082120
No minimum order value
Order code 1+
34-3702 2.57
34-3704 3.02
06-0904 3.02
UK mainland only
075634
www.rapidonline.com sales@rapidonline.com
681
682 Stationery
RVFM
Multiword Self Inking Date Stamp
This self inking stamp
has multi words and
date. With a pressdown-action and 12
selectable words.
• Date format DD MMM
YYYY
• Text size
approximately 4mm
high
• 12-year date band
• 12 captions: PAID,
'/#+.'&74)'06
%#0%'..'&(#:'&4'%'+8'&#22418'&18'4&7'
4'8+5'&5*+22'&%*'%-'&CPF%1/2.'6'&
• 5WRRNKGFEQORNGVGYKVJTGRNCEGCDNGDNWGTGFKPMRCF
Type
12-in-1 Date stamp
Order code 1+
34-9748 6.34
Education
082122
Stationery
17
The Clix Stamper is a
retractable ballpoint
pen with built-in
stamp. Available in a
variety of fun, positive
stamp styles these
pens are a quick and
convenient method
for teachers to
provide motivation in
an exciting way.
• 0.7mm ballpoint
pen
• Side click advance and retract mechanism
• Pocket clip
• 9mm, long-life, pre-inked stamp can give up to 5,000
impressions – no need for a stamp pad
• Suitable for stamping on most surfaces
• 5PCRƁVUVCORECR
This assorted
pack of 12 unique
rubber stamps are
a fun and easy
way to incentivise
children. They are
ideal for school
teachers and
are excellent
motivational tools.
• Represents
great value for
money
• 12 different
stamps provide
a varied way
of saying well
done
• No stamp pad required - pre-inked and re-inkable
• 100,000 impressions before re-inking is required
• Quick, clean and fun
Type
Good work
Gold star
Blue star
Motivational Stamps
These unique rubber
stamps are a fun
and easy way to
incentivise children.
They are ideal for
school teachers
and are excellent
motivational tools.
See technical
URGEKƁECVKQPHQT
designs.
• No stamp pad
required – pre-inked
and re-inkable
• 100,000 impressions before re-inking
is required
• Quick, clean and fun
• Stamp diameter approx. 25mm
Order code
06-0954
06-0956
06-0960
06-0962
06-0964
06-0966
06-0978
06-0984
Order code 1+
06-0988 3.70
06-0996 3.52
06-0998 3.52
With a blu
page regis
and a 75m
• Size A4
• 50 entri
Type
Register & m
Type
Visitors book
The Xstamper 3 in 1 is a value for money, compact and
convenient way to motivate children in a fun and positive
way.
• Pre-inked and re-inkable
• Each message stamp gives up to 100,000 impressions
before re-inking is required
• Three popular messages in one Xstamper
• Messages are easily changed by the turn of a wheel
• 06-1000: )QQFYQTMMGGRKVWR/WEJKORTQXGF
Excellent effort
• 06-1002: Excellent work, Brilliant & Great improvement
Type
Xstamper Good work
Xstamper Excellent
079991
Adjust
This adjus
foot rest w
to maintai
comfortab
at the wor
The foot re
be adjuste
of two heig
or 105mm
HTGGƂQCVKP
allows the
stretch for
• Textured
tension
• +PENWFGU
• HxWx
This 24 page attendance register has a red manilla
cover. With 70gsm white paper which is ruled with 5mm
squares and a 75mm wide margin on each double page.
• 326 x 205mm
• 50 entries
Type
Attendance register
Order code 1+
34-9146 2.24
079988
Order code 1+
06-1000 16.01
06-1002 15.63
071935
Dinner Register
This dinner register has a buff manilla cover with 70gsm
Star Stamps
Xstamper star
stamps are a
quick and easy
YC[VQƁNNKP
registers, annotate
work, art projects,
etc.
• Pre-inked and
re-inkable
• Protective dust cap
• Metal pocket clip
1+
2.35
3.20
2.35
2.99
2.99
2.99
2.35
3.20
071920
Type
Star stamp red
Star stamp gold
De
Order code 1+
34-9152 15.95
Attendance Register
3 in 1 Motivational Stamps
071921
Type
Smiley face
Gold Star
Excellent
Very Good
Well done
Brilliant
Good effort
Good work
Visitors Book
071929
Order code 1+
06-0986 33.75
Registe
This visitors book is ideal for reception desks at schools,
colleges, hotels or other workplaces.
• Blue PVC cover
• 50 sheets, ruled for 18 entries per page
• Sheet size 210 x 297mm
Motivational Stamps Pack
Type
Stamps pack
Type
Adjustable fo
A4 Wor
This works
document
is an ease
copyholde
can hold u
125 sheet
The stand
removable
for highlig
and a pap
for secure
copy.
• Black
• Track de
user to p
guide an
• Easel ba
HQNFUƂC
• Holds u
• HxWx
Type
Copyholder
Order code 1+
06-1018 3.70
06-1020 4.76
Order online
Activate your account for online ordering. For further information:
www.rapidonline.com/activate
682
Visitor Books
Clix Stampers Pens with
Motivational Stamps
071937
white paper. The inside pages are ruled with 5mm
squares and a 75mm wide margin on each double page.
• 380 x 203mm
• 12 pages
• 60 entries
Type
Dinner register
Tel: 01206 751166 Fax: 01206 751188
Order code 1+
34-9148 2.15
079989
N
Stationery 683
Type
Handi-Holder coloured
Handi-holder easy view
Register & Mark Book
Desktop Paper Stands
With a blue manilla cover and white wove paper this 48
page register and mark book is ruled with 5mm squares
and a 75mm wide margin on each double page.
• Size A4
• 50 entries
122693
A fun and useful
desktop paper stand
that can hold up to
30 sheets ofpaper.
• Compact desktop
accessory
• Available in blue
or black
• Manufactured in
plastic
• Dimensions 48 x
75 x 63mm
Type
Paper stand blue
Paper stand black
Eco Friendly Maxi-File
Order code 1+
45-1227 3.15
45-1228 3.15
517001
Order code 1+
34-9150 1.79
079990
schools,
Desk Tidies
Desk Accessories
079991
This adjustable
foot rest will help
to maintain a
comfortable posture
at the workstation.
The foot rest can
be adjusted to one
of two heights 85
or 105mm and the
HTGGƂQCVKPIRNCVHQTO
allows the legs to
stretch for increased circulation.
• Textured surface massages soles of feet to relieve
tension
• +PENWFGUXCTKCDNGVKNVECPPQVDGƁZGF
• H x W x D 74 x 448 x 330mm
nilla
th 5mm
ble page.
Type
Adjustable foot rest
Type
Maxi-File
122686
h 70gsm
Type
Blue Desk Tidy
Black Desk Tidy
Magazine File
Order code 1+
34-5520 2.69
34-5522 2.69
078713
Order code 1+
45-1231 16.99
517004
RVFM
This workstation
document holder
is an easel type
copyholder that
can hold up to
125 sheets of A4.
The stand has a
removable line guide
for highlighting text
and a paper holder
for securely holding
copy.
• Black
• Track design allows
user to position line
guide and paper holder along the top or side
• Easel back extends for height and angle adjustment or
HQNFUƂCVHQTGCU[UVQTCIG
• Holds up to 125 sheets of paper at a time
• H x W x D 272 x 262 x 190mm
Order code 1+
45-1229 7.89
517002
Volume pricing
Need to buy larger quantities?
Contact us now for a
volume pricing quotation
01206 751166
This value pack of
handy pen pots
are suitable for
storing pencils,
pens, paint
brushes, rulers,
scissors and
much, much more.
• Made from
tough, breakresistant plastic
• Colours may vary
• Supplied in packs of 12
Type
Packs of 12
#ƁNGYJKEJ
accepts both
A4 and foolscap
documents,
magazines, square
cut folders and
document wallets.
• Available in
Black, Blue or
Red
Type
Black
Blue
Red
Desk Pots
Type
Copyholder
m
ble page.
RVFM
An attractive and highly functional desk tidy.
• Five compartments and two scoop trays
• Central tube provides storage for a mobile phone
• Ideal for storage of stationery sundries
• 5WKVCDNGHQTVJGJQOGQTQHƁEG
• Available in blue or black
• Helix types R40076 & R40077
A4 Workstation Copyholder
079988
Order code 1+
06-8524 14.99
17
Stationery
Adjustable Foot Rest
Made from
recycled plastic,
this versatile
equipment
can be used
for carrying
documents
and also for
document
storage. The unit
KUƂCVRCEMGF
and has easy to
follow assembly
instructions.
6JGTGCTGƁXGFKXKFGTUKPOOKPETGOGPVUCPFECTT[KPI
handles, making this case highly adaptable to a wide
range of uses.
• Eco friendly
• Strong yet very light
• Truly portable
• Built-in carrying handles
• Huge capacity
• Takes extra large documents
• Highly adjustable and adaptable
• Dimensions (H x L x W) 265 x 360 x 228mm
• Suitable for all ages
Education
Type
Register & mark book
Order code 1+
06-8542 6.95
06-8544 6.95
Order code 1+
34-9108 2.21
34-9110 2.21
34-9112 2.21
079993
WOW A4 Magazine Files
Order code 1+
34-9918 9.49
122479
Handi-Holder Storage Unit Desk Tidy
A portable and
versatile storage unit
with six removable
triangular pots for
the ultimate in
organisation. Ideal
for pencils, brushes,
rulers, paper clips,
and much more.
• Complete with
handle
• Sturdy and wash proof
• Available in fun coloured or clear easy view versions
• Suitable for all ages
These top-quality magazine
ƁNGU from the Leitz919TCPIG
have a stylish sleek design
incorporating a choice of
vibrant contemporary colours,
each with a glossy metallic
ƁPKUJ1HHGTKPIUVTGPIVJCPF
FWTCDKNKV[VJGUGƁNGUCTG
ideal for keeping magazines,
catalogues and other printed
material neat and tidy in the
QHƁEGENCUUTQQOQTJQOG
• Thumb hole enables easy
pull-out from crowded of
high shelves
• Made from polystyrene
• Dimensions 312 x 258 x 75mm
Type
Pink
Blue
Green
Assorted set of 6
Order code
06-9779
06-9780
06-9781
06-9782
1+
3.19
3.19
3.19
18.95
530879
…where price meets quality
079989
www.rapidonline.com sales@rapidonline.com
683
684 Stationery
RVFM
Card Index Boxes
Type
Black box
Blue box
Record cards
Order code 1+
35-2550 1.97
35-2552 0.455
Education
Stationery
122459
Shatter Resistant Plastic Ruler
30cm/12in – Recycled Pack
Recoil Key Ring
9CNNƁNG2QTVCDNG9CNN*CPIKPI
7-Pocket Organiser
A 25mm keyring on an
extending nylon coated
stainless steel cord.
The cord recoils into a
circular plastic fob, with
a belt clip on the reverse
side.
• Key ring cord extends
up to 650mm
• Self-recoiling
• Belt clip on reverse
side of key fob
• Ideal for security
passes, keys, small
tools, etc.
• Dimensions 15 x 50mm dia.
Type
Recoil key ring
This compact and adaptable
A4 wallet doubles as a
portable or wall-hung
QTICPKUGTFKURNC[U[UVGO6JG
wallet features seven pockets
with index strips and reinforced
wall hanging rings. It is ideal
HQTƁNKPIOCKNUQTVKPILQD
records, brochures or as a
seven day organiser.
• Available in black
• Space-saving portable
organiser
• Tough polypropylene
construction
• Front fastening
• Seven pockets with index
strips
• Reinforced wall hanging rings
• (NGZKDNGƁNKPIUQNWVKQPUCV
home or at work
Order code 1+
34-5466 0.853
Order code 1+
34-9888 14.99
A high quality 30cm ruler clearly graduated in both
OKNNKOGVTGUCPFKP)TCFWCVKQPUUVCTVHTQOVJGXGT[
end of the ruler permitting measurement from an edge.
• Anodised aluminium construction
• Non-slip rubber insert on rear
• Bevelled edges
• Convenient hanging hole
• Width 35mm
Type
30cm Aluminium ruler
Plastic
Pack o
Order code 1+
34-2662 1.24
5+
1.16
Shatter res
and imper
• Bevelled
• Availabl
• Supplied
Type
30cm clear r
15cm clear r
070842
This high quality and
reliable quartz wall
clock is made from
recycled plastic.
• Eco friendly
• Diameter 226mm
(Approximately 9
inches)
• Depth 45mm
• Guaranteed clock
movements
• Easy to read
numerals
• Clock face is 12-hour format
• Quality domed lens
• Complete with battery
Type
Eco friendly wall clock
Fingerg
30cm/
Aluminium Ruler – 30cm/12in
Eco Friendly 9 inch Wall Clock
516933
Type
300mm Safe
Type
Fingergrip rul
122461
073755
Order code 1+
25-1035 4.74
Brightly coloured shatter resistant rulers made from
recycled computer printers.
• 30cm length showing metric one side, imperial the
other
• Supplied in packs of 100
• 25 each of red, yellow, blue and green
Type
Pack of 100 assorted
A metal ru
ƁPIGTUCTG
• Ideal for
• Incorpor
• Helix ty
An easy to
due to the
• Millimet
• Clear pl
• 30cm lo
• Supplied
Order code 1+
34-9196 2.51
080006
530878
Order code 1+
34-9886 15.99
1HƁEG$KPU
Type
Black
Order code 1+
06-9776 2.19
06-9777 2.19
06-9778 2.19
Shatter resistant rulers in popular bright colours.
• 30cm length showing metric on one side and imperial
the other
• Supplied in an assorted pack of 100
• 25 each of red, yellow, blue and green
Type
Pack of 100 assorted
A simple, elegant bin with
tapered walls that is made
from robust polypropylene
but lightweight.
• 298 x 314mm
• Colour Black
You’ve got mail... but you
need somewhere to put it.
Leitz has the answer with
these A4 letter trays from
VJG919TCPIG&GUKIPGF
for strength and durability,
these robust trays are
available in a choice of 3
striking metallic colours
with a stylishly glossy
ƁPKUJ
• High side walls allow for
larger than average capacity
• Vertical stacking allows easy organisation
• Easy access via large front opening
• Internal dimensions 330 x 242 x 60mm
• Stackable up to 10 high
Type
9CNNƁNGDNCEM
Order code 1+
34-9206 4.43
34-9204 4.43
34-9208 2.01
RVFM
WOW A4 Letter Trays
Type
Pink
Blue
Green
Shatter Resistant Plastic Ruler
30cm/12in – Pack of 100
080007
066975
17
Metal
Card index boxes for storing
up to 250 record cards make
indexing simple.
• Record cards and guide
cards available
• 152 x 102mm
• Record cards supplied in
packs of 100
• Guide cards tabbed A - Z
A high quality,
robust and
functional A4
letter tray, ideal
for organising
paperwork at home
or work.
• 1RGPUJQTVUKFG
• Dimensions: 255
x 365 x 50mm
• Colour: black
• Supplied singly
• Riser rods (115mm long) are available separately
in packs of 4 to allow trays to be stacked
Type
Letter tray (single)
Risers (pack of 4)
Rulers
RVFM
Expandable Foolscap Letter
Tray System
Translu
Shatter-Resistant Plastic Ruler
30cm/12in
6JKUVTCPUN
ruler can b
direction.
• Unbreak
UWKVCDNG
and edu
applicat
• 30cm le
• Helix ty
Standard, transparent shatter-resistant 30cm (12 in)
rulers.
• Graduated in both inches and millimetres
• 30cm length
• Helix type L16
Order code 1+
06-8510 9.89
122681
Type
300mm Ruler
Type
Flexible ruler
Order code 1+
34-2660 0.62
061901
Page 651
Save
ww
%R[ÀOHV
684
Tel: 01206 751166 Fax: 01206 751188
Stationery 685
Self-adhesive Notes
Metal Safety Ruler 30mm/12in
r
s.
imperial
122459
Rainbow Notes
A metal rule with a recess down the centre, so that
ƁPIGTUCTGRTQVGEVGFYJGPWUGFHQTEWVVKPIYQTM
• Ideal for use with knives or scalpels and cutting mats
• Incorporates non-slip foam backing for precision work
• Helix type T33010
Type
300mm Safety rule
Order code 1+
34-2664 3.95
061283
r
rom
Type
Fingergrip rulers (10)
al the
Order code 1+
34-9880 6.49
122454
122461
Plastic Shatter Resistant Rulers
Pack of 100
n
Type
Red
Blue
Yellow
Order code 1+
34-1926 2.30
34-1928 2.30
34-1930 2.30
300331
Original Yellow Sticky Pads
Shatter resistant clear ruler with metric rulings one side
and imperial the other.
• Bevelled edges
• Available in 15 or 30cm
• Supplied in packs of 100
Type
30cm clear ruler
15cm clear ruler
Order code 1+
34-9882 14.95
34-9884 9.99
122456
070842
Translucent Flexible Rule
r
6JKUVTCPUNWEGPVƂGZKDNG
ruler can bend in any
direction.
• Unbreakable ruler
UWKVCDNGHQTQHƁEG
and educational
applications
• 30cm length
• Helix type K47010
12 in)
Type
Flexible ruler 30cm
Post-it Note Cubes
A whole stack of
colourful Post-it notes
for when one pack
never seems enough.
• 76 x 76mm
• 450 sheets per
cube
Order code
34-1914
34-1916
34-1920
34-1922
17
1+
5.35
5.35
4.64
5.35
RVFM
Repositionable Note Cubes
Order code 1+
3+
34-1882 5.02 4.70
34-1884 10.83 10.44
Each cube of repositionable
notes has 5 assorted
vibrant colours.
• Will stick to most
surfaces
• Available in 50mm or
75mm
Size
50 x 50mm
75 x 75mm
Super Sticky Post It Notes
No. Sheets
250
400
Order code 1+
34-9872 0.99
34-9874 1.79
122447
Super Sticky Notes stick
RTCEVKECNN[CP[YJGTG6JG[CTG
ideal for vertical and hard-tostick-to surfaces, when you
need your message to stay put
and get noticed.
• Stands out and sticks
CTQWPF
• Size 76 x 76mm
• Extra-sticky notes stay put on
virtually any surface
• 90 sheets per pad
• Supplied in packs of 6 pads
Type
Super sticky yellow
1+
7.06
9.71
9.71
9.46
300329
300322
oth
VJGXGT[
n edge.
Order code
34-1902
34-1908
34-1910
34-1912
300328
Type
Pastel pink
Pastel blue
Neon pink
Neon green
The original self-stick
PQVG
• No more mislaid
messages
• Will stick to almost
any surface
• Can be removed
without trace
• 100 sheets per pad
• Supplied in packs
of 12 pads
Type
Yellow 38 x 51mm
Yellow 76 x 76mm
Type
Warm neon 76 x 76mm
Warm neon 76 x 127mm
Cool neon 76 x 127mm
Cool pastel 76 x 127mm
Stationery
An easy to grip, useful ruler ideal for the younger children
due to the raised centrepiece.
• Millimetres one side, centimetres the other
• Clear plastic
• 30cm long
• Supplied in pack of 10
6JGUGKPFGZƂCIUCTG
repositionable tabs
used for marking,
highlighting and
indexing important
information that you
need to refer to again
and again.
• Perfect for books, magazines, folders and catalogues
• Provides a quick and easy reference
• Transparent strip
• 25mm x 43mm
• Dispenser of 50 sheets
• Available in red, blue and yellow
• Supplied singly
Education
Fingergrip Plastic Ruler
30cm/12in
Standard Index Flags
Add a splash of colour to your
messages with these rainbow
notes from Post-it.
• Available in 76 x 76mm and
76 x 127mm sizes
• 100 sheets per pad
• Supplied in packs of 6
Recycled Repositionable
Note Cubes
Order code 1+
34-1898 8.61
300326
Quality sticky notes made
from 100% recycled paper
with minimum packaging to
cut down on materials used.
• 100 yellow sheets per
pad
• Supplied in packs of 12
• Available in 75x75mm or
75x125mm
Type
75 x 75mm
75 x 125mm
Order code 1+
34-9876 4.49
34-9878 5.95
122450
Super Sticky Ultra Yellow
Notes Cube
Order code 1+
34-2661 0.75
071596
061901
Order online
Save time, and place your order at:
www.rapidonline.com
24 hours a day
Super Sticky Notes stick
RTCEVKECNN[CP[YJGTG6JG[CTG
ideal for vertical and hard-tostick-to surfaces, when you
need your message to stay put
and get noticed.
• Stands out and sticks
CTQWPF
• Extra-sticky notes stay put on virtually any surface
• 350 sheets per cube
Type
Super sticky cube
Buying in bulk?
Get a quote and save money
on your order
01206 751166 or
sales@rapidelec.co.uk
Order code 1+
34-1900 5.35
300327
www.rapidonline.com sales@rapidonline.com
685
686 Stationery
Flash Cards
RVFM
RVFM
Education
Small Flash Cards – Assorted
Stationery
17
These brightly
coloured cards
are just the job for
making your own
ƂCUJECTFUCPF
are suitable for
many instructional
purposes.
• Ideal for schools
• Suitable for use
as vocabulary
ƂCUJECTFUQTVQ
learn important
subjects in
school
• $NCPMƂCUJECTFUECPCNUQDGWUGFHQTPQVGUTGEKRGU
craft projects, and more
• Supplied in 5 assorted colours; pink, yellow, blue,
green and salmon
• Flash card size 50(W) x 760(H)mm
• Suitable for Foundation and Key Stages 1 & 2
(ages 4 to 11)
• Supplied in boxes of 1000 (200 of each colour)
Type
#UUQTVGFƂCUJECTFU
Order code 1+
98-0200 5.95
074118
RVFM
Large Flash Cards – Assorted
These brightly
coloured cards
are just the job for
making your own
ƂCUJECTFUCPF
are suitable for
many instructional
purposes.
• Ideal for schools
• Suitable for
WUGCUXQECDWNCT[ƂCUJECTFUQTVQNGCTPKORQTVCPV
subjects in school
• $NCPMƂCUJECTFUECPCNUQDGWUGFHQTPQVGUTGEKRGU
craft projects, and more
• Supplied in 5 assorted colours: pink, yellow, blue,
green and salmon
• Flash card size 76(H) x 288(L)mm
• Suitable for Foundation and Key Stages 1 & 2
(ages 4 to 11)
• Supplied in boxes of 250 (50 of each colour)
Type
#UUQTVGFƂCUJECTFU
Order code 1+
98-0204 5.95
074120
RVFM
Kaleidoscope Long Sentence Strips
Perfect for any classroom, these pastel coloured sentence
strips are just the job for creating your desk nameplates
and word lists.
• Suitable for many instructional purposes
• Supplied in 5 assorted colours: pink, yellow, blue,
green and salmon
• All strips have a black baseline on the back
• Heavy paper construction
• 'ZCEVEQNQWTOCVEJHQTVJGCUUQTVGFƂCUJECTFU
QTFGT
codes 98-0200 and 98-0204)
• Dimensions 7.6 x 61cm with 3.8cm rule and 19mm
midline and 10mm descender space
• Suitable for Key Stages 1 & 2 (ages 5 to 11)
• Supplied in packs of 100 (20 of each colour)
Order code 1+
98-0208 4.45
074122
686
Type
Power hole punch
2 Hole Punch Paper – 010 to 040
Sheets Black
RV
1 Hole
Order code 1+
35-2602 6.50
077256
2 Hole Punch Paper – 065 Sheets
Black Rapid HDC65 High Capacity
5VCPFCTFQHƁEGRWPEJGUVJCVRTQFWEGJQNGUOO
CRCTVKPRCRGTHQTDKPFKPIKPDQZƁNGUTKPIDKPFGTUGVE
• Punching capacities from 10 to 40 sheets of 80gsm
paper
• Available with plastic or metal construction
• Colour: black
6GEJPKECNURGEKƁECVKQP
1TFGTEQFG
Material
Punching capacity (mm)
Punching capacity sheets (80gsm)
Dimensions (mm)
Weight (g)
Manuf’s Part No.
34-8174
Plastic
1
10
61 x 35 x 116
126
623674
34-8176
Plastic
2
20
83 x 44 x 103
194
623675
1TFGTEQFG
Material
Punching capacity (mm)
Punching capacity sheets (80gsm)
Dimensions (mm)
Weight (g)
Manuf’s Part No.
34-8178
Metal
3
30
114 x 52 x 122
441
623667
34-8180
Metal
4
40
114 x 60 x 153
643
623668
Size
10 sheets
20 sheets
10 sheets
20 sheets
Material
Plastic
Plastic
Metal
Metal
Order code
34-8174
34-8176
34-8178
34-8180
1+
1.54
1.92
2.99
5.34
518427
2 Hole Punch Paper – 020 Sheets
Black Rapid Eco
The Rapid Eco Punch
is an environmentally
friendly hole punch
with a punching
capacity of 20 sheets.
Each punch is 5.5mm
in diameter and they
are spaced at the
normal distance of
80mm. The Rapid Eco Punch’s environmental credentials
include being made from 100% recycled plastic, soybased printing and recycled cardboard packaging.
• Punching capacity 20 sheets
• Punch diameter 5.5mm
• Hole spacing 80mm
• 100% recycled plastic
• Soy-based printing
• Cardboard packaging
• Rapid type Eco Punch
Type
Eco Hole Punch
Type
Long sentence strips
• Large compartment for confetti
• Black colour
• Forty sheet capacity
• Hole diameter 5.5mm
• Hole distance 80mm
• Manufacturer’s 5-year guarantee
Hole Punches
Order code 1+
34-9525 3.95
The Rapid Metal
Lever Hole Punch
is a powerful metal
hole punch, ideal for
larger documents
and other heavier
duty applications.
• Paper guide
• Ergonomically
designed handle
in die-cast metal
• Lock down handle
for easy storage
• Large
compartment for confetti
• Black colour
• 5KZV[ƁXGUJGGVECRCEKV[
• Hole diameter 5.5mm
• Hole distance 80mm
• Manufacturer’s 5-year guarantee
Type
Hole punch
Order code 1+
35-2604 16.79
2 Hole Punch Paper – 150 Sheets
Rapid HDC150 High Capacity
A powerful hole
punch that is the
ideal addition to
any professional
QHƁEGYJGTGNCTIG
documents are
being prepared. Its
punching cutters
are made from the
highest quality steel.
• Self-centering
paper guide
• Power reduction
• Ergonomically
designed easy
grip rubber handle
• Large transparent confetti compartment
• Compartment for spare parts
• /CUUKXGQPGJWPFTGFCPFƁHV[UJGGVECRCEKV[
• Punching life 20,000 operations
• Hole diameter 5.5mm
• Hole distance 80mm
• Includes multi-language instruction booklet
• /CPWHCEVWTGToUƁXG[GCTIWCTCPVGG
• Spare disks and cutters are available separately
• Rapid type HDC150
Electri
106E A
Order code 1+
35-2606 59.26
35-2607 3.99
35-2609 16.99
RVFM
2 Hole Punch Paper – 040 Sheets
Black Rapid FMC40
A four-hole paper punch for A4 paper.
• 16-sheet capacity
• Handle can be locked down when not in use
• Adjustable paper guide
• Manufacturer’s 15 year guarantee
Type
4-Hole punch
Tel: 01206 751166 Fax: 01206 751188
These NeX
QHƁEGhole
from the L
range cert
above the
Smoothly
available i
vibrant co
2-hole pun
capable o
with up to
of paper a
• Sharper
• Strong g
• Hinged w
• Dimensi
• GS safe
• 10 year
Sta
4 Hole Punch Paper – 016 Sheets
A powerful metal
hole punch,
ideal for larger
documents and
other heavier duty
applications.
• Paper guide
• Lock down
handle for easy
storage
Type
Single hole p
Type
Pink
Blue
Green
077258
500427
Colour may
9190
Capac
077257
Type
Hole punch
Spare disks (10)
Spare cutters (2)
The RVFM
Punch (Sin
cost-effect
paper pun
• 8 sheet
• Lock-do
• Ideal siz
pocket
Order code 1+
34-5754 6.69
080033
The Rapid
an industr
electrically
stapler. It
quick and
stapling a
the deman
industry fo
operationa
CPFƂGZKDK
The Rapid
the perfec
for staplin
both loose
and broch
example, i
RTKPVKPIYQ
easily inte
ECPJCPFN
staplers ca
operations
'ECP
mode and
Free stand
106E elec
available f
• 230 to 2
• Staple d
• Adjustab
• Reliable
• Safe to
easy to
• 5VCPFCT
single h
Stationery 687
• User friendly - front-loading. Automatic or pedal
RVFM
•
•
•
•
1 Hole Punch Paper – 8 Sheets
077256
eets
acity
The RVFM Lever Metal Hole
Punch (Single-Hole) is a
cost-effective single-hole
paper punch.
• 8 sheet capacity
• Lock-down catch
• Ideal size for brief case or
pocket
Type
106E Electric
66/8 staples (5000)
Type
PressLess stapler
Order code 1+
35-2577 12.75
500423
Colour may vary from that shown.
Type
Single hole punch
Order code 1+
34-5756 1.55
9190G::V/GVCN1HƁEG5JGGV
Capacity, 2-Hole Punches
Type
Pink
Blue
Green
A professional quality,
extremely durable,
medium weight tacker
that features a high
impact force, recoilless
action and noise
damper. Its all-steel
construction, ergonomic
design and soft grip
make this machine ideal for tacking fabric, canvas,
NGCVJGTRQUVGTUGVEKPUEJQQNUGZJKDKVKQPUQHƁEGCPF
light industry.
• Lock function for safety
• .KHGVKOGVGUVGFHQTƁTKPIU
• Simple bottom loading
• (QTƁPGYKTGUVCRNGU
• %CRCEKV[ZUVCRNGU
• Manufacturer’s two year guarantee
Type
Metal tacker
Order code 1+
35-2588 21.38
077247
Electric Stapler – 25 Sheets Black
with Low Staple Indicator
A professional,
mains-powered stapler
HQTOQUVQHƁEGCPF
printroom applications.
• Single-handed
operation
• Fast push-button
front staple loading
• Low staple indicator
light
• 25 sheet stapling capacity
• Anti-jam and anti-twist feature
• Rotating anvil for stapling or pinning
• 25mm stapling depth adjuster
• 6CMGUWRVQZQTUK\GUVCRNGU
• Manufacturer’s 2-year guarantee
Type
Electric stapler
17
Order code 1+
34-5758 61.99
080035
RVFM
Long Arm Stapler 40 – Sheets
Order code 1+
06-9796 5.95
06-9797 5.95
06-9798 5.95
Half & Full Strip Staplers
20 Sheets Black
Stationery
These NeXXt metal
QHƁEGhole punches
from the Leitz WOW
range certainly punch
above their weight.
Smoothly styled and
available in three
vibrant colours, these
2-hole punches are
capable of dealing
with up to 30 sheets
of paper at a time.
• Sharper stamps reduce punching effort
• Strong guide bar ensures perfect paper alignment
• Hinged waste box makes emptying easy
• Dimensions 137 x 107 x 100mm
• GS safety tested
• 10 year guarantee
RVFM
R23 Metal Tacker
Education
eets
Order code 1+
34-2587 359.99
35-2619 3.29
500431
080034
077257
• 6CMGU4CRKF5WRGTUVTQPICPFUVCRNGU
• 5WRGT(NCV%NKPEJvD[RCUUU[UVGO
• Rapid patented technology
• TGFWEGFRCRGTUVCEMUFWGVQƂCVVGTUVCRNGU
• 2 to 60 sheet capacity using only 1 staple type
• 2TGUU.GUUvNGXGTVGEJPQNQI[
• Up to 50% less effort than standard
• Stapling depth 50mm
• Rapid type S60
controlled stapling
Supplied with foot pedal as standard
Two or more 106E staplers can be linked for
simultaneous stapling
6CMGU4CRKFUVCRNGU
Rapid type 106E
530883
Staplers & Tackers
Electric Stapler – 40 Sheets Rapid
106E Automatic or Pedal Controlled
ely
077258
eets
080033
The Rapid 106E is
an industrial grade
electrically operated
stapler. It offers
quick and silent
stapling and meets
the demands of
industry for strength,
operational reliability
CPFƂGZKDKNKV[
The Rapid 106E is
the perfect choice
for stapling of
both loose sheets
and brochures, for
example, in schools,
RTKPVKPIYQTMUKPFWUVTKCNYQTMUCPFQHƁEGU6JCPMUVQKVU
easily interchangeable insert staplers, the Rapid 106E
ECPJCPFNGDQVJƂCVCPFUCFFNGUVCRNKPI6YQQTOQTG
staplers can be connected together to allow several
operations to be carried out simultaneously. The Rapid
'ECPUVCRNGWRVQUJGGVU
IUOKPƂCVUVCRNKPI
mode and 20 sheets (75gsm) in saddle mode.
Free standard post and packing is available on the Rapid
106E electric stapler, or a Next Day Delivery Service is
available for urgent requirements.
• 230 to 240V, 50Hz operation
• Staple depth variable up to 100mm
• Adjustable stapling depth and variable impact force
• Reliable operation, long service life
• Safe to use - stapling head guard and clearly visible,
easy to access stapling zone
• 5VCPFCTFVCDNGCNNQYUUKPINGJGCFƂCVUVCRNKPICPF
single head saddling stapling
6JKUOOUJGGVECRCEKV[UVCRNGTHTQORapid UK
features a long arm that makes it possible to staple
along the fold to create centre-stapled booklets, etc.
The Direct Impact Technology design ensures absolutely
perfect, hassle-free stapling and the 180° opening
ensures that both loading and stapling are easy.
• %CRCEKV[OOUJGGVU
IUORCRGT
• Easy to read and quickly adjustable format frame (A6
to A2, US-norm and folio, scala in mm and inch)
• 1RGPCPFENQUGFUVCRNKPIsGCU[EJCPIKPID[VWTPCDNG
anvil, staples included
• 180 degree opening top loading mechanism
• Material: plastic with metal housing, with non-slip
RNCUVKEDCUGVQRTGXGPVUETCVEJKPIQHƁEGHWTPKVWTG
• 10 year guarantee when using Leitz staples
6GEJPKECNURGEKƁECVKQP
Capacity
Stapling
Loading Mechanism
Type of Staples
W x H x D (mm)
Type
Long Arm Stapler
OOUJGGVU
IUORCRGT
1RGPCPFENQUGF
Top loading, 180° opening
ZZQTZ
51 x 75 x 421
Order code 1+
35-2575 12.95
500432
PressLess 60 Sheet Half Strip
Stapler S60
The Rapid S60 halfstrip stapler brings
you the heavy-duty
power that you lack
QP[QWTFGUM6JG
S60 combines the
power of Rapid’s
1OPKRTGUUv
technology with
Rapid’s patented
5WRGT(NCV%NKPEJv
by-pass system for
GHHQTVNGUUCPFVTQWDNGHTGGƂCVENKPEJUVCRNKPI(NCVVGT
stapling reduces the document thickness. The S60
staples any quantity between 2 and 60 sheets needing
only one staple type.
#TCPIGQHJKIJSWCNKV[UVCPFCTFDNCEMQHƁEGUVCRNGTU
including half-strip and full-strip models made from
plastic or metal.
• 5VCRNKPIECRCEKV[OOUJGGVU
IUO
• Closed and nailed stapling
• Top loading mechanism
• 6CMGCPFUVCRNGU
6GEJPKECNURGEKƁECVKQP
1TFGTEQFG
Strip
Material
Insertion depth (mm)
Staple capacity
Dimensions (mm)
Weight (g)
Manuf’s Part No.
34-8166
Half
Plastic
53
ZZ
33 x 53 x 124
104
623669
34-8168
Full
Plastic
76
ZZ
36 x 57 x 157
148
623670
1TFGTEQFG
Strip
Material
Insertion depth (mm)
Staple capacity
Dimensions (mm)
Weight (g)
Manuf’s Part No.
34-8170
Half
Metal
57
ZZ
31 x 55 x 126
153
623671
34-8172
Full
Metal
81
ZZ
35 x 56 x 156
223
623672
Size
Half strip
Full strip
Half strip
Full strip
Material
Plastic
Plastic
Metal
Metal
Order code
34-8166
34-8168
34-8170
34-8172
1+
1.35
1.76
2.15
2.76
518426
Fast Delivery
All orders for in-stock items received
by 7pm – Monday to Friday
are despatched the same day
www.rapidonline.com sales@rapidonline.com
687
688 Stationery
RV
Education
Full Strip Stapler – 25 Sheets Black
Rapid Eco
Stationery
17
The Rapid Eco Full
Strip Stapler takes a
whole strip of staples
for less reloading,
making it ideal for
high-useage tasks. It
employs Rapid’s patented SuperFlatClinch system that
ƂCVVGPUVJGUVCRNGTGFWEKPIVJGJGKIJVQHRCRGTUVCEMU
by up to 40%. The Rapid Eco Full Strip Stapler is friendly
to the environment: it is made from 100% recycled
plastic and is designed for easy disassembly at the end
of its life. Soy-based printing and recycled cardboard
packaging add to its green footprint.
• Takes a full strip of staples for less reloading
• 5WRGT(NCV%NKPEJVGEJPQNQI[HQTƂCVVGTFQEWOGPVU
• Capacity 25 sheets
• 7UGUUVCPFCTFUVCRNGU
• Made of 100% recycled plastic
• Soy-based printing
• Recycled cardboard packaging
• Designed for easy disassembly for recycling
• Rapid type Eco Full Strip
Type
Eco Full Strip
is easy to grip for immediate use. The
patented SuperFlatClinch system completely
ƂCVVGPUVJGUVCRNGTGFWEKPIVJGJGKIJV
of a document by up to 40%. The Rapid
Eco Stand Up Stapler isdesigned for easy
disassembly at the end of its life and is
made from 100% recycled plastic and has a
recycled cardboard pack to reduce its impact
on the environment.
• Takes half a strip of staples
• 5WRGT(NCV%NKPEJVGEJPQNQI[RTQFWEGUƂCVVGTFQEWOGPVU
• Capacity 25 sheets
• 7UGUUVCPFCTFUVCRNGU
• Made from 100% recycled plastic
• Soy-based printing
• Recycled cardboard packaging
• Designed for easy disassembly when recycled
• Rapid type Eco Half Strip
Type
Eco Stand-up Stapler
26/6 staples (5000)
Order code 1+
34-5761 5.58
35-2610 0.84
500429
These metal staplers
from the Leitz NeXXt
series not only have
VJG919HCEVQTYKVJ
their stylish shape
and cool colours, but
they are also serious
workhorses with the
capacity to staple up
to 30 sheets of paper at a time. Suitable for use in the
QHƁEGUEJQQNCPFKPVJGJQOG.GKV\9190G::VUVCRNGTU
are available in a choice of three eye-catching shades.
• Staples 30 sheets of paper (80gsm)
• Rotating anvil allows open and closed stapling
• 180° opening enables nailing function
• 5WKVCDNGHQT.GKV\2QYGT2GTHQTOCPEG2UVCRNGU
CPFUVCRNGURCEMKPENWFGF
• Handy, integrated staple remover
• 10-year guarantee
Type
Pink
Blue
Green
Order code 1+
06-9793 9.19
06-9794 9.19
06-9795 9.19
530882
500425
PressLess 60 Sheet Half Strip
Half Strip Stapler – 25 Sheets Black Stapler S60
Type
Eco Half Strip
26/6 staples (5000)
Order code 1+
34-2575 5.99
35-2610 0.84
500426
Half Strip Stapler – 10 Sheets Black
The Rapid Eco Mini
Stapler is a compactsized environmentallyfriendly stapler. It has
a 10 sheet capacity
at 80gsm and takes
UVCPFCTF
staples. The Rapid
Eco Mini Stapler is
made from 100%
recycled plastic with
soy-based printing
and is packed in recycled cardboard for minimum
environmental impact.
• Compact sized stapler
• 10 sheets at 80gsm capacity
• 7UGUUVCPFCTFUVCRNGU
• 100% recycled plastic
• Soy-based printing
• Cardboard packaging
• Rapid type Eco Mini
Type
Eco Mini
26/6 staples (5000)
The Rapid S60 half-strip stapler brings you the
JGCX[FWV[RQYGTVJCV[QWNCEMQP[QWTFGUM6JG5
EQODKPGUVJGRQYGTQH4CRKFoU1OPKRTGUUvVGEJPQNQI[
YKVJ4CRKFoURCVGPVGF5WRGT(NCV%NKPEJvD[RCUUU[UVGO
HQTGHHQTVNGUUCPFVTQWDNGHTGGƂCVENKPEJUVCRNKPI(NCVVGT
stapling reduces the document thickness. The S60
staples any quantity between 2 and 60 sheets needing
only one staple type.
• 6CMGU4CRKF5WRGTUVTQPICPFUVCRNGU
• 5WRGT(NCV%NKPEJvD[RCUUU[UVGO
• Rapid patented technology
• TGFWEGFRCRGTUVCEMUFWGVQƂCVVGTUVCRNGU
• 2 to 60 sheet capacity using only 1 staple type
• 2TGUU.GUUvNGXGTVGEJPQNQI[
• Up to 50% less effort than standard
• Stapling depth 50mm
• Rapid type S60
Type
PressLess stapler
Order code 1+
35-2577 12.75
This sturdy metalbodied desktop
stapler takes a whole
strip of staples so it’s
ideal for frequent use.
• Staples up to 25
sheets of paper
(80gsm)
• Robust all-metal construction
• Ergonomic rubber top and base
• Adjustable anvil for stapling and pinning
• )TGCVHQTJQOGCPFQHƁEG
• 6CMGUCPF4CRKF7-5VTQPIUVCRNGU
• Made from 100% recycled plastic
• Colour: Black
• Dimensions 44 x 60 x 168mm
• Weight 0.28kg
• 5 year manufacturer’s guarantee when using Rapid
UK staples
• Rapid UK type FM14
Type
Metal multi-t
RV
Metal
Type
Full strip stapler
A heavy-d
CPFQHƁEG
• Tough a
• Jam rem
• Light ha
• 6CMGU
• Includes
• Manufac
Type
Metal tacker
RV
Order code 1+
35-2573 3.95
537615
Standa
RVFM
Ultra Heavy-Duty Metal Multi-tacker
500423
A well-buil
• Robust A
• Internal
• 6CMGU
• Manufac
Half Strip Stapler – 25 Sheets
Stand-up
A half strip stapler, designed
to stand on your desk, ready
for use.
• Comfortable rubber grip
• Special shape to ensure
correct stapling position
• 6CMGUQTUK\G
staples - 25 sheet stapling
capacity
• Manufacturer’s 15 year
guarantee
Order code 1+
34-9493 1.59
35-2610 0.84
#JKIJURG
• Up to 10
• Jam rem
• Light ha
• 7UGU
• Supplied
• Manufac
Rapid UK Full Strip Metal Desktop
Stapler FM14
RVFM
Type
Stand-up stapler
500424
688
Half Strip Stapler – 25 Sheets Black WOW NeXXt Metal 30-Sheet
The Rapid Eco Stand Up Stapler stands
Staplers
on its end, takes up less desk space and
Order code 1+
34-2573 7.99
The Rapid Eco Half
Strip Stapler takes a
half strip of staples
allowing it to be
more compact.
Rapid’s patented
SuperFlatClinch
U[UVGOƂCVVGPUVJG
staple, reducing the height ofa paper stack by up to 40%.
The Rapid Eco Half Strip Stapler is made from 100%
recycled plastic and is designed for easy disassembly
at the end of its life. Designed to be friendlier to the
environment, it also uses soy-based printing and has a
recycled cardboard pack.
• Takes half a strip of staples
• 5WRGT(NCV%NKPEJVGEJPQNQI[RTQFWEGUƂCVVGTFQEWOGPVU
• Capacity 25 sheets
• 7UGUUVCPFCTFUVCRNGU
• Made from 100% recycled plastic
• Soy-based printing
• Recycled cardboard packaging
• Designed for easy disassembly when recycled
• Rapid type Eco Half Strip
Metal
Type
Standard tac
An exceptionally sophisticated and robust tacker for high
volume applications.
• Up to 14mm depth staples
• Jam removal function
• Light handle pressure
• Adjustable pressure control
• 7UGUCPFUVCRNGUQT
gauge brad nails up to 16mm long
• Supplied complete with box of 800 staples
• Manufacturer’s 3-year guarantee
Order code 1+
34-5760 3.99
Type
Metal multi-tacker
080036
Tel: 01206 751166 Fax: 01206 751188
Order code 1+
34-5772 19.99
080038
www
Mo
ava
Stationery 689
RVFM
Staples
Metal Multi-tacker
RVFM
Anti-jam Staples
Precision
engineered
anti-jam staples
offering great
value for money.
• Designed for
trouble-free use
• Fit most popular
makes of
staplers
RVFM
Galvanised Staples
e in the
VUVCRNGTU
hades.
g
GU
Size
26/6
24/6
13/6
13/8
23/6
23/8
#JKIJURGEKƁECVKQPJGCX[FWV[VCEMGT
• Up to 10mm depth staples
• Jam removal function
• Light handle pressure
• 7UGUQTUVCRNGU
• Supplied complete with box of 800 staples
• Manufacturer’s 3-year guarantee
1+
0.64
0.35
0.99
1.05
0.79
0.99
080037
Order code 1+
34-5774 14.99
080039
530882
Order code
34-5762
34-5764
34-5766
34-5768
34-5974
34-5976
RVFM
Metal Tacker
6GEJPKECNURGEKƁECVKQP
1TFGTEQFG
Staple type
Capacity
Box quantity
Box dimensions (mm)
Weight (g)
Manuf’s Part No.
34-8182
OOUJGGVU
1000
68 x 37 x 15
43
623697
34-8184
OOUJGGVU
2000
53 x 41 x 10
38
623698
1TFGTEQFG
Staple type
Capacity
Box quantity
Box dimensions (mm)
Weight (g)
Manuf’s Part No.
34-8186
OOUJGGVU
5000
113 x 55 x 22
165
623699
34-8188
No. 10
OOUJGGVU
1000
51 x 28 x 12
23
623678
RVFM
Staples – Rapesco
5VCPFCTF
staples for use
with most popular
QHƁEGUVCRNGTU
• 12.5mm wide
with 6mm legs
• Supplied in
boxes of 5,000
Type
26/6 staples (5000)
17
Order code 1+
35-2548 0.586
074220
Staple size
24/6
21/4
26/6
10
A heavy-duty tacker ideal for constant use in schools
CPFQHƁEGU
• Tough all-metal construction
• Jam removal feature
• Light handle pressure
• 6CMGUQTUK\GUVCRNGU
• Includes box of 800 staples
• Manufacturer’s 3-year guarantee
GU
Type
Metal tacker
Rapid
Standard Tacker
tacker
GUQT
High quality staples
for use with the Rapid
Eco Tacker, 34-5777
and other high quality
staplers and tackers.
• Ranges of lengths
• CPF
UVCRNGUCTG
supplied in packs
of 5000
• OO
staples are
supplied in packs of 2500
• UVCRNGUCTGUWRRNKGFKPpacks of 5000 or 1000
• /WNVKRCEMUVCRNGUKPENWFGCPFCU
a total pack of 1104
Type
13/4 (4mm)
13/6 (6mm)
13/8 (8mm)
24/6
24/6
26/6
66/6
66/8
A well-built tacker for everyday use.
• Robust ABS body with metal handle
• Internal parts made from high quality steel
• 6CMGUQTUK\GUVCRNGU
• Manufacturer’s 3-year guarantee
er for high
1+
0.19
0.30
0.50
0.12
High Quality Staples 13 Series
Order code 1+
34-5776 10.99
RVFM
Type
Standard tacker
Order code
34-8182
34-8184
34-8186
34-8188
518462
080040
537615
Number
1000
2000
5000
1000
Order code 1+
34-5778 4.39
080041
www.rapidonline.com
More Tackers
available online
Pack Size
5000
5000
2500
1000
5000
5000
5000
5000
Order code
35-2621
35-2623
35-2625
35-2506
35-2508
35-2610
35-2618
35-2619
1+
2.55
2.95
1.75
0.45
1.15
0.84
2.99
3.29
Stationery
ktop
High quality galvanised staples in a range of commonly
used sizes.
• 5GGVGEJPKECNURGEKƁECVKQPHQTHWNNFGVCKNU
Education
Type
Metal multi-tacker
Box quantity
5000
1000
1200
1000
1000
1000
Staple Removers
Staple Removers Heavy Duty
A heavy-duty staple
TGOQXGTYKVJCƁTO
handle and pliers grip.
• Removes almost any
staple
• Manufacturer’s two
year guarantee
Type
HD Staple remover
Order code 1+
35-2594 6.45
077250
RVFM
Staple Removers Light Duty
500430
Remove staples
SWKEMN[CPFGHƁEKGPVN[
from your paperwork
with this handy staple
remover. Removing
staples with your
nails can damage
your manicure or even
ECWUGCPKPLWT[
• Removes staples
quickly and
GHƁEKGPVN[
• Be safe - removing
staples with
ƁPIGTPCKNUECPTGUWNVKPKPLWT[
• Locks in closed position for safety
Type
Staple Remover
Order code 1+
35-2595 0.394
500648
080038
www.rapidonline.com sales@rapidonline.com
689
690 Stationery
Basic Calculator
HC133 Basic Calculator
070 x 115 x 15mm – Pack of 30
FREE Software
Education
HS-8V Basic Calculator
62 x 102 x 9mm
#FWCNRQYGTGF
UQNCTDCVVGT[
8-digit calculator, ideally suited
to educational applications as
the low-cost makes it possible
to allocate one per student. The
dual-power facility allows use in
darker environments than solar
power only.
• DCUKEHWPEVKQPU
sZ
plus mark-up percentage, sign
change key and square root
• MG[UKPINGOGOQT[NCTIGno
key and auto power-off
• Dimensions: 102 x 57 x 8mm
• Weight 35g
Replacement batteries type LR54/SR54.
Type
HS-8V
Order code 1+
25-0128 2.95
061815
Stationery
Size Basic Calculator
17 Pocket
This calculator is suitable for basic
Order code 1+
34-2610 1.99
A robust model, with hard
slide-on case, designed for
portability.
• Durable hard keys
• Clear 8 digit LCD display
• 4 Constants
• 3 key memory
• CPFUSWCTGTQQV
keys
• Solar powered
• Dimensions: 70 x 125 x
13mm
• Suitable for Key Stages
1 & 2 (ages 5 to 11)
Type
HC106 Calculator
A robust calculator with durable
hard keys and large numeric
keypad.
• Clear 8 digit LCD display
• 4 constants
• Memory
• CPFUSWCTGTQQVMG[U
• Solar power with battery
backup
• Dimensions: 70 x 115 x
15mm
• Suitable for Key Stages 1 & 2
(ages 5 to 11)
Handheld &
Desktop Calculators
Tax Calculator – 12 Digits Handheld
Aurora HC208TX
Order code 1+
25-0636 2.19
077467
HC106 Basic Calculator
070 x 125 x 13mm – Pack of 30
FREE Software
Order code 1+
25-0632 1.59
077465
RVFM
Basic Calculator – 210 x 300mm
Jumbo A4
Order code 1+
25-0652 3.49
Page 785
Lithium
Cell
CR2032
A class pack of 30 HC106 calculators in a Gratnells
storage tray.
• Foam insert separates and protects each unit
• 3 rows of 10 for convenient stock checking
• Hard protective lid
• Please see 25-0636 for full details of the HC106
calculator
• Aurora type CK12
• Suitable for Key Stages 1 & 2 (ages 5 to 11)
Order code 1+
52-9774 5.95
Type
HC106 classpack
An 8-digit
offering th
functions:
subtractio
and divisio
percent an
Ideal for e
purpose u
• Rugged
• Large an
• 3-key m
and last
• Dual-po
CODKGPV
strong, a
battery
• 1XGTCNNF
• Weight:
Type
EL-240SB
Aurora
095 x
A robust d
calculator
IGPGTCNQHƁ
• Spaciou
easy ent
• .CTIG
angle di
• Durable
• 4 key m
constan
• sC
root key
• Solar po
battery
• Dimensi
125 x 2
Type
DT210 Calcu
Basic C
31mm
518260
080133
690
The Aurora HC208TX
is an executive
handheld solar
calculator with a
stylish and durable
all-metal casing. It
has a programmable
one-touch Tax feature,
ideal for adding or
subtracting VAT.
• 12-digit, clear, easy
view LCD display
• Programmable tax
feature
• All-metal casing
• Soft rubber keys
• Foldover protective wallet
• Solar power with back-up battery
• Auto power off
• 3-key memory
• Percentage key
• Size 70 x 119 x 10mm
• Aurora type HC208TX
Type
HC208TX Calculator
An A4 size calculator, great
fQTUOCNNƁPIGTUCPFHTQPV
of class demonstrations.
• 8-digit display
• basic 4 functions
plus square root and
percentage
• Dual powered: solar
panel and button cell
• Colour: dark blue
• Dimensions: 210 x
300mm
• Suitable for Key Stages 1
& 2 (ages 5 to 11)
Order code 1+
25-0646 2.09
518251
HC106 Basic Calculator
070 x 125 x 13mm
HC133 Basic Calculator
070 x 115 x 15mm
Type
A4 calculator
The Aurora EcoCalc
EC240 Handheld
Calculator combines
the requirement
for a basic school
QTQHƁEGECNEWNCVQT
with a greener
manufacturing
process and reduced
carbon footprint.
Quality, Value and
Environmental
$GPGƁVUJCXGDGGP
combined to provide
the ideal solution
for any organization
looking to implement a greener procurement policy and
reduce their environmental impact.
• Solar only, battery-free power
• Square root
• 'ZVTCNCTIGnoMG[
• Sign change key
• 3 key memory
• Percentage key
• Unit weight: 47g
• Dimensions 62 x 102 x 9mm
• Ideal for keystages 1 & 2
• Aurora type EC240
Type
EC240 Calculator
071588
Type
HC133 Calculator
Order code 1+
25-0634 58.29
077466
calculations and National Curriculum
Key Stages 1 & 2 mathematics.
• 8-digit display
• Easy to use plastic keys
• Full function memory
• Auto power off
• Square root function
• Percentage function
• 110 x 60mm
• Helix type RC1070
• Suitable for Key Stages 1 & 2
(ages 5 to 11)
Type
Basic calculator
A class pack of 30 HC133 calculators in a Gratnells
storage tray.
• Foam insert separates and protects each unit
• 3 rows of 10 for convenient stock checking
• Hard protective lid
• Please see 25-0632 for full details of the HC133
calculator
• Aurora type CK30
• Suitable for Key Stages 1 & 2 (ages 5 to 11)
Type
HC133
EL-240
62 x 1
Aurora EcoCalc EC240 Basic
Calculator – 062 x 102 x 09mm
The Casio
desktop ca
has a big
display an
ideal for u
KPVJGQHƁE
in the clas
With a dua
facility, the
ensures th
calculator
on working
where ther
available l
• Angled b
• .CTIG
• Percenta
• Mark-up
• 3 digit c
• Sign cha
• Square
• Auto pow
• Plastic c
• Manufac
6GEJPKECNURGE
Display digits
Memory
Power
Height
Width
Depth
Weight
Type
MX 8 S
Order code 1+
25-0638 74.95
077468
Tel: 01206 751166 Fax: 01206 751188
Stationery 691
EL-240SB Basic Calculator
62 x 102 x 9mm
m
licy and
Desktop Calculator Currency
Conversion
An 8-digit pocket calculator
offering the four basic
functions: addition,
subtraction, multiplication
and division, as well as
percent and square root.
Ideal for education or
general purpose use.
• Rugged plastic keys
• Large angled display
• 3-key memory, tab
function and last answer
function
• Dual-powered: solar,
when ambient light is
UWHƁEKGPVN[UVTQPICPFD[CP.4DCVVGT[
• Overall dimensions: 69 x 115 x 6.5mm
• Weight: 58g
Order code 1+
25-0100 2.28
061793
Aurora DT210 Basic Calculator
095 x 125 x 22mm
tors
dheld
Type
MS 88 ECO
A robust desktop
calculator ideal for
IGPGTCNQHƁEGWUG
• Spacious keypad for
easy entry
• .CTIGFKIKVƁZGF
angle display
• Durable hard keys
• 4 key memory and
4 constants
• +/–, % and square
root keys
• Solar power with
battery backup
• Dimensions: 95 x
125 x 22mm
Type
DT210 Calculator
517692
Cost/Sell/Margin/Tax Calculator 08 Digits Desktop Sharp EL330FB
Order code 1+
25-0644 2.89
077471
Basic Calculator - 103 x 137
x 31mm - Casio Desktop MX8S
518260
The Casio MX-8S
desktop calculator
has a big 8-digit
display and is
ideal for use both
KPVJGQHƁEGCPF
in the classroom.
With a dual power
facility, the battery
ensures the
calculator goes
on working even
where there is no
available light for solar power.
• Angled best view display
• Large + key
• Percentage key
• Mark-up key
• 3 digit comma marker
• Sign change key
• Square root key
• Auto power off
• Plastic case
• Manufacturer’s part MX-8S
6GEJPKECNURGEKƁECVKQP
Display digits
Memory
Power
Height
Width
Depth
Weight
Type
MX 8 S
Order code 1+
19-1958 7.95
The Sharp EL330FB
is a modern-looking
desktop calculator
that comes in a
contemporary white
ƁPKUJ$CUGFQP
Sharp’s best selling
desktop calculator
series, the EL330FB
features all the
standard Sharp
calculator features
together with a time
saving TAX function
that cuts out as much
as 6 additional key
presses. A useful
new function to this
range is the COST / SELL / MARGIN feature which is an
KPFKURGPUCDNGHQTCP[DWUKPGUURGTUQPCUKVCNNQYURTQƁV
margins, cost prices or selling prices to be computed in
a very easy and logical manner. The tilted LCD display
allows for all 8 digits to be displayed clearly and 3-digit
punctuation helps to prevent any mis-reading.
• Portable yet suitable for desk use
• Large 8-digit LCD display
• Easy-to-view angled display
• Modern and stylish contemporary white design
• Save time with TAX+ / TAX- and COST / SELL / MARGIN
keys
• 3-digit punctuation helps reduce misreading
• Easy to use 3-key memory
• Quick percentage calculations
• Quality feel with responsive high quality plastic buttons
• Power saving - auto power off after approximately 7
minutes
• Dual-power: solar and battery (1x LR44 button cell)
• Dimensions: 102 (w) x 146.8 (l) x 31 (d) mm
• Weight: 120g
• Sharp type EL330FB
Type
EL330FB
Order code 1+
25-0119 4.49
300751
8
4 key
Battery and solar (dual) 1 x LR54
31mm
103mm
137mm
105g
The Sharp EL331FB
is a modern-looking
desktop calculator
that comes in a
contemporary white
ƁPKUJ$CUGFQP
Sharp’s best selling
desktop calculator
series, the EL331FB
features all the
standard Sharp
calculator features
together with a time
saving TAX function that
cuts out as much as 6
additional key presses.
A useful new function
to this range is the COST / SELL / MARGIN feature
which is an indispensable for any business person as it
CNNQYURTQƁVOCTIKPUEQUVRTKEGUQTUGNNKPIRTKEGUVQDG
computed in a very easy and logical manner. The tilted
LCD display allows for all 10 digits to be displayed clearly
and 3-digit punctuation helps to prevent any mis-reading.
• Portable yet suitable for desk use
• Large 10-digit LCD display
• Easy-to-view angled display
• Modern and stylish contemporary white design
• Save time with TAX+ / TAX- and COST / SELL / MARGIN
keys
• 3-digit punctuation helps reduce misreading
• Easy to use 3-key memory
• Quick percentage calculations
• Quality feel with responsive high quality plastic buttons
• Power saving - auto power off after approximately
7 minutes
• Dual-power: solar and battery (1x LR44 button cell)
• Dimensions: 102 (w) x 146.8 (l) x 31 (d) mm
• Weight: 120g
• Sharp type EL331FB
Type
EL331FB
17
Stationery
518251
With its recycled plastic
housing, the solarpowered Casio MS-88
ECO Desktop Calculator
means you can
crunch the numbers
without crunching the
environment.
The MS-88 ECO
has plenty of useful
functions in addition to
the normal calculation
facilities, including
currency conversion
and square root
calculation.
• Extra large 8-digit LC display
• 2-way power
• Key rollover
• Independent memory
• 3 digit comma markers
• Rapid correction key
• Dimensions 30.7mm x 103mm x 145mm
• Weight 120g
• Runs off 1 CR2032 battery
• Manufacturer’s part MS88ECO
Education
Type
EL-240SB
Cost/Sell/Margin/Tax Calculator 10 Digits Desktop Sharp EL331FB
Price each – MOQ 10
Order code 10+
25-0117 5.45
300752
Calculator (Cost/Sell/Margin/Tax)
The Aurora DT910P
desktop calculator
calculates any
variation of Cost
/ Sell / Margin
and displays all 3
RCTVUQH[QWTƁPCN
answer. In addition,
its programmable
one-touch Tax feature
is ideal for adding
or subtracting VAT,
making it an excellent
calculator for
business.
• Large 12-digit LCD display
• Cost/Sell/Margin calculation
• One-touch Tax feature
• Fixed angle display
• Auto power-on when any key is pressed
• Solar power with battery back-up
• Auto power off
• Backspace correction
• 3-key memory
• +/- sign change, Double zero and Percentage keys
• Durable hard plastic keys
• Size: 95 x 140 x 33mm
• Aurora type DT910P
Type
DT910P Calculator
Order code 1+
25-0656 6.49
518262
Order online
Activate your account for online ordering. For further information:
Order code 1+
19-1962 3.49
517693
www.rapidonline.com/activate
www.rapidonline.com sales@rapidonline.com
691
692 Stationery
5EKGPVKƁE
Graphic Calculators
Graphic Calculator
Casio FX-9750G11
5EKGPVKƁE%CNEWNCVQTs.KPGU
252 Functions
Casio FX-83GT & FX-85GT PLUS
Education
(:/55EKGPVKƁE%CNEWNCVQT
Stationery
17
#UEKGPVKƁEECNEWNCVQTYKVJ
twin-line LCD display and
dual power source - solar and
battery.
• The main display is a
conventional 10-digit type
plus 2-digit exponent
• The upper line of the
display is a dot-matrix type
which displays the formula
being calculated
• The calculator uses S-VPAM
logic (Super Visually
Perfect Algebraic Method)
which allows a formula to
be entered in the same
sequence as written
• 300 functions (218
UEKGPVKƁE
• Includes trigonometric and statistical functions,
numeric integration, complex numbers, binary, hex,
decimal and octal bases
• Supplied complete with slide-on hard case and battery
• Dimensions: 154.5 x 78 x 12.7mm
• Weight 105g
• Suitable for Key Stages 3, 4 & A Level (ages 11 to 18)
Replacement battery type LR44.
Type
FX-115MS
Order code 1+
25-0355 9.89
036175
5EKGPVKƁE%CNEWNCVQTs.KPGU
335 Functions – Sharp WriteView
ELW531B
Type
FX-83 GT PLUS
FX-85 GT PLUS
FX-85 GT PLUS in Pink
082358
The Casio FX991ES Plus is
CVQRQHVJGTCPIGUEKGPVKƁE
calculator with 403
mathematical functions
and an exceptionally easy
to read Natural Textbook
display. Ideal for Key Stage
3 and above, the FX991ES
Plus has random integers
and an improved equation
mode.
• Dual solar and battery
(LR44) powered, ensuring
full operation even in
dark conditions
• Supplied with slide-on
plastic case
• Functions include
trigonometrics,
logarithms, reciprocals, factorials, standard deviation,
fractions, roots and powers
• Auto power off
• Plastic keyboard
• Manufacturer’s part FX991ES Plus
6GEJPKECNURGEKƁECVKQP
Memories
5EKGPVKƁEEQPUVCPVU
/GVTKEKORGTKCNEQPXGTUKQPU
Display
Height
Width
Depth
Weight
Type
FX991 ES PLUS
Type
FX 9750 G11
Plain D
Order code 1+
19-1954 54.95
517690
Wallets
Type
Clear A4 pockets
A4 Pol
Docum
Order code 1+
34-9020 1.67
075846
These Centra A4 Clear Plastic
Cut Flush Wallets have one side
and one end open for easy
insertion of documents.
• A4 wallets
• 65 micron thickness
• Clear plastic (PP)
• Supplied in packs of 100
2QN[ƁNG
Order code 1+
06-9841 2.89
530893
New products
www.rapidonline.com
Order code 1+
19-1952 17.95
Tel: 01206 751166 Fax: 01206 751188
Strong pol
document
colour-cod
stud faste
• Takes A4
• Supplied
colour p
1x red, 1
and 2x c
Type
A4 document
Centra A4 Clear Plastic Cut Flush
Wallets
Type
Plastic wallets (100)
9
40
40
TwinLine LCD dot matrix
12.2 mm
80 mm
161 mm
105 g
%NCUUKEHQQ
suspensio
folders.
• Foolsca
• 250gsm
• OO
and 32m
gusset
• Assorted
colours
buff, pin
• Supplied
Type
Document wa
A4 open top multipunched
50 micron polypropylene
pockets with reinforcing strip.
• Anti-static formulation
allows paper to be inserted
and removed easily
• Copy secure: does not stick
to copier or printer toner
• Pack weight: 0.58kg
• Pack dimensions: 250 x
337 x 32mm
• Supplied in packs of 100
517689
692
10
61 kb
21.3 mm
87.5 mm
180.5 mm
205 g (including batteries)
4 AAA batteries
Clear A4 Punched Pockets
5EKGPVKƁE%CNEWNCVQTs.KPGU
Functions – Casio FX991 ES PLUS
Order code 1+
25-0603 6.35
Squared
Paper
6GEJPKECNURGEKƁECVKQP
Regression types
User memory
Height
Width
Depth
Weight
Power supply
Type
A4
A3
RVFM
Order code 1+
25-0311 6.82
25-0313 7.95
19-1950 7.48
300397
Powered by a single LR44 battery, (included).
Page 642
A classic
document
which can
ƁNGFKPCF
or suspens
ƁNG
• A4 size:
A4 or fo
size doc
• Holds a
180 she
• Expands
• 300 mic
• 229 x 3
• A3 size:
• Full A3 s
• Holds a
• Expands
• 300 mic
• 325 x 4
• Supplied
green, b
25-0313 and 19-1950 require an LR44 button cell (included).
#UEKGPVKƁEECNEWNCVQTYKVJ
4-line LCD display, 3-digit
punctuation, 335 functions
and 2 key rollover.
• Deg-Rad-Grad and DegMin-Sec
• Logs Base E Base 10
• Variable statistics and
regression models
• Statistics graphs and
advanced statistics tests
• Set decimal place
• Trigometric functions and
hyperbolics
• Factorials and random
numbers
• Direct algebraic logic
• Percentage key and change
UKIP
• Dimensions 79.6 x 161.5 x 15.5mm
• Weight 139g including slide-on hard cover
Type
ELW531B calculator
5EKGPVKƁEECNEWNCVQTUYKVJVYKPNKPG.%&FQVOCVTKZ
displays, which show calculations in a natural textbook
HQTOCV6JGVYQOQFGNUJCXGKFGPVKECNURGEKƁECVKQPU
except that the FX-83GT is powered by a single AAA
DCVVGT[YJGTGCUVJG(:)6JCUVJGCFFKVKQPCNDGPGƁV
of a dual power supply – solar and battery.
The new FX-83GT PLUS and FX-85GT PLUS offer you
additional functions such as Verify, Prime Factorisation
and Recurring Decimal.
The FX-85GT PLUS is also available in bright pink.
• 6QVCNQHHWPEVKQPUKPENWFKPIUEKGPVKƁE
• OCPVKUUCGZRQPGPV
• 7 memories
• 79 byte formula memory
• 24 level parenthesis
• (WPEVKQPUKPENWFGVTKIQPQOGVTKEU
5+06#0GVE
logarithms, co-ordinate conversion, hyperbolics,
factorials, combinations and permutations, standard
deviation, linear regression, random numbers and
many more
• Slide-on case
• Dimensions 161 x 80 x 13.7mm
• Weight 110g
• Suitable for Key Stages 2, 3, 4 & A Level (ages 7 to
18)
Pocket
The Casio FX-9750GII is a
dynamic graphic calculator
ideal for the quick
graphing and analysis
of conic expressions in
rectangular, polar and
parametric formats.
The easy-to-use FX9750GII also has a builtin catalogue of functions
VQJGNR[QWƁPFWPHCOKNKCT
commands.
• 21 character, 8 line
black and white LCD
display
• Functions include
angle measurements,
fractions, pie charts,
ƁPCPEKCNECNEWNCVKQPU
roots and powers
• Data communication with PC and calculators
• Communications port
• Snap-on cover
• Plastic keypad
• Powered by 4 AAA batteries
• Manufacturer’s part FX-9750II
These stro
polypropyl
ƁNGUWUGC
simple pre
stud closu
to keep yo
contents s
• Availabl
either cl
• Supplied
Type
Classic
Electra
Stationery 693
Clipboards
PolyPlus
Pocket Wallets
Type
A4
A3
Order code 1+
34-5554 10.99
34-5556 26.99
078778
517690
%NCUUKEHQQNUECRYCNNGVUVJCVCTGKFGCNHQTƁNKPIKP
suspension
folders.
• Foolscap size
• 250gsm
• OOƂCR
and 32mm
gusset
• Assorted
colours (blue,
buff, pink, orange, red, green and yellow)
• Supplied in packs of 50
Type
Document wallets
Type
PolyPlus
Eco Friendly Clipboards
Pack of 24
Order code 1+
34-9322 7.49
079914
These practical full size A4 clipboards are made from
TGE[ENGFRNCUVKECPFCTGRGTHGEVHQTWUGKPVJGQHƁEG
classroom and warehouse and for use both indoors and
outdoors.
• Eco friendly
• Lightweight yet strong
• Durable, weather resistant construction
• Hygenic and washable for sterile conditions
• Useful hanging hole
• Supplied in packs of 24
Zippa-Bags for A4 and Foolscap
Paper
These Zippa-Bags
are made from
a transparent,
ƂGZKDNGOCVGTKCN
and have a metal
zip which makes
them ideal for
WUGKPVJGQHƁEG
industry, home or
school.
• 5K\GUVQƁVDQVJ#CPF(QQNUECRUK\GRCRGT
• Supplied in packs of 25
Type
A4 Red
Foolscap Assorted
Foolscap Blue
Foolscap Green
Foolscap Red
Foolscap Yellow
Order code
34-9340
34-9346
34-9348
34-9350
34-9352
34-9354
Type
Eco friend. Klipboard pk24
122683
Clipboard
1+
10.99
9.25
9.25
8.95
9.25
9.25
079919
Order code 1+
34-5548 7.99
078783
A3 Zippa-Bags
075846
Strong polypropylene A4
document wallet folders with
colour-coded ‘popper’ pressstud fastener.
• Takes A4 documents
• Supplied in an assorted
colour pack of 5 containing
1x red, 1x purple, 1x blue
and 2x clear
Type
A4 document wallets
ush
Type
Assorted
530059
A4 Canvas Zip Bags
These A4
canvas zippered
portfolio bags
are perfect for all
your important
documents or
valuables.
• Tough canvas material
• Separate mesh pocket
• Secure up and over zip
• Available in black, blue, green and pink
530893
om
These strong
polypropylene
ƁNGUWUGC
simple press
stud closure
to keep your
contents safe.
• Available in
either classic or electra colours
• Supplied in packs of 5
Type
Classic
Electra
Order code 1+
34-9318 2.89
34-9320 2.89
079913
Type
Black zip bag
Blue zip bag
Pink zip bag
Green zip bag
Order code
34-6150
34-6152
34-6154
34-6156
Order code 1+
34-9286 31.99
A4 Fold Over/Heavy Duty Clipboards
079921
2QN[ƁNGU
17
079904
Order code 1+
34-9358 12.59
Order code 1+
06-0389 2.14
A strong a lightweight
clipboard with a handy
built-in pen holder and
pen. Ideal for use with
A4 papers, forms and
documents.
• Assorted colour pack
• Supplied in packs
of 10
Type
Clipboard pack of 10
The A3 Zippa-Bag
is made from
a transparent,
ƂGZKDNGOCVGTKCN
and has a metal
zip which makes
it ideal for use in
VJGQHƁEGKPFWUVT[
home or school.
• Supplied in
assorted coloured packs of 25
A4 Polypropylene ‘Popper’
Document Wallets
Order code 1+
06-8514 32.49
Stationery
Plain Document Wallets
)
6JG2QN[2NWUƁNGUCTG
made from strong, wipeclean polypropylene
and use two press-studs
to keep your contents
safe. A business card
pocket on the front
QHVJGƁNGCNNQYUHQT
personalisation.
• Assorted colour pack
• Supplied in packs
of 5
Education
A classic
document wallet
which can be
ƁNGFKPCFTCYGT
or suspension
ƁNG
• A4 size: Takes
A4 or foolscap
size documents
• Holds approx.
180 sheets
• Expands to 32mm capacity
• 300 micron
• 229 x 360mm
• A3 size:
• Full A3 size
• Holds approx. 180 A3 sheets
• Expands to 32mm capacity
• 300 micron
• 325 x 445mm
• Supplied in packs of 25 assorted colours (red, yellow,
green, blue, lilac)
These A4
clipboards from
Esselte CTGƁVVGF
with a strong
metal clip and
ƁTON[JQNFWRVQ
200 sheets of
A4 paper. Ideal
for meetings and
surveys, while
light for mobile
use. Designed with a handy inside pocket for loose
documents and items, plus slot in back for pen or pencil
• Hanging hook
• Cover for protecting paper
• Hard cardboard coated with PP foil
• Dimensions: 242 x 12 x 349mm
• For A4 paper
• Range includes heavy duty version
• Black, blue and red available
Type
Fold over
Fold over
Fold over
Heavy duty
1+
1.55
1.55
1.55
1.55
Colour
Red
Blue
Black
Black
Order code
06-9883
06-9884
06-9885
06-9886
1+
1.59
1.59
1.59
1.25
544632
No minimum order value
UK mainland only
081550
www.rapidonline.com sales@rapidonline.com
693
694 Stationery
Box Files
Colour
Pink
Blue
Purple
Green
RVFM
Education
These cloud effect
DQZƁNGUJCXGC
ƂWUJƁVVKPINKF
with a strong press
button catch. An
interior lock-spring
secures loose
papers. A spine
label makes for
GCU[KFGPVKƁECVKQP
• Size: Foolscap
• Supplied singly
Stationery
+++ BEST SELLER +++
1+
4.95
4.95
4.95
4.95
544606
$QZƁNG
17
Order code
06-9857
06-9858
06-9859
06-9860
Ring Binders
RVFM
Coloured Polypropylene A4 Ring
Binders – 25mm
A range of
polypropylene
covered A4 Ring
Type
Order code 1+
Binders for compact
$QZƁNG
34-9226 2.29
storage of punched
080011
documents up to
approx. 190 sheets
of 80gsm paper.
The binders have a
standard 2 round-ring
WOW Click & Store Storage and
mechanism for easy
turning of single
Magazine Boxes
sheets.
• A4 size
• Made from board covered with coloured polypropylene
foil with a linen embossing
• Dimensions (W x H x D) 42 x 318 x 255mm
• Capacity approx. 190 sheets (80 gsm)
-GGR[QWTQHƁEGENCUUTQQOYQTMRNCEGQTJQOGPGCVCPF • 2 ring mechanism
• Ring diameter 25mm
tidy with these stackable storage boxes from the Leitz
919TCPIG#XCKNCDNGKPCEJQKEGQHVJTGGUVTKMKPIEQNQWTU • No spine label
• Weight 258g
VJGUGDQZƁNGUEQOGKPHQWTFGUKIPUVQCEEQOOQFCVG
A5 papers, A4 papers, magazines and CDs.
Colour
Order code 1+
Black
34-8100 0.87
• Easy assembly and sturdy design
Red
34-8104 0.87
• 5RCEGGHƁEKGPVUVQTCIG
Blue
34-8108 0.87
• Label holder for easy indexing
Colour
Pink
Blue
Green
Pink
Blue
Green
Pink
Blue
Green
Pink
Green
Type
Small (A5)
Small (A5)
Small (A5)
Medium (A4)
Medium (A4)
Medium (A4)
CD
CD
CD
Magazine
Magazine
White Presentation Ring Binder
Folders
Order code
06-9764
06-9765
06-9766
06-9767
06-9768
06-9769
06-9770
06-9771
06-9772
06-9773
06-9775
Green
1+
4.95
4.95
4.95
5.95
5.95
5.95
3.39
3.39
3.39
3.89
3.89
34-8112
0.87
518421
RVFM
A4 Ring Binders
530877
WOW Click and Store Organiser
Boxes
A4 ring binders with hard-wearing PVC
covers.
• 35mm spine
• 5RKPGNCDGNHQTGCU[KFGPVKƁECVKQPQH
contents
• Capacity: 25mm - approx. 200 sheets
• Pack weight: 2.84kg
• Pack dimensions: 130 x 360 x
330mm
• Supplied in packs of 10
Type
Black
Blue
Red
Green
Yellow
Order code
34-9000
34-9002
34-9004
34-9006
34-9008
Choice of A4 and A5 white ring binders from Esselte
with clear vinyl pockets for your presentation and
personalisation artwork.
• n&oUJCRGFTKPIUCVVCEJGFVQDCEMEQXGTHQTNC[ƂCV
display
Type
White A5 Ring Binder
White A4 Ring Binder
RV
Order code 1+
34-9751 1.05
34-9755 2.39
519371
+++++++++++
Buy these eyecatching A4 ring
binders from the
Leitz919TCPIG
and your work will
always be easy to
locate. With a glossy,
laminated dual colour
appearance these
binders certainly have
VJG919HCEVQT
• Available in a
choice of 3 striking colours
• 2 x 25mm D ring mechanism
• Stylish spine label and dual colour cover
• 230 A4 sheet capacity (80gsm)
• Spine width 40mm
These high
cardboard
paper insi
metal sho
Arch Files
equipped
JQNFGT6JG
either 50 o
• Dimensi
x D)
• Dimensi
x D)
• Weight:
• Weight:
Order code 1+
06-9735 1.89
06-9736 1.89
06-9737 1.89
530871
Lever Arch Files
RVFM
RV
Black
Board
Ringbinder Electra
694
These lightweight,
oversized ring
binders have a
pocket for loose
papers on the
inside front cover
and a business
card holder.
• Assorted colour
pack
• Supplied in
packs of 10
Type
Pack 10
Colour
Black
Blue
Red
Green
Yellow
Black
Blue
Red
Green
Yellow
A4 Polypropylene Lever Arch Files
075844
These click and store organiser boxes from the Leitz
WOW range are beautiful storage solutions designed to
keep your workplace or home neat and tidy. Equipped
with 4 individual storage compartments, making them
ideal for storing stationery, electrical chargers, beauty
products, wires or any other bits and pieces.
• Striking blue, green, pink or purple colours
• Medium - A4
• Can be collapsed to save space when not in use
• Easy assembly and tough design
• Label holder enables easy indexing
• Polypropylene laminated for long-lasting protection
50mm
Paper
Shoes
WOW A4 Laminated 2D Ring Binders
Type
Pink
Blue
Green
1+
8.07
8.07
8.07
8.07
8.07
Colour
Black
Blue
Red
Green
Yellow
Violet
Fuchsia
Medium blue
Turquoise
Bordeaux
Black
Blue
Red
Green
Yellow
Violet
Fuchsia
Medium Blue
Turquoise
Bordeaux
Order code 1+
34-9330 17.95
079917
Available with 50 and 75mm spines and in a wide range
of colours, these rugged A4 Lever Arch Files are made
of strong polypropylene sheet covered with textured
polypropylene foil. Their spines have a thumbhole for
GCU[UGNGEVKQPCPFVJGƁNGUCTGGSWKRRGFYKVJCUVCPFCTF
NCDGNƁVVGFKPVQCVTCPURCTGPVRQEMGVQPVJGURKPG
• Made of polypropylene sheet covered with textured
polypropylene foil
• Thumbhole in spine
• Label housed in pocket on spine
• Available in 50 and 75mm spine widths
• Wide range of colours
Tel: 01206 751166 Fax: 01206 751188
These eco
Lever Arch
are case-m
cardboard
with pape
have meta
to protect
edges from
damage a
slid in and
shelves. Th
have a thu
easy selec
VJGƁNGUC
with a stan
• Made of
• Metal sh
damage
Stationery 695
+++
er
selte
d
Colour
Black
Blue
Red
Green
Yellow
Violet
Fuchsia
Medium blue
Turquoise
Bordeaux
Black
Blue
Red
Green
Yellow
Violet
Fuchsia
Medium Blue
Turquoise
Bordeaux
Spine
50mm
50mm
50mm
50mm
50mm
50mm
50mm
50mm
50mm
50mm
75mm
75mm
75mm
75mm
75mm
75mm
75mm
75mm
75mm
75mm
Order code
34-8240
34-8244
34-8248
34-8252
34-8256
34-8260
34-8264
34-8268
34-8276
34-8284
34-8192
34-8196
34-8200
34-8204
34-8208
34-8212
34-8216
34-8220
34-8228
34-8236
• Thumbhole in spine
• Label glued on spine
• Available in 50 and 75mm spine widths
• Colour black
1+
1.64
1.64
1.64
1.64
1.64
1.64
1.64
1.64
1.64
1.64
1.64
1.64
1.64
1.64
1.64
1.64
1.64
1.08
1.64
1.64
Type
50mm
75mm
Low Cost Lever Arch Files
6JGUGXCNWGHQTOQPG[#NGXGTCTEJƁNGU
have a brightly coloured paper covering
over a high quality board.
• Reinforced bottom edge for added
durability
• /GVCNƁPIGTJQNGNKPKPI
• Slotted front covers allow rings to
protrude when closed for extra stability
• Supplied with compessor bar to clamp
sheets down
• 5RKPGNCDGNHQTGCU[KFGPVKƁECVKQPQH
contents
• Spine width 70mm
• Available in blue, black, red, yellow
and green
• Supplied in packs of ten
Order code
34-9010
34-9012
34-9014
34-9016
34-9018
530889
1+
14.13
14.13
14.13
14.13
14.13
075845
inders
These high quality Lever Arch Files are made of
cardboard covered with coloured PP foil outside and
paper inside. Their lower edges are protected with
metal shoes to prevent wear. The spines of these Lever
Arch Files have a thumbhole for easy handling and are
equipped with a standard label inserted in the label
JQNFGT6JGƁNGUCTGCXCKNCDNGKPCTCPIGQHEQNQWTUYKVJ
either 50 or 75mm wide spines.
• Dimensions: 50mm type 52 x 318 x 287mm (W x H
x D)
• Dimensions: 75mm type 72 x 318 x 290mm (W x H
x D)
• Weight: 50mm type 390g
• Weight: 75mm type 414g
530871
es
Colour
Black
Blue
Red
Green
Yellow
Black
Blue
Red
Green
Yellow
Spine width
50mm
50mm
50mm
50mm
50mm
75mm
75mm
75mm
75mm
75mm
Order code
34-8130
34-8132
34-8134
34-8136
34-8138
34-8118
34-8120
34-8122
34-8124
34-8126
1+
1.55
1.55
1.55
1.55
1.55
1.55
1.55
1.55
1.55
1.55
518422
iles
ide range
made
ured
le for
CUVCPFCTF
PG
xtured
RVFM
Black Lever Arch Files, Paper Over
Board with Metal Shoe
These economical
Lever Arch Files
are case-made of
cardboard covered
with paper and
have metal shoes
to protect the lower
edges from wear and
damage as they are
slid in and out of
shelves. Their spines
have a thumbhole for
easy selection and
VJGƁNGUCTGGSWKRRGF
with a standard label glued on to the spine.
• Made of cardboard covered with paper
• Metal shoes protect lower edges from wear and
damage
WOW Laminated A4 180° Lever Arch
Files
These eye-catching A4 NGXGTCTEJƁNGUfrom the Leitz
919TCPIGJCXGCURGEKCNRCVGPVGFOGEJCPKUOYJKEJ
OGCPUVJG[ECPDGQRGPGFYKFGTCPFUQƁNNGFOQTG
GCUKN[VJCPUVCPFCTFƁNGU9KVJCNCOKPCVGFUWTHCEG
VJGUGƁNGUJCXGCINQUU[NQQMCPFHGGN6JG[CTGCXCKNCDNG
in a choice of three vibrant colours each in two sizes. All
KPCNNVJKUTCPIGTGCNN[FQGUJCXGVJG919HCEVQT
• Unique patented mechanism opens 180° for 50%
YKFGTQRGPKPICPFHCUVGTƁNKPI
• Stylish spine label and dual colour cover
• 600 A4 sheet capacity (80gsm)
• 5 year guarantee on the mechanism
Colour
Pink
Blue
Pink
Blue
Green
Capacity
50mm
50mm
80mm
80mm
80mm
Order code
06-9741
06-9742
06-9738
06-9739
06-9740
1+
2.79
2.79
2.89
2.89
2.89
530872
Page 685
Standard Index Flags
Order code 1+
06-9825 0.23
06-9826 0.47
17
Multicoloured A4, 115μ
Polypropylene Dividers
Stationery
Type
Blue
Black
Red
Yellow
Green
Type
5-part
10-part
These polypropylene
dividers from Esselte
can be used with
#NGXGTCTEJƁNGU
or folders. These
dividers have either 5
or 10 multicoloured
tabs for easier
ENCUUKƁECVKQPCPF
the front sheets have
spaces for effective
section descriptions.
• Reinforced
punched strip on
front sheet
• JQNGWPKXGTUCNƁV
• A4 and wider
A4 Maxi formats
available
Type
5-part
10-part
5-part extra wide
10-part extra wide
Order code
06-9827
06-9828
06-9829
06-9830
Education
++
50mm and 75mm Polypropylene/
Paper Lever Arch Files with Metal
Shoes
100% Recycled Multicoloured A4
Cardboard Dividers
These cardboard
dividers from Esselte
are ideal for use
with any A4 lever
CTEJƁNGQTHQNFGT
Made from 100%
recycled cardboard,
the dividers have
either 5 or 10
multicoloured tabs
for easier recognition
of sections.
• JQNGWPKXGTUCNƁV
• A4 format
• Strong 160gsm cardboard
• $NWG#PIGNEGTVKƁECVG
RVFM
RVFM
519371
Order code 1+
34-8146 1.38
34-8142 1.38
518424
518464
[ƂCV
Dividers
1+
0.42
0.72
0.47
0.75
530890
Grey Polypropylene A4 Indices
Grey polypropylene
indices from Esselte
which can be used
with A4 lever arch
ƁNGUQTHQNFGTU6JGUG
indices have printed
tabs for easier
ENCUUKƁECVKQPCPF
the front sheets have
spaces for effective
section descriptions.
• Available with
choice of indices:
1-5, 1-10, 1-12
and A-Z
• Reinforced
punched strip on
front sheet
• JQNGWPKXGTUCNƁV
• A4 format
Type
1 to 5
1 to 10
1 to 12
A to Z
Order code
06-9831
06-9832
06-9833
06-9834
www.rapidonline.com sales@rapidonline.com
1+
0.39
0.67
0.69
1.09
530891
695
696 Stationery
• Perfect for archiving A4 documents transferred from
Archive Storage
•
•
•
•
•
Subject Dividers
These multi-coloured A4
subject dividers are punched
with 11 holes to accomodate
virtually all commonly used
ring binders.
• 300 micron
• 10 part set
• Supplied as a set of of 10
dividers
Type
10 Part pack of 10
Standard A4 Magazine Files
Order code 1+
34-9128 13.49
079986
Education
Suspension Files
RVFM
Tabs & Inserts for Suspension Files
Standard tabs and inserts for
WUGYKVJUWURGPUKQPƁNGU
• Supplied in packs of 50
Stationery
17
Type
/CIC\KPGƁNG
Type
6CDUHQTUWURGPUKQPƁNGU
Inserts for tabs
•
•
•
•
•
•
Type
100mm
Order code 1+
34-0047 7.99
526174
Presentation
+++ BEST SELLER +++
#JCPF[E
ideal for b
document
• Easy to
slide cli
close
• Transpa
cover fo
KFGPVKƁE
contents
• Holds a
20 A4 s
• Pentel t
With tough
clean cove
display bo
come with
copy-safe
pockets.
• Supplied
24 pock
• Supplied
assorted
of 10
Eco Storage and Transportation
Boxes with top opening
Suspension Files
Order code 1+
34-1010 9.08
077115
Foolscap Suspension Files
(Premium)
Theses Foolscap
Suspension Files
have been made
from heavyweight
coloured manilla.
They have been
pre-scored for
ease of use, and
have a V-base
20mm capacity.
• 2TGOKWOSWCNKV[UWURGPUKQPƁNGU
• 9TCRQXGTDCTFGUKIPRTQVGEVUƁPIGTUCPFPCKNUHTQO
cuts and scratches
• Supplied complete with clear index system
• Available in packs of 10, 20 and 50
• Size: Foolscap
Order code 1+
34-6136 4.00
34-6138 6.34
34-6140 10.39
081547
Free Delivery*
on all orders over £30 (excl. VAT)
(UK mainland only)
* See Terms & Conditions for full details
#%NKR
Display
RVFM
Type
10 pack
20 pack
50 pack
Colour
Blue
Red
Green
Yellow
Black
Assorted
526177
076691
Type
5WURGPUKQPƁNGU
• Size 226
• Weight 3
• Supplied
Type
#%NKRƁNG
White Presentation Ring Binder
Folders
Order code 1+
34-0052 9.89
Order code 1+
34-1012 2.01
34-1014 0.798
Standard
UWURGPUKQPƁNGU
HQTWUGKPƁNKPI
cabinets.
• Supplied in
packs of 50
696
Strong cardboard
OCIC\KPGƁNGUOO
YKFGYKVJƁPIGTJQNG
Ideal for storage and
archiving of A4 size
magazines, brochures,
ECVCNQIWGUƁNGUGVE
• Dimensions 80 x
325 x 247mm (W
x H x D)
• Finger hole for
easy retrieval from
shelves
• Material:
cardboard,100%
recyclable,
environmentfriendly
• Colour: white with
red print
• Weight 90g each
• Quick and easy to assemble
• 5WRRNKGFƂCVRCEMGFKPpacks of 25
• Esselte Ref: 49322
a binder
Sturdy construction with reinforced sides
Easy to assemble, simple-to-follow instructions printed
on each box
Perfect size for archiving shelves
Can be positioned vertically or horizontally
Made from 100% recycled corrugated board including
85% post-consumer material, 100% recyclable, FSC
EGTVKƁGF
Suitable for A4 format documents
Size 233 x 327mm
Available in 80 and 100mm widths
Weight each: 120g (80mm), 140g (100mm)
5WRRNKGFƂCVRCEMGFKPpacks of 25
Esselte Ref: 623916 (80mm), 623917 (100mm)
These fully functional
Storage and
Transportation Boxes
are made from 100%
recycled corrugated
board, including
85% post-consumer
material that is 100%
recyclable and FSC
EGTVKƁGF$[UGNGEVKPI'UUGNVG'EQ$QZGU[QWDGPGƁVHTQO
a cost-effective solution for archiving documents and
contribute to protecting our planet.
• +PVGITCVGFƂCRNKF
• Perfect as universal storage and transportation boxes,
or as a container for Esselte Eco archive boxes
• Takes 5x 80mm Eco Boxes or 4x 100mm Eco Boxes
• Easy assembly, simple-to-follow instructions printed
on the box
• Reinforced sides and base make the box sturdy and
suitable for large or heavy documents
• Made from 100% recycled corrugated board including
85% post-consumer material, 100% recyclable, FSC
EGTVKƁGF
• 5WRRNKGFƂCVRCEMGFKPpacks of 10
• Esselte Ref: 623918
Type
Storage boxes
Order code 1+
34-0048 16.99
Choice of A4 and A5 white ring binders from Esselte
with clear vinyl pockets for your presentation and
personalisation artwork.
• n&oUJCRGFTKPIUCVVCEJGFVQDCEMEQXGTHQTNC[ƂCV
display
Type
24 Pocket
Type
White A5 Ring Binder
White A4 Ring Binder
Recyco
Pack o
Order code 1+
34-9751 1.05
34-9755 2.39
519371
+++++++++++
RVFM
Polypropylene A4 Flat Files
526175
Eco Archiving Boxes/Transfer Files
These Esselte Eco
#TEJKXKPI$QZGU
Transfer Files are
perfect for general
A4 size document
storage or archiving
A4 documents
transferred from a
binder.
By selecting Eco
$QZGU[QWDGPGƁV
from a cost-effective
solution for archiving
documents and
contribute to
protecting our planet. These fully functional archiving
boxes are made from 100% recycled corrugated board
that includes 85% post-consumer material and is 100%
TGE[ENCDNGCPF(5%EGTVKƁGF
These lightweight, durable Polypropylene Flat Files are
ideal for binding small punched documents. They have
a folding 2 prong mechanism to keep the sheets secure
and a full-length title strip for labelling.
• 0QPTGƂGEVKXGENGCTEQXGTIKXGUIQQFXKUKDKNKV[
of document
• Full-length title strip for labelling
• Thumb cut at top and bottom for easy removal
of title strip
• Environmentally friendly polypropylene material
• For A4 and smaller punched paper
Tel: 01206 751166 Fax: 01206 751188
The Vivid r
Recycolog
at least 50
contain 30
document
• A4 disp
• Brightly
• Title spa
• 0QPTGƂ
• Made fr
• Supplied
yellow, p
Type
Recycology b
Stationery 697
d from
ns printed
including
le, FSC
• Size 226 x 1 x 310mm
• Weight 30g each
• Supplied in single colour or assorted packs of 25
Colour
Blue
Red
Green
Yellow
Black
Assorted
Pack of 25
Order code
34-8152
34-8154
34-8156
34-8158
34-8160
34-8162
Filelastic
1+
3.43
3.43
3.43
3.43
3.43
3.49
518425
mm)
#%NKRƁNG
526174
#JCPF[ENKRƁNG
ideal for binding short
documents.
• Easy to use - simply
slide clip to open and
close
• Transparent front
cover for easy
KFGPVKƁECVKQPQH
contents
• Holds approximately
20 A4 sheets
• Pentel type DCB14-T
Type
#%NKRƁNG
er
Type
Filelastic
Order code 1+
34-5968 0.82
519371
++
al
WOW Project Files
TheseRTQLGEVƁNGU
from the Leitz
WOW range offer a
solution to keeping
your workplace or
home neat and
tidy. Equipped with
spacious, expanding
compartments and
ideal for storing
important documents,
letters and any other vital paperwork in one secure place.
• A4
• Polypropylene
• 250 sheet capacity
• Front label
• Elastic fastener for secure closure
• Striking blue, green, pink or purple colours available
Recycology Presentation Books
Pack of 5
al
Order code 1+
06-9731 1.79
06-9732 1.99
06-9734 3.95
Order code 1+
34-9300 19.49
[ƂCV
Colour
Pink
Blue
Purple
Green
Order code
06-9861
06-9862
06-9863
06-9864
1+
4.69
4.69
4.69
4.69
544607
The Vivid range of presentation books are part of the
Recycology range of products from Pentel. Made from
at least 50% recycled material these A4 display books
contain 30 clear pockets for the display and protection of
documents, etc.
• A4 display book, 30 pockets
• Brightly coloured cover in vivid shades
• Title space on spine for easy reference
• 0QPTGƂGEVKXGOCVVƁPKUJNQYUVCVKERQEMGVU
• Made from at least 50% recycled material
• Supplied in mixed packs of 5 of 1 each of blue, green,
yellow, pink and violet
Type
Recycology books
Order code 1+
34-9297 9.24
500666
WOW 3-Flap Folders
WOW Display Books – 20/40
Pockets
These 20-pocket and
40-pocket display books from
the Leitz WOW range have been
designed for clear personalised
presentation and offer versatility
for a number of uses, including
displaying documents, menus,
RTGUGPVCVKQPUQTEGTVKƁECVGU
Equipped with either 20
pockets or 40 pockets, making
them ideal for the workplace,
QHƁEGUQTJQOGQHHGTKPIDQVJ
a professional and stylish
presentation.
• Ideal for displaying
documents
• 40-sheet or 80-sheet
capacity
• Polypropylene
• Available in blue, green, pink
or purple colours
530870
079908
es are
ey have
s secure
544608
These Multicolour
Printable A4 Index
Sheets from the Leitz
919TCPIGIKXG[QW
a choice of extremely
durable index sheets
in vibrant colours.
Available with a range
of tabs from 1-5 to
1-12.
• PC printable table
of contents
• Strong and durable
• Quick access even when used with pockets
• Made from polypropylene
• JQNGWPKXGTUCNƁV
Type
1 to 5 tabs
1 to 6 tabs
1 to 12 tabs
1+
1.75
1.75
1.75
1.75
These ƂCRHQNFGTU
from the Leitz WOW
range are stylish
solutions for storing
RCRGTNGCƂGVU
and brochures,
especially when on
the move. Designed
VQƁVWRVQ
A4 sheets (80gsm) and manufactured with laminated
Colour
20 pockets
Pink
Blue
Purple
Green
40 pockets
Pink
Blue
Purple
Green
Order code
17
Stationery
With tough, wipeclean covers these
display books
come with 100%
copy-safe clear
pockets.
• Supplied with
24 pockets
• Supplied in
assorted packs
of 10
Order code
06-9865
06-9866
06-9867
06-9868
Order code 1+
34-9302 6.19
WOW PP Multicolour Printable A4
Index Sheets
Display Books
Type
24 Pocket
Colour
Pink
Blue
Purple
Green
079909
081163
selte
d
Filelastics provide
a secure method
of paper storage.
Three internal
ƂCRUCPFVJG
coloured elastics
prevent papers
from falling out.
• Assorted colour
pack
• Supplied in
packs of 5
Education
+++
RQN[RTQR[NGPGVJGHQNFGTUCNUQHGCVWTGƂCRUCPFCP
elastic fastening band for security of contents.
• 150 sheet capacity - A4
• Dimensions: 310 x 244mm (H x W)
• Flaps prevent contents from falling out or being
damaged
• Elastic band fastener for secure transportation of
documents
• Glossy metallic colours in blue, green, pink or purple
1+
06-9869
06-9870
06-9871
06-9872
1.75
1.75
1.75
1.75
06-9873
06-9874
06-9875
06-9876
2.45
2.45
2.45
2.45
544609
WOW A4 250-Sheet Capacity Flat
Files
These A4 ƂCVƁNGUfrom the Leitz 919TCPIGCTG
available in a choice of three vibrant shades and have a
dual colour effect. Their laminated exterior gives them a
glossy look and feel.
• Holds up to 250 A4 sheets (80gsm)
• $CTOGEJCPKUOENKRUCPFƁNGUJQNGRWPEJGF
documents
• (CUVƁNKPICPFGCU[CEEGUUVQEQPVGPVU
Type
Blue
Order code 1+
06-9759 0.69
530875
…where price meets quality
www.rapidonline.com sales@rapidonline.com
697
698 Stationery
Expanding Box Files
Expanding Box File
Binders
6GEJPKECNURGEKƁECVKQP
Binding system
/CPWCNGNGEVTKE
Punching capacity (80gsm)
Binding capacity (80gsm)
Comb size max.
Comb and doc size guide
Chip tray
Type
Electric comb binder
Manual Comb Binder
Plastic Comb
Electric
20
300
50mm
Yes
Single side burst out
Order code 1+
45-1219 399.99
516993
Education
Electric Comb Binder Multiple User
Galaxy-E500
Stationery
17
This Expanding Box File has a choice of multi-purpose
(indexed A-Z, 1-21, monthly planner and utilities)
versions to meet your individual requirements. Pleated
base and sides allowing for maximum paper capacity
(25mm per pocket).
• Front cover to protect contents
• Size allows for storage of both A4 and foolscap
documents
Type
$NCEMƁNGDQZ
$NWGƁNGDQZ
4GFƁNGDQZ
Order code 1+
34-6144 6.34
34-6146 6.34
34-6148 6.34
081549
Manilla Multi-Purpose Expanding
File System
This expanding
ƁNGU[UVGOKU
KFGCNHQTƁNKPI
loose papers in
individual pockets.
It has been made
from strong,
manilla board.
6JGGZRCPFKPIƁNG
is perfect for all
household bills,
invoices, delivery
notes or temporary mark forward purposes.
• Manufactured from strong manilla
• Reinforced gussets
• 5KZVGGPƁNKPIRQEMGVU
• Suitable for both A4 and foolscap papers
• Colour - Light brown
Type
'ZRCPFKPIƁNG
The Quasar manual comb binder is designed for
OCZKOWORGTHQTOCPEGKPVJGQHƁEG9KVJVJGHWNNYKFVJ
punch handle, it will punch up to 20 sheets (80gsm). It
will bind with all sizes of comb from 6mm up to 50 mm
creating documents up to 500 sheets in size.
• Vertical document loading ensures consistent punch
alignment
• 'HƁEKGPVFGUKIPRGTOKVUUGRCTCVGRWPEJKPICPFDKPFKPI
• Rotary edge guide adjustment for quick and accurate
document centering
• Full-width punch handle is easy to operate all
punching requirements
• Document thickness and comb sizing guide allows user
to quickly select
• Punched sheets can be loaded onto the separate
comb opening mechanism for faster binding results
• Chip tray window shows when the waste tray is full
• .KFCPFRWPEJJCPFNGHQNFƂCVHQTGCU[UVQTCIG
• Combs storage tray and patented document measure
• Includes binding starter pack for 10 documents
• Durable metal mechanism for longevity
• 2 year warranty
Type
Manual comb binder
Order code 1+
34-5792 165.95
080931
'NGEVTKE%QOD$KPFGT1HƁEG7UG
Quasar-E500
Order code 1+
34-6142 2.61
Binding Combs
Plastic Binding Combs
A range of binding combs designed for use with plastic
comb binding machines.
• A4 size with 21 rings
• 14.28mm pitch
• Colour blue or black
• Supplied in packs of 100
Type
8mm
8mm
16mm
Colour
black
blue
black
Order code 1+
45-2086 2.39
45-2090 2.39
45-2110 7.59
072431
698
6GEJPKECNURGE
Binding system
/CPWCNGNGEVT
Punching capa
Binding capac
Comb size ma
Comb and doc
Chip tray
This comb binder has been designed for heavy, multiple
WUGKPCNCTIGQHƁEGGPXKTQPOGPVCPFJCUOCP[HGCVWTGU
VJCVOCMGKVCRQYGTHWNCPFGHƁEKGPVFGXKEG6JGGNGEVTKE
punch can handle up to 25 sheets of 80gsm paper and,
with a maximum comb size of 50mm, the machine can
DKPFWRVQRCIGU#DGPGƁVQHWUKPICEQODDKPFGT
KUVJCVVJGTGUWNVKPIDQWPFFQEWOGPVECPDGQRGPGFƂCV
for easy viewing, photocopying, etc., also pages may be
CFFGFTGOQXGFGCUKN[CPFSWKEMN[
6JGDKPFGTECPDGWUGFOQTGGHƁEKGPVN[FWGVQVJG
innovative satellite system that consists of a removeable
binding platform that allows multiple users to punch and
bind simultaneously. There is a selection facility enabling
the choice of punching A4 or A5 sized documents and
the back margin adjustment selector is ideal for thick
documents. Spare covers and combs can be stored in
the front access, full size storage tray which also has a
clever comb and document measuring system.
• Includes starter kit for binding 20 documents
• Electric punch for up to 25 sheets
• 500 sheet binding capacity
• Maximum comb size of 50mm
• Angled comb rake
• Adjustable rotary edge guide
• Storage tray with comb and document measure
• Burst out chip tray accessible from both sides
• Vertical Punching
• Binding Element Selector
6GEJPKECNURGEKƁECVKQP
Binding system
/CPWCNGNGEVTKE
Punching capacity (80gsm)
Binding capacity (80gsm)
Comb size max.
Comb and doc size guide
Chip tray
081548
This electric punch comb binder has been designed for
HTGSWGPVQHƁEGWUGCPFECPGHHQTVNGUUN[RQYGTVJTQWIJ
up to 20 sheets of 80gsm paper. The machine will bind
up to 300 sheets, with a maximum comb size of 50mm.
#HVGTDKPFKPIVJGFQEWOGPVUOC[DGQRGPGFƂCVGIHQT
photocopying and pages can be quickly and easily added
and removed.
Additional features that enhance this binder include
an angled comb rake that makes it easier to load the
punched sheets and the adjustable rotary edge guide
ensures that sheets are aligned accurately. A storage tray
is provided that has a patented comb and document
measure that assists in the quick selection of the
requisite supplies for a particular task. Also, to help
prevent jams the unique chip tray will burst out when full.
• Includes starter kit for binding 10 documents
• Electric punch for up to 20 sheets
• 300 sheet binding capacity
• Maximum comb size of 50mm
• Angled comb rake
• Adjustable rotary edge guide
• Storage tray with comb and document measure
• Burst out chip tray
• Vertical Punching
• Binding Element Selector
bind up to
binder suit
all metal e
DQWPFFQE
or photoco
add or rem
To produce
binder has
punching
An adjusta
document
GCUKN[EGPV
back marg
• Heavy d
• Pedal op
• For high
• Electric
• 500 she
• Maximu
• Cooling
engine a
• Durable
• Extra-lar
Type
Electric comb binder
Plastic Comb
Electric
25
300
50mm
Yes
Burst out type accessible both sides
Order code 1+
45-1220 459.99
516994
Electric Comb Binder Heavy Use
Pedal Operated Orion-E500
Type
Electric comb
Electri
Galaxy
+PVGPFGFH
process up
bindercan
comb size
produce a
HTQOVCOR
viewing an
Further fea
VJGTGSWKTG
EQPVTQNHQT
selection f
edge guide
wire and d
binding wi
covers and
of the mac
• Includes
• Heavy d
• For high
• Stylish a
• Vertical
• Binding
• Chip tra
• Electric
• 130 she
• Maximu
6GEJPKECNURGE
Binding system
/CPWCNGNGEVT
Punching capa
Binding capac
Comb size ma
Comb and doc
Chip tray
A comb binder that has a pedal operated electric
punch and is designed for heavy usage in a commercial
environment. The ability to punch up to 30 sheets and to
Tel: 01206 751166 Fax: 01206 751188
Type
Electric wire
Stationery 699
516993
User
bind up to 500 sheets with a 51mm comb makes this
binder suitable for a wide range of documents and the
all metal engine and body is durable and attractive. The
DQWPFFQEWOGPVOC[DGQRGPGFƂCVHQTGCU[XKGYKPI
or photocopying and the comb binding makes it easy to
add or remove pages.
To produce documents precisely as required the
binder has features such as 21 individually selectable
punching pins to tailor for individual document widths.
An adjustable punch depth is provided for extra large
documents and an adjustable side margin edge guide
GCUKN[EGPVGTUFQEWOGPVU6JGTGKUCNUQCƁXGRQUKVKQP
back margin and document measure.
• Heavy duty commercial binder
• Pedal operated punch
• For high volume use
• Electric punch for up to 30 sheets
• 500 sheet binding capacity
• Maximum comb size of 51mm
• Cooling fan, safety fuse and auto-reverse protect the
engine and mechanism
• Durable all metal construction
• Extra-large chip tray with convenient front access
VJG
moveable
unch and
enabling
ts and
r thick
ored in
o has a
Type
Electric comb binder
Order code 1+
45-1221 649.99
516995
Type
For
Sprung scissors Right hand
Sprung scissors Left hand
121779
This class pack features a sturdy wooden storage block
and a mixture of right-handed and left-handed ruler
scissors.
The scissor block is also available separately.
• Colour-coded: red handles for right-handed and
[GNNQYITGGPHQTNGHVJCPFGFUEKUUQTU
• Supplied as a pack with block and 32 ruler scissors:
28 right-handed and 4-left handed
• Solid scissor block is also available separately
• Block dimensions are 29 x 7 x 6cm (L x W x H),
holes are approximately 1cm diameter
Type
Block + 32 scissors
Scissor block only
Order code 1+
52-1842 12.95
06-1999 3.29
121789
Electric Wire Binder Heavy Use
Galaxy-E500
Order code 1+
52-1832 0.69
52-1834 0.69
13cm Ruler Scissors – Pack of 12
These scissors have a
blade that has ruled
markings to enable
precise cutting.
• Length 13cm
• Available in right
hand or left hand
types
• Supplied in packs
of 12
Type
For
Ruler scissors Right handed
Ruler scissors Left handed
Order code 1+
52-1846 3.95
52-1848 3.49
121777
Crazy Cut Craft Scissors
A pack of 6 Crazy Cut craft scissors each with a different
decorative cutting edge in a variety of bright colours. With
six different patterned blades to produce a variety of
pretty effects, including deckle edge, scallop, wave, saw
tooth, and zig zag, these decorative edge scissors are
ideal for all your paper crafting needs and provide good
value for money.
These crazy cut craft scissors have 6 different cutting
designs and are ideal for a variety of paper craft projects
including card making, scrap booking, matting and
layering, and classroom display work and will bring
RTQHGUUKQPCNƂCKTVQCNN[QWTRTQLGEVU
With stainless steel, rust resistant blades these craft
scissors are lightweight and comfortable to use; perfect
HQTNKVVNGCPFDKIƁPIGTUCNKMG
• Supplied as an assorted pack of 6 different decorative
edge scissors
• 2.5 inch stainless steel blades
• Rust resistant
• Lightweight
• Comfortable grip
• Suitable for Key Stages 1, 2 & 3 (ages 5 to 14) as well
as seasoned crafters
17
Stationery
multiple
HGCVWTGU
GNGEVTKE
aper and,
ine can
DDKPFGT
RGPGFƂCV
may be
Plastic Comb
Electric
30
500
51mm
Yes
Front
Scissor Blocks and Ruler Scissors
Education
6GEJPKECNURGEKƁECVKQP
Binding system
/CPWCNGNGEVTKE
Punching capacity (80gsm)
Binding capacity (80gsm)
Comb size max.
Comb and doc size guide
Chip tray
The brightly coloured handles, blunt ends and sturdy
construction means they are ideal in a classroom,
nursery, or kids club.
Perfect for all art and craft projects, these scissors
provide great quality and superb value. Models available
for both left and right handed use.
• Length 13cm - blade 5cm
• Bright plastic handles
• Available in right hand or left hand versions
• Suitable for Key Stages 1 & 2 (ages 5 to 11)
Scissors
Colours vary.
re
s
both sides
516994
se
ic
mmercial
ts and to
+PVGPFGFHQTWUGKPCNCTIGQHƁEGVJKUYKTGDKPFGTECP
process up to 20 sheets with its electric punch and the
bindercan deal with up to 130 sheets, with a maximum
comb size of 14mm. The unique, user-friendly features
produce a professional quality document that is secure
HTQOVCORGTKPICPFECPDGQRGPGFQWVƂCVHQTGCU[
viewing and photocopying.
Further features that allow the tailoring of documents to
VJGTGSWKTGFURGEKƁECVKQPKPENWFGCRTGUGNGEVCDNGENQUWTG
EQPVTQNHQTGCU[CPFGHƁEKGPVYKTGENQUWTGCPFCRWPEJ
selection for A4 and A5 sized documents. An adjustable
edge guide aligns sheets accurately and the patented
wire and document measure ensures that the correct
binding wire is chosen. A storage tray is provided to keep
covers and combs handy and is accessible from the front
of the machine.
• Includes starter kit for binding 20 documents
• Heavy duty commercial binder
• For high volume use
• Stylish and durable
• Vertical punching
• Binding element selector
• Chip tray accessible from both sides
• Electric punch for up to 20 sheets
• 130 sheet binding capacity
• Maximum comb size of 14mm
6GEJPKECNURGEKƁECVKQP
Binding system
/CPWCNGNGEVTKE
Punching capacity (80gsm)
Binding capacity (80gsm)
Comb size max.
Comb and doc size guide
Chip tray
Type
Electric wire binder
Wire
Electric
20
130
14mm
Yes
Both sides
Order code 1+
45-1222 549.99
516996
Type
Crazy cut scissors pk of 6
Order code 1+
52-1828 3.19
School Scissors
121786
High quality,
general-purpose
scissors with
round-ended
blades for safer
use in the school
environment.
• Stainless steel blades and rugged ABS handles to help
withstand the rigours of use by pupils
• 1XGTCNNNGPIVJOO
• Supplied singly
Type
School scissors
Order code 1+
86-1015 1.72
034579
Spring-Aid Children’s
Scissors 13cm
Plastic handled, roundended metal scissors
with 5 centimetre rule
markings on one blade.
These children’s
scissors are ideal for
use by little hands,
or for those who have
trouble with manual
dexterity as their inbuilt
spring means that the
scissors automatically open when pressure is released.
Supersafe Scissors
High quality
children’s scissors
ƁVVGFYKVJ
(+0)'4)7#4&v
blade covers. As
the blades cannot
be accessed,
they have been
produced slightly
UJCTRGTVJCPWUWCNIKXKPIUKIPKƁECPVN[KORTQXGFEWVVKPI
quality compared to standard children’s scissors, along
with increased blade life.
• Larger soft-grip handles for maximum comfort when
cutting
• Space provided to personalise each pair with child’s
name if required
• Highly recommended for classroom use
• Supplied in packs of 24 or 72 – assorted colours
Type
Classpack of 24 assorted
Bulkpack of 72
Order code 1+
34-9890 32.99
34-9910 108.99
122462
New products
www.rapidonline.com
www.rapidonline.com sales@rapidonline.com
699
700 Stationery
RVFM
Go Green Recycled Scissors
Education
All Metal Stainless Steel Scissors
These quality
Stainless Steel
Scissors have doublebowed handles and
OKTTQTƁPKUJGFVKRU
1PGVKRKUDNWPVCPF
the other sharp,
allowing things to
be easily cut while
laying on a table top. Their all-metal construction allows
the scissors to be readily washed or dishwashed to
remove ink or glue deposits without fear of damage to
the handles.
• Quality Stainless Steel Scissors
• Double-bowed handles
• /KTTQTƁPKUJGFVKRU
• 1PGDNWPVVKRQPGUJCTRVKR
• Easy cutting on table top
• Can be safely washed or dishwashed
• Available in 150mm (6in.) and 180mm (7in.) lengths
Type
150mm Metal Scissors
180mm Metal Scissors
Order code 1+
52-1819 1.29
52-1875 1.79
Stationery
Type
250mm soft grip scissors
Type
220mm universal scissors
RVFM
Length
6in.
8.25in
8.25in.
5in
Order code
52-1807
52-1814
52-1813
52-1816
1+
0.95
1.09
1.29
0.89
121776
Premium Softgrip Scissors
Order code 1+
86-1020 6.24
034580
Left Handed Scissors
A high-quality pair of
210mm scissors.
• Stainless steel blades
• Rugged, moulded ABS
handles, which are
correctly contoured
for comfortable, and accurate use in the left hand
Type
Left-handed scissor
Combining high quality and superb comfort these
premium quality scissors are ideal for a wide range of
cutting tasks. The scissors feature precision stainless
steel machined blades and tough ABS handles with a
soft inner grip for premium comfort.
• Ergonimically designed sidebent handles for comfort
and ease of use
• Quality stainless steel, bevel ground blades
• Available in 165mm (6.5in.) and 210mm (8.25in.)
• 5 year manufacturer’s warranty
Length
16.5cm
21cm
Order code 1+
52-1826 1.39
52-1824 1.89
121778
RVFM
Order code 1+
86-1038 6.24
060382
A range of economical
stainless steel blade
scissors.
• Moulded ABS handles
for comfort
• 5WKVCDNGHQTIGPGTCNQHƁEGWUG
Type
OO1HƁEGUEKUUQTU
OO1HƁEGUEKUUQTU
Type
Right-handed
Left-handed
Order code 1+
86-1005 3.82
86-1007 5.64
067063
Activate your account for
online ordering.
For further information:
www.rapidonline.com/
activate
RVFM
21cm Multi-purpose Scissors
These heavy duty
PrecisionGrip shears
feature precision
ground, high quality
blades and contoured
soft grip ridged handles
CPFƁPIGTITKRHQT
maximum comfort in use.
• Stainless steel blades
• Ergonomic handles
• Suitable for both left and right handed users
5in Softgrip Scissors
Childrens soft grip
handle for added
comfort and grip in use.
• Length 13cm
• Ergonomically designed handles
• Stainless steel blades
Order code 1+
52-1817 3.95
No minimum order value
UK mainland only
121788
700
Order code 1+
52-1818 2.95
502672
Order code 1+
52-1840 0.79
Tel: 01206 751166 Fax: 01206 751188
Carbon
These Carb
Scissors w
almost any
the garden
cut woody
thin branc
take cuttin
hosepipe,
plant labe
• Carbon
• Cut alm
• Cut woo
• Cut thin
• Take cut
• Cut hose
• Cut plas
• And mu
5in No
The handles of these
scissors contain a
special BioGuard
formula that allows
the slow release
of active biocidal
silver ions which
constantly migrate to the surface of the plastic to kill
harmful organisms. BioGuard is effective for a minimum
of 8 years.
The scissors have high quality titanium blades and are
200mm (8in) in length.
• Handles contain BioGuard biocidal formula
• BioGuard is effective for a minimum of 8 years
• High quality titanium blades
• 200mm (8in.) length
Type
Titanium Scissors
RV
RV
BioGuard Titanium Scissor
Order code 1+
52-1843 1.99
52-1845 1.99
Type
21cm Pinking
Type
Carbon Blade
RVFM
500097
Type
5in Softgrip scissors
502671
121783
RVFM
Order online
Order code 1+
52-1811 1.29
52-1815 1.59
Type
Multi-purpose scissors
Premium Paper/Dressmaker’s
Scissors 254mm (10in.)
Premium comfort
scissors with multiuse stainless steel
machined blades
suitable for a variety of cutting tasks.
• Tough ABS plastic handles with soft grip inner for
premium comfort
• 254mm (10in.) blades
• Ideal for dress making
• Available in right- and left-hand versions
1HƁEG5EKUUQTU
The handles of these
scissors contain a
special BioGuard
formula that allows
the slow release of
active biocidal silver
ions which constantly
migrate to the surface
of the plastic to kill
harmful organisms.
BioGuard is effective
for a minimum of 8
years.
The scissors have high quality stainless steel blades and
are available in 150mm (6in.) and (8in.) lengths.
• Handles contain BioGuard biocidal formula
• BioGuard is effective for a minimum of 8 years
• High quality stainless steel blades
• Available in 150mm (6in.) and 200mm (8in.) lengths
Type
150mm
200mm
Type
Softgrip scissors
Softgrip scissors
Order code 1+
86-1045 1.69
BioGuard Scissors
RVFM
High quality scissors
with stainless steel
blades bonded to
rugged ABS plastic
handles.
• Handles are angled
VQCNNQYGCUKGTEWVVKPICICKPUVCƂCVUWTHCEGGIHQT
fabrics and large sheets of paper, etc.
• .CTIGQRGPKPIHQTƁPIGTU
• 1XGTCNNNGPIVJOO
Heavy duty
blade she
trimming c
and also t
effects in a
• Length 2
• Black ha
• Suitable
(ages 1
300738
517878
17 Universal Scissors
21cm
General purpose
scissors with
comfortably styled, soft
grip moulded handles.
• Angled handles for
GCU[EWVVKPIQHNCTIGƂCVUJGGVU
• Stainless steel blades
• 1XGTCNNNGPIVJOO
These scissors have
been created using
recycled materials
for the blades and
handles.
• Available in 6in,
8.25in or 5in with
rounded tips
• 8.25in. available
in right- and lefthanded versions
• Cuts cleanly
through a wide
variety of materials
• The 5in. rounded
tip type (52-1816)
• Manufacturer’s 10
year guarantee
Type
Recyc. scissors
Recyc. scissors
Left-handed
Re. scissors round tip
RV
Soft Grip Scissors 250mm (10in.)
These craf
JCXG6GƂQP
non-stick
NCTIGƁPIG
making th
for decoup
generally f
card, plast
• Length 1
• Suitable
Type
Non-stick cra
RV
Electro
Scisso
Blade
These hea
scissors h
extremely
blades tha
almost any
are equall
for use in
UEJQQNQHƁ
and works
The blades
serrated s
stops thing
This is par
things like
Stationery 701
0in.)
21cm Pinking Shears/Scissors
Heavy duty, high quality pinking
blade shears for an accurate
trimming cut in dressmaking
and also to produce decorative
effects in art and craft designs.
• Length 21cm
• Black handles
• Suitable for Key Stage 3
(ages 11 to 14)
Type
Serrated scissors
Guillotines
*GCX[&WV[##1HƁEG
Guillotines
Order code 1+
52-1825 3.49
502670
300738
RVFM
Multi Tool TufKut Scissors 180mm
Order code 1+
52-1822 5.95
121785
RVFM
Carbon Blade Scissors
) lengths
502671
Type
Carbon Blade Scissors
Type
TufKut scissors
Order code 1+
86-1239 1.14
300739
RVFM
These high quality guillotines are designed for frequent
use.
• Adjustable back stop
• Robust steel base printed with size guides
• Hand clamp to hold items securely in position
• High quality ground blades
• Cutting capacity of 2mm (20 sheets of 80gsm paper)
• Replacement guard for 45-5510 available separately
• Manufactured to BS5498
Type
A3 guillotine
Repl. guard 45-5510
A4 guillotine
Order code 1+
45-5510 82.95
45-5511 18.99
45-5512 64.99
072386
Snip and Measure Scissors
200mm (8in.)
17
Stationery
s
These Carbon Blade
Scissors will cut
almost anything. In
the garden they will
cut woody stems,
thin branches,
take cuttings, cut
hosepipe, cut plastic
plant labels, etc.
• Carbon Blade Scissors
• Cut almost anything in the garden
• Cut woody stems
• Cut thin branches
• Take cuttings
• Cut hosepipe
• Cut plastic plant labels
• And much more
Universal heavy-duty
stainless steel
scissors that can be
used in the workshop,
garden, kitchen,
home, school and
industry.
• Cuts plastics,
plastic rods and sheets, wire, carpet, metal, raw meats,
rubber, vinyl tiles, thick card, etc.
• Ideal for modelling and craft construction in education
• An essential for First Aid kits
• Serrated lower blade for non-slip cutting
• 1XGTCNNNGPIVJOO
Education
Type
21cm Pinking shears
ades and
s.
.KIJV&WV[##1HƁEG
Guillotines
Order code 1+
52-1821 3.99
502668
RVFM
These innovative safety scissors have an integrated lockand-release tape measure and safety blade cover.
• Length 210mm (8in.)
• Crafted from brushed satin stainless steel
• Designed for precise and controlled cutting
• Suitable for use with right or left hand
5in Non-stick Craft Scissors
121783
These craft scissors
JCXG6GƂQPEQCVGF
non-stick blades and
NCTIGƁPIGTITKRU
making them ideal
for decoupage and
generally for cutting
card, plastic, leather, etc.
• Length 13cm
• Suitable for Key Stage 3 (ages 11 to 14)
Type
Non-stick craft scissors
Type
Snip and measure
Order code 1+
52-1820 1.59
RVFM
and are
s
502672
Order code 1+
52-1847 1.73
500099
121784
to kill
minimum
lue
In the garden they will cut woody stems, thin branches,
take cuttings, cut hosepipe, cut plastic plant labels, etc.
They also have slightly rounded tips which are safer to
use in the school garden.
• Extremely tough blades with a serrated section
• 2QRWNCTICTFGPKPICPFƂQTKUVT[UEKUUQTU
• Cut almost anything in the garden
• Cut woody stems, thin branches, take cuttings, cut
hosepipe, cut plastic plant labels, etc.
• Cuts wire, plastics, etc.
• Slightly rounded tips - safer in the school garden
RVFM
Electroplated Multipurpose
Scissors/Snips with Serrated
Blade Section
These heavy-duty
scissors have
extremely tough
blades that will cut
almost anything. They
are equally suited
for use in the home,
UEJQQNQHƁEGICTCIG
and workshop.
The blades have a
serrated section that
stops things from being pushed away as the scissors cut.
This is particularly useful for cutting harder or slippery
things like wire, bacon rinds, plastic, pipe cleaners, etc.
General Purpose Value Scissors
150mm
Value by name and value by
PCVWTG
These 150mm (6in.) scissors
are ideal for general-purpose
paper cutting and are widely
used in secondary schools. The scissors have stainless
steel blades and plastic handles which are equally
comfortable for left-handed or right-handed users.
• Excellent value
• 150mm (6in.)
• Ideal for general-purpose paper cutting
• Widely used in secondary schools
• Stainless steel blades
• Plastic handles
• Comfortable for both left-handed and right-handed
users
Type
150mm value scissors
Order code 1+
52-1849 0.49
539752
These guillotines are designed for occasional home or
QHƁEGWUG
• Adjustable back stop
• Tough ABS base printed with size guides
• Transparent safety guard
• Cutting capacity of 1mm (10 sheets of 80gsm paper)
• Manufactured to BS5498
Type
A3 guillotine
A4 guillotine
Order code 1+
45-5514 49.99
45-5516 32.99
072390
Page 46
Kaleidocraft Card A4
Pack of 100
www.rapidonline.com sales@rapidonline.com
701
702 Stationery
A1 Rotary Paper Trimmers
Heavy Duty, 10 Sheets
Education
A4 Guillotine – Light Duty,
10 Sheets
Stationery
17
If scissors are
not quite up to
the job, then this
handy machine
will make light
work of your tasks.
This guillotine
will provide a
much more costeffective paper
cutting option for
the home and
OQUVDWU[QHƁEGU
The guillotine is supplied complete with a guard, which
RTQVGEVU[QWTƁPIGTUHTQOVJGDNCFGCPFCNUQCEVUVQ
secure the paper in place, and a large blade for cutting
the paper.
• Cuts up to 10 A4 sheets of 80gsm paper at a time
• Ideal for cutting paper, card and photographs
• Transparent safety guide
• Sturdy metal base for added strength
• Pre-printed guides and clear marking for easy paper
alignment
• 5RGEKƁECNN[FGUKIPGFHQTGCUGQHUVQTCIG
• Cutting guard folds down for easy storage
• Clip mechanism to lock the guard when not in use
• Precise, accurate cutting action
Type
A4 Guillotine
Order code 1+
34-6178 21.27
081556
Type
A3 trimmer
Order code 1+
45-5506 74.95
081460
Type
4-blade pape
A4 Rotary Paper Trimmers
Heavy Duty, 15 Sheets
Order code 1+
45-5502 149.99
45-5503 19.99
A2 Rotary Paper Trimmers
Heavy Duty, 12 Sheets
Paper
A professional A0 rotary trimmer, designed for high
volume usage, providing accurate trimming of paper, card
and laminating pouches.
• Safe and easy to use
• Long-life, self-sharpening blade
• Maximum Cut Length of 1300mm
• #WVQOCVKEENCORVQJQNFKVGOUƁTON[KPRQUKVKQP
• Adjustable back stop for accurate alignment
• Ergonomic rubber cutting head to give maximum
comfort when trimming
• Printed base showing paper size guides
• #VVTCEVKXGUKNXGTCPFDNCEMƁPKUJ
• Stand with bin for catching trimmings
• Manufactured to BS5498
• Manufacturer’s 2 year warranty
Order code 1+
45-5500 184.99
072384
Fast Delivery
All orders for in-stock items received
by 7pm – Monday to Friday
are despatched the same day
A professional A2 rotary trimmer, designed for high
volume usage, providing accurate trimming of paper, card
and laminating pouches.
• Safe and easy to use
• Long-life, self-sharpening blade
• #WVQOCVKEENCORVQJQNFKVGOUƁTON[KPRQUKVKQP
• Adjustable back stop for accurate alignment
• Ergonomic rubber cutting head to give maximum
comfort when trimming
• Printed base showing paper size guides
• #VVTCEVKXGUKNXGTCPFDNCEMƁPKUJ
• Can cut up to 12 sheets of 80gsm paper at a time
• Manufactured to BS5498
Type
A2 trimmer
Order code 1+
45-5504 88.99
081459
Page 44
A3 Cartridge Paper
130gsm - Pack of 250
A professional A4 rotary trimmer, designed for high
volume usage, providing accurate trimming of paper, card
and laminating pouches.
• Recommended maximum capacity 15 sheets of 80gsm
paper or equivalent
• Safe and easy to use
• Long-life, self-sharpening blade
• #WVQOCVKEENCORVQJQNFKVGOUƁTON[KPRQUKVKQP
• Adjustable back stop for accurate alignment
• Ergonomic rubber cutting head to give maximum
comfort when trimming
• Printed base showing paper size guides
• #VVTCEVKXGUKNXGTCPFDNCEMƁPKUJ
• Can cut up to 15 sheets of 80gsm paper at a time
• Manufactured to BS5498
Type
A4 trimmer
Order code 1+
45-5508 57.99
081461
A4 & A3 Rotary Paper Trimmers
Medium Duty, 8 to 10 Sheets
These high quality paper trimmers feature ground rotary
cutting blades and a see-through paper clamp.
• Available in A4 and A3
• Metal cutting table
• Cuts up to 10 sheets of 80gsm (A4) and 8 sheets
of 80gsm (A3)
• Table measures 320 x 157mm (A4)
and 460 x 155mm (A3)
Type
A4 Rotary trimmer
A3 Rotary trimmer
Order code 1+
25-1045 12.00
25-1046 18.00
516935
702
This innova
cuts, wavy
A fourth b
creating fo
To choose
Blade’ kno
change or
• Ideal for
• Takes A4
• 300mm
metric a
• Cuts up
• Safe - n
blades t
• Straight
• Simply r
the requ
• To opera
away fro
• Slide th
ƁPKUJGF
• Anti-slip
• +FGCNHQT
• 1XGTCNNN
081458
A0 Rotary Paper Trimmers
Heavy Duty
Type
A0 trimmer
A4 Cre
Trimme
A professional A3 rotary trimmer, designed for high
volume usage, providing accurate trimming of paper, card
and laminating pouches.
• Safe and easy to use
• Long-life, self-sharpening blade
• #WVQOCVKEENCORVQJQNFKVGOUƁTON[KPRQUKVKQP
• Adjustable back stop for accurate alignment
• Ergonomic rubber cutting head to give maximum
comfort when trimming
• Printed base showing paper size guides
• #VVTCEVKXGUKNXGTCPFDNCEMƁPKUJ
• Can cut up to 15 sheets of 80gsm paper at a time
• Manufactured to BS5498
A professional A1 rotary trimmer, designed for high
volume usage, providing accurate trimming of paper,
card and laminating pouches.
• Safe and easy to use
• Long-life, self-sharpening blade
• #WVQOCVKEENCORVQJQNFKVGOUƁTON[KPRQUKVKQP
• Adjustable back stop for accurate alignment
• Ergonomic rubber cutting head to give maximum
comfort when trimming
• Printed base showing paper size guides
• #VVTCEVKXGUKNXGTCPFDNCEMƁPKUJ
• Stand with bin for catching trimmings
• Replacement blades available separately
• Manufactured to BS5498
Type
A1 trimmer
Replacement Blade
Trimmers
A3 Rotary Paper Trimmer
Heavy Duty, 15 Sheets
Tel: 01206 751166 Fax: 01206 751188
(GNNQYGU2
the perform
cleaning a
wheels an
• Availabl
350ml b
Type
350ml
Cross C
4 Shee
The AS424
Aurora is a
saving and
tabletop s
capable o
up to 4 fo
sheets of
credit card
a convenie
handle, a
waste bin,
shreds pa
cards, stap
small pap
to Security
in accorda
DIN32757
• 220 to 2
• Automat
• Reverse
• Remova
• 1XGTJGC
• 1XGTCNNU
• GS & C
Stationery 703
A4 Creative 4-Blade Paper and Card
Trimmer
6GEJPKECNURGEKƁECVKQP
Cutting type
Feed opening width
Capacity
Cut size
Shred speed
Bin capacity
Weight
Type
4-sheet Shredder
Cross-cut
120mm
4 folded sheets of 75gsm paper or equivalent
5 x 47mm
2.2m per minute
5 litres
2.2kg
Cross Cut Paper Shredder
10 Sheets, 20 Litres, Din 3,
AS1018CD
Order code 1+
34-6222 20.99
518253
igh
aper, card
QP
time
081460
Order code 1+
06-0409 6.25
530062
Type
5-sheet shredder
Shredders
of 80gsm
Cross Cut Paper Shredder
8 Sheets, 16 Litres, Din 3, AS800CD
(GNNQYGU2CRGT5JTGFFGT1KNGPJCPEGU
the performance of all shredders by
cleaning and lubricating the cutting
wheels and punches.
• Available in squeezable
350ml bottles
QP
Type
350ml
um
Order code 1+
34-5790 7.95
080930
time
081461
rs
nd rotary
heets
516935
Order code 1+
34-6170 26.64
081553
Paper Shredder Oil
igh
aper, card
Protect your identity
by shredding personal
CPFEQPƁFGPVKCN
documents. For
extra high security
choose this cross-cut
shredder. It will
cut any unwanted
documents and paper
into tiny ‘confetti’
size bits so it’s
virtually impossible
for a document to be
reconstructed. Crosscut or ‘confetti’ waste
is less bulky so you don’t need to empty the basket so
often.
• Takes a maximum of 5 sheets at once
• 14 litre bin
• 5WKVCDNGHQTTGIWNCTWUGKPJQOGQTUOCNNQHƁEG
• Reverse function when overfed
• #WVQ1P1HHQRGTCVGFD[OKETQUYKVEJ
• Safety cut-out when head is removed
Cross Cut Paper Shredder
4 Sheets, 5 Litres, Din 3, AS424C
The AS424C from
Aurora is a spacesaving and compact
tabletop shredder
capable of shredding
up to 4 folded
sheets of paper and
credit cards. It has
a convenient carry
handle, a transparent
waste bin, and
shreds paper, credit
cards, staples and
small paper clips
to Security Level 3
in accordance with
DIN32757-1.
• 220 to 240V AC mains power
• Automatic operation
• Reverse direction in case of jamming
• Removable cutting head
• 1XGTJGCVRTQVGEVKQP
• 1XGTCNNUK\GZZOO
• GS & CE approved
•
Type
6-Sheet Shredder
Type
10 Sheet Shredder
17
Cross-cut
220mm
10 sheets of 75gsm paper or equivalent
4 x 3.7mm
3m per minute
20 litres
73dB
2QYGT1XGTNQCF/KUCNKIPGF
6.6kg
Order code 1+
34-6226 39.95
518255
Cross Cut Paper Shredder
8 Sheets, 18 Litres, Din 3, P-48C
The Aurora
AS800CD cross-cut
shredder has an
8 sheet capacity
and a separate
slot for strip-cut
shredding of CDs.
It also shreds
credit cards and
can handle paper
with staples and
small paperclips.
The waste bin has
a viewing window
for easy visibility
of needing to be
emptied. The AS800CD shreds to Security level 3 in
accordance with DIN32757-1.
• 230V AC mains power
• Automatic operation
• Reverse direction in case of jamming
• Handle for easy removal of top when emptying
• Size: 324 x 186 x 405mm
• GS & CE approved
6GEJPKECNURGEKƁECVKQP
Cutting type
Feed opening width
Capacity
Cut size
Shred speed
Bin capacity
Weight
6GEJPKECNURGEKƁECVKQP
Cutting type
Feed opening width
Capacity
Cut size
Shred speed
Bin capacity
Noise level
Status indicator
Weight
Stationery
Type
4-blade paper trimmer
Cross Cut Paper Shredder
5 Sheets, 14 Litres, CC5
Education
um
This innovative 4-blade trimmer can produce straight
cuts, wavy cuts and perforations in paper and thin card.
A fourth blade produces a non-cutting crease, ideal for
creating folds or embossed lines.
To choose a style, simply rotate the patented ‘Dial-aBlade’ knob to the required style - there’s no need to
change or handle the blades.
• Ideal for paper and lightweight card
• Takes A4 sheets lengthways
• 300mm (11.8in.) calibrated cutting table with both
metric and imperial measuring scales
• Cuts up to 5 sheets of 80gsm paper
• Safe - no exposed blades and no need to remove
blades to change style
• Straight cut, perforation, wavy cut and card creasing
• Simply rotate the patented ‘Dial-a-Blade’ selector to
the required style
• To operate, simply press and slide the selected cutter
away from the dial and along the rule to cut or crease
• Slide the cutter back and click into the dial when
ƁPKUJGF
• Anti-slip rubber feet
• +FGCNHQTQHƁEGJQOGCPFETCHVU
• 1XGTCNNNGPIVJOO
The Aurora
AS1018CD is a 10
sheet capacity crosscut shredder that also
shreds CDs, credit
cards and paper
containing staples
and small paperclips.
Its waste bin has a
viewing window for
easy visibility of the
level of shredded
material. The top of
the shredder has
a handle for easy
removal of the topr when emptying. The AS1018CD
shreds to Security level 3 in accordance with
DIN32757-1.
• 230V AC mains operation
• Automatic operation
• Reverse direction in case of jams
• 1XGTJGCVRTQVGEVKQP
• Status indicator
• Size 353 x 240 x 420mm
• GS & CE approved
This powerful
personal shredder
has been designed
HQTWUGKPVJGJQOG
JQOGQHƁEG7UGT
safety is paramount
and is provided by
a patented safety
lock that disables
the shredder. The
unit will take up to 8
sheets of paper per
pass and produces a
DIN security level 3
particle size of 3.9 x 50mm.
• &GUKIPGFHQTQPGRGTUQPWUGKPVJGJQOGJQOGQHƁEG
• Shreds staples, credit cards and paperclips
• Safety lock mechanism
• 5JTGFUEQPVKPWQWUN[HQTWRVQƁXGOKPWVGU
• Bin capacity 18l
• Shredder head easy to remove for bin emptying
Cross-cut
220mm
8 sheets of 75gsm paper or equivalent
5 x 47mm
2.2m per minute
16 litres
4.1kg
Order code 1+
34-6224 31.99
518254
6GEJPKECNURGEKƁECVKQP
Sheet capacity
Average shred speed
Duty cycle
DIN Level
Cut type
Cut size
Throat width
Basket type
Bin capacity
Shreds
Usage
8
3.6 mpm
3 to 5 min
3
Cross-cut
3.9 x 50mm
225mm
Wastebasket
18 litres
Staples, credit cards, paper clips
1PGRGTUQP
Type
Cross-cut shredder
Order code 1+
45-1226 54.99
517000
www.rapidonline.com
18x28x39 Black Sacks
150g E6bc - Pack of 200
www.rapidonline.com sales@rapidonline.com
1TFGTEQFG
52-9447
703
704 Stationery
Fast & friendly service
Call now 8am to 7pm, Monday to Friday,
9am to 5pm Saturday
01206 751166
Education
Cross Cut Paper Shredder
10 Sheets, 18 Litres, Din 3,
AS1023CD
Stationery
17
Type
10 Sheet Shredders
This shredder has additional features that make it ideal
HQTWUGKPOWNVKWUGTGPXKTQPOGPVUKPENWFKPICP#WVQ1KN
feature that automatically lubricates the cutting blades
to extend the life of the shredder and to enhance
performance. Safety is taken care of via the SafeSense
system that will stop the shredder when the paper entry
area is touched. In-use energy consumption is reduced
by the implementation of an energy saving system which
also shuts off power after two minutes of inactivity.
Order code 1+
45-1201 439.99
516975
Cross Cut Paper Shredder
20 Sheets, 60 Litres, Din 3, 225Ci
Cross cut
220mm
10 sheets, 75gsm or equivalent
5 x 55mm
2.2m per minute
18 Litres
2QYGT1XGTNQCF1XGTJGCV&QQTQRGP
7.4kg
Order code 1+
34-6228 51.95
518256
Cross Cut Paper Shredder
18 Sheets, 49 Litres, Din 3, 125Ci
This shredder features
100% jam proof
technology that
eliminates paper
jams and misfeeds,
powering through
any problems. With
the ability to shred
up to 18 A4 sheets
per pass at a rate
of 4.8mpm this unit
YKNNHWNƁNVJGPGGFU
QHVJTGGVQƁXGWUGTU
The shredder will
also cut credit cards,
staples, paperclips
CPF&8&U%&UCPF
produces a DIN
security level 3 crosscut particle of 38 x
3.9mm.
An extended run time
of up to 45 mins means that high volume shredding
jobs can be carried out and the SilentShred technology
ensures that there is minimum disruption in the work
place. Safety is provisioned by the use of the SafeSense
system which automatically stops the shredder when the
paper entry is touched.
• Shreds 18 sheets per pass
• DIN 3 cross-cut
• SilentShred and SafeSense technology
• Energy savings system reduces energy consumption
• Auto power off powers down after 2 min of inactivity
• Extended runtime of 45 minutes for high volume
shredding
• 49l pull-out bin for easy emptying
704
3 particle of 4 x 30mm. The shredder can also tackle
staples, paperclips, credit cards and CDs.
18
4.8 mpm
45 min
3
Cross-cut
3.9 x 38mm
230mm
Pull-out bin
49l
5VCRNGUETGFKVECTFURCRGTENKRU%&U&8&U
3 to 5
732 x 280 x 520mm
26.74kg
Type
Cross-cut shredder
The Aurora AS1023CD
is a 10 sheet crosscut shredder with
a pull-out waste
bin and castors for
manoeuverability.
It has a separate
slot for strip cut
shredding of CDs and
can cope with credit
cards, staples and
small paperclips. The
pull-out waste bin
has a viewing window
so you can see when
it needs emptying.
Shredding is to
Security level 3 in accordance with DIN32757-1.
• Automatic operation
• Reverse switch
• Slide-out bin
• 1XGTJGCVRTQVGEVKQP
• Status indicator
• Size 315 x 220 x 510mm
• GS & CE approved
6GEJPKECNURGEKƁECVKQP
Cutting type
Feed opening width
Capacity
Cut size
Shred speed
Bin capacity
Status indicator
Unit weight
6GEJPKECNURGEKƁECVKQP
Sheet capacity
Average shred speed
Duty cycle
DIN Level
Cut type
Cut size
Throat width
Basket type
Bin capacity
Shreds
Usage
Dimensions H x W x D
Weight
A commercial
standard, powerful
cross-cut shredder
intended for high
useage within
CUJCTGFQHƁEG
environment and with
a DIN 3 security level
cut that produces a
particle size of 3.9 x
38mm. The machine
can shred up to 20
sheets at a time and
is 100% jam-proof,
powering through
potential jams and
tough jobs and
also has the ability
to shred staples,
paperclips, credit
cards and CDs.
A continuous use duty cycle enables the full utilisation
of the shredder and the SilentShred function means that
there is minimum disruption. An energy saving system
reduces energy consumption by up to 70% and switches
to standby mode after two minutes of inactivity. For
safety, SafeSense halts the shredding function when the
the paper entry is touched.
• Continuous duty motor
• 7UCIGRGQRNG
• Shreds 20 sheets per pass
• Particle size 3.9 x 38mm cross-cut
• Shreds staples, paperclips, credit cards and CDs
• Wide paper entry - throat width 240mm
• Bin full light
• Autostart and autostop
• Basket type pull-out bin
• Bin full light
6GEJPKECNURGEKƁECVKQP
Sheet capacity
Average shred speed
Duty cycle
DIN Level
Cut type
Cut size
Throat width
Basket type
Bin capacity
Shreds
Usage
20
4.8 mpm
Continuous
3
Cross-cut
3.9 x 38mm
240mm
Pull-out bin
60l
Staples, credit cards, paper clips, CDs
WUGTU
Type
Cross-cut shredder
Order code 1+
45-1213 549.99
516987
Cross Cut Paper Shredder
28 Sheets, 121 Litres, Din 3, 425Ci
A heavy duty
shredder intended
for installation in
NCTIGQHƁEGUVQ
UWRRQTVWUGTU
The machine has a
continuous use duty
cycle and the wide
305mm paper entry
can handle up to 30
sheets in one pass.
A 100% jam-proof
system ensures that
potential jams are
powered through
and the shredder
produces a DIN
• 7UCIGRGQRNG
• Shreds up to 30 sheets per pass
• Continuous duty motor
• Particle size 4 x 30mm cross-cut
• Wide paper entry - throat width 305mm
• Shreds staples, paperclips, credit cards and CDs
• Autostart and autostop
• Large capacity basket type pull-out bin
• Bin full light
6GEJPKECNURGEKƁECVKQP
Sheet capacity
Average shred speed
Duty cycle
DIN Level
Cut type
Cut size
Throat width
Basket type
Bin capacity
Shreds
Usage
Type
Cross-cut shredder
A3 & A
These lam
available i
A3, feature
warm-up t
a jam rele
The lamina
employ ad
• Preserve
• Can acc
• Starter p
Type
A4
A3
28 to 30
6 mpm
Continuous
3
Cross-cut
4 x 30mm
305mm
Pull-out bin
121l
Staples, credit cards, paper clips, CDs
WUGTU
A4 Me
Order code 1+
45-1215 1249.99
516989
Cross Cut Paper Shredder
40 Sheets, 142 Litres, Din 3, 485Ci
This shreddder
produces a DIN 3
cross-cut particle
size of just 3.9 x
30mm from paper
entered through its
wide paper entry.
The powerful motor
also has the ability
to shred staples,
paperclips, credit
cards and CDs and
a 100% jam-proof
mechanism prevents
jams from happening.
The shredder may
be used continously
CPFGXGPJCUCP#WVQ1KNHWPEVKQPVJCVNWDTKECVGUVJG
cutting blades, enhancing performance and extending
shredder life.
A large capacity 142l pull-out bin is suitable for a high
volume of shredding and further features that make
this shredder suitable for commercial use by multiple
users include SafeSense technology which will shut
down shredding when the paper entry area is touched
and also an energy saving system reduces in-use power
consumption, powering down the shredder after two
minutes of inactivity.
• 7UCIGRGQRNG
• Shreds up to 40 sheets per pass
• Continuous duty motor
• Particle size 5.8mm strip-cut
• Wide paper entry - throat width 305mm
• Shreds staples, paperclips, credit cards and CDs
• Autostart and autostop
• Large capacity basket type pull-out bin
• Bin full light
6GEJPKECNURGEKƁECVKQP
Sheet capacity
Average shred speed
Duty cycle
DIN Level
Cut type
Cut size
Throat width
Basket type
Bin capacity
Shreds
Usage
Type
Cross-cut shredder
Tel: 01206 751166 Fax: 01206 751188
28 to 30
6 mpm
Continuous
3
Cross-cut
3.9 x 30mm
400mm
Pull-out bin
142l
Staples, credit cards, paper clips, CDs
WUGTU
The Saturn
possibilitie
design. It i
JQOGQHƁE
• Laminat
• &WCNVGO
micron p
• Quick he
• Ready b
to lamin
• Fast and
• Double• Dual-pu
• Anti-jam
• Handle
for easy
Type
A4 Laminator
A4 Me
These high
laminators
smooth bu
results wit
use of a c
They are id
RTQVGEVKPI
letters and
• A4 size
• Silent, a
• Fast war
• High an
• Smooth
• Roller re
• Ready a
6GEJPKECNURGE
Model
Throat width
1RGTCVKPIXQNV
Laminating thi
Laminating thi
Laminating sp
Dimensions (o
Order code 1+
45-1217 1599.99
Type
A4 Laminator
516991
Stationery 705
ackle
e it ideal
#WVQ1KN
blades
ce
eSense
per entry
educed
em which
vity.
CDs
A3 & A4 Low Use Laminators
These laminators,
available in A4 and
A3, feature fast
warm-up times and
a jam release switch.
The laminators
employ advanced hot roller technology.
• Preserve all important documents
• Can accomodate both 160 and 250 micron pouches
• Starter pack of laminating pouches included
Type
A4
A3
• Reverse mode disengages pouch for re-centering or
removal
• Cooling plate on exit shelf
Page 629
Laminators
Eco-Friendly
Light Oak
Effect
Noticeboards
6GEJPKECNURGEKƁECVKQP
Entry width
Transport type
Heat-up time
Temperature settings
Micron capability
Speed
Display
Misfeed mechanism
320mm
6
3 min
Variable (6 pre-sets)
80 to 250
EOOKP
Full logic LED
Manual reverse
Type
Proteus A3 laminator
Order code 1+
45-1225 539.99
516999
A3 Heavy Duty High Use Laminator
A3 Medium Use Laminator
Order code 1+
25-1047 24.00
25-1049 28.00
A4 Medium to Low Use Laminator
516989
GUVJG
ending
The Saturn A4 laminator offers numerous laminating
possibilities with minimal adjustment in a user friendly
design. It is perfectly suited for occasional use in the
JQOGQHƁEGUOCNNQHƁEGQTUEJQQN
• Laminates photos and documents up to 220mm wide
• &WCNVGORGTCVWTGUGVVKPIUHQTCPF
micron pouches
• Quick heat-up time - ready in just 6 minutes
• Ready beep or light indicates when machine is ready
to laminate
• Fast and easy to use - laminates in less than 1 minute
• Double-walled insulation keeps heat inside
• Dual-purpose tray guides pouch
• Anti-jamming release lever for trouble free operation
• Handle for portability plus stand-up feet and cord wrap
for easy storage
Type
A4 Laminator
Order code 1+
34-5784 84.99
080927
r a high
make
ultiple
shut
ouched
se power
two
CDs
Order code 1+
34-9940 219.99
122519
Order code 1+
34-5796 199.95
080933
A2 & A3 Low to Medium Use
Laminators
A3 Heavy Duty High Volume
Laminator – Titan
A4 Medium to Low Use Laminator
These high quality
laminators produce
smooth bubble-free
results without the
use of a carrier sheet.
They are ideal for
RTQVGEVKPI[QWTKORQTVCPVFQEWOGPVURJQVQUEGTVKƁECVGU
letters and business cards, etc.
• A4 size
• Silent, automatic roller feed system
• Fast warm-up time
• High and low heat settings
• Smooth, bubble-free lamination
• Roller release mechanism
• Ready and power lights
6GEJPKECNURGEKƁECVKQP
Model
Throat width
1RGTCVKPIXQNVCIG
Laminating thickness (Low Temp.)
Laminating thickness (High Temp.)
Laminating speed
Dimensions (overall)
Type
A4 Laminator
516991
Type
A3 educational laminator
Type
A3 Laminator
17
Stationery
485Ci
These laminators are engineered for educational and
high volume use and very easy to use as the unique
operating instructions label is displayed on the front of
the machine for inexperienced users.
• New improved model
• Engineered for educational and high volume use
• Doubly effective heating system
• Ultra tough metal body and heavy duty chassis
• Very easy to use – operating instructions label
displayed on the front of the machine for
inexperienced users
• Anti-jam reverse button
• Digital display for accurate temperature selection
• (CUVTQNNGTOCEJKPGNCOKPCVGUOOOKPWVG
• 'HƁEKGPVXCTKCDNGVGORGTCVWTGNCOKPCVKPIIKXKPI
UWRGTKQTSWCNKV[ƁPKUJYKVJCNNRQWEJGUWRVQ
micron (2x250)
• Ideal for high quality photo lamination
• Very robust machine ensuring as trouble-free use as
possible
• FREE Expert Pouch Jacket and Laminating Dos and
Don’ts Guide
The Jupiter A3 Laminator offers numerous laminating
possibilities with minimal adjustment in a user friendly
design. It is perfectly suited for occasional use in the
1HƁEGQTUEJQQN
• Laminates photos and documents up to 330mm wide
• 5 temperature settings for laminating cold and 75-180
micron hot pouches
• LED User Interface
• Quick heat-up time – ready in just 4 minutes
• Ready beep or light indicates when machine is ready
• Fast and easy to use – laminates A4 in less than 1
minute
• Auto shut-off after 60 minutes of inactivity prevents
overheating
• Double-walled insulation keeps heat inside
• Manual Reverse function
• Laminator opens after cool-down to allow maintenance
and cleaning
Education
516936
A4
235mm
220 to 240V mains
80 to 100 μm (each side) 160 to 200
μm (total)
125 to 150 μm (each side) 250 to
300 μm (total)
0.3m per minute
383 x 136 x 85mm
Order code 1+
34-6230 18.95
518257
Suitable for heavy duty use the Proteus laminator will
process documents, including photographs, up to A3
size using pouches of between 80 and 250 micron. The
laminator is 100% jam free and the advanced control
panel accurately monitors lamination temperature,
ensuring a consistently high quality output. The
NCOKPCVKPIU[UVGOECPYQTMCVURGGFUQHWRVQEO
min meaning that it can process approximately 180x A4
pouches per hour.
The speed and temperature setting can be adjusted for
individual preference and there is a handy guide printed
on the large laminator entry shelf to help choose the right
settings. Additionally there are six presets for the most
popular laminating applications. The device has six roller
technology, heating four rollers to produce high quality
results and has the ability to laminate both hot and cold,
with or without carriers, mounting board and foils.
• Laminates up to 250 micron pouches
• Photo capable
• Auto shut off prevents overheating when not in use
These professional hot seal laminators work with up to
2x 250 (500) micron professional pouches and have
a warm up time of 4 - 8 minutes. They are perfect for
protecting inkjet printed photos,
ID cards, letters and much more.
• Available in A3 and A2 sizes
Type
A3
A2
Order code 1+
34-9384 89.95
34-9386 139.95
079927
Page 717
Brass
Drawing
Pins
Box of 150
www.rapidonline.com sales@rapidonline.com
705
706 Stationery
RVFM
Education
Heavy Duty A2 Laminator
Stationery
17
A4 & A3 Laminating Pouches
These laminators are engineered for educational and
high volume use and very easy to use as the unique
operating instructions label is displayed on the front of
the machine for inexperienced users.
• New improved model
• Engineered for educational and high volume use
• Doubly effective heating system
• Ultra tough metal body and heavy duty chassis
• Very easy to use – operating instructions label
displayed on the front of the machine for inexperienced
users
• Anti-jam reverse button
• Digital display for accurate temperature selection
• (CUVTQNNGTOCEJKPGNCOKPCVGUOOOKPWVG
• 'HƁEKGPVXCTKCDNGVGORGTCVWTGNCOKPCVKPIIKXKPI
UWRGTKQTSWCNKV[ƁPKUJYKVJCNNRQWEJGUWRVQ
micron (2x250)
• Ideal for high quality photo lamination
• Very robust machine ensuring as trouble-free use
as possible
• FREE Expert Pouch Jacket and Laminating Dos
and Don’ts Guide
Type
A2 educational laminator
A3 & A4 250 Micron Heavy Duty
Laminating Pouches
Order code 1+
34-9942 324.99
122524
Laminating Pouches
A3 Laminator Protectors
A wide range of laminating
pouches for use with heated
laminating machines. The
high quality transparent
pouches bond to both sides
of your document, sealing
and protecting, as well as
enhancing the contrast and
colour of your artwork.
• +FGCNHQTEGTVKƁECVGU
instruction sheets, posters,
notices, signs, menus, etc.
• Seals and protects
• Waterproof
• Tear-proof
• Improves contrast and colours
• Range of pack quantities
• Available in sizes suitable for A4 and A3 paper,
in 150 micron (2x 75μ) and 250 micron (2x 125μ)
thicknesses
Thickness
A4
150 micron
150 micron
150 micron
250 micron
250 micron
250 micron
250 micron
A3
150 micron
Pack Qty
Order code
20
50
100
20
50
100
100
06-0393
06-0397
06-0399
06-0401
06-0403
06-0405
06-0345
0.88
2.95
5.42
1.94
4.20
8.19
8.19
20
06-0407
2.72
These economical
heavy duty laminating
pouches are ideal for
use in most heated
laminators.
• A4 size available
in Gloss and Matt
ƁPKUJGU
• 250 micron
• Supplied in boxes of 100
Type
A4 Gloss
A4 Matt
Type
A3 pouch jacket
www.rapidonline.com
These professional
laminating
pouches provide
protection against
water, light and
ƁPIGTRTKPVU
• 150 and
250 micron
thickness
• A4 pouches
supplied in
packs of 25
or 100
• A3 pouches supplied in packs of 50
Order code 1+
87-0586 0.74
87-0590 0.90
87-0595 1.92
Type
Thin
Medium
Thick
RV
10+
0.61
0.73
1.60
Polypro
50+
0.52
0.62
1.23
RVFM
Self Seal Mini Grip Polythene
Packing Bags - Plain
A strong p
ideal for p
JQOGVJG
• Also ide
pulley p
• Supplied
Type
Polypropylene
A
1+
2.69
8.29
13.39
9.95
15.49
RV
A3 & A4 160 Micron Laminating
Pouches
These clear polythene bags are ideal for the storage and
packing of all sorts of items and are available in a wide
range of sizes.
The bags have a resealable grip top seal and are made
from 160 gauge polythene, with the exception of the
largest bag in the range, 14-0904, which is 300 gauge.
The 230 x 355mm bag, 14-0904, is big enough to take
A4 (210 x 297mm) sheets, ideal for notices, instruction
OCPWCNUNGCƂGVUUOCNNFQEWOGPVUƁNKPIGVE
• Mini grip seal can be opened and resealed as required
• Ideal for the packing and storage of small components
• Supplied in packs of 100 bags, except 14-0935
(60 x 60mm) which is supplied in packs of 1000
Size
60 x 60mm
These gloss laminating pouches are ideal for use in most
laminators.
• Available in A4 and A3 sizes
• 160 micron (80 micron each side)
• Supplied in boxes of 100
Order code 1+
34-9212 7.02
34-9216 15.10
60 x 75mm
75 x 85mm
75 x 190mm
90 x 115mm
100 x 140mm
115 x 115mm
125 x 190mm
140 x 140mm
190 x 190mm
230 x 355mm
080008
706
A generalstring, also
making.
• Approxim
1.2mm
(medium
• Sold by
064282
RVFM
Type
A4
A3
White
Resealable
polythene bags
on 200 gauge
material.
• Mini grip seal
can be opened
and resealed as
required
• Write-on panels
• Ideally suited
to packing and
storage of small components
• Supplied in packs of 100 bags
Size
60 x 60mm
75 x 85mm
100 x 140mm
122526
…added daily, check our website
Type
Cotton twine
Resealable Polythene Bags
Order code 1+
34-9944 11.49
New products
Order code 1+
34-9214 11.10
34-9215 20.15
RVFM
1+
079930
The revolutionary new way to prevent laminator jams.
• Just simply insert your laminating pouch into the Pouch
Jacket and start laminating
• Highly recommended to prevent jams, especially when
laminating small or irregular shaped items or when the
RQWEJKUPQVEQORNGVGN[ƁNNGFYKVJ[QWTFQEWOGPV
• Also recommended when using thin, lightweight
laminating pouches
• Made from a special lightweight, heatproof material,
similar to saucepan coating
• Much more effective than traditional card carriers,
which need excessive heat to work effectively
• A3 size - for use with all A3 and A2 pouch laminators
Ideal for b
CPFQHƁEG
twine can
packaging
pulley proj
• Supplied
125g
Resealable Bags
A3 & A4 150 & 250 Micron
Laminating Pouches
Order code
34-9396
34-9394
34-9388
34-9400
34-9390
Cotton
080009
530061
Type
A4, 150 micron (25)
A4, 150 micron (100)
A4, 250 micron (100)
A3, 150 micron (50)
A3, 250 micron, (50)
RV
Tel: 01206 751166 Fax: 01206 751188
Price per pack of 1000
Order code 1+
10+
50+
14-0935 2.99
Price per pack of 100
14-0937 1.13 1.07 1.01
14-0944 1.13 1.07 1.01
14-0938 2.16 2.00 1.82
14-0946 1.54 1.42 1.23
14-0926 2.49 2.37 2.15
14-0948 2.05 1.92 1.70
14-0940 2.96 2.72 2.49
14-0909 2.61 2.49 2.25
14-0907 2.97 2.73 2.50
14-0904 10.18
Matt C
An adhesi
INCTGƁPKUJ
virtually ‘in
• Ideal for
books, d
drawing
• /CVVƁP
to be re
with pen
• Ideal for
tabbing
• 19mm w
• 33m sm
• Supplie
Type
Matt Clear Ta
Pag
Glu
Sti
064283
Stationery 707
www.rapidonline.com
String
ty
Blu-Tack
Original
Re-Usable
Adhesive
RVFM
Cotton twine
Ideal for both home
CPFQHƁEGVJKUEQVVQP
twine can be used for
packaging, design and
pulley projects.
• Supplied in balls of
125g
Type
Cotton twine
Order code 1+
34-5730 0.948
079815
A general-purpose white cotton
string, also useful for model
making.
• Approximate thickness
1.2mm (thin), 2.2mm
(medium), 3.5mm (thick)
• Sold by weight
6GEJPKECNURGEKƁECVKQP
51-2088
Colour
Dimensions
Type (manufacturer type)
51-2089
Colour
Dimensions
Type (manufacturer type)
Size (W x L)
19mm x 10m
19mm x 33m
Transparent
(L x W) 33m x 19mm
FT-5100-3060-2
6+
0.88
1.93
064282
A strong polypropylene twine,
ideal for packing solutions at
JQOGVJGQHƁEGQTUEJQQN
• Also ideal for design and
pulley projects
• Supplied in balls of 2.25kg
Type
Order code 1+
5+
10+
Polypropylene twine 2.25kg 14-0999 17.00 15.75 14.34
074018
RVFM
rage and
n a wide
e made
f the
0 gauge.
h to take
struction
s required
mponents
935
000
000
0+
Matt Clear Adhesive Tape
Type
Matt Clear Tape (2)
00
01
01
82
23
15
70
49
25
50
Size
19mm x 10m
19mm x 25m
An adhesive tape with a nonINCTGƁPKUJYJKEJOCMGUKV
virtually ‘invisible’ on paper.
• Ideal for mending torn
books, documents and
drawings
• /CVVƁPKUJCNNQYUVJGVCRG
to be readily written on
with pen or pencil
• Ideal for photocopying,
tabbing and labelling
• 19mm wide
• 33m small-cored reel
• Supplied in packs of 2 reels
Glue
Sticks
064283
Matte
(L x W) 10m x 19mm
FT-5100-5249-9
Large Tape Dispenser
A high
quality
adhesive
tape
dispenser
ideal for
QHƁEG
home or
school.
• Accepts
up to
25mm (1in) wide tapes on 25mm (1in) or 75mm (3in)
diameter cores
• Weighted, rubber base prevents slipping and scratching
• Approx. overall dimensions: 200 x 80 x 80mm
• Colour may vary
Tape not included.
Matte
(L x W) 25m x 19mm
FT-5100-4921-4
Type
Large tape dispenser
Order code 1+
51-2105 2.57
51-2106 4.11
Order code 1+
34-3190 3.29
6+
3.07
12+
2.85
060236
524056
Scotch® Magicv 810 Adhesive Tape
in Dispenser
Order code 1+
34-3185 1.58
6+
1.37
12+
1.25
48+
1.05
060218
Page 680
Order code 1+
87-7182 8.49
RVFM
Scotch Magic 810
adhesive tape is
ideal for use in
QHƁEGUUEJQQNUCPF
in the home. - in
fact anywhere you
are likely to need
sticky tape. With this
“invisible” adhesive tape, you can easily repair damaged
documents, combine pages and paste or display letters
and notes.
• Resistant against ageing
• Available in two sizes
6GEJPKECNURGEKƁECVKQP
51-2105
Colour
Dimensions
Type (manufacturer type)
51-2106
Colour
Dimensions
Type (manufacturer type)
Adhesive Tape
Type
Pack of 6
17
080238
Scotch Magic 810 Adhesive Tape
Polypropylene Twine
0.87
The original Sellotape
transparent sticky tape
with hundreds of uses.
• Easy tear
• Antistatic
• 25mm width
• 76mm core
• Length 66m
• Available singly or in
packs of 6 reels
524052
RVFM
36+
Sellotape Original
300489
0+
52
62
23
12+
0.49
0.59
1.04
060210
Transparent
(L x W) 10m x 19mm
FT-5100-5222-6
Order code 1+
51-2088 0.94
51-2089 2.05
Order code 1+
34-3180 0.57
34-3182 0.78
14-0992 1.23
Stationery
Order code 1+
06-9272 2.09
06-9274 4.19
06-9276 4.19
Type
19mm x 66m
25mm x 66m
48mm x 66m
This 3M 600 Crystal
Clear Tape is very
transparent, light and
resistant to ageing
and is suitable for a
YKFGTCPIGQHƁZKPI
sticking and repairing
tasks.
• Made from Cellulose-Acetate
• Available in two sizes
Education
White Cotton String
Type
Thin
Medium
Thick
Good quality
general purpose
clear adhesive
tape.
• Available in a
range of widths
• High tackadhesion
qualities for everyday sealing
and sticking
• Length 66m
600 Crystal Clear Tape
080009
gs
RVFM
Clear Adhesive Tape
5EQVEJŠ/CIKEv#FJGUKXG
Tape is ideal for use in all
UQTVUQHUKVWCVKQPUKPVJGQHƁEG
classroom and in the home.
This “invisible” adhesive tape
can be used to repair damaged
documents, bind pages and
stick memos.
• Practically invisible on paper
• Matt surface
• Tearable by hand
• Neither yellows nor dries
6GEJPKECNURGEKƁECVKQP
51-1835
Dimensions
Type (manufacturer type)
Type
19mm x 7.5m
High quality
parcel tapes
for all carton
sealing and
packaging
applications.
• Available
in brown
and clear
• Low-noise and standard options
• Low-noise option 48mm x 66m reels with 75mm dia.
cores
• Standard option 50mm x 66m reels with 75mm dia.
cores
• Supplied in packs of 6
Type
Brown - low noise
Super clear - low noise
Brown - standard
Transparent - standard
(L x W) 7.5m x 19mm
70-0713-2156-9
Order code 1+
51-1835 1.31
Scotch Packaging Tape
Brown and Clear
6+
1.22
Order code
87-7722
87-7724
87-7726
87-7728
523923
www.rapidonline.com sales@rapidonline.com
1+
10.80
10.80
10.25
10.23
6+
9.66
9.66
8.75
7.94
123959
707
708 Stationery
Type
Red
Black
Blue
4CHƂG6KEMGVU
Standard Key Tags
Assorted Colours
Education
Ideal for school
functions and a
variety of social
events anywhere,
VJGUG4CHƂGCPF
Cloakroom Tickets
from Silvine are
supplied in books of
1000.
• Five pairs of tickets
per page
• Numbered 1 to
1000
• Serial numbered for
additional security
• Available in six
assorted colours
• Made from 100% recycled paper
• Tickets perforated for easy separation
• Silvine part 1000
No. of tickets
1000
081558
Coloured plastic tags
for keys. Ideal for
use in key cabinets
for quick and easy
reference where many
different keys are
stored.
• Card insert and
protective window held in place by split ring
• Hanging hole
• Ideal for use in key cabinets
• Size 50 x 22 x 3mm
• Available in packs of 50 and 100
4CHƂG6KEMGVU
Type
Pack of 50
Pack of 100
Order code 1+
06-0437 2.00
06-0441 3.67
Cash Boxes
& Accessories
These powder-coated
steel boxes complete
with ‘bolt down’
ƁZKPIUCTGKFGCNHQT
secure storage of
small valuables and
documents.
• Tough powdercoated steel
construction
• Fix to wall or table
top
• 2TGFTKNNGFƁZKPI
holes
• +PENWFGUnDQNVFQYPoƁZKPIU
• Cylinder lock with 2 keys
• 300mm box holds A4 documents unfolded
Type
170 x 175 x 80mm
240 x 300 x 90mm
530046
Order code 1+
06-0443 3.95
06-0445 9.34
Type
Fire resistant
530066
Stationery
17
Photo Frames
Key Lock Cash Box
Sturdy steel construction
with rounded corners and
reinforced locking catch plate.
Fitted with high quality cylinder
type lock and supplied with 2
keys. Hinged lid with recessed
handle allowing boxes to be
stacked. All models feature a
removable 6 compartment coin
tray, apart from Model No. SCB4 which has
a 9 compartment tray.
• Sturdy steel construction with rounded corners
and reinforced locking catch plate.
• Fitted with high quality cylinder type lock
and supplied with 2 keys.
• Hinged lid with recessed handle allowing boxes
to be stacked.
• Supplied with removable 6 compartment coin tray.
Clip Photo Frames
Top quality clip frames with
non-glass, break-resistant
styrene face and metal clips.
The frames are ideal for
quick-and-easy frameless
photo frames, notices, menus,
signs, etc.
• Available in a range of sizes
to suit A4, A3, A2 and A1
artwork
• Individually packed and
shrink-wrapped with
protective corners
Type
A4
A3
A2
A1
Order code
06-0413
06-0415
06-0417
06-0429
1+
1.43
2.20
4.97
10.42
530063
Key Boxes & Tags
6GEJPKECNURGEKƁECVKQP
89-8059
Model No:
Size (W x D x H):
Compartments:
89-8060
Model No:
Size (W x D x H):
Compartments:
89-8061
Model No:
Size (W x D x H):
Compartments:
Type
SCB2
SCB3
SCB4
Tough, powder-coated
steel wall safes with
high security 2-bolt
double lever locks,
ideal for cash and
jewellery.
• High security
double-bolt, lever
locks
• Powder-coated
steel construction
• 5mm thick steel door, 2.5mm thick steel body
• Manufacturers rating for cash and jewellery
• Interior carpet
• 5WRRNKGFEQORNGVGYKVJURCTGMG[UCPFUWTHCEGƁZKPIU
• 2-year manufacturer’s warranty
6GEJPKECNURGEKƁECVKQP
SCB2
200 x 160 x 90mm
6
Exterior dimensions (W x H x D)
Interior dimensions (W x H x D)
Approx weight
Capacity
SCB3
250 x 180 x 90mm
6
Type
5 Litre
9 Litre
SCB4
300 x 240 x 90mm
9
Type
20 key
48 key
93 key
Order code 1+
06-0431 5.87
06-0433 8.55
06-0435 13.19
530064
708
Solid steel boxes with
high quality locks for
coins, money, etc. These
lockable 6in. cash boxes
are perfect for the home
or workplace. Secure,
compact and portable.
• Attractive appearance
with a unique design
• Light and robust
• Inner removable plastic
tray allows use as a
storage box for valuables
• Comes complete with two keys
• Strong recessed metal handle
• Rounded corners
• Available in red, black and blue
Cash not included.
06-0447
200 x 150 x 200mm
196 x 146 x 150mm
2.6kg
5 litres
06-0449
310 x 200 x 200mm
306 x 196 x 140mm
5.7kg
9 litres
Order code 1+
06-0447 27.50
06-0449 37.50
530067
6JKU%CVJG
Waterproo
Chest prot
FQEWOGPV
in tempera
to 840°C
minutes. A
seal keeps
contents d
when fully
in water. T
takes stan
UWURGPUKQ
• 2TQVGEVU
840°C f
• Waterpr
• Leak tes
• Key lock
• Folding
• 5WRRNKGF
• Exterior
• Interior
• Capacity
• Colour:
• Approx.
Type
Filing chest
Order code 1+
89-8059 9.24
89-8060 10.79
89-8061 13.88
Key Cabinets
Cash Box
Fire/W
Key-Locking Security Safes
527050
A range of cabinets for secure
storage and display of keys.
• Easy to see if a single key
is missing
• Ideal for large buildings, car
pools, lockers, emergency
access, etc.
• Seamless solid steel
construction
• Piano-hinged door with catch plate gives added
security
• &WTCDNGRQYFGTEQCVGFƁPKUJHQTEQTTQUKQPTGUKUVCPEG
• Fitted with high quality cylinder type lock and supplied
with two keys
• 5WRRNKGFEQORNGVGYKVJMG[HQDUCPFYCNNƁZKPIMKV
Securi
Electro
This Electr
Digital Saf
conforms
UL test sta
HQTJQWT
resistance
a digital lo
time delay
and emerg
key overrid
manufactu
the safe a
for protect
• UL test s
less tha
ƂCOGHQ
• #VVTCEVKX
protectio
• High sec
• Exterior
• Interior
• Approx.
• Batterie
Steel Security Boxes
530065
Order code 1+
06-0335 1.39
Order code 1+
34-6186 4.53
34-6188 4.53
34-6190 4.53
Security 5 Litre Safe with Electronic
Digital Locking
A wall-safe with
a digital lock,
time-delay function
and emergency key
override. The safe
is constructed from
thick, powder-coated
steeland has a very
strong mechanism.
• Manufacturer’s
rating for cash or
jewellery
• Interior dimensions: 225 x 125 x 165mm (W x D x H)
• Interior carpet
• Fix to surface - pre-drilled with bolts supplied
• Batteries and spare key included
• Weight 4kg
• Manufacturer’s 2 year warranty
Type
5 Litre wall safe
Tel: 01206 751166 Fax: 01206 751188
Order code 1+
06-0451 25.00
530068
Fire/W
The Cathe
chest that
protects th
a capacity
fully subm
Stationery 709
081558
Security 1 Hour Fire Resistant
Electronic Digital Locking Safe
Type
Fire resistant safe
Order code 1+
06-0457 125.00
530069
530066
[
EGƁZKPIU
0 x 200mm
6 x 140mm
530067
This Cathedral Fire/
9CVGTRTQQH(KNKPI
Chest protects
FQEWOGPVUHTQOƁTG
in temperatures up
VQŒ%HQT
OKPWVGU#YCVGTRTQQH
seal keeps the
contents dry even
YJGPHWNN[UWDOGTIGF
in water. The chest
takes standard A4
UWURGPUKQPƁNGUCPFKUMG[NQEMCDNG
• 2TQVGEVUFQEWOGPVUHTQOƁTGKPVGORGTCVWTGUWRVQ
Œ%HQTOKPWVGU
• 9CVGTRTQQHUGCNMGGRUEQPVGPVUFT[
• .GCMVGUVGFHQTJQWTUCVEOFGRVJ
• Key lockable (2 keys provided)
• (QNFKPIECTT[JCPFNG
• 5WRRNKGFYKVJZ#UWURGPUKQPƁNGU
• Exterior dimensions: 410 x 330 x 324mm (W x H x D)
• Interior dimensions: 309 x 260 x 218mm (W x H x D)
• Capacity 18 litres
• Colour: Black
• #RRTQZYGKIJVMI
Type
Filing chest
Order code 1+
06-0461 44.95
Type
Gel wrist rest
Order code 1+
45-1230 5.39
517003
530071
Security Namesafe Digital Electronic
Locking Safes
Lock up your
valuables with your
EJQKEGQHOGOQTCDNG
VJTGGVQGKIJVFKIKV
letters or numbers QTCEQODKPCVKQPQH
DQVJHQTVJGWVOQUV
protection!
6JGUGFKIKVCNUCHGU
CTGEQPUVTWEVGFHTQO
VJKEMRQYFGTEQCVGF
UVGGNCPFJCXGUVTQPINQEMKPIOGEJCPKUOUYKVJNQEMKPI
DQNVU6JG[CTGTGEQOOGPFGFD[VJGOCPWHCEVWTGTHQT
UGEWTKPIECUJCPFLGYGNNGT[
• /CPWHCEVWTGToUTCVKPIHQTECUJQTLGYGNNGT[
• 6JKEMRQYFGTEQCVGFUVGGNEQPUVTWEVKQPCPFUVTQPI
OGEJCPKUOYKVJNQEMKPIDQNVU
• &KIKVCNNQEMYKVJGOGTIGPE[MG[QXGTTKFGDCVVGTKGUCPF
spare key included
• 4GOQXGCDNGKPVGTKQTUJGNH
NKVTGOQFGN
• Interior carpet
• 2TGFTKNNGFOQWPVKPIJQNGU
• (KZVQUWTHCEGDQNVUUWRRNKGF
GEL Mousepad Wrist Rest
#PKPVGITCVGF)GNYTKUV
rest and mousepad
will provide excellent
UWRRQTVOCMKPIVKOG
spent at the computer
OQTGEQOHQTVCDNG
• 5WRGTUQHVVJKEM
EWUJKQPKPI
• .CTIGUWTHCEGQHVJG
RCFEQPHQTOUVQVJG
UJCRGQH[QWTYTKUV
• Helps to maintain
neutral wrist position
• Non-skid base hold
TGUVƁTON[KPRNCEG
• Universally sized
• Wrist pillow suits all
users
• &WTCDNGN[ETCDCUGFHCDTKEEQXGTKPIIKXGU[QWTOQWUG
UWRGTKQTVTCEMKPIEQPVTQN
• 2NGCUKPIVQVQWEJCPFKUGCUKN[ENGCPGF
• Colour sapphire with black base
Type
Mousepad wrist rest
Order code 1+
19-6705 11.78
075657
6GEJPKECNURGEKƁECVKQP
External dimensions (W x H x D)
Internal dimensions (W x H x D)
#RRTQZYGKIJV
Capacity
Type
8.5 Litre
16 Litre
06-0453
310 x 200 x 200mm
306 x 196 x 140mm
MI
8.5 litres
06-0455
350 x 250 x 250mm
346 x 246 x 190mm
MI
16 litres
Mouse Mats
Order code 1+
06-0453 34.80
06-0455 48.75
530447
Wrist Rests
17
Stationery
Fire/Waterproof Filing Chest
Type
Deed box
ƂGZKDNGUWRRQTVVJCVEQPHQTOUVQVJGYTKUVCPFJCPFCPF
TGFKUVTKDWVGURCKPHWNCPFWPEQOHQTVCDNGRTGUUWTGRQKPVU
UQVJCVGXGPCHVGTJQWTUQHEQPVKPWQWUYQTMCFGITGGQH
EQOHQTVKUUWUVCKPGF
• Attractive purple colour
• 5QQVJKPI)GNRTQXKFGUEQOHQTVCPFUWRRQTV
• Stain resistant and wipes clean with a damp cloth
• H x W x D 18 x 122 x 88mm
Education
This Electronic
&KIKVCN5CHG
EQPHQTOUVQVJG
UL test standard
HQTJQWTƁTG
resistance. It has
CFKIKVCNNQEMYKVJ
VKOGFGNC[HWPEVKQP
CPFGOGTIGPE[
key override. The
OCPWHCEVWTGTTCVGU
VJGUCHGCUUWKVCDNG
HQTRTQVGEVKPIWRVQECUJQTLGYGNNGT[
• UL test standard ensures that the inner temperature is
NGUUVJCPŒ%YJKNGVJGUCHGKUGZRQUGFVQŒ%
ƂCOGHQTJQWT
• #VVTCEVKXGOQWNFGFFGUKIPIKXKPIDQVJUGEWTKV[CPFƁTG
protection
• *KIJUGEWTKV[NQEMKPEQTRQTCVKPINKXGNQEMKPIDQNVU
• Exterior dimensions: 450 x 380 x 305mm (W x D x H)
• Interior dimensions: 340 x 230 x 190mm (W x D x H)
• #RRTQZYGKIJVMI
• $CVVGTKGUCPFGOGTIGPE[MG[KPENWFGF
• 2TQVGEVUFQEWOGPVUHTQOƁTGKPVGORGTCVWTGUQHWRVQ
Œ%HQTOKPWVGU
• 9CVGTRTQQHUGCNMGGRUEQPVGPVUFT[
• .GCMVGUVGFHQTWRVQJQWTUCVCFGRVJQHEO
• -G[NQEMHQTCFFGFUGEWTKV[
URCTGMG[UKPENWFGF
• Sturdy carry handle
• Exterior dimensions: 407 x 166 x 320mm (W x H x D)
• Interior dimensions: 333 x 94 x 216mm (W x H x D)
• Capacity 7 litres
• #RRTQZYGKIJVMI
RVFM
Anti-static Mouse Mats
)QQFSWCNKV[CPVKUVCVKE
mouse mats with a
special rubberised
DCEMKPIVQCXQKF
UNKRRKPI
• .CTIGCTGCQHZ
OOOOVJKEM
• Available in two
colours
Gel Wrist Rests
Order code 1+
06-0459 69.95
530070
Type
Blue
Red
tronic
063349
Fire/Waterproof Deed Box
%QNQWTHWNIGNYTKUVTGUVUVQRTQXKFGEQOHQTVCPFUWRRQTV
YJKNGV[RKPI
• Stain-resistant cover is easily cleaned with a damp
cloth
• 0QPUMKFDCUGJQNFUYTKUVTGUVUGEWTGN[QPYQTMUWTHCEG
• Colour: purple
Type
Purple wrist rest
Order code 1+
45-2006 8.79
071677
x D x H)
530068
Order code 1+
92-2080 0.90
92-2090 0.787
Wrist Support Crystals Gel Flex Rest
6JKUENGCTIGNƁNNGF
wrist rest will assist
TJG%CVJGFTCN(KTGCPF9CVGTRTQQH&GGF$QZKUCUGEWTKV[ KPIGVVKPIVJGOQUV
EQOHQTVCDNGRQUKVKQP
EJGUVVJCVVCMGU#FQEWOGPVUYKVJQWVHQNFKPICPF
RTQVGEVUVJGOWRVQŒ%HQTOKPWVGU6JGEJGUVJCU HQTCTOUCPFJCPFUCV
CECRCEKV[QHNKVTGUCPFKUHWNN[YCVGTRTQQHGXGPYJGP the workstation. The
IGNRTQXKFGUCUQHVCPF
HWNN[UWDOGTIGF
Bigfoot Gel Mouse Pad
#PGTIQPQOKE
mouse pad with
CUQHVIGNƁNNGF
YTKUVTGUVRTQXKFKPIC
EQOHQTVCDNGRQUKVKQP
HQT[QWTJCPF
RTGXGPVKPIGZEGUUKXG
strain.
• #PVKUMKFDQVVQOHQT
extra stability and
smooth mouse control
• /QWUGRCFCTGCJCUUQHVOKETQƁDTGUWTHCEGVJCV
KORTQXGUVJGRGTHQTOCPEGQH[QWTOQWUG
• 9QTMUYKVJCNNV[RGUQHOKEG
• Trust type 16977
Type
Gel mouse pad - black
Order code 1+
19-4124 6.64
www.rapidonline.com sales@rapidonline.com
300734
709
710 Stationery
A 3-button USB optical mouse
with scroll-wheel and an
advanced optical sensor for
high precision.
• Suitable for both right and
left hand users
• Just plug and go - no need
to install a driver
• Supplied complete with user’s guide
• System requirements: Windows 7, Vista or XP, USB port
• Trust type 16591
This mouse mat with Microban
anti-bacterial protection will
help to keep your home or
QHƁEGENGCPGTCPFJGCNVJKGT
• Fights the growth of harmful
bacteria for the life of the
product
• Suitable for use with both
ball mice and optical mice
• Non slip rubber base
Type
Black mouse mat
Tablets
USB Optical Computer Mouse
Mouse Mat with Microban
Anti-Bacterial Protection
Type
Optical mouse
Order code 1+
45-2018 2.95
155 x 120mm Flex Design Tablet
Microp
Order code 1+
19-4114 3.90
300729
071960
Education
Keyboards
Stationery
17
Eco Friendly Mouse Mat
This mouse mat
is manufactured
using 22 recycled
vending cups. The
mat features a
tracking surface
that is specially
designed for
optical mice.
• Eco friendly
• Rigid, with non-slip backing
• Hygienic, wipe clean design
• Suitable for all ages
Type
Eco friendly mouse mat
ClassicLine Keyboard
Order code 1+
06-8532 1.72
122690
Type
ClassicLine USB keyboard
Mice
A comfortable
optical mouse with
a USB connection
that is suitable
for all computers
with a USB port.
The mouse has
three buttons and
a scroll wheel and
features an advanced optical sensor for fast response
and high accuracy.
• Suitable for both right and left hand users
• Requires a USB port and Windows 7, Vista or XP
Order code 1+
19-4030 7.06
178286
PS/2 Optical Mouse (MI-2275F)
A comfortable
optical mouse with
C25EQPPGEVKQP
that is suitable
for all computers
YKVJC25RQTV
The mouse has
three buttons and
a scroll wheel
and features an
advanced optical
sensor for fast response and high accuracy.
• Suitable for both right and left hand users
• 4GSWKTGUC25RQTVCPF9KPFQYU8KUVCQT:2
Type
PS/2 Optical mouse
Wireless Computer Keyboard
and Mouse Set
Order code 1+
19-4100 23.98
300723
Hard Drive
Docking Stations
RVFM
Screen Case
& Keyboard
Cleaning Kit
The desktop docking
station allows users
to connect one or two
2.5 inch or 3.5 inch
SATA hard drives of
up to 1 Tbyte each to
a high speed USB2.0.
The docking station
lets you quickly read
and copy data from
SATA hard drives
without the need
for installing them.
Just simply drop the
drive into the dock
and connect to your
PC or laptop via the
USB connection. With its USB 2.0 connection a fast
TGCFYTKVGURGGFQHWRVQ/DRUECPDGCEJKGXGF
Its compact size and patented eject mechanism enables
ease of use and fast accessibility.
• Compatible with all 2.5 and 3.5 inch SATA HDD
• USB 2.0 transfer rate up to 480Mbps
• Compatible with 1.5Gbps and 3.0Gbps SATA HDD
• Compact size docking design
• 88#RQYGTCFCRVGT
• Patented design for HDD ejection
• Power indication LED
• HDD activity LED
• 5[UVGOTGSWKTGOGPVU9KPFQYU:28KUVC
9KPFQYU/CE15ZCPFCDQXGCXCKNCDNG75$
2.0 port
1TFGTEQFG87-0860
Type
Dual SATA docking station
A compact wireless keyboard and wireless mouse with
mini USB receiver. The 2.4GHz wireless operation gives
smooth and immediate mouse response with a range up
to 3 metres.
• Smart link technology for easy automatic wireless
connection
• Extra long battery life due to latest power saving
technology
• Suitable for both right and left hand users
• Package contents: Wireless keyboard, Wireless mouse,
Mini USB receiver, 2x AA batteries, User’s guide
• System requirements: Windows 7, Vista or XP, USB port
• Trust type 16593
300730
www.rapidonline.com
Order code 1+
19-4032 7.06
Type
Flex design tablet
Dual 3.5 inch and 2.5 inch Hard
Drive Docking Station
Type
Order code 1+
Wireless keyboard & mouse 19-4116 16.67
178287
710
Order code 1+
19-4034 7.24
178288
USB Optical Mouse (MI-2275F)
Type
USB Optical mouse
A durable, spill resistant keyboard that gives trouble free
and long lasting performance. Features a full size, classic
keyboard layout for comfortable and accurate typing.
• Just plug–in and start, no software required
• USB connection
• Requires Windows 7, Vista or XP and a USB port
A stylish, ultra-thin and space-saving tablet with 155 x
120mm (6 x 4.6in.) working space for picture editing,
freehand drawing and other graphic applications.
• Paper-thin design with anti-skid bottom for a
comfortable and ergonomic position for your hand,
helping to prevent excessive strain
• 5OCNNNKIJVYGKIJVCPFGPGTI[GHƁEKGPVFGUKIP
ideal for mobile users
• Includes ergonomic wireless 3-button pen with
1024-step pressure sensitivity
• Advanced software for drawing and editing pictures
included
• Fully supports Windows 7 & Vista advanced tablet
functions, such as pen pressure sensitivity, and
converting handwriting into digital text
• Package contents: Tablet, Pen, 2x pen tips, Pen-tip
TGOQXCNVQQN75$ECDNGZ###DCVVGT[%&41/
with software, User’s guide
• System requirements: Windows 7, Vista or XP, USB port
• Trust type 16937
Tel: 01206 751166 Fax: 01206 751188
Order code 1+
43-0977 26.51
180769
A highly se
microphon
connector
video conf
gaming, et
• The ang
can be a
• 180cm
• Package
Microph
• System
noteboo
input
• Trust typ
Type
Microphone a
MiLa 2
A compac
speaker se
rms outpu
for PC, not
MP3 playe
these spea
clear repro
of sound e
music.
• 10 Watt
• Suitable
noteboo
player, e
• Controls
• Front sid
• Content
user’s g
• System
output,
Type
Speaker set
eLight
The age of
webcam is
here, and T
released t
of the high
eLight Full
9GDECO
that the m
behind so
most user
products w
straight to
the resolut
First, let’s
details out
has a wide
LED lights
environme
1080p HD
/50.KXG
In terms o
typical hig
Stationery 711
Microphones
let
Microphone MC-1200
h 155 x
diting,
s.
Type
Microphone and stand
Order code 1+
19-4118 4.01
300731
Speakers
h
ctures
ablet
d
17676
8713439176766
3 years
60(H) x 63(W) x 59(D)mm
230g
9GDECO%&41/YKVJUQHVYCTGWUGToUIWKFG
Windows 8, 7, Vista, XP, USB port (2.0
recommended)
Additional system requirements +PVGN%QTG&WQ)J\
'#/&Z
for HD recording:
QTJKIJGT)$4#/&KTGEV:
compatible Graphics card
MiLa 2.0 Speaker Set
USB port
300723
ns
rd
A compact stereo
speaker set with 5W
rms output. Suitable
for PC, notebook,
MP3 player, etc.,
these speakers give
clear reproduction
of sound effects and
music.
• 10 Watt peak power
• Suitable for PC,
notebook, MP3
player, etc.
• Controls for power and volume adjustment
• Front side headphone connection
• Contents include: speakers (with cables attached),
user’s guide
• System requirements: device with 3.5mm audio
output, mains power connection
Type
Speaker set
Type
Trust 17676 Webcam
523636
Primo Webcam
Order code 1+
19-4013 10.09
300497
Webcams
eLight Full HD 1080p Webcam
fast
JKGXGF
m enables
DD
HDD
VC
G75$
180769
Order code 1+
19-4015 28.84
The age of the HD
webcam is truly
here, and Trust has
released the highest
of the high: the
eLight Full 1080p HD
9GDECO+VoUƁVVKPI
that the manufacturer
behind some of the
most user friendly
products would jump
straight to the top of
the resolution charts.
First, let’s get the
details out of the way. The eLight Full HD 1080p Webcam
has a wide resolution, built in microphone and integrated
LED lights that makes you perfectly visible in a low light
environment. The resolution is what you should expect for
1080p HD, with crystal clear images, so it is perfect for
/50.KXG/GUUGPIGT5M[RGGVE
In terms of design, the eLight 1080p represents Trust’s
typical high-quality feel, with a combination of matte and
Order code 1+
19-4138 7.87
519347
www.rapidonline.com
More online ...
USB 3.0 A Male to USB 3.0 B Male
Cables
A range of A Male
to B Male Cables
compatible with
the new USB 3.0
standard, a major
revamp of current
USB technology,
enabling USB
interfaces to stay
current with modern
demands for connectivity bandwidth.
Dubbed ‘SuperSpeed USB’, USB 3.0 promises a major
leap forward in transfer speeds and capability, while
maintaining backwards compatibility with current USB
2.0 devices.
USB 3.0 cables are available in a range of lengths and
colours.
• USB 3.0 A Male to USB 3.0 B Male Cables
• USB 3.0 SuperSpeed
• USB 2.0, 1.1 compatible
• 10 Pin
• 28 AWG
• 1XGTCNN%CDNG&KCOGVGTOO
• Shielded, Braided and Drain
• Gold contacts
• Nickel Connector
Type
A-B Black 1m
A-B Blue 1m
A-B Black 2m
A-B Blue 2m
A-B Black 3m
A-B Blue 3m
A-B Black 5m
A-B Blue 5m
Order code
19-4200
19-4202
19-4204
19-4206
19-4208
19-4210
19-4212
19-4214
1+
1.83
1.83
1.35
2.33
2.86
1.53
2.24
4.06
10+
1.67
1.67
50+
1.59
1.59
2.13
2.62
1.99
2.34
3.72
3.31
17
519458
The Trust 17405 Primo
Webcam has a hardware
resolution of 640 x 480 and 2
MegaPixel snapshot resolution
for sharp images, making it
KFGCNHQTWUGYKVJ/50.KXG
Messenger, Skype, etc.
• 640 x 480 hardware
resolution
• USB 2.0
• Built-in microphone
• Digital zoom
• Automatic face tracking technology
• Snapshot button
• Self-adjusting clamp
• Size (HxWxD): 88 x 66 x 87mm
• Weight: 99g
• Manufacturer’s 3 year warranty
• System requirements: Windows 7, Windows 8, Vista
or XP
• USB port (USB 2.0 recommended)
• For extra functionality drivers can be downloaded at
YYYVTWUVEQOFTKXGTU
• Trust type 17405
Type
Primo Webcam
RVFM
Stationery
n-tip
41/
6GEJPKECNURGEKƁECVKQP
Item number:
EAN-code:
Warranty term:
Product size:
Product weight:
Package contents:
System requirements:
PC Cables
& Adaptors
Education
hand,
A highly sensitive desk
microphone with 3.5mm
connector. Ideal for chatting,
video conferencing, online
gaming, etc.
• The angle of the microphone
can be adjusted
• 180cm cable length
• Package contents:
Microphone, 2-part stand
• System requirements: PC or
notebook with microphone
input
• Trust type MC-1200
JKIJINQUURNCUVKEU6JGOQWPVJCUDGGPFGUKIPGFVQƁV
UPWIN[QPVQVJGNKFQHCNCRVQRPQVGDQQMPGVDQQMCPF
proved to be very sturdy once in place. The camera can
be rotated every which way, so you know you will always
be in the frame. With the high quality image and the clear
and concise sound from the microphone, your friends,
family and online buddies will want one of these too.
All in all, this Webcam is a great value product.
• High performance USB 2.0 webcam with high
FGƁPKVKQPOGICRKZGN
ZXKFGQTGUQNWVKQP
• Up to 8.3 megapixel (3840 x 2160) photo resolution
• Supports Full HD 1080p (1920 x 1080) widescreen
resolution for highest quality Youtube video
broadcasting
• Powerful integrated LED lights for enhanced image
quality in low-light environment
• Includes widescreen HD video recording software with
special button to upload videos to Youtube with one
simple click
• #NUQRGTHGEVHQTQPNKPGEJCVWUKPI/50.KXG/GUUGPIGT
Skype etc: just plug in and start
• Integrated clamping system to attach the webcam to
[QWTPQVGDQQMUETGGPƂCVRCPGNFKURNC[QTRNCEGQP
ƂCVUWTHCEGU
• Built-in microphone for clear sound quality
• 2CEMCIGEQPVGPVU9GDECO%&41/YKVJUQHVYCTG
user’s guide
• System requirements: Windows 8, 7, Vista, XP, USB port
(2.0 recommended)
• Additional system requirements for HD recording: Intel
%QTG&WQ)J\
'#/&ZQT
higher, 2.0GB RAM - DirectX 10 compatible Graphics
card
RVFM
USB 3.0 A Male to USB 3.0 A
Female Extension Cables
A range of A Male to
A Female Extension
Cables compatible
with the new USB 3.0
standard, a major
revamp of current
USB technology,
enabling USB
interfaces to stay
current with modern
demands for connectivity bandwidth.
Dubbed ‘SuperSpeed USB’, USB 3.0 promises a major
leap forward in transfer speeds and capability, while
maintaining backwards compatibility with current USB
2.0 devices.
USB 3.0 extension cables are available in a range
of lengths and colours.
• USB 3.0 A Male to USB 3.0 A Female Extension Cables
• USB 3.0 SuperSpeed
• USB 2.0, 1.1 compatible
• 10 Pin
• 28 AWG
• 1XGTCNN%CDNG&KCOGVGTOO
• Shielded, Braided and Drain
• Gold contacts
• Nickel Connector
Type
A-A Black 2m
A-A Blue 2m
A-A Black 3m
A-A Blue 3m
A-A Black 5m
A-A Blue 5m
Order code
19-4216
19-4218
19-4220
19-4222
19-4224
19-4226
www.rapidonline.com sales@rapidonline.com
1+
2.33
2.33
3.39
3.39
4.62
4.60
10+
2.13
2.13
3.06
3.06
4.40
4.28
50+
1.99
1.99
2.77
2.77
4.19
4.03
519459
711
712 Stationery
RVFM
Laptop & Tablet
Storage
Education
USB 3.0 A Male to 10-Pin Micro
B Male Cables
USB 3.0 A Male to 10-pin
Micro B Male Cables
compatible with the new USB
3.0 standard, a major revamp
of current USB technology,
enabling USB interfaces to stay current with modern
demands for connectivity bandwidth.
Dubbed ‘SuperSpeed USB’, USB 3.0 promises a major
leap forward in transfer speeds and capability, while
maintaining backwards compatibility with current USB
2.0 devices.
USB 3.0 A Male to 10-pin Micro B Male Cables are
available in 2m lengths in Black and Blue.
• USB 3.0 A Male to 10-Pin Micro B Male Cables
• USB 3.0 SuperSpeed
• USB 2.0, 1.1 compatible
• 10 Pin
• 28 AWG
• 1XGTCNN%CDNG&KCOGVGTOO
• Shielded, Braided and Drain
• Gold contacts
• Nickel Connector
Type
Black 2m
Blue 2m
Order code 1+
19-4230 4.06
19-4232 4.06
10+
3.72
3.72
USB Hubs & Card
Readers
Laptop Carry Bags
Barra Compact 4-port USB2.0
Mini Hub
Rugged storage and
carry bags for 16 to
17.4in. laptop and
peripherals.
• Large main
compartment to
ƁVOQUVNCRVQRU
with screens up to
17.4in.
• Padded interior to
protect your laptop
• Extra compartments to store your iPod, MP3 player,
PDA, power supply, etc.
• High strength fabric for heavy-duty use
• Dual metal zippers and velcro fasteners
• Durable and adjustable shoulder-strap
• Trust types BG-3350Cp and BG-3680Cp
Type
15 to 16in.
17.4in.
Order code 1+
19-4108 7.60
19-4112 12.03
300727
519461
Stationery
17
18187 Bluetooth 4.0 USB Adapter
The Trust Bluetooth 4.0 adapter
is ultra small and it will enable
your computer to communicate
with other Bluetooth devices
with high speed transfer rates.
With a range of up to 15m
depending on environmental
factors, the adapter is
compatible with Windows from
XP through to Windows 8.
The ultra-mini USB 2.0 Bluetooth adapter enables a
wireless communication or data transfer e.g. between
two PCs or a PC and a mobile phone or other device. This
Bluetooth adapter can remain plugged in your notebook
since it stands out only 7mm from the USB port of your
notebook.
The adapter works as dual mode dongle and does not
require high power due to the Bluetooth 4.0 standard.
The adapter is also backwards compatible with classic
Bluetooth (1.x and 2.x) devices.
• Latest Bluetooth 4.0 technology
• Low energy mode
• 15m wireless range
• Ultra small size
• Compatible with older Bluetooth versions
• Package contents: USB adapter with Bluetooth 4.0
wireless technology, Mini-DVD with driver, user’s guide
• System requirements: Windows 8, 7, Vista or XP, USB
port, DVD-drive or internet connection, Bluetooth
enabled device
6*+55*17.&$'%1.7/05$766*'4'+50o6411/
Type
Bluetooth 4.0 adapter
Order code 1+
19-4021 19.56
Anti-Shock Bubble Sleeves
for 7 Inch Tablets
These high
performan
CompactF
have been
designed b
to ensure
capture th
With outst
data trans
and lower
consumpt
no compro
you choos
performan
Ideal for p
• Type: Co
• Capacity
• Warranty
• Dimensi
• Weight:
• Adaptor
Type
4GB Compac
8GB Compac
Order code 1+
19-9088 5.52
078060
Micro
Class 4
10-Port USB 2.0 Desktop Hub
Protect your tablet against scratches, dust and dirt with
these 7 inch sleeves with soft bubble compartment.
• Anti-shock, soft bubble compartment
• Easy accessible opening with zip fastener
• Soft and lightweight
• Durable neoprene material
• Compartment size: 135 x 200mm
• Available in Grey, Pink and Blue
Type
Grey
Pink
Blue
Order code 1+
19-6893 11.89
19-6894 7.86
19-6895 7.86
525464
A high speed,
10-port USB 2.0
hub for desktop
use. Features 3x
USB ports on the
rearside to reduce
cable clutter
across the desk.
• Compatible with
both Hi–speed
USB 2.0 and
USB 1.1 devices
• Includes power adaptor to ensure stable operation of
connected devices
• Includes 150mm USB 2.0 cable
• System requirements Windows 7, Vista or XP
Type
Order code 1+
10-Port USB 2.0 d/top hub 19-4024 22.28
178283
Anti-Shock Bubble Sleeves
for 10 Inch Tablets
Mini Card Reader
Page 616
Protect your tablet against scratches, dust and dirt with
these 10 inch sleeves with soft bubble compartment.
• Anti-shock, soft bubble compartment
• Easy accessible opening with zip fastener
• Soft and lightweight
• Durable neoprene material
• Compartment size: 189 x 245mm
• Colour: Pink
Type
Pink
Order code 1+
19-6891 7.86
A mini, high speed USB
2.0 memory card reader
that supports all popular
compact sized memory
cards from mobile phones
and digital cameras,
including latest generation
SDHC cards.
• Compact, space saving design – ideal for portable use
• High speed USB 2.0 ensures quick access and transfer
QHƁNGU
• Includes USB extension cable for convenient on–desk
use
• Requires USB port (USB 2.0 recommended)
and Windows 7, Vista or XP
Type
Mini card reader
Order code 1+
19-4028 8.23
178285
No minimum order value
UK mainland only
525466
712
Compa
This 4-port USB2 mini
hub will assure that
you will always have
enough USB ports on
a PC or notebook.
• Allows a maximum
of four high-speed USB devices to be connected to
one USB port
• Ideal for use with a notebook
• Very compact
• 1PGUGRCTCVG75$EQPPGEVKQPCVVJGUKFGRTQXKFKPI
extra space for big USB connectors, such as MP3
players
• Short USB cable can be folded into the body of the
hub for easy transportation
• Quick and easy to install
• Supports USB 2.0 (up to 480Mbps) and USB 1.1 (up
to 12Mbps) peripherals
• No power adapter needed
• Dimensions 14(H) x 90(W) x 30(D)mm
• System requirements: USB connection, Windows 7,
Vista or XP
• Supplied with 4-port USB hub with cable attached and
user’s guide
Type
4-port USB2 Mini hub
523637
Vertical Laptop Storage
for 10, 16 or 20 Laptops
M
Tel: 01206 751166 Fax: 01206 751188
Kingston’s
MicroSDH
offer highe
for more m
more vide
pictures, m
games and
everything
in today’s
world. The
card allow
maximise
Kingston’s
rating of C
VTCPUHGTTC
with devic
size to tod
ECTFUCTG
Version 2.
devices. Th
used with
To ensure
logo on ho
9JGTGXGT[
rely on Kin
percent te
Can also b
adaptor.
1PGECTFH
• High-sp
• /D[VG
• %QORNKC
• Versatile
WUGFCU
• Compat
devices
• Guarant
• File form
• Dimensi
(0.43(W
• 1RGTCVKP
sŒ(
• 5VQTCIG
sŒ(
• Weight:
• Availabl
Please Note
devices/rea
Stationery 713
rd
Memory Cards
& Drives
6GEJPKECNURGEKƁECVKQP
Card storage chart
Track
Track
type
type
Capacity MP3
WMA
4 Gbyte 760
1520
8 Gbyte 1520 3040
16 Gbyte 3040 6080
32 Gbyte 6080 12160
CompactFlash Memory Cards
ted to
of the
B 1.1 (up
ows 7,
081347
078060
Micro SDHC Memory Cards
Class 4 plus SD Adapter
ation of
178283
table use
nd transfer
on–desk
lue
Order code 1+
45-7011 6.30
45-7033 8.57
178285
Kingston’s Class 4
MicroSDHC cards
offer higher storage
for more music,
more videos, more
pictures, more
games and more of
everything you need
in today’s mobile
world. The MicroSDHC
card allows you to
maximise today’s revolutionary mobile devices.
Kingston’s MicroSDHC cards use the new speed class
rating of Class 4 that guarantees a minimum data
VTCPUHGTTCVGQH/D[VGUGEHQTQRVKOWORGTHQTOCPEG
with devices that use MicroSDHC. Identical in physical
size to today’s standard MicroSD card, the MicroSDHC
ECTFUCTGFGUKIPGFVQEQORN[YKVJ5&5RGEKƁECVKQP
Version 2.00 and are only recognised by MicroSDHC host
devices. They can be used as full-size SDHC cards when
used with the included adapter.
To ensure compatibility, look for the MicroSDHC or SDHC
logo on host devices (e.g., phones, PDAs and cameras).
9JGTGXGT[QWƁPF[QWTUGNHKPVJGOQDKNGYQTNF[QWECP
rely on Kingston’s MicroSDHC cards. All cards are 100
percent tested and are backed by a lifetime warranty.
Can also be used as an SD Card with the supplied
adaptor.
1PGECTFHQTCNN
• High-speed class rating: Class 4:
• /D[VGUGE/KPKOWOUWUVCKPGFFCVCVTCPUHGTTCVG
• %QORNKCPV9KVJVJG5&%CTF#UUQEKCVKQPURGEKƁECVKQP
• Versatile: When combined with the adapter, can be
WUGFCUCHWNNUK\G5&*%5&:%ECTF
• Compatible: With MicroSDHC and MicroSDXC host
devices
• Guaranteed: Lifetime warranty, free technical support
• File format: FAT 32
• Dimensions: 11(W)mm x 15(L)mm x 1(D)mm
(0.43(W) x 0.59(L) x 0.039(D) inches)
• 1RGTCVKPIVGORGTCVWTGsŒ%VQŒ%
sŒ(VQŒ(
• 5VQTCIGVGORGTCVWTGsŒ%VQŒ%
sŒ(VQŒ(
• Weight: 1.4g (0.05 oz)
• Available in 4, 8, 16 and 32 Gbyte options
Please Note: Not compatible with standard MicroSD enabled
devices/readers
Order code
19-9220
19-9222
19-9224
19-9226
Picture
size
1 MPixel
3619
7238
14480
28960
Picture
size
3 MPixel
1905
3812
7616
15232
Picture
size
6 MPixel
1206
2413
4827
9653
1+
2.51
2.92
4.62
9.21
523634
Kingston SDC10G2 microSDHC/
microSDXC Class 10 UHS-I Flash
Memory Cards
This range of microSDHC
OKETQ5&:%%NCUU
10 UHS-I cards from
Kingston, feature Class
10 UHS-I speeds
QH/$U
TGCF
CPF/$U
YTKVG
making them ideal for
photographing everything
from still images to active kids and pets. They are also
ideal for cinema-quality HD (1080p) video and reduce
buffer time between shots when compared to Class 4
cards.
6JGUOCNNGUV5&ECTFUCXCKNCDNGOKETQ5&*%
microSDXC Class 10 UHS-I have become the standard
expandable storage device for many tablets, smartphones
and action cameras. The cards can also be used with the
included SD card adaptor for use in standard size SDHC
5&:%FGXKEGU
Able to withstand harsh environments, these versatile
cards are waterproof, temperature proof, shock and
vibration proof and X-ray proof.
9KVJECRCEKVKGUHTQO)$VQ)$KVoUGCU[VQƁPFVJG
right card for your devices, providing space for thousands
of hi-res photos and hours of video.
• %NCUU7*5+URGGFUQH/$UTGCFCPF/$U
write
• Small form factor
• Durable enough to protect your photos and videos,
even in harsh environments
• Capacities from 8GB to 128GB
• UHS-I interface is ideal for cinema-quality HD video
(1080p) and photos of subjects (kids, pets, etc.)
in motion
• 9CVGTRTQQHVGORGTCVWTGRTQQHUJQEMXKDTCVKQPRTQQH
and X-ray proof
• Guaranteed - covered by Kingston’s lifetime warranty,
free technical support and legendary reliability
6GEJPKECNURGEKƁECVKQP
Capacities
Performance
microSD dimensions
SD adapter dimensions
Format
1RGTCVKPIVGORGTCVWTG
Storage temperature
Voltage
Warranty
Capacity
8GB
16GB
32GB
64GB
128GB
Type
SDHC
SDHC
SDHC
SDXC
SDXC
8GB, 16GB, 32GB, 64GB, 128GB
/$UTGCF%NCUU7*5+/$UOKPKOWO
data transfer
11 x 15 x 1mm
24 x 32 x 2.1mm
FAT32 (microSDHC 8GB to 32GB); exFAT (microSDXC
64GB to 128GB)
-25 to 85°C
-40 to 85°C
3.3V
Lifetime
Order code
19-9231
19-9233
19-9235
19-9237
19-9239
1+
3.65
4.99
8.95
16.62
41.49
Kingston Technology’s Secure Digital
High-Capacity (SDHC) memory
cards are fully compliant with the
new Secure Digital Association
URGEKƁECVKQP6JG[CTGCPGY
performance class of SD memory
cards designed to meet the storage
demands of high-quality digital still
and video cameras and other highresolution image recording devices.
Type
4GB
8GB
16GB
32GB
Order code
45-7007
45-7009
45-7025
45-7027
1+
2.49
3.02
4.62
9.21
500212
Kingston DTIG4 DataTraveler G4
USB 3.0 Flash Drive Memory Sticks
17
A range of Kingston’s DataTraveler® Generation 4 (DTIG4)
Flash Drives, featuring USB 3.0 connectivity for quick
CPFGCU[VTCPUHGTQH[QWTOWUKEXKFGQURJQVQUFCVCƁNGU
and more. Their practical size makes them ideal for
everyday use at work, home, school, college, university,
or wherever you need to take your data. Kingston’s
DataTraveler® Generation 4 (DTIG4) Flash Drives are
available with capacities up to 128GB. The drives are
backwards compatible with USB 2.0 and are backed by
-KPIUVQPoUƁXG[GCTYCTTCPV[HTGGVGEJPKECNUWRRQTVCPF
legendary reliability.
• Colour-coded by capacity: 8GB Yellow, 16GB Blue,
32GB Red, 64GB Violet, 128GB Green
• Large, colourful loop easily attaches to key rings, etc.
• Practical end cap protects the USB plug and your data
• %QORNKCPVYKVJ75$URGEKƁECVKQPUCPFbackwards
compatible with USB 2.0
• Dimensions 55mm x 21mm x 10.1mm
Compatible with:
Windows® 8.1; Windows® 8; Windows® 7 (SP1); Windows Vista® (SP1, SP2);
9KPFQYU:2
52/CE15:XZ.KPWZXZ
559828
SDHC Memory Cards
SDHC cards offer larger-volume data storage and
optimized recording performance with support for FAT 32
ƁNGHQTOCVU#NVJQWIJKFGPVKECNKPUK\GVQVQFC[oUUVCPFCTF
SD card, the new SDHC cards are designed differently
and are only recognized by SDHC host devices. To ensure
compatibility, look for the SDHC logo on cards and host
devices (cameras, camcorders, etc.).
For added reliability and durability, Kingston Technology’s
solid-state SDHC memory cards are built of nonvolatile
memory components and have no moving parts that
could wear out or break. All Kingston’s SDHC cards
are 100-percent tested and are backed by a lifetime
YCTTCPV[CPFNKXGVGEJPKECNUWRRQTV
• Capacities: 4GB, 8GB, 16GB & 32GB
• *KIJ5RGGF%NCUU4CVKPI%NCUU/$UGEOKPKOWO
data transfer rate
• Dimensions: 24 x 32 x 2.1mm (0.94 x 1.25 x 0.08in.)
• 1RGTCVKPI6GORGTCVWTGŒVQŒ%
ŒVQ
185°F)
• Weight: 2.3g (0.08 oz.)
• Voltage: 3.3V
• File Format: FAT 32
• Secure: built-in write-protect switch prevents accidental
data loss
• Guaranteed: lifetime warranty
• Simple: as easy as plug-and-play
• Economical: low power consumption for better device
battery life
Stationery
ched and
Type
4GB CompactFlash card
8GB CompactFlash card
Video
time
HDef
60
120
240
480
Education
XKFKPI
MP3
These high
performance
CompactFlash cards
have been specially
designed by Kingston
to ensure that you
capture the moment.
With outstanding
data transfer speeds
and lower power
consumption there is
no compromise when
you choose this ultra
performance CompactFlash memory card.
Ideal for portable applications such as digital cameras.
• Type: CompactFlash card
• Capacity: 4GB & 8GB
• Warranty: Lifetime
• Dimensions: 42.8 x 36.4 x 3.3mm
• Weight: 11.4g
• Adaptor: None
Type
4 Gbyte SDHC card
8 Gbyte SDHC card
16 Gbyte SDHC card
32 Gbyte SDHC card
Video
time
Normal
120
240
480
960
Type
8 GB Yellow
16 GB Blue
32 GB Red
64 GB Violet
128 GB Green
Order code
19-9240
19-9242
19-9244
19-9246
19-9248
1+
3.15
5.29
9.99
17.49
29.99
533015
Order online
Save time, and place your order at:
www.rapidonline.com
24 hours a day
www.rapidonline.com sales@rapidonline.com
713
714 Stationery
• Designed for both PC and video entertainment
•
•
DataTraveler 101 Generation 2
Flash Drives
• Media Form Factor: 5.25 inch
• Native Capacity: 700 MB
• Recording Time: 80min
• Write Speed: 52x (max)
• Write once
• Available in packs of 10 and on spindles of 25
applications
Long-term data archiving
Available on spindles of 25 or in slim cases of 10
Type
DVD+R, 10 slim case pack
DVD-R, 25 pack spindle
Order code 1+
06-8464 5.04
06-8466 7.02
122106
Type
CD-R, 10 pack slim case
CD-R, 25 pack spindle
Screen
and Fi
Order code 1+
06-8470 4.84
06-8472 5.85
122108
Education
DVD+RW 4x Speed
Stationery
17
The Kingston® DataTraveler®101 Generation 2 (G2) is
the next generation of top-selling Kingston Flash drives.
This convenient storage companion lets you take all of
[QWTFCVCVQ[QWTJQOGQHƁEGUEJQQNCPFCP[YJGTG
[QWVTCXGN0QYYKVJWT&TKXGUQHVYCTGVJGUGƂCUJ
drives give you a better way to look at your data while
combining features to make it your own. The urDrive
software enables you to easily store, organize and share
your favourite photos through the built-in photo viewer,
use the convenient built-in Internet browser and view
VJG#RR<QPGHQTPGYCRRUVQVT[CNNKPCƂCUJ5NGGM
practical and attractively designed, the affordable
DataTraveler 101 G2 serves the needs of the budgetEQPUEKQWUWUGTCUYGNNCUVJQUGNQQMKPIHQTUKIPKƁECPV
storage capacity in a lightweight, compact drive. It
features a capless, swivel design for added functionality
and ease of use. Available in fun colours that denote
capacity. Ideal for anyone on the go, the new DT 101
G2 with urDrive is like having a customisable, portable
desktop - anywhere. DataTraveler 101 G2 is backed by
-KPIUVQPTGNKCDKNKV[YKVJCƁXG[GCTYCTTCPV[CPFHTGGVGEJ
support.
• 5RGGF)$)$/$UGETGCFCPF/$
sec. write
• Dimensions: 57.18 x 17.28 x 10.00mm (2.25 x 0.68
x 0.39in.)
• 1RGTCVKPI6GORGTCVWTGVQŒ%
sVQŒ(
• Storage Temperature: –20 to 85°C (–4 to 185°F )
• Simple: just plug into a USB port
• Handy compact size
• )WCTCPVGGFƁXG[GCTYCTTCPV[
• Available in fun colours: 8 GB Red, 16 GB Black,
32 GB Purple, 64GB Green, 128GB White
• Compatible with Windows®7, Vista®, XP, 2000,
/CE15.KPWZZ
Type
8GB (Red)
16GB (Black)
32GB (Purple)
64GB (Green)
128GB (White)
Order code
19-9192
19-9193
19-9194
19-9197
19-9198
1+
3.02
5.04
9.58
17.16
29.44
+OCVKQP&8&49
media is a universal
and interchangeable
rewritable media
format. Each disc can
hold 4.7 Gbytes of
information, which
translates to more
than two hours of
high quality MPEG2
video with excellent
picture quality.
With its two-way
EQORCVKDKNKV[&8&49OGFKCECPDGRNC[GFKPOQUV&8&
8KFGQRNC[GTUCPF&8&41/FTKXGUKPWUGVQFC[CUYGNN
CU&8&49FTKXGU5KOKNCTVQ%&49FKUEU&8&49
media can be rewritten more than 1,000 times. Ideal
for the combined storage of large capacity video, music,
RJQVQCPFFCVCƁNGUCUYGNNCUNQPIVGTOCEJKXCNUVQTCIG
• 4GYTKVCDNG&8&4
• Ideal for video and data applications
• 4x Recording
• Holds seven times more data than CD-R
• 1WVUVCPFKPIRKEVWTGCPFUQWPFSWCNKV[
• Rewritable format allows 1,000 rewrite cycles
• Records and stores data, video, photos, music and
more
• Designed for both PC and video entertainment
applications
• Long-term data archiving
• Supplied in jewel case in packs of 10
Type
DVD+RW 10 pack
Order code 1+
06-8468 8.03
122107
Blank Media
This cleaning kit provides
everything necessary to
maintain the external surfaces
of PCs and workstations.
• 0QPƂCOOCDNGPQP
smearing anti-static cleaning
HQTƁNVGTUCPFOQPKVQTU
• Powerful foaming cleaner for
cases and keyboards
• Cleaning cloths for use with cleaner
• Kit contains:87ml Foamclene aerosol, 100ml Screen
%NGPGRWORURTC[RCKTU7NVTCENGPGYGVFT[UCEJGVU
1 keyboardcleaning card, 50 Computiss, Instructions
Type
Screen, Case, Keyboard
Order code 1+
6+
87-0860 11.04 10.52
These top quality,
32-speed, recordable
CDs can store up to
700MB of data or 80
minutes of audio.
• Suitable for use
in both CD-R or
CD-RW drives
• Supplied in spindle
packs of 50
Type
CD-R 52x
+OCVKQP&8&4CPF&8&4
media is a universal and
interchangeable media
format. Each disc can hold
4.7 Gbytes of information,
which translates to more
than two hours of high
quality MPEG2 video
with excellent picture
quality. With its two-way
compatibility, DVD-R and
&8&4OGFKCECPDGRNC[GFKPOQUV&8&8KFGQRNC[GTU
CPF&8&41/FTKXGUKPWUGVQFC[CUYGNNCUKPOWNVK
format drives and super drives. Ideal for the combined
storage of large capacity video, music, photo and data
ƁNGUCUYGNNCUNQPIVGTOCTEJKXCNUVQTCIG
• 4GEQTFCDNG&8&4CPF&8&4
• Ideal for video and data applications
• 16x Recording
• Holds seven times more data than CD-R
• 1WVUVCPFKPIRKEVWTGCPFUQWPFSWCNKV[
• Rewritable format allows 1,000 rewrite cycles
• Records and stores data, video, photos, music and
more
714
300568
CD-R 52x Speed
Imation CD-R disks store data swiftly and permanently.
Imation CD-Rs are the optimal media due to distribution
capabilities, huge install base and archive possibilities.
The media gives you great performance that ensures low
failure rates. Store your images and photos, archive your
data or create custom music mixes.
• Product Description: Imation CD-R - 700 MB - storage
media
• Type: Storage media - CD-R
Type
Tub of 100
067834
PhoneHygien
SafePad Isopropyl Impregnated
Cleaning Pads
Type
Cleaning pad
Order code 1+
06-8473 6.55
Anti-static
developed
glass and
computer
• Ideal for
UETGGPU
• (QTDGUV
off with
87-093
• 0QVUWKV
• AF type
• Availabl
12+
9.41
Lint free c
with a bac
perfume fo
telephone
equipmen
• Essentia
to preve
germs
• AF type
• Supplied
Type
Tub of 100
Order code 1+
25+ 100+ 500+
87-0900 0.286 0.251 0.218 0.198
030103
DVD-R/DVD+R 16x Speed
Type
Tub of 100
Anti-St
Screen, Case and Keyboard
Cleaning Kit
Individual cleaning
pads containing soft,
lint free material presaturated with 100%
isopropanol.
• Warning: contents
CTGƂCOOCDNG
and the product
should be used in
a well ventilated
area
• Electrolube Part
No. SPA100
CD-R 52x Speed
500716
Desk & Computer
Cleaning Products
Anti-static
developed
CPFCPVKI
• Also sui
overhea
• 0QVUWKV
• AF type
• Availabl
SCS100 Screen-Clene Anti-Static
Screen Wipes
An individually
packed, presaturated, anti-static
wipe suitable for
monitors, laptops and
CPVKINCTGƁNVGTU
• Removes dust and
ƁPIGTOCTMUHTQO
screen surfaces
• Non-smearing
• 0QPƂCOOCDNGCNEQJQNHTGG
• Safe to use on all coated glass (including TFT and LCD)
CPFRQNCTKUKPIƁNVGTU
• Reduces the risk of eyestrain
• #NUQUCHGVQWUGQPOKTTQTUNGPUGU1*2UOKETQƁNO
CPFOKETQƁEJGTGCFGTU
• #RRTQXGFHQT1'/WUGQPCPVKINCTGEQCVKPIU
• Individual sachet packed
• Sold singly
• Electrolube Part No. SCS100
Type
Anti-static screen wipe
Tel: 01206 751166 Fax: 01206 751188
Order code 1+
25+ 100+ 500+
87-0910 0.186 0.175 0.154 0.131
030105
Safetis
High quali
single-ply
• Size 23
• Combin
absorbe
good str
when we
• +FGCNN[U
87-011
• AF type
• Supplied
Type
200 Paper w
Laptop
and Cl
A two sach
especially
to gently r
dust, dirt,
residues fr
laptop scr
• Anti-stat
• Non-sm
Stationery 715
• 0QPƂCOOCDNG
• 5WKVCDNGHQTWUGQP6(6.%&RNCUOCƂCVUETGGPUCPF
panels
• Supplied in packs of 5 double sachets (one anti-
Screen-Clene Anti-static Screen
and Filter Cleaning Wipes
25
122108
ter
cts
static wet wipe and one lint free drying cloth)
Type
Laptop Clene
Anti-static, lint-free screen cleaning wipes
developed for daily cleaning of VDU screens
CPFCPVKINCTGƁNVGTU
• Also suitable for similar applications like
overhead projector and photocopier glass
• 0QVUWKVCDNGHQTOGUJV[RGUETGGPƁNVGTU
• AF type SCR100T
• Available in tubs of 100
Type
Tub of 100
Order code 1+
87-0194 4.83
6+
4.49
12+
4.20
24+
3.70
067834
Phone-Clene Telephone
Hygiene Wipes
Lint free cleaning wipes impregnated
with a bacterial cleaner and light
perfume for sanitising and freshening
telephones, headsets and dictation
equipment.
• Essential where equipment is shared,
to prevent cross contamination of
germs
• AF type PHC 100T
• Supplied in tubs of 100 wipes
Type
Tub of 100
Order code 1+
87-0920 4.16
6+
3.97
030103
atic
High quality, lint free,
single-ply wipes.
• Size 23 x 23cm
• Combine high
absorbency with
good strength
when wet
• +FGCNN[UWKVGFHQTWUGYKVJHQCOENGCPGT
1TFGTEQFG
87-0110)
• AF type ST1200
• Supplied in packs of 200
Order code 1+
87-0930 3.97
12+
3.78
24+
3.36
066328
ETQƁNO
0+ 500+
154 0.131
030105
Laptop Clene Cleaning Wipes
and Cloths
A two sachet system
especially developed
to gently remove
dust, dirt, smears and
residues from soft
laptop screens.
• Anti-static
• Non-smearing
Order code 1+
06-8474 3.99
122109
Plastic CD/DVD
Envelopes & Pockets
Invertible HFC-Free Air Duster
200ml
These wallets are ideal
HQTRTQVGEVKPI%&U&8&U
from dust and scratches
and may also hold thin
booklets.
This invertible ozone friendly
pressure duster removes dust
and debris from hard to reach
areas. It provides a powerful
blast for the easy removal of
dust from precision equipment
such as printed circuit boards as
well as general cleaning in areas
where the use of a liquid cleaner
may be undesirable. Perfect for
keyboards, printers, cameras etc.
• High-powered jet nozzle
• Extension tube for greater
control
• Extension tube helps to reach
KPCEEGUUKDNGTGOQVGCTGCU
• Safe on plastics, rubbers and
painted surfaces
• Supplied in cans of 200ml
Type
Air duster
and LCD)
Type
DVD/ CD Envelopes
17
Strand
12+
3.40
Safetiss Paper Wipes
Type
200 Paper wipes
Order code 1+
35-4505 5.09
400292
062705
0+ 500+
218 0.198
A handy repair kit for
your old CDs and DVDs
that have sustained
minor damage through
repeat use. This kit can
clean CD, DVD, CD-R,
CD-RW, VCD and CDRom discs and repair
minor scratches that
can cause drop-outs
and skipping.
• Not only removes the dust from your disc but also
polishes any minor scratches on it
• Mends any damage to the data side of your disc
allowing it to be read again
• Easy to use rotary cleaning action,
• 5WRRNKGFYKVJONENGCPKPIƂWKFONUETCVEJ
remover and 4 cleaning pads
Type
Disc Scratch Repair Kit
CD/DVD Envelopes & Pockets
Paper & Plastic Window x50
Stationery
032137
10+
3.30
Acid-free archival
quality compact disc
storage envelopes
YKVJRTQVGEVKXGƂCR
For long term archival
care of your precious
DVDs or CDs. They
have been designed
to house one single
&8&%&YKVJC
UPWIƁVVQRTGXGPV
movement inside the
envelope.
These sturdy, inexpensive storage envelopes help protect
CNNV[RGUQH&8&%&HTQOCVOQURJGTKERQNNWVCPVUVJCV
ECPEQTTQFGC&8&%&UKORQTVCPVOGVCNNKENC[GT6JGUG
are an inexpensive replacement for bulky, fragile jewel
cases.
• %NGCTRNCUVKEYKPFQYCNNQYUGCU[&8&%&TGEQIPKVKQP
• Dimensions: 126 x 126mm
• Colour: white
• Supplied in packs of 50
Disc Scratch Repair Set
24+
3.83
5+
3.81
RVFM
Order code 1+
35-4506 1.19
RVFM
12+
4.14
Order code 1+
35-3301 4.43
073334
400293
2+
41
d
Type
Disc sleeves 100 pack
Education
6+
4.30
This CD lens cleaner utilises
three angled brushes to quickly
remove dust and dirt from your
CD players optical lens.
• Easy to use
• Audio instructions (6
languages) with music during
cleaning operation
• Features an automatic stop
facility
Type
CD Lens Cleaner
CD/DVD Envelopes & Pockets
Paper & Plastic Window x100
6JGUGYJKVGRCRGT%&&8&
UNGGXGUYKVJƂCRCTGCEQPXGPKGPV
and low-cost way to preserve the
information you have written to
[QWT%&&8&
• Discs are kept free of dust
• %NGCTYKPFQYHQT%&&8&KFGPVKƁECVKQP
• Store your discs in less space
• Supplied in packs of 100
CD Lens Cleaner
Anti-static, lint-free cleaning wipes
developed for removing dirt and grime from
glass and plastic surfaces of PCs and other
computer related equipment.
• Ideal for PC cases, keyboards, VDU
UETGGPUCPFƁNVGTU
• (QTDGUVTGUWNVUQPINCUUCPFƁNVGTUFT[
off with Safetiss tissues, order code
87-0930
• 0QVUWKVCDNGHQTOGUJV[RGUETGGPƁNVGTU
• AF type PCC100
• Available in tubs of 100
Order code 1+
87-0198 4.49
Strand
12+
3.63
RVFM
Anti-Static PC Cleaning Wipes
Type
Tub of 100
6+
3.87
067833
032136
Screen
UCEJGVU
uctions
Order code 1+
87-0858 3.97
Media Cases
Type
CD/DVD Wallets 50 pack
CD/DVD Wallets 100 pack
www.rapidonline.com
10+
2.48
3.30
RVFM
CD/DVD Jewel Cases – Slim
081146
…added daily, check our website
5+
2.88
3.88
073814
Order code 1+
45-2013 2.69
New products
Order code 1+
35-3309 3.33
35-3310 4.43
These ultra thin
RTQƁNG%&LGYGN
cases are made
from high quality
clear plastic and
are the same
height and width as a standard jewel case, but only 5mm
thick. This means that two of these cases can be stored
in the same width as one standard CD case.
• Super slim case holds one CD plus inlay
• 50% space-saving
• Ideal replacement when the original box is damaged
or broken
• Size 125 x 124 x 5mm
• Supplied in packs of 10
Type
Slim CD cases
Order code 1+
06-8476 5.22
122110
www.rapidonline.com sales@rapidonline.com
715
716 Stationery
RVFM
Aluminium Flight Case – CD x120
CD/DVD Envelopes & Pockets
Plastic x25
These pockets will protect
your valuable memories that
you placed on either DVD
or CD against dust and dirt.
Ideal for storage, archiving
CPFFGURCVEJQH&8&%&U
• 4GUGCNCDNGƂCR
• Manufactured from
polypropylene
• Supplied in packs of 25
Type
Protective pockets
Order code 1+
06-8478 4.23
122111
Education
RVFM
Stationery
17
CD/DVD Wallets – Holds 200
This convenient
case will let you
bring along a
selection of your
favourites.
• Holds up to 200
CDs or DVDs
• Protect your
media discs
from scratches
and smudges
• Double-sided
DNCEMRCFFGFUNGGXGURTQVGEVVJGFGNKECVG%&&8&
surface
• Made of durable high quality leather-like material
• Protective plastic inner shield
• 6TCPURCTGPVRQEMGVUHQTGCU[KFGPVKƁECVKQP
• Durable high quality zipper and lining for years of use
• Easy to carry handy size
• 5NGGXGUJQNF%&U&8&UVQUKFG
• Inner elastic strap holds sleeves securely
Type
CD/DVD Disc wallet
• Laser beam is 5 times brighter than most comparable
RVFM
A range of robust
CNWOKPKWOƂKIJV
cases for storage
of CDs. The case
features internal
padding, with
separators for the
CDs. The outside of
the case is made
from tough diamond
patterned aluminium
with curved extrusions and chrome plated steel corners
and hardware. The catches secure the removable lid and
can be locked using the keys provided. The carry handle
has cushioning for extra comfort.
• Ideal for the mobile DJ
• Holds 120 CDs
• Aluminium case with strong chrome corners, handle,
hinges and lockable catches, 2 keys supplied
• Detachable lid
• Lined case for maximum CD protection
• Material Aluminium
Type
CDA:120 Aluminium CD Case 120
Order code 1+
35-6077 12.99
077750
716
U-board - Portable Interactive
Whiteboard Kit
Stylus and w
Deluxe Metal Laser Pointer MP1800
Type
Laser pointer
073491
PQY$QCTF
It works w
software a
CPKPVGTCE
UCXKPIPQ
of all softw
existing pr
games, dis
watching e
images, op
PQY$QCTF
installation
cable and
• 6JGEQUV
• 6WTPUCP
• Set-up a
• Easily to
and you
• Main un
• Extra Wa
• Junior W
• Suitable
Interactive
Whiteboard Kits
This affordable and popular pen-style laser pointer is
perfect for business presentations and lectures.
• Red beam
• Ideal for highlighting overhead or LCD projections,
videos, maps and charts
• Allows you to move freely around the room
• Powerful beam can be seen even in the brightest room
• Laser beam is 5 times brighter than most comparable
ones on the market
• Made of metal, making it durable
• Ideal for corporate gifts
• #XCKNCDNGKPOCVVEJTQOGƁPKUJ
• Dimensions 140(L) x 12.6(W)mm
• Supplied with deluxe laser pointer, protection pouch,
2x AAA batteries and instructions
• CE approved
Order code 1+
35-8001 29.99
080766
400295
Laser pointers are not recommended for use by children under
sixteen.
Type
96CD/DVD Case
Order code 1+
35-6024 8.59
Order code 1+
35-4511 38.99
073494
6JKUƂKIJVECUGKUUWEJCJQVHCXQWTKVGYKVJGXGT[QPG
representing unbelievable value for money and complete
protection for its contents.
• 5V[NKUJRQNKUJGFCNWOKPKWOƂKIJVECUGUWKVCDNGHQT%&U
and DVDs
• Safe storage and transportation of your precious CDs
• Rounded protective corners, comfortable carrying
handle
• Foam padded interior
• Fully lockable
• Strong design
• Removable lid
• Ideal for the mobile DJ, or for schools to safely store
%&U&8&U
• #XCKNCDNGKP%&U&8&UUK\G
Type
Laser pointer
Now!Bo
Portab
Techno
Contents not included.
Order code 1+
35-8004 8.99
Aluminium Flight Case
CD/DVD x60/96
•
•
•
•
•
•
•
•
•
•
ones on the market
Made of ABS, making it durable
Ideal for corporate gifts
Available in black
Dimensions 140(L) x 18(W)mm
Supplied with laser pointer and 2x AAA batteries
CE approved
1WVRWV9CXGNGPIVJPO
$GCOFKCOGVGTRNWUOKPWUOOCVO
Beam projection: 100m
Weight: 24g (minus batteries)
Super Compact Laser Pointer
This affordable and
popular pen-style laser
pointer is perfect for
business presentations
and lectures.
• Red beam
• Ideal for highlighting
overhead or LCD
projections, videos,
maps and charts
• Allows you to move
freely around the room
• Powerful beam can be seen even in the brightest room
The uBoard system provides the ultimate in retrospective
Virtual Interactive Systems converting any conventional
projector into a high performance virtual interactive
board solution. Stylish, simple to set-up and extremely
portable, uBoard consists of a small magnetic-mount
5[UVGO%QPVTQNNGT6TCPUOKVVGTCPFW$QCTF'2GP$[
OQWPVKPIVJGW$QCTF%QPVTQNNGT6TCPUOKVVGTQPVQVJG
edge of any conventional dry-wipe board - or simply onto
CP[ENGCTNKIJVEQNQWTGFYCNNCP[ƂCVUWTHCEGECPDG
KOOGFKCVGN[VTCPUHQTOGFKPVQCHWNN[KPVGTCEVKXGYQTMKPI
teaching space, providing an advanced interactive
UQHVYCTGFTCYKPICPPQVCVKQPRCEMCIGRNWUHWNNEQPVTQNQH
any standard software installed on your computer.
• Dedicated ASIC chipset
• Fast response time
• High resolution
• Ultra smooth response
• Smooth writing touch and feel
• Virtual Pressure Brush effects without programming
• Minimum eye strain
• 5VCVGQHCTVPQKUGƁNVGTKPI
• 300cm (120in.) working area
• Slim, distinctive and stylish design
• Wireless connectivity
• High portability
• Rechargeable Battery
• No software installation
• Integrated Laser Pointer
• 100% Microsoft compatibility
6GEJPKECNURGEKƁECVKQP
Effective Working Area
USB Device Class
Sampling Frequency
Dimensions
Power
Computer
CPU
Interface
1RGTCVKPI5[UVGO
RAM
Humidity
Recommended operating temperature
Power
Battery
Rechargeable terminal
Button
Battery monitoring
Full recharging time
Continuous operating time
Power saving mode
USB recharging cable
Active Laser pointer
Type
Whiteboard kit
Tel: 01206 751166 Fax: 01206 751188
300cm (120 Inches)
Microsoft HID Pen
40kHz
22(L) x 30(W) x 17(H)mm
75$8QNVO#
IBM PC Compatible
Intel Pentium or Above
USB 2.0 full speed or USB 1.1
9KPFQYU:28KUVC
Minimum 1Gb
VQ4*Œ%
PQPEQPFGPUKPI
15° to 40°C
8#*
Lithium polymer
3.5mm jack
Right & Left Mouseclick
2 step LED Indicator
2 hours
15 hours
Automatic after 20 seconds idle time
USB recharging cable 70cm
#VVCEJCDNGVQUJCTGURQYGTYKVJ
the digital pen
Order code 1+
34-9639 556.30
500220
6GEJPKECNURGE
1RGTCVKPIU[UV
Main unit size
Stylus size
Wand length
Main unit pow
Stylus and wa
Type
Now!Board In
Now!Board Ju
Now!Board W
BIC Ve
These dou
plastic bo
draw and
• Size 20
• Each bo
pen and
• %QNQWTU
• Supplied
Type
Whiteboard 2
Stationery 717
mparable
Now!Board
Free Delivery*
Portable Interactive Whiteboard
Technology
8GNNGFC1HƁEG9JKVGDQCTFU
ries
080766
ospective
entional
ctive
tremely
mount
$[
QVJG
mply onto
CPDG
YQTMKPI
ve
EQPVTQNQH
er.
6GEJPKECNURGEKƁECVKQP
1RGTCVKPIU[UVGO
Main unit size
Stylus size
Wand length
Main unit power
Stylus and wands power
Type
Now!Board Interactive
Now!Board Junior Wand
Now!Board Wand
PC and Mac
75 x 90mm
75 x 75mm
160 to 440mm
Via USB cable
2x AAA batteries each
Order code 1+
34-9954 406.98
34-9955 13.17
34-9956 20.29
516909
Whiteboards
Type
30 x 44cm
44 x 55cm
60 x 90cm
* See Terms & Conditions for full details
RVFM
Push Pins
Order code 1+
34-7180 5.19
34-7182 10.69
34-7184 16.68
517602
Type
Push pins
Edding 1591 Magic-Chart
Whiteboard
The Edding 1591
Magic-Chart
Whiteboard is a
roll of plain white
RQN[RTQR[NGPGƁNO
that will adhere
electrostatically to
any smooth surface
such as windows,
walls and doors, etc.
It provides a creative,
space-saving solution
for presentations,
meetings and brainstorming sessions. Legamaster MagicChart Whiteboard is supplied as a roll of 25 Sheets of
600 x 800mm.
• Sticks electrostatically to all kinds of surfaces
• Just attach and smooth out
• Packed in a handy lightweight box that can be hooked
QPVQUVCPFCTFƂKREJCTVGCUGN
• 25 perforated sheets on roll
• Sheet size: 600 x 800mm
• Environmentally friendly material
• Fully recyclable
• Can be repositioned several times leaving no trace
Type
Magic Whiteboard
BIC Velleda Kids Whiteboards
Order code 1+
06-9295 14.49
516969
Notice Board
Accessories
RVFM
PFGPUKPI
ds idle time
m
GTYKVJ
These double-sided BIC whiteboards with fun-shaped
plastic borders provide hours of fun for children, as they
draw and erase over and over again.
• Size 20 x 31cm
• Each board supplied with 1x blue Velleda 1721 marker
pen and eraser that clips on to the board
• %QNQWTU$NWG1TCPIGCPF)TGGP
• Supplied in assorted coloured packs of 24
Type
Whiteboard 20 x 31cm
Order code 1+
34-7150 49.99
517598
Standard brass
drawing pins.
• 11mm head
diameter
• Supplied in packs
of 150
Type
Brass drawing pins
®
QL-570 USB Continuous Label
Printer
The Brother QL-570 USB Label Printer prints high quality
labels from your PC quickly and easily, whether you need
just one, or a series of labels.
• Attractive slim design
• Supports barcode printing
• Uses DK Series labels
• Automatic cutter
• 68 standard labels per minute print speed
• Brother type QL-570
Label rolls
(available separately)
Order code 1+
34-3712 0.556
075161
17
Label Printers
6GEJPKECNURGEKƁECVKQP
Barcode printing
Consumable type
Cutter type
Dimensions
Interface
Mirror printing
Print head
Print resolution
Print speed
Print technology
Roll width
Vertical printing
Warranty
Weight
Consumables included
Brass Drawing Pins
B 1.1
Order code 1+
34-3716 0.859
075163
Please note that the whiteboard is plain, not gridded.
mming
1RCSWGEQNQWTGFQHƁEGRWUJRKPU
• Supplied in assorted coloured packs of 100
Stationery
Stylus and wand both take 2x AAA batteries, included.
Double-sided
whiteboards, for use
with drywipe markers
and pens, ideal for
temporary messages
KPQHƁEGUHCEVQTKGU
schools, reception
areas, etc.
• Easy to mount on
most wall surfaces
• Holes for screw
attachment
• Can also be used on
easels
• Ideal for daily targets,
notices, greetings, training, etc.
• Available in 3 sizes
• Sold singly
Education
PQY$QCTFvKUC2QTVCDNG8KTVWCN+PVGTCEVKXG9JKVGDQCTF
It works with your existing projector, computer and
software and allows you to turn any teaching activity into
CPKPVGTCEVKXGITQWRGZRGTKGPEG%QPXGPKGPVCPFVKOG
UCXKPIPQY$QCTFCNNQYUEQORNGVGCEEGUUCPFHWNNWUG
of all software already installed; making the most of your
existing prepared lessons. Ideal uses include: interactive
games, display and complete teaching activities,
watching educational videos, accessing and annotating
images, opening, editing and saving documents.
PQY$QCTFKU2%CPF/CEEQORCVKDNGCPFEQOGUYKVJCP
installation CD, stylus, extendable wand, carry case, USB
cable and CD software guide.
• 6JGEQUVGHHGEVKXGUQNWVKQPHQTCPKPVGTCEVKXGENCUUTQQO
• 6WTPUCP[ƂCVUWTHCEGKPVQCPKPVGTCEVKXGYJKVGDQCTF
• Set-up and start teaching in a few minutes
• Easily toggle between your virtual whiteboard, the web
and your current software
• Main unit is powered via the USB connection
• Extra Wand available separately
• Junior Wand also available separately
• Suitable for ages 3 to 18
on all orders over £30 (excl. VAT)
(UK mainland only)
Type
QL-570 printer
Supported
Label rolls & continuous tape
Automatic
5.2in (W) x 8.2in (D) x 5.6in (H)
USB
Mirror printing
Self cleaning
300dpi
68 standard labels per minute
Direct thermal printing
Prints on DK-Rolls up to 62mm (2.3in) wide
Supported
3 year return to base
1.14 kg
DK11201 starter roll (100x standard address labels)
DK22205 starter roll (8 meter continuous paper tape)
.CDGNDCTEQFG2VQWEJGFKVQTUQHVYCTG
Power lead, user guide & USB cable
Size
17 x 54mm
29 x 90mm
62 x 100mm
Brother type
DK11204
DK11201
DK11202
1TFGTEQFG
34-6126
34-6122
34-6123
Order code 1+
34-6113 69.95
082526
New products – www.rapidonline.com
500220
www.rapidonline.com sales@rapidonline.com
717
718 Stationery
26
Label P
Education
With ergon
design and
stylish loo
PT-90 is id
organising
home and
QHƁEG.KIJ
and comp
enough to
hand-held
include ico
• 8 print s
bold, ita
• 3 print s
• 7 frame
• 7.5mm
• 12 char
• 2 line p
• QWERTY
• Tape wid
• Takes Br
• Size 156
• Weight 2
Requires 4x
Tape casse
PT-65 and P
Type
PT-90 label p
Stationery
17
TZe La
A wide ran
tapes suita
Brother lab
systems a
printers.
Brother TZ
use less m
and have
packaging
on the env
compatibl
• Labels a
scratchp
• Will end
• Charact
tapes su
Please note
TZ tapes. Pl
Please note
Only
Only
£79.99
Order code
06-0513
718
Tel: 01206 751166 Fax: 01206 751188
£45.79
Order code
06-0501
6GEJPKECNURGE
Tape width (m
3.5
6
6
6
9
9
9
9
12
12
12
12
12
12
12
12
18
18
18
18
24
24
24
*Not laminate
Font colour
3.5mm
Black
6mm
Black
Black
Yellow
9mm
Black
Black
Black
Red
Stationery 719
®
26*QOG1HƁEGOOOO
Label Printer
Clear
Fluor. orange
Red
White
Yellow
White
White
Clear
25-0912
25-0961
57-5832
25-0916
25-0918
25-0922
25-0920
25-1032
13.32
15.54
13.83
14.48
14.48
14.13
14.48
15.54
Clear
Red
White
Yellow
57-5819
57-5822
25-0924
25-0926
15.10
16.11
14.27
14.27
Clear
White
Yellow
57-5820
25-0930
57-5823
17.12
18.89
19.14
6GEJPKECNURGEKƁECVKQP
Tape width (mm) Font colour
9
Black
9
Black
12
Black
12
Black
18
Black
18
Black
Font colour
9mm
Black
Black
12mm
Black
Black
18mm
Black
Black
Tape colour Order code
Brother type
TZeFX221
TZeFX621
TZeFX231
TZeFX631
TZeFX241
TZeFX641
1TFGTEQFG
57-5825
57-5826
57-5827
57-5828
57-5829
57-5830
1+
White
Yellow
57-5825
57-5826
14.09
14.09
White
Yellow
57-5827
57-5828
15.10
15.10
White
Yellow
57-5829
57-5830
17.12
17.12
545502
031804
®
M Label Printer Tapes
®
TC Label Printer Tapes
Brother M label tapes
in a range of sizes
and colours.
• Suitable for use
in Brother P-Touch
and other Brother
label printers.
Requires 4x AAA batteries, not included.
Tape cassettes are compatible with the discontinued Brother
PT-65 and PT-80 label printers.
Type
PT-90 label printer
Tape colour
White
Yellow
White
Yellow
White
Yellow
Education
With ergonomic
design and
stylish looks, the
PT-90 is ideal for
organising your
home and home
QHƁEG.KIJVYGKIJV
and compact
enough to be
hand-held or used on the desk. Many special features
include icons, symbols, frames and special characters.
• 8 print styles: normal, bold, outline, shadow, italic, italic
bold, italic outline & italic shadow
• 3 print sizes
• 7 frames: round, leaf, tile, star, heart, square & bubble
• 7.5mm per second print speed
• 12 character display
• 2 line printing
• QWERTY style keyboard
• Tape width 9 and 12mm
• Takes Brother M-tape cassettes
• Size 156 x 111 x 57mm
• Weight 250g
12mm
Black
Black
Black
Black
Black
Blue
Red
White
18mm
Black
Black
Black
Black
24mm
Black
Black
Black
Order code 1+
25-1036 28.55
17
061825
TZe Laminated Label Printer Tapes
A wide range of
tapes suitable for
Brother labelling
systems and label
printers.
Brother TZe tapes
use less material
and have less
packaging than the old TZ tapes to reduce their impact
on the environment. TZe tapes are fully backward
compatible with older printers.
• Labels are laminated making them weatherproof and
scratchproof
• Will endure temperatures from 50° to 300°C
• Characters are printed under the laminate making the
tapes suitable for use in the harshest of environments
Please note that newer models of printer may not accept the old
TZ tapes. Please check compatibility.
Please note that TZe-N241, 25-0924 is not laminated.
Only
£45.79
Order code
06-0501
6GEJPKECNURGEKƁECVKQP
Tape width (mm) Font colour
3.5
Black
6
Black
6
Black
6
Yellow
9
Black
9
Black
9
Black
9
Red
12
Black
12
Black
12
Black
12
Black
12
Black
12
Blue
12
Red
12
White
18
Black
18
Black
18
Black
18
Black
24
Black
24
Black
24
Black
*Not laminated.
Font colour
3.5mm
Black
6mm
Black
Black
Yellow
9mm
Black
Black
Black
Red
Tape colour
Tape colour
White
Clear
White
Black
Clear
White
Yellow
White
Clear
(NWQTGUEGPV1TCPIG
Red
White
Yellow
White
White
Clear
Clear
Red
White
Yellow
Clear
White
Yellow
Brother type
TZeN201
TZe111
TZe211
TZe611
TZe121
TZe221
TZe621
TZe222
TZe131
TZeB31
TZe431
TZe231
TZe631
TZe233
TZe232
TZe135
TZe141
TZe441
TZe241
TZe641
TZe151
TZe251
TZe651
Price each
Order code
1TFGTEQFG
57-5824*
57-5831
25-0902
57-5821
25-0904
25-0906
25-0908
25-0910
25-0912
25-0961
57-5832
25-0916
25-0918
25-0922
25-0920
25-1032
57-5819
57-5822
25-0924
25-0926
57-5820
25-0930
57-5823
1+
White
57-5824
9.04
Clear
White
Black
57-5831
25-0902
57-5821
9.75
12.25
11.10
Clear
White
Yellow
White
25-0904
25-0906
25-0908
25-0910
12.25
13.32
13.32
13.32
Brother TC label printer tapes in a range of sizes and
colours.
TC Tapes are laminated for increased durability and are
RGTHGEVHQTGXGT[FC[KPFQQTCPFQWVFQQTJQOGCPFQHƁEG
labeling needs.
• Tape length 7.7m
• Suitable for use in Brother P-Touch and other Brother
label printers.
• Brother TC series
6GEJPKECNURGEKƁECVKQP
Tape width (mm) Font colour
9
Black
12
Black
12
Black
12
Black
12
Black
Tape colour
White
Clear
White
Red
Yellow
Brother type
TC-291
TC-101
TC-201
TC-401
TC-601
1TFGTEQFG
57-5818
57-5814
57-5815
57-5816
57-5817
6GEJPKECNURGEKƁECVKQP
Tape width
Tape length
(mm)
(m)
9
4
9
8
9
8
9
8
12
4
12
8
12
8
12
8
12
8
Font colour
9mm
Black
Black
Black
Black
12mm
Black
Black
Black
Black
Red
Font colour Tape colour Brother type 1TFGTEQFG
Black
Black
Black
Black
Black
Black
Black
Black
Red
White
White
Blue
Yellow
White
White
Blue
Yellow
White
Tape colour Order code
MK221SBZ
MK221BZ
MK521BZ
MK621BZ
MK231SBZ
MK231BZ
MK531BZ
MK631BZ
MK232BZ
57-5835
25-0852
57-5833
25-0853
57-5836
25-0858
57-5834
25-0859
25-0861
Stationery
®
1+
White
White
Blue
Yellow
57-5835
25-0852
57-5833
25-0853
5.00
7.02
8.27
7.02
White
White
Blue
Yellow
White
57-5836
25-0858
57-5834
25-0859
25-0861
5.44
7.02
9.04
7.02
7.02
545503
Font colour
9mm
Black
12mm
Black
Black
Black
Black
Tape colour Order code
1+
White
57-5818
15.10
Clear
White
Red
Yellow
57-5814
57-5815
57-5816
57-5817
13.08
15.10
15.10
15.10
®
DK Series Pre-Sized Labels
545501
®
TZeFX Flexible Label Printer Tapes
Brother TZeFX label
printer tapes are
a variation of the
standard TZe tapes
that have been
especially designed
HQTƂGZKDKNKV[6JG
labels are particularly
suitable for marking
cables and pipes, and
for sticking around
UOCNNTCFKKVQOCMGNKVVNGnƂCIoNCDGNUQTUNGGXGU
Like the original TZe tape, the labels are laminated
making them weatherproof, scratchproof, temperature
resistant and suitable for use in harsh environments.
• 'ZVTCƂGZKDNGHQTCVVCEJKPIVQUOCNNTCFKWURCTVUYKVJQWV
peeling
• Tape length: 8m
• Available in a range of widths and colours
6JGUG$TQVJGT&-UGTKGURTGUK\GFNCDGNUƁVVJG3.
and other Brother label printers.
• Brother DK series
Size
17 x 54mm
17 x 87mm
29 x 62mm
29 x 90mm
38 x 90mm
62 x 100mm
58mm diameter
No. of labels
400
300
800
400
400
300
100
www.rapidonline.com sales@rapidonline.com
Order code
34-6126
57-5839
57-5838
34-6122
57-5837
34-6123
57-5840
1+
5.87
8.27
12.07
10.02
12.07
10.54
21.16
545504
719
720 Stationery
Education
LabelManager PnP Plug and Play
USB Label Printer
Stationery
17
*Compatible with Windows® XP, Windows Vista®, Windows® 7,
Windows® 8, Mac OS® X 10.5 or later - Intel® only.
Order code 1+
06-0505 38.99
06-0835 33.95
530118
LabelManager 280
• #WVQUCX
•
• Manufac
•
6JG&;/1Š
.CDGN/CPCIGTv2P2
is the answer to a
host of your labelling
challenges. As it is
USB connectable, you
can produce labels
directly from your
PC or Mac*, with no
need for power cords
or batteries.
The built-in software
pops up on to your
computer screen,
ready-to-use, and
you can print all
the font styles and
sizes available in
9KPFQYU/CE15
as well as graphics from your computer. Editing your
text and managing the layout of the label (borders,
orientation, margins, etc.) has never been so easy. The
&;/1.CDGN/CPCIGT2P2oUJKIJRTKPVKPIURGGFCPF
compatibility with a wide range of labels helps make your
NCDGNNKPIGXGPOQTGRTQHGUUKQPCN
• Connects via USB to your PC or Mac*
• No software or drivers to install - built-in software pops
up on your computer screen, ready-to-use
• Customize your label with any fonts or graphics on your
computer
• Special ‘format break’ function makes it simple to
combine different labeling features on one label for a
unique look
• Lithium-ion battery recharges via USB connection - no
power adaptor or batteries needed
• Compact, streamlined design has minimal footprint
• 6CMGUOO&;/1&VCRGU
• Dimensions 135 x 142.4 x 53mm
• Weight 329g
• DYMO LabelManager PnP
Type
LabelManager PnP
Printer + 2 tapes
• Customize labels with any fonts and graphics on your
•
•
•
•
•
•
•
•
•
•
•
•
•
computer through PC or Mac®* connection
Type text quickly on the computer-style keyboard with
EQWPVT[URGEKƁENC[QWV
Avoid the cost and waste of disposable batteries with a
rechargeable battery pack
Edit text easily with one-touch fast-formatting keys
%TGCVGCYKFGXCTKGV[QH&;/1&NCDGNUKP
mm widths and multiple colors
Large screen lets you see text effects before you print.
No more guessing what your label will look like. ‘What
[QWUGGKUYJCV[QWIGVo
Create labels with 6 font sizes, 6 text styles, 9 boxes
plus underline, and 220 symbols and clip-art images
Store and quickly access up to 9 frequently-used
labels
Create batches of labels quickly - print up to 10 copies
of the same label
Extend battery life with automatic shut-off
3WKEMCEEGUUDWVVQPUVQRWPEVWCVKQPEWTTGPE[QVJGT
U[ODQNUFKCETKVKECNU
Package includes electronic label maker, rechargeable
battery pack, USB cable, D1 starter label cassette
black on white, 12mm x 3m, Quick Start and Reference
Guides, Charging adaptor
Dimensions: 107.5 x 206.0 x 46.5mm
Weight: 395g
Manufacturer’s 2 year warranty (plus 1 extra year if you
register your purchase)
Dymo LabelManager 280
*Compatible with Windows Vista®, Windows® 7, Windows® XP,
Mac OS® X 10.5 or later - Intel® only.
Type
LabelManager 280
Order code 1+
06-0501 45.79
530116
LabelManager 160
Pick up a portable,
CHHQTFCDNG&;/1Š
.CDGN/CPCIGTv
label maker and start
making your mark on
VJGYQTNF,WUVV[RG
your text, format it
with one-touch Smart
Keys and print. It’s
that easy to create
professional-looking
labels you can use all
CTQWPFVJGQHƁEGCPF
home.
• Type your text easily
With the portable and
TGEJCTIGCDNG&;/1Š
.CDGN/CPCIGTŠv
280 you can easily
label anything. You
can even connect it
to your PC or Mac®*
to customize your
labels with fonts
and graphics from
your computer. The
computer-style
keyboard with
EQWPVT[URGEKƁE
layout lets you enter
text quickly and edit
it using the one-touch
fast-formatting keys.
Label without the
cost and waste
of disposable
batteries - with the
rechargeable battery pack you just charge, type and print.
The LabelManager 280 prints 50% faster than other
&;/1NCDGNOCMGTUCPFKVRTKPVU&;/1&NCDGNUKP
& 12mm widths in a variety of colours.
•
•
•
•
•
•
•
•
•
•
•
on the computerstyle keyboard with
EQWPVT[URGEKƁE
layout
Choose from 6 font
sizes, 8 text styles, 4 boxes plus underline
Format quickly with one-touch Smart Keys for text size,
DQNFKVCNKEWPFGTNKPGDQZCPFXGTVKECNVGZV
Add professional impact and clarity to your labels with
228 symbols and clip art images
Use quick-access key to enter punctuation
See what your label will look like before you print preview it in the large LCD display
Powered by 6x AAA alkaline batteries (not included) or
optional AC adaptor
Dimensions: 118 x 203 x 49mm
Weight: 350g
/CPWHCEVWTGToUYCTTCPV[[GCTU[GCTKH[QWTGIKUVGT
your purchase
Package includes: Label maker, D1 starter label
cassette - black, Quick Start Guide and 2-Year Limited
Warranty Card
DYMO type LabelManager 160
Type
LabelManager 160
Order code 1+
06-0503 23.49
Fast Delivery
All orders for in-stock items received
by 7pm – Monday to Friday
are despatched the same day
720
530117
losing c
RHINO 6000 Professional Labelling
Machine with Hard Case
Runs on 6 A
quick-charg
click here
Type
RHINO 4200
RHINO
With the RHINO 6000 professional labelling machine
you can download labels from your PC and create perfect
labels on the spot - at a moment’s notice. This really is a
machine for the professional - it is loaded with a number
of innovative time-saving features. “Hot Keys” enable you
to enjoy fast and easy formatting of labels for marking
wire and cable, terminal blocks and patch panels among
QVJGTU6JG4*+01oUITCRJKECNKPVGTHCEGNGVU[QW
create, edit and preview multiple labels on the large
backlit LCD.
6JKUJCTFECUGMKVKPENWFGUC4*+014*+01
%100'%6UQHVYCTGOODNCEMQPYJKVGƂGZKDNGP[NQP
label cartridge, 9mm black on white vinyl label cartridge,
Li-ion rechargeable battery pack, AC adaptor and USB
cable - all contained in a durable carrying case.
There is also a library of industry terms and symbols to
save you typing time – and you can store 1,000 of your
own labels and recall them instantly.
• Prints six different barcodes
• 1MB memory stores graphics, logos and symbols, for
on-demand printing
• 1PGVQWEJRQYGTGFEWVVGTCPFECUUGVVGGLGEVKQP
system for effortless labels
• Uses thermal transfer print technology – so no ink is
needed
• Quick-charge lithium-ion rechargeable battery and
on-screen battery life indicator ensures your printer is
ready whenever you need it
• #EEGRVUCPFOO4*+01NCDGNU
• 9QTMUYKVJ4*+01%100'%6v5QHVYCTGVQRTQXKFG2%
connectivity
• Manufacturer’s part S0771940
Type
RHINO 6000
Order code 1+
06-0541 269.95
530129
RHINO 4200 Labelling Machine
19mm PB1 UK
If you want labelling
jobs done fast - and
done right - the
DYMO Rhino™
4200 is the labelling
machine for you. With
a familiar QWERTY
keyboard, the DYMO
Rhino™ 4200 prints
labels up to 19mm
YKFGKPƂGZKDNG
nylon, permanent
polyester and durable
vinyl materials
– and can also
print directly onto
heat-shrink tubes.
The “Favourites” key
provides single-key access to commonly used labels,
symbols and terms; and the “Custom” key eliminates
repeated steps by saving customised settings - to save
you time when it matters.
• Pre-programmed library with 150 symbols and terms
• Integrated rubber bumpers help prevent damage from
accidental drops and falls
• Large back-lit display is easy to read, even in dimly-lit
work areas
Tel: 01206 751166 Fax: 01206 751188
If you need
you need t
writer. Su
MKVKPENWFG
label cass
CFCRVQT6J
by profess
hot keys to
VGTOKPCND
5200 uses
CFJGUKXGU
stuck, and
• Pre-prog
• Large tw
• Backlit f
• Integrate
• Prints C
labels
• Automat
• Manufac
Requires 6 A
ion battery.
Type
Rhino Pro 52
D1 Sta
%TGCVGFUR
[QWT&;/1
label make
polyester D
performan
need for a
- indoor or
QHƁEG[QW
store or an
YQTM#NN&
have an ‘E
for trouble
tapes prod
high-quali
• Tape len
• Withstan
• 9KVJUVCP
• Can be
• Easy-pe
• UV resis
• DYMO D
Width
9mm
12mm
12mm
Stationery 721
elling
• #WVQUCXGCWVQRQYGTQHHGZVGPFUDCVVGT[NKHGYKVJQWV
• Sleep mode ensures energy conservation when not
•
• Includes cords, cables, software, instructions and
starter labels
• Manufacturer’s type SO838810
losing current work
Manufacturer’s part S0955950
Runs on 6 AA batteries (not included). Also compatible with
quick-charging Lithium-ion battery. For Rapid’s batteries section
click here
Type
RHINO 4200
Order code 1+
06-0543 74.95
530130
RHINO Pro 5200
o ink is
y and
printer is
U
QXKFG2%
Type
57 x 32mm
89 x 28mm
89 x 36mm
101 x 54mm
Labels Rolls per Dymo type
per roll pack
57 x 32mm 1000 1
S0722540
89 x 28mm 130
89 x 36mm 260
101 x 54mm 220
Order code
06-0529
06-0531
06-0525
06-0527
2
2
1
S0722400
S0722540
S0722430
1+
16.39
7.39
15.49
13.69
530126
If you need to print top-quality labels on the move then
you need the RHINO™5200 professional portable label
writer. Supplied in a durable carrying case, this handy
MKVKPENWFGUC4*+01NCDGNNKPIVQQNVYQV[RGUQH
label cassettes,a lithium-ion reachargeble battery and AC
CFCRVQT6JG4*+01NCDGNOCMGTKUFGUKIPGFHQTWUG
by professional installers - wherever they may be. It uses
hot keys to print pre-formatted labels for wire and cable,
VGTOKPCNDNQEMUGNGEVTKECNCPFRCVEJRCPGNU6JG4*+01
5200 uses easy-peel labels with industrial strength
CFJGUKXGUUQ[QWECPDGEQPƁFGPV[QWTNCDGNUYKNNUVC[
stuck, and legible, even in tough conditions.
• Pre-programmed symbol library
• Large two-line display
• Backlit for use in poorly-lit installations
• Integrated, slip-resistant rubber grip
• Prints Code 39 and Code 128 barcodes on 19mm
labels
• Automatic shut-off maximises battery life
• Manufacturer’s part S0841390
Requires 6 AA batteries (not included) - or a quick-charging lithium
ion battery. For Rapid’s batteries section click here
530129
Size
Type
Rhino Pro 5200
Order code 1+
06-0545 154.95
530131
RHINO Label Printer Tapes
4*+01XKP[NNCDGNU
HTQO&;/1CTGVJG
perfect solution for
general labeling in
and around industrial
facilities. The labels
are ideal for warning
and safety messages,
patch panels, face
plates and general
NCDGNNKPI4*+01XKP[N
labels can be used
outdoors in direct
sunlight.
• See Technical
5RGEKƁECVKQPHQTUK\GUCPFOCVGTKCN
6GEJPKECNURGEKƁECVKQP
1TFGTEQFG
Width
06-0547
9mm
06-0548
12mm
06-0549
19mm
Width
9mm
12mm
19mm
Length
5.5m
5.5m
3.5mm
Colour
Black on white
Black on white
Black on white
Material
Vinyl
Vinyl
Nylon
abels,
nates
to save
d terms
age from
dimly-lit
Width
9mm
12mm
12mm
Colour
Black on white
Black on white
Black on yellow
Order code 1+
06-0509 11.25
06-0507 11.99
06-0511 11.89
530119
LabelWriter 450 Turbo
The DYMO
LabelWriter 450
Turbo is capable
of printing address
labels, name badges,
barcodes etc at
speeds up to 71
per minute - 40%
HCUVGTVJCPVJG&;/1
LabelWriter 450. This
easy-to-use machine
is an ideal addressing
UQNWVKQPHQTCP[DWU[QHƁEGQTYQTMRNCEG
• 7UGU&;/1.CDGNvXGTUKQP5QHVYCTGVQETGCVGCPF
RTKPVCFFTGUUGUƁNGUHQNFGTUCPFDCTEQFGNCDGNUGVE
• Uses thermal printing technology – so dispenses with
the need for expensive ink or toner
• Creates labels directly from text in Microsoft® Word,
'ZEGNŠ1WVNQQMŠCPFQVJGTRTQITCOOGU
• Built-in address book easily prints labels from your
contacts
• Quickly creates one-off labels
• Prints crystal-clear text, graphics and barcodes
• Sleep mode ensures energy conservation when not
in use
• Includes cords, cables, software, instructions and
starter labels
• Manufacturer’s type SO838860
Order code 1+
06-0515 107.99
17
530121
LabelWriter 4XL
&;/1V[RG
18443
18444
18489
Order code 1+
06-0547 18.95
06-0548 18.95
06-0549 19.99
ne
%TGCVGFURGEKƁECNN[HQT
[QWT&;/1.CDGN/CPCIGTv
label maker, these standard
polyester D1 labels offer the
performance and variety you
need for any labelling job
- indoor or outdoor, in your
QHƁEG[QWTYQTMUJQR[QWT
store or anywhere else you
YQTM#NN&;/1Š&NCDGNU
have an ‘Easy Peel’ back-slit
for trouble-free application. The
tapes produce long-lasting,
high-quality labelling that will last for many years.
• Tape length 7m
• Withstands water, oil, grease and most mild solvents
• 9KVJUVCPFUVGORGTCVWTGUHTQOsVQŒ%
• Can be removed without leaving adhesive residues
• Easy-peel backing
• UV resistant - no peeling or fading
• DYMO D1 series
Order code 1+
06-0513 79.99
530120
Type
450 Turbo
530132
D1 Standard Polyester Label Tapes
Type
Labelwriter 450
Stationery
QP
Nothing prints faster than a
LabelWriter and no labels
are more dependable than
these. When quality can’t be
EQORTQOKUGFD[GHƁEKGPE[
these are the labels you need.
These easy-to-peel labels
deliver maximum performance
from your LabelWriter without
jamming your main printer or wasting an entire sheet of
labels to print just one.
• 2NGCUGUGG6GEJPKECN5RGEKƁECVKQPHQTUK\GUCPF
quantities
Education
bols, for
LabelWriter White Labels
6GEJPKECNURGEKƁECVKQP
1TFGT
Type
code
06-0529 Removable multipurpose
06-0531 Standard address label
06-0525 Large address label
06-0527 5JKRRKPIPCOGDCFIG
machine
te perfect
really is a
a number
nable you
marking
ls among
VU[QW
arge
01
NGP[NQP
cartridge,
d USB
.
mbols to
of your
in use
LabelWriter 450
6JG&;/1.CDGN9TKVGT
450 is fast and
effective and takes
the hassle out of
printing labels, no
matter what your
budget may be. It is
capable of printing
labels for envelopes,
RCEMCIGUCPFƁNGU
among other items,
at speeds up to 51
per minute. Compact design and contemporary colours
OGCPVJG&;/1.CDGN9TKVGTYKNNNQQMIQQFKPCP[
workplace.
• 7UG&;/1.CDGNvXGTUKQP5QHVYCTGVQETGCVGCPF
RTKPVCFFTGUUGUƁNGUHQNFGTUCPFDCTEQFGNCDGNUGVE
• Uses thermal printing technology – so no expensive ink
or toner needed
• Create labels directly from text in Microsoft® Word,
'ZEGNŠ1WVNQQMŠCPFQVJGTRTQITCOOGU
• Built-in address book easily prints labels from your
contacts
• Quickly create one-off labels
• Prints crystal-clear text, graphics and barcodes
• Choose from more than 100 label styles
Save money, save
time and above
all save hassle by
adding the DYMO®
LabelWriter™ 4XL
label printer to your
workplace. This
easy-to-use machine
enables you to print
professional quality
labels in a range of
sizes up to 10cm wide. With 300dpi print quality and
a compact design, the DYMO® LabelWriter™ 4XL can
handle a wide variety of labels in numerous applications
to offer a value-for-money option.
Packs of spare labels are available separately.
• Prints 10 x 15cm (4” x 6”) labels
• %CPWUGGZKUVKPI&;/1.CDGN9TKVGTNCDGNUV[NGUCPF
sizes
• Prints up to 53 labels per minute
• High resolution - 300 dpi - print quality, ideal for text,
graphics and barcodes
• Thermal printing so avoids the need for ink or toner.
cartridges
• USB connected
• Compatible with Windows® XP, Windows Vista®,
9KPFQYUŠ9KPFQYUŠ/CE15Š:QTNCVGT
Intel® only
• Network compatible
• Manufacturer’s part S0904960
Type
Labelwriter 4XL
Labels for 4XL
Order code 1+
06-0517 194.99
06-0523 15.49
530122
Order online
Save time, and place your order at:
www.rapidonline.com
24 hours a day
www.rapidonline.com sales@rapidonline.com
721
722 Stationery
• Prints crystal-clear text, graphics and barcodes with
LabelWriter 450 Twin Turbo
•
•
•
600 x 300 dpi graphics mode (D1 label resolution
180 dpi)
Conserves energy in sleep mode when not in use
%QORCEVUK\GOGCPUKVƁVUKPVQCP[YQTMRNCEG
Manufacturer’s part S0838960
Type
450 Duo
Size
22 x 88mm
22 x 61mm
22 x 50mm
22 x 39mm
22 x 25mm
22 x 19mm
22 x 12mm
3-In-1 Labelling Machine
Order code 1+
06-0521 145.99
530124
Education
LetraTag LT-100H
Stationery
17
If time is of the essence in your organisation then the
DYMO® LabelWriter™ 450 Twin Turbo is just the thing
KH[QWPGGFNCDGNURTKPVKPIKPCJWTT[6JG.CDGN9TKVGTv
450 Twin Turbo holds two rolls of labels at the same time
sGPCDNKPI[QWVQIGVVJGLQDFQPGSWKEMN[CPFGHƁEKGPVN[
This versatile machine enables you to print labels without
swapping label rolls or to print large batches by loading
two rolls of the same label – the DYMO® LabelWriter™
450 Twin Turbo UYKVEJGUVQVJGUGEQPFTQNNYJGPVJGƁTUV
runs out.
• Prints up to 71 labels per minute
• 7UGU&;/1.CDGNvX5QHVYCTGVQETGCVGCPFRTKPV
address, folder and barcode labels, plus name badges
etc
• HCUVGTVJCP&;/1.CDGN9TKVGT
• Uses thermal printing technology avoiding need for ink
or toner cartridges
• Creates labels directly from text in Microsoft® Word,
'ZEGNŠ1WVNQQMŠCPFQVJGTRTQITCOOGU
• Built-in address book easily prints labels
• Creates one-off labels with the QuickPrint widget
• Prints crystal-clear text, graphics and barcodes with
600 x 300 dpi graphics mode
• Sleep mode ensures energy conservation when not
in use
• %QORCEVUK\GCPFEQPVGORQTCT[EQNQWTUƁVKPVQCP[
workplace
• Manufacturer’s part S0838910
Type
450 Twin Turbo
Order code 1+
06-0519 145.99
530123
You can make labels
exactly the way you
want them with the
DYMO LetraTag
LT-100H labelmaker.
This easy-to-use
machine can print a
variety of coloured
labels and offers
multiple font styles,
underlining and
bolding. You don’t
have to wait for the
label to be printed
to know for sure
what it will look like
- the DYMO LetraTag
LT-100H’s graphical
display gives you a
chance to preview
KVƁTUV
• Large 13-character
display with print
preview
• Navigation buttons
for easy access to
advanced features
• 9 label memory
• Choice of 5 font sizes and 8 box styles
• Auto-off Power saver
• &CVG6KOGHWPEVKQP
• Ergonomic design for easy handling
• Manufacturer’s type S0883980
The 3-in-1 labelling machine from Leitz is the ideal
solution for your labelling needs - just one machine
which replaces label printers, marking devices and label
UJGGVU6JGGCU[VQWUGWPKVOCMGUNCDGNEJCPIKPIUQ
easy: simply insert the cartridge and you’re done.
The machine’s versatility means there are countless
formats, up to 88mm wide and 2.7m long, while the
optional lithium-ion battery packs allows it to be used
anywhere (up to 12 hours). Incredibly fast, the device can
print up to 200 labels per minute.
• Print from your PC, Mac, iPad or iPhone and Android
• Connect via USB cable or Wi-Fi
• Free app and supports Apple AirPrint
• Cuts automatically to size
• Includes 88mm cartridge
• Manufacturer’s part 70010000
Type
Labelling Machine
554297
Battery Pack
Order code 1+
06-0537 23.45
530127
LabelWriter 450 Duo
LetraTag White Plastic Tape 12mm
Plastic tape for
use with the DYMO
LetraTag LT-100H
labelmaker.
• Black on white
• Tape size 12mm
(width) x 4m
(length)
• Manufacturer’s part
S0721610
Type
12mm Tape
722
A rechargeable battery pack from Leitz for fully mobile
RTKPVKPI1HHGTKPIWRVQJQWTUQHWUGQTNCDGNU
• 1WVRWVXQNVCIGEWTTGPV8#
• Battery capacity: 2405mAh
• #ODKGPVVGORGTCVWTG1RGTCVKQPCNVQŒ%5VQTCIG
-20 to 20°C
• Material: plastic ABS
• Dimensions: 51 x 112 x 129mm
• Weight: 0.5kg
• Manufacturer’s part 70020000
Type
Battery Pack
Order code 1+
06-1372 57.99
554298
Order code 1+
06-0539 4.49
530128
Scheduled orders
Rapid will store your order
FREE OF CHARGE and then deliver
the required amount along
with an individual invoice on your
specified dates.
Email your scheduled order and
required dates to:
education@rapidonline.com
Continuous Paper Tape White
Permanent Adhesive 88mm (W)
Packs of 4/5
Continuous adhesive
label cartridges
from Leitz, ideal for
shipping labels, spine
labels, lever arch
ƁNGUCPFYJCVGXGT
you need – even print
banners. The reels
measure 22m, and are available in different width sizes.
• White colour
• Displays how many labels remaining
• Easy to change cartridge - just snap-on
• Permanent adhesive
• Widths: 12/19/25/39/50/61/88mm
6GEJPKECNURGEKƁECVKQP
1TFGTEQFG
Manu. part
06-1373
70030001
06-1374
70040001
06-1375
70060001
06-1376
70070001
06-1377
70090001
06-1378
70100001
06-1379
70110001
Tel: 01206 751166 Fax: 01206 751188
Die-cut ad
labels from
designed f
label print
the need f
ink or tone
permanen
labels pro
quality tex
addressing
rate of 20
• White co
• Displays
• Easy to
• No wast
• Large o
6GEJPKECNURGE
1TFGTEQFG
06-1381
06-1382
06-1383
06-1384
Size
36 x 88mm
26 x 88mm
59 x 102mm
50 x 88mm
Requires 4 AA batteries (not included). For Rapid’s range of
batteries click here
Type
LT-100H
No matter what labelling or mailing job you have to
tackle, the DYMO® LabelWriter™ 450 Duo will get it
FQPGGCUKN[CPFGHƁEKGPVN[6JKUUOCTVDKVQHMKVECPTCVVNG
out impressive address labels, shipping labels, name
badges and a whole lot more, at speeds up to 71 labels
per minute. It can also print DYMO® D1 plastic labels
in a range of sizes and colours – perfect when you need
durable labels for computers, cabinets and so on.
• &;/1.CDGNvX5QHVYCTGGPCDNGU[QWVQETGCVGCPF
print address, folder and barcode labels, name badges
and more
• Prints up to 71 paper labels per minute
• 9QTMUHCUVGTVJCP&;/1.CDGN9TKVGT
• Uses thermal printing technology eliminating the need
for ink and toner cartridges
• Can create labels directly from text in Microsoft® Word,
'ZEGNŠ1WVNQQMŠCPFQVJGTRTQITCOOGU
• Built-in address book easily prints labels from your
contacts
• Quickly creates one-off labels with the QuickPrint
widget
Order code 1+
06-1371 99.99
Die-Cu
Packs
Size
22 x 88mm
22 x 61mm
22 x 50mm
22 x 39mm
22 x 25mm
22 x 19mm
22 x 12mm
Pack
4
5
5
5
5
5
5
Contin
Perma
Pack o
Continuou
label cart
from Leitz
cable orga
KFGPVKƁ[KPI
marking, w
whatever y
- for exam
outside of
with width
• Waterpr
• Easy to
• Cut labe
• Easy to
• Permane
• Colours:
• Availabl
For Leitz Ico
6GEJPKECNURGE
1TFGTEQFG
06-1385
06-1386
06-1387
06-1388
06-1389
06-1390
Size
Pack of 5
10 x 12mm
10 x 12mm
10 x 12mm
Pack of 4
10 x 88mm
10 x 88mm
10 x 88mm
Stationery 723
Size
22 x 88mm
22 x 61mm
22 x 50mm
22 x 39mm
22 x 25mm
22 x 19mm
22 x 12mm
Pack
4
5
5
5
5
5
5
Order code
06-1373
06-1374
06-1375
06-1376
06-1377
06-1378
06-1379
• Not suitable for printing barcodes
• Shading, underlining and boxing styles
• Runs on 6 AA batteries
Card Stock White Non-Adhesive 22m • Manufacturer’s part KL-120
1+
42.95
44.95
41.95
39.95
37.49
36.95
34.95
Packs of 4/5
554299
ndroid
6GEJPKECNURGEKƁECVKQP
1TFGTEQFG
Manu part
06-1381
70120001
06-1382
70170001
06-1383
70130001
06-1384
70180001
Size
36 x 88mm
26 x 88mm
59 x 102mm
50 x 88mm
Labels
600
690
225
435
Size
36 x 88mm
26 x 88mm
59 x 102mm
50 x 88mm
Order code
06-1381
06-1382
06-1383
06-1384
1+
41.96
41.96
52.49
41.96
554300
y mobile
NCDGNU
5VQTCIG
554298
W)
dth sizes.
Continuous Plastic Tape White
Permanent Adhesive 10mx12mm
Pack of 5
Continuous adhesive
label cartridges
from Leitz, ideal for
cable organisation,
KFGPVKƁ[KPIRTQRGTV[
marking, warnings or
whatever you need
- for example, the
outside of a handwash bottle. The reels measure 10m,
with widths of either 12mm or 80mm.
• Waterproof and UV-resistant
• Easy to peel off
• Cut labels to length required
• Easy to change cartridge
• Permanent adhesive
• Colours: white, red or yellow
• Available in packs of 4 or 5
For Leitz Icon label printers. 100% recyclable.
6GEJPKECNURGEKƁECVKQP
1TFGTEQFG
Manu. part
06-1385
70150001
06-1386
70150015
06-1387
70150025
06-1388
70160001
06-1389
70160015
06-1390
70160025
Size
Pack of 5
10 x 12mm
10 x 12mm
10 x 12mm
Pack of 4
10 x 88mm
10 x 88mm
10 x 88mm
Size
10 x 12mm
10 x 12mm
10 x 12mm
10 x 88mm
10 x 88mm
10 x 88mm
Colour
White
Yellow
Red
White
Yellow
Red
Colour
Order code
White
Yellow
Red
06-1385
06-1386
06-1387
39.95
39.95
39.95
White
Yellow
Red
06-1388
06-1389
06-1390
49.99
49.99
49.99
517694
KL 7400 Label Printer
For Leitz Icon label printers. 100% recyclable.
6GEJPKECNURGEKƁECVKQP
1TFGTEQFG
Manu. part
06-1391
70190001
06-1392
70050001
06-1393
70080001
Size
22m x 91mm
22m x 57mm
22m x 32mm
Pack
4
5
5
Size
22m x 91mm
22m x 57mm
22m x 32mm
Pack
4
5
5
Order code 1+
06-1391 42.99
06-1392 42.45
06-1393 39.95
554303
KL-60 Label Printer
Labels
600
690
225
435
The Casio KL-60
label printer
provides a quick
and easy solution
to label printing in
industry, education
and sales
environments.
• QWERTY
keyboard for
easy entry
• *KIJFGƁPKVKQPUOWFIGTGUKUVCPVNCDGNU
• Self-adhesive label backing
• Up to 2 lines of text
• Choice of 6 character sizes
• 3 text effects: shade, underline and box
• 6, 9 and 12mm wide tapes (tapes are 8m long)
• Up to 63 characters can be stored for instant recall
when required
• 4-character LCD display
• Automatic power-off
• Wide range of coloured vinyl tapes available, please
see below
• Supplied with comprehensive instructions and 9mm
black-on-white tape
• Dimensions 168 x 114 x 51.5mm
• Weight, excluding batteries: 300g
Requires 6x AA alkaline batteries (not included).
Type
KL-60 Label printer
Order code 1+
19-1850 15.99
061817
KL 120 Label Printer
Pack
5
5
5
4
4
4
1+
554302
Phone
01206 751166
Order code 1+
19-1964 23.49
The Casio KL-120 label printer is just the job when
you need labels for use in the school, at home or in
VJGQHƁEG6JGUVWTFKN[DWKNVDWVEQORCEV-.JCU
a 16-digit, 2-line LCD and can print in 4 different type
sizes.
• Qwerty keyboard
• Print resolution 200 dpi
• Prints at 6 mm per second (approx)
• 4 print sizes - 18mm, 12mm, 9mm and 6mm
• Prints currency symbols
• Character matrix 16 x 16 dot
• Single sans serif font
6JGXGTUCVKNG-..CDGN2TKPVGTECPRTQFWEGƁXG
fonts, 20 character sizes and has 60 pre-installed logos
with text and icons enabling you to produce professional
labels and barcodes in next to no time.
• Maximum of 3 print lines and 20 character sizes (1x1
to 4x4)
• Produce your own high quality barcodes (EAN-8 and
EAN-13)
• 60 pre-installed logos
• 5 fonts and various effects and expressions preinstalled
• Produces labels with a resolution of 200dpi
• High-resolution display with 4 lines with 16 characters
• Uses EZ label cartridges in 6, 9, 12, 18 & 24mm
widths
• Casio model KL-7400
17
Stationery
554297
Die-cut adhesive
labels from Leitz
designed for quick
label printing, without
the need for messy
ink or toner. The
permanent adhesive
labels produce a high
quality text and come in two sizes, making them ideal for
addressing or shipping requirements. Can be printed at a
rate of 200 per minute.
• White colour
• Displays how many labels remaining
• Easy to change cartridge - just snap-on
• No wasting or jamming an entire sheet
• Large or small size
Type
KL 120
63
248
1 x XR-12WE2 cartridge
49 mm
168 mm
114 mm
300 g
Education
ideal
hine
nd label
IKPIUQ
e.
less
e the
e used
device can
Die-Cut White Adhesive Labels
Packs of 4/5 - Small/Large
6GEJPKECNURGEKƁECVKQP
Character memory
Number of characters
Tape (included)
Height
Width
Depth
Weight
Continuous card
label cartridges
from Leitz, ideal for
multipurpose labelling
tasks such as name
badges, appointment
cards and more. The
reels measure 22m,
with various widths, and come in packs of 4 or 5.
• White colour
• Cut cards to length required
• Easy to change cartridge
• Non-adhesive
Uses AC adaptor, supplied, or 8x AA batteries, not included.
6GEJPKECNURGEKƁECVKQP
Model
Keyboard layout
Display
KL-7400
QWERTY
128 x 64 dots
16 digits x 3 lines
Usable tape widths (mm)
6, 9, 12, 18, 24mm
Printing resolution
FRKFQVU
Unit of length switching
EOKPEJGU
2TKPVKPIURGGF
OOUGE
10
Maximum printing height (mm)
12
Maximum printing lines
6
Fonts
Sans-serif
Sans-serif italic
Sans-serif rounded
Roman
Roman italic
Character styles
0QTOCN$QNF1WVNKPG5JCFQY4CKUGF
Character effects
5JCFKPI7PFGTNKPG$QZ
Built-in character types
680
Alphanumeric characters
62
5RGEKCNEJCTCEVGTUU[ODQNU
395
Illustrations
124
Countries’ characters
99
Frame printing
65
Print preview
Yes
Tape length setting
05
Layouts according to use
24
Mirror printing
Yes
Printing direction
*QTK\QPVCN8GTVKECN
Printing number setting
100
Design logos
60
Numbering
Yes
Barcode printing
Yes
Languages supported
14 *1
Message switching
6 languages *2
Print job memories
127 characters x 10
Copy and paste
127 characters x 1
Auto power off
Yes
Maximum characters per input data
127
Power supply
AC adaptor AD-A12150L (included)
or 8 x AA-size alkaline (LR6) batteries
(sold separately)
Approximate battery life *3
2 rolls
Dimensions *4: H x W x D (mm)
64.5 x 202 x 216
Approximate weight (g) *5
800g
Bundled tape cartridge
12mm x 1
'PINKUJ5RCPKUJ(TGPEJ2QTVWIWGUG%\GEJ2QNKUJ*WPICTKCP)GTOCP
+VCNKCP&WVEJ(KPPKUJ5YGFKUJ&CPKUJ0QTYGIKCP
'PINKUJ5RCPKUJ(TGPEJ)GTOCP+VCNKCP5YGFKUJ
*3 Continuous printing
*4 The height dimension includes the feet.
*5 Not including batteries
Type
KL 7400 Label Printer
Order code 1+
19-1966 69.95
www.rapidonline.com sales@rapidonline.com
517695
723
724 Stationery
Bins for Recycling
EZ-Label Tape Cartridges
Education
A wide range of coloured EZlabel vinyl tape cartridges for
use with Casio label printers.
• Available in 6, 9, 12, 18
and 24mm widths
• Cartridges contain 8m
of tape
• Please note that 18 &
24mm tapes cannot be
used with the model KL-60
printer
Stationery
17
Type
6mm Black on white
6mm Black on clear
6mm Black on yellow
9mm Black on white
9mm Black on clear
9mm Black on red
9mm Black on yellow
12mm Black on white
12mm Black on clear
12mm Black on yellow
18mm Black on white
18mm Black on yellow
18mm black on clear
24mm Black on white
24mm Black on yellow
Big Bins
Classroom Recycling Twin Bin
Price each
Order code 1+
19-1922 5.59
19-1924 5.59
19-1926 5.59
19-1930 5.99
19-1935 5.99
19-1940 5.99
19-1945 5.99
19-1866 6.99
19-1868 6.99
19-1870 6.99
19-1875 9.99
19-1890 9.99
19-1880 9.99
19-1968 11.99
19-1969 11.49
061819
Quick-laser Label System
6JKUEQORCEVTGE[ENKPIWPKVƁVUUPWIN[CICKPUVCYCNNQT
in a recess and can be used in the classroom, corridor or
anywhere rubbish is likely to accumulate.
• 8GT[JGCX[FWV[FQWDNGYCNNƂWVGFDQCTF
• 2 compartments e.g. for paper and standard waste
• Blank identity panels on lid for your own messages
• Four pre-printed labels
• Four labels for use with inkjet and laser printers
• Very low carbon footprint
• Made in UK from up to 80% recycled material
• Large 180 litre capacity (2x 90 litre)
• Patented ‘drop out base’ allows body of bin to be lifted
off full sacks avoiding high lifting
• 6TCPURCTGPVDKPNKPGTUCNNQYGCU[KFGPVKƁECVKQPQH
contents
• $KPUCTGUWRRNKGFƂCVRCEMGFHQTTGFWEGFUVQTCIGCPF
transport
• Strong re-useable bin liners are available separately
in rolls of 50
Type
Classroom twin bin
Roll of 50 bags
Order code 1+
34-6206 38.90
34-6216 30.99
High volume waste and recycling bins for use in
ENCUUTQQOUQHƁEGUGVE
• Very low carbon footprint
• Made in UK from up to 80% recycled material
• Large 160 litre capacity per bin
• 6TCPURCTGPVDKPNKPGTUCNNQYGCU[KFGPVKƁECVKQPQH
contents
• 5WRRNKGFƂCVRCEMGFHQTTGFWEGFUVQTCIGCPFVTCPURQTV
• Bins are supplied in packs of 5 (total capacity 800
litres)
• Strong re-useable bin liners are available separately
in rolls of 50
Type
Big bins pack of 5
Roll of 50 bags
Order code 1+
34-6210 54.99
34-6216 30.99
082576
Paper Recycling Bins
082574
A laser printable self-adhesive polyester sheet supplied
in A4 size for the easy production of labels, control
panels, warning labels and signs.
• Ideal for serial number and rating labels
• No dedicated printer required: The image is designed
QPC2%CPFVJGUJGGVURTKPVGFD[CP[QTFKPCT[QHƁEG
laser printer
• Designed to accept the former to give a high resolution
durable image
• A4 Polyester sheets, available in white, silver or yellow
CTGEQCVGFKPCJKIJRGTHQTOCPEGOQFKƁGFCET[NKE
adhesive
• Completed labels have a temperature rating of –40°
VQŒ%
• For added protection the printed sheets can be coated
YKVJUGNHCFJGUKXGQXGTNCOKPCVKPIƁNOUKPGKVJGTXKP[N
or polycarbonate.
• Supplied over-size as 250 x 300mm to aid lamination
• All label material is supplied in packs of 10 or 50
sheets
• 1XGTNCOKPCVKPIƁNOKUUWRRNKGFKP5 sheet packs
Type
Silver A4 label
White A4 label
Yellow A4 label
Red A4 label
Silver A4 label
White A4 label
Transparent A4 label
1XGTNCOƁNOVTCPURCTGPV
1XGTNCOƁNOOCVV
#RRNKECVKQPƂWKF
Applicator
Qty
10
10
10
10
50
50
50
5
5
500ml
1
Order code
37-1780
37-1782
37-1784
37-1785
37-1786
37-1788
37-1792
37-1720
37-1725
37-1755
37-1745
1+
28.27
28.27
35.34
35.34
131.29
131.29
126.20
8.49
7.79
9.99
2.95
064793
No minimum order value
UK mainland only
724
School Vending Recycling Bin
This compact 3-bin unit offers low-cost entry into waste
recycling.
• 8GT[JGCX[FWV[FQWDNGYCNNƂWVGFDQCTFYKVJ78
varnished, wipe-clean lid
• 3 compartments for cans, plastic bottles and plastic
cups
• Ideal for placing near vending machines and tuck
shops
• Very low carbon footprint
• Made in UK from up to 80% recycled material
• Large 180 litre capacity (3x 60 litre)
• Patented ‘drop out base’ allows body of bins to be
lifted off full sacks avoiding high lifting
• 6TCPURCTGPVDKPNKPGTUCNNQYGCU[KFGPVKƁECVKQPQH
contents
• $KPUCTGUWRRNKGFƂCVRCEMGFHQTTGFWEGFUVQTCIGCPF
transport
• Strong re-useable bin liners are available separately
in rolls of 50
Type
School recycling bin
Order code 1+
34-6208 38.82
High volume paper recycling bins for use in classrooms,
QHƁEGUGVE
• Very low carbon footprint
• Made in UK from up to 80% recycled material
• Large 60 litre capacity per bin
• 6TCPURCTGPVDKPNKPGTUCNNQYGCU[KFGPVKƁECVKQPQH
contents
• 5WRRNKGFƂCVRCEMGFHQTTGFWEGFUVQTCIGCPFVTCPURQTV
• Bins are supplied in packs of 5 (total capacity 300
litres)
Type
Paper bins pack of 5
Order code 1+
34-6212 42.99
082577
Spending BIG?
Become a key account
holder with special terms
& volume pricing
www.rapidonline.com/
bulk
082575
Tel: 01206 751166 Fax: 01206 751188
Was this manual useful for you? yes no
Thank you for your participation!

* Your assessment is very important for improving the work of artificial intelligence, which forms the content of this project

Download PDF

advertising