104258 101A
AIT LoaderXpress™
By Overland Data, Inc
Models
%-80408&
%-80406&
Installation and User Manual
P/N 104258-101
Revision A - August 2001
4VSTVMIXEV]2SXMGI
All information contained in or disclosed by this document is considered proprietary by Overland Data. By accepting this
material the recipient agrees that this material and the information contained therein are held in confidence and in trust and
will not be used, reproduced in whole or in part, nor its contents revealed to others, except to meet the purpose for which it
was delivered. It is understood that no right is conveyed to reproduce or have reproduced any item herein disclosed without
express permission from Overland Data.
Overland Data provides this manual as is, without warranty of any kind, either expressed or implied, including, but not limited to, the implied warranties of merchantability and fitness for a particular purpose. Overland Data may make improvements or changes in the product(s) or programs described in this manual at any time. These changes will be incorporated in
new editions of this publication.
Overland Data assumes no responsibility for the accuracy, completeness, sufficiency, or usefulness of this manual, nor for
any problem that might arise from the use of the information in this manual.
Worldwide
Headquarters
Sales
Technical Support
Overland Data, EMEA
Overland Data, Inc.
8975 Balboa Avenue
San Diego, CA 92123-1599
Toll Free: (800) 729-8725
Tel: (858) 571-5555
Fax: (858) 571-3664
Tel: (858) 571-5555
Fax: (858) 571-3664
E-mail: [email protected]
www.overlanddata.com
Tel: (858) 571-5555
Fax: (858) 571-3664
E-mail: [email protected]
Overland House, Ashville Way
Wokingham, Berkshire
RG41 2PL, England
Tel: +44 (0) 118-9898000
Fax: +44 (0) 118-9891897
www.overlanddata.com
AIT LoaderXpress
Preface
4YVTSWISJ8LMW1ERYEP
This manual provides step-by-step installation instructions, and information required
for ongoing use and maintenance of the AIT LoaderXpress tape drive system by
Overland Data, Inc. This manual is written for the installer and user of this
equipment.
3VKERM^EXMSR
The following information is contained in this manual:
'LETXIV
-RXVSHYGXMSR4VSZMHIWERMRXVSHYGXMSRXSXLI%-80SEHIV<TVIWWF]3ZIVPERH(EXE
EPSRK[MXLEFVMIJHIWGVMTXMSRSJXLIFIRIJMXWJIEXYVIWERHXETIGETEGMXMIWHVMZIW
ERHPMWXWXLIQSHIPWGSZIVIHMRXLMWQERYEP
'LETXIV
-RWXEPPEXMSR4VIWIRXWWXITF]WXITTVSGIHYVIWJSVYRTEGOMRKERHMRWXEPPMRKXLI
%-80SEHIV<TVIWWMRXIVJEGIGSRRIGXMSRWERHEHIWGVMTXMSRSJXLI0SEHIV<TVIWW %-8
GSRJMKYVEXMSRSTXMSRW
'LETXIV
3TIVEXMSR(IWGVMFIWJVSRXTERIPSTIVEXMSRWJSVXLI%-80SEHIV<TVIWWEPSRK[MXL
MRWIVXMRKERHVIQSZMRKXETIGEVXVMHKIWERHXETIVIUYMVIQIRXW
'LETXIV
1EMRXIRERGI(IWGVMFIWTVSGIHYVIWJSVYWMRKERHWXSVMRKXLIGPIERMRK
GEVXVMHKI[MXLXLI%-80SEHIV<TVIWWVIUYMVIHWPSXPSGEXMSREPSRK[MXLVYRRMRK
XLIGPIERMRKGEVXVMHKIJVSQXLIJVSRXTERIPERHXLI%YXS'PIERQSHI
'LETXIV
8VSYFPIWLSSXMRK4VSZMHIWTVSFPIQHMEKRSWMWIVVSVVIGSZIV]TVSGIHYVIWERH
*EYPX7]QTXSQ'SHIWXSEMHMRXVSYFPIWLSSXMRKTSXIRXMEPIVVSVGSRHMXMSRW[MXL%-8
0SEHIV<TVIWW
%TTIRHM\%
7TIGMJMGEXMSRW'SRXEMRW%-80SEHIV<TVIWWERH)1-GSQTPMERGIMRJSVQEXMSR
%TTIRHM\&
7TEVIWERH%GGIWWSVMIW'SRXEMRWEPMWXSJ%-80SEHIV<TVIWWWTEVITEVXWERH
EGGIWWSVMIW
AIT LoaderXpress
i
ii
AIT LoaderXpress
Table of Contents
Purpose of This Manual ........................................................... -i
Organization ...................................................................... -i
Chapter 1 - Introduction
Models .................................................................................. 1-1
Table 1-1 AIT LoaderXpress Features..................... 1-1
Table 1-2 AIT LoaderXpress Models ...................... 1-2
Figure 1-1 Model Number Breakdown.................... 1-2
Mail Slot ............................................................................... 1-2
SCSI Interface ....................................................................... 1-3
Multi-Server Data Sharing ............................................. 1-3
Configurations ................................................................ 1-4
SCSI Bus Performance Considerations ................................ 1-4
Drives ............................................................................. 1-4
Data Transfer Rate ......................................................... 1-4
Internal Cabling Configuration ...................................... 1-5
Bus Length Limitations .................................................. 1-5
Physical Configuration ................................................... 1-5
Shuttle Lockdown Mechanism ....................................... 1-5
Features .......................................................................... 1-6
Figure 1-2 AIT LoaderXpress Front View .............. 1-6
Control Panel .................................................................. 1-6
Display ........................................................................... 1-6
Power Supply ................................................................. 1-7
Tape Cartridge Magazine ............................................... 1-7
Figure 1-3 Cartridge Magazine ................................ 1-7
Integral Fan Cooling ....................................................... 1-8
Robotics .......................................................................... 1-8
Bar Code Reader ............................................................ 1-8
Advanced Design Features ................................................... 1-9
Embedded Diagnostics ................................................... 1-9
AIT LoaderXpress
iii
Table of Contents (Cont’d)
Error Checking ............................................................... 1-9
Buffer ............................................................................. 1-9
Compression ................................................................... 1-9
Capacity ........................................................................ 1-10
Table 1-3 Capacity ................................................. 1-10
Media Life .................................................................... 1-10
Chapter 2 - Installation
Unpacking ............................................................................. 2-1
Releasing the Lockdown Mechanism ................................... 2-2
Figure 2-1 Lockdown Screw.................................... 2-2
To release the Lockdown Mechanism ............................ 2-3
Figure 2-2 Releasing the Lockdown Screw ............. 2-3
To lock the Lockdown Mechanism ................................ 2-3
Figure 2-3 Locking the Lockdown Screw................ 2-4
Setting Up the Desktop Model .............................................. 2-4
Setting Up the Rack Mount Model ....................................... 2-5
Precaution ....................................................................... 2-5
Remove Tabletop Cover ................................................. 2-6
Figure 2-4 Removing Desktop Cover ...................... 2-6
Install Top Cover ............................................................ 2-7
Figure 2-5 Installing The Top Cover ....................... 2-7
Install The Rack Slides ................................................... 2-8
Figure 2-6 Rack Slide Parts ..................................... 2-8
Figure 2-7 Attaching Rack Slides ............................ 2-9
Install the Panel Extensions ............................................ 2-9
Figure 2-8 Panel Extension Attachment .................. 2-9
Installing Unit Into A Rack .......................................... 2-10
Figure 2-9 Lock Tab .............................................. 2-11
Figure 2-10 Sliding Module In Rack ..................... 2-12
Figure 2-11 Module In Rack.................................. 2-13
iv
AIT LoaderXpress
Table of Contents (Cont’d)
Cabling ................................................................................ 2-14
Figure 2-12 Connectors, SCSI Terminator & Cables2-14
Attach the AC Power Cord ........................................... 2-15
Attach Cables To SCSI Connectors ............................. 2-15
Interface Cable Specifications ...................................... 2-16
Configuring the AIT LoaderXpress ............................. 2-17
Configuration Example: Setting the SCSI ID .............. 2-17
Figure 2-13 Primary Default Screen ...................... 2-17
Figure 2-14 Secondary Default Screen .................. 2-18
Figure 2-15 Main Menu ......................................... 2-18
Figure 2-16 Configure Submenu............................ 2-18
Figure 2-17 SCSI Options Submenu...................... 2-18
Figure 2-18 SCSI Options Submenu...................... 2-19
Setting Up Reserved Slots ............................................ 2-20
Reserved Slot Numbering ........................................ 2-20
Figure 2-19 Reserved Slot Numbering .................. 2-20
Reserving Slots ........................................................ 2-21
Figure 2-20 Main Menu ......................................... 2-21
Figure 2-21 Configure Submenu............................ 2-21
Figure 2-22 Library Options Submenu .................. 2-21
Figure 2-23 Reserved Slots Submenu.................... 2-21
Configuration Options Description ..................................... 2-22
SCSI Options ................................................................ 2-22
Library Options ....................................................... 2-24
Barcode Options ...................................................... 2-25
Set Element Base ..................................................... 2-25
Set Serial Number .................................................... 2-26
Set Default ............................................................... 2-26
Table 2-1 AIT LoaderXpress SCSI Options .......... 2-26
Table 2-2 AIT LoaderXpress Library Options ...... 2-27
Table 2-3 AIT LoaderXpress Barcode Options ..... 2-27
AIT LoaderXpress
v
Table of Contents (Cont’d)
Table 2-4 AIT LoaderXpress
Set Element Base Options...................................... 2-28
Table 2-5 AIT LoaderXpress
Set Serial Number Option ...................................... 2-28
Table 2-6 AIT LoaderXpress Set Default Option .. 2-28
Chapter 3 - Operation
Front Panel ............................................................................ 3-1
Figure 3-1 AIT LoaderXpress1 Front Panel ............ 3-1
Power Switch .................................................................. 3-1
Buttons and Indicators .................................................... 3-2
Figure 3-2 Buttons & Indicators .............................. 3-2
Buttons ....................................................................... 3-2
LED Indicators .......................................................... 3-3
Front Panel & Media Locks ........................................... 3-5
Startup Display Messages .......................................... 3-5
Power-On Self Test Screen ....................................... 3-5
Power-On Self Test (POST) Screen .......................... 3-6
Figure 3-3 POST Screen .......................................... 3-6
Initialization Screens ................................................. 3-6
Figure 3-4 Initialization Screen................................ 3-6
Default Screen ........................................................... 3-7
Figure 3-5 Default Screens ...................................... 3-7
Fault Screen ............................................................... 3-8
Figure 3-6 Fault Screen............................................ 3-8
Using AIT LoaderXpress Menus .......................................... 3-9
Figure 3-7 AIT LoaderXpress Menu ....................... 3-9
vi
AIT LoaderXpress
Table of Contents (Cont’d)
Using the Status Mode ................................................. 3-10
Figure 3-8 Status Menu.......................................... 3-10
Exiting the Status Mode .......................................... 3-10
Exploring the Status Mode ...................................... 3-10
Library Status .......................................................... 3-11
Figure 3-9 Library Status Menu............................. 3-11
Drive Status ............................................................. 3-12
Figure 3-10 Status Menu........................................ 3-12
Figure 3-11 Drive Status Menu.............................. 3-12
Map Information Screen .......................................... 3-13
Figure 3-12 Map Info Submenu............................. 3-13
Using the Menu Mode .................................................. 3-14
Figure 3-13 Main Menu ......................................... 3-14
Figure 3-14 Panel Locked Screen .......................... 3-14
Figure 3-15 Code Entry Submenu ......................... 3-14
Exiting The Menu Mode ......................................... 3-15
Navigating In Menu Structure ................................. 3-15
Load/Unload Menu ...................................................... 3-16
Remove Magazine Menu ............................................. 3-16
Maintenance Menu ....................................................... 3-16
Configure Menu ........................................................... 3-16
Security Menu .............................................................. 3-17
Figure 3-16 Security Menu .................................... 3-17
Figure 3-17 Code Select Submenu......................... 3-17
Figure 3-18 Code Accept Submenu ....................... 3-18
Figure 3-19 Panel Locked Screen .......................... 3-18
Figure 3-20 Code Entry Submenu ......................... 3-18
Figure 3-21 Code Validate Submenu..................... 3-19
AIT LoaderXpress
vii
Table of Contents (Cont’d)
Loading and Unloading ................................................ 3-19
Figure 3-22 Default Screen .................................... 3-19
Figure 3-23 Main Menu ......................................... 3-19
Figure 3-24 Load/Unload Initial Screen ................ 3-20
Initial Screen - From Line ....................................... 3-20
Initial Screen - To Line ............................................ 3-20
Scroll List - To Line ................................................ 3-21
Figure 3-25 Load/Unload From Entry Screen ....... 3-21
Figure 3-26 Load/Unload To Entry Screen............ 3-21
Figure 3-27 Load/Unload To Entry Screen............ 3-21
Figure 3-28 Load/Unload In Progress Screen........ 3-22
Inserting and Removing Cartridges .............................. 3-22
Removing the Magazine ............................................... 3-23
Figure 3-29 Magazine In Place .............................. 3-23
Inserting Cartridges into the Magazine ........................ 3-24
Figure 3-30 Tape Magazine
With Cartridges Installed ....................................... 3-24
Inserting the Magazine ................................................. 3-24
Using the Mail Slot ...................................................... 3-25
Figure 3-31 Mail Slot Location.............................. 3-25
Tape Cartridge Requirements ....................................... 3-25
Handling and Storing ............................................... 3-25
Write Protecting Cartridges ..................................... 3-26
Figure 3-32 Tape Cartridge Write Protection Switch3-26
Barcode Labels ............................................................. 3-27
Figure 3-33 Barcode Label .................................... 3-27
viii
AIT LoaderXpress
Table of Contents (Cont’d)
Chapter 4 - Maintenance
Introduction ........................................................................... 4-1
Running A Cleaning Cartridge ............................................. 4-1
Automatically ................................................................. 4-1
Running A Cleaning Cartridge Using Auto Clean .... 4-2
Manually ......................................................................... 4-2
Running A Cleaning Cartridge Manually .................. 4-2
Figure 4-1 Main Menu ............................................. 4-2
Figure 4-2 Maintenance Submenu ........................... 4-3
Figure 4-3 Cleaning Submenu ................................. 4-3
Figure 4-4 Cleaning Confirmation Screen ............... 4-3
Figure 4-5 Cleaning In Progress Screen .................. 4-4
Removing the Cleaning Cartridge .................................. 4-4
Using the Demo Submenu .............................................. 4-4
Pausing Demo 1 ......................................................... 4-5
Stopping Demo 1 ....................................................... 4-5
Chapter 5 - Troubleshooting
Introduction ........................................................................... 5-1
Platform Problems ................................................................ 5-1
General Drive Errors ............................................................. 5-1
Error Recovery ...................................................................... 5-2
Figure 5-1 Troubleshooting Flow Chart .................. 5-2
Error Recovery Procedures (ERP) ................................. 5-3
Table 5-1 Error Recovery Procedures...................... 5-3
Fault Symptom Codes (FSC) ......................................... 5-3
Table 5-2 Fault System Codes ................................. 5-3
AIT LoaderXpress
ix
Table of Contents (Cont’d)
Appendix A - Specifications
Table A-1 Operational Performance ....................... A-1
Table A-2 Reliability (Drives) ................................ A-2
Table A-3 Reliability (Library Robotics)................ A-2
Table A-4 Power ..................................................... A-2
Table A-5 Mechanical............................................. A-3
Table A-6 Environmental........................................ A-3
Acoustic Emissions ....................................................... A-5
Safety ........................................................................ A-5
Table A-7 Acoustic ................................................. A-5
Table A-8 Regulatory Agency Certifications ......... A-5
Electromagnetic Emissions ........................................... A-6
Notice ....................................................................... A-6
Industry Canada ........................................................ A-6
Industrie Canada ....................................................... A-6
FCC Notice ............................................................... A-6
Appendix B - Spares and Accessories
Table B-1 AIT LoaderXpress™
Spares and Accessories ............................................B-1
x
AIT LoaderXpress
List of Figures
Chapter 1 Introduction
Figure 1-1 Model Number Breakdown............................ 1-2
Figure 1-2 AIT LoaderXpress Front View ...................... 1-6
Figure 1-3 Cartridge Magazine........................................ 1-7
Chapter 2 Installation
Figure 2-1 Lockdown Screw............................................ 2-2
Figure 2-2 Releasing the Lockdown Screw ..................... 2-3
Figure 2-3 Locking the Lockdown Screw ....................... 2-4
Figure 2-4 Removing Desktop Cover .............................. 2-6
Figure 2-5 Installing The Top Cover ............................... 2-7
Figure 2-6 Rack Slide Parts ............................................. 2-8
Figure 2-7 Attaching Rack Slides .................................... 2-9
Figure 2-8 Panel Extension Attachment .......................... 2-9
Figure 2-9 Lock Tab ...................................................... 2-11
Figure 2-10 Sliding Module In Rack ............................. 2-12
Figure 2-11 Module In Rack.......................................... 2-13
Figure 2-12 Connectors, SCSI Terminator & Cables .... 2-14
Figure 2-13 Primary Default Screen .............................. 2-17
Figure 2-14 Secondary Default Screen .......................... 2-18
Figure 2-15 Main Menu ................................................. 2-18
Figure 2-16 Configure Submenu ................................... 2-18
Figure 2-17 SCSI Options Submenu ............................. 2-18
Figure 2-18 SCSI Options Submenu ............................. 2-19
Figure 2-19 Reserved Slot Numbering .......................... 2-20
Figure 2-20 Main Menu ................................................. 2-21
Figure 2-21 Configure Submenu ................................... 2-21
Figure 2-22 Library Options Submenu .......................... 2-21
Figure 2-23 Reserved Slots Submenu............................ 2-21
AIT LoaderXpress
xix
List of Figures (Cont’d)
Chapter 3 Operation
Figure 3-1 AIT LoaderXpress1 Front Panel .................... 3-1
Figure 3-2 Buttons & Indicators ...................................... 3-2
Figure 3-3 POST Screen .................................................. 3-6
Figure 3-4 Initialization Screen ....................................... 3-6
Figure 3-5 Default Screens .............................................. 3-7
Figure 3-6 Fault Screen.................................................... 3-8
Figure 3-7 AIT LoaderXpress Menu ............................... 3-9
Figure 3-8 Status Menu.................................................. 3-10
Figure 3-9 Library Status Menu..................................... 3-11
Figure 3-10 Status Menu................................................ 3-12
Figure 3-11 Drive Status Menu ..................................... 3-12
Figure 3-12 Map Info Submenu..................................... 3-13
Figure 3-13 Main Menu ................................................. 3-14
Figure 3-14 Panel Locked Screen .................................. 3-14
Figure 3-15 Code Entry Submenu ................................. 3-14
Figure 3-16 Security Menu ............................................ 3-17
Figure 3-17 Code Select Submenu ................................ 3-17
Figure 3-18 Code Accept Submenu............................... 3-18
Figure 3-19 Panel Locked Screen .................................. 3-18
Figure 3-20 Code Entry Submenu ................................. 3-18
Figure 3-21 Code Validate Submenu............................. 3-19
Figure 3-22 Default Screen............................................ 3-19
Figure 3-23 Main Menu ................................................. 3-19
Figure 3-24 Load/Unload Initial Screen ........................ 3-20
Figure 3-25 Load/Unload From Entry Screen ............... 3-21
Figure 3-26 Load/Unload To Entry Screen ................... 3-21
Figure 3-27 Load/Unload To Entry Screen ................... 3-21
Figure 3-28 Load/Unload In Progress Screen................ 3-22
Figure 3-29 Magazine In Place ...................................... 3-23
Figure 3-30 Tape Magazine With Cartridges Installed . 3-24
xx
AIT LoaderXpress
List of Figures (Cont’d)
Figure 3-31 Mail Slot Location ..................................... 3-25
Figure 3-32 Tape Cartridge Write Protection Switch .... 3-26
Figure 3-33 Barcode Label ............................................ 3-27
Chapter 4 Maintenance
Figure 4-1 Main Menu ..................................................... 4-2
Figure 4-2 Maintenance Submenu ................................... 4-3
Figure 4-3 Cleaning Submenu ......................................... 4-3
Figure 4-4 Cleaning Confirmation Screen....................... 4-3
Figure 4-5 Cleaning In Progress Screen .......................... 4-4
Chapter 5 Troubleshooting
Figure 5-1 Troubleshooting Flow Chart .......................... 5-2
AIT LoaderXpress
xxi
xxii
AIT LoaderXpress
List of Tables
Chapter 1 - Introduction
Table 1-1 AIT LoaderXpress Features .................................. 1-1
Table 1-2 AIT LoaderXpress Models .................................... 1-2
Table 1-3 Capacity............................................................... 1-10
Chapter 2 - Installation
Table 2-1 AIT LoaderXpress SCSI Options........................ 2-26
Table 2-2 AIT LoaderXpress Library Options .................... 2-27
Table 2-3 AIT LoaderXpress Barcode Options ................... 2-27
Table 2-4 AIT LoaderXpress Set Element Base Options .... 2-28
Table 2-5 AIT LoaderXpress Set Serial Number Option .... 2-28
Table 2-6 AIT LoaderXpress Set Default Option................ 2-28
Chapter 5 - Troubleshooting
Table 5-1 Error Recovery Procedures ................................... 5-3
Table 5-2 Fault System Codes ............................................... 5-3
Appendix A - Specifications
Table A-1 Operational Performance..................................... A-1
Table A-2 Reliability (Drives) .............................................. A-2
Table A-3 Reliability (Library Robotics) ............................. A-2
Table A-4 Power ................................................................... A-2
Table A-5 Mechanical .......................................................... A-3
Table A-6 Environmental ..................................................... A-3
Table A-7 Acoustic ............................................................... A-5
Table A-8 Regulatory Agency Certifications ....................... A-5
Appendix B - Spares and Accessories
Table B-1 AIT LoaderXpress™ Spares and Accessories......B-1
AIT LoaderXpress
xxiii
xxiv
AIT LoaderXpress
'LETXIV-RXVSHYGXMSR
The AIT LoaderXpres™ by Overland Data, Inc. is a tape autoloader combining
Advanced Intelligent Tape™ (AIT) drive technology with advanced robotics.
Designed for high duty-cycle online and near online applications, such as hierarchical
storage management, it is a superior performer in high-volume backup and archival
service.
The AIT LoaderXpress can be equipped with one or two tape drives, and has a 19-slot
tape cartridge magazine, with a mail slot.
1SHIPW
AIT LoaderXpress features and model configurations are listed in Table 1-1 and
Table 1-2.
8EFPI%-80SEHIV<TVIWW*IEXYVIW
'SQTSRIRX
%-88ETI(VMZI
1IHME7PSXW
1EMP7PSX
7'7--RXIVJEGI
0:(
2YQFIVSJ(VMZIW
SV7SR]7(<
0:(%-8HVMZIW
8ETI'EVXVMHKIWQQ
SV+&REXMZI
1SYRXMRK
8EFPIXSTSV
6EGOQSYRX[MXL
GSRZIVWMSROMX
AIT LoaderXpress
1-1
INTRODUCTION
8EFPI%-80SEHIV<TVIWW1SHIPW
1SHIP2YQFIV
'SRJMKYVEXMSR
%-80408&
(VMZI%-88EFPIXST0:(7)7'7-
%-804061
(VMZI%-86EGOQSYRX0:(7)7'7-
LP1L119TB
Barcode Option:
B = Barcode Reader Included
Mounting Type:
T = Tabletop, R = Rackmount
Number of available cartridge slots
Number of Tape Drives Included:
1 or 2
SCSI Interface Type:
L = Low Voltage, H = High Voltage Differential
AIT Drive Technology Version:
1= AIT 1
LoaderXpress™ - AIT-1 Product Family
Figure 1-1. Model Number Breakdown
1EMP7PSX
If your host software permits, you can use the front slot in the magazine (the first
slot you see when you open the door) as a mail slot for inserting or removing a
single cartridge without interrupting host operations in progress. The mail slot is
implemented using the SCSI Import/Export commands.
1-2
AIT LoaderXpress
INTRODUCTION
7'7--RXIVJEGI
The AIT LoaderXpress unit presents the following to the host:
• A single SCSI medium changer device with a single SCSI Medium
Transport element
• A number of SCSI Storage elements equal to the total number of cartridge
magazine slots
• A single SCSI Import/Export element
• A number of SCSI Data Transfer elements equal to the total number of
drives in the system.
1YPXM7IVZIV(EXE7LEVMRK
A host computer with a SCSI controller connected to a bus is a SCSI Initiator. The AIT
LoaderXpress is a SCSI Target. SCSI rules permit multiple Initiators on a single bus.
Therefore, with the proper host software, it is possible to connect multiple hosts to a
single AIT LoaderXpress over a single SCSI bus. This allows multiple hosts to operate
the robotics, loading and unloading cartridges as each host requires.
In a system with many drives, it may be desirable to use multiple SCSI buses for the
drives so the data transfer rate of the drives is not limited by bus bandwidth. Individual
drives can be connected to separate hosts. Using special software, one of the hosts can
act as a master server, processing all robotics commands and permitting several hosts
to share a common database.
AIT LoaderXpress
1-3
INTRODUCTION
'SRJMKYVEXMSRW
The AIT LoaderXpress standard SCSI interface is:
• Ultra /Wide SCSI Low Voltage Differential (LVD)/Single-Ended (S/E)
The AIT LoaderXpress uses high-density 68-pin D-series connectors. For more
information see SCSI Interfaces in Chapter 2 - Installation.
7'7-&YW4IVJSVQERGI'SRWMHIVEXMSRW
(VMZIW
With a standard Ultra/Wide SCSI interface, the AIT-1 drive offers a sustained
native data transfer rate of 4 MB/sec (AIT 1) The rates for compressed data are the
native rates multiplied by the compression factor, which depends on file content,
but averages approximately 2:1.
(EXE8VERWJIV6EXI
The data transfer rate of theAIT LoaderXpress depends on the type of AIT drive,
the number of drives, and on how many drives are connected to the SCSI bus. The
robotics impose minimal loading on the bus.
• AIT-1 Ultra/Wide @ 20 MB/sec (burst)
• AIT-1 Sustained @ 4 MB/sec (native)
@ 8 MB/sec (compressed)
Each AIT-1 drive has a maximum sustained data transfer rate up to 8 MB/sec with
compressed data.
1-4
AIT LoaderXpress
INTRODUCTION
-RXIVREP'EFPMRK'SRJMKYVEXMSR
Each SCSI bus in theAIT LoaderXpress System is wired separately. The library
robotics and Drive 1 share one bus; Drive 2 is connected to a separate SCSI bus. SCSI
jumper cables are available to allow the drives and robotics of a module to be daisychained to a single SCSI bus. For more detailed information, see SCSI Interfaces in
Chapter 2 - Installation.
&YW0IRKXL0MQMXEXMSRW
If all devices and host adapter are LVD, length is 12 meters (1.5 meters in SE mode).
4L]WMGEP'SRJMKYVEXMSR
AIT LoaderXpress comes configured as a tabletop or rack-mount model. The tabletop
model can be later converted for rack-mount usage. To convert a tabletop AIT
LoaderXpress to a rack-mount model, order the Overland Tabletop to Rackmount
Conversion Kit (Part Number 106070-001).
7LYXXPI0SGOHS[R1IGLERMWQ
Overland Data has installed a shuttle lockdown mechanism as a precautionary safety
mechanism to prevent damage to the AIT LoaderXpress during shipment from the
factory. The mechanism is a spring-loaded screw in the back of the AIT LoaderXpress
that secures the shuttle to a bracket.
238)=SYQYWXVIPIEWIXLIWLYXXPIPSGOHS[RQIGLERMWQFIJSVITS[IVMRKYTXLI
YRMXSVMX[MPPRSXSTIVEXI7IIXLITVSGIHYVIMR'LETXIV-RWXEPPEXMSR
AIT LoaderXpress
1-5
INTRODUCTION
*IEXYVIW
This section describes and illustrates some of the external features of the AIT
LoaderXpress by Overland Data, Inc, including the control panel, power supply,
tape cartridge magazine and rear ports and connectors.
Control Panel
Lo ad e r Xpr
ess
Ready
U se
C lean
29(5/$1'
er
Dr ive
Fau lt
Lo ader
Fau lt
Escape
E nter
Magazine
Door
LXL-0022
Power Switch
Figure 1-2. AIT LoaderXpress Front View
'SRXVSP4ERIP
The control panel features a 4-line by 20-character backlit liquid crystal display,
four LED indicators and four buttons. The buttons enable the operator to navigate
through the menu structure to select and display operating modes, device status,
diagnostic and maintenance functions, device history and error statistics, and
system configuration. The control panel is described in detail in Chapter 3 Operation.
(MWTPE]
The backlit 4-line by 20-character control panel display provides a highly
intelligible presentation of drive and loader status, menu choices and error
messages. The scrolling feature greatly expands the amount of information
available to the operator.
1-6
AIT LoaderXpress
INTRODUCTION
4S[IV7YTTP]
The AC Power switch is located on the front panel of the module. The auto ranging
power supply adjusts automatically to either of two operating voltage ranges. The
ranges are 100-120 VAC and 200-240 VAC. The power supply is capable of operating
at 50 or 60 Hz without any adjustment or modification. AC power is supplied to the
power supply by a single IEC-compatible socket, which can be connected to any
properly grounded outlet.
8ETI'EVXVMHKI1EKE^MRI
The rugged polymer magazine, Figure 1-3 fits into an extruded track, which assures
precise positioning for the library robotics.
Figure 1-3. Cartridge Magazine
The front slot in the magazine is a Mail Slot, used to add or remove cartridges without
interrupting library operation. You can remove the magazine through the front door,
but it is protected from tampering in either of two ways:
• An electronic combination lock, operated from the control panel
• The host issuing a SCSI Prevent/Allow Medium Removal command.
For more information on inserting and removing the magazine, see Chapter 3 Operation.
AIT LoaderXpress
1-7
INTRODUCTION
-RXIKVEP*ER'SSPMRK
Each AIT drive contains a thermostat-controlled fan. In addition, a fan is mounted
inside the AIT LoaderXpress to prevent critical parts from overheating.
6SFSXMGW
The AIT LoaderXpress features Overland Data's Mainframe-Class™ Library
Robotics. These advanced robotics can load any of the cartridges stored in the
magazine into any of the tape drives.
&EV'SHI6IEHIV
A standard barcode reader is mounted on the cartridge shuttle. It reads barcode
labels attached to each cartridge, and maintains the barcode data in memory as part
of the library System Map.
1-8
AIT LoaderXpress
INTRODUCTION
%HZERGIH(IWMKR*IEXYVIW
)QFIHHIH(MEKRSWXMGW
The AIT LoaderXpress provides three levels of embedded diagnostics:
1) Power-On Self Test (POST ) - Performs various verification tests on the
system’s configuration, host interface and device control functions, as well
as memory tests when you power on the unit.
2) User Diagnostics - Allow you to display and change configuration options.
Select from front panel.
3) CE Diagnostics - Advanced diagnostics used by Customer Engineers for
servicing the AIT LoaderXpress. Select from front panel.
For more information on user diagnostics, see Chapter 2 - Installation.
)VVSV'LIGOMRK
The drives used in the AIT LoaderXpress use read while write data checking and errorcorrection code (ECC) technology such as is used in audio CD, DVD and laser discs.
&YJJIV
Drives are equipped with the following buffer size:
• AIT-1: 10MB
'SQTVIWWMSR
The drives used in the AIT LoaderXpress use the Adaptive Lossless Data Compression
(ALDC) data compression algorithm developed by IBM.
AIT LoaderXpress
1-9
INTRODUCTION
'ETEGMX]
The AIT LoaderXpress, with its 19-cartridge magazine, offers formatted
capacities as shown in Table 1-3.
.
8EFPI'ETEGMX]
1SHIP
2EXMZI'ETEGMX]
TIV'EVXVMHKI
4IV'EVXVMHKI
'SQTVIWWIH
*YPP1EKE^MRI
'SQTVIWWIH
%-8
+&SR
+&
+&
+&
+&
7(<'QIHME
+&SR
7(<'QIHME
1IHME0MJI
The media used in the AIT LoaderXpress is rated by the media manufacturer at
over 30,000 end-to-end passes, and a shelf life of at least 30 years.
1-10
AIT LoaderXpress
'LETXIV-RWXEPPEXMSR
This chapter describes installing the AIT LoaderXpress by Overland Data, Inc,
including:
• Unpacking
• Releasing the Lockdown Mechanism
• Setting up the Desktop Model
• Setting up the Rackmount Model
• Setting up Cables and Interfaces
• Configuring
9RTEGOMRK
Follow the directions in the shipping container to unpack the AIT LoaderXpress and
place it in the desired physical location. Save the packing materials for reuse in case
you need to ship it.
AIT LoaderXpress
2-1
INSTALLATION
6IPIEWMRKXLI0SGOHS[R1IGLERMWQ
If you haven’t done so, release the lockdown mechanism on the AIT
LoaderXpress, using the Lockdown Screw on the back of the unit.
0SGOHS[R
7GVI[
*MKYVI0SGOHS[R7GVI[
2-2
AIT LoaderXpress
INSTALLATION
8SVIPIEWIXLI0SGOHS[R1IGLERMWQ
238)=SYWLSYPHVIPIEWIXLI0SGOHS[R1IGLERMWQFIJSVITS[IVMRKYTXLI%-8
0SEHIV<TVIWW
1) Make sure that the power cord is disconnected from line power.
2) If necessary, reposition the unit for easier access to the back panel.
3) Turn the spring-loaded lockdown screw on the back counter-clockwise.
238)8LIWGVI[TSTWSYXERHXLIPSGOHS[RQIGLERMWQVIPIEWIWJVSQXLIWLYXXPI
4) Turn the power on.
8YVRPSGOHS[R
WGVI[
GSYRXIVGPSGO[MWI
XSVIPIEWIXLI
PSGOHS[R
QIGLERMWQ
*MKYVI6IPIEWMRKXLI0SGOHS[R7GVI[
8SPSGOXLI0SGOHS[R1IGLERMWQ
To lock the lockdown mechanism, do the following:
1) Park the shuttle assembly:
• From the Main Menu, select Maintenance Menu / Park.
238)8LIWLYXXPIEWWIQFP]QSZIWXSLSQITSWMXMSRFVMRKMRKXLIXLVIEHIHLSPIMRXS
EPMKRQIRX[MXLXLIPSGOHS[RWGVI[
AIT LoaderXpress
2-3
INSTALLATION
2) Turn off the unit.
3) Disconnect the power cord from line power.
4) If necessary, reposition the unit for easier access to the back panel.
5) Tightly secure the shuttle to the chassis.
6) Push in the spring-loaded lockdown screw on the back and turn it
clockwise.
238)8LMWWIGYVIWXLIWLYXXPIXSEFVEGOIXERHPSGOWMXMRTPEGI
8YVRPSGOHS[R
WGVI[GPSGO[MWI
XSWIXXLI
PSGOHS[R
QIGLERMWQ
*MKYVI0SGOMRKXLI0SGOHS[R7GVI[
7IXXMRK9TXLI(IWOXST1SHIP
The AIT LoaderXpress desktop model requires no mechanical assembly for
mounting. Place the unit on a desk, table, server top, or other stable, horizontal
surface. Make sure the cooling grilles at the rear of the unit are not obstructed.
Allow two inches of clearance behind the rear panel.
2-4
AIT LoaderXpress
INSTALLATION
7IXXMRK9TXLI6EGO1SYRX1SHIP
To convert a tabletop AIT LoaderXpress to a rack mount model, order the Overland
Tabletop to Rackmount Conversion Kit (Part Number 106070-001).
If your AIT LoaderXpress is already rack-mount configured, See “Installing Unit Into
A Rack”.
4VIGEYXMSR
If you do mount the AIT LoaderXpress in a rack, be sure to take the following
precaution:
'%98-328346):)288-44-2+2):)670-()13(90)73983*8,)6%'/73
8,%8136)8,%20&363*8,)838%06%'/;)-+,8-7)<8)2()(%8
%2=8-1)
:367-',&-88)&)%',8)2(%—;)22(-)0%9*;)67',-)2)2%97+)>3+)2
7-2()-2)>97â8>0-',)0%78:321),6%07()7+)78%00+);-',8)7
/+(-)78%&-0-8â8()7+)78%007+)*â,6()(
AIT LoaderXpress
2-5
INSTALLATION
6IQSZI8EFPIXST'SZIV
Before installing the tabletop AIT LoaderXpress module in a rack it must be
converted for use, using the Rack Mount Adapter Kit. First remove the tabletop
cover. Refer to Figure 2-4.
1) Remove the four screws (M4 x 8mm) that attach the cover to the sides
of the unit.
2) Slide the cover toward the rear until clear of the unit.
3) Save the hardware for re-use.
Read
y
U se
Cle an
er
D rive
F au lt
L oad
er
F au
lt
Escape
En te
r
*MKYVI6IQSZMRK(IWOXST'SZIV
2-6
AIT LoaderXpress
INSTALLATION
-RWXEPP8ST'SZIV
With the tabletop cover removed, you next need to install a sheet metal top cover that
protects the AIT LoaderXpress interior components when mounted in a rack. Refer to
Figure 2-5.
1) Place the top cover over the AIT LoaderXpress chassis top with each side
flange to the outside of the chassis.
2) Slide the cover forward until it is flush with the front panel.
3) Fasten the cover with two screws (4M x 8mm).
4) Remove the four rubber feet on the bottom of the AIT LoaderXpress.
7MHI*PERKIW
Rea dy
Use
C le an
er
Drive
Faul
t
Loade
F au lt
r
Escape
Enter
*MKYVI-RWXEPPMRK8LI8ST'SZIV
AIT LoaderXpress
2-7
INSTALLATION
-RWXEPP8LI6EGO7PMHIW
After you’ve attached the top cover, you attach rack slides to both sides of the
module using the procedure outlined below. You’ll attach each inner slide of the
rack slide assembly to the module enclosure first. You’ll fasten each outer slide to
the rack mount cabinet later.
238)8LIPIJXERHVMKLXWPMHIWEVIEPMOIWSXLIVIMWRSVMWOSJGSRJYWMRKXLITEVXWSR
VIEWWIQFP]
1) Study the following Figure 2-6 to identify the parts of the rack slide
assembly.
WGVI[W
0S[4VSJMPI
3YXIV7PMHI
-RXIVQIHMEXI7PMHI
2YX4PEXI
0SGO8EF
-RRIV7PMHI
EXXEGLXS
QSHYPI
1SYRXMRK
&VEGOIX
WGVI[W
2YX4PEXI
*MKYVI6EGO7PMHI4EVXW
2) Pull the outer slide toward the rear, along with the intermediate slide,
until the inner slide lock engages the intermediate slide.
3) Continue to pull the outer slide towards the rear until the outer slide
lock engages the intermediate slide. Press down on the inner slide lock
to permit the intermediate slide to continue to move toward the rear.
Continue to move the outer and intermediate slides toward the rear until
they are separated from the inner slide. Push the intermediate slide back
into the outer slide.
4) Remove the inner slide of the second rack slide following steps 2-3.
5) Place an inner slide flat against one side of the module. Match screw
holes in the slide to the three screw holes on the module chassis. The
inner slide lock must be toward the rear of the module.
2-8
AIT LoaderXpress
INSTALLATION
6) Use three M4x8mm screws to attach the inner slide to the side of the
module as shown in Figure 2-7.
1\7GVI[W
4IV7MHI
-RRIV7PMHI0SGO
*MKYVI%XXEGLMRK6EGO7PMHIW
7) Attach the second inner slide to the other side of the module.
-RWXEPPXLI4ERIP)\XIRWMSRW
238)8LIPIJXERHVMKLXTERIPI\XIRWMSRWEVIEPMOIWSXLIVIMWRSVMWOSJGSRJYWMRKXLI
TEVXWSREWWIQFP]
1) Place a panel extension against one side of the chassis so that the holes in
the panel extension are aligned with the two holes in the chassis as shown in
Figure 2-8.
*PYWL
1SYRX
6IKYPEV
1SYRX
1\7GVI[W
4IV7MHI
LP-0008
*MKYVI4ERIP)\XIRWMSR%XXEGLQIRX
AIT LoaderXpress
2-9
INSTALLATION
2) Install two M4 X 8mm Phillips head screws through the holes in the
panel extension into the chassis.
238)8LITERIPI\XIRWMSRLEWX[STEMVWSJQSYRXMRKLSPIW9WIXLIJSV[EVHTEMV
JSVXLIVIKYPEVQSYRXMRKTSWMXMSR6IKYPEVQSYRXMRKPIEZIWXLIGYVZIHJVSRX
TERIPWYVJEGII\XIRHMRKSYX[EVHJVSQXLIJVSRXSJXLIVEGO8LIVIEVTEMVSJ
LSPIWTIVQMXEJPYWLQSYRXTSWMXMSRXLEXPIEZIWXLIJVSRXTERIPVIGIWWIHMRXS
XLIVEGO=SYQMKLXGLSSWIJPYWLQSYRXMRKMJJSVI\EQTPI]SYLEZIVEGO
HSSVWXLEX[SYPHFILMRHIVIHF]XLITVSXVYHMRKJVSRXTERIP
3) Repeat steps 1 and 2 for the other side of the chassis.
-RWXEPPMRK9RMX-RXS%6EGO
With the inner rack slides attached to the AIT LoaderXpress unit and the
intermediate/outer slides separated from the inner slides, you can install the outer
rack slides in the rack.
1) Locate the screw holes in the front and rear rails of the cabinet or
equipment rack where the drive is to be installed.
2) Loosely assemble a mounting bracket to each outer slide, using two 1032 screws and a nut-plate for each. Select slots in the mounting brackets
so the length of the assembly equals the distance between the front and
rear rails of the rack.
3) Fasten each outer slide behind the front rail of the rack using two 10-32
low-profile screws and one nut plate.
4) Fasten each of the mounting brackets to the front of the rear rail of the
rack using two standard 10-32 screws and one nut plate.
5) Tighten the screws installed in step 2.
6) If they are not already locked, pull the intermediate slides toward the
front (out of the rack) so that they lock in the extended position.
238)8LIRI\XWXITWLSYPHFITIVJSVQIHF]X[STISTPI
7) Install the Library unit into the rack:
a. In front of the rack, lift the module to its installed height.
b. Engage the inner slides mounted on the module with the
intermediate slides protruding from the rack
2-10
AIT LoaderXpress
INSTALLATION
c. Slide the module toward the rack until the inner slide’s lock engages the
intermediate slides.
d. Depress the lock tab and continue until the lock tab engages in the
locking hole shown in Figure 2-9. This leaves the entire module
protruding from the rack, locked in position, supported by slides.
0SGO
8EF
*MKYVI0SGO8EF
8) Press inward (toward the module) on each of the inner slide locks to permit
the intermediate slides to move toward the rack.
9) Slide the module in and out several times as shown in Figure 2-10, ensuring
that the inner and outer slide locks engage, and that the module does not
bind against the slides.
AIT LoaderXpress
2-11
INSTALLATION
*MKYVI7PMHMRK1SHYPI-R6EGO
10) If binding or misalignment with other rack devices occurs, loosen the
four screws that secure the slides to the front rails and the four screws
that secure the slides to the rear rails and realign the module. Retighten
the screws.
11) If necessary, repeat steps 9 and 10 until the module does not bind
against the slides.
12) Install two clip nuts on each front rail at the height of the front panel
mounting screws (thumbscrews).
13) Slide the module into the rack as shown in Figure 2-11, and tighten the
thumbscrews.
2-12
AIT LoaderXpress
INSTALLATION
*MKYVI1SHYPI-R6EGO
238)=SYEVIRS[VIEH]XSGSRRIGXTS[IVERHMRXIVJEGIGEFPMRKERHGSRJMKYVIXLI%-8
0SEHIV<TVIWWQSHYPIJSVYWI
AIT LoaderXpress
2-13
INSTALLATION
'EFPMRK
Cabling the AIT Loaderxpress includes attaching cables to the following interface
connectors:
• AC power
• SCSI ports (to connect to the host).
7'78IVQMREXSV
7'7.YQTIV'EFPI
7'7,SWX'EFPI
(6:
%'4S[IV'SVH
)\TERWMSR4SVXW
(MEKRSWXMG
1SXSV
(6-:)7
(6-:)
8IVQMREXSV
7'7,SWX
'EFPI
7'7.YQTIV
'EFPI
7'7,SWX
'EFPI
8IVQMREXSV
*MKYVI'SRRIGXSVW7'7-8IVQMREXSV'EFPIW
2-14
AIT LoaderXpress
INSTALLATION
%XXEGLXLI%'4S[IV'SVH
1) Connect a standard grounding AC cord to the connector on the AIT
LoaderXpress. The connector is an IEC-compatible connector on the rear
panel.
2) Connect the other end to a reliably grounded AC outlet or rack power outlet.
238)8SQEMRXEMRWEJIX]GSQTPMERGIYWIERETTVSZIHTS[IVGSVH
• U.S.UL Listed
• CanadaCSA certified
• EuropeHarmonized marked <HAR> or nationally certified
%XXEGL'EFPIW8S7'7-'SRRIGXSVW
238)-J]SYV%-80SEHIV<TVIWWMWYWIHSREWMRKPIIRHIH7'7-FYWXLIMRXIVREP[MVMRK
PIRKXLSJER]VEGOQSYRXIH7'7-W]WXIQGERETTVSEGLXLIQE\MQYQPIRKXL
WTIGMJMGEXMSRSJEWMRKPIIRHIH7'7-FYW=SYQYWXPSGEXIXLIVEGOGPSWIXSXLI
LSWXGSQTYXIVXSEZSMHI\GIWWMZIFYWPIRKXL-XMWEPWSIWTIGMEPP]MQTSVXERXMR
WMRKPIIRHIHW]WXIQWXSYWIXLILMKLIWXUYEPMX]7'7-GEFPIW&YWIVVSVWGEYWIH
F]I\GIWWMZIPIRKXLSVTSSVUYEPMX]GEFPIWGERWMKRMJMGERXP]HIKVEHITIVJSVQERGI
ERHVIPMEFMPMX]
238)*SVXLSWIHYEPHVMZIETTPMGEXMSRW[LIVIFSXL%-8HVMZIWVYRMR7'7-7)QSHI
VEXLIVXLER0:(QSHIIEGLHVMZIQYWXFIGSRRIGXIHXSMXWS[R7'7-FYW
Each drive is wired to an independent bus, with a pair of SCSI connectors. Drive 1
shares a SCSI bus with the AIT LoaderXpress’s robotics. To fully use the bus
bandwidth, connect all the SCSI buses together as shown in the following figure. The
insets in show how to connect the SCSI cable, the jumper cables and the terminator for
one or two-drive units.
Each of the drives in the AIT LoaderXpress and the robotics is a separate SCSI device.
When any two or more devices are connected to the same SCSI bus, each separate
SCSI device must be assigned a unique SCSI address. For information on assigning
SCSI addresses, see the Configuration section later in this chapter.
To connect an AIT LoaderXpress to a host computer, the host must have at least one
Wide SCSI controller and the appropriate driver software. The controller must be
LVD/SE or differential, as required to match the module interface.
AIT LoaderXpress
2-15
INSTALLATION
-RXIVJEGI'EFPI7TIGMJMGEXMSRW
• AIT LoaderXpress is a high-performance system. To avoid degradation
of performance, use the highest-quality interface cables from a
reputable manufacturer of computer cables. All SCSI cables used with
the AIT LoaderXpress should meet the following requirements:
• Shielded or double-shielded, as required to meet EMI specifications
• Impedance match with cable terminators that meet current SCSI
specifications
• Characteristic impedance between 72 and 96 ohms for single-ended and
between 115 and 160 ohms for differential
• 34-pair twisted-pair
• Each end of a twisted pair ground connected to chassis ground
• Maximum cable length of 5 feet (1.5 m) for the LVD/SE model in
single-ended mode connected to a host SCSI adapter capable of Ultra
SCSI speed
• Maximum cable length of 40 feet (12 m) for LVD/SE SCSI bus
• Internal cable lengths of 22 inches for Drive 1 and Robot and 15 inches
for Drive 2
• Cables of different impedances should not be used together.
Additional specifications to assure the highest SCSI performance can be found in
the current version of ANSI X3.131.
238)8LMWIUYMTQIRXLEWFIIRXIWXIHJSVIPIGXVSQEKRIXMGIQMWWMSRWERH
MQQYRMX]YWMRKKSSHUYEPMX]WLMIPHIHGEFPIW-J]SYYWIYRWLMIPHIHSVTSSV
UYEPMX]GEFPIWSVSXLIV[MWIZEV]JVSQKSSHTVEGXMGI]SYQE]RSXGSQTP]
[MXLREXMSREPERHMRXIVREXMSREPVYPIW
2-16
AIT LoaderXpress
INSTALLATION
'SRJMKYVMRKXLI%-80SEHIV<TVIWW
The AIT LoaderXpress is designed with many configuration options, each offering
multiple settings to support a variety of applications and platforms. The setting of each
option is stored in non-volatile memory in the module. For most applications, you do
not have to change the factory default settings. If you need to change the configuration,
go on to the next section. If you are uncertain whether you need to change a setting,
contact your Technical Support representative.
To change settings, use the Control Panel. For an overview of how the Control Panel
works, and a description of the functions of the buttons, indicators and display, refer to
Entering the Menu Mode, Exiting the Menu Mode, and Navigating through the Menu
Structure in Chapter 3 - Operation.
You can change the settings using the procedure in How to Customize Configuration
later in this chapter. Consult your host computer and software documentation to
determine which settings you might have to change.
238)8LI%-80SEHIV<TVIWWWLEVIWQER]YGSQQSRJIEXYVIWSJXLI0MFVEV]<TVIWWERH
0MFVEV]4VSQSHIPWJVSQ3ZIVPERH(EXE*SVTYVTSWISJWSJX[EVIGSQTEXMFMPMX]XLI
%-80SEHIV<TVIWW[MPPVITSVXEWER3ZIVPERH0MFVEV]4VSXSXLIWSJX[EVI1ER]
l0MFVEV]zJYRGXMSRWMRXLIQIRYWIXYTWXLSYKLPMWXIH[MPP238JYRGXMSRSV
GLERKIW]WXIQSTIVEXMSR
'SRJMKYVEXMSR)\EQTPI7IXXMRKXLI7'7--(
1) Turn the AIT LoaderXpress on and wait until the Power-On Self Test
terminates and the default screen displays. You can toggle between the
Primary and Secondary Default Screens with the p and q buttons.
Loader Idle
Drv 1: No Tape
Drv 2: Unloaded
*MKYVI4VMQEV](IJEYPX7GVIIR
AIT LoaderXpress
2-17
INSTALLATION
Ready
1uCCCC CCCCCt 10
11uCCCC CCCt 19
*MKYVI7IGSRHEV](IJEYPX7GVIIR
2) At the Default Screen, press the )RXIV button. The screen displays the
Main Menu:
uLoad/Unload
Remove Magazine
Maintenance Menu
Configure Menu
$
*MKYVI1EMR1IRY
3) Press the q button three times to scroll to the Configure Menu, and
press )RXIV. The screen displays the Configure submenu:
uSCSI Options
#
Library Options
Barcode Options
Set Base Element
*MKYVI'SRJMKYVI7YFQIRY
4) To select a configuration option, press the p or q button on the control
panel until the u displays next to the option you want to change. The
first two choices on this menu, SCSI Options and Library Options, are
actually categories of options. In this case, choose SCSI Options. Press
the Enter button to display the options for that category. The submenu
displays:
uLibrary Parity:
✴Enabled
Library Bus ID:
✴6
$
*MKYVI7'7-3TXMSRW7YFQIRY
2-18
AIT LoaderXpress
INSTALLATION
238)8EOIEQSQIRXXSPSSOGPSWIP]EXXLIWYFQIRY2SXIXLEXXLIuSRXLIHMWTPE]MW
RI\XXSPMRIERHXLEXPMRIMWMRHIRXIHMRHMGEXMRKEX[SXMIVIHQIRY8LIp
ERHqFYXXSRW[SVOSRX[SPIZIPWMRXLMWOMRHSJQIRY[LMGLMWX]TMGEPSJQER]
WYFQIRYWSJXLI'SRJMKYVI1IRY8LIJMVWXPIZIPMWEWJSPPS[W-J]SYTVIWWXLIq
FYXXSRXLIuQSZIWXSPMRI-J]SYTVIWWXLIpFYXXSRXLIuQSZIWFEGOXS
PMRI
If you press the )RXIV button while the u is next to line 1 (or line 3), the pERHq
buttons operate on the second level. You can tell because the u moves next to line 2
(or line 4), and a ✴ displays at the end of line 4, indicating that there is a list of settings
that can be scrolled using the pERHq buttons.
The $ at the end of line 4 means that there are other options that can be displayed by
scrolling, using the q button repeatedly.
5) Suppose you want to set the Drive1 bus ID to 3. With the u next to line 1,
press the q button until the display scrolls as shown in the following
screen:
uLibrary Bus ID:
✴6
Drive 1 Bus ID:
✴4
#
*MKYVI7'7-3TXMSRW7YFQIRY
6) With the u next to line 3, press the )RXIV button. The u moves to line 4 and
the $ remains at the end of line 4, and a # displays at the end of line 1. Use
the p and q buttons to scroll line 4 to display the possible settings. Scroll
up so that 3 is displayed and press the )RXIV button to save the new
selection. An ✴ displays to the left of the 3 indicating it as the current
selection.
7) Press the )WGETI button repeatedly until the submenu reappears.
8) Repeat this procedure for each configuration option you want to change.
AIT LoaderXpress
2-19
INSTALLATION
7IXXMRK9T6IWIVZIH7PSXW
Use this option to withdraw some of the slots in the AIT LoaderXpress from use as
storage slots to meet software licensing requirements or to dedicate one or more
slots as a cleaning slot.
6IWIVZIH7PSX2YQFIVMRK
Ordinary cartridge slots are numbered from the front of the magazine to the rear. If
you reserve one slot, it becomes Reserved Slot #1 in the last slot (#19) of the
magazine. If you reserve two slots, slot #18 becomes Reserved Slot # 1, while slot
#19 becomes Reserved Slot #2. Additional reserved slots continue in this rear-tofront pattern. Reserved Slot #1 always follows the last unreserved data cartridge,
see Figure 2-19.
-J]SYVIWIVZISRIWPSX
6IWIVZIH7PSX
g
-J]SYVIWIVZIX[SWPSXW
f
f
6IWIVZIH7PSX
6IWIVZIH7PSX
*VSRX
*MKYVI6IWIVZIH7PSX2YQFIVMRK
2-20
AIT LoaderXpress
INSTALLATION
6IWIVZMRK7PSXW
1) From the Default Screen, press )RXIV to display the main menu.
uLoad/Unload
Remove Magazine
Maintenance Menu
Configure Menu
$
*MKYVI1EMR1IRY
2) Press the q button three times to move the u to Configure Menu, then press
the )RXIV button. The screen displays the Configure submenu:
uSCSI Options
#
Library Options
Barcode Options
Set Base Element
*MKYVI'SRJMKYVI7YFQIRY
3) Scroll down by pressing the q button to move the u to Library Options,
then press the )RXIV button. The following screen appears:
uConfiguration:
✴Standalone
Unload Mode:
✴Implicit
$
*MKYVI0MFVEV]3TXMSRW7YFQIRY
4) Scroll down to Reserved Slots by pressing the q button and press )RXIV. The
Reserved Slots Submenu displays:
Baud Rate:
✴38,400
Reserved Slots:
✴0
$
*MKYVI6IWIVZIH7PSXW7YFQIRY
5) Scroll down to line 4 and specify the number of slots you are reserving.
Press )RXIV to save.
AIT LoaderXpress
2-21
INSTALLATION
238)-J]SYVWSJX[EVIPMGIRWIPMQMXWXLIRYQFIVSJYWEFPIWPSXWMRXLIQEKE^MRI
]SYQYWXVIWIVZIXLIVIQEMRMRKWPSXW=SYGERYWIER]SJXLIVIWIVZIHWPSXW
XSWXSVIEWII'LETXIV1EMRXIRERGI
6) Press the )WGETI button repeatedly to return to the Default Screen. Your
choice takes effect the next time the AIT LoaderXpress is rebooted.
'SRJMKYVEXMSR3TXMSRW(IWGVMTXMSR
The following options are available on the Configuration Menu:
7'7-3TXMSRW
Library Parity: Allows you to enable or disable the library robotics SCSI bus
parity checking. The default is Library Parity Enabled.
Library Bus ID: Allows you to set the SCSI addresses of the library robotics. The
default is 6.
Drive n Bus ID: Allows you to set the SCSI addresses of the drives. The
designators Drive 1 through Drive n refer to the first through nth drives, counting
from the top module in the AIT LoaderXpress.
Vendor ID: Allows you to specify the response of the AIT LoaderXpress’s
robotics to the SCSI Inquiry command in the Vendor ID field. The default is
OVERLAND.
Product ID: Allows you to specify the response of the AIT LoaderXpress’s
robotics to the SCSI Inquiry command in the Product ID fields (LIBRARYPRO,
LXB, EXB-210, EXB-440, EXB-480, TL800 (c) DEC, <Vendor unique>. The
default is LIBRARYPRO.
Negotiation Mode: Allows you to enable Initiate Synchronous Negotiation.
Initiate Synchronous Negotiation, if set, allows the AIT LoaderXpress to initiate
SCSI Synchronous Negotiation with the host (the default is No). The AIT
LoaderXpress always responds to host-initiated synchronous negotiation.
Transfer Rate: Allows you to set the data Transfer Rate to 10 MB/sec, 5 MB/sec
or Asynchronous. The default is 10 MB/sec.
2-22
AIT LoaderXpress
INSTALLATION
Mode Page 1F Length: Allows you to choose between two lengths of the Mode
Sense/Select Device Capabilities Page (SCSI Page 1Fh), which are Short (14 bytes)
and Long (18 bytes), to accommodate different SCSI device implementations of this
page. The default is Short.
Initialize Element Status: Allows you to specify the module’s response to the SCSI
Initialize Element Status command. The possible settings are No Inventory, Force
Inventory, and Force Label Scan. The default is No Inventory.
Unit Attn Report: Allows you to select reporting of All or only One unit attention
conditions. If set to All, the unit reports all unit attention conditions in sequence; if set
to One, the unit reports only the highest priority condition. The default is All.
SCSI Mode: Defines the loader as SCSI-2 or SCSI-3. The default is SCSI-2.
Post Recv’d Error: Enables reporting of TapeAlert informational exception
conditions with a Recovered Error sense key, when the Method of Reporting
Information Exceptions (MRIE) field is set to a value of 0x3 in Mode Page 1Ch, or if
the TapeAlert Mode option is set to Rec Error (cnd). The default is Disabled.
Tape Alert Mode: Specifies conditions for logging and reporting TapeAlert data.
The default is Logging Disabled.
• Logging Disabled-Inhibits logging feature.
• No Exceptions-Device should not report information exceptions.
• Unit Attention-Report information exceptions with a Unit Attention sense
key and an ASC/ASCQ of 5D/00.
• Rec Error (cnd)-Report information exceptions with a Recovered Error
sense key and an ASC/ASCQ of 5D/00, if Recovered Error Reporting is
enabled.
• Rec Error (unc)-Unconditionally report information exceptions with a
Recovered Error sense key and an ASC/ASCQ of 5D/00.
• No Sense-Report information exceptions with a No Sense sense key and an
ASC/ASCQ of 5D/00.
• On Request- Report information exceptions with a No Sense sense key and
an ASC/ASCQ of 5D/00, only in response to an unsolicited Request Sense
command.
AIT LoaderXpress
2-23
INSTALLATION
0MFVEV]3TXMSRW
Configuration: The menu allows you to configure the AIT LoaderXpress as a
stand-alone, master, or slave module. The default is stand-alone. Do not select the
“Master” or “Slave” options.
Unload Mode: Allows you to determine whether a SCSI Move Medium
command is interpreted as Implicit or Explicit. If Implicit, the module unloads a
drive before attempting to move a cartridge from that drive. If Explicit, the host
must issue a SCSI Unload command to a drive before each Move Medium
command that removes a cartridge from that drive. The default is Implicit.
Numbering: Allows you to specify whether SCSI elements in the unit display
with either zero or one. This affects only the front panel display, not the actual
SCSI element addresses. The default is One.
Auto Clean: Allows you to enable an automatic cleaning cycle which operates as
part of the cartridge unload sequence whenever the Use Cleaner LED comes on.
To use this option, you must have reserved a slot for a cleaning cartridge using the
Reserve Slots option. The default is Disabled.
Library Mode: Allows you to set the robotics operating mode to Random,
Sequential 1, Sequential 2 or Sequential Split. The default is Random.
238)8LIWIUYIRXMEPSTIVEXMRKQSHIWEVIEZEMPEFPIMRWXERHEPSRIGSRJMKYVEXMSR
SRP]-JSRP]SRIHVMZIMWMRWXEPPIHSRP]XLI7IUYIRXMEPSTXMSRMWEZEMPEFPI
238)6ERHSQ2SVQEPSTIVEXMRKQSHI%PPS[WGSQTPIXILSWXGSRXVSPSJXLI
VSFSXMGW
238)7IUYIRXMEP0SEHWGEVXVMHKIWMRRYQIVMGEPSVHIVMREPPQEKE^MRIWPSXW
JSV(VMZI
238)7IUYIRXMEP0SEHWGEVXVMHKIWMRRYQIVMGEPSVHIVMREPPQEKE^MRIWPSXW
JSV(VMZI
238)7IUYIRXMEP7TPMX0SEHWGEVXVMHKIWMRRYQIVMGEPSVHIVMRQEKE^MRIWPSXW
XLVSYKLJSV(VMZIERHQEKE^MRIWPSXWXLVSYKLJSV(VMZI
Baud Rate: Allows you to set the data transmission rate of the trace port. This
function is intended for use by CEs only. The default is 38400 bits/sec.
2-24
AIT LoaderXpress
INSTALLATION
Reserved Slots: Allows you to withdraw from use a specified number of slots in the
back of the magazine. Some host software imposes size limits on tape library
magazines for licensing purposes, and does not operate with a library that exceeds the
licensed size. The default is 0.
Model Number: Allows you to change the model number information displayed on
the initial screens. You can choose between OVERLAND LIBRARYPRO, a blank
line, DIGITAL TL20x, and a vendor unique number. The Default is OVERLAND
LIBRARYPRO.
&EVGSHI3TXMSRW
Label Size: Allows you to limit length of the barcode label. Possible settings are 1
through 8. The default is 8.
Label Alignment: Allows you to specify alignment of barcode label. The options are
Left or Right. When used with the label size option, strips unwanted trailing characters
(left alignment) or leading characters (right alignment). The default is Left Alignment.
Check Digit: Allows you to enable or disable check digit function. For barcodes
without check digits, you can select Disable. For barcodes with check digits, you can
select Enable/Send or Enable/No Send. The default is Disable.
7IX)PIQIRX&EWI
Transport: Allows you to set the base address of the robotics mechanism. The default
is 0000.
Storage: Allows you to set the base address of the 19 magazine slots. The default is
0001.
Transfer: Allows you to set the base address of the drive. The default is 00E0 for
Drive 1.
Import/Export: Allows you to set the base address of the mail slot. The default is
00D0.
AIT LoaderXpress
2-25
INSTALLATION
7IX7IVMEP2YQFIV
Serial Number: Allows you to alter the module’s serial number as stored in the
unit. The AIT LoaderXpress’s robotics reports these settings in response to the
SCSI Inquiry command in the Unit Serial Number Page.
7IX(IJEYPX
Overland Defaults: Resets all configuration options to Overland defaults or
Compaq defaults. The default is Overland defaults.
The following tables summarizes the configuration settings for the AIT
LoaderXpress.
8EFPI%-80SEHIV<TVIWW7'7-3TXMSRW
3TXMSR
2-26
7IXXMRK
(IJEYPX
0MFVEV]4EVMX]
)REFPIH(MWEFPIH
)REFPIH
0MFVEV]-(
7'7--(
(VMZISV&YW-(
7'7--(
:IRHIV-(
3:)60%2()<%&=8)()'
:)2(3692-59)"
3:)60%2(
4VSHYGX-(
0-&6%6=4630<&)<&
)<&)<&
80()' :IRHSV
9RMUYI"
0-&6%6=463
2IKSXMEXMSR1SHI
-RMXMEXI(S2SX-RMXMEXI
(S2SX-RMXMEXI
8VERWJIV6EKI
7]RG1&WIG7]RG
1&WIG%W]RGSRP]
7]RG1&WIG
1SHI4EKI*0IRKXL
7LSVX)0SRK
7LSVX
-RMX)PIQIRX7XEXYW
2S-RZIRXSV]*SVGI
-RZIRXSV]*SVGI0EFIP7GER
2S-RZIRXSV]
9RMX%XXIRXMSR6ITSVX
3RI%PP
%PP
7'7-1SHI
7'7-7'7-
7'7-
4SWX6IGZkH)VVSV
)REFPIH(MWEFPIH
(MWEFPIH
AIT LoaderXpress
INSTALLATION
8EFPI%-80SEHIV<TVIWW7'7-3TXMSRW
3TXMSR
8ETI%PIVX1SHI
7IXXMRK
(IJEYPX
0SKKMRK(MWEFPIH
0SKKMRK(MWEFPIH2S
)\GITXMSRW9RMX%XXIRXMSR
6IG)VVSVGRH6IG)VVSV
YRG2S7IRWI3R6IUYIWX
8EFPI%-80SEHIV<TVIWW0MFVEV]3TXMSRW
3TXMSR
7IXXMRK
(IJEYPX
'SRJMKYVEXMSR
7XERHEPSRI1EWXIV7PEZI
7XERHEPSRI
9RPSEH1SHI
-QTPMGMX)\TPMGMX
-QTPMGMX
2YQFIVMRK
3RI&EWIH>IVS&EWIH
3RI&EWIH
%YXS'PIER
)REFPIH(MWEFPIH
(MWEFPIH
0MFVEV]1SHI
6ERHSQ7IUYIRXMEP
7IUYIRXMEP7IUYIRXMEP
7TPMX
6ERHSQ
&EYH6EXI
%YXS
6IWIVZIH7PSXW
XLVSYKLRSRIPIWWXLER
QEKE^MRI
1SHIP2YQFIV
3:)60%2(0-&6%6=463
&PERO0MRI"(-+-8%0
80\ :IRHSV9RMUYI"
3:)60%2(
0-&6%6=463
8EFPI%-80SEHIV<TVIWW&EVGSHI3TXMSRW
3TXMSR
7IXXMRK
(IJEYPX
0EFIP7M^I
XLVSYKL
0EFIP%PMKRQIRX
0IJXSV6MKLX
0IJX
'LIGO(MKMX
)REFPI2S7IRH
(MWEFPIJSVFEVGSHIW[S
GLIGOHMKMXW)REFPI7IRHSV
)REFPI2S7IRHJSV
FEVGSHIW[MXLGLIGOHMKMXW
AIT LoaderXpress
2-27
INSTALLATION
8EFPI%-80SEHIV<TVIWW7IX)PIQIRX&EWI3TXMSRW
3TXMSR
7IXXMRK
(IJEYPX
8VERWTSVX
2222LI\
7XSVEKI
2222LI\
8VERWJIV
2222LI\
)
-QTSVX)\TSVX
2222LI\
(
8EFPI%-80SEHIV<TVIWW7IX7IVMEP2YQFIV3TXMSR
3TXMSR
7IVMEP2YQFIV
7IXXMRK
2<22222222LI\
(IJEYPX
*
8EFPI%-80SEHIV<TVIWW7IX(IJEYPX3TXMSR
3TXMSR
3ZIVPERH(IJEYPXW
7IXXMRK
(IJEYPX
3ZIVPERH(IJEYPXW'SQTEU
(IJEYPXW
3ZIVPERH(IJEYPXW
238)8LISTXMSRWHIWGVMFIHMRXLMWXEFPIVITVIWIRXXLIZIVWMSRSJXLIJMVQ[EVIMR
YWI[LIRXLMWQERYEP[EW[VMXXIR-JXLISTXMSRWHMWTPE]IHSR]SYVGSRXVSP
TERIPHMJJIVJVSQXLSWIHIWGVMFIHLIVI]SYGERHS[RPSEHXLIPEXIWXSTXMSR
HIWGVMTXMSRWJVSQXLI3ZIVPERH(EXE[IFWMXI[[[3ZIVPERHHEXEGSQSV
GSRXEGX]SYV8IGLRMGEP7YTTSVXVITVIWIRXEXMZI
2-28
AIT LoaderXpress
'LETXIV3TIVEXMSR
This chapter describes operating the AIT LoaderXpress by Overland Data, Inc
through the Control Panel on the front of the unit.
*VSRX4ERIP
The front panel of the AIT LoaderXpress module includes a power switch for the
module and the control panel, which has buttons, a display and indicators.
Control Panel
Lo ad e r Xpre
ss
Re ady
29(5/$1'
E scap
e
Us e
Clean er
D rive
F au lt
Lo ader
Fau lt
En ter
Magazine
Door
LXL-0022
Power Switch
*MKYVI%-80SEHIV<TVIWW*VSRX4ERIP
4S[IV7[MXGL
The power switch controls the supply of AC power to the AIT LoaderXpress. It is a
push-on, push-off switch. When the power is on, the backplane of the control panel
display is illuminated.
AIT LoaderXpress
3-1
OPERATION
&YXXSRWERH-RHMGEXSVW
The control panel consists of four LED indicators, a four-line by 20-character
backlit LCD display, and four buttons.
6IEH]
9WI'PIERIV
(VMZI*EYPX
0SEHIV*EYPX
+VIIR
=IPPS[
6IH
6IH
(MWTPE]4ERIP
)WGETI
)RXIV
7GVSPP9T
7GVSPP(S[R
*MKYVI&YXXSRW-RHMGEXSVW
&YXXSRW
There are four buttons on the control panel: )WGETI, )RXIV, p, and q. The buttons
do not directly control specific functions or options. Instead, you use the buttons to
navigate from the Default Screen through a multi-level menu structure, then select
the desired option from the appropriate menu using the )RXIV button.
Using the )RXIV button to access the Main Menu
To enter the Menu Mode and display the Main Menu from the Default Screen,
press the Enter button. When you enter the Menu Mode, the 6IEH] light goes out.
This means that the AIT LoaderXpress is offline, and the AIT LoaderXpress
responds to all commands from the host with a SCSI Not Ready until you exit the
Menu Mode and the 6IEH] light goes on.
3-2
AIT LoaderXpress
OPERATION
)WGETI&YXXSR6IXYVR8S(IJEYPX7GVIIR
To return to the Main Menu from a submenu, press the )WGETI button repeatedly until
the Main Menu displays. Pressing the )WGETI button while the Main Menu is displayed
exits the Menu Mode and returns you to the Default Screen.
)WGETI&YXXSR%GGIWW7XEXYW1SHI
To enter the Status Mode, which displays all aspects of the AIT LoaderXpress’s
operating and configuration status, press the )WGETI button at the Default Screen. The
AIT LoaderXpress remains online.
0)(-RHMGEXSVW
There are four LED indicators on the control panel, labeled 6IEH] (green), 9WI'PIERIV
(yellow), (VMZI*EYPX (red), and 0SEHIV*EYPX (red).
The 6IEH] LED (green) is illuminated when the AIT LoaderXpress is ready to accept
commands from the host computer. The Ready indicator goes out when you enter the
Menu Mode, indicating that the AIT LoaderXpress is offline.
The 9WI'PIERIV LED (yellow) indicates that one or more of the drives in the AIT
LoaderXpress needs cleaning. Perform a cleaning operation as described in Chapter 4 Maintenance. When the Use 9WI'PIERIV comes on, you can find out which drive needs
cleaning by selecting Cleaning Needed on the Drive Status submenu.
When either the (VMZI*EYPX or the 0SEHIV*EYPX LED (red) is illuminated, a Fault Screen
displays on the LCD display. The Fault Screen is described later in this chapter.
See Chapter 5 - Troubleshooting for a list of fault symptom codes (FSC) and error
recovery procedures (ERP).
Table 3-1 Control Panel Button Functions
(MWTPE]1SHI
%X4SWX7GVIIR
)WGETI
)RXIV
p
q
2%
2%
2%
2%
AIT LoaderXpress
3-3
OPERATION
Table 3-1 Control Panel Button Functions
(MWTPE]1SHI
%X(IJEYPX7GVIIR
-R7XEXYW1SHI
[LMPISRPMRI
-R1IRY1SHI
)WGETI
)RXIVW7XEXYW
1SHI
)RXIV
)RXIVW7XEXYW
1SHI
q
8SKKPIW
FIX[IIR
4EKI
8SKKPIW
FIX[IIR
4EKI
ERH4EKI
ERH4EKI
6IXYVRWXS(IJEYPX 7EQIEW1IRY
7GVIIR
1SHI
7EQIEW
1IRY1SHI
7EQIEW
1IRY1SHI
6INIGXW'YVVIRXP] %GGITXW
(MWTPE]IH'LSMGI 'YVVIRXP]
(MWTPE]IH
SV
'LSMGI
%FSVXW'SRXVSP
1SZIW 0MRI9T[EVH
8LVSYKL0MWX
SJ3TXMSRW
SV
4ERIP3TIVEXMSR-R
4VSKVIWWSV
)\MXW1IRY1SHI
XS(IJEYPX7GVIIR
2%
u
7GVSPPW4EVX
SJ(MWTPE]
0MRI8S[EVH
8STSJ0MWXSJ
3TXMSRW
)\MXWXS2I\X
,MKLIV1IRY
0IZIPSV
%X*EYPX7GVIIR
p
'PIEVW7SJX
)VVSVW
2%
u
1SZIW 0MRI
(S[R[EVH
8LVSYKL0MWX
SJ3TXMSRW
SV
7GVSPPW4EVX
SJ(MWTPE]
0MRI8S[EVH
&SXXSQSJ
0MWXSJ
3TXMSRW
2%
238)8LIVIMWEREYXSVITIEXJIEXYVIJSVXLIpERHqFYXXSRW;LIR]SYTVIWW
IMXLIVFYXXSRJSVQSVIXLERSRILEPJWIGSRHXLIGSRXVSPTERIPFILEZIWEWMJ
]SY[IVITVIWWMRKERHVIPIEWMRKXLIFYXXSREFSYXJSYVXMQIWTIVWIGSRH
8LMWIJJIGXWXSTW[LIR]SYVIPIEWIXLIFYXXSR
3-4
AIT LoaderXpress
OPERATION
*VSRX4ERIP1IHME0SGOW
To avoid accidental interruption of AIT LoaderXpress operation by entering the Menu
Mode or removing cartridges while the host is accessing the AIT LoaderXpress, the
front panel and the media may be electronically locked. When the front panel is
locked, you can only enter the Menu Mode after entering a 4-digit code. That is, when
the Default Screen is displayed, pressing the )RXIV button does not invoke the Menu
Mode until you enter the code. The front panel cannot be unlocked without using the
Security submenu to unlock it.
The media may also be locked by software running on the host, using the SCSI
Prevent/Allow Medium Removal command. The AIT LoaderXpress provides no
control panel override for this command. Usually, exiting the host software restores
media access. In the event of host failure, you can restore media access by cycling AIT
LoaderXpress power.
Procedures for locking and unlocking front panels and media are described later in this
chapter.
7XEVXYT(MWTPE]1IWWEKIW
The display on the control panel is capable of displaying four lines of 20 characters
each, to allow the use of easy-to-understand messages. Many of these messages and
their functions are described in this chapter. Those displays that are described in other
chapters are cross-referenced here as well.
4S[IV3R7IPJ8IWX7GVIIR
When power is first applied to the module, a series of power-on self test (POST)
diagnostics are performed. During POST execution, the model number of the module,
the firmware revision, and the status or result of the test in progress are displayed on
the control panel.
AIT LoaderXpress
3-5
OPERATION
4S[IV3R7IPJ8IWX43787GVIIR
When power is first applied to the module, a series of power-on self test (POST)
diagnostics are performed. During POST execution, the model number of the
module, the firmware revision, and the status or result of the test in progress are
displayed on the control panel.
OVERLAND LIBRARYPRO
Firmware Level 0X.XX
Checking Hardware
*MKYVI43787GVIIR
-RMXMEPM^EXMSR7GVIIRW
After the POST is completed, the library robotics are initialized. A series of
screens similar to the following displayed during this process.
OVERLAND LIBRARYPRO
Firmware Level 0X.XX
Initializing Loader
*MKYVI-RMXMEPM^EXMSR7GVIIR
3-6
AIT LoaderXpress
OPERATION
(IJEYPX7GVIIR
After the POST diagnostics have concluded successfully and initialization is complete,
the default screen displays, as shown in the following example. The Default Screen
consists of two pages.
Loader Idle
Drv 1: No Tape
Drv 2: No Tape
q
4VIWWXLI
4EKI
p
ERH
FYXXSRWXSXSKKPI
FIX[IIRXLIX[S
TEKIW
Loader Idle
1uCCCC CCCCCt 10
11 u _ _ _ _ _ _ _ t 19t
4EKI
*MKYVI(IJEYPX7GVIIRW
Page 1 displays library and drive status. Page 2 displays library status (Line 1) and
magazine slot status (Lines 3 and 4).
The library status lines show each slot as a rectangle. A solid block indicated that a
cartridge is present. A hollow block indicates that a slot is empty.
Line 4 also shows the status of the mail slot:
t
v
indicates that a cartridge is in the mail slot.
indicates that the mail slot is empty
AIT LoaderXpress
3-7
OPERATION
*EYPX7GVIIR
When a fault is detected, a screen similar to the following displays.
(In addition, either the Drive Fault or the Loader Fault LED on the control panel
lights up.)
3005
Fault Code:
Picker Jammed
Power Down to Clear
*MKYVI*EYPX7GVIIR
The first line of the Fault Screen displays a numerical fault symptom code (FSC).
The second line displays a brief description of the error. The third and fourth lines
display a one- or two-line message describing the initial error recovery procedure
(ERP).
For a list of the fault symptom codes (FSC) and error recovery procedures (ERP)
see Chapter 5 - Troubleshooting.
3-8
AIT LoaderXpress
OPERATION
9WMRK%-80SEHIV<TVIWW1IRYW
Use the AIT LoaderXpress menus (shown in the following illustration) to display
status information and to operate and configure the AIT LoaderXpress.
)WGETI&YXXSR
*EYPX(MWTPE]
4S[IV94(MWTPE]W
(IJEYPX(MWTPE]
)RXIV&YXXSR
4ERIP0SGO
1EMR1IRY
0SEH9RPSEH
6IQSZI
1EMRXIRERGI
'SRJMKYVI
7LS[,MWXSV]
From/To
1EKE^MRI
1IRY
1IRY
1IRY
Clean Drive
Cleaning Using
7XEXYW1SHI
Access Mail Slot
Library Status
Model Number
Firmware Revision
SCSI Bus ID
SCSI Bus Parity
Boot Verision
Flash Type
Library Mode
Library Config
Vendor ID
Product ID
Baud ID
Transport Addr
Storage Addr
Transfer Addr
Import/Export
Serial Number
Negotiation Mode
Transfer Rate
Unload Mode
Auto Clean Mode
Reserved Slots
Mode Page 1F
Length
TUR Reporting
Init Elem Status
Barcode Reader
Label Size
Label Assignment
Loader Status
SCSI Mode
Abort Move Status
Post Recv’d Error
Tape Alert Mode
Diagnostic Menu
Cartridge Cycle
Friction Test
Tach Feedback
Scanner Feedback
Scan Labels
Demo Menu
Demo 1
Demo 2
Flash Update
Novram Update
Park
Reboot Module
Drive"n" Status
Tape Motion
Tape Motion
SCSI Bus ID
Firmware Rev
Cartridge Pres
Hardware Error
Cleaning Needed
Write Protected
Serial Number
Map Info
SCSI Options
Statistics
Error History
Library Parity
Initial
Config
Library Bus ID
Drive "n" Bus ID Config History
Vendor ID
Product ID
Negotiation Mode
Transfer Rate
Mode Page 1F
Length
Init Elem Status
Unit Attn Report
SCSI Mode
Post Recv’d Error
Tape Alert Mode
7IGYVMX]
1IRY
Ulock All Panels
Ulock All Meda
Lock All Panels
Lock All Media
Master Locking
Set Ulock Code
Set Mail Slot Code
Library Options
Configuration
Unload Mode
Numbering
Auto Clean
Library Mode
Baud Rate
Reserved Slots
Model Number
Barcode Options
Label Size
Label Assignment
Check Digit
Set Element Base
Transport
Storage
Transfer
Import/Export
Set Serial Number
Set Default
Overland Defaults
Compaq Defaults
*MKYVI%-80SEHIV<TVIWW1IRY
AIT LoaderXpress
3-9
OPERATION
9WMRKXLI7XEXYW1SHI
You can enter the Status Mode by pressing the Escape button whenever the
Default Screen displays. Entering the Status Mode does not affect operation of the
AIT LoaderXpress. When you enter the Status Mode, the Status Menu displays:
uAccess Mail Slot
Library Status
Drive 1 Status
Map Info
$
*MKYVI7XEXYW1IRY
)\MXMRKXLI7XEXYW1SHI
To exit the Status Mode, press the Escape button until the Status Menu displays.
Press the Escape button again to display the Default Screen.
)\TPSVMRKXLI7XEXYW1SHI
The functions available in the Status Mode are:
• Access Mail Slot
• Library Status
• Drive n Status
• Map Info
Scroll up or down with the p and q buttons and press the Enter button to select
the item.
3-10
AIT LoaderXpress
OPERATION
0MFVEV]7XEXYW
To view the Library Status, select the Library Status option from the Status menu.
Model Number
OVERLAND LIBRARYPRO
Firmware Revision:
04.00
$
*MKYVI0MFVEV]7XEXYW1IRY
Scroll down this screen to view the status of any of the following:
w1SHIP2YQFIV
w2IKSXMEXMSR1SHI
w*MVQ[EVI2YQFIV
w8VERWJIV6EXI
w7'7-&YW-(
w9RPSEH1SHI
w7'7-&YW4EVMX]
w%YXS'PIER1SHI
w&SSX:IVWMSR
w6IWIVZIH7PSXW
w*PEWL8]TI
w1SHI4EKI*0IRKXL
w0MFVEV]1SHI
w8966ITSVXMRK
w0MFVEV]'SRJMK
w-RMXMEPM^I)PIQIRX7XEXYW
w:IRHSV-HIRXMX]
w&EVGSHI6IEHIV
w4VSHYGX-HIRXMX]
w0EFIP7M^I
w&EYH6EXI
w0EFIP%WWMKRQIRX
w8VERWTSVX%HHVIWW
w0SEHIV7XEXYW
w7XSVEKI%HHVIWW
w%FSVX1SZI7XEXYW
w8VERWJIV%HHVIWW
w7'7-1SHI
w-QTSVX)\TSVX%HHV
w4SWX6IGZ
H)VVSV
w7IVMEP2YQFIV
w8ETI%PIVX1SHI
AIT LoaderXpress
3-11
OPERATION
(VMZI7XEXYW
To view the Drive Status, select the Drive Status option from the Status menu:
uAccess Mail Slot
Library Status
Drive 1 Status
Map Info
$
*MKYVI7XEXYW1IRY
The following screen displays:
uTape Motion
Idle
SCSI Bus ID
4
$
*MKYVI(VMZI7XEXYW1IRY
Scroll down this screen to view the following list of available options:
w8ETI1SXMSR
w7'7-&YW-(
w*MVQ[EVI6IZMWMSR
w'EVXVMHKI4VIWIRX
w'PIERMRK2IIHIH
w;VMXI4VSXIGXIH
w7IVMEP2YQFIV
3-12
AIT LoaderXpress
OPERATION
1ET-RJSVQEXMSR7GVIIR
When you select Map Info, the Map Info Submenu displays. The location being
reported displays on Line 1. The content of the barcode on the label, up to 8 characters,
displays on Line 4.
Drv 1
Occupied
Label Valid
XXXXXXXX
$
*MKYVI1ET-RJS7YFQIRY
The list of locations available for display on line 1 is as follows. If you do not
designate any mail slots, those lines are omitted from the list.
w(VMZI
w(VMZI
w7PSX
w7PSX
w
w7PSX
w1EMP7PSX
Depending on the report for each location, Line 2 may display either Empty or
Occupied, or, if a magazine is absent, Not Installed.
Depending on the report for each location, Line 3 may display either Label Valid, or
Label Not Present.
For each location reported, Line 4 displays the actual barcode on the label, up to 8
characters.
AIT LoaderXpress
3-13
OPERATION
9WMRKXLI1IRY1SHI
238);LIRXLI0MFVEV]4VSIRXIVWXLI1IRY1SHIXLI6IEH]PMKLXKSIWSYX8LMW
QIERWXLEXXLIQSHYPIMWSJJPMRIERHVIWTSRHWXSEPPGSQQERHWJVSQXLI
LSWX[MXLE7'7-2SX6IEH]YRXMP]SYI\MXXLI1IRY1SHIERHXLI6IEH]
PMKLXKSIWSR
To prevent interruption of host operations, you can lock out the Menu Mode using
the Security Menu. See Security Menu later in this chapter. When all control
panels are locked, you must enter your unlock code to display the Main Menu.
When the Default Screen displays, you can enter the Menu Mode by pressing the
Enter button. The Main Menu displays.
uLoad/Unload
Remove Magazine
Maintenance Menu
Configure Menu
$
*MKYVI1EMR1IRY
238)-JXLI'SRXVSP4ERIPLEWFIIRPSGOIHXLIJSPPS[MRKWGVIIRHMWTPE]WMRWXIEHSJ
XLI1EMR1IRY=SYQYWXORS[XLIYRPSGOGSHIJSVXLI%-80SEHIV<TVIWW
FIJSVI]SYGERGSRXMRYI
Front Panel Locked
ENTER to Unlock
ESCAPE to Exit
*MKYVI4ERIP0SGOIH7GVIIR
When you press the Enter button, the Code Entry Submenu displays.
Unlock Code
“
#
$
*MKYVI'SHI)RXV]7YFQIRY
3-14
AIT LoaderXpress
OPERATION
Using the p button and the q Buttons, set the first digit of the unlock code. Press the
)RXIV button to move the cursor to the second digit and repeat the process. Press the
)WGETI button, then the )RXIV button to confirm your entry. If the code is correct, the
Main Menu is displayed. If the code is incorrect, an error screen displays.
)\MXMRK8LI1IRY1SHI
To exit the menu mode and return to the Default Screen, press the )WGETI button
repeatedly. Each time you press the )WGETI button, the display moves to a higher menu
level. When the Main Menu is visible, pressing the Escape button once returns to the
Default Screen. At this point, the 6IEH] LED lights.
2EZMKEXMRK-R1IRY7XVYGXYVI
To select a submenu, move the u on the display to the desired line using the p and q
buttons. Press the )RXIV button to confirm your choice and display the submenuu. You
can scroll to additional configuration options with the q button.
The options available on the Main Menu are:
• Load/Unload
• Remove Magazine
• Maintenance Menu
• Configuration Menu
• Security Menu
AIT LoaderXpress
3-15
OPERATION
0SEH9RPSEH1IRY
Refer to “Loading and Unloading” later in this chapter.
6IQSZI1EKE^MRI1IRY
When you scroll to Remove Magazine and press the Enter button, the magazine
door swings open.
238)-JXLIQIWWEKI1EKE^MRI0SGOIHHMWTPE]WSRXLIWGVIIRXLILSWXWSJX[EVI
LEWPSGOIHXLIQEKE^MRI)\MXMRK]SYVFEGOYTSVLSWXQEREKIQIRXWSJX[EVI
YWYEPP]VIPIEWIWXLIPSGO8LILSWXQEREKIQIRXWSJX[EVIWLSYPHLEZIE
[E]XSVIPIEWIXLIQEKE^MRI[MXLSYXWLYXXMRKHS[R-JXLILSWXJEMPW]SY
GERG]GPITS[IVXSXLI%-80SEHIV<TVIWWXSVIPIEWIXLIPSGO
1EMRXIRERGI1IRY
The Maintenance Menu options intended for operator use are described in Chapter
4 - Maintenance. Additional Maintenance Menu options used by service
technicians are described in the AIT LoaderXpress Service Manual.
'SRJMKYVI1IRY
The Configure Menu, how to use it and the options available under it are described
in Chapter 4 - Maintenance.
3-16
AIT LoaderXpress
OPERATION
7IGYVMX]1IRY
Use the Security Menu to lock the control panel. This prevents inadvertent or
unauthorized access to the Menu Mode, which takes the AIT LoaderXpress offline.
238)=SYGERHMWTPE]XLI7LS[7XEXYW1IRY[MXLSYXYRPSGOMRKXLITERIPERH[MXLSYX
XEOMRKXLI%-80SEHIV<TVIWWSJJPMRIF]TVIWWMRKXLI)WGETIFYXXSREXXLI(IJEYPX
7GVIIR
When you select the Security Menu, the Security Menu displays:
uSet Unlock Code
Set Mail Slot Code
*MKYVI7IGYVMX]1IRY
The Security Menu includes the following options:
• Set Unlock Code
• Set Mail Slot Code
To change the unlock code, or to enable or disable the panel locking function, scroll
downward to Set Unlock Code. Press the )RXIV button. The Code Select Submenu
displays.
Unlock Code
✶0000
#
0000 Disables Lock
$
*MKYVI'SHI7IPIGX7YFQIRY
An underline cursor displays under the first digit. To set the first digit, press the p
button or the q button until the number you want displays. To move the cursor to the
second digit, press the )RXIV button. Repeat the process for each of the four digits. Be
sure to remember the 4-digit number; you use it to enter the Menu Mode. Use an
unlock code of 0000 to disable panel locking.
AIT LoaderXpress
3-17
OPERATION
When you have finished entering four digits, press the )WGETI button. The Code
Accept Submenu displays. Your code displays instead of XXXX.
Unlock Code
✶“XXXX”
ENTER to Accept
ESCAPE to Exit
#
$
*MKYVI'SHI%GGITX7YFQIRY
Press the )RXIV button to accept the displayed unlock code or Escape to return to
the Main Menu.
The next time you try to enter Menu Mode, the following screen displays. You can
still display the Status Menu without using the security code by pressing the
)WGETI button at the Default Screen.
Front Panel Locked
ENTER to Unlock
ESCAPE to Exit
*MKYVI4ERIP0SGOIH7GVIIR
When you press the )RXIV button, the following screen displays:
Unlock Code
#
“
“
$
*MKYVI'SHI)RXV]7YFQIRY
3-18
AIT LoaderXpress
OPERATION
Using the p button and the q Buttons, set the first digit of the unlock code. Press the
)RXIV button to move the cursor to the second digit and repeat the process. When you
have finished, press the )WGETI button. The Code Validate Submenu displays
Unlock Code
✶“XXXX”
ENTER to Accept
ESCAPE to Exit
#
$
*MKYVI'SHI:EPMHEXI7YFQIRY
Press the )RXIV button to validate your choice. If the code is correct, the Main Menu is
displayed. If the code is incorrect, an error screen displays. If you have forgotten your
unlock code, contact your technical support representative for assistance.
0SEHMRKERH9RPSEHMRK
The Load/Unload menus allow you to specify a source and a destination for a cartridge
movement, so you use exactly the same procedure to load and unload. To load or
unload a tape from the front panel, use the Load/Unload menus as follows:
Ready
1uCCCC CCCCCt 10
11 u _ _ _ _ _ _ _ t 19t
*MKYVI(IJEYPX7GVIIR
From the Default Screen, enter the Menu Mode by pressing the Enter button. The Main
Menu displays with the u next to Load/Unload.
uLoad/Unload
Remove Magazine
Maintenance Menu
Configure Menu
$
*MKYVI1EMR1IRY
AIT LoaderXpress
3-19
OPERATION
The Press )RXIV to display the first Load/Unload submenu:
From:
u✶Slot 1
To:
✶Drv 1
$
*MKYVI0SEH9RPSEH-RMXMEP7GVIIR
The u is next to line 2 of the display. Line 2 shows the top item in a scrollable list
of sources. Note that an $ has appeared on the right of the bottom line. This
indicates that the q button may now be used to scroll through the list, and that the
top item on the list is displayed. As soon as you press the qbutton, the following
three things happen:
• The list scrolls down one item (only line 2 scrolls)
• An ˆ displays on the right of line 1, meaning there are more options
above the item displayed on line 2
• The ✶ at the left of line 2 (the current selection) disappears, meaning
you have not selected an item from the list.
238)8LIGSRXIRXWSJXLIPMWXWSRPMRIERHPMRIZEV]EWJSPPS[W
-RMXMEP7GVIIR*VSQ0MRI
The list on line 2 (the From line) includes every drive and magazine slot
(including mail slots) with cartridges. (You can’t retrieve a cartridge from an
empty slot or drive.)
-RMXMEP7GVIIR8S0MRI
The list on line 4 (the To line) includes all the valid destination choices, that is,
drives and slots that are empty. (You can’t put a cartridge into a full slot or drive.)
3-20
AIT LoaderXpress
OPERATION
7GVSPP0MWX8S0MRI
There is another limitation on the To list. If you have selected a drive on the From
screen, the To list can include only slots. If you have selected a slot on the From screen,
the To list can contain only drives.
Let us assume that you want to load the cartridge that is in Slot 11 into any available
drive. Use the q button to scroll line two to Slot 11. The following screen displays:
From:
uSlot 11
To:
Drv 1
#
*MKYVI0SEH9RPSEH*VSQ)RXV]7GVIIR
When you have scrolled to your desired source, press the )RXIV button to select it. Two
changes occur in the display.
• The ✶ reappears at the beginning of line 2, indicating that you have made a
selection
• The u moves to line 4, indicating that you can select a destination.
From:
✶Slot 11
To:
u✶Drv 1
*MKYVI0SEH9RPSEH8S)RXV]7GVIIR
Press the )RXIV button to select Drive 1 as the destination.
The Confirmation Screen displays:
From: Slot 11 To: Drv 1
ENTER to Execute
ESCAPE to Cancel
*MKYVI0SEH9RPSEH8S)RXV]7GVIIR
AIT LoaderXpress
3-21
OPERATION
Press the )RXIV button to execute the load or unload or the Escape button to cancel
or return to the From entry screen.
When you press the )RXIV button, the following screen displays. If the source is a
drive, the word Unload displays in place of the word Load on line 4.
From: Slot 11 To: Drv 1
Load In Progress
*MKYVI0SEH9RPSEH-R4VSKVIWW7GVIIR
When the load or unload operation is finished, the Default Screen reappears.
-RWIVXMRKERH6IQSZMRK'EVXVMHKIW
Before inserting or removing cartridges, remove the tape magazine from the AIT
LoaderXpress. Make sure the slot you want to use is not already reserved for a
cartridge in a drive. Unload all drives, either through your host computer software
or by using the Load/Unload command on the Main Menu, described earlier in this
chapter.
Make sure the Control Panel is unlocked. When the Control Panel is locked, it is
impossible to enter the Menu Mode. The host computer must allow removal of the
magazine. The host software can enable or disable the door unlock function using
the SCSI Prevent/Allow Medium Removal command. If the host is preventing
removal, when you select Unlock Door on the Main Menu and press the Enter
button, the message Magazine Locked is displayed.
The host software should be able to release the magazine without shutting down. If
host computer failure prevents the host from releasing the lock, cycle power to the
unit.
238)-J]SYWXMPPGERRSXSTIRXLIQEKE^MRIHSSVGEPP3ZIVPERH8IGLRMGEP7YTTSVX
JSVEWWMWXERGI
3-22
AIT LoaderXpress
OPERATION
6IQSZMRKXLI1EKE^MRI
Whenever a magazine is in place inside the module it is locked in place to prevent
tampering or accidental removal. To remove the magazine, enter the Menu Mode by
pressing the )RXIV button at the Default Screen. At the Main Menu, select Remove
Magazine and press the )RXIV button. The magazine door swings open.
238)-JEJEYPXSGGYVWXLEXTVIZIRXWVIQSZMRKXLIQEKE^MRIGSRXEGX3ZIVPERH8IGLRMGEP
7YTTSVXJSVEWWMWXERGI
1EKE^MRIMR4PEGI
*MKYVI1EKE^MRI-R4PEGI
AIT LoaderXpress
3-23
OPERATION
-RWIVXMRK'EVXVMHKIWMRXSXLI1EKE^MRI
A full magazine is shown in the following illustration. Insert cartridges so that the
label end with the write protect switch is outward, with the write protect switch
toward the bottom of the magazine. The lowest numbered cartridge slot in the
magazine is next to the mail slot. The mail slot is closest to the handle.
7PSX
7PSX
*MKYVI8ETI1EKE^MRI;MXL'EVXVMHKIW-RWXEPPIH
-RWIVXMRKXLI1EKE^MRI
If the magazine door on the front of the AIT LoaderXpress is closed and locked,
open it, as follows. Enter the Menu Mode by pressing the )RXIV button at the
Default Screen. At the Main Menu, select Remove Magazine and press the )RXIV
button. The magazine door swings open. Slide the magazine through the door
opening, with the cartridges protruding from the left. When the magazine is fully
inserted, push the door closed until it locks.
3-24
AIT LoaderXpress
OPERATION
9WMRKXLI1EMP7PSX
The mail slot is used only with host software that supports this feature. To access the
mail slot from the Default Screen, press the )WGETI button to enter the Status Mode.
Press the )RXIV button and the magazine door opens, exposing the Mail Slot. The
magazine remains locked inside the module. Tilt the Mail Slot forward to insert or
remove a cartridge. After inserting or removing a cartridge, close the magazine door.
1EMP7PSX
*MKYVI1EMP7PSX0SGEXMSR
8ETI'EVXVMHKI6IUYMVIQIRXW
The AIT LoaderXpress uses Advanced Intelligent Tape (AIT) 8 mm tape cartridges.
8]TI
'ETEGMX]
18&*
4EVX2YQFIV
%-8
+&
LVW
TEGO
,ERHPMRKERH7XSVMRK
Handle and store tape cartridges in a clean, dust-free environment.
AIT LoaderXpress
3-25
OPERATION
;VMXI4VSXIGXMRK'EVXVMHKIW
To write protect a tape cartridge (disable data recording), slide the write protect
switch up so that no orange color is visible in the lower small window. To enable
data recording, slide the write protect switch down until the orange indicator
shows in both small windows.
6$)(
5(&
*MKYVI8ETI'EVXVMHKI;VMXI4VSXIGXMSR7[MXGL
3-26
AIT LoaderXpress
OPERATION
&EVGSHI0EFIPW
Barcode labels should meet the following specifications:
• Size: 55 mm x 10.2 mm
• Stock: Label stock with adhesive back and matte overlaminate
• Location: Mounts next to write-protect switch on cartridge
• Text: Six characters, any combination of alphabetic and numeric
• Bar Code: Code 39, Codabar, 3-of-9, standard 2-of-5, or interleaved 2-of-5,
with a length of eight digits. Minimum element width is 7.5 mm
0EFIP7M^I
QQ
\
QQ
*MKYVI&EVGSHI0EFIP
Prepackaged sets are available from Overland Data under part number 106075-001.
The package includes 60 data cartridge labels, and 12 cleaning cartridge labels.
AIT LoaderXpress
3-27
OPERATION
3-28
AIT LoaderXpress
'LETXIV1EMRXIRERGI
-RXVSHYGXMSR
This chapter describes running a cleaning cartridge and using the demo menu to test
the robotics.
Access these options from the Maintenance Menu.
The other options on the Maintenance Menu should be performed by a qualified
service technician.
6YRRMRK%'PIERMRK'EVXVMHKI
There are two ways to run a cleaning cartridge:
• Automatically-by enabling the Auto Clean option
• Manually-by selecting the Clean Drive command from the Maintenance
Submenu on the front panel display
%YXSQEXMGEPP]
You can configure the AIT LoaderXpress so that it runs the cleaning cartridge
automatically. Because the cleaning cartridge is abrasive, you should not use it unless
Use Cleaner displays on the control panel screen. The Auto Clean option operates
after the first unload operation completes and the LED comes on.
AIT LoaderXpress
4-1
MAINTENANCE
6YRRMRK%'PIERMRK'EVXVMHKI9WMRK%YXS'PIER
1) Reserve a slot as the cleaning slot:
• Refer to “Setting Up Reserved Slots” in Chapter 2.
• If you have more than one reserved slot, the Cleaning Slot is the
first reserved slot. Reserved slots are at the back of the magazine.
2) Install a cleaning cartridge into Reserved Slot #1.
3) Enable the Auto Clean option on the Configuration Menu:
• From the Main Menu, select Library Options / Auto Clean /
Enabled.
1ERYEPP]
You can manually run a cleaning cartridge.
6YRRMRK%'PIERMRK'EVXVMHKI1ERYEPP]
The following instructions discribe how to manually run a cleaning cartridge in
your AIT LoaderXpress:
1) Install the cleaning cartridge into any slot. In this example, we use Slot
1.
2) At the Default Screen, press the )RXIV button. The Main Menu screen
displays:
uLoad/Unload
Remove Magazine
Maintenance Menu
Configure Menu
*MKYVI1EMR1IRY
4-2
AIT LoaderXpress
$
MAINTENANCE
3) Scroll down to the Maintenance Menu and press the Enter button. The
screen displays the Maintenance Submenu:
uClean Drive
Diagnostic Menu
Demo Menu
Flash Update
$
*MKYVI1EMRXIRERGI7YFQIRY
4) Press the )RXIV button once to select Clean Drive. The screen displays the
Cleaning Submenu:
u
Cleaning:
✶Drv 1
Using:
✶Slot 1
*MKYVI'PIERMRK7YFQIRY
5) Press the )RXIV button to accept Drive1. The u moves to line 4 of the
display. The choices available on Line 4 are slots 1 through 19. Press the
)RXIV button again to use the cartridge in Slot 1.
238)-J]SYGERRSXYWIWPSXJSVXLIGPIERMRKGEVXVMHKI]SYGERWGVSPPPMRIXSWIPIGX
ERSXLIVWPSX
The Cleaning Confirmation Screen displays:
Cleaning:
Drive 1
Using:
Slot 1
ENTER to Execute
ESCAPE to Cancel
*MKYVI'PIERMRK'SRJMVQEXMSR7GVIIR
6) As the confirmation screen indicates, to execute the cleaning operation,
press the )RXIV button. If the confirmation screen does not show your
intended drive and cleaning cartridge, press the )WGETI
AIT LoaderXpress
4-3
MAINTENANCE
When you press the )RXIV button, the Cleaning In Progress screen displays:
button to return to the Cleaning submenu.
Cleaning:
Using:
Drive 1
Slot 1
Cleaning in Progress
*MKYVI'PIERMRK-R4VSKVIWW7GVIIR
When the cleaning operation is completed, the Default Screen reappears.
6IQSZMRKXLI'PIERMRK'EVXVMHKI
1) Examine the Default Screen on the AIT LoaderXpress to make sure the
cleaning cartridge has been unloaded from the drive. If not, then
unload it using the Load/Unload Menu, as described in Chapter 3 Operation.
2) Remove the magazine from the AIT Loaderxpress (refer to “Inserting
and Removing Cartridges” in Chapter 3).
3) Remove the cleaning cartridge from the magazine.
4) Insert any desired data cartridge into the slot vacated by the cleaning
cartridge.
5) Insert the magazine into the AIT LoaderXpress.
6) Close the magazine door.
9WMRKXLI(IQS7YFQIRY
Use this option to fully exercise the library robotics.
1) From the Maintenance Menu, select the Demo Submenu.
2) Select Demo 1.
The library robotics begin to move cartridges randomly from slot to slot,
displaying the number of passes on the screen.
4-4
AIT LoaderXpress
MAINTENANCE
If all slots in the magazine are full, Demo 1 loads a cartridge into Drv1 and leaves it
there. If you press the p button while Demo 1 is running, the AIT LoaderXpress loads
a cartridge into Drv1, unless Drv1 is full. If you press the p button again, the cartridge
is unloaded from Drv1 and returned to the magazine.
Demo 1 runs continuously as long as the AIT LoaderXpress has power.
4EYWMRK(IQS
To pause the test, press and hold the )WGETI button until a flashing message displays
that the test is paused.
7XSTTMRK(IQS
To stop the test, press the )WGETI button a second time to return to the Main Menu.
AIT LoaderXpress
4-5
MAINTENANCE
4-6
AIT LoaderXpress
'LETXIV8VSYFPIWLSSXMRK
-RXVSHYGXMSR
There are two types of problems that can cause AIT LoaderXpress by Overland Data,
Inc. to malfunction:
• Platform Problems
• General Drive Errors
4PEXJSVQ4VSFPIQW
These errors are caused by incorrect installation and configuration; the AIT
LoaderXpress displays as if operating normally, but no data can be interchanged. You
may or may not get an error code on the control panel. To identify an error caused by
this type of problem, check your installation and configuration setup, referring back
to Chapter 3 - Operation.
+IRIVEP(VMZI)VVSVW
General Drive Errors usually result from:
• A miscommunication between a module’s processor and a drive processor,
or
• A mechanical malfunction within the AIT LoaderXpress
Both platform problems and general drive errors display an error message and a Fault
System Code (FSC) on the control panel. Use the FSC to report errors to your
Technical Support Representative, or, in some cases, to determine a recovery
procedure.
AIT LoaderXpress
5-1
TROUBLESHOOTING
A simple error recovery procedure is displayed on the bottom line of the control
panel display. You can clear some errors by pressing the Enter button on the
control panel, or by cycling the power to the AIT LoaderXpress.
)VVSV6IGSZIV]
The following flow chart outlines the recommended steps for error recovery. You
should follow this chart in all cases.
TROUBLESHOOTING
AND ERROR RECOVERY
PLATFORM
No FSC displayed. Normal front
panel operation.
Cycle the power
to the drive
Follow the ERP on
the Control Panel
Retry
Find the FSC in
Table 5-2
Check configuration
in Chapter 2
Find the ERP in
Table 5-1
Call Technical Support
Call Technical Support
CARTRIDGE ERROR
FSC may or may not be displayed
Cartridge will not eject
Normal operation impossible
*MKYVI8VSYFPIWLSSXMRK*PS['LEVX
5-2
AIT LoaderXpress
TROUBLESHOOTING
)VVSV6IGSZIV]4VSGIHYVIW)64
Table 5-1 lists error recovery procedures for errors reported on the front panel of the
AIT LoaderXpress. This list includes only those procedures that may be safely
performed by an operator. The Service Manual includes additional procedures that
may be performed by a qualified service technician.
8EFPI)VVSV6IGSZIV]4VSGIHYVIW
)64'SHI
4VSGIHYVI(IWGVMTXMSR
'
']GPITS[IVXSXLI%-80SEHIV<TVIWWYWMRKXLI%'W[MXGLSR
XLIJVSRXTERIP;EMXWIGSRHWXSTS[IVSREKEMR
(
8YVRSJJTS[IVXSXLI%-80SEHIV<TVIWWERHMRWTIGX
GSRRIGXSVWERHGEFPIW
*
-RZEPMHSTIVEXMSR7IPIGXTEVEQIXIVWGSVVIGXP]ERHXV]EKEMR
+
'EPP8IGLRMGEP7YTTSVX
*EYPX7]QTXSQ'SHIW*7'
Fault Symptom Codes appear in the Fault Screen described in Chapter 3 - Operation.
Each FSC is accompanied by a descriptive message and instructions for clearing the
fault, see Table 5-2. If a fault persists, look up the FSC in the following table to
determine the error recovery procedure or to report to your Technical Support
Representative.
8EFPI*EYPX7]WXIQ'SHIW
*7''SHI
1IWWEKI
4MGOIV8VMIW)WGH
'(+
4S[IV(S[RXS'PIEV
4MGOIV8EGL)VVSVW
4S[IV(S[RXS'PIEV
AIT LoaderXpress
(+
5-3
TROUBLESHOOTING
8EFPI*EYPX7]WXIQ'SHIW
*7''SHI
1IWWEKI
)PIZEXSV8EGL)VVSVW
4S[IV(S[RXS'PIEV
)PIZEXSV.EQQIH
(+
'(+
4S[IV(S[RXS'PIEV
4MGOIV.EQQIH
'(+
4S[IV(S[RXS'PIEV
%PP(VMZIW7PSXW)QTX]
*
4VIWW)RXIVXS'PIEV
%PP(VMZIW7PSXW*YPP
4VIWW)RXIVXS'PIEV
*
%PP(VMZIW*YPP
4VIWW)RXIVXS'PIEV
*
%-8%PVIEH]0SEHIH
4VIWW)RXIVXS'PIEV
*
)\TMVIH'PIERMRK'EVX
*
4VIWW)RXIVXS'PIEV
2SXE'PIERMRK'EVX
*
4VIWW)RXIVXS'PIEV
238)-JERIVVSVQIWWEKIHMWTPE]WXLEXMWRSXMRGPYHIHMRXLMWXEFPI[VMXIHS[RXLI
JEYPXGSHIRYQFIVERHJSPPS[XLIVIGSZIV]TVSGIHYVIHIWGVMFIHSRPMRISJ
XLIHMWTPE]-JXLIWEQIIVVSVSGGYVWEKEMRGEPP]SYV8IGLRMGEP7YTTSVX
6ITVIWIRXEXMZI
5-4
AIT LoaderXpress
%TTIRHM\%7TIGMJMGEXMSRW
8EFPI%3TIVEXMSREP4IVJSVQERGI
(IWGVMTXMSR
7TIGMJMGEXMSR
,SWX-RXIVJEGI
0:(7)
2YQFIVSJ'EVXVMHKIW*YPP1EKE^MRI
1IHMEX]TI
%-8QQ%HZERGIH1IXEP)ZETSVEXIH
2YQFIVSJ(VMZIW
0408&0406&
7(<'0
0SEH8MQI
WIGQE\MRGPYHMRKTMGOMRKJVSQWPSX
9RPSEH8MQI
WIGQE\MRGPYHMRKTMGOMRKJVSQWPSX
6I[MRH7TIIH
MRGLIWWIG%PPQSHIPW
7YWXEMRIHREXMZIHEXEXVERWJIVVEXIQE\MQYQ
XS+&LV%-8
%-80SEHIV<TVIWWREXMZIHEXEGETEGMX]*YPP
1EKE^MRI
+&%8-
%-80SEHIV<TVIWWGSQTVIWWIHEWWYQIW
HEXEGETEGMX]*YPP1EKE^MRI
+&%-8
AIT LoaderXpress
A-1
8EFPI%6IPMEFMPMX](VMZIW
(IWGVMTXMSR
7TIGMJMGEXMSR
F]XIW
(EXE)VVSV6EXI
MR
18&*
LVW$HYX]G]GPI
LVW$
1886
%-8QQ%HZERGIH1IXEP)ZETSVEXIH
,IEH0MJI
XETIQSXMSRLVW
8EFPI%6IPMEFMPMX]0MFVEV]6SFSXMGW
(IWGVMTXMSR
7TIGMJMGEXMSR
0MJI)\TIGXERG]0SEH9RPSEH3TIVEXMSRW
G]GPIW
(IWMKR0MJI
]IEVW
8EFPI%4S[IV
(IWGVMTXMSR
A-2
7TIGMJMGEXMSR
:SPXEKI
:%'
'YVVIRX
EQTVIW
0MRI*VIUYIRG]
,IVX^
AIT LoaderXpress
8EFPI%1IGLERMGEP
(IWGVMTXMSR
7TIGMJMGEXMSR
,IMKLX
MRGQ
;MHXL
MRGQ
(ITXL
3ZIVEPP
&ILMRH4ERIP
MRGQ
MRGQ
;IMKLX
PFWOK
8EFPI%)RZMVSRQIRXEP
(IWGVMTXMSR
7TIGMJMGEXMSR
3TIVEXMRK
(V]&YPF8IQTIVEXYVI
­*XS­*­'XS­'
8IQTIVEXYVI+VEHMIRX
­*QMR­'QMR
8IQTIVEXYVI7LSGO
­*­'SZIVQMR
;IX&YPF8IQTIVEXYVI
­*­'
6IPEXMZI,YQMHMX]RSRGSRHIRWMRK
XS
,YQMHMX]+VEHMIRX
LSYV
%PXMXYHI
JXXSJXQXSQ
2SR3TIVEXMRK4EGOIHSV9RTEGOIH
(V]&YPF8IQTIVEXYVI
­*XS­*­'XS­'
8IQTIVEXYVI+VEHMIRX
­*­'LSYVEGVSWWXLIVERKI
8IQTIVEXYVI7LSGO
­*­'SZIVQMR
;IX&YPF8IQTIVEXYVI
­*­'
6IPEXMZI,YQMHMX]RSRGSRHIRWMRK
XS
AIT LoaderXpress
A-3
8EFPI%)RZMVSRQIRXEP
(IWGVMTXMSR
7TIGMJMGEXMSR
,YQMHMX]+VEHMIRX
LSYV
%PXMXYHI
JXXSJXQXSQ
7XSVEKI8VERWMX
A-4
(V]&YPF8IQTIVEXYVI
­*XS­*­'XS­'
8IQTIVEXYVI+VEHMIRX
­*­'LSYVEGVSWWXLIVERKI
8IQTIVEXYVI7LSGO
­*­'SZIVQMR
;IX&YPF8IQTIVEXYVI
­*­'
6IPEXMZI,YQMHMX]RSRGSRHIRWMRK
XS
,YQMHMX]+VEHMIRX
LSYV
%PXMXYHI
JXXSJXQXSQ
AIT LoaderXpress
%GSYWXMG)QMWWMSRW
7EJIX]
All models carry the Regulatory Agency product safety certifications Listed in
Table A-8.
8EFPI%%GSYWXMG
(IWGVMTXMSR
(VMZI-R9WI-RXIVQMXXIRXVSFSXQSXMSR
I\GITXIH
7TIGMJMGEXMSR
H&%
8EFPI%6IKYPEXSV]%KIRG]'IVXMJMGEXMSRW
'IVXMJMGEXMSR
7XERHEVH
900MWXIH
90
89:4VSHYGX7IVZMGI
)2
+71EVO')1EVOMRK
)1'(MVIGXMZI
0S[:SPXEKI(MVIGXMZI
'EREHMER900MWXIH
'7%2S
AIT LoaderXpress
A-5
)PIGXVSQEKRIXMG)QMWWMSRW
2SXMGI
This equipment has been tested using double shielded cables for EMI compliance.
The use of unshielded cables or modifications requires system testing for EMI
testing for compliance to the standard.
-RHYWXV]'EREHE
This Class A digital apparatus meets all requirements of the Canadian
Interference-causing Equipment Standard ICES-003 Class A.
-RHYWXVMI'EREHE
Cet appareil numérique de la classe A respecte toutes les exigencies du Standard
ICES-003 classe A sur le matériel brouilleur du Canada.
*''2SXMGI
This equipment has been tested and found to comply with the limits for a Class A
digital device, pursuant to Part 15 of the FCC rules. These limits are designed to
provide reasonable protection against harmful interference when the equipment is
operated in a commercial environment. This equipment generates, uses and can
radiate radio frequency energy and, if not installed and used in accordance with
the instruction manual, may cause harmful interference to radio communications.
Operation of this equipment in a residential area is likely to cause harmful
interference in which case the user will be required to correct the interference at
their own expense.
A-6
AIT LoaderXpress
.ETERIWI:SPYRXEV]'SRXVSP'SYRGMPJSV-RXIVJIVIRGI:''-
AIT LoaderXpress
A-7
8VERWPEXMSR
This is a Class A product based on the standard of the Voluntary Control
Council for Interference by Information Technology Equipment (VCCI). If
this equipment is used in a domestic environment, radio disturbance may
occur, in which case the user may be required to take corrective actions.
A-8
AIT LoaderXpress
%TTIRHM\&7TEVIWERH%GGIWWSVMIW
8EFPI&%-80SEHIV<TVIWW¬7TEVIWERH%GGIWWSVMIW
(IWGVMTXMSR
4EVX2YQFIV
%HHSR6ITPEGIQIRX(VMZI%-80:(7)
3:0<%
%-8'SRXVSPPIV
0:(7)
%-8+&1IHME%-8TEGO
%-8'PIERMRK'EVXVMHKITEGO
&EV'SHI0EFIPW%-8'EVXVMHKI'VX'PR
'EFPI7IX7LYXXPI
'SRZIVWMSR/MX8EFPIXSTXS6EGOQSYRX%-8
)\XIRWMSR4MIGILMKL
,EVRIWW7IX(VMZI'EFPI
,EVRIWW7IX4S[IV
1EKE^MRIWPSX
4S[IV7YTTP]
4S[IV7[MXGL
7LYXXPI%WW][4;&
7SPIRSMH%WW]
AIT LoaderXpress
B-1
B-2
AIT LoaderXpress
Index
A
%-80MFVEV]<TVIWW
GSRJMKYVEXMSRWQSHIPRYQFIVW 1-2
JIEXYVIW1-6
%YXSGPIERSTXMSRIREFPI 4-2
EYXSVERKMRKTS[IV 1-7
EYXSVITIEXJIEXYVI3-4
EYXSQEXMGGPIERMRK4-1
B
&EV'SHI
GLIGOHMKMXSTXMSR 2-25
0EFIP%PMKRQIRXWTIGMJ] 2-25
0EFIP7M^IWTIGMJ] 2-25
PEFIPTEVXRYQFIV B-1
PEFIPWHIGVMTXMSRSJ 3-27
VIEHIVHIGVMTXMSR 1-8
&EYHVEXI
HIGVMTXMSR 2-24
HIJEYPX2-242-27
WIXXMRKW 2-27
&YJJIVHVMZIWM^I 1-9
&YW
0:(PIRKXLPMQMXEXMSRW 1-5
7'7-TIVJSVQERGIGSRWMHIVEXMSRW 1-4
&YXXSRWGSRXVSPTERIP
)RXIV 3-3
)WGETI 3-3
7GVSPP(S[R 3-3
7GVSPP9T3-3
C
'EFPIW
EXXEGLMRKTS[IVGSVH 2-15
EXXEGLMRK7'7-GSRRIGXMSRW 2-15
WTIGMJMGEXMSRW 2-16
'EVXVMHKIQEKE^MRI
HIWGVMTXMSR 1-7
MRWIVXMSR 3-24
1EMP7PSXYWMRK 3-25
VIQSZEP 3-23
WIGYVMX]PSGO 1-7
'EVXVMHKIQEKE^MRI 1-7
'PIERMRKGEVXVMHKI
VYRRMRK 4-1
'SQTVIWWMSRHIWGVMTXMSR 1-9
'SRJMKYVEXMSR
&YW0IRKXL0MQMXEXMSRW 1-5
'EFPMRK 1-5
'SRJMKYVEXMSR)\EQTPI
WIXXMRK7'7--( 2-17
'SRJMKYVI7YFQIRYWGVIIR 2-18
'SRRIGXSVW7'7- 2-14
'SRXVSP4ERIP
&YXXSR*YRGXMSRW 3-3
HMWTPE] 1-6
'SRXVSP4ERIP 1-6
D
(EXE8VERWJIV6EXI 1-4
(IJEYPX7GVIIR
4VMQEV] 2-17
7IGSRHEV] 2-18
(IJEYPXW
&EVGSHISTXMSRW 2-27
)PIQIRX&EWISTXMSRW 2-28
PMFVEV]STXMSRW 2-27
7'7-STXMSRW 2-26
7IVMEP2YQFIVSTXMSRW 2-28
7IX(IJEYPXSTXMSR 2-28
(IWOXSTQSHIPWIXXMRKYT 2-4
(MEKRSWXMGW 1-9
AIT LoaderXpress
Index-1
Index
(VMZI
&YW-(HIWGVMTXMSR 2-22
(VMZI'ETEGMX]
%-8 1-10
(VMZI)VVSVW 5-1
E
)PIQIRX7XEXYWMRMXMEPM^I 2-23
)QFIHHIH(MEKRSWXMGW
')(MEKRSWXMGW 1-9
4S[IV3R7IPJ8IWX4SWX 1-9
9WIV(MEKRSWXMGW 1-9
)VVSV
'LIGOMRK 1-9
6IGSZIV] 5-2
6IGSZIV]*PS[GLEVX 5-2
6IGSZIV]4VSGIHYVIW 5-3
F
*ER 1-8
*EYPX7GVIIR 3-8
*EYPX7]QTXSQ'SHIW 5-3
*VSRXTERIPPSGOMRK 3-17
*7''SHIW 5-3
I
-QTSVX)\TSVXSTXMSR
HIJEYPX 2-28
HIWGVMTXMSR 2-25
-RMXMEPM^EXMSR7GVIIRW 3-6
L
0MFVEV]
&YW-(HIWGVMTXMSR 2-22
0MFVEV]7XEXYW1IRY 3-11
4EVMX]HIWGVMTXMSR 2-22
Index-2
0MFVEV]4VS
QSHIPRYQFIVFVIEOHS[R1-2
QSHIPW 1-2
9RTEGOMRK 2-1
0SGOHS[R1IGLERMWQ
PSGOMRK 2-3
VIPIEWMRK 2-3
WGVI[ 2-2
0S[4VSJMPIWGVI[W 2-8
M
1EMP7PSX
PSGEXMSR 3-25
1EMRQIRYWGVIIR 2-18
1IHME0MJI1-10
1YPXMWIVZIVWLEVMRK1-3
N
2IKSXMEXMSR1SHI2-22
O
3ZIVPERH(EXE-RG
'SRXEGX-RJSVQEXMSR 1-ii
7EPIW 1-ii
8IGLRMGEP7YTTSVX 1-ii
P
4PEXJSVQTVSFPIQW 5-1
4S[IV7YTTP]
EYXSVERKMRK1-7
JVIUIRG]VERKI 1-7
ZSPXEKIVERKIW1-7
4S[IV7YTTP]1-7
R
6EGO1SYRXQSHIPWIXXMRKYT2-5
AIT LoaderXpress
Index
6IEH]-RHMGEXSV 3-3
6IWIVZI7PSXW
HIWGVMTXMSR 2-25
RYQFIVMRK 2-20
WIXXMRKYT 2-20
6SFSXMGW
HIWGVMTXMSR1-8
S
7'7-
EVGLMXIGXYVIHIWGVMTXMSR 2-15
&YW'SRWMHIVEXMSRW 1-4
GEFPIW 2-14
HIJEYPXW 2-26
MRXIVJEGIGSRRIGXSVW 2-14
MRXIVJEGIW 1-1
QSHIHIWGVMTXMSR 2-23
QSHIHIJEYPX 2-23
STXMSRW 2-222-26
4L]WMGEPGSRJMKYVEXMSR1-5
XIVQMREXSV 2-14
7'7-MRMXMEXSV 1-3
7'7-MRXIVJEGI 1-3
7'7-3TXMSRW7YFQIRY 2-18
7IGYVMX]1IRY
GLERKIYRPSGOGSHI 3-17
7IGYVMX]1IRY 3-17
7IX(IJEYPXSTXMSR 2-26
7TIGMJMGEXMSRW
FEVGSHIPEFIP 3-27
IRZMVSRQIRXEP A-3
MRXIVJEGIGEFPIW 2-16
QIGLERMGEP A-3
STIVEXMSREPTIVJSVQERGI A-1
TS[IV A-2
VIPMEFMPMX] A-2
T
8ETI%PIVX1SHI 2-23
8ETI'EVXVMHKI
'ETEGMX] 3-25
,ERHPMRK 3-25
6IUYMVIQIRXW 3-25
;VMXITVSXIGXMSR 3-253-26
8VERWJIVVEXI
%-8 1-4
8VERWJIV6EXIWIXHEXESTXMSR 2-22
8VSYFPIWLSSXMRK
*EYPX7]QTXSQ'SHIW 5-3
U
9RTEGOMRKXLI0MFVEV]4VS 2-1
9WI'PIERIVMRHMGEXSV 3-3
AIT LoaderXpress
Index-3
Was this manual useful for you? yes no
Thank you for your participation!

* Your assessment is very important for improving the work of artificial intelligence, which forms the content of this project

Download PDF

advertisement