(OHFWULF *($SSOLDQFHVFRP 6DIHW\,QVWUXFWLRQV 2ZQHU·V0DQXDO

(OHFWULF *($SSOLDQFHVFRP 6DIHW\,QVWUXFWLRQV 2ZQHU·V0DQXDO
)UHH6WDQGLQJ6OLGH,QDQG'URS,Q(OHFWULF
5DQJHV
*($SSOLDQFHVFRP
(VSDxRO
)RUD6SDQLVKYHUVLRQRIWKLVPDQXDOYLVLW
RXU:HEVLWHDW*($SSOLDQFHVFRP
3DUDFRQVXOWDUXQDYHUVLRQHQHVSDxRO
GHHVWHPDQXDOGHLQVWUXFFLRQHVYLVLWH
QXHVWURVLWLRGHLQWHUQHW
*($SSOLDQFHVFRP
6DIHW\,QVWUXFWLRQV ²
2SHUDWLQJ,QVWUXFWLRQV
2ZQHU·V0DQXDO
.LWFKHQ7LPHU 2YHQ ²
$GMXVW2YHQ7KHUPRVWDW %DNLQJRU5RDVWLQJ %URLOLQJ%URLOLQJ*XLGH &RQWUROV &RQYHFWLRQ2YHQ 3L]]D 3UHKHDWLQJ 3UREH 6DEEDWK)HDWXUH 6HOI&OHDQLQJ
6ORZ&RRNDQG:DUPLQJ)HDWXUHV 6SHFLDO)HDWXUHV 6WHDP&OHDQ 7LPHG%DNLQJDQG5RDVWLQJ :DUPLQJ'UDZHU 6XUIDFH8QLWV ²
&RRNZDUH *ODVV&RRNWRS :DUPLQJ=RQH 1H[W6WHS&RQWURO
&DUHDQG&OHDQLQJ
$OXPLQXP)RLO &RQWURO3DQHO *ODVV&RRNWRS /LIW2II2YHQ'RRU /LJKW 2YHQ)ORRU 2YHQ+HDWLQJ(OHPHQWV 5DFNV 5HPRYDEOH:DUPLQJ'UDZHU'UDZHU3DQ 6WRUDJH'UDZHU 6XUIDFHV 9HQW 7URXEOHVKRRWLQJ7LSV $FFHVVRULHV &RQVXPHU6XSSRUW
&RQVXPHU6XSSRUW %DFN&RYHU
:DUUDQW\ :ULWHWKHPRGHODQGVHULDO
QXPEHUVKHUH
0RGHOBBBBBBBBBBBBBBBB
6HULDO BBBBBBBBBBBBBBBB
,Q&DQDGD
ZZZ*($SSOLDQFHVFD
3ULQWHGLQWKH8QLWHG6WDWHV
<RXFDQILQGWKHPRQDODEHO
EHKLQGWKHGUDZHURUEHKLQGWKH
ORZHURYHQGRRURQWKHIURQWRI
WKHUDQJHIUDPH
3ULQWHGRQ
5HF\FOHG3DSHU
*(
,03257$176$)(7<,1)250$7,21
5($'$//,16758&7,216%()25(86,1*
:$51,1*
5HDGDOOVDIHW\LQVWUXFWLRQVEHIRUHXVLQJWKHSURGXFW)DLOXUHWRIROORZWKHVHLQVWUXFWLRQVPD\UHVXOWLQILUHHOHFWULFVKRFN
VHULRXVLQMXU\RUGHDWK
$17,7,3'(9,&(
7RUHGXFHWKHULVNRIWLSSLQJWKH
UDQJHWKHUDQJHPXVWEHVHFXUHG
E\DSURSHUO\LQVWDOOHGDQWLWLS
Tip-Over Hazard
EUDFNHW6HHLQVWDOODWLRQLQVWUXFWLRQV
A child or adult can tip the range and be killed.
VKLSSHGZLWKWKHEUDFNHWIRU
Verify the anti-tip bracket has been properly installed
FRPSOHWHGHWDLOVEHIRUHDWWHPSWLQJ
and engaged.
WRLQVWDOO
Ensure the anti-tip bracket is re-engaged when the range
is moved.
)RU)UHHVWDQGLQJDQG6OLGH,Q
5DQJHV
Do not operate the range without the anti-tip bracket in
place and engaged.
7RFKHFNLIWKHEUDFNHWLVLQVWDOOHG
Failure to follow these instructions can result in death or
DQGHQJDJHGSURSHUO\ORRN
serious burns to children or adults.
XQGHUQHDWKWKHUDQJHWRVHHWKDW
WKHUHDUOHYHOLQJOHJLVHQJDJHG
LQWKHEUDFNHW2QVRPHPRGHOVWKHVWRUDJHGUDZHURUNLFNSDQHOFDQEH
$QWL7LS
UHPRYHGIRUHDV\LQVSHFWLRQ,IYLVXDOLQVSHFWLRQLVQRWSRVVLEOHVOLGHWKH
%UDFNHW
UDQJHIRUZDUGFRQILUPWKHDQWLWLSEUDFNHWLVVHFXUHO\DWWDFKHGWRWKHIORRU
RUZDOODQGVOLGHWKHUDQJHEDFNVRWKHUHDUOHYHOLQJOHJLVXQGHUWKHDQWLWLS
EUDFNHW
,IWKHUDQJHLVSXOOHGIURPWKHZDOOIRUDQ\UHDVRQDOZD\VUHSHDWWKLV
/HYHOLQJ/HJ
SURFHGXUHWRYHULI\WKHUDQJHLVSURSHUO\VHFXUHGE\WKHDQWLWLSEUDFNHW
)UHHVWDQGLQJDQG6OLGH,Q5DQJHV 1HYHUFRPSOHWHO\UHPRYHWKHOHYHOLQJOHJVRUWKHUDQJHZLOOQRWEHVHFXUHG
WRWKHDQWLWLSGHYLFHSURSHUO\
)RU'URS,Q5DQJHV
Countertop or
7RFKHFNLIWKHEUDFNHWLVLQVWDOOHGDQGHQJDJHGSURSHUO\VOLGHWKHUDQJH
Wood Block
IRUZDUGFRQILUPWKHDQWLWLSEUDFNHWLVVHFXUHO\DWWDFKHGWRWKHUHDURIWKH
UDQJHDQGVOLGHWKHUDQJHEDFNVRWKDWWKHDQWLWLSEUDFNHWVOLGHVMXVWXQGHU
WKHFRXQWHUWRSRUZRRGEORFNDWWDFKHGWRWKHUHDUZDOO
,I\RXGLGQRWUHFHLYHDQDQWLWLSEUDFNHWZLWK\RXUSXUFKDVHFDOO
WRUHFHLYHRQHDWQRFRVWLQ&DQDGDFDOO
)RULQVWDOODWLRQLQVWUXFWLRQVRIWKHEUDFNHWYLVLW*($SSOLDQFHVFRPLQ
Anti-Tip
&DQDGD*($SSOLDQFHVFD
Bracket
Oven
Rear Wall
WARNING
'URS,Q5DQJHV
:$51,1*
,03257$176$)(7<127,&(
7KH&DOLIRUQLD6DIH'ULQNLQJ:DWHUDQG7R[LF(QIRUFHPHQW$FWUHTXLUHVWKH*RYHUQRURI&DOLIRUQLDWRSXEOLVKDOLVWRIVXEVWDQFHV
NQRZQWRWKHVWDWHWRFDXVHFDQFHUELUWKGHIHFWVRURWKHUUHSURGXFWLYHKDUPDQGUHTXLUHVEXVLQHVVHVWRZDUQFXVWRPHUVRISRWHQWLDO
H[SRVXUHWRVXFKVXEVWDQFHV
7KHILEHUJODVVLQVXODWLRQLQVHOIFOHDQRYHQVJLYHVRIIDYHU\VPDOODPRXQWRIFDUERQPRQR[LGHGXULQJWKHFOHDQLQJF\FOH([SRVXUHFDQ
EHPLQLPL]HGE\YHQWLQJZLWKDQRSHQZLQGRZRUXVLQJDYHQWLODWLRQIDQRUKRRG
*($SSOLDQFHVFRP
:$51,1* *(1(5$/6$)(7<,16758&7,216
„8VHWKLVDSSOLDQFHIRULWVLQWHQGHGSXUSRVHDVGHVFULEHGLQWKLV
2ZQHU·V0DQXDO
„%HVXUH\RXUDSSOLDQFHLVSURSHUO\LQVWDOOHGDQGJURXQGHGE\D
TXDOLILHGLQVWDOOHULQDFFRUGDQFHZLWKWKHSURYLGHGLQVWDOODWLRQ
LQVWUXFWLRQV
„
'RQRWDWWHPSWWRUHSDLURUUHSODFHDQ\SDUWRI\RXUUDQJHXQOHVV
LWLVVSHFLILFDOO\UHFRPPHQGHGLQWKLVPDQXDO$OORWKHUVHUYLFLQJ
VKRXOGEHWUDQVIHUUHGWRDTXDOLILHGWHFKQLFLDQ
„
%HIRUHSHUIRUPLQJDQ\VHUYLFHXQSOXJWKHUDQJHRUGLVFRQQHFW
WKHSRZHUVXSSO\DWWKHKRXVHKROGGLVWULEXWLRQSDQHOE\UHPRYLQJ
WKHIXVHRUVZLWFKLQJRIIWKHFLUFXLWEUHDNHU
„
'RQRWOHDYHFKLOGUHQDORQH³FKLOGUHQVKRXOGQRWEHOHIWDORQH
RUXQDWWHQGHGLQDQDUHDZKHUHDQDSSOLDQFHLVLQXVH7KH\
VKRXOGQHYHUEHDOORZHGWRFOLPEVLWRUVWDQGRQDQ\SDUWRIWKH
DSSOLDQFH
&$87,21
„
'RQRWVWRUHLWHPVRILQWHUHVWWRFKLOGUHQ
DERYHDUDQJHRURQWKHEDFNJXDUGRIDUDQJH³FKLOGUHQFOLPELQJ
RQWKHUDQJHWRUHDFKLWHPVFRXOGEHVHULRXVO\LQMXUHG
„
8VHRQO\GU\SRWKROGHUV³PRLVWRUGDPSSRWKROGHUVRQKRW
VXUIDFHVPD\UHVXOWLQEXUQVIURPVWHDP'RQRWOHWSRWKROGHUV
WRXFKKRWVXUIDFHXQLWVRUKHDWLQJHOHPHQWV'RQRWXVHDWRZHO
RURWKHUEXON\FORWKLQSODFHRISRWKROGHUV
„'RQRWWRXFKWKHVXUIDFHXQLWVWKHKHDWLQJHOHPHQWVRUWKH
LQWHULRUVXUIDFHRIWKHRYHQ7KHVHVXUIDFHVPD\EHKRWHQRXJK
WREXUQHYHQWKRXJKWKH\DUHGDUNLQFRORU'XULQJDQGDIWHUXVH
GRQRWWRXFKRUOHWFORWKLQJRURWKHUIODPPDEOHPDWHULDOVFRQWDFW
WKHVXUIDFHXQLWVDUHDVQHDUE\WKHVXUIDFHXQLWVRUDQ\LQWHULRU
DUHDRIWKHRYHQDOORZVXIILFLHQWWLPHIRUFRROLQJILUVW2WKHU
VXUIDFHVRIWKHDSSOLDQFHPD\EHFRPHKRWHQRXJKWRFDXVH
EXUQV3RWHQWLDOO\KRWVXUIDFHVLQFOXGHWKHFRRNWRSDUHDVIDFLQJ
WKHFRRNWRSRYHQYHQWRSHQLQJVXUIDFHVQHDUWKHRSHQLQJDQG
FUHYLFHVDURXQGWKHRYHQGRRU
„'RQRWKHDWXQRSHQHGIRRGFRQWDLQHUV3UHVVXUHFRXOGEXLOGXS
DQGWKHFRQWDLQHUFRXOGEXUVWFDXVLQJDQLQMXU\
„
'RQRWXVHDOXPLQXPIRLOWROLQHWKHGULSSDQVRUDQ\ZKHUHLQWKH
RYHQH[FHSWDVGHVFULEHGLQWKLVPDQXDO0LVXVHFRXOGUHVXOWLQ
GDPDJHWRWKHUDQJHDQGVKRFNRUILUHKD]DUG
„
$
YRLGVFUDWFKLQJRULPSDFWLQJJODVVGRRUVFRRNWRSVRUFRQWURO
SDQHOV'RLQJVRPD\OHDGWRJODVVEUHDNDJH'RQRWFRRNRQD
SURGXFWZLWKEURNHQJODVV6KRFNILUHRUFXWVPD\RFFXU
„&RRNPHDWDQGSRXOWU\WKRURXJKO\³PHDWWRDWOHDVWDQLQWHUQDO
WHPSHUDWXUHRIƒ)DQGSRXOWU\WRDWOHDVWDQLQWHUQDO
WHPSHUDWXUHRIƒ)&RRNLQJWRWKHVHWHPSHUDWXUHVXVXDOO\
SURWHFWVDJDLQVWIRRGERUQHLOOQHVV
„
1
HYHUXVH\RXUDSSOLDQFHIRUZDUPLQJRUKHDWLQJWKHURRP
:$51,1* .((3)/$00$%/(0$7(5,$/6$:$<)520
7+(5$1*(
„'RQRWVWRUHRUXVHIODPPDEOHPDWHULDOVLQDQRYHQRUQHDU
WKHFRRNWRSLQFOXGLQJSDSHUSODVWLFSRWKROGHUVOLQHQVZDOO
FRYHULQJVFXUWDLQVGUDSHVDQGJDVROLQHRURWKHUIODPPDEOH
YDSRUVDQGOLTXLGV
„1HYHUZHDUORRVHILWWLQJRUKDQJLQJJDUPHQWVZKLOHXVLQJ
WKHDSSOLDQFH7KHVHJDUPHQWVPD\LJQLWHLIWKH\FRQWDFWKRW
VXUIDFHVFDXVLQJVHYHUHEXUQV
„
'
RQRWOHWFRRNLQJJUHDVHRURWKHUIODPPDEOHPDWHULDOV
DFFXPXODWHLQRUQHDUWKHUDQJH*UHDVHLQWKHRYHQRURQWKH
FRRNWRSPD\LJQLWH
„
&OHDQYHQWLODWLQJKRRGVIUHTXHQWO\*UHDVHVKRXOGQRWEHDOORZHG
WRDFFXPXODWHRQWKHKRRGRUILOWHU
:$51,1* ,17+((9(172)$),5(7$.(7+()2//2:,1*67(36
7235(9(177+(),5()520635($',1*
„'RQRWXVHZDWHURQJUHDVHILUHV1HYHUSLFNXSDIODPLQJSDQ
7XUQWKHFRQWUROVRII6PRWKHUDIODPLQJSDQRQDVXUIDFHXQLWE\
FRYHULQJWKHSDQFRPSOHWHO\ZLWKDZHOOILWWLQJOLGFRRNLHVKHHW
RUIODWWUD\8VHDPXOWLSXUSRVHGU\FKHPLFDORUIRDPW\SHILUH
H[WLQJXLVKHU
„
,
IWKHUHLVDILUHLQWKHRYHQGXULQJVHOIFOHDQWXUQWKHRYHQ
RIIDQGZDLWIRUWKHILUHWRJRRXW'RQRWIRUFHWKHGRRURSHQ
,QWURGXFWLRQRIIUHVKDLUDWVHOIFOHDQWHPSHUDWXUHVPD\OHDGWR
DEXUVWRIIODPHIURPWKHRYHQ)DLOXUHWRIROORZWKLVLQVWUXFWLRQ
PD\UHVXOWLQVHYHUHEXUQV
„,IWKHUHLVDILUHLQWKHRYHQGXULQJEDNLQJVPRWKHUWKHILUHE\
FORVLQJWKHRYHQGRRUDQGWXUQLQJWKHRYHQRIIRUE\XVLQJD
PXOWLSXUSRVHGU\FKHPLFDORUIRDPW\SHILUHH[WLQJXLVKHU
,03257$176$)(7<,1)250$7,21
5($'$//,16758&7,216%()25(86,1*
:$51,1* &22.7236$)(7<,16758&7,216
„ 1HYHUOHDYHWKHVXUIDFHXQLWVXQDWWHQGHGDWPHGLXPRU „ 2QO\FHUWDLQW\SHVRIJODVVJODVVFHUDPLFHDUWKHQZDUH
RURWKHUJOD]HGFRQWDLQHUVDUHVXLWDEOHIRUFRRNWRS
KLJKKHDWVHWWLQJV%RLORYHUVFDXVHVPRNLQJDQGJUHDV\
VHUYLFHRWKHUVPD\EUHDNEHFDXVHRIWKHVXGGHQ
VSLOORYHUVWKDWPD\FDWFKRQILUH
FKDQJHLQWHPSHUDWXUH
„ 1HYHUOHDYHRLOXQDWWHQGHGZKLOHIU\LQJ,IDOORZHGWR
„ 7RPLQLPL]HWKHSRVVLELOLW\RIEXUQVLJQLWLRQRI
KHDWEH\RQGLWVVPRNLQJSRLQWRLOPD\LJQLWHUHVXOWLQJ
IODPPDEOHPDWHULDOVDQGVSLOODJHWKHKDQGOHRID
LQILUHWKDWPD\VSUHDGWRVXUURXQGLQJFDELQHWV8VHD
FRQWDLQHUVKRXOGEHWXUQHGWRZDUGWKHFHQWHURIWKH
GHHSIDWWKHUPRPHWHUZKHQHYHUSRVVLEOHWRPRQLWRURLO
UDQJHZLWKRXWH[WHQGLQJRYHUQHDUE\VXUIDFHXQLWV
WHPSHUDWXUH
:KHQSUHSDULQJIODPLQJIRRGVXQGHUDKRRGWXUQWKH
„
7RDYRLGRLOVSLOORYHUDQGILUHXVHDPLQLPXPDPRXQWRI „
IDQRQ
RLOZKHQVKDOORZSDQIU\LQJDQGDYRLGFRRNLQJIUR]HQ
IRRGVZLWKH[FHVVLYHDPRXQWVRILFH
„
,ISRZHULVORVWWRDQHOHFWULFFRRNWRSZKLOHDVXUIDFH
XQLWLV21WKHVXUIDFHXQLWZLOOWXUQEDFN21DVVRRQ
„
8VHSURSHUSDQVL]H³VHOHFWFRRNZDUHKDYLQJIODW
DVSRZHULVUHVWRUHG,QWKHHYHQWRISRZHUORVVIDLOXUH
ERWWRPVODUJHHQRXJKWRFRYHUWKHVXUIDFHKHDWLQJ
WRWXUQDOOVXUIDFHXQLWNQREVWRWKH2))SRVLWLRQPD\
HOHPHQW7KHXVHRIXQGHUVL]HGFRRNZDUHZLOOH[SRVH
UHVXOWLQLJQLWLRQRILWHPVRQRUQHDUWKHFRRNWRSOHDGLQJ
DSRUWLRQRIWKHVXUIDFHXQLWWRGLUHFWFRQWDFWDQGPD\
WRVHULRXVLQMXU\RUGHDWK
UHVXOWLQLJQLWLRQRIFORWKLQJ3URSHUUHODWLRQVKLSRI
FRRNZDUHWRVXUIDFHXQLWZLOODOVRLPSURYHHIILFLHQF\
:$51,1*
VRPHPRGHOV
5$',$17&22.7236$)(7<,16758&7,216
„
8VH&(5$0$%5<7(ŠFHUDPLF&RRNWRS&OHDQHUDQG
&(5$0$%5<7(Š&OHDQLQJ3DGWRFOHDQWKHFRRNWRS
:DLWXQWLOWKHFRRNWRSFRROVDQGWKHLQGLFDWRUOLJKW
JRHVRXWEHIRUHFOHDQLQJ$ZHWVSRQJHRUFORWKRQD
„ 'RQRWFRRNRQDEURNHQFRRNWRS,IJODVVFRRNWRS
KRWVXUIDFHFDQFDXVHVWHDPEXUQV6RPHFOHDQHUV
VKRXOGEUHDNFOHDQLQJVROXWLRQVDQGVSLOORYHUV
FDQSURGXFHQR[LRXVIXPHVLIDSSOLHGWRDKRWVXUIDFH
PD\SHQHWUDWHWKHEURNHQFRRNWRSDQGFUHDWHD
127(6XJDUVSLOOVDUHDQH[FHSWLRQ7KH\VKRXOGEH
ULVNRIHOHFWULFVKRFN&RQWDFWDTXDOLILHGWHFKQLFLDQ
VFUDSHGRIIZKLOHVWLOOKRWXVLQJDQRYHQPLWWDQGD
LPPHGLDWHO\
VFUDSHU6HHWKH&OHDQLQJWKHJODVVFRRNWRSVHFWLRQIRU
GHWDLOHGLQVWUXFWLRQV
„
$YRLGVFUDWFKLQJWKHJODVVFRRNWRS7KHFRRNWRSFDQEH
VFUDWFKHGZLWKLWHPVVXFKDVNQLYHVVKDUSLQVWUXPHQWV
„ 5HDGDQGIROORZDOOLQVWUXFWLRQVDQGZDUQLQJVRQWKH
ULQJVRURWKHUMHZHOU\DQGULYHWVRQFORWKLQJ
FOHDQLQJFUHDPODEHO
„
'RQRWSODFHRUVWRUHLWHPVWKDWFDQPHOWRUFDWFKILUH
„ 'RQRWXVHDOXPLQXPIRLOWROLQHGULSSDQV)RLOFDQWUDS
RQWKHJODVVFRRNWRSHYHQZKHQLWLVQRWEHLQJXVHG,I
KHDWRUPHOWUHVXOWLQJLQGDPDJHWRWKHSURGXFWDQGD
WKHFRRNWRSLVLQDGYHUWHQWO\WXUQHGRQWKH\PD\LJQLWH
VKRFNRUILUHKD]DUG
+HDWIURPWKHFRRNWRSRURYHQYHQWDIWHULWLVWXUQHGRII
PD\FDXVHWKHPWRLJQLWHDOVR
„ 8VHFDUHZKHQWRXFKLQJWKHFRRNWRS7KHJODVVVXUIDFH
RIWKHFRRNWRSZLOOUHWDLQKHDWDIWHUWKHFRQWUROVKDYH
EHHQWXUQHGRII
:$51,1*
VRPHPRGHOV
&2,/&22.7236$)(7<,16758&7,216
„'RQRWLPPHUVHRUVRDNWKHUHPRYDEOHVXUIDFHXQLWV
'RQRWSXWWKHPLQDGLVKZDVKHU'RQRWVHOIFOHDQWKH
VXUIDFHXQLWVLQDQRYHQ'RLQJVRPD\FDXVHWKHPWR
IDLOSUHVHQWLQJDEXUQRUILUHKD]DUG
„7RDYRLGWKHSRVVLELOLW\RIDEXUQRUHOHFWULFVKRFNDOZD\V
EHFHUWDLQWKDWWKHFRQWUROVIRUDOOVXUIDFHXQLWVDUHDWWKH
2))SRVLWLRQDQGDOOFRLOVDUHFRROEHIRUHDWWHPSWLQJWROLIW
RUUHPRYHDFRLOVXUIDFHXQLW
„
%HVXUHWKHGULSSDQVDUHQRWFRYHUHGDQGDUHLQSODFH
7KHLUDEVHQFHGXULQJFRRNLQJFRXOGGDPDJHUDQJH
SDUWVDQGZLULQJ
„
'RQRWXVHDOXPLQXPIRLOWROLQHGULSSDQV)RLOFDQWUDS
KHDWRUPHOWUHVXOWLQJLQGDPDJHWRWKHSURGXFWDQGD
VKRFNRUILUHKD]DUG
*($SSOLDQFHVFRP
:$51,1*
29(16$)(7<,16758&7,216
„ 6WDQGDZD\IURPWKHUDQJHZKHQRSHQLQJWKHRYHQ
GRRU+RWDLURUVWHDPZKLFKHVFDSHVFDQFDXVHEXUQV
WRKDQGVIDFHDQGRUH\HV
„ .HHSWKHRYHQYHQWXQREVWUXFWHG
„
.HHSWKHRYHQIUHHIURPJUHDVHEXLOGXS*UHDVHLQWKH
RYHQPD\LJQLWH
„
3ODFHRYHQUDFNVLQGHVLUHGORFDWLRQZKLOHRYHQLVFRRO
,IUDFNPXVWEHPRYHGZKLOHRYHQLVKRWGRQRWOHWSRW
KROGHUFRQWDFWKRWKHDWLQJHOHPHQWLQRYHQ
„ :KHQXVLQJFRRNLQJRUURDVWLQJEDJVLQWKHRYHQ
IROORZWKHPDQXIDFWXUHU·VGLUHFWLRQV
:$51,1*
6RPHPRGHOV
„ 3XOOWKHRYHQUDFNWRWKHVWRSORFNSRVLWLRQZKHQ
ORDGLQJDQGXQORDGLQJIRRGIURPWKHRYHQ7KLVKHOSV
SUHYHQWEXUQVIURPWRXFKLQJKRWVXUIDFHVRIWKHGRRU
DQGRYHQZDOOV
„
'
RQRWOHDYHLWHPVVXFKDVSDSHUFRRNLQJXWHQVLOVRU
IRRGLQWKHRYHQZKHQQRWLQXVH,WHPVVWRUHGLQDQ
RYHQFDQLJQLWH
„
'RQRWXVHDOXPLQXPIRLOWROLQHWKHRYHQERWWRP)RLO
PD\WUDSRUUHIOHFWKHDWOHDGLQJWRDVKRFNRUILUH
KD]DUG
6(/)&/($1,1*29(16$)(7<,16758&7,216
7KHVHOIFOHDQLQJIHDWXUHRSHUDWHVWKHRYHQDWWHPSHUDWXUHVKLJKHQRXJKWREXUQDZD\IRRGVRLOVLQWKHRYHQ
)ROORZWKHVHLQVWUXFWLRQVIRUVDIHRSHUDWLRQ
„ %HIRUHRSHUDWLQJWKHVHOIFOHDQF\FOHUHPRYHSDQV
VKLQ\PHWDORYHQUDFNVDQGRWKHUXWHQVLOVIURPWKH
RYHQ2QO\JUD\RUEODFNSRUFHODLQFRDWHGRYHQUDFNV
DQGGULSSDQVPD\EHOHIWLQWKHRYHQ'RQRWXVH
VHOIFOHDQWRFOHDQRWKHUSDUWVVXFKDVVKLQ\GULSSDQV
RUERZOV
„ %HIRUHRSHUDWLQJWKHVHOIFOHDQF\FOHZLSHJUHDVHDQG
IRRGVRLOVIURPWKHRYHQ([FHVVLYHDPRXQWRIJUHDVH
PD\LJQLWHOHDGLQJWRVPRNHGDPDJHWR\RXUKRPH
„
,IWKHVHOIFOHDQLQJPRGHPDOIXQFWLRQVWXUQWKHRYHQ
RIIDQGGLVFRQQHFWWKHSRZHUVXSSO\+DYHLWVHUYLFHG
E\DTXDOLILHGWHFKQLFLDQ
„
'RQRWFOHDQWKHGRRUJDVNHW7KHGRRUJDVNHWLV
HVVHQWLDOIRUDJRRGVHDO&DUHVKRXOGEHWDNHQQRWWR
UXEGDPDJHRUPRYHWKHJDVNHW
„
'RQRWXVHRYHQFOHDQHUV1RFRPPHUFLDORYHQFOHDQHU
RURYHQOLQHUSURWHFWLYHFRDWLQJRIDQ\NLQGVKRXOGEH
XVHGLQRUDURXQGDQ\SDUWRIWKHRYHQ
:$51,1* :$50,1*'5$:(5/2:(529(1'5$:(56$)(7<
,16758&7,216VRPHPRGHOV
„
8VHFDUHZKHQRSHQLQJWKHGUDZHU2SHQWKHGUDZHUD
„ 7KHSXUSRVHRIWKHZDUPLQJGUDZHULVWRKROGKRW
FUDFNDQGOHWKRWDLURUVWHDPHVFDSHEHIRUHUHPRYLQJRU
FRRNHGIRRGVDWVHUYLQJWHPSHUDWXUH%DFWHULDZLOOJURZ
UHSODFLQJIRRG+RWDLURUVWHDPWKDWHVFDSHVFDQFDXVH
LQIRRGZKLOHLWLVEHORZƒ)'RQRWSXWFROGIRRG
EXUQVWRKDQGVIDFHDQGRUH\HV
LQZDUPLQJGUDZHU'RQRWKHDWIRRGIRUPRUHWKDQ
KRXUV)DLOXUHWRIROORZWKHVHLQVWUXFWLRQVPD\UHVXOWLQ
„
'RQRWXVHDOXPLQXPIRLOWROLQHWKHORZHUGUDZHU7KH
IRRGERUQHLOOQHVV
IRLOZLOOWUDSKHDWEHORZDQGXSVHWWKHSHUIRUPDQFH
RIWKHRYHQ)RLOFDQPHOWDQGSHUPDQHQWO\GDPDJH
„ 'RQRWOHDYHSDSHUSURGXFWVSODVWLFVFDQQHGIRRGRU
WKHGUDZHUERWWRP'DPDJHIURPLPSURSHUXVHRI
FRPEXVWLEOHPDWHULDOVLQWKHGUDZHU7KH\PD\LJQLWH
DOXPLQXPIRLOLVQRWFRYHUHGE\WKHSURGXFWZDUUDQW\
„
'RQRWWRXFKWKHKHDWLQJHOHPHQWRUWKHLQWHULRUVXUIDFH
RIWKHGUDZHU7KHVHVXUIDFHVPD\EHKRWHQRXJKWR
FDXVHEXUQV
8VLQJWKHVXUIDFHXQLWV
),5(+$=$5'1HYHUOHDYHWKHUDQJHXQDWWHQGHGZLWKWKHFRRNWRSRQPHGLXPRUKLJK
VHWWLQJV.HHSIODPPDEOHLWHPVDZD\IURPWKHFRRNWRS7XUQRIIDOOFRQWUROVZKHQ
GRQHFRRNLQJ)DLOXUHWRIROORZWKHVHLQVWUXFWLRQVFDQUHVXOWLQILUHVHULRXVLQMXU\RU
GHDWK
7KURXJKRXWWKLVPDQXDOIHDWXUHVDQGDSSHDUDQFHPD\YDU\IURP\RXUPRGHO
:$51,1*
6XUIDFH8QLW&RRN6HWWLQJV
7KHSRZHUOHYHOZLWKDIUDFWLRQ
LQGLFDWHVWKHDGGLWLRQDO
KDOIVWHSVHWWLQJ<RXPD\
KHDUFOLFNLQJVRXQGVLQGLFDWLQJ
WKHFRQWUROLVPDLQWDLQLQJ\RXU
GHVLUHGVHWWLQJ
7KHFRRNWRSRIIHUVSRZHUOHYHOV3RZHU
OHYHOVUDQJHIURP´/µWR+,LQSUHFLVHKDOIVWHS
LQFUHPHQWV)RUH[DPSOHDQG
XSWR+,
127(:KHQFKDQJLQJIURPDKLJKKHDWVHWWLQJ
WRDORZHUKHDWVHWWLQJWKHVXUIDFHXQLWPD\
VWRSJORZLQJ7KLVLVQRUPDO7KHXQLWLVVWLOORQ
DQGKRW
3RZHU/HYHO´/µWKHORZHVWVHWWLQJLV
UHFRPPHQGHGIRU´.HHS:DUPµ
127(7KLVFRRNWRSKDVDUDSLGKHDWXSIHDWXUH
,IWKHFRRNWRSLVFRROZKHQWXUQHGRQLWZLOO
JORZUHGIRUDVKRUWSHULRGRIWLPHXQWLOWKH
GHVLUHGSRZHUVHWWLQJLVUHDFKHG
7KHSRZHUOHYHOLQFUHDVHVRQHKDOIOHYHOZLWK
HDFKWRXFK
6LQJOH6XUIDFH8QLW³&RRN6HWWLQJV
7RWXUQRQDVLQJOHVXUIDFHXQLW
7RXFKWKH212))SDGWKHQWRXFKWKH
²SDG
8VHWKH²SDGWRFKRRVHWKHGHVLUHG
SRZHUVHWWLQJ
7RXVHWKH0HOWIHDWXUH
7RXFKWKH212))SDGWKHQWRXFK0(/7
7KHHOHPHQWZLOODXWRPDWLFDOO\VHWWRD
SUHGHWHUPLQHGVHWWLQJDQG´/µZLOOEHGLVSOD\HG
7RWXUQRIIDVLQJOHVXUIDFHXQLWWRXFKWKH21
2))SDGDJDLQ
7RXVHWKH6LPPHUIHDWXUH
7RXFKWKH212))SDGWKHQWRXFK6,00(5
7KHHOHPHQWZLOODXWRPDWLFDOO\VHWWRD
SUHGHWHUPLQHGVHWWLQJDQG´µZLOOEHGLVSOD\HG
$GMXVWXVLQJWKH²SDGWRLQFUHDVHRU
GHFUHDVHWKHVLPPHUUDWH
0XOWL5LQJ%XUQHUFDQEHGXDORUWULSOHGHSHQGLQJRQPRGHO
7RXFKWKH212))SDGIRUWKHULJKWIURQW
VXUIDFHXQLW
8VHWKH²SDGWRVHWWKHGHVLUHGSRZHU
VHWWLQJ
7RXFKWKH%851(56,=(SDGDVQHHGHGWR
VHOHFWWKHGHVLUHGEXUQHUVL]H
7KHOLJKWQH[WWRWKH%851(56,=(SDG
LQGLFDWHVZKLFKVL]HWKHVXUIDFHXQLWLVRQ
7RWXUQWKHVXUIDFHXQLWRIIWRXFKWKH212))
SDG
6HHSDJHIRUDGGLWLRQDOLQIRUPDWLRQ
*($SSOLDQFHVFRP
:$51,1*
)22'32,621+$=$5'%DFWHULDPD\JURZLQIRRGDWWHPSHUDWXUHVEHORZƒ)
‡$OZD\VVWDUWZLWKKRWIRRG'RQRWXVHZDUPVHWWLQJVWRKHDWFROGIRRG
‡'RQRWZDUPIRRGIRUPRUHWKDQKRXUV
)DLOXUHWRIROORZWKHVHLQVWUXFWLRQVPD\UHVXOWLQIRRGERUQHLOOQHVV
8VLQJWKH:DUPLQJ=RQHRQVRPHPRGHOV
7KH:$50,1*=21(LVORFDWHGLQWKHEDFN
FHQWHURIWKHJODVVVXUIDFH
WARMING ZONE
7RXVHWKH:$50,1*=21(
7RXFKWKH:$50,1*=21(212))SDG
SELECT
ON
OFF
)RUEHVWUHVXOWVDOOIRRGVRQWKH:$50,1*
=21(VKRXOGEHFRYHUHGZLWKDOLGRUDOXPLQXP
IRLO
$OZD\VXVHSRWKROGHUVRURYHQPLWWVZKHQ
UHPRYLQJIRRGIURPWKH:$50,1*=21(DV
FRRNZDUHZLOOEHKRW
7RVHOHFWWKHGHVLUHGFRQWUROVHWWLQJWRXFK
WKH6(/(&7SDGRQFHIRU/2WZLFHIRU0(' ‡'RQRWXVHSODVWLFZUDSWRFRYHUIRRG3ODVWLF
RUWKUHHWLPHVIRU+,
PD\PHOWRQWRWKHVXUIDFHDQGEHYHU\
GLIILFXOWWRFOHDQ
7RWXUQRIIWKH:$50,1*=21(
7RXFKWKH:$50,1*=21(212))SDG
‡8VHRQO\FRRNZDUHUHFRPPHQGHGIRUWRSRI
UDQJHFRRNLQJ
8VLQJWKHVXUIDFHXQLWV
+RPH&DQQLQJ7LSV
%HVXUHWKHFDQQHULVFHQWHUHGRYHUWKHVXUIDFH
XQLW
0DNHVXUHWKHFDQQHULVIODWRQWKHERWWRP
7RSUHYHQWEXUQVIURPVWHDPRUKHDWXVH
FDXWLRQZKHQFDQQLQJ
8VHUHFLSHVDQGSURFHGXUHVIURPUHSXWDEOH
VRXUFHV7KHVHDUHDYDLODEOHIURP
PDQXIDFWXUHUVVXFKDV%DOOŠDQG.HUUŠDQGWKH
'HSDUWPHQWRI$JULFXOWXUH([WHQVLRQ6HUYLFH
)ODWERWWRPHGFDQQHUVDUHUHFRPPHQGHG8VH
RIZDWHUEDWKFDQQHUVZLWKULSSOHGERWWRPV
PD\H[WHQGWKHWLPHUHTXLUHGWREULQJWKH
ZDWHUWRDERLO
)RU0RGHOV:LWKD5DGLDQW*ODVV&RRNWRS
1HYHUFRRNGLUHFWO\RQWKHJODVV
$OZD\VXVHFRRNZDUH
$OZD\VSODFHWKHSDQLQWKHFHQWHURI
WKHVXUIDFHXQLW\RXDUHFRRNLQJRQ
7KHUDGLDQWFRRNWRSIHDWXUHVKHDWLQJXQLWV
EHQHDWKDVPRRWKJODVVVXUIDFH
127($VOLJKWRGRULVQRUPDOZKHQDQHZ
FRRNWRSLVXVHGIRUWKHILUVWWLPH,WLVFDXVHG
E\WKHKHDWLQJRIQHZSDUWVDQGLQVXODWLQJ
PDWHULDOVDQGZLOOGLVDSSHDULQDVKRUWWLPH
127(2QPRGHOVZLWKOLJKWFRORUHGJODVV
FRRNWRSVLWLVQRUPDOIRUWKHFRRNLQJ]RQHVWR
FKDQJHFRORUZKHQKRWRUFRROLQJGRZQ7KLVLV
WHPSRUDU\DQGZLOOGLVDSSHDUDVWKHJODVVFRROV
WRURRPWHPSHUDWXUH
7KHVXUIDFHXQLWZLOOF\FOHRQDQGRIIWR
PDLQWDLQ\RXUVHOHFWHGFRQWUROVHWWLQJ
,WLVVDIHWRSODFHKRWFRRNZDUHRQWKHJODVV
VXUIDFHHYHQZKHQWKHFRRNWRSLVFRRO
(YHQDIWHUWKHVXUIDFHXQLWVDUHWXUQHGRIIWKH
JODVVFRRNWRSUHWDLQVHQRXJKKHDWWRFRQWLQXH
FRRNLQJ7RDYRLGRYHUFRRNLQJUHPRYHSDQV
IURPWKHVXUIDFHXQLWVZKHQWKHIRRGLVFRRNHG
$YRLGSODFLQJDQ\WKLQJRQWKHVXUIDFHXQLWXQWLO
LWKDVFRROHGFRPSOHWHO\
'RQRWVOLGHFRRNZDUHDFURVVWKHFRRNWRSEHFDXVH
LWFDQVFUDWFKWKHJODVV³WKHJODVVLVVFUDWFKUHVLVWDQW
QRWVFUDWFKSURRI
■:DWHUVWDLQVPLQHUDOGHSRVLWVDUH
UHPRYDEOHXVLQJWKHFOHDQLQJFUHDPRUIXOO
VWUHQJWKZKLWHYLQHJDU
■8VHRIZLQGRZFOHDQHUPD\OHDYHDQ
LULGHVFHQWILOPRQWKHFRRNWRS7KHFOHDQLQJ
FUHDPZLOOUHPRYHWKLVILOP
■'RQ·WVWRUHKHDY\LWHPVDERYHWKHFRRNWRS,I
WKH\GURSRQWRWKHFRRNWRSWKH\FDQFDXVH
GDPDJH
■'RQRWXVHWKHVXUIDFHDVDFXWWLQJERDUG
7HPSHUDWXUH/LPLWHURQ5DGLDQW*ODVV&RRNWRSV
(YHU\UDGLDQWVXUIDFHXQLWKDVDWHPSHUDWXUH
OLPLWHU
7KHWHPSHUDWXUHOLPLWHUPD\F\FOHWKHVXUIDFH
XQLWVRIIIRUDWLPHLI
7KHWHPSHUDWXUHOLPLWHUSURWHFWVWKHJODVV
FRRNWRSIURPJHWWLQJWRRKRW
■WKHSDQERLOVGU\
■WKHSDQERWWRPLVQRWIODW
■WKHSDQLVRIIFHQWHU
■WKHUHLVQRSDQRQWKHXQLW
6HOHFWLQJW\SHVRIFRRNZDUHIRU
UDGLDQWJODVVFRRNWRSPRGHOV
*($SSOLDQFHVFRP
7KHIROORZLQJLQIRUPDWLRQZLOOKHOS\RXFKRRVHFRRNZDUHZKLFKZLOOJLYHJRRGSHUIRUPDQFHRQJODVVFRRNWRSV
&KHFNSDQVIRUIODWERWWRPVE\
XVLQJDVWUDLJKWHGJH
6WDLQOHVV6WHHO
3RUFHODLQ(QDPHORQ&DVW,URQ
UHFRPPHQGHG
UHFRPPHQGHGLIERWWRPRISDQLVFRDWHG
$OXPLQXP
3RUFHODLQ(QDPHORQ6WHHO
KHDY\ZHLJKWUHFRPPHQGHG
*RRGFRQGXFWLYLW\$OXPLQXPUHVLGXHV
VRPHWLPHVDSSHDUDVVFUDWFKHVRQWKHFRRNWRS
EXWFDQEHUHPRYHGLIFOHDQHGLPPHGLDWHO\
%HFDXVHRILWVORZPHOWLQJSRLQWWKLQZHLJKW
DOXPLQXPVKRXOGQRWEHXVHG
QRWUHFRPPHQGHG
+HDWLQJHPSW\SDQVFDQFDXVHSHUPDQHQW
GDPDJHWRFRRNWRSJODVV7KHHQDPHOFDQPHOW
DQGERQGWRWKHFHUDPLFFRRNWRS
&RSSHU%RWWRP
UHFRPPHQGHG
&RSSHUPD\OHDYHUHVLGXHVZKLFKFDQDSSHDU
DVVFUDWFKHV7KHUHVLGXHVFDQEHUHPRYHGDV
ORQJDVWKHFRRNWRSLVFOHDQHGLPPHGLDWHO\
+RZHYHUGRQRWOHWWKHVHSRWVERLOGU\
2YHUKHDWHGPHWDOFDQERQGWRJODVVFRRNWRSV
$QRYHUKHDWHGFRSSHUERWWRPSRWZLOOOHDYHD
UHVLGXHWKDWZLOOSHUPDQHQWO\VWDLQWKHFRRNWRS
LIQRWUHPRYHGLPPHGLDWHO\
3DQVZLWKURXQGHGFXUYHG
ULGJHGRUZDUSHGERWWRPVDUHQRW
UHFRPPHQGHG
*ODVVFHUDPLF
QRWUHFRPPHQGHG
3RRUSHUIRUPDQFH:LOOVFUDWFKWKHVXUIDFH
6WRQHZDUH
QRWUHFRPPHQGHG
3RRUSHUIRUPDQFH0D\VFUDWFKWKHVXUIDFH
&DVW,URQ
QRWUHFRPPHQGHG³XQOHVVGHVLJQHGVSHFLILFDOO\
IRUJODVVFRRNWRSV
3RRUFRQGXFWLYLW\DQGVORZWRDEVRUEKHDW:LOO
VFUDWFKWKHFRRNWRSVXUIDFH
127()ROORZDOOFRRNZDUHPDQXIDFWXUHU·VUHFRPPHQGDWLRQVZKHQXVLQJDQ\W\SHRIFRRNZDUHRQ
WKHFHUDPLFFRRNWRS
)RU%HVW5HVXOWV
■3ODFHRQO\GU\SDQVRQWKHVXUIDFH
HOHPHQWV'RQRWSODFHOLGVRQWKHVXUIDFH
HOHPHQWVSDUWLFXODUO\ZHWOLGV:HWSDQV
DQGOLGVPD\VWLFNWRWKHVXUIDFHZKHQFRRO
'RQRWSODFHZHWSDQV
RQWKHJODVVFRRNWRS
■'RQRWXVHZRNVWKDWKDYHVXSSRUWULQJV
7KLVW\SHRIZRNZLOOQRWKHDWRQJODVV
VXUIDFHHOHPHQWV
'RQRWXVHZRNVZLWKVXSSRUW
ULQJVRQWKHJODVVFRRNWRS
■:HUHFRPPHQGWKDW\RXXVHRQO\DIODW
ERWWRPHGZRN7KH\DUHDYDLODEOHDW\RXU
ORFDOUHWDLOVWRUH7KHERWWRPRIWKHZRN
VKRXOGKDYHWKHVDPHGLDPHWHUDVWKH
VXUIDFHHOHPHQWWRHQVXUHSURSHUFRQWDFW
8VHIODWERWWRPHGZRNV
RQWKHJODVVFRRNWRS
■6RPHVSHFLDOFRRNLQJSURFHGXUHVUHTXLUH
VSHFLILFFRRNZDUHVXFKDVSUHVVXUH
FRRNHUVRUGHHSIDWIU\HUV$OOFRRNZDUH
PXVWKDYHIODWERWWRPVDQGEHWKHFRUUHFW
VL]H
8VLQJWKHRYHQFRQWUROV
7KURXJKRXWWKLVPDQXDOIHDWXUHVDQGDSSHDUDQFHPD\YDU\IURP\RXUPRGHO
%52,/+,/23DG
7RXFKWKLVSDGWRVHOHFWWKHEURLOIXQFWLRQ6HHWKH
+RZWR6HWWKH2YHQIRU%URLOLQJVHFWLRQ
29(1/,*+73DG
7RXFKWRWXUQWKHRYHQOLJKWVRQRURII
%$.(3DG
7RXFKWKLVSDGWRVHOHFWWKHEDNHIXQFWLRQ6HH
WKH+RZWR6HWWKH2YHQIRU%DNLQJVHFWLRQ
&219(&7,21&22.3DG
8VHVDIDQWRFLUFXODWHDLULQWKHRYHQ6HHWKH
8VLQJWKHFRQYHFWLRQRYHQVHFWLRQ
7,0(5212))3DGV
7RXFKWRVHWWKHNLWFKHQWLPHU
6HHWKH8VLQJWKH.LWFKHQ7LPHUVHFWLRQ
&22.7,0(7,0(3DG
:$503DG
7RXFKWRNHHSFRRNHGIRRGVZDUP
6HHWKH+RZWR6HWWKH2YHQIRU:DUPLQJVHFWLRQ
7RXFKWKLVSDGDQGWKHQWRXFKWKHQXPEHUSDGV
WRVHWWKHDPRXQWRIWLPH\RXZDQW\RXUIRRG
WRFRRN7KHRYHQZLOOVKXWRIIZKHQWKHFRRNLQJ
WLPHKDVUXQRXW
6/2:&22.3DG
'(/$<67$573DG
7RXFKIRUORQJKRXUVRIXQDWWHQGHGFRRNLQJ
6HHWKH+RZWR6HWWKH2YHQIRU6ORZ&RRN
VHFWLRQ
352%(3DG
7RXFKZKHQXVLQJWKHSUREHWRDXWRPDWLFDOO\
FRRNWRDGHVLUHGLQWHUQDOIRRGWHPSHUDWXUH
6HHWKH8VLQJWKH3UREHVHFWLRQ
7RXFKWKLVSDGWRVHWWKHRYHQWRVWDUW
DXWRPDWLFDOO\DWDWLPH\RXVHW
&/2&.3DG
6(/)&/($13DG
127(:KHQVHWWLQJWLPHV\RXDUHVHWWLQJKRXUV
DQGPLQXWHVRQO\7KHORZHVWWLPH\RXFDQVHWLV
RQHPLQXWH
7KHFORFNPXVWEHVHWWRWKHFRUUHFWWLPHRIGD\
IRUWKHDXWRPDWLFRYHQWLPLQJIXQFWLRQVWRZRUN
SURSHUO\7KHWLPHRIGD\FDQQRWEHFKDQJHG
GXULQJDWLPHGEDNLQJRUVHOIFOHDQLQJF\FOH
67($0&/($13DG
6HH7RVHWWKHFORFNVHFWLRQ
&/($52))3DG
,I\RXURYHQZDVVHWIRUDWLPHGRYHQRSHUDWLRQ
DQGDSRZHURXWDJHRFFXUUHGWKHFORFNDQGDOO
SURJUDPPHGIXQFWLRQVPXVWEHUHVHW7KHWLPH
RIGD\ZLOOIODVKLQWKHGLVSOD\ZKHQWKHUHKDV
EHHQDSRZHURXWDJH
7RXFKWRVHOIFOHDQWKHRYHQ
6HHWKH8VLQJWKH6HOI&OHDQLQJ2YHQVHFWLRQ
7RXFKWKLVSDGIRUHDVLHUFOHDQLQJRIOLJKWVRLOLQJ
RIIWKHRYHQFDYLW\RUGRRU6HHWKH8VLQJVWHDP
FOHDQVHFWLRQ
7RXFKWRFDQFHO$//RYHQRSHUDWLRQVH[FHSWWKH
FORFNDQGWLPHU
:$50,1*'5$:(5SDG
67$573DG
0XVWEHWRXFKHGWRVWDUWDQ\FRRNLQJRUFOHDQLQJ
IXQFWLRQ
7KHZDUPLQJGUDZHUZLOONHHSKRWFRRNHG
IRRGVDWVHUYLQJWHPSHUDWXUH$OZD\VVWDUWZLWK
KRWIRRG6HHWKH8VLQJWKHZDUPLQJGUDZHU
VHFWLRQ
3,==$3DG
7RXFKWKH3,==$SDG
7RXFKWKHQXPEHUSDGVWRVHOHFWIRUIUR]HQRU
IRUIUHVKSL]]D
7RXFKWKHQXPEHUSDGVWRVHWWKHEDNLQJ
WHPSHUDWXUH
7RXFKWKH67$57SDG
%DNLQJWLPHLVGHWHUPLQHGE\SDFNDJHGLUHFWLRQV
3ODFHSL]]DRQWRSUDFNSRVLWLRQRIXSSHURYHQ
:KHQXVLQJDPHWDOWUD\XVHWKHORZHUUDFN
SRVLWLRQ
&21752//2&.287RU5$1*(/2&.287
7KHFRQWUROSDGVFDQEHORFNHGVRWKH\FDQQRW
EHDFWLYDWHGZKHQWRXFKHG&RQWURO/RFNRXW
6RPHPRGHOVKDYH5DQJH/RFNRXWZKLFKZLOO
DOVRWXUQRIIWKHVXUIDFHXQLWV6HHWKH+RZWR
/RFN2XWWKH&RQWUROVVHFWLRQ
8VLQJWKHFORFNNLWFKHQWLPHUDQGFRQWUROORFNRXW
*($SSOLDQFHVFRP
7R6HWWKH&ORFN
7KHFORFNPXVWEHVHWWRWKHFRUUHFWWLPHRIGD\
IRUWKH'HOD\6WDUWIXQFWLRQVWRZRUNSURSHUO\
7KHWLPHRIGD\FDQQRWEHFKDQJHGGXULQJ
DGHOD\HGFRRNLQJRUDGHOD\HGVHOIFOHDQLQJ
F\FOH
7RXFKWKH&/2&.SDG
7RXFKWKHQXPEHUSDGVXQWLOWKHFRUUHFW
WLPHRIGD\LVVKRZQLQWKHGLVSOD\,IWKH
QXPEHUSDGVDUHQRWWRXFKHGZLWKLQRQH
PLQXWHDIWHU\RXWRXFKWKH&/2&.SDG
WKHGLVSOD\UHYHUWVWRWKHRULJLQDOVHWWLQJ,I
WKLVKDSSHQVWRXFKWKH&/2&.SDGDQG
HQWHUWKHWLPHRIGD\
7RXFKWKH67$57SDGXQWLOWKHWLPHRIGD\
VKRZVLQWKHGLVSOD\7KLVHQWHUVWKHWLPH
DQGVWDUWVWKHFORFN
7RFKHFNWKHWLPHRIGD\ZKHQWKHGLVSOD\LV
VKRZLQJRWKHULQIRUPDWLRQWRXFKWKH&/2&.
SDG7KHWLPHRIGD\VKRZVXQWLODQRWKHUSDG
LVWRXFKHG7RFKDQJHWKHWLPHIRUPDWRUWXUQ
RIIWKHFORFNGLVSOD\VHHWKH6SHFLDO)HDWXUHV
VHFWLRQ
7R6HWWKH.LWFKHQ7LPHU
7RXFKWKH7,0(521SDG
7KH.LWFKHQ7LPHULVLQKRXUVDQG
PLQXWHV
7KH.LWFKHQ7LPHUGRHVQRWFRQWURORYHQ
RSHUDWLRQV7KHPD[LPXPVHWWLQJRQWKH
.LWFKHQ7LPHULVKRXUVDQGPLQXWHV
7RXFKWKHQXPEHUSDGVXQWLOWKHDPRXQW
RIWLPH\RXZDQWVKRZVLQWKHGLVSOD\)RU
H[DPSOHWRVHWKRXUVDQGPLQXWHV
WRXFK DQG LQWKDWRUGHU,I\RXPDNH
DPLVWDNHWRXFKWKH7,0(52))SDGDQG
EHJLQDJDLQ
7RXFKWKH67$57SDG
$IWHUWRXFKLQJWKH67$57SDG6(7
GLVDSSHDUVWKLVWHOOV\RXWKHWLPHLVFRXQWLQJ
GRZQDOWKRXJKWKHGLVSOD\GRHVQRWFKDQJH
XQWLORQHPLQXWHKDVSDVVHG6HFRQGVZLOOQRW
EHVKRZQLQWKHGLVSOD\XQWLOWKHODVWPLQXWHLV
FRXQWLQJGRZQ
:KHQWKHNLWFKHQWLPHUUHDFKHVWKH
FRQWUROZLOOEHHSWLPHVIROORZHGE\RQH
EHHSHYHU\VHFRQGVXQWLOWKH7,0(52))
SDGLVWRXFKHG
7KHVHFRQGWRQHFDQEHFDQFHOOHGE\
IROORZLQJWKHVWHSVLQWKH6SHFLDOIHDWXUHVRI
\RXURYHQFRQWUROVHFWLRQXQGHU7RQHVDWWKH
(QGRID7LPHG&\FOH
7R5HVHWWKH.LWFKHQ7LPHU
,IWKHGLVSOD\LVVWLOOVKRZLQJWKHWLPHUHPDLQLQJ
\RXPD\FKDQJHLWE\WRXFKLQJWKH7,0(521
SDGWKHQWRXFKLQJWKHQXPEHUSDGVVRWKDWWKH
WLPH\RXZDQWDSSHDUVLQWKHGLVSOD\
,IWKHUHPDLQLQJWLPHLVQRWLQWKHGLVSOD\FORFN
GHOD\VWDUWRUFRRNLQJWLPHDUHLQWKHGLVSOD\
UHFDOOWKHUHPDLQLQJWLPHE\WRXFKLQJWKH
7,0(521SDGDQGWKHQWRXFKWKHQXPEHU
SDGVWRHQWHUWKHQHZWLPH\RXZDQW
7R&DQFHOWKH.LWFKHQ7LPHU
7RXFKWKH7,0(52))SDG
+RZWR/RFN2XWWKH&RQWUROV
OR
7RXQORFNWKHFRQWUROWRXFKDQGKROGWKH
&RQWURO/RFNRXWRU5DQJH/RFNRXWZLOODOORZ
\RXWRORFNRXWWKHWRXFKSDGVVRWKH\FDQQRW
&RQWURO/RFNRXWRU5DQJH/RFNRXWSDG
EHDFWLYDWHGZKHQWRXFKHG6RPHPRGHOV
IRUVHFRQGV7KHRYHQGLVSOD\ZLOOVKRZ
KDYH5DQJH/RFNRXWZKLFKZLOODOVRGLVDEOHWKH
´/RF2))/RFµ
VXUIDFHXQLWV0DNHVXUHDOOVXUIDFHXQLWFRQWUROV
:KHQWKLVIHDWXUHLVRQWKHWRXFKSDGVZLOOQRW
DUHWXUQHGRIIZKHQXVLQJ5DQJH/RFNRXW$Q\
VXUIDFHXQLWWKDWLVVHWWRDQ´RQµSRVLWLRQZKLOH UHVSRQGH[FHSWIRUWKH&OHDU2IISDG
WKH5DQJH/RFNRXWLVHQDEOHGZLOODXWRPDWLFDOO\ ■7KHDGMXVWPHQWZLOOEHUHWDLQHGLQPHPRU\
FRPHRQDIWHUWKH5DQJH/RFNRXWLVGLVDEOHG
DIWHUDSRZHUIDLOXUH
7RORFNXQORFNWKHFRQWUROV
7RXFKDQGKROGWKH&RQWURO/RFNRXWRU
5DQJH/RFNRXWSDGIRUVHFRQGV7KH
RYHQGLVSOD\ZLOOVKRZ´/RF2Q/RFµ
8VLQJWKHRYHQ
7RDYRLGSRVVLEOHEXUQVSODFHWKHUDFNVLQWKHGHVLUHGSRVLWLRQEHIRUH\RXWXUQRQWKHRYHQ
%HIRUH\RXEHJLQ«
7KHUDFNVKDYHVWRSVVRWKDWZKHQSODFHG
FRUUHFWO\RQWKHVXSSRUWVWKH\ZLOOVWRSEHIRUH
FRPLQJFRPSOHWHO\RXWDQGZLOOQRWWLOW
:KHQSODFLQJDQGUHPRYLQJFRRNZDUHSXOOWKH
UDFNRXWXQWLOLWVWRSV
2QVRPHPRGHOVWKHEDNHKHDWLQJHOHPHQW
LVXQGHUWKHRYHQIORRU1HYHUSODFHFRRNLQJ
XWHQVLOVEDNLQJVWRQHVIRLORUDQ\RWKHULWHPV
RQWKHRYHQIORRU
7KHQXPEHURIUDFNSRVLWLRQVPD\
YDU\E\PRGHO
&$87,21
%851+$=$5'$YRLGWRXFKLQJWKHKRWGRRU
VXUIDFHZKHQXVLQJWKHRYHQUDFNLQWKHORZHVW
SRVLWLRQ$OZD\VXVHKDQGVDQGPLWWHQSRW
KROGHUVWRPRYHWKHUDFN3XOOWKHUDFNRXWD
IHZLQFKHVDQGWKHQFDUHIXOO\JUDVSWKHVLGHVRI
WKHUDFNWRSXOOLWRXWWKHUHVWRIWKHZD\
7RUHPRYHDUDFNSXOOLWWRZDUG\RXWLOWWKH
IURQWHQGXSDQGSXOOLWRXW
7RUHSODFHSODFHWKHHQGRIWKHUDFNVWRS
ORFNVRQWKHVXSSRUWWLOWXSWKHIURQWDQGSXVK
WKHUDFNLQ
1HYHUSODFHFRRNLQJXWHQVLOVEDNLQJVWRQHV
IRLORUDQ\RWKHULWHPVRQWKHRYHQIORRU
([WHQVLRQ5DFNRQVRPHPRGHOV
8SSHU)URQW
5DLO
)XOO\2SHQ3RVLWLRQ
:KHQSODFLQJDQGUHPRYLQJFRRNZDUH
DOZD\VSXOOWKHUDFNRXWE\LWVXSSHUIURQW
UDLOWRLWVIXOO\RSHQSRVLWLRQ
'RQRWH[WHQGWKHUDFNTXLFNO\)RRGPD\
VOLGHRIIWKHIURQWRIWKHUDFN
7RUHPRYHWKHUDFN
0DNHVXUHWKHUDFNLVSXVKHGDOOWKHZD\
LQWRWKHRYHQVRWKDWVLGHSDGGOHVRQWKH
UDFNIURPGLVHQJDJHGZLWKRYHQVXSSRUW
)LUPO\JUDVSERWKVLGHVRIWKHUDFN
IUDPHDQGWKHVOLGLQJUDFN
3ODFHWKHFXUYHGHQGRIWKHUDFNVWRS
ORFNVRQWRWKHRYHQVXSSRUWVWLOWXSWKH
IURQWRIWKHUDFNDQGSXVKLWLQDVIDUDVLW
ZLOOJR
&$87,21
6OLGHWKHUDFNWRZDUG\RXWRWKHEXPS
VWRSSRVLWLRQRQWKHUDFNVXSSRUW
1HYHUXVHWKHUDFNZKHQLWVIUDPHLVQRWIXOO\
LQVHUWHGLQWKHRYHQDQGORFNHGLQWRSRVLWLRQ
)LUPO\JUDVSERWKVLGHVRIWKHUDFNIUDPH
DQGWKHVOLGLQJUDFNWLOWWKHIURQWHQGXS
DQGSXOOLWRXW
„:KHQWKHUDFNLVSURSHUO\LQVWDOOHGDQG
ORFNHGLQWRSRVLWLRQWKHORFNLQJVLGHSDGGOHV
RQWKHUDFNIUDPHZLOOFOLFNORFNLQWRSODFH
RQWKHRYHQVXSSRUWV,IWKHVLGHSDGGOHV
GLGQRWFOLFNORFNLQWRSRVLWLRQUHSHDWWKH
VWHSVDERYHDQGPDNHVXUHWKHVLGHSDGGOHV
KDYHEHHQFRUUHFWO\FOHDQHGDQGOXEULFDWHG
6HH([WHQVLRQ5DFNLQWKH&DUHDQGFOHDQLQJ
VHFWLRQ
127(:KHQKDQGOLQJWKHH[WHQVLRQUDFNGR
QRWDOORZWKHVOLGLQJSRUWLRQWRIDOORSHQ7KLV
FDQGDPDJHWKHVOLGHV
*UDVSKHUH
7RUHSODFHWKHUDFN
*($SSOLDQFHVFRP
$OXPLQXP)RLO
'RQRWXVHDOXPLQXPIRLOWROLQHRYHQERWWRPV
7KHIRLOZLOOWUDSKHDWEHORZDQGXSVHWWKH
SHUIRUPDQFHRIWKHRYHQ)RLOFDQPHOW
DQGSHUPDQHQWO\GDPDJHWKHRYHQERWWRP
'DPDJHIURPLPSURSHUXVHRIDOXPLQXPIRLOLV
QRWFRYHUHGE\WKHSURGXFWZDUUDQW\
)RLOPD\EHXVHGWRFDWFKVSLOOVE\SODFLQJD
VKHHWRQDORZHUUDFNVHYHUDOLQFKHVEHORZ
WKHIRRG'RQRWXVHPRUHIRLOWKDQQHFHVVDU\
DQGQHYHUHQWLUHO\FRYHUDQRYHQUDFNZLWK
DOXPLQXPIRLO.HHSIRLODWOHDVWµIURP
RYHQZDOOVWRSUHYHQWSRRUKHDWFLUFXODWLRQ
3UHKHDWLQJDQG3DQ3ODFHPHQW
7RDYRLGSRVVLEOHEXUQVSODFHWKHUDFNV
LQWKHGHVLUHGSRVLWLRQEHIRUH\RXWXUQRQWKH
RYHQ
3UHKHDWWKHRYHQLIWKHUHFLSHFDOOVIRULW3UHKHDWLQJ
LVQHFHVVDU\IRUJRRGUHVXOWVZKHQEDNLQJFDNHV
FRRNLHVSDVWULHVDQGEUHDGV
5DFNSRVLWLRQIRUEDNLQJOD\HU
FDNHV
,IEDNLQJIRXUFDNHOD\HUVDWWKHVDPHWLPHSODFH
WZROD\HUVRQUDFN&DQGWZROD\HUVRQUDFN(
6WDJJHUSDQVRQWKHUDFNVRRQHLVQRWGLUHFWO\
DERYHWKHRWKHU
%DNLQJUHVXOWVZLOOEHEHWWHULIIRRGLVFHQWHUHGLQ
WKHRYHQDVPXFKDVSRVVLEOH$QJHOIRRGFDNHLV
WKHH[FHSWLRQDQGVKRXOGEHSODFHGRQWKHERWWRP
RYHQUDFNSRVLWLRQ$)ROORZSDFNDJHGLUHFWLRQVRQ
SUHSDFNDJHGDQGIUR]HQIRRGVIRUSDQSODFHPHQW
3DQVVKRXOGQRWWRXFKHDFKRWKHURUWKHZDOOVRI
WKHRYHQ,I\RXQHHGWRXVHWZRUDFNVVWDJJHUWKH
SDQVVRRQHLVQRWGLUHFWO\DERYHWKHRWKHU/HDYH
DSSUR[LPDWHO\ø´EHWZHHQSDQVDQGIURPWKH
IURQWEDFNDQGVLGHVRIRYHQZDOO
+RZWR6HWWKH2YHQIRU%DNLQJRU5RDVWLQJ
7RXFKWKH%$.(SDG
7RXFKWKHQXPEHUSDGVXQWLOWKHGHVLUHG
WHPSHUDWXUHLVGLVSOD\HG
7RXFKWKH67$57SDG
7KHRYHQZLOOVWDUWDXWRPDWLFDOO\7KHGLVSOD\ZLOO
VKRZWKHFKDQJLQJWHPSHUDWXUHVWDUWLQJDWÛ)
7KHWHPSHUDWXUHGLVSOD\ZLOOVWDUWWRFKDQJHRQFH
WKHRYHQWHPSHUDWXUHUHDFKHVÛ):KHQWKH
RYHQUHDFKHVWKHVHOHFWHGWHPSHUDWXUHWKHRYHQ
FRQWUROZLOOEHHSVHYHUDOWLPHVDQGWKHGLVSOD\ZLOO
VKRZWKHRYHQWHPSHUDWXUH
127( <RXPD\KHDUWKHFRQYHFWLRQIDQRQ
VRPHPRGHOVZKLOHWKHRYHQLVSUHKHDWLQJ7KH
IDQZLOOVWRSDIWHUWKHRYHQLVSUHKHDWHGDQG
WKHGLVSOD\VKRZV\RXUVHWWHPSHUDWXUH7KLVLV
QRUPDO
7RFKDQJHWKHRYHQWHPSHUDWXUHGXULQJWKH%$.(
F\FOHWRXFKWKH%$.(SDGDQGWKHQWKHQXPEHU
SDGVWRJHWWKHQHZWHPSHUDWXUH
&KHFNIRRGIRUGRQHQHVVDWWKHPLQLPXPWLPH
RQWKHUHFLSH&RRNORQJHULIQHFHVVDU\
7RXFKWKH&/($52))SDGZKHQEDNLQJLV
ILQLVKHGDQGWKHQUHPRYHWKHIRRGIURPWKH
RYHQ
5RDVWLQJ*XLGH
0HDW
%HHI
3RUN
/DPE
3RXOWU\
5LE5RDVWWROEV
%RQH,QDQG%RQHOHVV
%HHI7HQGHUORLQWROEV
%HHI7HQGHUORLQWROEV
%RQH,Q%RQHOHVVWROEV
%RQH,QWROEV
%RQHOHVVWROEV
:KROH&KLFNHQWROEV
7XUNH\:KROH
8QVWXIIHGWROEV
8QVWXIIHGWROEV
7XUNH\%UHDVWWROEV
2YHQ7HPS
5DUH
0HGLXP
5DUH
5DUH
0HGLXP
0HGLXP
ƒ)
ƒ)
ƒ)
ƒ)
ƒ)
ƒ)
ƒ)
ƒ)
ƒ)
ƒ)
ƒ)
,QWHUQDO7HPS
ƒ)
ƒ)
ƒ)
ƒ)
ƒ)
ƒ)
ƒ)
ƒ)
ƒ²ƒ)
ƒ²ƒ)
ƒ)
6WXIIHGELUGVJHQHUDOO\UHTXLUH²PLQXWHVDGGLWLRQDOURDVWLQJWLPH6KLHOGOHJVDQGEUHDVWZLWKIRLOWR
SUHYHQWRYHUEURZQLQJDQGGU\LQJRIVNLQ
8VLQJWKHRYHQ
+RZWR6HWWKH2YHQIRU%URLOLQJ
8VH/2%URLO WRFRRNIRRGVVXFKDVSRXOWU\
RUWKLFNFXWVRIPHDWWKRURXJKO\ZLWKRXW
RYHUEURZQLQJWKHP
3ODFHWKHPHDWRUILVKRQDEURLOHUJULGLQD
EURLOHUSDQGHVLJQHGIRUEURLOLQJ
)ROORZVXJJHVWHGUDFNSRVLWLRQVLQWKH
%URLOLQJ*XLGH
/HDYHWKHGRRURSHQWRWKHEURLOVWRS
SRVLWLRQ7KHGRRUVWD\VRSHQE\
LWVHOI\HWWKHSURSHUWHPSHUDWXUHLV
PDLQWDLQHGLQWKHRYHQ
7RFKDQJHWR/2%URLOWRXFKWKH
%52,/+,/2SDGDJDLQ
7RXFKWKH67$57SDG
:KHQEURLOLQJLVILQLVKHGWRXFKWKH
&/($52))SDG
7RXFKWKH%52,/+,/2SDGRQFHIRU+,
%URLO
%URLOLQJ*XLGH
7KHVL]HZHLJKWWKLFNQHVV
VWDUWLQJWHPSHUDWXUH
DQG\RXUSUHIHUHQFH
RIGRQHQHVVZLOODIIHFWEURLOLQJ
WLPHV7KLVJXLGH
LVEDVHGRQPHDWVDW
UHIULJHUDWRUWHPSHUDWXUH
‚7KH86'HSDUWPHQWRI
$JULFXOWXUHVD\V´5DUHEHHILV
SRSXODUEXW\RXVKRXOGNQRZWKDW
FRRNLQJLWWRRQO\ƒ)PHDQV
VRPHIRRGSRLVRQLQJRUJDQLVPV
PD\VXUYLYHµ6RXUFH6DIH)RRG
%RRN<RXU.LWFKHQ*XLGH86'$
5HY-XQH
3UHKHDWWKHEURLOHUIRUPLQXWHVWRLPSURYHSHUIRUPDQFH
)RRG
'RQHQHVV
7\SHRU
7KLFNQHVV
5DFN3RVLWLRQ
5DUHƒ)
0HGLXPƒ)
:HOO'RQHƒ)
6WHDNV²
µWKLFN
6WHDNV²
µWRµWKLFN
6WHDNV²
µWRµWKLFN
RU*URXQG%HHI3DWWLHV
(RU)IRRGVKRXOGEHµ
WRµIURPEURLOHOHPHQW
(IRRGVKRXOGEHµ
WRµIURPEURLOHOHPHQW
'RU(IRRGVKRXOGEHµ
WRµIURPEURLOHOHPHQW
6WHDNVOHVVWKDQµ
WKLFNDUHGLIILFXOWWR
FRRNUDUH7KH\FRRN
WKURXJKEHIRUHEURZQLQJ
7RSUHYHQWFXUOLQJRI
PHDWVODVKIDWDWµ
LQWHUYDOV
&KLFNHQ
%UHDVWERQHOHVV
%UHDVWERQHLQ
&IRRGVKRXOGEHµ
WRµIURPEURLOHOHPHQW
&IRRGVKRXOGEHµ
WRµIURPEURLOHOHPHQW
%URLOVNLQVLGHGRZQ
ILUVW
)LVK)LOOHWV
µWRµWKLFN
'RU(IRRGVKRXOGEHµ +DQGOHDQGWXUQYHU\
WRµIURPEURLOHOHPHQW FDUHIXOO\
3RUN&KRSV
:HOO'RQHƒ)
µWKLFN
%HHI
'IRRGVKRXOGEHµ
WRµIURPEURLOHOHPHQW
&RPPHQWV
7RSUHYHQWFXUOLQJRI
PHDWVODVKIDWDWµ
LQWHUYDOV
)RUGRXEOHRYHQVXVHUDFNSRVLWLRQ$IRUWKHVPDOOHUUDFNSRVLWLRQRYHQ
,I\RXUUDQJHLVFRQQHFWHGWRYROWVUDUHVWHDNVPD\EHEURLOHGE\SUHKHDWLQJWKH
EURLOHUDQGSRVLWLRQLQJWKHRYHQUDFNRQHSRVLWLRQKLJKHU
$GMXVWWKHRYHQWKHUPRVWDW³'RLW\RXUVHOI
*($SSOLDQFHVFRP
<RXPD\ILQGWKDW\RXUQHZRYHQFRRNVGLIIHUHQWO\WKDQWKHRQHLWUHSODFHG8VH\RXUQHZRYHQIRUDIHZZHHNVWR
EHFRPHPRUHIDPLOLDUZLWKLW,I\RXVWLOOWKLQN\RXUQHZRYHQLVWRRKRWRUWRRFROG\RXFDQDGMXVWWKHWKHUPRVWDW
\RXUVHOI
'RQRWXVHWKHUPRPHWHUVVXFKDVWKRVHIRXQGLQJURFHU\VWRUHVWRFKHFNWKHWHPSHUDWXUHVHWWLQJRI\RXURYHQ7KHVH
WKHUPRPHWHUVPD\YDU\²GHJUHHV
127(7KLVDGMXVWPHQWZLOORQO\DIIHFWEDNLQJDQGURDVWLQJWHPSHUDWXUHVLWZLOOQRWDIIHFWEURLOLQJRUVHOIFOHDQLQJ
WHPSHUDWXUHV7KHDGMXVWPHQWZLOOEHUHWDLQHGLQPHPRU\DIWHUDSRZHUIDLOXUH
7R$GMXVWWKH7KHUPRVWDW
7RXFKWKH%52,/+,/2DQG%$.(SDGVDW
WKHVDPHWLPHXQWLOWKHGLVSOD\VKRZV6)
7RXFKWKH%$.(SDG$QXPEHUVKRZVLQ
WKHGLVSOD\
'RXEOH2YHQV7RDGMXVWWKHXSSHURYHQ
WKHUPRVWDWWRXFKWKHXSSHURYHQ%$.(
SDG7RDGMXVWWKHORZHURYHQWKHUPRVWDW
WRXFKWKHORZHURYHQ%$.(SDG
7KHRYHQWHPSHUDWXUHFDQEHDGMXVWHGXS
WRž)KRWWHURUž)FRROHU7RXFK
WKHQXPEHUSDGVWKHVDPHZD\\RXUHDG
WKHP)RUH[DPSOHWRFKDQJHWKHRYHQ
WHPSHUDWXUHž)WRXFKDQG
7RXFKWKH%$.(SDGDJDLQWRDOWHUQDWH
EHWZHHQLQFUHDVLQJDQGGHFUHDVLQJWKH
RYHQWHPSHUDWXUH
:KHQ\RXKDYHPDGHWKHDGMXVWPHQW
WRXFKWKH67$57SDGWRJREDFNWRWKHWLPH
RIGD\GLVSOD\8VH\RXURYHQDV\RXZRXOG
QRUPDOO\
7KHW\SHRIPDUJDULQHZLOODIIHFWEDNLQJSHUIRUPDQFH
0RVWUHFLSHVIRUEDNLQJKDYHEHHQGHYHORSHGXVLQJKLJKIDWSURGXFWVVXFKDVEXWWHURUPDUJDULQHIDW
,I\RXGHFUHDVHWKHIDWWKHUHFLSHPD\QRWJLYHWKHVDPHUHVXOWVDVZLWKDKLJKHUIDWSURGXFW
5HFLSHIDLOXUHFDQUHVXOWLIFDNHVSLHVSDVWULHVFRRNLHVRUFDQGLHVDUHPDGHZLWKORZIDWVSUHDGV
7KHORZHUWKHIDWFRQWHQWRIDVSUHDGSURGXFWWKHPRUHQRWLFHDEOHWKHVHGLIIHUHQFHVEHFRPH
)HGHUDOVWDQGDUGVUHTXLUHSURGXFWVODEHOHG´PDUJDULQHµWRFRQWDLQDWOHDVWIDWE\ZHLJKW/RZIDWVSUHDGVRQWKHRWKHUKDQG
FRQWDLQOHVVIDWDQGPRUHZDWHU7KHKLJKPRLVWXUHFRQWHQWRIWKHVHVSUHDGVDIIHFWVWKHWH[WXUHDQGIODYRURIEDNHGJRRGV)RUEHVW
UHVXOWVZLWK\RXUROGIDYRULWHUHFLSHVXVHPDUJDULQHEXWWHURUVWLFNVSUHDGVFRQWDLQLQJDWOHDVWYHJHWDEOHRLO
8VLQJWKHFRQYHFWLRQRYHQRQVRPHPRGHOV
&RQYHFWLRQ)DQ2SHUDWLRQ
,QDFRQYHFWLRQRYHQDIDQFLUFXODWHVKRWDLU
RYHUXQGHUDQGDURXQGWKHIRRG
7KLVFLUFXODWLQJKRWDLULVHYHQO\GLVWULEXWHG
WKURXJKRXWWKHRYHQFDYLW\$VDUHVXOWIRRGV
DUHHYHQO\FRRNHGDQGEURZQHG³RIWHQLQOHVV
WLPHZLWKFRQYHFWLRQKHDW
127(2QVRPHPRGHOVWKHIDQLVGHVLJQHG
WRURWDWHLQERWKGLUHFWLRQVZLWKDSDXVHLQ
EHWZHHQ7KLVLVQRUPDO
7KHFRQYHFWLRQIDQVKXWVRIIZKHQWKHRYHQ
GRRULVRSHQHG'2127OHDYHWKHGRRURSHQ
IRUORQJSHULRGVRIWLPHZKLOHXVLQJFRQYHFWLRQ
FRRNLQJRU\RXPD\VKRUWHQWKHOLIHRIWKH
FRQYHFWLRQKHDWLQJHOHPHQW
&RQYHFWLRQ&RRN
7KHFRQYHFWLRQRYHQFRPHVZLWKRQH
FRQYHFWLRQFRRNPRGHDQGFDQEHXVHG
IRU0XOWL5DFN&RQYHFWLRQ%DNLQJRU5DFN
&RQYHFWLRQ%DNLQJ
0XOWL5DFN&RQYHFWLRQ%DNLQJ
%HFDXVHKHDWHGDLULVFLUFXODWHGHYHQO\
WKURXJKRXWWKHRYHQIRRGVFDQEHEDNHGZLWK
H[FHOOHQWUHVXOWVXVLQJPXOWLSOHUDFNV
0XOWLUDFNSRVLWLRQ
0XOWLUDFNEDNLQJPD\LQFUHDVHFRRNWLPHV
VOLJKWO\IRUVRPHIRRGVEXWWKHRYHUDOOUHVXOW
LVWLPHVDYHG&RRNLHVPXIILQVELVFXLWVDQG
RWKHUTXLFNEUHDGVJLYHYHU\JRRGUHVXOWVZLWK
PXOWLUDFNEDNLQJ
:KHQEDNLQJRQUDFNVSODFHRQHUDFNLQWKH
VHFRQG%SRVLWLRQDQRWKHUUDFNLQWKHIRXUWK
'SRVLWLRQDQGWKHWKLUGUDFNLQWKHVL[WK)
SRVLWLRQ
)RUWZRUDFNEDNLQJSODFHRQHUDFNLQWKH
VHFRQG%UDFNSRVLWLRQ3ODFHWKHRWKHUUDFNLQ
WKHILIWK(UDFNSRVLWLRQ
5DFN&RQYHFWLRQ%DNLQJ
:KHQFRQYHFWLRQEDNLQJZLWKRQO\UDFNSODFH
WKHIRRGVRWKDWLWLVFHQWHUHGLQWKHRYHQ
+RZWR6HWWKH2YHQIRU&RQYHFWLRQ%DNLQJ
7RXFKWKH&219(&7,21&22.SDGIRU
FRQYHFWLRQFRRNLQJ
7RXFKWKHQXPEHUSDGVWRVHWWKHRYHQ
WHPSHUDWXUH
7RXFKWKH67$57SDG
127(,IWKH$XWR5HFLSHŒ&RQYHUVLRQ)HDWXUH
LVRQLWZLOODXWRPDWLFDOO\UHGXFHWKHVHWUHJXODU
EDNLQJWHPSHUDWXUHE\DSSUR[LPDWHO\ƒ)
WRWKHDSSURSULDWHFRQYHFWLRQWHPSHUDWXUH
LQFRQYHFWLRQEDNHPRGH6HH$XWR5HFLSHŒ
&RQYHUVLRQLQWKH6SHFLDO)HDWXUHVVHFWLRQ
7RFKDQJHWKHRYHQWHPSHUDWXUHWRXFKWKH
&219(&7,21&22.SDGDQGWKHQWKHQXPEHU
SDGVWRVHWWKHQHZWHPSHUDWXUH
:KHQWKHRYHQVWDUWVWRKHDWWKHFKDQJLQJ
WHPSHUDWXUHVWDUWLQJDWƒ)ZLOOEHGLVSOD\HG
:KHQRYHQUHDFKHVWKHWHPSHUDWXUH\RXVHW
EHHSVZLOOVRXQG
7RXFK&/($52))SDGZKHQILQLVKHG
„<RXZLOOKHDUDIDQZKLOHFRRNLQJZLWK
FRQYHFWLRQ7KHIDQZLOOVWRSZKHQWKHGRRULV
RSHQHGEXWWKHKHDWZLOOQRWWXUQRII
„<RXPD\KHDUWKHRYHQFOLFNLQJGXULQJ
EDNLQJ7KLVLVQRUPDO
*($SSOLDQFHVFRP
&RRNZDUHIRU&RQYHFWLRQ&RRNLQJ
:KHQEDNLQJFRRNLHV\RXZLOOJHW
WKHEHVWUHVXOWVLI\RXXVHDIODW
FRRNLHVKHHWLQVWHDGRIDSDQZLWK
ORZVLGHV
%HIRUHXVLQJ\RXUFRQYHFWLRQRYHQFKHFNWRVHH
LI\RXUFRRNZDUHOHDYHVURRPIRUDLUFLUFXODWLRQ
LQWKHRYHQ,I\RXDUHEDNLQJZLWKVHYHUDOSDQV
OHDYHVSDFHEHWZHHQWKHP$OVREHVXUHWKH
SDQVGRQRWWRXFKHDFKRWKHURUWKHZDOOVRIWKH
RYHQ
3DSHUDQG3ODVWLF
+HDWUHVLVWDQWSDSHUDQGSODVWLFFRQWDLQHUVWKDW
DUHUHFRPPHQGHGIRUXVHLQUHJXODUEDNLQJFDQ
DOVREHXVHGIRUFRQYHFWLRQEDNLQJEXWVKRXOG
QRWEHXVHGDWWHPSHUDWXUHVKLJKHUWKDQWKH
WHPSHUDWXUHUHFRPPHQGHGE\WKHFRRNZDUH
PDQXIDFWXUHU3ODVWLFFRRNZDUHWKDWLVKHDW
UHVLVWDQWWRWHPSHUDWXUHVRIƒ)FDQDOVREH
XVHG
0HWDODQG*ODVV
$Q\W\SHRIFRRNZDUHZLOOZRUNLQ\RXU
FRQYHFWLRQRYHQKRZHYHUPHWDOSDQVKHDWWKH
IDVWHVWDQGDUHUHFRPPHQGHGIRUFRQYHFWLRQ
EDNLQJ
„'DUNHQHGRUPDWWHILQLVKHGSDQVZLOOEDNH
IDVWHUWKDQVKLQ\SDQV
„*ODVVRUFHUDPLFSDQVFRRNPRUHVORZO\
)RUUHFLSHVOLNHRYHQEDNHGFKLFNHQXVHDSDQ
ZLWKORZVLGHV+RWDLUFDQQRWFLUFXODWHZHOO
DURXQGIRRGLQDSDQZLWKKLJKVLGHV
8VLQJWKHSL]]DIHDWXUHRQVRPHPRGHOV
+RZWR6HWWKH8SSHU2YHQ)RU3L]]D
$GMXVWUDFNSRVLWLRQIRUW\SHRISL]]DWUD\EHLQJXVHG
VHHFKDUW
7RXFKWKH3,==$SDG
7RXFKWKHQXPEHUSDGVWRVHOHFWIRUIUR]HQRU
IRUIUHVKSL]]D
%DNLQJWLPHLVGHWHUPLQHGE\SDFNDJHGLUHFWLRQV
7\SHRI3L]]D7UD\
7UD\VXSSOLHGZLWKIUHVKSL]]D
3L]]DSODFHGGLUHFWO\RQUDFN
0HWDOWUD\
5DFN3RVLWLRQ
%
%
$
7RXFKWKHQXPEHUSDGVWRVHWWKHEDNLQJ
WHPSHUDWXUH
7RXFKWKH67$57SDG
8VLQJWKHSUREHRQVRPHPRGHOV
)RUPDQ\IRRGVHVSHFLDOO\URDVWVDQGSRXOWU\LQWHUQDOIRRGWHPSHUDWXUHLVWKHEHVWWHVWIRUGRQHQHVV7KHWHPSHUDWXUH
SUREHWDNHVWKHJXHVVZRUNRXWRIURDVWLQJE\FRRNLQJIRRGVWRWKHH[DFWGRQHQHVV\RXZDQW
7RSUHYHQWEXUQVGRQRWXQSOXJWKHSUREHIURP
WKHRYHQRXWOHWXQWLOWKHRYHQKDVFRROHG
&$87,21
8VHRISUREHVRWKHUWKDQWKHRQHSURYLGHGZLWK
WKLVSURGXFWPD\UHVXOWLQGDPDJHWRWKHSUREH
RURYHQFRQWURO
7KHWHPSHUDWXUHSUREHKDVD
VNHZHUOLNHSUREHDWRQHHQGDQG
DSOXJDWWKHRWKHUHQGWKDWJRHV
LQWRWKHRXWOHWLQWKHRYHQ
8VHWKHKDQGOHVRIWKHSUREHDQGSOXJZKHQ
LQVHUWLQJDQGUHPRYLQJWKHPIURPWKHIRRGDQG
RXWOHW
„
7RDYRLGGDPDJLQJ\RXUSUREHGRQRWXVH
WRQJVWRSXOORQWKHFDEOHZKHQUHPRYLQJLW
„
7RDYRLGEUHDNLQJWKHSUREHPDNHVXUHIRRG
LVFRPSOHWHO\GHIURVWHGEHIRUHLQVHUWLQJ
$IWHUSUHSDULQJWKHPHDWDQGSODFLQJLWRQ
DWULYHWRUDEURLOHUSDQJULGIROORZWKHVH
GLUHFWLRQVIRUSURSHUSUREHSODFHPHQW
,QVHUWWKHSUREHFRPSOHWHO\LQWRWKHPHDW,W
VKRXOGQRWWRXFKERQHIDWRUJULVWOH
127()DLOXUHWRIXOO\LQVHUWWKHSUREHLQWRWKH
PHDWPD\UHVXOWLQSRRUFRRNLQJSHUIRUPDQFH
EHFDXVHWKHSUREHZLOOVHQVHWKHRYHQDLUYV
WKHIRRGWHPSHUDWXUH
3OXJ
&DEOH
+DQGOHV
3UREH
5HDGDQGUHPRYHODEHO
„
1HYHUOHDYH\RXUSUREHLQVLGHWKHRYHQ
GXULQJDVHOIFOHDQLQJRUEURLOF\FOH
„
'RQRWVWRUHWKHSUREHLQWKHRYHQ
)RUURDVWVZLWKQRERQHLQVHUWWKHSUREHLQWR
WKHPHDWLHVWSDUWRIWKHURDVW)RUERQHLQKDP
RUODPELQVHUWWKHSUREHLQWRWKHFHQWHURIWKH
ORZHVWODUJHPXVFOH
,QVHUWWKHSUREHLQWRWKHFHQWHURIGLVKHVVXFK
DVPHDWORDIRUFDVVHUROHV
,QVHUWWKHSUREHLQWRWKHPHDWLHVWSDUWRIWKH
LQQHUWKLJKIURPEHORZDQGSDUDOOHOWRWKHOHJRI
DZKROHWXUNH\
127(6HOIFOHDQDQG%URLOVHWWLQJVZLOOQRWZRUN
LIWKHWHPSHUDWXUHSUREHLVSOXJJHGLQ
+RZWR6HWWKH2YHQ)RU%DNLQJ5RDVWLQJ:KHQ8VLQJWKH3UREH
RQVRPHPRGHOV
,QVHUWWKHSUREHIXOO\LQWRWKHIRRG
3OXJWKHSUREHLQWRWKHRXWOHWLQWKHRYHQ
0DNHVXUHLW·VSXVKHGDOOWKHZD\LQ&ORVH
WKHRYHQGRRU0DNHVXUHWKHSUREHFDEOH
LVQRWWRXFKLQJWKHEURLOHOHPHQW
7RXFKWKH352%(SDG'LVSOD\ZLOOVKRZ
´6HW3UREH7HPSµ
OR
7RXFKWKHQXPEHUSDGVWRVHWWKHGHVLUHG
LQWHUQDOIRRGRUPHDWWHPSHUDWXUH7KH
PD[LPXPLQWHUQDOWHPSHUDWXUHIRUWKH
IRRGWKDW\RXFDQVHWLVž)
7RXFKWKH67$57SDG
7RXFKWKH%$.(RU&219(&7,21SDG
7RXFKWKHQXPEHUSDGVWRVHWWKHGHVLUHG
RYHQWHPSHUDWXUH
7RXFKWKH67$57SDG
7KHGLVSOD\ZLOOIODVKLIWKHSUREHLVLQVHUWHG
LQWRWKHRXWOHWDQG\RXKDYHQRWVHWDSUREH
WHPSHUDWXUHDQGWRXFKHGWKH67$57SDG
7RXFKWKH352%(SDGWRUHFDOOWKHSUREH
WHPSHUDWXUHRU%$.(RU&219(&7,21SDG
WRUHFDOOWKHRYHQWHPSHUWXUH)RUWKHSUREH
WHPSHUDWXUHDIWHUWKHLQWHUQDOWHPSHUDWXUH
RIWKHIRRGUHDFKHVƒ)WKHFKDQJLQJ
WHPSHUDWXUHZLOOEHVKRZQLQWKHGLVSOD\
:KHQWKHLQWHUQDOWHPSHUDWXUHRIWKHIRRG
UHDFKHVWKHQXPEHU\RXKDYHVHWWKH
SUREHDQGWKHRYHQWXUQRIIDQGWKHRYHQ
FRQWUROVLJQDOV7RVWRSWKHVLJQDOWRXFK
WKH&/($52))SDG8VHKRWSDGVWR
UHPRYHWKHSUREHIURPWKHIRRG'RQRW
XVHWRQJVWRSXOORQLW³WKH\PLJKW
GDPDJHLW
„,IWKHSUREHLVUHPRYHGIURPWKHRYHQ
ZKLOHSUREHFRRNLQJWKHRYHQZLOOQRW
DXWRPDWLFDOO\WXUQRII
7RFKDQJHWKHRYHQWHPSHUDWXUHGXULQJ
WKH%DNH5RDVWF\FOHWRXFKWKH%$.(RU
&219(&7,21SDGDQGWKHQWKHQXPEHUSDGV
WRVHWWKHQHZWHPSHUDWXUH
„<RXFDQXVHWKH.LWFKHQ7LPHUHYHQWKRXJK
\RXFDQQRWXVHWLPHGRYHQRSHUDWLRQVZKLOH
XVLQJWKHSUREH
8VLQJWKHWLPHGEDNLQJ
DQGURDVWLQJIHDWXUHVRQVRPHPRGHOV
*($SSOLDQFHVFRP
127()RRGVWKDWVSRLOHDVLO\³VXFKDVPLONHJJVILVKVWXIILQJVSRXOWU\DQGSRUN³VKRXOGQRWEHDOORZHGWRVLWIRUPRUH
WKDQKRXUEHIRUHRUDIWHUFRRNLQJ5RRPWHPSHUDWXUHSURPRWHVWKHJURZWKRIKDUPIXOEDFWHULD
%HVXUHWKDWWKHRYHQOLJKWLVRIIEHFDXVHKHDWIURPWKHEXOEZLOOVSHHGKDUPIXOEDFWHULDJURZWK
+RZWR6HWDQ,PPHGLDWH6WDUWDQG$XWRPDWLF6WRS
OR
7KHRYHQZLOOWXUQRQLPPHGLDWHO\DQGFRRN
IRUDVHOHFWHGOHQJWKRIWLPH$WWKHHQG
RIWKHFRRNLQJWLPHWKHRYHQZLOOWXUQRII
DXWRPDWLFDOO\
7RXFKWKH%$.(RU&219(&7,21&22.
SDGRURWKHUGHVLUHGFRRNLQJIXQFWLRQ
7RXFKWKHQXPEHUSDGVWRVHWWKHGHVLUHG
RYHQWHPSHUDWXUH
7RXFKWKH67$57SDG
7RXFKWKH&22.7,0(SDG
127(,I\RXUUHFLSHUHTXLUHVSUHKHDWLQJ\RX
PD\QHHGWRDGGDGGLWLRQDOWLPHWRWKHOHQJWKRI
WKHFRRNLQJWLPH
7RXFKWKHQXPEHUSDGVWRVHWWKHGHVLUHG
OHQJWKRIFRRNLQJWLPH7KHPLQLPXP
FRRNLQJWLPH\RXFDQVHWLVPLQXWH
7KHRYHQWHPSHUDWXUHWKDW\RXVHWDQG
WKHFRRNLQJWLPHWKDW\RXHQWHUHGZLOOEH
LQWKHGLVSOD\
7RXFKWKH67$57SDG
7KHRYHQZLOOWXUQ21DQGWKHGLVSOD\ZLOOVKRZ
WKHFRRNLQJWLPHFRXQWGRZQDQGWKHFKDQJLQJ
WHPSHUDWXUHVWDUWLQJDWƒ)7KHWHPSHUDWXUH
GLVSOD\ZLOOVWDUWWRFKDQJHRQFHWKHRYHQ
WHPSHUDWXUHUHDFKHVƒ):KHQWKHRYHQ
UHDFKHVWKHWHPSHUDWXUH\RXVHWEHHSVZLOO
VRXQG
7KHRYHQZLOOFRQWLQXHWRFRRNIRUWKHVHW
DPRXQWRIWLPHWKHQWXUQRIIDXWRPDWLFDOO\
7RXFKWKH&/($52))SDGWRFOHDUWKH
GLVSOD\LIQHFHVVDU\5HPRYHWKHIRRGIURP
WKHRYHQ5HPHPEHUHYHQWKRXJKWKH
RYHQWXUQVRIIDXWRPDWLFDOO\IRRGOHIWLQ
WKHRYHQZLOOFRQWLQXHFRRNLQJDIWHUWKH
RYHQWXUQVRII
+RZWR6HWD'HOD\HG6WDUWDQG$XWRPDWLF6WRS
7KHRYHQZLOOWXUQRQDWWKHWLPHRIGD\\RXVHW
FRRNIRUDVSHFLILFOHQJWKRIWLPHDQGWKHQWXUQ
RIIDXWRPDWLFDOO\
0DNHVXUHWKHFORFNVKRZVWKHFRUUHFWWLPHRI
GD\
7RXFKWKH'(/$<67$57SDG
OR
7RXFKWKHQXPEHUSDGVWRVHWWKHWLPHRI
GD\\RXZDQWWKHRYHQWRWXUQRQDQG
VWDUWFRRNLQJ
7RXFKWKH67$57SDG
7RXFKWKH%$.(RU&219(&7,21&22.
SDGRURWKHUGHVLUHGFRRNLQJIXQFWLRQ
7RXFKWKHQXPEHUSDGVWRVHWWKHGHVLUHG
RYHQWHPSHUDWXUH
7RXFKWKH67$57SDG
7RXFKWKH&22.7,0(SDG
127(,I\RXUUHFLSHUHTXLUHVSUHKHDWLQJ\RX
PD\QHHGWRDGGDGGLWLRQDOWLPHWRWKHOHQJWK
RIWKHFRRNLQJWLPH
7RXFKWKHQXPEHUSDGVWRVHWWKHGHVLUHG
OHQJWKRIFRRNLQJWLPH7KHPLQLPXP
FRRNLQJWLPH\RXFDQVHWLVPLQXWH
7KHRYHQWHPSHUDWXUHWKDW\RXVHWDQG
WKHFRRNLQJWLPHWKDW\RXHQWHUHGZLOOEH
LQWKHGLVSOD\
7RXFKWKH67$57SDG
127(,I\RXZRXOGOLNHWRFKHFNWKHWLPHV
\RXKDYHVHWWRXFKWKH'(/$<67$57SDGWR
FKHFNWKHVWDUWWLPH\RXKDYHVHWRUWRXFKWKH
&22.7,0(SDGWRFKHFNWKHOHQJWKRIFRRNLQJ
WLPH\RXKDYHVHW
:KHQWKHRYHQWXUQV21DWWKHWLPHRIGD\
\RXVHWWKHGLVSOD\ZLOOVKRZWKHFRRNLQJWLPH
FRXQWGRZQDQGWKHFKDQJLQJWHPSHUDWXUH
VWDUWLQJDWƒ)7KHWHPSHUDWXUHGLVSOD\ZLOO
VWDUWWRFKDQJHRQFHWKHRYHQWHPSHUDWXUH
UHDFKHVƒ):KHQWKHRYHQUHDFKHVWKH
WHPSHUDWXUH\RXVHWEHHSVZLOOVRXQG
7KHRYHQZLOOFRQWLQXHWRFRRNIRUWKHVHW
DPRXQWRIWLPHWKHQWXUQRIIDXWRPDWLFDOO\
7RXFKWKH&/($52))SDGWRFOHDUWKH
GLVSOD\LIQHFHVVDU\5HPRYHWKHIRRGIURP
WKHRYHQ5HPHPEHUHYHQWKRXJKWKH
RYHQWXUQVRIIDXWRPDWLFDOO\IRRGOHIWLQ
WKHRYHQZLOOFRQWLQXHFRRNLQJDIWHUWKH
RYHQWXUQVRII
8VLQJWKHVORZFRRNDQGZDUPLQJIHDWXUHV
:$51,1*
)22'32,621+$=$5'%DFWHULDPD\JURZLQIRRGDWWHPSHUDWXUHVEHORZƒ)
‡$OZD\VVWDUWZLWKKRWIRRG'RQRWXVHZDUPVHWWLQJVWRKHDWFROGIRRG
‡'RQRWZDUPIRRGIRUPRUHWKDQKRXUV
)DLOXUHWRIROORZWKHVHLQVWUXFWLRQVPD\UHVXOWLQIRRGERUQHLOOQHVV
+RZWR6HWWKH2YHQ)RU6ORZ&RRN
6ORZ&RRNLVGHVLJQHGIRUORQJKRXUVRIXQDWWHQGHG
FRRNLQJ
7RXFKWKH6/2:&22.SDG
7RXFKWKH67$57SDG
7RXFKWKHQXPEHUSDGWRVHOHFWWKHGHVLUHG
VHWWLQJIRU3RXOWU\RUIRU0HDWV8VH0HDWV
LI\RXDUHXQVXUHZKLFKVHWWLQJWRXVH
6ORZ&RRN*XLGH
)RRG
4XDQWLW\
%HHI
&KXFN5RDVW
²øOEV
%HHI5LEV
ø²OEV
3RXOWU\
:KROH&KLFNHQ
OEV
&KLFNHQ3LHFHV
SLHFHV
DSSUR[OEV
3RUN
%RQHOHVV%ODGH
²OEV
5RDVW
&RXQWU\6W\OH
ø²OEV
3RUN5LEV
3RUN&KRSV
²OEV
6RXS
9HJHWDEOH%HHI
TXDUWV
6RXS
&KLOL
TXDUWV
7RXFKWKHQXPEHUSDGVWRVHWWKHGHVLUHG
OHQJWKRIFRRNLQJWLPH7KHFRRNLQJWLPHPXVW
EHDWOHDVWKRXUVXSWRKRXUVPLQXWHV
127(,IDSRZHURXWDJHRFFXUVZKLOHWKHRYHQLVLQ
6ORZ&RRNWKHUDQJHZLOOVKXWRII
*XLGHOLQH7LSV
5DFN
3RVLWLRQ
)RRG
6HWWLQJ
7LPH
+RXUV
&
&
&
&
&
&
&
&
&
0HDWV
0HDWV
+,²KUV $GGFXSOLTXLG
/2²KUV
+,²KUV 3ODFHULEVLQDVLQJOHOD\HU
/2²KUV
3RXOWU\
3RXOWU\
+,²KUV $GGFXSOLTXLG
/2²KUV
+,²KUV %HVWVXEPHUJHGXQGHUDVDXFH
/2²KUV WRSUHYHQWVXUIDFHGU\LQJ
0HDWV
0HDWV
0HDWV
+,²KUV $GG²FXSOLTXLG
/2²KUV
+,²KUV 3ODFHULEVLQDVLQJOHOD\HU
/2²KUV
+,²KUV 3ODFHFKRSVLQDVLQJOHOD\HU
/2²KUV
0HDWV
0HDWV
+,²KUV
/2²KUV
+,²KUV
/2²KUV
&RPPHQWV
0DNHVXUHEHHIFKXQNV
DUHVXEPHUJHG
6XEPHUJHEHDQV
WRSUHYHQWVXUIDFHGU\LQJ
„7KHVORZFRRNSURJUDPXVHVDFRPSOH[VHULHVRI
WHPSHUDWXUHF\FOLQJWRREWDLQWKHEHVWUHVXOWV)RUWKLV
UHDVRQLWLVUHFRPPHQGHGWKDWWKHVORZFRRNSURJUDP
EHDOORZHGWRUXQZLWKRXWFDQFHOOLQJRUUHVWDUWLQJ
5HVWDUWLQJWKHVORZFRRNIHDWXUHZKLOHLWLVLQSURJUHVV
PD\UHVXOWLQRYHUFRRNHGPHDW
„)RUMXLF\DQGWHQGHUPHDWFKRRVHFXWVRIPHDWVXFK
DVFKXFNURDVWRUDERQHOHVVEODGHURDVW/HDQHUFXWV
RIPHDWVXFKDVWRSURXQGDUHGULHUDQGPD\QHHG
DGGLWLRQDOOLTXLG
„8VHRQO\JODVVDQGFHUDPLFGLVKHV0HWDOSRWVDQGSDQV
WHQGWRWUDQVIHUWKHKHDWLQWRWKHIRRGVWRRTXLFNO\
„0DWFKWKHTXDQWLW\RIIRRGWRWKHVL]HSDQ)LOOWKHSDQ
DERXWIXOOIRUEHVWUHVXOWV7RRODUJHDSRWDOORZVWKH
VWHDPWRHVFDSHFDXVLQJIRRGVWRGU\RXW
„$OZD\VFRYHUWKHSRWZLWKDOLGRUDOXPLQXPIRLO
„$ZLGHUDQJHRIUHFLSHVPD\EHXVHGLQWKHVORZFRRN
IHDWXUH)RUEHVWUHVXOWVVRPHDGMXVWPHQWVPD\QHHGWR
EHPDGH)RUVPDOOHUVL]HGUHFLSHVEHJLQFKHFNLQJ
DWPLQLPXPWLPH)RUODUJHUHFLSHVRUZKHQGRXEOLQJ
UHFLSHVIRRGVPD\EHFRRNHGIRUORQJHUSHULRGVRIWLPH
„:KHQWKHVORZFRRNIHDWXUHFRPSOHWHVWKHRYHQZLOO
DXWRPDWLFDOO\VZLWFKWR´ZDUPµPRGH,IDGGLWLRQDOVORZ
FRRNWLPHLVGHVLUHGWKLVZDUPPRGHPD\EHXVHGWR
REWDLQWKHH[WUDWLPH
+RZWR6HWWKH2YHQ)RU:DUPLQJ
7KH:$50IHDWXUHNHHSVFRRNHGIRRGVKRW
7KLVIHDWXUHLVQRWGHVLJQHGWRUHKHDWFROGIRRG
7RXVHWKH:$50IHDWXUHWRXFKWKH:$50
SDGDQGWKHQWKH67$57SDG
7RXVHWKH:$50IHDWXUHDIWHU7LPHG%DNLQJ
IROORZWKHVHVWHSV
7RXFKWKHEDNHPRGHRIFRRNLQJ
7RXFKWKHQXPEHUSDGVWRVHWWKHRYHQ
WHPSHUDWXUH
7RXFKWKH&22.7,0(SDG
7RXFKWKHQXPEHUSDGVWRVHWWKHGHVLUHG
OHQJWKRIFRRNLQJWLPH
7RXFKWKH:$50SDG
7RXFKWKH67$57SDG
127(3ODVWLFFRQWDLQHUVOLGVRUSODVWLFZUDSZLOO
PHOWLISODFHGLQWKHRYHQ0HOWHGSODVWLFPD\
QRWEHUHPRYDEOHDQGLVQRWFRYHUHGXQGHU\RXU
ZDUUDQW\
8VLQJWKHZDUPLQJGUDZHURQVRPHPRGHOV
*($SSOLDQFHVFRP
)22'32,621+$=$5'%DFWHULDPD\JURZLQIRRGDWWHPSHUDWXUHVEHORZƒ)
‡$OZD\VVWDUWZLWKKRWIRRG'RQRWXVHZDUPVHWWLQJVWRKHDWFROGIRRG
‡'RQRWZDUPIRRGIRUPRUHWKDQKRXUV
)DLOXUHWRIROORZWKHVHLQVWUXFWLRQVPD\UHVXOWLQIRRGERUQHLOOQHVV
7KHZDUPLQJGUDZHUZLOONHHSKRWFRRNHGIRRGVDWVHUYLQJWHPSHUDWXUH$OZD\VVWDUWZLWKKRWIRRG
'RQRWXVHWRKHDWFROGIRRGRWKHUWKDQFULVSLQJFUDFNHUVFKLSVRUGU\FHUHDO
:$51,1*
7R8VHWKH:DUPLQJ'UDZHU
7RXFKWKH:$50,1*'5$:(5212))SDG
´6HW:DUPLQJ'UDZHUµEHJLQVWREOLQN7RXFK
WKH:$50,1*'5$:(56(77,1*SDGWRVHWWKH
ZDUPLQJGUDZHUWR´+,µ´67'µRU´/2µ
7RFDQFHOWRXFKWKH:$50,1*'5$:(521
2))SDG
127(7RXFKLQJWKH&/($52))SDGGRHVQRW
WXUQRIIWKHZDUPLQJGUDZHU
:KHQ8VLQJWKH:DUPLQJ'UDZHU
7KHZDUPLQJGUDZHUZLOONHHSKRWFRRNHG
IRRGVZDUP$OZD\VVWDUWZLWKKRWIRRG'R
QRWXVHWRKHDWFROGIRRGRWKHUWKDQFULVSLQJ
FUDFNHUVFKLSVRUGU\FHUHDO
'RQRWOLQHWKHZDUPLQJGUDZHURUSDQ
ZLWKDOXPLQXPIRLO)RLOLVDQH[FHOOHQWKHDW
LQVXODWRUDQGZLOOWUDSKHDWEHQHDWKLW7KLV
ZLOOXSVHWWKHSHUIRUPDQFHRIWKHGUDZHUDQG
FRXOGGDPDJHWKHLQWHULRUILQLVK
$OORZDSSUR[LPDWHO\PLQXWHVIRUWKH
ZDUPLQJGUDZHUWRSUHKHDW
„'RQRWSXWOLTXLGRUZDWHULQWKHZDUPLQJ
GUDZHU
„$OOIRRGVSODFHGLQWKHZDUPLQJGUDZHU
VKRXOGEHFRYHUHGZLWKDOLGRUDOXPLQXP
IRLO:KHQZDUPLQJSDVWULHVRUEUHDGVWKH
FRYHUVKRXOGEHYHQWHGWRDOORZPRLVWXUHWR
HVFDSH
„)RRGVKRXOGEHNHSWKRWLQLWVFRRNLQJ
FRQWDLQHURUWUDQVIHUUHGWRDKHDWVDIH
VHUYLQJGLVK
127(3ODVWLFFRQWDLQHUVRUSODVWLFZUDSZLOO
PHOWLILQGLUHFWFRQWDFWZLWKWKHGUDZHUSDQ
RUDKRWXWHQVLO0HOWHGSODVWLFPD\QRWEH
UHPRYDEOHDQGLVQRWFRYHUHGXQGHU\RXU
ZDUUDQW\
„5HPRYHVHUYLQJVSRRQVHWFEHIRUHSODFLQJ
FRQWDLQHUVLQZDUPLQJGUDZHU
7HPSHUDWXUH6HOHFWLRQ&KDUW
7RNHHSVHYHUDOGLIIHUHQWIRRGVKRWVHWWKHFRQWUROWR
WKHIRRGQHHGLQJWKHKLJKHVWVHWWLQJ
„7KHWHPSHUDWXUHW\SHDQGDPRXQWRIIRRGDQG
WKHWLPHKHOGZLOODIIHFWWKHTXDOLW\RIWKHIRRG
„5HSHDWHGRSHQLQJRIWKHGUDZHUDOORZV
WKHKRWDLUWRHVFDSHDQGWKHIRRGWRFRRO
„:LWKODUJHORDGVLWPD\EHQHFHVVDU\
WRXVHDKLJKHUZDUPLQJGUDZHUVHWWLQJDQG
FRYHUVRPHRIWKHFRRNHGIRRGLWHPV
„'
RQRWXVHSODVWLFFRQWDLQHUVRUSODVWLFZUDS
)RRG7\SH
&DVVHUROH
&RQWURO6HWWLQJ
67'
&KLOL
+,
3L]]D
67'
3RWDWRHVEDNHG
+,
7RUWLOOD&KLSV
/2
:DIIOHV
/2
7R&ULVS6WDOH,WHPV
„3ODFHIRRGLQORZVLGHGGLVKHVRUSDQV
„3UHKHDWRQ/2VHWWLQJ
„&KHFNFULVSQHVVDIWHUPLQXWHV$GGWLPHDV
QHHGHG
7R:DUP6HUYLQJ%RZOVDQG3ODWHV
&$87,21
'LVKHVZLOOEHKRW8VHSRWKROGHUVRUPLWWVZKHQ
UHPRYLQJKRWGLVKHV
7RZDUPVHUYLQJERZOVDQGSODWHVVHWWKHFRQWURO
RQ/2
„8VHRQO\KHDWVDIHGLVKHV
„,I\RXZDQWWRKHDWILQHFKLQDSOHDVHFKHFN
ZLWKWKHPDQXIDFWXUHURIWKHGLVKHVIRUWKHLU
PD[LPXPKHDWWROHUDQFH
„<RXPD\ZDUPHPSW\VHUYLQJGLVKHVZKLOH
SUHKHDWLQJWKHGUDZHU
8VLQJWKHVHOIFOHDQLQJRYHQ
%HIRUHD6HOI&OHDQ&\FOH
:$51,1*
),5(+$=$5':LSHJUHDVHDQGKHDY\VRLOIURPWKH
RYHQERWWRPEHIRUHVHOIFOHDQLQJ)DLOXUHWRGRVR
PD\UHVXOWLQDQRYHQILUH
:LSHXSKHDY\VRLORQWKHRYHQ
ERWWRP
:HUHFRPPHQGYHQWLQJ\RXUNLWFKHQZLWKDQRSHQ
ZLQGRZRUXVLQJDYHQWLODWLRQIDQRUKRRGGXULQJWKH
ILUVWVHOIFOHDQF\FOH
5HPRYHDQ\EURLOHUSDQEURLOHUJULGSUREHDOO
FRRNZDUHDQGDQ\DOXPLQXPIRLOIURPWKHRYHQ
127(
„,I\RXURYHQLVHTXLSSHGZLWKVKLQ\VLOYHUFRORUHG
RYHQUDFNVZHUHFRPPHQG\RXUHPRYHWKHP
EHIRUH\RXEHJLQWKHVHOIFOHDQF\FOH7KH\PD\
UHPDLQLQWKHRYHQGXULQJWKHVHOIFOHDQF\FOHEXW
WKH\ZLOOGDUNHQORVHWKHLUOXVWHUDQGEHFRPHKDUG
WRVOLGH
„,I\RXURYHQLVHTXLSSHGZLWKJUD\SRUFHODLQ
FRDWHGRYHQUDFNVWKH\PD\EHOHIWLQWKHRYHQ
GXULQJWKHVHOIFOHDQF\FOH
'RQRWFOHDQWKHJDVNHW7KHILEHUJODVVPDWHULDORI
WKHRYHQGRRUJDVNHWFDQQRWZLWKVWDQGDEUDVLRQ,WLV
HVVHQWLDOIRUWKHJDVNHWWRUHPDLQLQWDFW,I\RXQRWLFH
LWEHFRPLQJZRUQRUIUD\HGUHSODFHLW
0DNHVXUHWKHRYHQOLJKWEXOEFRYHULVLQSODFHDQG
WKHRYHQOLJKWLVRII
,03257$177KHKHDOWKRIVRPHELUGVLVH[WUHPHO\
VHQVLWLYHWRWKHIXPHVJLYHQRIIGXULQJWKHVHOI
FOHDQLQJF\FOHRIDQ\UDQJH0RYHELUGVWRDQRWKHU
ZHOOYHQWLODWHGURRP
'RXEOH2YHQDQG&DQDGLDQ0RGHOV2QO\
7KHVXUIDFHXQLWVDUHDXWRPDWLFDOO\GLVDEOHGGXULQJ
WKHVHOIFOHDQF\FOH0DNHVXUHWKDWDOOVXUIDFH
XQLWFRQWUROVDUHWXUQHGRIIDWDOOWLPHVGXULQJWKH
VHOIFOHDQF\FOH$Q\VXUIDFHXQLWWKDWLVVHWWRDQ
´RQµSRVLWLRQZKLOHWKHVHOIFOHDQF\FOHLVRSHUDWLQJ
ZLOODXWRPDWLFDOO\FRPHRQDIWHUWKHVHOIFOHDQF\FOH
LVILQLVKHGDQGFRXOGUHVXOWLQDQ´RQµXQDWWHQGHG
VXUIDFHXQLW:DLWXQWLOWKHVHOIFOHDQF\FOHLVILQLVKHG
WRVHWDQGXVHWKHVXUIDFHXQLWV
6RLORQWKHIURQWIUDPHRIWKHUDQJHDQGRXWVLGH
WKHJDVNHWRQWKHGRRUZLOOQHHGWREHFOHDQHGE\
KDQG&OHDQWKHVHDUHDVZLWKKRWZDWHUVRDSILOOHG
VWHHOZRROSDGVRUFOHDQVHUVVXFKDV6RIW6FUXEŠ
5LQVHZHOOZLWKFOHDQZDWHUDQGGU\
+RZWR6HWWKH2YHQIRU6HOI&OHDQLQJ
7KHRYHQGRRUVPXVWEHFORVHGDQGDOOFRQWUROVVHW
FRUUHFWO\IRUWKHF\FOHWRZRUNSURSHUO\
7RXFKWKH6(/)&/($1SDG
,IDWLPHRWKHUWKDQWKHGHIDXOWWLPHLVQHHGHG
XVHWKHQXPEHU SDGVDQGHQWHUWKHGHVLUHG
FOHDQWLPH
<RXFDQFKDQJHWKHFOHDQWLPHWRDQ\WLPHEHWZHHQ
KRXUVDQGKRXUVGHSHQGLQJRQKRZGLUW\\RXU
RYHQLV
7RXFKWKH67$57SDG
7KHRYHQGRRUORFNVDXWRPDWLFDOO\7KHGLVSOD\ZLOO
VKRZWKHFOHDQWLPHUHPDLQLQJ,WZLOOQRWEHSRVVLEOH
WRRSHQWKHRYHQGRRUXQWLOWKHWHPSHUDWXUHGURSV
EHORZWKHORFNWHPSHUDWXUHDQG/2&.(''225
JRHVRIILQWKHFRQWUROGLVSOD\
„7KHZRUG/2&.(''225 ZLOOIODVKDQGWKH
ZRUG'225ZLOOGLVSOD\LI\RXVHWWKHFOHDQF\FOH
DQGIRUJHWWRFORVHWKHRYHQGRRU
„7RVWRSDFOHDQF\FOHWRXFKWKH&/($52))SDG
:KHQ/2&.(''225 JRHVRIILQGLFDWLQJWKH
RYHQKDVFRROHGEHORZWKHORFNLQJWHPSHUDWXUH
\RXZLOOEHDEOHWRRSHQWKHGRRU
'RXEOH2YHQV
„<RXFDQVHWDFOHDQF\FOHLQERWKRYHQVDWWKH
VDPHWLPHKRZHYHUWKH\ZLOOQRWVHOIFOHDQDWWKH
VDPHWLPH7KHODVWRYHQVHWZLOODXWRPDWLFDOO\
GHOD\LWVVWDUWXQWLOWKHHQGRIWKHILUVWRYHQ·VFOHDQ
F\FOH
„:KHQDQRYHQLVVHWWRVHOIFOHDQERWKRYHQGRRUV
ZLOOORFNDQGWKHFRRNWRSFRQWUROVZLOOORFNRXW7KH
RYHQVDQGFRRNWRSFDQQRWEHXVHGZKHQDQRYHQ
LVVHWWRVHOIFOHDQ
*($SSOLDQFHVFRP
7KHRYHQGRRUVPXVWEHFORVHGDQGDOOFRQWUROVVHWFRUUHFWO\IRUWKHF\FOHWRZRUNSURSHUO\
+RZWR'HOD\WKH6WDUWRI6HOI&OHDQLQJ
7RXFKWKH'(/$<67$57SDG
8VLQJWKHQXPEHUSDGVHQWHUWKHWLPHRI
GD\\RXZDQWWKHFOHDQF\FOHWRVWDUW
7RXFKWKH67$57SDG
7RXFKWKH6(/)&/($1SDG
7RXFKWKH67$57SDG
7KHRYHQGRRUORFNVDXWRPDWLFDOO\,WZLOOQRW
EHSRVVLEOHWRRSHQWKHRYHQGRRUXQWLOWKH
WHPSHUDWXUHGURSVEHORZWKHORFNWHPSHUDWXUH
DQG/2&.(''225 JRHVRIILQWKHFRQWURO
GLVSOD\
8VHWKHQXPEHU SDGVDQGHQWHUWKH
GHVLUHGFOHDQWLPH
<RXFDQFKDQJHWKHFOHDQWLPHWRDQ\WLPH
EHWZHHQKRXUVDQGKRXUVGHSHQGLQJRQ
KRZGLUW\\RXURYHQLV
$IWHUD6HOI&OHDQ&\FOH
<RXPD\QRWLFHVRPHZKLWHDVKLQWKHRYHQ
:LSHLWXSZLWKDGDPSFORWKDIWHUWKHRYHQ
FRROV
,IZKLWHVSRWVUHPDLQUHPRYHWKHPZLWKD
VRDSILOOHGVWHHOZRROSDGDQGULQVHWKRURXJKO\
ZLWKDYLQHJDUDQGZDWHUPL[WXUH
7KHVHGHSRVLWVDUHXVXDOO\DVDOWUHVLGXHWKDW
FDQQRWEHUHPRYHGE\WKHFOHDQF\FOH
([WHQVLRQ5DFN
,ILWEHFRPHVGLIILFXOWWRVOLGHVHH([WHQVLRQ
5DFNLQWKH&DUHDQGFOHDQLQJVHFWLRQ'RQRW
VSUD\H[WHQVLRQUDFNZLWKFRRNLQJVSUD\RU
RWKHUOXEULFDQWVSUD\V
,ILWEHFRPHVKDUGWRUHPRYHRUUHSODFHZLSH
WKHRYHQUDFNVXSSRUWVZLWKFRRNLQJRLO'RQRW
ZLSHFRRNLQJRLORQWKHVOLGHV
,IWKHRYHQLVQRWFOHDQDIWHURQHFOHDQF\FOH
UHSHDWWKHF\FOH
127($IWHUWKHILUVWVHOIFOHDQF\FOHWKHJUD\
VWDLQOHVVVWHHOVXUIDFHVZLOOFKDQJHFRORURQ
„<RXFDQQRWVHWWKHRYHQIRUFRRNLQJXQWLOWKH HQDPHOHGH[WHQVLRQUDFNV7KLVLVQRUPDO,WLV
QRWUHFRPPHQGHGWRVHOIFOHDQQLFNHOH[WHQVLRQ
RYHQLVFRROHQRXJKIRUWKHGRRUWRXQORFN
„:KLOHWKHRYHQLVVHOIFOHDQLQJ\RXFDQWRXFK UDFNVDVWKHZKROHUDFNZLOOGLVFRORUEHFDXVHRI
&/2&.WRGLVSOD\WKHWLPHRIGD\7RUHWXUQWR WKHVHOIFOHDQWHPSHUDWXUHV
WKHFOHDQFRXQWGRZQWRXFK6(/)&/($1
6WDQGDUG5DFNV
,IWKH\EHFRPHKDUGWRVOLGHZLSHWKHLUVLGH
HGJHVDQGWKHRYHQUDFNVXSSRUWVZLWKFRRNLQJ
RLO
8VLQJ6WHDP&OHDQRQVRPHPRGHOV
'XULQJWKHVWHDPFOHDQF\FOH
WKHRYHQERWWRPEHFRPHVKRW
HQRXJKWRFDXVHEXUQV:DLW
XQWLOWKHF\FOHLVRYHUPLQXWHVEHIRUHZLSLQJWKH
LQVLGHVXUIDFHVRIWKHRYHQ)DLOXUHWRGRVRPD\UHVXOW
LQEXUQV
&$87,21
7KHUDQJHVKRXOGEHDWURRPWHPSHUDWXUHEHIRUHEHJLQQLQJ
WKH6WHDP&OHDQF\FOH,IWKHRYHQLVWRRKRW´KRWµZLOO
DSSHDURQWKHGLVSOD\DQGWKHF\FOHZLOOQRWDFWLYDWHXQWLOWKH
RYHQFRROVGRZQ
7KH6WHDP&OHDQF\FOHSHUIRUPVEHVWRQQHZVSLOOV
RUVRLOV%XUQHGRQIRRGLVPRUHGLIILFXOWWRUHPRYH
7KH6WHDP&OHDQF\FOHPDNHVLWHDVLHUWRFOHDQOLJKWVRLOLQJ
RIIWKHVWDQGDUGFOHDQSRUFHODLQRYHQLQWHULRU
7R%HJLQ6WHDP&OHDQ&\FOH
5HPRYHUDFNVDQGDFFHVVRULHVIURPWKH
RYHQFDYLW\'RQRWSODFHFRRNZDUHRU
RWKHULWHPVLQWKHRYHQGXULQJWKH6WHDP
&OHDQF\FOH
3RXUFXSR]URRPWHPSHUDWXUHZDWHU
RQWRWKHUHFHVVHGDUHDRIWKHRYHQERWWRP
'RQRWDGGFOHDQLQJVROXWLRQVRUFKHPLFDOV
RIDQ\NLQGWRWKHZDWHU2QO\DGGZDWHU
ZKHQXVLQJWKH6WHDP&OHDQF\FOH'RQRW
DGGZDWHUZKHQXVLQJWKH6HOI&OHDQF\FOH
3RXURXQFHVRIZDWHURQWRWKH
RYHQIORRU
&ORVHWKHGRRU
3UHVVWKH6WHDP&OHDQSDGWKHQSUHVV
6WDUW
7KHRYHQGRRUORFNVDXWRPDWLFDOO\$
PLQXWHF\FOHZLOOEHJLQWRFRXQWGRZQ
RQWKHGLVSOD\,WZLOOQRWEHSRVVLEOHWR
RSHQWKHRYHQGRRUXQWLOWKHF\FOHHQGVRU
\RXSUHVVWKH&OHDU2IISDGDQGWKHGRRU
XQORFNV
:KHQWKH6WHDP&OHDQF\FOHLVFRPSOHWH
WKHGRRUZLOOXQORFNWKHRYHQFRQWUROZLOO
EHHSDQGWKH6WHDP&OHDQOLJKWZLOOEOLQN
3UHVVWKH&OHDU2IISDGDQGRSHQWKHGRRU
7KHRYHQERWWRPDQGUHPDLQLQJZDWHUZLOO
VWLOOEHYHU\ZDUPDWWKHHQGRIWKHF\FOH
7KLVLVQRUPDO
5HPRYHVRLOVXVLQJDVFUXEEUXVKRUQ\ORQ
VFRXULQJSDG$VRDSILOOHGVWHHOZRROSDG
PD\EHXVHGRQO\RQWKHSRUFHODLQRYHQ
LQWHULRU7KHXVHRIDEUDVLYHSDGVZLOO
VFUDWFKWKHGRRUJODVV'RQRWZLSHVRLORU
ZDWHURQWRWKHGRRUJDVNHW
5HPRYHDQ\UHPDLQLQJZDWHUZLWKDGU\
FORWKRUVSRQJH
/HDYHWKHGRRURSHQWRDLUGU\
,03257$17127(6
‡ ,IDVWHDPFOHDQF\FOHLVLQLWLDWHGZLWKRXW
ZDWHUSUHVVWKH&OHDU2IISDGWRHQGWKH
F\FOH:DLWIRUWKHUDQJHWRFRROWRURRP
WHPSHUDWXUHEHIRUHSRXULQJZDWHULQWRWKH
UHFHVVHGDUHDDQGLQLWLDWLQJDQRWKHUVWHDP
F\FOH
‡ 'RQRWRSHQWKHGRRUGXULQJWKH6WHDP
&OHDQF\FOH$QHUURUEHHSZLOOVRXQGXSRQ
RSHQLQJWKHGRRU
‡ 3UHVV&OHDU2IISDGDWDQ\WLPHWRHQGWKH
F\FOH
‡ ,IPLQHUDOGHSRVLWVUHPDLQLQWKHRYHQ
ERWWRPDIWHUFOHDQLQJXVHDFORWKRUVSRQJH
VRDNHGLQYLQHJDUWRUHPRYHWKHP
‡ 6RPHZDWHUPD\GULSIURPWKHERWWRPRI
WKHRYHQGRRU,IWKLVKDSSHQVZLSHLWXSDW
WKHHQGRIWKHF\FOH
‡ 7KHGRRUJDVNHWPD\EHZHWZKHQWKH
6WHDP&OHDQF\FOHILQLVKHV7KLVLVQRUPDO
'RQRWFOHDQWKHJDVNHW
‡ ,IVRLOVWLOOUHPDLQVDIWHUFOHDQLQJWKHRYHQ
VHHWKH&DUHDQGFOHDQLQJRIWKHUDQJH
VHFWLRQRIWKH2ZQHU·V0DQXDOIRUDGGLWLRQDO
RSWLRQV
6SHFLDOIHDWXUHVRI\RXURYHQFRQWURO
*($SSOLDQFHVFRP
<RXUQHZWRXFKSDGFRQWUROKDVDGGLWLRQDOIHDWXUHVWKDW\RXPD\FKRRVHWRXVH7KHIROORZLQJDUHWKHIHDWXUHVDQGKRZ
\RXPD\DFWLYDWHWKHP
7KHVSHFLDOIHDWXUHPRGHVFDQRQO\EHDFWLYDWHGZKLOHWKHGLVSOD\LVVKRZLQJWKHWLPHRIGD\7KH\UHPDLQLQWKHFRQWURO·V
PHPRU\XQWLOWKHVWHSVDUHUHSHDWHG
7RHQWHUDVSHFLDOIHDWXUHIRUHLWKHURYHQ\RXPXVWILUVWWRXFKWKHXSSHURYHQ%52,/+,/2DQG%$.(SDGVDWWKHVDPH
WLPH7KHORZHURYHQ%52,/+,/2DQG%$.(SDGVZLOOQRWDFWLYDWHVSHFLDOIHDWXUHV
:KHQWKHGLVSOD\VKRZV\RXUFKRLFHWRXFKWKH67$57SDG7KHVSHFLDOIHDWXUHVZLOOUHPDLQLQPHPRU\DIWHUDSRZHU
IDLOXUHH[FHSWIRUWKH6DEEDWKIHDWXUHZKLFKZLOOKDYHWREHUHVHW
)DKUHQKHLWRU&HOVLXV7HPSHUDWXUH6HOHFWLRQ
<RXURYHQFRQWUROLVVHWWRXVHWKH)DKUHQKHLW
WHPSHUDWXUHVHOHFWLRQVEXW\RXPD\FKDQJHWKLV
WRXVHWKH&HOVLXVVHOHFWLRQV
7RXFKWKHXSSHURYHQ%52,/+,/2DQG
%$.(SDGVDWWKHVDPHWLPHXQWLOWKHGLVSOD\
VKRZV6)
7RXFKWKH&22.7,0(DQG%52,/+,/2
SDGVDWWKHVDPHWLPH7KHGLVSOD\ZLOOVKRZ
))DKUHQKHLW
7RXFKWKH&22.7,0(DQG%52,/+,/2
SDGVDJDLQDWWKHVDPHWLPH7KHGLVSOD\ZLOO
VKRZ&&HOVLXV
7RXFKWKH67$57SDG
7RQHVDWWKH(QGRID7LPHG&\FOH
$WWKHHQGRIDWLPHGF\FOHVKRUWEHHSVZLOO
VRXQGIROORZHGE\RQHEHHSHYHU\VHFRQGV
XQWLOWKH&/($52))SDGLVWRXFKHG7KLV
FRQWLQXDOVHFRQGEHHSPD\EHFDQFHOOHG
7RFDQFHOWKHVHFRQGEHHS
7RXFKWKHXSSHURYHQ%52,/+,/2DQG
%$.(SDGVDWWKHVDPHWLPHXQWLOWKH
GLVSOD\VKRZV6)
7RXFKWKH%52,/SDG7KHGLVSOD\VKRZV
&21%((3FRQWLQXRXVEHHS7RXFKWKH
%52,/SDGDJDLQ7KHGLVSOD\VKRZV%((3
7KLVFDQFHOVWKHRQHEHHSHYHU\VHFRQGV
7RXFKWKH67$57SDG
7RQH9ROXPH
7KLVIHDWXUHDOORZV\RXWRDGMXVWWKHWRQH
YROXPHVWRDPRUHDFFHSWDEOHYROXPH7KHUH
DUHWKUHHSRVVLEOHYROXPHOHYHOV
7RXFKWKHXSSHURYHQ%52,/+,/2DQG
%$.(SDGVDWWKHVDPHWLPHXQWLOWKH
GLVSOD\VKRZV6)
7RXFKWKH&22.7,0(SDG7KHGLVSOD\ZLOO
VKRZ67'%((37KLVLVWKHPLGGOHYROXPH
OHYHO
7RXFKWKH&22.7,0(SDGDJDLQ7KLV
FKDQJHVWKHYROXPHOHYHOHDFKWLPHWKH
SDGLVWRXFKHGDQGDWRQHZLOOVRXQGWR
SURYLGHDQLQGLFDWLRQRIWKHYROXPHOHYHO
&KRRVHWKHGHVLUHGVRXQGOHYHO/2%((3
67'%((3+,%((3RU2))
7RXFKWKH67$57SDGWRDFWLYDWHWKHOHYHO
VKRZQ
6SHFLDOIHDWXUHVRI\RXURYHQFRQWURO
+RXU+RXURU&ORFN%ODFNRXW
<RXUFRQWUROLVVHWWRXVHDKRXUFORFN
,I\RXZRXOGSUHIHUWRKDYHDKRXUPLOLWDU\
WLPHFORFNRUEODFNRXWWKHFORFNGLVSOD\IROORZ
WKHVWHSVEHORZ
7RXFKWKHXSSHURYHQ%52,/+,/2DQG
%$.(SDGVDWWKHVDPHWLPHXQWLOWKH
GLVSOD\VKRZV6)
7RXFKWKH&/2&.SDGRQFH7KHGLVSOD\
ZLOOVKRZK ,IWKLVLVWKHFKRLFH\RX
ZDQWWRXFKWKH67$57SDG
7RXFKWKH&/2&.SDGDJDLQWRFKDQJHWRWKH
KRXUPLOLWDU\WLPHFORFN7KHGLVSOD\ZLOO
VKRZK,IWKLVLVWKHFKRLFH\RXZDQWWRXFK
WKH67$57SDG
7RXFKWKH&/2&.SDGDJDLQWREODFNRXWWKH
FORFNGLVSOD\7KHGLVSOD\ZLOOVKRZ2)) ,IWKLVLV
WKHFKRLFH\RXZDQWWRXFKWKH67$57SDG
127(,IWKHFORFNLVLQWKHEODFNRXWPRGH\RX
ZLOOQRWEHDEOHWRXVHWKH'HOD\6WDUWIXQFWLRQ
$XWR5HFLSHŒ&RQYHUVLRQRQVRPHPRGHOV
:KHQXVLQJFRQYHFWLRQEDNHWKH$XWR5HFLSHŒ
&RQYHUVLRQIHDWXUHFDQDXWRPDWLFDOO\FRQYHUW
HQWHUHGUHJXODUEDNLQJWHPSHUDWXUHVWR
FRQYHFWLRQEDNLQJWHPSHUDWXUHV7KHGLVSOD\
ZLOOQRWVKRZWKHFRQYHUWHGWHPSHUDWXUH,WZLOO
DOZD\VVKRZWKHWHPSHUDWXUHHQWHUHG
7RXFKWKH&219(&7,21&22.SDGXQWLO
WKHGLVSOD\VKRZV&2121&RQYHUVLRQ
2QRU&212))&RQYHUVLRQ2IIDV
GHVLUHG
7RXFKWKH67$57SDG
7RDFWLYDWHRUGHDFWLYDWHWKHIHDWXUH
7RXFKWKHXSSHURYHQ%$.(DQG%52,/
+,/2SDGVDWWKHVDPHWLPHXQWLOWKH
GLVSOD\VKRZV6)
+RXU6KXWGRZQ
:LWKWKLVIHDWXUHVKRXOG\RXIRUJHW
DQGOHDYHWKHRYHQRQWKHFRQWUROZLOO
DXWRPDWLFDOO\WXUQRIIWKHRYHQDIWHU
KRXUVGXULQJEDNLQJIXQFWLRQVRUDIWHU
KRXUVGXULQJDEURLOIXQFWLRQ
,I\RXZLVKWRWXUQ2)) WKLVIHDWXUHIROORZ
WKHVWHSVEHORZ
7RXFKWKHXSSHURYHQ%52,/+,/2DQG
%$.( SDGVDWWKHVDPHWLPHXQWLOWKH
GLVSOD\VKRZV6)
7RXFKWKH'(/$<67$57 SDGXQWLOQR
VKGQQRVKXWRIIDSSHDUVLQWKH
GLVSOD\
7RXFKWKH67$57 SDGWRDFWLYDWHWKHQR
VKXWRIIDQGOHDYHWKHFRQWUROVHWLQWKLV
VSHFLDOIHDWXUHVPRGH
8VLQJWKH6DEEDWKIHDWXUHXSSHUDQGORZHURYHQV
'HVLJQHGIRUXVHRQWKH-HZLVK6DEEDWKDQG+ROLGD\VRQVRPHPRGHOV
*($SSOLDQFHVFRP
7KH6DEEDWKIHDWXUHFDQEHXVHGIRUEDNLQJURDVWLQJRQO\,WFDQQRWEHXVHGIRUFRQYHFWLRQEURLOLQJVHOIFOHDQLQJRU'HOD\6WDUW
FRRNLQJ
127(7KHRYHQOLJKWFRPHVRQDXWRPDWLFDOO\RQVRPHPRGHOVZKHQWKHGRRULVRSHQHGDQGJRHVRIIZKHQWKHGRRULVFORVHG7KHEXOEPD\EHUHPRYHG6HH
WKH2YHQ/LJKW5HSODFHPHQWVHFWLRQ2QPRGHOVZLWKDOLJKWVZLWFKRQWKHFRQWUROSDQHOWKHRYHQOLJKWPD\EHWXUQHGRQDQGOHIWRQ
+RZWR6HWIRU5HJXODU%DNLQJ5RDVWLQJ
:KHQWKHGLVSOD\VKRZVŠWKH
RYHQLVVHWLQ6DEEDWK:KHQWKH
GLVSOD\VKRZVŠWKHRYHQLV
EDNLQJURDVWLQJ
0DNHVXUHWKHFORFNVKRZVWKHFRUUHFWWLPHRIGD\
DQGWKHRYHQLVRII
7RXFKDQGKROGERWKWKHXSSHURYHQ%52,/+,
/2DQG%$.(SDGVDWWKHVDPHWLPHXQWLOWKH
GLVSOD\VKRZV6)
127(,IEDNHRUEURLODSSHDUVLQWKHGLVSOD\WKH
%52,/+,/2DQG%$.(SDGVZHUHQRWWRXFKHG
DWWKHVDPHWLPH7RXFKWKH&/($52))SDG
DQGEHJLQDJDLQ
7DSWKH'(/$<67$57SDGXQWLO6$EE$W+
DSSHDUVLQWKHGLVSOD\
7RXFKWKH67$57SDGDQGŠZLOODSSHDULQWKH
GLVSOD\7KHRYHQLVQRZLQ6DEEDWKPRGH
7RXFKWKH%$.(SDG1RVLJQDOZLOOEHJLYHQ
8VLQJWKHQXPEHUSDGVHQWHUWKHGHVLUHG
WHPSHUDWXUHEHWZHHQƒ)DQGƒ)1R
VLJQDORUWHPSHUDWXUHZLOOEHJLYHQ7KHUHLVQR
GHIDXOWWHPSHUDWXUH
7RXFKWKH67$57SDGRQWKHFRUUHVSRQGLQJ
RYHQ
$IWHUDUDQGRPGHOD\SHULRGRIDSSUR[LPDWHO\
VHFRQGVWRPLQXWHŠZLOODSSHDULQWKH
GLVSOD\LQGLFDWLQJ WKDWWKHRYHQLVEDNLQJ
URDVWLQJ,IŠGRHVQ·WDSSHDULQWKHGLVSOD\
VWDUWDJDLQDW6WHS
7RDGMXVWWKHRYHQWHPSHUDWXUHWRXFKWKH%$.(SDG
HQWHUWKHQHZWHPSHUDWXUHXVLQJWKHQXPEHUSDGV
DQGWRXFKWKH67$57SDG
127(7KH&/($52))DQG&22.7,0(SDGV
DUHDFWLYHGXULQJWKH6DEEDWKIHDWXUH
+RZWR([LWWKH6DEEDWK)HDWXUH
7RXFKWKH&/($52))SDG
,IWKHRYHQLVFRRNLQJZDLWIRUDUDQGRPGHOD\
SHULRGRIDSSUR[LPDWHO\VHFRQGVWR
PLQXWHXQWLORQO\ŠLVLQWKHGLVSOD\
7RXFKDQGKROGERWKWKH%52,/+,/2DQG
%$.(SDGVDWWKHVDPHWLPHXQWLOWKHGLVSOD\
VKRZV6)
7DSWKH'(/$<67$57SDGXQWLOVKGQRUQR
VKGQDSSHDUVLQWKHGLVSOD\
&KRRVHVKGQLQGLFDWLQJWKDWWKHRYHQZLOO
DXWRPDWLFDOO\WXUQRIIDIWHUKRXUVRUQR
VKGQLQGLFDWLQJWKDWWKHRYHQZLOOQRW
DXWRPDWLFDOO\WXUQRIIDIWHUKRXUV
3UHVV67$57ZKHQWKHRSWLRQWKDW\RXZDQWLV
LQWKHGLVSOD\VKGQRUQRVKGQ
127(,IDSRZHURXWDJHRFFXUUHGZKLOHWKHRYHQ
ZDVLQ6DEEDWKWKHRYHQZLOODXWRPDWLFDOO\WXUQRII
DQGVWD\RIIHYHQZKHQWKHSRZHUUHWXUQV7KHRYHQ
FRQWUROPXVWEHUHVHW6RPHPRGHOVZLOOUHVXPH
6DEEDWKPRGHKRZHYHURSHQLQJWKHGRRUZLOO
DFWLYDWHWKHRYHQOLJKW
+RZWR6HWIRU7LPHG%DNLQJ
127(7KLVSURFHGXUHPXVWWDNHSODFH%()25(WKH
6DEEDWKEHJLQVWREHDEOHWRXVHWKH7LPHG%DNH
IHDWXUHGXULQJWKH6DEEDWKWKHXQLWVKRXOG127EH
SXWLQWR6DEEDWKPRGHGXULQJD7LPH%DNH
0DNHVXUHWKHFORFNVKRZVWKHFRUUHFWWLPHRIGD\
DQGWKHRYHQLVRII
7RXFKDQGKROGERWKWKHXSSHURYHQ%52,/+,
/2DQG%$.(SDGVDWWKHVDPHWLPHXQWLOWKH
GLVSOD\VKRZV6)
127(,IEDNHRUEURLODSSHDUVLQWKHGLVSOD\WKH
%52,/+,/2DQG%$.(SDGVZHUHQRWWRXFKHG
DWWKHVDPHWLPH7RXFKWKH&/($52))SDG
DQGEHJLQDJDLQ
3UHVVWKH%52,/+,/2SDGWRFKDQJHWKH
EHHSHUVHWWLQJWRE((3WKHGHIDXOWVHWWLQJLV
&RQWLQXRXV%HHSZKLFKVKRZVLQWKHGLVSOD\DV
&RQE((3
3UHVVWKH67$57SDGWRVDYHWKHFKDQJHV
8VLQJWKHQXPEHUSDGVHQWHUWKHGHVLUHG
WHPSHUDWXUH
3UHVVWKH67$57SDGRQWKHFRUUHVSRQGLQJ
RYHQ
3UHVV&22.7,0()25WKHFRUUHVSRQGLQJRYHQ
3UHVVWKHQXPEHUSDGVWRVHWWKHGHVLUHGOHQJWK
RIFRRNLQJWLPHEHWZHHQPLQXWHDQGKRXUV
DQGPLQXWHV
3UHVVWKH67$57SDG
3UHVVWKH&/2&.SDGWRGLVSOD\WKHFXUUHQW
WLPHRIGD\7KLVLVWRGLVSOD\WKHWLPHRIGD\
LQVWHDGRIWKHFRXQWGRZQFRRNWLPHU7KHRYHQ
ZLOORSHUDWHDWWKHVHWWHPSHUDWXUHIRUWKHVHW
DPRXQWRIWLPHDQGWKHQLWZLOOVKXWRII$WWKH
WLPHWKHRYHQVKXWVRIIWKHEHHSHUZLOOEHHS
WLPHV
3UHVVWKH%$.(SDG
&DUHDQGFOHDQLQJRIWKHUDQJH
%HVXUHDOOFRQWUROVDUHRIIDQGDOOVXUIDFHVDUHFRROEHIRUHFOHDQLQJDQ\SDUWRIWKHUDQJH
:$51,1*
,I\RXUUDQJHLVUHPRYHGIRUFOHDQLQJVHUYLFLQJRUDQ\UHDVRQEH
VXUHWKHDQWLWLSGHYLFHLVUHHQJDJHGSURSHUO\ZKHQWKHUDQJHLV
UHSODFHG)DLOXUHWRWDNHWKLVSUHFDXWLRQFRXOGUHVXOWLQWLSSLQJRI
WKHUDQJHDQGFDQUHVXOWLQGHDWKRUVHULRXVEXUQVWRFKLOGUHQRU
DGXOWV
+RZWR5HPRYH3URWHFWLYH6KLSSLQJ)LOPDQG3DFNDJLQJ7DSH
&DUHIXOO\JUDVSDFRUQHURIWKHSURWHFWLYHVKLSSLQJ
ILOPZLWK\RXUILQJHUVDQGVORZO\SHHOLWIURPWKH
DSSOLDQFHVXUIDFH'RQRWXVHDQ\VKDUSLWHPVWR
UHPRYHWKHILOP5HPRYHDOORIWKHILOPEHIRUHXVLQJ
WKHDSSOLDQFHIRUWKHILUVWWLPH
7RHQVXUHQRGDPDJHLVGRQHWRWKHILQLVKRIWKH
SURGXFWWKHVDIHVWZD\WRUHPRYHWKHDGKHVLYHIURP
SDFNDJLQJWDSHRQQHZDSSOLDQFHVLVDQDSSOLFDWLRQ
RIDKRXVHKROGOLTXLGGLVKZDVKLQJGHWHUJHQW$SSO\
ZLWKDVRIWFORWKDQGDOORZWRVRDN
127(7KHDGKHVLYHPXVWEHUHPRYHGIURPDOOSDUWV
,WFDQQRWEHUHPRYHGLILWLVEDNHGRQ
&RQWURO3DQHO
,IGHVLUHGWKHWRXFKSDGVPD\EHGHDFWLYDWHGEHIRUH
FOHDQLQJ
6HH+RZWR/RFN2XWWKH&RQWUROVLQWKH8VLQJWKH
FORFNNLWFKHQWLPHUDQGFRQWUROORFNRXWVHFWLRQLQWKLV
PDQXDO
&OHDQXSVSODWWHUVZLWKDGDPSFORWK
<RXPD\DOVRXVHDJODVVFOHDQHU
5HPRYHKHDYLHUVRLOZLWKZDUPVRDS\ZDWHU'RQRW
XVHDEUDVLYHVRIDQ\NLQG
5HDFWLYDWHWKHWRXFKSDGVDIWHUFOHDQLQJ
3DLQWHG6XUIDFHV
3DLQWHGVXUIDFHVLQFOXGHWKHVLGHVRIWKHUDQJHDQG
WKHGRRUWRSRIFRQWUROSDQHODQGWKHGUDZHUIURQW
&OHDQWKHVHZLWKVRDSDQGZDWHURUDYLQHJDUDQG
ZDWHUVROXWLRQ
'RQRWXVHFRPPHUFLDORYHQFOHDQHUVFOHDQLQJ
SRZGHUVVWHHOZRRORUKDUVKDEUDVLYHVRQDQ\
SDLQWHGVXUIDFH
6WDLQOHVV6WHHO6XUIDFHVRQVRPHPRGHOV
'RQRWXVHDVWHHOZRROSDGLWZLOOVFUDWFKWKH
VXUIDFH
7RFOHDQWKHVWDLQOHVVVWHHOVXUIDFHXVHZDUP
VXGV\ZDWHURUDVWDLQOHVVVWHHOFOHDQHURU
SROLVK$OZD\VZLSHWKHVXUIDFHLQWKHGLUHFWLRQ
RIWKHJUDLQ)ROORZWKHFOHDQHULQVWUXFWLRQVIRU
FOHDQLQJWKHVWDLQOHVVVWHHOVXUIDFH
7RLQTXLUHDERXWSXUFKDVLQJVWDLQOHVVVWHHO
DSSOLDQFHFOHDQHURUSROLVKRUWRILQGWKH
ORFDWLRQRIDGHDOHUQHDUHVW\RXSOHDVH
FDOORXUWROOIUHHQXPEHU
1DWLRQDO3DUWV&HQWHU
*($SSOLDQFHVFRP
3RUFHODLQ(QDPHO&RRNWRSRQVRPHPRGHOV
7KHSRUFHODLQHQDPHOILQLVKLVVWXUG\EXW
EUHDNDEOHLIPLVXVHG7KLVILQLVKLVDFLG
UHVLVWDQW+RZHYHUDQ\DFLGLFIRRGVVSLOOHG
VXFKDVIUXLWMXLFHVWRPDWRRUYLQHJDUVKRXOG
QRWEHSHUPLWWHGWRUHPDLQRQWKHILQLVK
,IDFLGVVSLOORQWKHFRRNWRSZKLOHLWLVKRWXVH
DGU\SDSHUWRZHORUFORWKWRZLSHLWXSULJKW
DZD\:KHQWKHVXUIDFHKDVFRROHGZDVKZLWK
VRDSDQGZDWHU5LQVHZHOO
)RURWKHUVSLOOVVXFKDVIDWVSDWWHULQJVZDVK
ZLWKVRDSDQGZDWHURUFOHDQVLQJSRZGHUV
DIWHUWKHVXUIDFHKDVFRROHG5LQVHZHOO3ROLVK
ZLWKDGU\FORWK
*($SSOLDQFHVFRP
:$51,1*
6+2&.25%851+$=$5'%HIRUHUHSODFLQJRYHQOLJKWEXOEGLVFRQQHFW
WKHHOHFWULFDOSRZHUWRWKHUDQJHDWWKHPDLQIXVHRUFLUFXLWEUHDNHUSDQHO
)DLOXUHWRGRVRPD\UHVXOWLQHOHFWULFVKRFNRUEXUQ
&$87,21
%851+$=$5'7KHJODVVFRYHUDQGEXOEVKRXOGEHUHPRYHGZKHQFRRO
7RXFKLQJKRWJODVVZLWKEDUHKDQGVRUDGDPSFORWKFDQFDXVHEXUQV
5HFHSWDFOH
6RFNHW
2YHQ/LJKW5HSODFHPHQWRQVRPHPRGHOV
7RUHPRYH
7XUQWKHJODVVFRYHUFRXQWHUFORFNZLVH
WXUQXQWLOWKHWDEVRIWKHJODVVFRYHUFOHDU
WKHJURRYHVRIWKHVRFNHW:HDULQJODWH[
JORYHVPD\RIIHUDEHWWHUJULS
*%XOE
7DE
*ODVVFRYHU
RQVRPHPRGHOV
5HFHSWDFOH
6RFNHW
*%XOE
5HFHSWDFOH
8VLQJJORYHVRUDGU\FORWKUHPRYHWKH
EXOEE\SXOOLQJLWVWUDLJKWRXW
7RUHSODFH
8VHDQHZYROWKDORJHQEXOEQRW
WRH[FHHGZDWWV5HSODFHWKHEXOEZLWK
WKHVDPHW\SHRIEXOEWKDWZDVUHPRYHG
<RXUPRGHOZLOOKDYHRQHRIWKHWZRW\SHV
VKRZQRQWKHOHIW7RGHWHUPLQHWKH
FRUUHFWUHSODFHPHQWEXOEFKHFNWKHEXOE
WHUPLQDOV%XOEVZLWKVWUDLJKWSLQ
WHUPLQDOVDUH*EXOEV%XOEVZLWK
ORRSHGWHUPLQDOVDUH*EXOEV'RQRW
LQWHUFKDQJH%HVXUHWKHUHSODFHPHQW
EXOELVUDWHGYROWVRUYROWV127
YROWV
8VH
JORYHVRU
FORWK
3XVKWKHEXOEVWUDLJKWLQWRWKHUHFHSWDFOH
DOOWKHZD\
3ODFHWKHWDEVRIWKHJODVVFRYHULQWRWKH
JURRYHVRIWKHVRFNHW7XUQWKHJODVVFRYHU
FORFNZLVHWXUQ
)RULPSURYHGOLJKWLQJLQVLGHWKHRYHQ
FOHDQWKHJODVVFRYHUIUHTXHQWO\XVLQJD
ZHWFORWK7KLVVKRXOGEHGRQHZKHQWKH
RYHQLVFRPSOHWHO\FRRO
8VLQJJORYHVRUDGU\FORWKUHPRYHWKH
EXOEIURPLWVSDFNDJLQJ'RQRWWRXFKWKH
EXOEZLWKEDUHILQJHUV2LOIURPVNLQZLOO
GDPDJHWKHEXOEDQGVKRUWHQLWVOLIH
5HFRQQHFWHOHFWULFDOSRZHUWRWKHRYHQ
7DE
*ODVVFRYHU
RQVRPHPRGHOV
2YHQ/LJKW5HSODFHPHQWRQVRPHPRGHOV
7RUHPRYH
7XUQWKHJODVVFRYHUFRXQWHUFORFNZLVH
WXUQXQWLOWKHWDEVRIWKHJODVVFRYHUFOHDU
WKHJURRYHVRIWKHVRFNHW:HDULQJODWH[
JORYHVPD\RIIHUDEHWWHUJULS
5HPRYHWKHEXOEE\WXUQLQJLWFRXQWHU
FORFNZLVH
7RUHSODFH
5HSODFHEXOEZLWKDQHZZDWW
DSSOLDQFHEXOE,QVHUWWKHEXOEDQGWXUQLW
FORFNZLVHXQWLOLWLVWLJKW
3ODFHWKHWDEVRIWKHJODVVFRYHULQWRWKH
JURRYHVRIWKHVRFNHW7XUQWKHJODVV
FRYHUFORFNZLVHWXUQ
)RULPSURYHGOLJKWLQJLQVLGHWKHRYHQFOHDQWKH
JODVVFRYHUIUHTXHQWO\XVLQJDZHWFORWK7KLV
VKRXOGEHGRQHZKHQWKHRYHQLVFRPSOHWHO\
FRRO
5HFRQQHFWHOHFWULFDOSRZHUWRWKHRYHQ
&DUHDQGFOHDQLQJRIWKHUDQJH
&OHDQLQJWKH2YHQ'RRU
7RFOHDQWKHLQVLGHRIWKHGRRU
„
%HFDXVHWKHDUHDLQVLGHWKHJDVNHWLVFOHDQHG
GXULQJWKHVHOIFOHDQF\FOH\RXGRQRWQHHGWR
FOHDQWKLVE\KDQG
7KHJDVNHWLVGHVLJQHGZLWKDJDS
DWWKHERWWRPWRDOORZIRUSURSHUDLU
FLUFXODWLRQ
'RQRWUXERUFOHDQWKHGRRUJDVNHW³LW
KDVDQH[WUHPHO\ORZUHVLVWDQFHWR
DEUDVLRQ
,I\RXQRWLFHWKHJDVNHWEHFRPLQJ
ZRUQIUD\HGRUGDPDJHGLQDQ\ZD\
RULILWKDVEHFRPHGLVSODFHGRQWKH
GRRU\RXVKRXOGKDYHLWUHSODFHG
„
7KHDUHDRXWVLGHWKHJDVNHWDQGWKHGRRUOLQHU
FDQEHFOHDQHGZLWKDVRDSILOOHGRUSODVWLF
VFRXULQJSDGKRWZDWHUDQGGHWHUJHQW5LQVHZHOO
ZLWKDYLQHJDUDQGZDWHUVROXWLRQ
7RFOHDQWKHRXWVLGHRIWKHGRRU
„
,IDQ\VWDLQRQWKHGRRUYHQWWULPLVSHUVLVWHQWXVH
DVRIWDEUDVLYHFOHDQHU
DQGDVSRQJHVFUXEEHUIRUEHVWUHVXOWV
„
6SLOODJHRIPDULQDGHVIUXLWMXLFHVWRPDWRVDXFHV
DQGEDVWLQJPDWHULDOVFRQWDLQLQJDFLGVPD\
FDXVHGLVFRORUDWLRQDQGVKRXOGEHZLSHGXS
LPPHGLDWHO\:KHQVXUIDFHLVFRROFOHDQDQG
ULQVH
„
'RQRWXVHRYHQFOHDQHUVFOHDQLQJSRZGHUVRU
KDUVKDEUDVLYHVRQWKHRXWVLGHRIWKHGRRU
„
8VHVRDSDQGZDWHUWRWKRURXJKO\FOHDQWKHWRS
VLGHVDQGIURQWRIWKHRYHQGRRU5LQVHZHOO<RX
PD\DOVRXVHDJODVVFOHDQHUWRFOHDQWKHJODVVRQ
WKHRXWVLGHRIWKHGRRU'RQRWOHWZDWHUGULSLQWR
WKHYHQWRSHQLQJV
/LIW2II2YHQ'RRURQVRPHPRGHOV
7KHGRRULVYHU\KHDY\%HFDUHIXOZKHQUHPRYLQJ
DQGOLIWLQJWKHGRRU
'RQRWOLIWWKHGRRUE\WKHKDQGOH
7RUHPRYHWKHGRRU
6ORW
+LQJH
ORFN
3XOOKLQJHORFNVGRZQWRXQORFN
)XOO\RSHQWKHGRRU
3XOOWKHKLQJHORFNVGRZQWRZDUGWKHGRRU
IUDPHWRWKHXQORFNHGSRVLWLRQ$WRROVXFKDV
DVPDOOIODWEODGHVFUHZGULYHUPD\EHUHTXLUHG
)LUPO\JUDVSERWKVLGHVRIWKHGRRUDWWKHWRS
&ORVHGRRUWRWKHGRRUUHPRYDOSRVLWLRQZKLFK
LVKDOIZD\EHWZHHQWKHEURLOVWRSSRVLWLRQDQG
IXOO\FORVHG
/LIWGRRUXSDQGRXWXQWLOWKHKLQJHDUPLVFOHDU
RIWKHVORW
7RUHSODFHWKHGRRU
)LUPO\JUDVSERWKVLGHVRIWKHGRRUDWWKHWRS
%RWWRP
:LWKWKH
+LQJHDUP
HGJH
GRRUDWWKHVDPH
RIVORW
DQJOH
DVWKHUHPRYDO
SRVLWLRQVHDWWKH
LQGHQWDWLRQRIWKHKLQJH
,QGHQWDWLRQ
DUPLQWRWKHERWWRPHGJH
RIWKHKLQJHVORW7KHQRWFK
LQWKHKLQJHDUPPXVWEHIXOO\VHDWHGLQWRWKH
ERWWRPRIWKHVORW
)XOO\RSHQWKHGRRU,IWKHGRRUZLOOQRWIXOO\
RSHQWKHLQGHQWDWLRQLVQRWVHDWHGFRUUHFWO\LQ
WKHERWWRPHGJHRIWKHVORW
3XVKWKHKLQJHORFNVXSDJDLQVWWKHIURQWIUDPH
RIWKHRYHQFDYLW\WRWKHORFNHGSRVLWLRQ
+LQJH
ORFN
+LQJH
DUP
5HPRYDOSRVLWLRQ
3XVKKLQJHORFNVXSWRORFN
&ORVHWKHRYHQGRRU
*($SSOLDQFHVFRP
/LIW2II8SSHU2YHQ'RRURQVRPHPRGHOV
7RUHPRYHWKHGRRU
2YHQ
IUDPH
)XOO\RSHQWKHGRRU
/LIWXSRQWKHKLQJHORFNWRZDUGWKHRYHQ
IUDPHXQWLOWKH\VWRS
&ORVHWKHGRRUWRGHJUHHV\RXZLOOIHHO
WKHGRRUVWRS7KHKLQJHORFNZLOOFRQWDFW
WKHRYHQIUDPH
2QERWKVLGHVRIWKHGRRUSUHVVGRZQRQ
WKHUHOHDVHEXWWRQVRQHDFKKLQJH
/LIWGRRUXSXQWLOLWLVFOHDURIWKHKLQJH
3XOORQKLQJHDUPVVOLJKWO\WRUHOLHYH
SUHVVXUHRQWKHORFNLQJWDEV
'RRU
IUDPH
3XVKWKHKLQJHORFNVGRZQRQWRWKHKLQJH
5HOHDVH
EXWWRQV
7RUHSODFHWKHGRRU
3XOOWKHKLQJHVGRZQDZD\IURPWKHRYHQ
IUDPHWRWKHIXOO\RSHQSRVLWLRQ
/LIWXSRQWKHKLQJHORFNVWRZDUGWKHRYHQ
IUDPHXQWLOWKH\VWRS
7KHKLQJHVZLOOUHOHDVHWRWKHGHJUHH
SRVLWLRQ7KHKLQJHORFNVZLOOFRQWDFWWKH
RYHQIUDPH
6OLGHWKHGRRUEDFNRQWRWKHKLQJHV0DNH
VXUHWKHEXWWRQVSRSEDFNRXW
)XOO\RSHQWKHGRRU
3XVKWKHKLQJHORFNVGRZQRQWRWKHKLQJH
&ORVHWKHRYHQGRRU
3XVKWKHKLQJHVLQWRZDUGWKHXQLWVRWKH\
DUHFORVHG
3XVKLQ
3XOOGRZQ
&DUHDQGFOHDQLQJRIWKHUDQJH
)ODWUDFN
+DQGOHV
)RUGRXEOHRYHQVXVHWKHUDFNZLWKWKH
WZRIURQWKDQGOHVLQWKHXSSHURYHQ
)RUGRXEOHRYHQVXVHWKHUDFN
ZLWKRXWWKHWZRIURQWKDQGOHVLQ
WKHORZHURYHQ
2YHQ5DFNV
$OORYHQUDFNVPD\EHFOHDQHGE\KDQGZLWKDQ
DEUDVLYHFOHDQHURUVWHHOZRRO$IWHUFOHDQLQJ
ULQVHWKHUDFNVZLWKFOHDQZDWHUDQGGU\ZLWKD
FOHDQFORWK*UD\SRUFHODLQFRDWHGRYHQUDFNV
PD\UHPDLQLQWKHRYHQGXULQJWKHVHOIFOHDQLQJ
F\FOHZLWKRXWEHLQJGDPDJHG7KHQLFNHOSODWHG
RYHQUDFNVPD\UHPDLQLQWKHRYHQGXULQJWKH
VHOIFOHDQLQJF\FOHEXWWKH\ZLOOORVHWKHLUOXVWHU
DQGEHFRPHKDUGWRVOLGH,WZLOOEHQHFHVVDU\
WRJUHDVHDOORYHQUDFNVLGHHGJHVZLWKDOLJKW
FRDWLQJRIYHJHWDEOHRLODIWHUFOHDQLQJWKHPE\
KDQGRULQWKHRYHQ7KLVZLOOKHOSPDLQWDLQWKH
HDVHRIVOLGLQJWKHUDFNVLQDQGRXWRIWKHRYHQ
([WHQVLRQ5DFNRQVRPHPRGHOV
([WHQVLRQUDFNVPD\EHFOHDQHGE\KDQG
ZLWKDQDEUDVLYHFOHDQHURUVWHHOZRRO'XULQJ
FOHDQLQJEHFDUHIXOQRWWRDOORZZDWHURU
FOHDQHUWRHQWHUWKHH[WHQVLRQVOLGHVRQWKH
VLGHVRIWKHUDFN
127('RQRWFOHDQLQDGLVKZDVKHU
,IWKHUDFNEHFRPHVKDUGWRUHPRYHRUUHSODFH
OLJKWO\ZLSHWKHRYHQUDFNVXSSRUWVZLWK
FRRNLQJRLO'RQRWZLSHFRRNLQJRLORQWKH
VOLGHV
,IWKHUDFNEHFRPHVGLIILFXOWWRVOLGHRULIWKH
SDGGOHLVGLIILFXOWWRDFWXDWHWKHUDFNPD\
QHHGWREHOXEULFDWHGXVLQJWKH*UDSKLWH
/XEULFDWLRQVKLSSHGZLWK\RXURYHQ7RRUGHU
DGGLWLRQDO*UDSKLWH/XEULFDWLRQFDOORXU
1DWLRQDO3DUWV&HQWHUDWDQG
UHIHUHQFH:%7
7ROXEULFDWHWKHVOLGHV
2SHQDQGFORVHWKHUDFNVHYHUDOWLPHVWR
GLVWULEXWHWKHOXEULFDQW
127('RQRWVSUD\H[WHQVLRQUDFNZLWKFRRNLQJ
5HSODFHWKHFDSRQWKHOXEULFDQWDQG
VSUD\RURWKHUOXEULFDQWVSUD\V
VKDNHLWDJDLQ7XUQWKHUDFNRYHUDQG
5HPRYHWKHUDFNIURPWKHRYHQ6HH
UHSHDWVWHSVDQG
([WHQVLRQ5DFNLQWKH8VLQJWKHRYHQ
&ORVHWKHUDFNWXUQUDFNULJKWVLGHXSDQG
VHFWLRQ
SODFHLQWKHRYHQ6HH([WHQVLRQ5DFNLQ
)XOO\H[WHQGWKHUDFNRQDWDEOHRU
WKH8VLQJWKHRYHQVHFWLRQ
FRXQWHUWRS1HZVSDSHUPD\EHSODFHG
7ROXEULFDWHWKHSDGGOH
XQGHUQHDWKWKHUDFNIRUHDV\FOHDQXS
,IWKHUHLVGHEULVLQWKHVOLGHWUDFNVZLSHLW 6KDNHOXEULFDQWDQGDSSO\WRWKHPRYLQJSDUWV
DZD\XVLQJDSDSHUWRZHO
RIWKHSDGGOHPHFKDQLVPVDVVKRZQ
127($Q\JUDSKLWHOXEULFDQWZLSHGDZD\
PXVWEHUHSODFHGVHHVWHSVWKURXJK
6KDNHWKHJUDSKLWHOXEULFDQWEHIRUH
RSHQLQJLW6WDUWLQJZLWKWKHOHIWVOLGH
PHFKDQLVPRIWKHUDFNSODFHIRXU
VPDOOGURSVRIOXEULFDQWRQWKHWZR
ERWWRPWUDFNVRIWKHVOLGHFORVHWRWKH
EHDULQJFDUULHUV
5HSHDWIRUWKHULJKWVOLGHPHFKDQLVPRI
WKHUDFN
*($SSOLDQFHVFRP
2YHQ+HDWLQJ(OHPHQWV
'RQRWFOHDQWKHEDNHHOHPHQWRUWKHEURLO
HOHPHQW$Q\VRLOZLOOEXUQRIIZKHQWKH
HOHPHQWVDUHKHDWHG
7RFOHDQWKHRYHQIORRUJHQWO\OLIWWKHEDNH
HOHPHQW2QVRPHPRGHOVWKHEDNHHOHPHQWLV
QRWH[SRVHGDQGLVXQGHUWKHRYHQIORRU&OHDQ
ZLWKZDUPVRDS\ZDWHU
:LSHXSKHDY\VRLORQWKHRYHQ
ERWWRP
2YHQ9HQWRQ5DGLDQW*ODVV&RRNWRSV
$OOPRGHOVKDYHDQRYHQYHQWORFDWHGEHKLQGWKH
ULJKWUHDUVXUIDFHXQLW2QGRXEOHRYHQVWKHUHLVDQ
DGGLWLRQDORYHQYHQWIRUWKHXSSHURYHQEHKLQGWKH
OHIWUHDUVXUIDFHXQLW
7KLVDUHDFRXOGEHFRPHKRWGXULQJRYHQXVH
,WLVQRUPDOIRUVWHDPWRFRPHRXWRIWKHYHQWDQG
PRLVWXUHPD\FROOHFWXQGHUQHDWKLWZKHQWKHRYHQ
LVLQXVH
7KHYHQWLVLPSRUWDQWIRUSURSHUDLUFLUFXODWLRQ1HYHU
EORFNWKLVYHQW
6WRUDJH'UDZHU5HPRYDORQVRPHPRGHOV
7RUHPRYHWKHGUDZHU
5DLO
6WRSJXLGH
7RUHSODFHWKHGUDZHU
3XOOWKHGUDZHURXWXQWLOLWVWRSV
3ODFHWKHGUDZHUUDLOVRQWKHJXLGHV
/LIWWKHIURQWRIWKHGUDZHUXQWLOWKHVWRSV
FOHDUWKHJXLGHV
5HPRYHWKHGUDZHU
3XVKWKHGUDZHUEDFNXQWLOLWVWRSV
/LIWWKHIURQWRIWKHGUDZHUDQGSXVKEDFN
XQWLOWKHVWRSVFOHDUWKHJXLGHV
/RZHUWKHIURQWRIWKHGUDZHUDQGSXVK
EDFNXQWLOLWFORVHV
5HPRYDEOH:DUPLQJ'UDZHU'UDZHU3DQRQVRPHPRGHOV
127()RUPRGHOVZLWKDQHOHFWULF
ZDUPLQJGUDZHUEHIRUHSHUIRUPLQJ
DQ\DGMXVWPHQWVFOHDQLQJRUVHUYLFH
GLVFRQQHFWWKHUDQJHHOHFWULFDOSRZHU
VXSSO\DWWKHKRXVHKROGGLVWULEXWLRQSDQHO
E\UHPRYLQJWKHIXVHRUVZLWFKLQJRIIWKH
FLUFXLWEUHDNHU0DNHVXUHWKHGUDZHU
KHDWLQJHOHPHQWLVFRRO
„1HYHUSODFHXVHRUVHOIFOHDQWKHGUDZHUSDQ
LQWKHXSSHURYHQ
„:DUPLQJGUDZHUKDVDUHPRYDEOHSDQIRU
HDV\FOHDQLQJ&OHDQZLWKKRWVRDS\ZDWHU
DQGDVSRQJHRUGLVKWRZHO'U\ZLWKD
FOHDQFORWK5HSODFHWKHSDQLQWKHZDUPLQJ
GUDZHU
127($OORZZDUPLQJGUDZHUWRFRROEHIRUH
UHPRYLQJSDQ
127(:LSHVSLOOVSURPSWO\DIWHUHDFKXVH
&OHDQLQJWKHJODVVFRRNWRSRQVRPHPRGHOV
1RUPDO'DLO\8VH&OHDQLQJ
21/<XVH&(5$0$%5<7(Š&HUDPLF&RRNWRS
&OHDQHURQWKHJODVVFRRNWRS2WKHUFUHDPV
PD\QRWEHDVHIIHFWLYH
7RPDLQWDLQDQGSURWHFWWKHVXUIDFHRI\RXU
JODVVFRRNWRSIROORZWKHVHVWHSV
&OHDQ\RXUFRRNWRSDIWHUHDFK
VSLOO8VH&(5$0$%5<7(Š&HUDPLF
&RRNWRS&OHDQHU
%HIRUHXVLQJWKHFRRNWRSIRUWKH
ILUVWWLPHFOHDQLWZLWK&(5$0$%5<7(Š
&HUDPLF&RRNWRS&OHDQHU7KLVKHOSV
SURWHFWWKHWRSDQGPDNHVFOHDQXSHDVLHU
'DLO\XVHRI&(5$0$%5<7(Š&HUDPLF
&RRNWRS&OHDQHUZLOOKHOSNHHSWKH
FRRNWRSORRNLQJQHZ
6KDNHWKHFOHDQLQJFUHDPZHOO$SSO\D
IHZGURSVRI&(5$0$%5<7(Š&HUDPLF
&RRNWRS&OHDQHUGLUHFWO\
WRWKHFRRNWRS
8VHDSDSHUWRZHORU&(5$0$%5<7(Š
&OHDQLQJ3DGIRU&HUDPLF&RRNWRSVWR
FOHDQWKHHQWLUHFRRNWRSVXUIDFH
8VHDGU\FORWKRUSDSHUWRZHO
WRUHPRYHDOOFOHDQLQJUHVLGXH
1RQHHGWRULQVH
127(,WLVYHU\LPSRUWDQWWKDW\RX'2127
KHDWWKHFRRNWRSXQWLOLWKDVEHHQFOHDQHG
WKRURXJKO\
%XUQHG2Q5HVLGXH
127('$0$*(WR\RXUJODVVVXUIDFHPD\
RFFXULI\RXXVHVFUXESDGVRWKHUWKDQWKRVH
UHFRPPHQGHG
$OORZWKHFRRNWRSWRFRRO
8VHD&(5$0$%5<7(Š&OHDQLQJ
3DGIRU&HUDPLF&RRNWRSV
6SUHDGDIHZGURSVRI&(5$0$%5<7(Š
&HUDPLF&RRNWRS&OHDQHURQWKHHQWLUH
EXUQHGUHVLGXHDUHD
,IDQ\UHVLGXHUHPDLQVUHSHDW
WKHVWHSVOLVWHGDERYHDVQHHGHG
)RUDGGLWLRQDOSURWHFWLRQDIWHUDOO
UHVLGXHKDVEHHQUHPRYHGSROLVKWKH
HQWLUHVXUIDFHZLWK&(5$0$%5<7(Š
&HUDPLF&RRNWRS&OHDQHUDQGDSDSHU
WRZHO
8VLQJWKHLQFOXGHG&(5$0$%5<7(Š
&OHDQLQJ3DGIRU&HUDPLF&RRNWRSVUXE
WKHUHVLGXHDUHDDSSO\LQJSUHVVXUHDV
QHHGHG
+HDY\%XUQHG2Q5HVLGXH
$OORZWKHFRRNWRSWRFRRO
7KH&(5$0$%5<7(Š&HUDPLF
&RRNWRS6FUDSHUDQGDOO
UHFRPPHQGHGVXSSOLHVDUH
DYDLODEOHWKURXJKRXU3DUWV
&HQWHU6HHLQVWUXFWLRQVXQGHU´7R
2UGHU3DUWVµVHFWLRQRQQH[WSDJH
127('RQRWXVHDGXOORU
QLFNHGEODGH
8VHDVLQJOHHGJHUD]RUEODGHVFUDSHU
DWDSSUR[LPDWHO\DƒDQJOHDJDLQVW
WKHJODVVVXUIDFHDQGVFUDSHWKHVRLO,W
ZLOOEHQHFHVVDU\WRDSSO\SUHVVXUHWR
WKHUD]RUVFUDSHULQRUGHUWRUHPRYH
WKHUHVLGXH
$IWHUVFUDSLQJZLWKWKHUD]RUVFUDSHU
VSUHDGDIHZGURSVRI&(5$0$%5<7(Š
&HUDPLF&RRNWRS&OHDQHURQWKHHQWLUH
EXUQHGUHVLGXHDUHD8VHWKH&(5$0$
%5<7(Š&OHDQLQJ3DGWRUHPRYHDQ\
UHPDLQLQJUHVLGXH
)RUDGGLWLRQDOSURWHFWLRQDIWHUDOO
UHVLGXHKDVEHHQUHPRYHGSROLVKWKH
HQWLUHVXUIDFHZLWK&(5$0$%5<7(Š
&HUDPLF&RRNWRS&OHDQHUDQGDSDSHU
WRZHO
*($SSOLDQFHVFRP
0HWDO0DUNVDQG6FUDWFKHV
%HFDUHIXOQRWWRVOLGHSRWVDQGSDQV
7KLVVKRXOGEHUHPRYHGLPPHGLDWHO\
DFURVV\RXUFRRNWRS,WZLOOOHDYHPHWDO
EHIRUHKHDWLQJDJDLQRUWKH
PDUNLQJVRQWKHFRRNWRSVXUIDFH
GLVFRORUDWLRQPD\EHSHUPDQHQW
7KHVHPDUNVDUHUHPRYDEOHXVLQJWKH
127(&DUHIXOO\FKHFNWKHERWWRPRISDQVIRU
&(5$0$%5<7(Š&HUDPLF&RRNWRS&OHDQHU URXJKQHVVWKDWZRXOGVFUDWFKWKHFRRNWRS
ZLWKWKH&(5$0$%5<7(Š&OHDQLQJ3DG
IRU&HUDPLF&RRNWRSV
,ISRWVZLWKDWKLQRYHUOD\RIDOXPLQXP
RUFRSSHUDUHDOORZHGWRERLOGU\WKH
RYHUOD\PD\OHDYHEODFNGLVFRORUDWLRQ
RQWKHFRRNWRS
&RRNWRS6HDO
7RFOHDQWKHFRRNWRSVHDODURXQGWKHHGJHV
RIWKHJODVVOD\DZHWFORWKRQLWIRUDIHZ
PLQXWHVWKHQZLSHFOHDQZLWKQRQDEUDVLYH
FOHDQHUV
*ODVVVXUIDFH³SRWHQWLDOIRUSHUPDQHQWGDPDJH
6XJDU\VSLOORYHUVVXFKDV
MHOOLHVIXGJHFDQG\V\UXSV
RUPHOWHGSODVWLFVFDQFDXVH
SLWWLQJRIWKHVXUIDFHRI\RXU
FRRNWRSQRWFRYHUHGE\WKH
ZDUUDQW\XQOHVVWKHVSLOOLV
UHPRYHGZKLOHVWLOOKRW6SHFLDO
FDUHVKRXOGEHWDNHQZKHQ
UHPRYLQJKRWVXEVWDQFHV
%HVXUHWRXVHDQHZVKDUS
UD]RUVFUDSHU
'DPDJHIURP6XJDU\6SLOOVDQG0HOWHG3ODVWLF
7XUQRIIDOOVXUIDFHXQLWV5HPRYHKRW
SDQV
:HDULQJDQRYHQPLWW
D8VHDVLQJOHHGJHUD]RU
EODGHVFUDSHU&(5$0$%5<7(Š
&HUDPLF&RRNWRS6FUDSHU
WRPRYHWKHVSLOOWRDFRRO
DUHDRQWKHFRRNWRS
E5HPRYHWKHVSLOOZLWKSDSHUWRZHOV
'RQRWXVHDGXOORUQLFNHG
EODGH
$Q\UHPDLQLQJVSLOORYHUVKRXOGEHOHIW
XQWLOWKHVXUIDFHRIWKHFRRNWRSKDV
FRROHG
'RQ·WXVHWKHVXUIDFHXQLWVDJDLQXQWLO
DOORIWKHUHVLGXHKDVEHHQFRPSOHWHO\
UHPRYHG
127(,ISLWWLQJRULQGHQWDWLRQLQWKHJODVV
VXUIDFHKDVDOUHDG\RFFXUUHGWKHFRRNWRS
JODVVZLOOKDYHWREHUHSODFHG
,QWKLVFDVHVHUYLFHZLOOEHQHFHVVDU\
7R2UGHU3DUWV
7RRUGHU&(5$0$%5<7(Š&HUDPLF&RRNWRS
&OHDQHUDQGWKHFRRNWRSVFUDSHUSOHDVHFDOO
RXUWROOIUHHQXPEHU
1DWLRQDO3DUWV&HQWHU
Š
&(5$0$%5<7( &HUDPLF
&RRNWRS&OHDQHU :;;
&(5$0$%5<7(Š&HUDPLF
&RRNWRS6FUDSHU :;;
.LW :%;
.LWLQFOXGHVFUHDPDQGFRRNWRSVFUDSHU
&(5$0$%5<7(Š&OHDQLQJ3DGVIRU
&HUDPLF&RRNWRSV :;;
%HIRUH<RX&DOO)RU6HUYLFH«
7URXEOHVKRRWLQJ7LSV
6DYHWLPHDQGPRQH\5HYLHZWKHFKDUWVRQWKHIROORZLQJ
SDJHVILUVWDQG\RXPD\QRWQHHGWRFDOOIRUVHUYLFH
3UREOHP
3RVVLEOH&DXVHV
:KDW7R'R
6XUIDFHXQLWVZLOOQRW
PDLQWDLQDUROOLQJERLO
RUFRRNLQJLVQRW
IDVWHQRXJK
,PSURSHUFRRNZDUH
EHLQJXVHG
‡ 8VHSDQVZKLFKDUHIODWDQGPDWFKWKHGLDPHWHURI
WKHVXUIDFHXQLWVHOHFWHG
,QVRPHDUHDVWKHSRZHU
YROWDJHPD\EHORZ
‡ &RYHUSDQZLWKDOLGXQWLOGHVLUHGKHDWLVREWDLQHG
6XUIDFHXQLWVGR
QRWZRUNSURSHUO\
$IXVHLQ\RXUKRPHPD\EH
EORZQRUWKHFLUFXLWEUHDNHU
WULSSHG
‡ 5HSODFHWKHIXVHRUUHVHWWKHFLUFXLWEUHDNHU
&RRNWRSFRQWUROV
LPSURSHUO\VHW
‡ &KHFNWRVHHWKHFRUUHFWFRQWUROLVVHWIRUWKHVXUIDFH
XQLW\RXDUHXVLQJ
6XUIDFHXQLWVWRSV
JORZLQJZKHQWXUQHG
WRDORZHUVHWWLQJ
7KLVLVQRUPDO7KHXQLW
LVVWLOORQDQGKRW
6FUDWFKHVPD\DSSHDU
DVFUDFNVRQFRRNWRS
JODVVVXUIDFH
,QFRUUHFWFOHDQLQJ
PHWKRGVEHLQJXVHG
‡ 6FUDWFKHVDUHQRWUHPRYDEOH7LQ\VFUDWFKHVZLOOEHFRPH
OHVVYLVLEOHLQWLPHDVDUHVXOWRIFOHDQLQJ
&RRNZDUHZLWKURXJKERWWRPV ‡ 7RDYRLGVFUDWFKHVXVHWKHUHFRPPHQGHGFOHDQLQJ
EHLQJXVHGRUFRDUVHSDUWLFOHV SURFHGXUHV0DNHVXUHERWWRPVRIFRRNZDUHDUHFOHDQ
VDOWRUVDQGZHUHEHWZHHQ
EHIRUHXVHDQGXVHFRRNZDUHZLWKVPRRWKERWWRPV
WKHFRRNZDUHDQGWKHVXUIDFH
RIWKHFRRNWRS
&RRNZDUHKDVEHHQVOLG
DFURVVWKHFRRNWRSVXUIDFH
$UHDVRIGLVFRORUDWLRQ )RRGVSLOORYHUVQRWFOHDQHG
RQWKHFRRNWRS
EHIRUHQH[WXVH
‡ 6HHWKH&OHDQLQJWKHJODVVFRRNWRSVHFWLRQ
+RWVXUIDFHRQDPRGHO
‡ 7KLVLVQRUPDO7KHVXUIDFHPD\DSSHDUGLVFRORUHG
ZLWKDOLJKWFRORUHGFRRNWRS ZKHQLWLVKRW7KLVLVWHPSRUDU\DQGZLOOGLVDSSHDU
DVWKHJODVVFRROV
3ODVWLFPHOWHGWR
WKHVXUIDFH
+RWFRRNWRSFDPHLQWR
FRQWDFWZLWKSODVWLFSODFHG
RQWKHKRWFRRNWRS
‡ 6HHWKH*ODVVVXUIDFH³SRWHQWLDOIRUSHUPDQHQWGDPDJH
VHFWLRQLQWKH&OHDQLQJWKHJODVVFRRNWRSVHFWLRQ
3LWWLQJRULQGHQWDWLRQ +RWVXJDUPL[WXUHVSLOOHG
RIWKHFRRNWRS
RQWKHFRRNWRS
‡ &DOODTXDOLILHGWHFKQLFLDQIRUUHSODFHPHQW
)UHTXHQWF\FOLQJ
RIIDQGRQRI
VXUIDFHXQLWV
,PSURSHUFRRNZDUH
EHLQJXVHG
‡ 8VHRQO\IODWFRRNZDUHWRPLQLPL]HF\FOLQJ
2YHQOLJKWGRHV
QRWZRUN
/LJKWEXOELVORRVH
‡ 7LJKWHQRUUHSODFHWKHEXOE
2YHQZLOOQRWZRUN
3OXJRQUDQJHLVQRWFRPSOHWHO\ ‡ 0DNHVXUHHOHFWULFDOSOXJLVSOXJJHGLQWRDOLYHSURSHUO\
LQVHUWHGLQWKHHOHFWULFDORXWOHW JURXQGHGRXWOHW
$IXVHLQ\RXUKRPHPD\
EHEORZQRUWKHFLUFXLW
EUHDNHUWULSSHG
2YHQFRQWUROVLPSURSHUO\VHW ‡ 6HHWKH8VLQJWKHRYHQVHFWLRQ
2YHQWRRKRW
‡ 5HSODFHWKHIXVHRUUHVHWWKHFLUFXLWEUHDNHU
‡ $OORZWKHRYHQWRFRROWREHORZORFNLQJWHPSHUDWXUH
*($SSOLDQFHVFRP
3UREOHP
3RVVLEOH&DXVHV
:KDW7R'R
)RRGGRHVQRWEDNH
RUURDVWSURSHUO\
2YHQFRQWUROVLPSURSHUO\VHW
‡ 6HHWKH8VLQJWKHRYHQVHFWLRQ
5DFNSRVLWLRQLVLQFRUUHFW
RUWKHUDFNLVQRWOHYHO
‡ 6HHWKH8VLQJWKHRYHQVHFWLRQ
,QFRUUHFWFRRNZDUHRU
FRRNZDUHRILPSURSHU
VL]HEHLQJXVHG
‡ 6HHWKH8VLQJWKHRYHQVHFWLRQ
2YHQWKHUPRVWDWQHHGV
DGMXVWPHQW
‡ 6HHWKH$GMXVWWKHRYHQWKHUPRVWDW³'RLW\RXUVHOI
VHFWLRQ
)RRGGRHVQRW
EURLOSURSHUO\
2YHQFRQWUROVLPSURSHUO\VHW
‡ 0DNHVXUH\RXWRXFKWKH%52,/+,/2SDG
,PSURSHUUDFNSRVLWLRQ
EHLQJXVHG
‡ 6HHWKH%URLOLQJ*XLGH
&RRNZDUHQRWVXLWHG
IRUEURLOLQJ
‡ )RUEHVWUHVXOWVXVHDSDQGHVLJQHGIRUEURLOLQJ
7KHSUREHLVSOXJJHG
LQWRWKHRXWOHWLQWKHRYHQ
RQVRPHPRGHOV
‡ 8QSOXJDQGUHPRYHWKHSUREHIURPWKHRYHQ
‡ 3UHKHDWWKHEURLOHOHPHQWIRUPLQXWHV
,QVRPHDUHDVWKHSRZHU
YROWDJHPD\EHORZ
2YHQWHPSHUDWXUH
WRRKRWRUWRRFROG
2YHQWKHUPRVWDW
QHHGVDGMXVWPHQW
‡ 6HHWKH$GMXVWWKHRYHQWKHUPRVWDW³'RLW\RXUVHOI
VHFWLRQ
6WRUDJHGUDZHU
LVFURRNHG
5HDUGUDZHUVXSSRUWLV
RQWRSRIWKHJXLGHUDLO
‡ 5HSRVLWLRQWKHGUDZHU6HHWKH6WRUDJH'UDZHU
5HPRYDOLQVWUXFWLRQVLQWKH&DUHDQGFOHDQLQJRIWKH
UDQJHVHFWLRQ
‡ &KHFNWRPDNHVXUHGUDZHULVSURSHUO\VHDWHG
LIUHPRYHG
6WRUDJHGUDZHU
ZRQ·WFORVH
3RZHUFRUGPD\EH
REVWUXFWLQJGUDZHU
LQWKHORZHUEDFN
RIWKHUDQJH
‡ 5HSRVLWLRQWKHGUDZHUDQGSRZHUFRUG6HHWKH
6WRUDJH'UDZHU5HPRYDOLQVWUXFWLRQVLQWKH&DUHDQG
FOHDQLQJRIWKHUDQJHVHFWLRQ
5HDUGUDZHUVXSSRUWLV
RQWRSRIWKHJXLGHUDLO
‡ 5HSRVLWLRQWKHGUDZHU6HHWKH6WRUDJH'UDZHU
5HPRYDOLQVWUXFWLRQVLQWKH&DUHDQGFOHDQLQJRIWKH
UDQJHVHFWLRQ
2YHQGRRULVFURRNHG
7KHGRRULVRXWRISRVLWLRQ
‡ %HFDXVHWKHRYHQGRRULVUHPRYDEOHLWVRPHWLPHVJHWVRXW RISRVLWLRQGXULQJLQVWDOODWLRQ
‡ 7RVWUDLJKWHQWKHGRRUSXVKGRZQRQWKHKLJKFRUQHU
‡ %URLOIRUWKHORQJHVWSHULRGRIWLPHUHFRPPHQGHG
LQWKH%URLOLQJ*XLGH
%HIRUH<RX&DOO)RU6HUYLFH«
7URXEOHVKRRWLQJ7LSV
3UREOHP
3RVVLEOH&DXVHV
:KDW7R'R
&ORFNDQGWLPHUGR
QRWZRUN
3OXJRQUDQJHLVQRWFRPSOHWHO\ ‡ 0DNHVXUHHOHFWULFDOSOXJLVSOXJJHGLQWRDOLYHSURSHUO\
LQVHUWHGLQWKHHOHFWULFDORXWOHW JURXQGHGRXWOHW
$IXVHLQ\RXUKRPH
PD\EHEORZQRUWKH
FLUFXLWEUHDNHUWULSSHG
2YHQFRQWUROVLPSURSHUO\VHW ‡ 6HHWKH8VLQJWKHNLWFKHQWLPHUVHFWLRQ
‡ 5HSODFHWKHIXVHRUUHVHWWKHFLUFXLWEUHDNHU
2YHQZLOOQRWVHOIFOHDQ 7KHRYHQWHPSHUDWXUHLV
WRRKLJKWRVHWDVHOIFOHDQ
RSHUDWLRQ
‡ $OORZWKHUDQJHWRFRRODQGUHVHWWKHFRQWUROV
2YHQFRQWUROVLPSURSHUO\VHW
‡ 6HHWKH8VLQJWKHVHOIFOHDQLQJRYHQVHFWLRQ
7KHSUREHLVSOXJJHGLQWR
WKHRXWOHWLQWKHRYHQ
RQVRPHPRGHOV
‡ 5HPRYHWKHSUREHIURPWKHRYHQ
´&UDFNOLQJµRU
´SRSSLQJµVRXQG
7KLVLVWKHVRXQGRIWKH
‡ 7KLVLVQRUPDO
PHWDOKHDWLQJDQGFRROLQJ
GXULQJERWKWKHFRRNLQJDQG
FOHDQLQJIXQFWLRQV
([FHVVLYHVPRNLQJ
GXULQJDFOHDQF\FOH
([FHVVLYHVRLO
‡ 7RXFKWKH&/($52))SDG2SHQWKHZLQGRZVWR
ULGWKHURRPRIVPRNH:DLWXQWLO/2&.(''225 JRHVRII$IWHUWKHRYHQFRROVZLSHXSWKH
H[FHVVVRLODQGUHVHWWKHFOHDQF\FOH
2YHQGRRUZLOOQRW
RSHQDIWHUDFOHDQF\FOH
2YHQWRRKRW
‡ $OORZWKHRYHQWRFRROEHORZORFNLQJWHPSHUDWXUH
2YHQQRWFOHDQDIWHUD
FOHDQF\FOH
2YHQFRQWUROVQRWSURSHUO\VHW ‡ 6HHWKH8VLQJWKHVHOIFOHDQLQJRYHQRU8VLQJVWHDPFOHDQVHFWLRQ
2YHQZDVKHDYLO\VRLOHG
´/2&.('µIODVKHV
LQWKHGLVSOD\
7KHVHOIFOHDQF\FOHKDVEHHQ ‡ &ORVHWKHRYHQGRRU
VHOHFWHGEXWWKHGRRULVQRW FORVHG
´/2&.('µLVRQ
ZKHQ\RXZDQW
WRFRRN
7KHRYHQGRRULVORFNHG
EHFDXVHWKHWHPSHUDWXUH
LQVLGHWKHRYHQKDVQRW
GURSSHGEHORZWKH
ORFNLQJWHPSHUDWXUH
´)³µDQGDQXPEHU
RUOHWWHUIODVK
LQWKHGLVSOD\
<RXKDYHDIXQFWLRQHUURUFRGH ‡ 'LVFRQQHFWDOOSRZHUWRWKHUDQJHIRUDWOHDVW
VHFRQGVDQGWKHQUHFRQQHFWSRZHU,IWKHIXQFWLRQ
HUURUFRGHUHSHDWVFDOOIRUVHUYLFH
‡ &OHDQXSKHDY\VSLOORYHUVEHIRUHVWDUWLQJWKHFOHDQ
F\FOH+HDYLO\VRLOHGRYHQVPD\QHHGWREHFOHDQHGDJDLQ
‡ 7RXFKWKH&/($52))SDG$OORZWKHRYHQWRFRRO
*($SSOLDQFHVFRP
3UREOHP
3RVVLEOH&DXVHV
:KDW7R'R
&RQWUROVLJQDOVDIWHU
HQWHULQJFRRNLQJWLPH
RUVWDUWWLPH
<RXIRUJRWWRHQWHUD
EDNHWHPSHUDWXUHRU
FOHDQLQJWLPH
‡ 7RXFKWKH%$.(SDGDQGGHVLUHGWHPSHUDWXUHRU
WKH6(/)&/($1SDGDQGGHVLUHGFOHDQWLPH
'LVSOD\JRHVEODQN
$IXVHLQ\RXUKRPHPD\EH
EORZQRUWKHFLUFXLW
EUHDNHUWULSSHG
‡ 5HSODFHWKHIXVHRUUHVHWWKHFLUFXLWEUHDNHU
7KHFORFNLVLQWKH
EODFNRXWPRGH
‡ 6HHWKH6SHFLDOIHDWXUHVRI\RXURYHQFRQWUROVHFWLRQ
'LVSOD\IODVKHV
3RZHUIDLOXUH
‡ 5HVHWWKHFORFN
8QDEOHWRJHWWKH
GLVSOD\WRVKRZ´6)µ
2YHQFRQWUROSDGVZHUH
QRWWRXFKHGSURSHUO\
‡ 7KH%52,/+,/2DQG%$.(SDGVPXVWEHWRXFKHGDW
WKHVDPHWLPHDQGKHOGIRUVHFRQGV
´3UREHµDSSHDUVLQ
WKHGLVSOD\
RQVRPHPRGHOV
7KLVLVUHPLQGLQJ\RXWR
HQWHUDSUREHWHPSHUDWXUH
DIWHUSOXJJLQJLQWKHSUREH
‡ (QWHUDSUREHWHPSHUDWXUH
3RZHURXWDJH
FORFNIODVKHV
3RZHURXWDJHRUVXUJH
‡ 5HVHWWKHFORFN,IWKHRYHQZDVLQXVH\RXPXVWUHVHW
LWE\WRXFKLQJWKH&/($52))SDGVHWWLQJWKHFORFN
DQGUHVHWWLQJDQ\FRRNLQJIXQFWLRQ
6WHDPIURPWKHYHQW
:KHQXVLQJWKHRYHQV
‡ 7KLVLVQRUPDO
LWLVQRUPDOWRVHHVWHDP
FRPLQJRXWRIWKHRYHQ
YHQWV$VWKHQXPEHURIUDFNV
RUDPRXQWRIIRRGEHLQJ
FRRNHGLQFUHDVHVWKHDPRXQW
RIYLVLEOHVWHDPZLOOLQFUHDVH
´%XUQLQJµRU´RLO\µ
RGRUHPLWWLQJIURP
WKHYHQW
7KLVLVQRUPDOLQDQHZRYHQ ‡ 7RVSHHGWKHSURFHVVVHWDVHOIFOHDQF\FOHIRUD
DQGZLOOGLVDSSHDULQWLPH PLQLPXPRIKRXUV6HHWKH8VLQJWKHVHOIFOHDQLQJ
RYHQVHFWLRQ
6WURQJRGRU
$QRGRUIURPWKHLQVXODWLRQ ‡ 7KLVLVWHPSRUDU\
DURXQGWKHLQVLGHRIWKHRYHQ
LVQRUPDOIRUWKHILUVWIHZWLPHV
WKHRYHQLVXVHG
)DQQRLVH
RQVRPHPRGHOV
$FRQYHFWLRQIDQPD\
DXWRPDWLFDOO\WXUQRQ
DQGRII
$FRROLQJIDQPD\
‡ 7KLVLVQRUPDORQVRPHPRGHOV7KHFRROLQJIDQZLOOWXUQRIIDQG
DXWRPDWLFDOO\WXUQRQDQGRII RQWRFRROLQWHUQDOSDUWV,WPD\UXQDIWHUWKHRYHQLV
WXUQHGRII
‡ 7KLVLVQRUPDO7KHIDQLVGHVLJQHGWRRSHUDWHLQWHUPLWWHQWO\
WRPD[LPL]HFRRNLQJHYHQQHVV
‡ 7KHFRQYHFWLRQIDQZLOORSHUDWHGXULQJSUHKHDW
RIWKHEDNHF\FOH7KHIDQZLOOWXUQRIIDIWHUWKHRYHQ
LVKHDWHGWRWKHVHWWHPSHUDWXUH7KLVLVQRUPDO
%HIRUH<RX&DOO)RU6HUYLFH«
7URXEOHVKRRWLQJ7LSV
3UREOHP
3RVVLEOH&DXVHV
:KDW7R'R
2YHQUDFNVDUH
GLIILFXOWWRVOLGH
7KHVKLQ\VLOYHUFRORUHG
UDFNVZHUHFOHDQHGLQD
VHOIFOHDQF\FOH
‡$SSO\DVPDOODPRXQWRIYHJHWDEOHRLOWRDSDSHU
WRZHODQGZLSHWKHHGJHVRIWKHRYHQUDFNVZLWK WKHSDSHUWRZHO'RQRWVSUD\ZLWK3DPŠRURWKHU OXEULFDQWVSUD\V
'UDZHUGRHVQRWVOLGH 7KHGUDZHULVRXW
VPRRWKO\RUGUDJV
RIDOLJQPHQW
‡ )XOO\H[WHQGWKHGUDZHUDQGSXVKLWDOOWKHZD\LQ
6HHWKH&DUHDQGFOHDQLQJRIWKHUDQJHVHFWLRQ
'UDZHULVRYHUORDGHGRU
ORDGLVXQEDODQFHG
‡ 5HGXFHZHLJKW5HGLVWULEXWHGUDZHUFRQWHQWV
:DUPLQJGUDZHU
ZLOOQRWZRUN
$IXVHLQ\RXUKRPHPD\EH ‡ 5HSODFHWKHIXVHRUUHVHWWKHFLUFXLWEUHDNHU
EORZQRUWKHFLUFXLWEUHDNHU
WULSSHG
&RQWUROVLPSURSHUO\VHW
([FHVVLYHFRQGHQVDWLRQ /LTXLGLQGUDZHU
LQWKHGUDZHU
8QFRYHUHGIRRGV
‡ 6HHWKH8VLQJWKHZDUPLQJGUDZHUVHFWLRQ
‡ 5HPRYHOLTXLG
‡ &RYHUIRRGZLWKOLGRUDOXPLQXPIRLO
7HPSHUDWXUHVHWWLQJWRRKLJK ‡ 5HGXFHWHPSHUDWXUHVHWWLQJ
)RRGGULHVRXWLQWKH
ZDUPLQJGUDZHU
0RLVWXUHHVFDSLQJ
‡ &RYHUIRRGZLWKOLGRUDOXPLQXPIRLO
'UDZHUQRWIXOO\FORVHG
‡ 3XVKGUDZHULQXQWLOODWFKHQJDJHV
:DWHUUHPDLQLQJRQ
7KLVLVQRUPDO
RYHQIORRUDIWHU6WHDP
&OHDQF\FOH
‡ 5HPRYHDQ\UHPDLQLQJZDWHUZLWKDGU\FORWKRUVSRQJH
2YHQZLOOQRWVWHDP
FOHDQ
'LVSOD\IODVKHV+27
‡ $OORZWKHRYHQWRFRROWRURRPWHPSHUDWXUHDQGUHVHWWKH
FRQWUROV
2YHQFRQWUROVLPSURSHUO\VHW ‡ 6HHWKH8VLQJ6WHDP&OHDQVHFWLRQ
2YHQGRRULVQRWFORVHG
‡ 0DNHVXUH\RXFORVHWKHGRRUWRVWDUWVWHDPFOHDQF\FOH
$FFHVVRULHV
*($SSOLDQFHVFRP
/RRNLQJ)RU6RPHWKLQJ0RUH"1RWDOODFFHVVRULHVDUHDYDLODEOHIRUDOOPRGHOV
<RXFDQILQGWKHVHDFFHVVRULHVDQGPDQ\PRUHDW*($SSOLDQFHVFRP86
RUZZZ*($SSOLDQFHVFD&DQDGDRUFDOO86RU&DQDGD
GXULQJQRUPDOEXVLQHVVKRXUV+DYH\RXUPRGHOQXPEHUUHDG\
*UDWHV
6XUIDFH%XUQHU+HDGVDQG&DSV
.QREV
6XUIDFH(OHPHQWVDQG'ULS3DQV
RU
2YHQ5DFNV
2YHQ(OHPHQWV
/LJKW%XOEV
([WHQVLRQ5DFN
,I\RXUPRGHOLQFOXGHGDQH[WHQVLRQUDFN\RXFDQLQFUHDVHWKHIXQFWLRQDOLW\RI\RXUUDQJHZKHQ\RXSXUFKDVHDGGLWLRQDOH[WHQVLRQUDFNV9LVLW
ZZZJHDSSOLDQFHSDUWVFRPRUFDOODQGRUGHUSDUWQXPEHU:%73OHDVHQRWHH[WHQVLRQUDFNVGRQRWILWDOOPRGHOUDQJHV
([SHULHQFHWKHVHRWKHUJUHDWSURGXFWVWRNHHS\RXUNLWFKHQORRNLQJJUHDW
&HUDPLF
&RRNWRS
&OHDQLQJ.LW
,QFOXGHVFOHDQHU
VFUDSHUDQGSDG
&HUDPLF&RRNWRS
&OHDQLQJ:LSHV
6WDLQOHVV6WHHO
$SSOLDQFH3ROLVK
:LSHV
6WDLQOHVV6WHHO
$SSOLDQFH
&OHDQHU
:;;*&6
:;;
:;;
30;
*HWWKHPRVWRXWRI\RXU%URLOHU3DQ1RWIRUXVHZLWK%URLOHU'UDZHUPRGHOV
8VH\RXUSDQDQGJULGFRYHUWREURLOKDPEXUJHUVVHDIRRGVWHDNVYHJHWDEOHVEDFRQFKRSVDQGVRPXFKPRUH7KHSDQEHORZFDWFKHV
WKHH[FHVVIDWVDQGRLOV
‡*HQXLQH*(3DUW
‡(DV\7R&OHDQ
‡2QH<HDU:DUUDQW\
/LPLWHG7LPH2IIHU)UHH6KLSSLQJ
:KHQ\RXRUGHU\RXUEURLOHUSDQZLWKLQGD\VRISXUFKDVLQJ\RXU*(FRRNLQJSURGXFW
863DUW
'LPHQVLRQV
6PDOO
:%;
µ:[µ+[µ'
/DUJH
:%;
µ:[µ+[µ'
;/
:%;
µ:[µ+[µ'
7KHODUJHVWDQGDUGEURLOSDQGRHVQRWILWLQµµUDQJHV
7KH;/SDQGRHVQRWILWLQµZDOORYHQVµGURSLQVRUµµUDQJHV
7RSODFH\RXURUGHUFDOO86&DQDGDRUPDLOWKLVIRUPWR
,QWKH86*(3DUWV32%R[0HPSKLV71,Q&DQDGD*(3DUWV)DFWRU\/DQH0RQFWRQ1%(&0
✁
BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
4XDQWLW\BBBBBBBBBBBBBBBBBBBB BBBBBBBBBBBBBBBBBBBB BBBBBBBBBBBBBBBBBBBB %URLOHU3DQ2UGHU)RUP
3DUW1XPEHU BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
0RGHO1XPEHUBBBBBBBBBBBBBB 6HULDO1XPEHU BBBBBBBBBBBBBBBBBB %UDQG BBBBBBBBBBBBBBB 'DWHRI3XUFKDVHBBBBBBBBBB
)LUVW1DPHBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB /DVW1DPHBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
$GGUHVVBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
&LW\BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB 6WDWHBBBBBBBBBBB =LS&RGHBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
3KRQHBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB (0DLOBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
&KHFN BBBBBB
0RQH\2UGHUBBBBBB
&DOOLQWKH86RULQ&DQDGDIRUFXUUHQWSULFLQJ$OOFUHGLWFDUGRUGHUVPXVWEHFDOOHGLQ
1RWHV
*((OHFWULF5DQJH:DUUDQW\
*($SSOLDQFHVFRP
$OOZDUUDQW\VHUYLFHSURYLGHGE\RXU)DFWRU\6HUYLFH&HQWHUV
RUDQDXWKRUL]HG&XVWRPHU&DUHŠWHFKQLFLDQ7RVFKHGXOH
VHUYLFHYLVLWXVRQOLQHDW*($SSOLDQFHVFRPRUFDOO
*(&$5(63OHDVHKDYHVHULDOQXPEHU
DQGPRGHOQXPEHUDYDLODEOHZKHQFDOOLQJIRUVHUYLFH
6WDSOH\RXUUHFHLSWKHUH
3URRIRIWKHRULJLQDOSXUFKDVH
GDWHLVQHHGHGWRREWDLQVHUYLFH
XQGHUWKHZDUUDQW\
)RU7KH3HULRG2I *(:LOO3URYLGH
2QH<HDU
)URPWKHGDWHRIWKH
RULJLQDOSXUFKDVH
$Q\SDUWRIWKHUDQJHZKLFKIDLOVGXHWRDGHIHFWLQPDWHULDOVRUZRUNPDQVKLS
'XULQJWKLVOLPLWHGRQH\HDUZDUUDQW\*(ZLOODOVRSURYLGHIUHHRIFKDUJHDOOODERUDQGLQKRPH
VHUYLFHWRUHSODFHWKHGHIHFWLYHSDUW
)RU3URILOH0RGHOV
)LYH<HDUV
)URPWKHGDWHRIWKH
RULJLQDOSXUFKDVH
)RU3URILOH0RGHOV
$UHSODFHPHQWJODVVFRRNWRSLILWVKRXOGFUDFNGXHWRWKHUPDOVKRFNGLVFRORURULIWKHSDWWHUQ
ZHDUVRII
$UHSODFHPHQWUDGLDQWVXUIDFHHOHPHQWLILWVKRXOGEXUQRXW
'XULQJWKLVOLPLWHGDGGLWRQDOIRXU\HDUZDUUDQW\\RXZLOOEHUHVSRQVLEOHIRUDQ\ODERURU
LQKRPHVHUYLFH
:KDW*(:LOO1RW&RYHU
„6HUYLFHWULSVWR\RXUKRPHWRWHDFK\RXKRZWRXVH
WKHSURGXFW
„'DPDJHWRWKHSURGXFWFDXVHGE\DFFLGHQWILUHIORRGVRU
DFWVRI*RG
„,PSURSHULQVWDOODWLRQGHOLYHU\RUPDLQWHQDQFH
„,QFLGHQWDORUFRQVHTXHQWLDOGDPDJHFDXVHGE\SRVVLEOH
GHIHFWVZLWKWKLVDSSOLDQFH
„3URGXFWGDPDJHRUIDLOXUHRIWKHSURGXFWLILWLVDEXVHG
PLVXVHGPRGLILHGXVHGIRURWKHUWKDQWKHLQWHQGHG
SXUSRVHRUXVHGFRPPHUFLDOO\
„'DPDJHFDXVHGDIWHUGHOLYHU\
„3URGXFWQRWDFFHVVLEOHWRSURYLGHUHTXLUHGVHUYLFH
„'DPDJHWRWKHJODVVFRRNWRSFDXVHGE\XVHRIFOHDQHUV
RWKHUWKDQWKHUHFRPPHQGHGFOHDQLQJFUHDPVDQGSDGV
„'DPDJHWRWKHJODVVFRRNWRSFDXVHGE\KDUGHQHGVSLOOV
RIVXJDU\PDWHULDOVRUPHOWHGSODVWLFWKDWDUHQRWFOHDQHG
DFFRUGLQJWRWKHGLUHFWLRQVLQWKH2ZQHU·V0DQXDO
„5HSODFHPHQWRIKRXVHIXVHVRUUHVHWWLQJRIFLUFXLWEUHDNHUV
(;&/86,212),03/,(':$55$17,(6³<RXUVROHDQGH[FOXVLYHUHPHG\LVSURGXFWUHSDLUDVSURYLGHGLQWKLV/LPLWHG
:DUUDQW\$Q\LPSOLHGZDUUDQWLHVLQFOXGLQJWKHLPSOLHGZDUUDQWLHVRIPHUFKDQWDELOLW\RUILWQHVVIRUDSDUWLFXODUSXUSRVH
DUHOLPLWHGWRRQH\HDURUWKHVKRUWHVWSHULRGDOORZHGE\ODZ
7KLVZDUUDQW\LVH[WHQGHGWRWKHRULJLQDOSXUFKDVHUDQGDQ\VXFFHHGLQJRZQHUIRUSURGXFWVSXUFKDVHGIRUKRPH
XVHZLWKLQWKH86$,IWKHSURGXFWLVORFDWHGLQDQDUHDZKHUHVHUYLFHE\D*($XWKRUL]HG6HUYLFHULVQRWDYDLODEOH\RX
PD\EHUHVSRQVLEOHIRUDWULSFKDUJHRU\RXPD\EHUHTXLUHGWREULQJWKHSURGXFWWRDQ$XWKRUL]HG*(6HUYLFHORFDWLRQIRU
VHUYLFH,Q$ODVNDWKHZDUUDQW\H[FOXGHVWKHFRVWRIVKLSSLQJRUVHUYLFHFDOOVWR\RXUKRPH
6RPHVWDWHVGRQRWDOORZWKHH[FOXVLRQRUOLPLWDWLRQRILQFLGHQWDORUFRQVHTXHQWLDOGDPDJHV7KLVZDUUDQW\JLYHV
\RXVSHFLILFOHJDOULJKWVDQG\RXPD\DOVRKDYHRWKHUULJKWVZKLFKYDU\IURPVWDWHWRVWDWH7RNQRZZKDW\RXU
OHJDOULJKWVDUHFRQVXOW\RXUORFDORUVWDWHFRQVXPHUDIIDLUVRIILFHRU\RXUVWDWH·V$WWRUQH\*HQHUDO
:DUUDQWRU*HQHUDO(OHFWULF&RPSDQ\/RXLVYLOOH.<
&RQVXPHU6XSSRUW
*($SSOLDQFHV:HEVLWH
*($SSOLDQFHVFRP
+DYHDTXHVWLRQRUQHHGDVVLVWDQFHZLWK\RXUDSSOLDQFH"7U\WKH*($SSOLDQFHV:HEVLWHKRXUVDGD\
DQ\GD\RIWKH\HDU)RUJUHDWHUFRQYHQLHQFHDQGIDVWHUVHUYLFH\RXFDQQRZGRZQORDG2ZQHU·V0DQXDOV
RUGHUSDUWVRUHYHQVFKHGXOHVHUYLFHRQOLQH
6FKHGXOH6HUYLFH
*($SSOLDQFHVFRP
([SHUW*(UHSDLUVHUYLFHLVRQO\RQHVWHSDZD\IURP\RXUGRRU*HWRQOLQHDQGVFKHGXOH\RXUVHUYLFHDW
\RXUFRQYHQLHQFHDQ\GD\RIWKH\HDU2UFDOO*(&$5(6GXULQJQRUPDOEXVLQHVVKRXUV
5HDO/LIH'HVLJQ6WXGLR
*($SSOLDQFHVFRP
*(VXSSRUWVWKH8QLYHUVDO'HVLJQFRQFHSW³SURGXFWVVHUYLFHVDQGHQYLURQPHQWVWKDWFDQEHXVHGE\
SHRSOHRIDOODJHVVL]HVDQGFDSDELOLWLHV:HUHFRJQL]HWKHQHHGWRGHVLJQIRUDZLGHUDQJHRISK\VLFDODQG
PHQWDODELOLWLHVDQGLPSDLUPHQWV)RUGHWDLOVRI*(·V8QLYHUVDO'HVLJQDSSOLFDWLRQVLQFOXGLQJNLWFKHQGHVLJQ
LGHDVIRUSHRSOHZLWKGLVDELOLWLHVFKHFNRXWRXU:HEVLWHWRGD\)RUWKHKHDULQJLPSDLUHGSOHDVHFDOO7''
*($&
([WHQGHG:DUUDQWLHV
*($SSOLDQFHVFRP
3XUFKDVHD*(H[WHQGHGZDUUDQW\DQGOHDUQDERXWVSHFLDOGLVFRXQWVWKDWDUHDYDLODEOHZKLOH\RXUZDUUDQW\
LVVWLOOLQHIIHFW<RXFDQSXUFKDVHLWRQOLQHDQ\WLPHRUFDOOGXULQJQRUPDOEXVLQHVVKRXUV
*(&RQVXPHU+RPH6HUYLFHVZLOOVWLOOEHWKHUHDIWHU\RXUZDUUDQW\H[SLUHV
3DUWVDQG$FFHVVRULHV
*($SSOLDQFHVFRP
,QGLYLGXDOVTXDOLILHGWRVHUYLFHWKHLURZQDSSOLDQFHVFDQKDYHSDUWVRUDFFHVVRULHVVHQWGLUHFWO\WRWKHLUKRPHV
9,6$0DVWHU&DUGDQG'LVFRYHUFDUGVDUHDFFHSWHG2UGHURQOLQHWRGD\KRXUVHYHU\GD\RUE\SKRQHDW
GXULQJQRUPDOEXVLQHVVKRXUV
,QVWUXFWLRQVFRQWDLQHGLQWKLVPDQXDOFRYHUSURFHGXUHVWREHSHUIRUPHGE\DQ\XVHU2WKHUVHUYLFLQJ
JHQHUDOO\VKRXOGEHUHIHUUHGWRTXDOLILHGVHUYLFHSHUVRQQHO&DXWLRQPXVWEHH[HUFLVHGVLQFHLPSURSHU
VHUYLFLQJPD\FDXVHXQVDIHRSHUDWLRQ
&RQWDFW8V
*($SSOLDQFHVFRP
,I\RXDUHQRWVDWLVILHGZLWKWKHVHUYLFH\RXUHFHLYHIURP*(FRQWDFWXVRQRXU:HEVLWHZLWKDOOWKHGHWDLOV
LQFOXGLQJ\RXUSKRQHQXPEHURUZULWHWR *HQHUDO0DQDJHU&XVWRPHU5HODWLRQV
*($SSOLDQFHV$SSOLDQFH3DUN
/RXLVYLOOH.<
5HJLVWHU<RXU$SSOLDQFH
*($SSOLDQFHVFRP
5HJLVWHU\RXUQHZDSSOLDQFHRQOLQH³DW\RXUFRQYHQLHQFH7LPHO\SURGXFWUHJLVWUDWLRQZLOODOORZIRUHQKDQFHG
FRPPXQLFDWLRQDQGSURPSWVHUYLFHXQGHUWKHWHUPVRI\RXUZDUUDQW\VKRXOGWKHQHHGDULVH
<RXPD\DOVRPDLOLQWKHSUHSULQWHGUHJLVWUDWLRQFDUGLQFOXGHGLQWKHSDFNLQJPDWHULDO
GEAppliances.com
Induction Self-Cleaning Convection
Ranges
IMPORTANT SAFETY INFORMATION.
READ ALL INSTRUCTIONS BEFORE USING.
WARNING!
For your safety, the information in this manual must be
followed to minimize the risk of fire, explosion, electric shock,
or to prevent property damage, personal injury, or loss of life.
This unit has been tested and found to comply with the
limits for a class B digital device, pursuant to Part 18
of the FCC rules. These limits are designed to provide
reasonable protection against harmful interference in
a residential installation. This unit generates, uses and
can radiate radio frequency energy and, if not installed
and used in accordance with the instructions, may cause
harmful interference to radio communications. However,
there is no guarantee that interference will not occur in
a particular installation. If this unit does cause harmful
interference to radio or television reception, which can
Mini-Guide
be determined by turning the unit off and on, the user is
encouraged to try to correct the interference by one or
more of the following measures:
• Reorient or relocate the receiving antennae.
• Increase the distance between the unit and receiver.
• Connect the unit into an outlet or a circuit different from
that to which the receiver is connected.
CAUTION!
Persons with a pacemaker or similar medical device
should exercise caution when using or standing
near an induction unit while it is in operation. The
electromagnetic field may affect the working of the
pacemaker or similar medical device. It is advisable to
consult your doctor or the pacemaker manufacturer
about your particular situation.
Using the cooktop.
How Induction Surface Cooking Works
Inductioncoilsundertheglasscookingsurfaceproduce
amagneticfieldthatgeneratesheatinferrousmetals
thatareincloseproximity.Theglasscookingsurfaceis
notheateddirectlysinceitisnotaferrousmetal,butthe
glassmayeventuallybecomehotfromthepan.Induction
surfacecoilsaremoreefficientandwillheatmuchfaster
thanconventionalelectricandgascookingsurfacecooking
products.
CAUTION:
•Theinductioncookingelementsmayappeartobecoolwhile
turnedONandaftertheyhavebeenturnedOFF.Theglass
surfacemaybeHOTfromresidualheattransferredfromthe
cookwareandburnsmayoccur.
•DONOTTOUCHHOTCOOKWAREorPANSdirectlywithhands.
Alwaysusemittsorpotholderstoprotecthandsfromburns.
•DONOTSLIDEcookwareacrossthecooktopsurface.Doing
somaypermanentlydamagetheappearanceoftheceramic
cooktop.
49-80630 02-11 GE
Using the cooktop. (cont.)
What Type of Pans Are Required?
Youmustuseaferrouspanwhenusingtheinductioncoilson
this range. The warming zone is not an induction coil and will
workwithanytypeofcookware.Youcanverifyyourpanis
ferrous if a magnet sticks to it. Quality cookware with heavy
bottomsmadeofcastiron,magneticstainlesssteeland
enameled steel work best. For best results, use pans with flat
bottoms.Woksthatdonothaveflatbottomsinclosecontactto
the glass surface will not work. Some pans are made especially
forinductioncooking.
Useflat-bottomedpans.
Useagriddle.
Useaflat-bottomedwok.
Pan Size and Shape
Theinductioncoilsrequireaminimumpansizeinorderfortheelementtoturnon.
Inorderfortheinductioncoiltocorrectlydetermineifthepanislargeenough,itis
importantthatthepanbecenteredwithinthecirculargraphicsmarkedonthe
glasscookingsurface.Theminimumpansizethatwillworkforeachinductioncoil
isshownontheright.Pansthatarenotferrousoraretoosmallwillnotallowthe
inductioncoiltoturnon,andthepowerleveldisplayforthatcoillocationwillflash
for30secondsandthenturnoff.Ifapanisremovedfromtheinductioncoilfor
morethan30seconds,thepowerwillbeshutoff.Squarepanswillwork,although
roundpansthatmatchtheinductioncoilsizesworkbest.Cookwarelargerthan
thecooktopglassgraphicswillwork.Forbestresults,matchthepansizewith
thenearest-sizegraphicsontheglasscookingsurface.
Boost Mode and Power
Sharing
PowerSharingisactivatedwhen
bothelementsinthesamecooking
zoneareactivatedandoneelement
issetforBoost(H).Theelement
thatisnotsetforBoostwillchange
toalowerpowerlevel.Thisis
calledPowerSharing.WhenBoost
operationiscomplete(10minutes),
theotherelementmayberesetto
anypowerlevel.Bothelementscan
operatesimultaneouslyatnormal
powerlevelsettingsof“L”to9.
IMPORTANT NOTE FOR RIGHT
SIDE POWER SHARING
The elements on the right side share one
generator. Both elements can operate at
any non-Boost (level L to 9) power level
at the same time. When the large 11”
element is set for “H” or Boost, the smaller
element is automatically shut off and
cannot be activated. After 10 minutes,
Boost (H) will revert to power level 9.
At that time, the smaller element may be
activated and set for any power level.
5-3/4”Min.Dia.
PanSize
LR
5-3/4”Min.Dia.
PanSize
LF
4-3/4”Min.
Dia.PanSize
RR
8”Min.Dia.
PanSize
RF
4burnercooktopswithright-andleft-side(2)
inductiongenerators
Usetheminimumsizepanshownforeachcookingelement.
Cookware “Noise”
Alowhummingnoiseisnormalwhenusinginductioncoils,
especiallyonhigherpowersettings.Heavyenamelcast-iron
potsproducelessnoisethanlightweightsteelpans.Theamount
ofcontentinthepanscanalsoaffectnoiselevel.Pansthat
completelycoverthegraphicsontheglasswillproduceless
noise.Watertrappedunderpanscanboil,causingthecookware
tovibrateorslideontheglasssurface.
Before you call for service…
Problem
Possible Causes
What To Do
Surface units do
not work properly or
flashing power setting
Improper cookware being used. • Wrongpantype.Useamagnettocheckthatcookwareis
induction-compatible.Useaflatinduction-capablepanthatmeets
theminimumsizefortheelementbeingused.SeethePansizeand
shapesection.
Pan is too small.
• Pansizeisbelowtheminimumsizefortheelement.SeethePan size
and shapesection.
Pan not positioned correctly. • Centerthepaninthecookingzone.
Pan detection/sizing not working properly
Pan is improperly placed. • Makesurethepaniscenteredonthecorrespondingsurfaceelement.
Cooktop control improperly set. • Checktoseethatthecontrolissetproperly.
Surface unit setting
changed or turned
off unexpectedly
Power sharing.
High cooktop temperature. • Checktoseeifpowerwasbeingsharedbetweentwoelements.See
Boost ModeandPower Sharing section.
• Allowtheinternalfantocoolthecooktop.
GEAppliances.com
Cocinas
Mini guía
autolimpiantes de convección e inducción
INFORMACIÓN IMPORTANTE DE SEGURIDAD.
LEA TODAS LAS INSTRUCCIONES ANTES DE SU USO.
¡ADVERTENCIA!
Para su seguridad, la información de este manual debe
seguirse al pie de la letra a fin de minimizar el riesgo de
incendio o explosión, descarga eléctrica, o para prevenir
daños, lesiones personales o la muerte.
Esta unidad se ha puesto a prueba y se ha determinado
que cumple con los límites de un dispositivo digital de clase
B, de conformidad con la Parte 18 de las normas de la FCC.
Estos límites están diseñados para brindar una protección
razonable contra interferencia dañina dentro de una
instalación residencial. Esta unidad genera, utiliza y puede
irradiar energía de frecuencia de radio y, si no se instala y
usa de acuerdo con las instrucciones, puede provocar una
interferencia dañina a las comunicaciones de radio. Sin
embargo, no hay garantía de que no haya interferencia
en una instalación determinada. Si la unidad provoca
interferencia nociva a la recepción de radio y televisión,
lo que puede determinarse encendiendo y apagando la
unidad, el usuario puede corregir la interferencia a través
de una o más de las siguientes medidas:
• Reoriente o cambie la posición de las antenas
receptoras.
• Incremente la distancia entre la unidad y el receptor.
• Conecte la unidad a un tomacorriente o un circuito
diferente del que está usando el receptor.
¡PRECAUCIÓN!
Las personas que utilicen un marcapasos o un
dispositivo médico similar deben tener cuidado cuando
utilicen y se encuentren cerca de una unidad por
inducción. El campo electromagnético puede afectar
el funcionamiento del marcapasos o del dispositivo
médico similar. Es recomendable consultar a su médico
o al fabricante del marcapasos sobre su situación
particular.
Cómo usar la estufa.
Cómo funciona la superficie de cocción por inducción
Las bobinas de inducción ubicadas debajo de la superficie de
cocción de vidrio producen un campo magnético que genera
calor en metales ferrosos que se encuentran muy cerca. La
superficie de cocción de vidrio no se calienta directamente ya
que no es un metal ferroso, pero el vidrio puede calentarse
por estar en contacto con el recipiente de cocción. Las
bobinas de la superficie de inducción son más eficientes
y se calientan con más rapidez que las cocinas eléctricas
o a gas con superficies de cocción convencionales.
PRECAUCIÓN:
• Los elementos de cocción por inducción pueden parecer
fríos cuando están encendidos (ON) y después de haber sido
apagados (OFF). La superficie de vidrio puede estar CALIENTE
debido a calor residual transferido del recipiente de cocción y
pueden provocarse quemaduras.
• NO TOQUE RECIPIENTES DE COCCIÓN CALIENTES directamente
con sus manos. Siempre use guantes de cocina o agarraderas
para proteger las manos de quemaduras.
• NO DESLICE recipientes de cocción a través de la superficie de
la estufa. Hacerlo puede dañar permanentemente la apariencia
de la estufa de cerámica.
49-80630
02-11 GE
Cómo usar la estufa. (cont.)
¿Qué clase de recipientes debe usarse?
Deben utilizarse recipientes ferrosos cuando se usen las bobinas
de inducción de esta cocina. La zona de calentamiento no es una
bobina de inducción y funciona con cualquier clase de recipiente
de cocción. Usted puede verificar si su recipiente es ferroso si
un imán se adhiere a él. Los recipientes de cocción de calidad
con bases pesadas hechas de hierro fundido, acero inoxidable
magnético y acero esmaltado funcionan mejor. Para mejores
resultados, utilice recipientes con bases planas. Los woks que no
poseen bases planas en contacto con la superficie de vidrio no
funcionan. Algunos recipientes están fabricados especialmente
para cocción por inducción.
Utilice recipientes
de base plana.
Utilice una plancha.
Utilice un wok
de base plana.
Tamaño y forma de los recipientes
Las bobinas de inducción requieren un tamaño mínimo de recipiente para que el elemento se
encienda. Para que la bobina de inducción pueda determinar correctamente si el recipiente es
lo suficientemente grande, resulta importante que el recipiente se centre dentro de los gráficos
circulares marcados en la superficie de cocción de vidrio. El tamaño mínimo de recipiente que
funcionará en cada bobina de inducción se indica a la derecha. Los recipientes no ferrosos y
demasiado pequeños no permitirán el accionamiento de la bobina de inducción y la pantalla del nivel
de energía de la ubicación de esa bobina destellará durante 30 segundos y luego se apagará. Si un
recipiente se retira de la bobina de inducción por más de 30 segundos, la energía se desactivará.
Pueden utilizarse recipientes cuadrados, aunque funcionan mejor los redondos que se ajustan a los
tamaños de las bobinas de inducción. Los recipientes de cocción de mayor tamaño que los gráficos
de vidrio de la estufa funcionarán. Para mejores resultados, ajuste el tamaño del recipiente con los
gráficos de tamaño más cercano que se encuentran sobre la superficie de cocción de vidrio.
Modo impulso (Boost) y distribución de energía
Los anafes de cinco quemadores están divididos en 3 zonas.
Los lados derecho e izquierdo tienen zonas de cocción
separadas y el elemento central grande es otra zona de
cocción individual. La distribución de energía se activa cuando
ambos elementos de la misma zona de cocción se activan y
un elemento se configura para Impulso (H). El elemento que
no esté configurado para Impulso cambiará a un nivel de
energía más bajo. Esto se denomina distribución de energía.
Cuando la operación de impulso haya finalizado (10 minutos),
el otro elemento puede reconfigurarse para cualquier nivel
de energía. Ambos elementos pueden funcionar de manera
simultánea a niveles de energía normales de “L” a 9.
Recipiente
de 5-3/4”
de diámetro
mínimo IT
Recipiente
de 5-3/4”
de diámetro
mínimo IF
Recipiente
de 4-3/4”
de diámetro
mínimo DT
Recipiente
de 8”
de diámetro
mínimo DF
Estufas de 4 quemadores con generadores
de inducción de lados derecho e izquierdo
(2) Utilice el recipiente de tamaño mínimo
ilustrado para cada elemento de cocción.
Distribucion de erergia en el lado derecho
Los anafes de cinco quemadores están divididos en 3 zonas. Los
lados derecho e izquierdo tienen zonas de cocción separadas y
el elemento central grande es otra zona de cocción individual.
La distribución de energía se activa cuando ambos elementos
de la misma zona de cocción se activan y un elemento se
configura para Impulso (H). El elemento que no esté configurado
para Impulso cambiará a un nivel de energía más bajo. Esto
se denomina distribución de energía. Cuando la operación de
impulso haya finalizado (10 minutos), el otro elemento puede
reconfigurarse para cualquier nivel de energía. Ambos elementos
pueden funcionar de manera simultánea a niveles de energía
normales de “L” a 9.
“Ruidos” de los recipientes de cocción
Un zumbido bajo es normal cuando se utilizan bobinas de inducción, especialmente en configuraciones de energía mayores. Los
recipientes pesados de hierro fundido esmaltado producen menos ruido que los recipientes de acero liviano. La cantidad de contenido
dentro de los recipientes también puede modificar el nivel de ruido. Los recipientes que cubren por completo el gráfico del vidrio
producen menos ruido. El agua que queda atrapada debajo de los recipientes puede hervir, lo que puede provocar que los recipientes
vibren o se deslicen sobre la superficie de vidrio.
Antes de llamar al servicio técnico…
Problema
Causas posibles
Las unidades de
superficie no funcionan
bien o destella
la configuración
de energía
Se están utilizando recipientes
de cocción inadecuados.
La detección/medición
de recipientes no está
funcionando de manera
adecuada
El recipiente está mal colocado. • Verifique que el recipiente esté centrado en el elemento de superficie
correspondiente.
El control de la estufa está
• Verifique que el control esté bien configurado.
mal configurado.
Distribución de energía.
• Verifique si se está compartiendo la energía entre dos elementos.
Ver la sección Modo impulso (Boost) y distribución de energía.
Temperatura elevada de
• Permita que el ventilador interno enfríe la estufa.
la estufa.
La configuración de la
unidad de superficie
cambió o se apagó
de repente
Qué hacer
• Recipiente incorrecto. Use un imán para verificar que el recipiente sea
compatible con la inducción. Use un recipiente plano con capacidad
de inducción que cumpla con el tamaño mínimo para el elemento
que se está usando. Ver la sección Tamaño y forma de los recipientes.
El recipiente es muy pequeño.
• El tamaño del recipiente es menor al tamaño mínimo para el elemento.
Ver la sección Tamaño y forma de los recipientes.
El recipiente no está bien colocado. • Centre el recipiente en la zona de cocción.
(Q&DQDGi
ZZZ*($SSOLDQFHVFD
,PSUHVRHQORV(VWDGRV8QLGRV
HOpFWULFDVLQGHSHQGLHQWHVHPSRWUDEOHV\HQFDVWUDEOHV
&RFLQDV
*($SSOLDQFHVFRP
,QVWUXFFLRQHVGH6HJXULGDG ²
,QVWUXFFLRQHVGH2SHUDFLyQ
+RUQR $MXVWHGHOWHUPRVWDWRGHOKRUQR $VDGR*XtDGHDVDGR $XWROLPSLH]D &DMyQFDOHQWDGRU &DUDFWHUtVWLFDVGHFRFFLyQOHQWDFDOHQWDPLHQWR
\OHXGDGR &DUDFWHUtVWLFDVHVSHFLDOHV &RQWUROHV )XQFLyQ6DEEDWK +RUQHDGRRURVWL]DGR +RUQHDGR\URVWL]DGRFRQWHPSRUL]DGRU +RUQRGHFRQYHFFLyQ 3L]]D 3UHFDOHQWDPLHQWR 6RQGD 7HPSRUL]DGRUGHFRFLQD 8QLGDGHVGHVXSHUILFLH ²
4XHPDGRUGHO3XHQWH 6HOHFFLRQDUWLSRVGHXWHQVLOLRV =RQDGHFDOHQWDPLHQWR 0DQXDOGHO
3URSLHWDULR
&RQWUROGHO
6LJXLHQWH3DVR,
&XLGDGR\OLPSLH]D
%DQGHMDV &DMyQFDOHQWDGRUGHVPRQWDEOH5HFLSLHQWH
GHOFDMyQGHOKRUQR &DMyQGHDOPDFHQDPLHQWR (OHPHQWRVFDOHQWDGRUHVGHOKRUQR (VWXIDGHYLGULR /X] 3DQHOGHFRQWURO 3DSHOGHDOXPLQLR 3LVRGHOKRUQR 3XHUWDGHOKRUQRGHVPRQWDEOH 6XSHUILFLHV 9HQWLODFLyQ &RQVHMRVSDUDODLGHQWLILFDFLyQ
\VROXFLyQGHSUREOHPDV $FFHVRULRV $SR\RDOFOLHQWH
$SR\RDOFOLHQWH *DUDQWtD (VFULEDORVQ~PHURVGHPRGHOR\GHVHULHDTXt
0RGHORBBBBBBBBBBBBBBB
6HULHBBBBBBBBBBBBBBBBB
3XHGHHQFRQWUDUORVHQXQDHWLTXHWDXELFDGDGHWUiV
GHOFDMyQRGHWUiVGHODSXHUWDGHOKRUQRLQIHULRUHQ
HOIUHQWHGHOPDUFRGHODFRFLQD
,PSUHVRHQ
SDSHOUHFLFODGR
*(
,1)250$&,Ï1,03257$17('(6(*85,'$'
/($72'$6/$6,16758&&,21(6$17(6'(68862
$'9(57(1&,$
/HDWRGDVODVLQVWUXFFLRQHVGHVHJXULGDGDQWHVGHXWLOL]DUHVWHSURGXFWR1RVHJXLUHVWDVLQVWUXFFLRQHVSXHGHJHQHUDUXQ
LQFHQGLRXQDGHVFDUJDHOpFWULFDOHVLRQHVFRUSRUDOHVRODPXHUWH
',6326,7,92$17,92/&$'85$6
3DUDUHGXFLUHOULHVJRGHYROFDU
ODFRFLQDpVWDGHEHVXMHWDUVH
PHGLDQWHXQVRSRUWHDQWL
Riesgo de Volcaduras
YROFDGXUDVFRQXQDDGHFXDGD
Un niño o adulto pueden volcar la cocina y morir.
LQVWDODFLyQ9HUODVLQVWUXFFLRQHVGH
Verifique que el soporte anti-volcaduras se haya
LQVWDODFLyQHQYLDGDVFRQHOVRSRUWH
instalado y ajustado correctamente.
SDUDREWHQHUGHWDOOHVFRPSOHWRV
Verifique que el soporte anti-volcaduras se haya
DQWHVGHLQLFLDUODLQVWDODFLyQ
instalado y ajustado correctamente.
3DUD&RFLQDV6LQ$SR\R\
No utilice la cocina sin que el soporte anti-volcaduras
esté colocado y ajustado.
'HVOL]DEOHVV
Si estas instrucciones no se siguen, como resultado se podrá
3DUDFRQWURODUVLHOVRSRUWHHV
producir la muerte o quemaduras graves de niños y adultos.
LQVWDODGR\DMXVWDGRGHIRUPD
DSURSLDGDPLUHTXHGHEDMRGH
ODFRFLQDODSDWDQLYHODGRUDWUDVHUDHVWpDMXVWDGDDOVRSRUWH(QDOJXQRV
6RSRUWH$QWL
9ROFDGXUDV
PRGHORVHOFDMyQGHDOPDFHQDPLHQWRRHOSDQHOGHSURWHFFLyQVHSXHGHQ
UHWLUDUSDUDXQDIiFLOLQVSHFFLyQ6LQRHVSRVLEOHUHDOL]DUXQDLQVSHFFLyQ
YLVXDOGHVOLFHODFRFLQDKDFLDDGHODQWHFRQILUPHTXHHOVRSRUWHDQWL
YROFDGXUDVHVWpDMXVWDGRGHIRUPDVHJXUDDOSLVRRODSDUHG\GHVOLFHOD
FRFLQDKDFLDDWUiVGHPRGRTXHODSDWDQLYHODGRUDWUDVHUDVHHQFXHQWUH
3DWD1LYHODGRUD
GHEDMRGHOVRSRUWHDQWLYROFDGXUDV
&RFLQDV6LQ$SR\R\'HVOL]DEOHV
6LODFRFLQDHVH[SXOVDGDGHODSDUHGSRUDOJXQDUD]yQVLHPSUHUHSLWDHVWH
SURFHGLPLHQWRDILQGHYHULILFDUTXHHVWpDVHJXUDGRGHIRUPDFRUUHFWDFRQXQ
VRSRUWHDQWLYROFDGXUDV
Base o Bloque de
1XQFDTXLWHODVSDWDVGHQLYHODFLyQSRUFRPSOHWR\DTXHODFRFLQDQR
Madera Negra
TXHGDUiELHQVXMHWDDOGLVSRVLWLYRDQWLYROFDGXUDV
&RFLQDV(PSRWUDEOHV
3DUDFRQWURODUVLHOVRSRUWHHVWiLQVWDODGR\FRQHFWDGRFRUUHFWDPHQWH
GHVOLFHODFRFLQDKDFLDDGHODQWHFRQILUPHTXHHOVRSRUWHDQWLYROFDGXUDV
HVWpDGKHULGRGHIRUPDVHJXUDDODSDUWHWUDVHUDGHODFRFLQD\GHVOLFH
Soporte
HVWD~OWLPDKDFLDDWUiVGHPRGRTXHHOVRSRUWHDQWLYROFDGXUDVVHGHVOLFH
Anti-Volcaduras
SRUGHEDMRGHOPRVWUDGRUREORTXHGHPDGHUDDGMXQWRDODSDUHGWUDVHUD
Horno
6LXVWHGQRUHFLELyXQVRSRUWHDQWLYROFDGXUDVFRQVXFRPSUDOODPHDO
SDUDUHFLELUXQRVLQFRVWRDOJXQRHQ&DQDGiOODPHDO
3DUDFRQVXOWDULQVWUXFFLRQHVGHLQVWDODFLyQGHOVRSRUWH
YLVLWH*($SSOLDQFHVFRPHQ&DQDGi*($SSOLDQFHVFD
Pared Trasera
ADVERTENCIA
&RFLQDV(PSRWUDEOHV
$'9(57(1&,$
127,),&$&,Ï1,03257$17('(6(*85,'$'
/DOH\GH&DOLIRUQLDVREUHDJXDVSRWDEOHV\Wy[LFRVH[LJHTXHHO*REHUQDGRUGH&DOLIRUQLDSXEOLTXHXQDOLVWDGHVXVWDQFLDVTXHVHJ~Q
HOHVWDGRSURYRTXHQFiQFHUGHIHFWRVFRQJpQLWRVXRWURVGDxRVUHSURGXFWLYRV\H[LJHDODVHPSUHVDVTXHDGYLHUWDQDORVFOLHQWHV
VREUHODH[SRVLFLyQSRWHQFLDODGLFKDVVXVWDQFLDV
/DDLVODFLyQGHILEUDGHYLGULRGHORVKRUQRVDXWROLPSLDQWHVHPLWHXQDSHTXHxDFDQWLGDGGHPRQy[LGRGHFDUERQRGXUDQWH
HOFLFORGHOLPSLH]D/DH[SRVLFLyQSXHGHPLQLPL]DUVHYHQWLODQGRFRQXQDYHQWDQDDELHUWDRXVDQGRXQDFDPSDQDRYHQWLODGRU
*($SSOLDQFHVFRP
$'9(57(1&,$ ,16758&&,21(6*(1(5$/(6'(6(*85,'$'
„8VHHVWHDSDUDWRVyORFRQHOREMHWLYRSDUDHOTXHIXHFUHDGR
FRPRVHGHVFULEHHQHVWH0DQXDOGHO3URSLHWDULR
„$VHJ~UHVHGHTXHXQWpFQLFRFDOLILFDGRUHDOLFHXQDFRUUHFWD
LQVWDODFLyQ\SXHVWDDWLHUUDGHODUWHIDFWRGHDFXHUGRFRQODV
LQVWUXFFLRQHVGHLQVWDODFLyQSURYLVWDV
„
1RLQWHQWHUHSDUDURFDPELDUQLQJXQDSLH]DGHVXFRFLQDD
PHQRVTXHHVWpHVSHFtILFDPHQWHUHFRPHQGDGRHQHVWHPDQXDO
&XDOTXLHURWURVHUYLFLRGHEHUHDOL]DUORXQWpFQLFRFDOLILFDGR
„$QWHVGHUHDOL]DUFXDOTXLHUFODVHGHUHSDUDFLyQGHVHQFKXIHOD
FRFLQDRGHVFRQHFWHHOVXPLQLVWURHOpFWULFRGHVGHHOSDQHOGH
GLVWULEXFLyQGRPpVWLFRTXLWDQGRHOIXVLEOHRGHVFRQHFWDQGRHO
LQWHUUXSWRUGHFLUFXLWRV
„1RGHMHDORVQLxRVVRORVpVWRVQRGHEHQTXHGDUVRORVRVLQ
DWHQFLyQHQXQiUHDGRQGHXQDSDUDWRHVWpHQXVR1XQFDGHEH
SHUPLWLUVHTXHVHVXEDQVLHQWHQRSDUHQHQFXDOTXLHUSDUWHGH
HVWHDSDUDWR
35(&$8&,21
1RDOPDFHQHHOHPHQWRVGHLQWHUpV
„
SDUDQLxRVVREUHXQDFRFLQDRHQODSURWHFFLyQWUDVHUDGH
XQDFRFLQDORVQLxRVTXHVHWUHSDQDODFRFLQDSDUDDOFDQ]DU
HOHPHQWRVSXHGHQUHVXOWDUJUDYHPHQWHKHULGRV
„6yORXVHDJDUUDGHUDVVHFDVODVDJDUUDGHUDVK~PHGDVR
PRMDGDVFRORFDGDVHQVXSHUILFLHVFDOLHQWHVSXHGHQSURYRFDU
TXHPDGXUDVGHYDSRU1RSHUPLWDTXHODVDJDUUDGHUDVHQWUHQ
HQFRQWDFWRFRQXQLGDGHVGHVXSHUILFLHRORVHOHPHQWRV
FDOHQWDGRUHVFDOLHQWHV1RXWLOLFHWRDOODV
XRWUDVWHODVJUXHVDVHQOXJDUGHXQDDJDUUDGHUD
„
1XQFDXVHVXHOHFWURGRPpVWLFRSDUDFDOHQWDUODKDELWDFLyQ
$'9(57(1&,$
0$17(1*$/260$7(5,$/(6
,1)/$0$%/(6$/(-$'26'(/$&2&,1$
„1RDOPDFHQHRXWLOLFHPDWHULDOHVLQIODPDEOHVGHQWURGHXQKRUQR
RFHUFDGHODHVWXIDWDOHVFRPRSDSHOSOiVWLFRDJDUUDGHUDV
WHODVUHFXEULPLHQWRVGHSDUHGFRUWLQDV\JDVROLQDXRWURV
YDSRUHV\OtTXLGRVLQIODPDEOHV
„1XQFDXVHYHVWLPHQWDVKROJDGDVRDPSOLDVPLHQWUDVXWLOLFHHO
DSDUDWR(VWDVYHVWLPHQWDVSXHGHQSUHQGHUVHIXHJRVLHQWUDQ
HQFRQWDFWRFRQVXSHUILFLHVFDOLHQWHVSURYRFDQGRTXHPDGXUDV
JUDYHV
$'9(57(1&,$
„1RWRTXHODVXQLGDGHVGHVXSHUILFLHORVHOHPHQWRVFDOHQWDGRUHV
RODVXSHUILFLHLQWHULRUGHOKRUQR(VWDVVXSHUILFLHVSXHGHQHVWDU
ORVXILFLHQWHPHQWHFDOLHQWHVSDUDTXHPDUD~QFXDQGRWHQJDQ
XQFRORURVFXUR'XUDQWH\GHVSXpVGHOXVRQRWRTXHRGHMHTXH
VXYHVWLPHQWDXRWURVPDWHULDOHVLQIODPDEOHVHQWUHQHQFRQWDFWR
FRQXQLGDGHVGHVXSHUILFLHiUHDVFHUFDQDVDODVXQLGDGHVGH
VXSHUILFLHRFXDOTXLHUiUHDLQWHULRUGHOKRUQRGHMHSDVDUXQ
WLHPSRSUXGHQFLDOSDUDTXHVHHQIUtHQ2WUDVVXSHUILFLHVGHO
DSDUDWRSXHGHQFDOHQWDUVHORVXILFLHQWHFRPRSDUDSURYRFDU
TXHPDGXUDV/DVVXSHUILFLHVSRWHQFLDOPHQWHFDOLHQWHVLQFOX\HQ
ODHVWXIDODViUHDVRULHQWDGDVKDFLDODHVWXIDODDEHUWXUDGH
YHQWLODFLyQGHOKRUQRODVVXSHUILFLHVFHUFDQDVDODDEHUWXUD\ODV
KHQGLGXUDVXELFDGDVDOUHGHGRUGHODSXHUWDGHOKRUQR
„1RFDOLHQWHUHFLSLHQWHVFHUUDGRVGHDOLPHQWRV3RGUtDKDEHUXQD
DFXPXODFLyQGHSUHVLyQHQHOUHFLSLHQWH\pVWHSRGUtDH[SORWDU
SURYRFDQGROHVLRQHV
„
1RXWLOLFHSDSHOGHDOXPLQLRSDUDUHYHVWLUODVEDQGHMDVFROHFWRUDV
RQLQJXQDSDUWHGHOKRUQRFRQH[FHSFLyQGHORGHVFULSWRHQHVWH
PDQXDO8QXVRLQDGHFXDGRSXHGHSURYRFDUGDxRVDODFRFLQD\
XQDGHVFDUJDHOpFWULFDRXQULHVJRGHLQFHQGLR
„
7UDWHGHQRUD\DURJROSHDUODVSXHUWDVHVWXIDVRSDQHOHV
GHFRQWUROGHYLGULR6LORKDFHSRGUtDURPSHUVHHOYLGULR1R
FRFLQHVLXQSURGXFWRWLHQHXQYLGULRURWR3XHGHSURYRFDUVHXQD
GHVFDUJDXQLQFHQGLRRKHULGDV
„
&RFLQHFDUQHVGHUHV\GHDYHSRUFRPSOHWR/DVFDUQHVGH
UHVKDVWDDOFDQ]DUXQDWHPSHUDWXUDLQWHUQDGHSRUORPHQRV
ƒ)ƒ&\ODVFDUQHVGHDYHDXQDWHPSHUDWXUDLQWHUQDGH
SRUORPHQRVƒ)ƒ&/DFRFFLyQDHVWDVWHPSHUDWXUDV
JHQHUDOPHQWHSURWHJHGHHQIHUPHGDGHVWUDQVPLWLGDVSRUORV
DOLPHQWRV
„1RSHUPLWDTXHODJUDVDGHODFRFFLyQXRWURVPDWHULDOHV
LQIODPDEOHVVHDFXPXOHQGHQWURGHODFRFLQDRHQVXFHUFDQtD/D
JUDVDGHQWURGHOKRUQRRVREUHODHVWXIDSXHGHHQFHQGHUVH
„/LPSLHODVFDPSDQDVGHYHQWLODFLyQFRQIUHFXHQFLD1RGHEH
SHUPLWLUVHODDFXPXODFLyQGHJUDVDHQODFDPSDQDRHQHOILOWUR
(1&$62'(,1&(1',26,*$/26
6,*8,(17(63$6263$5$(9,7$5
/$3523$*$&,Ï1'(/)8(*2
„1RXWLOLFHDJXDHQLQFHQGLRVGHJUDVD1XQFDOHYDQWHXQDVDUWpQ
HQOODPDV$SDJXHORVFRQWUROHV$SDJXHXQDVDUWpQHQOODPDV
VREUHXQDXQLGDGGHVXSHUILFLHFXEULHQGRODVDUWpQSRUFRPSOHWR
FRQXQDWDSDTXHDMXVWHELHQXQDSODQFKDSDUDJDOOHWDVRXQD
EDQGHMDSODQD8WLOLFHXQTXtPLFRVHFRPXOWLXVRRXQH[WLQWRUGH
LQFHQGLRVGHHVSXPD
„6LKD\XQLQFHQGLRHQHOKRUQRGXUDQWHHOKRUQHDGRDSiJXHOR
FHUUDQGRODSXHUWDGHOKRUQR\DSDJDQGRHOFRQWURORXVDQGRXQ
TXtPLFRVHFRPXOWLXVRRXQH[WLQWRUGHLQFHQGLRVGHHVSXPD
„6LKD\XQLQFHQGLRHQHOKRUQRGXUDQWHODDXWROLPSLH]D
DSDJXHHOKRUQR\HVSHUHDTXHHOLQFHQGLRVHFRQVXPD1R
DEUDODSXHUWDGHOKRUQRDODIXHU]D(OLQJUHVRGHDLUHIUHVFRD
WHPSHUDWXUDVGHDXWROLPSLH]DSXHGHSURYRFDUXQDH[SORVLyQ
GHOODPDVGHVGHHOKRUQR1RVHJXLUHVWDLQVWUXFFLyQSXHGH
SURYRFDUTXHPDGXUDVJUDYHV
,1)250$&,Ï1,03257$17('(6(*85,'$'
/($72'$6/$6,16758&&,21(6$17(6'(68862
$'9(57(1&,$ ,16758&&,21(6'(6(*85,'$''(/$(678)$
„1XQFDGHMHODVXQLGDGHVGHVXSHUILFLHVLQDWHQFLyQ
HQFRQILJXUDFLRQHVGHFDORUPHGLDRDOWD/RVDOLPHQWRVTXH
KLHUYHQ\VHGHUUDPDQSXHGHQSURYRFDUKXPR\GHUUDPHV
JUDVRVRVTXHSXHGHQSUHQGHUVHIXHJR
„1XQFDGHMHDFHLWHVLQDWHQFLyQPLHQWUDVIUtH6LVHGHMD
FDOHQWDUPiVDOOiGHOSXQWRGHKXPHRHODFHLWHSXHGH
HQFHQGHUVHSURYRFDQGRXQLQFHQGLRTXHSRGUtDSURSDJDUVH
DORVJDELQHWHVFHUFDQRV8WLOLFHXQWHUPyPHWURSDUDJUDVD
FXDQGRVHDSRVLEOHSDUDFRQWURODUODWHPSHUDWXUDGHODFHLWH
„
3DUDHYLWDUHOGHUUDPHGHDFHLWH\XQLQFHQGLRXWLOLFHXQD
FDQWLGDGPtQLPDGHDFHLWHFXDQGRIUtDHQVDUWHQHVSRFR
SURIXQGDV\HYLWHODFRFFLyQGHDOLPHQWRVFRQJHODGRVFRQ
XQDFDQWLGDGH[FHVLYDGHKLHOR
„8WLOLFHHOWDPDxRGHUHFLSLHQWHDGHFXDGR(OLMDUHFLSLHQWHV
FRQEDVHVSODQDVORVXILFLHQWHPHQWHJUDQGHVSDUDFXEULU
HOHOHPHQWRFDOHQWDGRUGHVXSHUILFLH/DXWLOL]DFLyQGH
UHFLSLHQWHVPiVSHTXHxRVGHMDUiH[SXHVWDXQDSRUFLyQGH
ODXQLGDGGHVXSHUILFLHDOFRQWDFWRGLUHFWRORTXHSXHGH
SURYRFDUHOHQFHQGLGRGHVXVYHVWLPHQWDV
8QDUHODFLyQDGHFXDGDGHOUHFLSLHQWHFRQODXQLGDG
GHVXSHUILFLHWDPELpQPHMRUDUiODHILFLHQFLD
„6yORFLHUWRVWLSRVGHUHFLSLHQWHVGHYLGULRYLGULRFHUiPLFR
FHUiPLFDXRWURVUHFLSLHQWHVYLGULDGRVSXHGHQXWLOL]DUVH
VREUHODHVWXIDRWURVSXHGHQURPSHUVHGHELGRDOFDPELR
UHSHQWLQRGHWHPSHUDWXUD
„3DUDPLQLPL]DUODSRVLELOLGDGGHTXHPDGXUDV
HOHQFHQGLGRGHPDWHULDOHVLQIODPDEOHV\ORVGHUUDPHV
ODPDQLMDGHORVUHFLSLHQWHVGHEHQJLUDUVHKDFLDHOFHQWURGH
ODFRFLQDVLQH[WHQGHUVHVREUHQLQJXQDXQLGDG
GHVXSHUILFLHFHUFDQD
„
6LIODPEHDDOLPHQWRVEDMRODFDPSDQDHQFLHQGD
HOYHQWLODGRU
„
6
LVHSURGXFHXQFRUWHGHOX]HQXQDFRFLQDHOpFWULFD
PLHQWUDVODXQLGDGVXSHUILFLDOHVWiHQ21(QFHQGLGROD
XQLGDGVHYROYHUiDHQFHQGHUFXDQGRUHJUHVHODOX](QFDVR
GHIDOWDGHFRUULHQWHVLQRVHJLUDQWRGDVODVSHULOODVGHOD
XQLGDGGHVXSHUILFLDODODSRVLFLyQ2))$SDJDGRVHSRGUiQ
LQFHQGLDUDUWtFXORVHQRFHUFDGHODHVWXIDORFXDOSRGUi
SURGXFLUOHVLRQHVJUDYHVRODPXHUWH
$'9(57(1&,$ ,16758&&,21(6'(6(*85,'$''(/$
(678)$5$',$17(DOJXQRVPRGHORV
„7HQJDFXLGDGRDOWRFDUODHVWXID/DVXSHUILFLHGHYLGULRGHOD
HVWXIDUHWHQGUiFDORUGHVSXpVGHTXHORVFRQWUROHVVHKD\DQ
DSDJDGR
„1RFRFLQHVREUHXQDHVWXIDURWD6LODHVWXIDVHURPSHODV
VROXFLRQHVGHOLPSLH]D\ORVGHUUDPHVSXHGHQSHQHWUDU
HQODHVWXIDURWD\FUHDUXQULHVJRGHGHVFDUJDHOpFWULFD
&RPXQtTXHVHFRQXQWpFQLFRFDOLILFDGRGHLQPHGLDWR
„(YLWHUD\DUODHVWXIDGHYLGULR/DHVWXIDSXHGHUD\DUVHFRQ
HOHPHQWRVWDOHVFRPRFXFKLOORVLQVWUXPHQWRVILORVRVDQLOORVX
RWUDVMR\DV\UHPDFKHVGHODURSD
„
1RFRORTXHRDOPDFHQHHOHPHQWRVTXHSXHGHQGHUUHWLUVHR
SUHQGHUVHIXHJRVREUHODHVWXIDGHYLGULRD~QFXDQGRQROD
HVWpXVDQGR6LODHVWXIDVHHQFLHQGHHQIRUPDDFFLGHQWDO
SXHGHQSUHQGHUVHIXHJR(OFDORUSURYHQLHQWHGHODHVWXIDR
GHODYHQWLODFLyQGHOKRUQRWDPELpQSXHGHSUHQGHUORVIXHJR
D~QVLHODSDUDWRHVWiDSDJDGR
„8VHHOOLPSLDGRUGHHVWXIDVFHUiPLFDV&(5$0$%5<7(Š
\ODHVSRQMLOODGHOLPSLH]D&(5$0$%5<7(ŠSDUDOLPSLDU
ODHVWXID(VSHUHKDVWDTXHODHVWXIDVHHQIUtH\ODOX]
LQGLFDGRUDVHDSDJXHDQWHVGHOLPSLDU8QDHVSRQMD
RXQSDxRK~PHGRVVREUHXQDVXSHUILFLHFDOLHQWHSXHGHQ
SURYRFDUTXHPDGXUDVGHYDSRU$OJXQRVOLPSLDGRUHVSXHGHQ
SURGXFLUKXPRVWy[LFRVVLVHORVDSOLFDDXQDVXSHUILFLH
FDOLHQWH127$/RVGHUUDPHVGHD]~FDUVRQODH[FHSFLyQ
eVWRVGHEHQTXLWDUVHPLHQWUDVHVWiQFDOLHQWHVXWLOL]DQGRXQD
DJDUUDGHUD\XQUDVSDGRU3DUDLQVWUXFFLRQHVGHWDOODGDVYHU
ODVHFFLyQ&yPROLPSLDU
ODHVWXIDGHYLGULR
„/HD\FXPSODFRQWRGDVODVLQVWUXFFLRQHV\DGYHUWHQFLDVGHOD
HWLTXHWDGHODFUHPDGHOLPSLH]D
$'9(57(1&,$ ,16758&&,21(6'(6(*85,'$''(/$
(678)$'(%2%,1$6DOJXQRVPRGHORV
„1RVXPHUMDRUHPRMHODVXQLGDGHVGHVXSHUILFLH
GHVPRQWDEOHV1RODVFRORTXHHQHOODYDYDMLOODV
1RFRORTXHODVXQLGDGHVGHVXSHUILFLHGHQWURGHOKRUQR
FXDQGRUHDOLFHODDXWROLPSLH]D6LORKDFHSXHGHQOOHJDUD
IDOODUSURYRFDQGRXQSHOLJURGHTXHPDGXUDVRGHLQFHQGLR
„3DUDHYLWDUODSRVLELOLGDGGHXQDTXHPDGXUDRGHVFDUJD
HOpFWULFDVLHPSUHYHULILTXHTXHORVFRQWUROHVGHWRGDV
ODVXQLGDGHVGHVXSHUILFLHVHHQFXHQWUHQHQODSRVLFLyQ2))
DSDJDGR\TXHWRGDVODVERELQDVHVWpQIUtDVDQWHV
GHOHYDQWDURTXLWDUXQDXQLGDGGHVXSHUILFLHGHERELQDV
„
$VHJ~UHVHGHTXHODVEDQGHMDVFROHFWRUDVQRHVWpQFXELHUWDV
\VHHQFXHQWUHQHQVXOXJDU6XDXVHQFLDGXUDQWHODFRFFLyQ
SRGUtDGDxDUODVSLH]DV\HOFDEOHDGRGHODFRFLQD
„
1RXVHSDSHOGHDOXPLQLRSDUDFXEULUFDFHURODVHQOD
SDUWHLQIHULRU(OSDSHOSXHGHDWUDSDUHOFDORURGHUUHWLUVH
RFDVLRQDQGRGDxRVVREUHHOSURGXFWR\ULHVJRGHGHVFDUJD
HOpFWULFDRLQFHQGLR
*($SSOLDQFHVFRP
$'9(57(1&,$
,16758&&,21(6'(6(*85,'$''(/+2512
„0DQWpQJDVHDOHMDGRGHODFRFLQDFXDQGRDEUD
ODSXHUWDGHOKRUQR(ODLUH\HOYDSRUFDOLHQWHVTXHVDOHQGHOD
FRFLQDSXHGHQSURYRFDUTXHPDGXUDVHQPDQRVURVWUR\R
RMRV
„0DQWHQJDVLQREVWUXFFLRQHVODYHQWLODFLyQGHOKRUQR
„
0DQWHQJDHOKRUQROLEUHGHDFXPXODFLRQHVGHJUDVD
/DJUDVDGHQWURGHOKRUQRSXHGHSUHQGHUVHIXHJR
„6LHPSUHFRORTXHODVEDQGHMDVGHOKRUQRHQODSRVLFLyQ
GHVHDGDPLHQWUDVHOKRUQRHVWpIUtR6LODEDQGHMDGHEH
TXLWDUVHFXDQGRHOKRUQRWRGDYtDHVWiFDOLHQWHQRSHUPLWD
TXHODDJDUUDGHUDWRTXHHOHOHPHQWRFDOHQWDGRUGHOKRUQR
„&XDQGRXWLOLFHEROVDVGHFRFFLyQRGHDVDGRHQHOKRUQRVLJD
ODVLQVWUXFFLRQHVGHOIDEULFDQWH
$'9(57(1&,$
„7LUHGHODEDQGHMDGHOKRUQRKDVWDODSRVLFLyQGHWRSH
GHGHWHQFLyQFXDQGRFDUJXHRGHVFDUJXHDOLPHQWRV
GHOKRUQR(VWRD\XGDDHYLWDUTXHPDGXUDVSRUWRFDU
VXSHUILFLHVFDOLHQWHVGHODSXHUWD\ODVSDUHGHVGHOKRUQR
„
1RGHMHSURGXFWRVFRPRSDSHOXWHQVLOLRVGHFRFLQD
RDOLPHQWRVHQHOKRUQRFXDQGRQRORHVWpXVDQGR
/RVHOHPHQWRVJXDUGDGRVHQHOKRUQRSXHGHQSUHQGHUVH
IXHJR
„1RXVHSDSHOGHDOXPLQLRSDUDFXEULUHOIRQGRGHOKRUQR(O
DOXPLQLRSXHGHDWUDSDUHOFDORURGHUUHWLUVHORFXDOSXHGH
GDxDUHOSURGXFWR\SURYRFDUULHVJRGHGHVFDUJDHOpFWULFDR
XQLQFHQGLR
,16758&&,21(6'(6(*85,'$''(/
+2512$872/,03,$17(DOJXQRVPRGHORV
/DFDUDFWHUtVWLFDGHDXWROLPSLH]DIXQFLRQDHQHOKRUQRDWHPSHUDWXUDVORVXILFLHQWHPHQWHHOHYDGDVFRPRSDUDTXHPDUORV
UHVWRVGHDOLPHQWRVTXHTXHGDURQGHQWURGHOKRUQR6LJDHVWDVLQVWUXFFLRQHVSDUDXQDRSHUDFLyQVHJXUD
„$QWHVGHLQLFLDUHOFLFORGHDXWROLPSLH]DTXLWHODVROODV
EDQGHMDVGHOKRUQRGHPHWDOEULOODQWH\RWURVXWHQVLOLRV
GHOKRUQR6yORSXHGHQGHMDUVHHQHOKRUQRODVEDQGHMDV
UHYHVWLGDVGHSRUFHODQDJULVRQHJUR1RXWLOLFHODDXWR
OLPSLH]DSDUDOLPSLDURWUDVSLH]DVFRPREDQGHMDVFROHFWRUDV
RWD]RQHV
„$QWHVGHXWLOL]DUHOFLFORGHDXWROLPSLH]DOLPSLHODJUDVD\ORV
GHUUDPHVGHDOLPHQWRVGHOKRUQR8QDFDQWLGDGH[FHVLYDGH
JUDVDSXHGHHQFHQGHUVHJHQHUDQGRGDxRVSRUHOKXPRHQ
VXKRJDU
$'9(57(1&,$
„6LHOPRGRGHDXWROLPSLH]DQRIXQFLRQDDSDJXHHOKRUQR
\GHVFRQHFWHHOVXPLQLVWURGHHQHUJtD/ODPHDXQWpFQLFR
FDOLILFDGRSDUDVROLFLWDUHODUUHJOR
„1ROLPSLHODHPSDFDGXUDGHODSXHUWD/DHPSDFDGXUDGH
ODSXHUWDHVHVHQFLDOSDUDXQEXHQVHOODGR'HEHWHQHUVH
FXLGDGRGHQRUHIUHJDUGDxDURPRYHUODHPSDFDGXUD
„
1RXWLOLFHOLPSLDGRUHVGHKRUQR1RGHEHXWLOL]DUVHQLQJ~Q
OLPSLDGRUFRPHUFLDORUHYHVWLPLHQWRSURWHFWRUGHQLQJXQD
FODVHGHQWURRDOUHGHGRUGHQLQJXQDSLH]DGHOKRUQR
&$-Ï1&$/(17$'25&$-Ï1'(/+2512
,1)(5,25,16758&&,21(6'(6(*85,'$'
DOJXQRVPRGHORV „(OREMHWLYRGHOFDMyQFDOHQWDGRUHVPDQWHQHUDOLPHQWRV
FRFLGRVFDOLHQWHVDODWHPSHUDWXUDGHVHUYLFLR3RUGHEDMRGH
ORVƒ)ƒ&SXHGHSURGXFLUVHFUHFLPLHQWRGHEDFWHULDVHQ
ORVDOLPHQWRV1RFRORTXHDOLPHQWRVIUtRV
HQHOFDMyQFDOHQWDGRU1RFDOLHQWHDOLPHQWRVSRUPiV
GHKRUDV1RVHJXLUHVWDVLQVWUXFFLRQHVSXHGHSURYRFDU
HQIHUPHGDGHVWUDQVPLWLGDVSRUORVDOLPHQWRV
„1RGHMHSURGXFWRVGHSDSHOSOiVWLFRVFRPLGDHQODWDGD
RPDWHULDOHVFRPEXVWLEOHVHQHOFDMyQ3XHGHQSUHQGHUVH
IXHJR
„1RWRTXHHOHOHPHQWRFDOHQWDGRURODVXSHUILFLHLQWHUQDGHO
FDMyQ(VWDVVXSHUILFLHVSXHGHQHVWDUORVXILFLHQWHPHQWH
FDOLHQWHVFRPRSDUDSURYRFDUTXHPDGXUDV
„
7HQJDFXLGDGRDODEULUHOFDMyQ$EUDXQSRFRHOFDMyQ\GHMH
VDOLUHODLUHFDOLHQWH\HOYDSRUDQWHVGHTXLWDURYROYHUD
FRORFDUORVDOLPHQWRV(ODLUH\HOYDSRUFDOLHQWHVTXHVDOHQ
SXHGHQSURYRFDUTXHPDGXUDVHQPDQRVURVWUR\RRMRV
„
1RXVHSDSHOGHDOXPLQLRSDUDFXEULUHOFDMyQLQIHULRU(OSDSHO
DWUDSDUiHQFDORUGHOIRQGR\DOWHUDUiHOIXQFLRQDPLHQWR
GHOKRUQR(OSDSHOVHSRGUiGHUUHWLU\GDxDUGHIRUPD
SHUPDQHQWHODSDUWHLQIHULRUGHOFDMyQ&XDOTXLHUGDxRSRU
XVRLQDGHFXDGRGHOSDSHOGHDOXPLQLRQRHVWDUiFXELHUWRSRU
ODJDUDQWtDGHOSURGXFWR
8VRGHXQLGDGHVGHODVXSHUILFLH
5,(6*2'(,1&(1',21XQFDSLHUGDGHYLVWDODFRFLQDFXDQGRODHVWXIDHVWp
HQODVFRQILJXUDFLRQHVPHGLRRDOWR0DQWHQJDORVtWHPVLQIODPDEOHVDOHMDGRV
GHODHVWXID$SDJXHWRGRVORVFRQWUROHVFXDQGRILQDOLFHODFRFFLyQ6LQRVH
VLJXHQHVWDVLQVWUXFFLRQHVVHSRGUiSURGXFLULQFHQGLRVOHVLRQHVJUDYHVRODPXHUWH
(VSRVLEOHTXHODVIXQFLRQHV\DSDULHQFLDVYDUtHQFRQUHODFLyQDVXPRGHORDORODUJRGHOPDQXDO
$'9(57(1&,=$
&RQILJXUDFLRQHVGHFRFFLyQGHODVXQLGDGHVGHVXSHUILFLH
(OQLYHOGHHQHUJtDFRQ
XQDIUDFFLyQLQGLFDOD
FRQILJXUDFLyQDGLFLRQDOGH
PHGLRSDVR8VWHGSXHGHRtU
FKDVTXLGRVTXHLQGLFDQTXHHO
FRQWUROHVWiPDQWHQLHQGRVX
FRQILJXUDFLyQGHVHDGD
/DHVWXIDRIUHFHQLYHOHVGHHQHUJtD
/RVQLYHOHVGHHQHUJtDYDQGHVGH´/µEDMD
KDVWD´+,µDOWDHQSUHFLVRVDXPHQWRVGH
PHGLRSDVR3RUHMHPSOR\
KDVWD+,
6HUHFRPLHQGDHOQLYHOGHHQHUJtDGH´/µ
ODFRQILJXUDFLyQPiVEDMDSDUD´PDQWHQHU
FDOLHQWHµ
(OQLYHOGHHQHUJtDDXPHQWDGHDPHGLRQLYHO
FRQFDGDWRTXH
127$&XDQGRVHFDPELDGHXQDFRQILJXUDFLyQ
GHFDORUDOWDDXQDEDMDODXQLGDGGHVXSHUILFLH
SXHGHGHMDUGHUHVSODQGHFHU(VWRHVQRUPDO/D
XQLGDGVLJXHHQFHQGLGD\FDOLHQWH
127$(VWDHVWXIDFXHQWDFRQXQDFDUDFWHUtVWLFD
GHFDOHQWDPLHQWRUiSLGR6LODHVWXIDHVWiIUtD
FXDQGRVHODHQFLHQGHUHVSODQGHFHUiGXUDQWH
XQSHUtRGRFRUWRKDVWDTXHVHDOFDQFHOD
FRQILJXUDFLyQGHHQHUJtDGHVHDGD
8QLGDGGHVXSHUILFLH~QLFD³&RQILJXUDFLRQHVGHFRFFLyQ
3DUDHQFHQGHUXQDXQLGDGGHVXSHUILFLH~QLFD
3UHVLRQHHOERWyQ212))HQFHQGLGR
DSDJDGROXHJRSUHVLRQHHOERWyQ²
8WLOLFHHOERWyQ²SDUDHOHJLUOD
FRQILJXUDFLyQGHHQHUJtDGHVHDGD
3DUDXWLOL]DUODFDUDFWHUtVWLFD´0HOWµGHUUHWLU
3UHVLRQHHOERWyQ212))HQFHQGLGRDSDJDGR
OXHJRSUHVLRQH0(/7GHUUHWLU(OHOHPHQWR
DXWRPiWLFDPHQWHTXHGDUiHQXQDFRQILJXUDFLyQ
SUHGHWHUPLQDGD\SRGUiYHUVH´/µ
3DUDXWLOL]DUODFDUDFWHUtVWLFD´6LPPHUµIXHJR
OHQWR
3UHVLRQHHOERWyQ212))HQFHQGLGR
DSDJDGROXHJRSUHVLRQH6,00(5IXHJROHQWR
(OHOHPHQWRDXWRPiWLFDPHQWHTXHGDUiHQXQD
FRQILJXUDFLyQSUHGHWHUPLQDGD\SRGUiYHUVH
´µ$MXVWHXWLOL]DQGRHOERWyQ²SDUDVXELUR
EDMDUHOQLYHOGHIXHJROHQWR
3DUDDSDJDUXQDXQLGDGGHVXSHUILFLH~QLFD
SUHVLRQHHOERWyQ212))HQFHQGLGR
DSDJDGRGHQXHYR
4XHPDGRUGHDQLOORVP~OWLSOHVSXHGHVHUGREOHRWULSOHGHSHQGLHQGRGHOPRGHOR
3UHVLRQHHOERWyQ212))HQFHQGLGR
DSDJDGRSDUDODXQLGDGGHVXSHUILFLH
IURQWDOGHUHFKD
3DUDDSDJDU2))ODXQLGDGGHVXSHUILFLH
SUHVLRQHHOERWyQ212))HQFHQGLGR
DSDJDGR
8WLOLFHHOERWyQ²SDUDHOHJLUOD
FRQILJXUDFLyQGHHQHUJtDGHVHDGD
9HUODSiJLQDSDUDLQIRUPDFLyQDGLFLRQDO
3UHVLRQHHOERWyQ%851(56,=(WDPDxR
GHTXHPDGRUSDUDVHOHFFLRQDUHOWDPDxR
GHTXHPDGRUGHVHDGRGHVHDGR
/DOX]XELFDGDDOODGRGHOERWyQ%851(56,=(
WDPDxRGHTXHPDGRULQGLFDHOWDPDxRGHOD
XQLGDGGHVXSHUILFLH
*($SSOLDQFHVFRP
$'9(57(1&,$
5,(6*2'(,172;,&$&,Ï1$/,0(17$5,$3RUGHEDMRGHORVƒ)ƒ&SXHGH
SURGXFLUVHFUHFLPLHQWRGHEDFWHULDVHQORVDOLPHQWRV
‡6LHPSUHHPSLHFHFRQDOLPHQWRVFDOLHQWHV1RXWLOLFHFRQILJXUDFLRQHV
GHPDQWHQHUFDOLHQWHSDUDFDOHQWDUDOLPHQWRVIUtRV
‡1RFDOLHQWHDOLPHQWRVSRUPiVGHKRUDV
1RVHJXLUHVWDVLQVWUXFFLRQHVSXHGHSURYRFDUHQIHUPHGDGHVWUDQVPLWLGDVSRU
ORVDOLPHQWRV
&yPRXVDUOD]RQDGHFDOHQWDPLHQWRHQDOJXQRVPRGHORV
WARMING ZONE
SELECT
ON
OFF
/D=21$'(&$/(17$0,(172VHHQFXHQWUD
HQODSDUWHWUDVHUDFHQWUDOGHODVXSHUILFLHGH
YLGULR
3DUDXWLOL]DUOD=21$'(&$/(17$0,(172
3UHVLRQHODWHFOD:$50,1*=21(21
2))]RQDGHFDOHQWDPLHQWRHQFHQGLGR
DSDJDGR
3DUDVHOHFFLRQDUODFRQILJXUDFLyQGH
FRQWUROGHVHDGDSUHVLRQHHOERWyQ6(/(&7
VHOHFFLRQDUXQDYH]SDUD/2EDMDGRV
YHFHVSDUD0('PHGLDRWUHVYHFHVSDUD
+,DOWD
3DUDDSDJDUOD=21$'(&$/(17$0,(172
3UHVLRQHODWHFOD:$50,1*=21(212))
]RQDGHFDOHQWDPLHQWRHQFHQGLGRDSDJDGR
3DUDPHMRUHVUHVXOWDGRVWRGRV
ORVDOLPHQWRVGHOD=21$'(&$/(17$0,(172
GHEHQFXEULUVHFRQ
XQDWDSDRFRQSDSHOGHDOXPLQLR
6LHPSUHXWLOLFHDJDUUDGHUDVRJXDQWHVGH
FRFLQDFXDQGRTXLWHDOLPHQWRVGHOD=21$
'(&$/(17$0,(172\DTXHORVUHFLSLHQWHV
HVWDUiQFDOLHQWHV
‡1RXWLOLFHHQYROWRULRVSOiVWLFRVSDUDFXEULU
DOLPHQWRV(OSOiVWLFRSXHGHGHUUHWLUVHHQOD
VXSHUILFLH\VHUiPX\GLItFLOOLPSLDUOR
‡8WLOLFHVyORUHFLSLHQWHVGHFRFLQD
UHFRPHQGDGRVSDUDFRFFLyQVREUHHVWXIDV
8VRGHXQLGDGHVGHODVXSHUILFLH
&RQVHMRVSDUD3URGXFWRV(QODWDGRVHQHO+RJDU
$VHJ~UHVHTXHHOSURGXFWRHQODWDGRVH
HQFXHQWUHVREUHODXQLGDGVXSHUILFLDO
$VHJ~UHVHGHTXHHOSURGXFWRHQODWDGRVHD
SODQRHQVXSDUWHLQIHULRU
3DUDHYLWDUTXHPDGRUDVGHYDSRURFDORU
WHQJDFXLGDGRDOHQODWDUHOSURGXFWR
8VHUHFHWDV\SURFHGLPLHQWRVGHIXHQWHV
FRQILDEOHV(VWRVVHHQFXHQWUDQGLVSRQLEOHVD
WUDYpVGHIDEULFDQWHVFRPR%DOOŠ\.HUUŠ\HO
'HSDUWPHQWRI$JULFXOWXUH([WHQVLRQ6HUYLFH
6HUYLFLRGHO'HSDUWDPHQWRGH$JULFXOWXUD
(OXVRGHHQODWDGRVFHUUDGRVDEDxRPDUtDFRQ
IRQGRVRQGHDGRVSRGUiQH[WHQGHUHOWLHPSR
UHTXHULGRSDUDWUDHUHODJXDDOSXQWRGHKHUYRU
3DUD0RGHORVFRQ(VWXIDGH9LGULR5DGLDQWH
/DHVWXIDUDGLDQWHFXHQWDFRQXQLGDGHV
FDOHQWDGRUDVGHEDMRGHXQDVXSHUILFLHOLVDGH
YLGULR
1XQFDFRFLQHGLUHFWDPHQWHVREUHHO
YLGULR6LHPSUHXWLOLFHUHFLSLHQWHVGH
FRFFLyQ
6LHPSUHFRORTXHHOUHFLSLHQWHHQHO
FHQWURGHODXQLGDGGHVXSHUILFLH
VREUHODTXHHVWiFRFLQDQGR
127$8QOLJHURRORUHVQRUPDOFXDQGR
XQDHVWXIDQXHYDVHXWLOL]DSRUSULPHUDYH]
(VSURYRFDGRSRUHOFDOHQWDPLHQWRGHSLH]DV
QXHYDV\PDWHULDOHVDLVODQWHV\GHVDSDUHFHUiHQ
SRFRWLHPSR
127$(QPRGHORVFRQHVWXIDVGHYLGULR
GHFRORUFODURHVQRUPDOTXHODV]RQDV
GHFRFFLyQFDPELHQGHFRORUFXDQGRHVWiQ
FDOLHQWHVRHQIULiQGRVH(VWRHVWHPSRUDO\
GHVDSDUHFHUiDPHGLGDTXHHOYLGULRVHHQIUtH
DWHPSHUDWXUDDPELHQWH
/DXQLGDGVXSHUILFLDOVHJXLUiXQFLFORGH
HQFHQGLGR\DSDJDGRSDUDPDQWHQHUVX
FRQILJXUDFLyQGHFRQWUROVHOHFFLRQDGD
(VVHJXURFRORFDUXWHQVLOLRVFDOLHQWHVHQOD
VXSHUILFLHGHYLGULRLQFOXVRFXDQGRODHVWXID
HVWpIUtD
$XQTXHODVXQLGDGHVGHVXSHUILFLHVHKD\DQ
DSDJDGRODHVWXIDGHYLGULRUHWLHQHVXILFLHQWH
FDORUSDUDFRQWLQXDUODFRFFLyQ3DUDHYLWDUOD
VREUHFRFFLyQTXLWHODVROODVGHODVXQLGDGHVGH
VXSHUILFLHFXDQGRORVDOLPHQWRVHVWpQFRFLGRV
1RGHVOLFHORVUHFLSLHQWHVGHFRFFLyQDWUDYpVGHOFRQWURO
\ODVXSHUILFLHGHODHVWXIDSRUTXHSXHGHUD\DUHOYLGULR
(OYLGULRHVUHVLVWHQWHDORVUD\RQHVSHURQRDSUXHEDGH
ORVPLVPRV
1RFRORTXHQDGDVREUHODXQLGDGGHVXSHUILFLH
KDVWDTXHVHKD\DHQIULDGRSRUFRPSOHWR
„/DVPDQFKDVGHDJXDGHSyVLWRVPLQHUDOHV
SXHGHQTXLWDUVHXWLOL]DQGRFUHPDOLPSLDGRUD
RYLQDJUHEODQFRVLQGLOXLU
„(OXVRGHOLPSLDGRUGHYHQWDQDVSXHGHGHMDU
XQDSHOtFXODLULGLVFHQWHVREUHODHVWXID
/DFUHPDOLPSLDGRUDTXLWDUiHVWD
GHFRORUDFLyQ
„1RDOPDFHQHHOHPHQWRVSHVDGRVVREUH
ODHVWXID6LFDHQVREUHODHVWXIDSRGUtDQ
SURYRFDUGDxRV
„1RXWLOLFHODVXSHUILFLHFRPRXQDWDEODSDUD
FRUWDU
/LPLWDGRUGH7HPSHUDWXUDHQ(VWXIDVGH9LGULR5DGLDQWH
&DGDXQLGDGGHVXSHUILFLHUDGLDQWHFXHQWDFRQ
XQOLPLWDGRUGHWHPSHUDWXUD
(OOLPLWDGRUGHWHPSHUDWXUDHYLWDTXHODHVWXIDGH
YLGULRVHFDOLHQWHHQH[FHVR
(OOLPLWDGRUGHWHPSHUDWXUDSRGUiDSDJDUODV
XQLGDGHVVXSHUILFLDOHVSRUFLFORVGXUDQWHXQ
WLHPSRVL
■ODROODKLHUYHKDVWDVHFDUVH
■ HOIRQGRGHODROODQRHVSODQR
■ODROODHVWiIXHUDGHOFHQWUR
■QRKD\ROODHQODXQLGDG
&yPRVHOHFFLRQDUWLSRVGHXWHQVLOLRVSDUD
PRGHORVGHHVWXIDGHYLGULRUDGLDQWH
*($SSOLDQFHVFRP
/DVLJXLHQWHLQIRUPDFLyQORD\XGDUiDHOHJLUORVUHFLSLHQWHVGHFRFFLyQTXHEULQGDQXQEXHQGHVHPSHxR
HQHVWXIDVGHYLGULR9HUHOIROOHWRVREUHUHFLSLHQWHVSDUDXVDUFRQHVWXIDVGHLQGXFFLyQ
$FHURLQR[LGDEOH
5HFRPHQGDGR
$OXPLQLR
9HULILTXHTXHORVUHFLSLHQWHV
WHQJDQEDVHVSODQDVXWLOL]DQGR
XQDUHJOD
6HUHFRPLHQGDGHFDSDJUXHVD
%XHQDFRQGXFWLYLGDG/RVUHVLGXRVGHDOXPLQLR
DYHFHVSDUHFHQUD\RQHVVREUHODHVWXIDSHUR
SXHGHQTXLWDUVHVLVHORVOLPSLDGHLQPHGLDWR
'HELGRDVXEDMRSXQWRGHIXVLyQQRGHEH
XWLOL]DUVHDOXPLQLRGHFDSDILQD
%DVHGHFREUH
5HFRPHQGDGR
(OFREUHSXHGHGHMDUUHVLGXRVTXHSXHGHQ
SDUHFHUUD\RQHV/RVUHVLGXRVSXHGHQ
HOLPLQDUVHVLHPSUH\FXDQGRODHVWXID
VHOLPSLHGHLQPHGLDWR6LQHPEDUJRQR
SHUPLWDTXHHVWDVROODVKLHUYDQHQVHFR
(OPHWDOVREUHFDOHQWDGRSXHGHDGKHULUVH
DODVHVWXIDVGHYLGULR6LQRVHHOLPLQDGH
LQPHGLDWRXQDROODFRQODEDVHGHFREUH
VREUHFDOHQWDGRGHMDUiXQUHVLGXRTXH
PDQFKDUiODHVWXIDHQIRUPDSHUPDQHQWH
1RVHUHFRPLHQGDQUHFLSLHQWHVFRQ
EDVHVUHGRQGHDGDVFXUYDGDVFRQ
UHERUGHVRWRUFHGXUDV
(VPDOWHGHSRUFHODQDVREUHKLHUUR
IXQGLGR
6HUHFRPLHQGDVLODEDVHGHODROODVHHQFXHQWUD
UHYHVWLGD
(VPDOWHGHSRUFHODQDVREUHDFHUR
1RVHUHFRPLHQGD
&DOHQWDUUHFLSLHQWHVYDFtRVSXHGHSURYRFDU
GDxRVSHUPDQHQWHVDOYLGULRGHODVHVWXIDV(O
HVPDOWHSXHGHGHUUHWLUVH\DGKHULUVHDODHVWXID
FHUiPLFD
9LGULRFHUiPLFR
1RVHUHFRPLHQGD
'HVHPSHxRSREUH5D\DODVXSHUILFLH
&HUiPLFD
1RVHUHFRPLHQGD
'HVHPSHxRSREUH3XHGHUD\DUODVXSHUILFLH
+LHUURIXQGLGR
1RVHUHFRPLHQGDDPHQRVTXHVHHQFXHQWUH
HVSHFtILFDPHQWHGLVHxDGRSDUDHVWXIDVGHYLGULR
3REUHFRQGXFWLYLGDG\OHQWLWXGSDUDDEVRUEHUHO
FDORU5D\DODVXSHUILFLHGHODHVWXID
127$6LJDWRGDVODVUHFRPHQGDFLRQHVGHOIDEULFDQWHGHUHFLSLHQWHVFXDQGRXWLOLFHFXDOTXLHUFODVH
GHUHFLSLHQWHGHFRFFLyQVREUHODHVWXIDFHUiPLFD
3DUDPHMRUHVUHVXOWDGRV
„&RORTXHVyORUHFLSLHQWHVVHFRVVREUHORV
HOHPHQWRVGHVXSHUILFLH1RFRORTXHWDSDV
VREUHORVHOHPHQWRVGHVXSHUILFLHHQ
HVSHFLDOWDSDVPRMDGDV
1RFRORTXHUHFLSLHQWHVPRMDGRV
VREUHODHVWXIDGHYLGULR
1RXVHZRNVFRQDQLOORVGH
VRSRUWHVREUHODHVWXIDGHYLGULR
8WLOLFHZRNVGHEDVHSODQDVREUH
ODHVWXIDGHYLGULR
„1RXVHZRNVFRQDQLOORVGHVRSRUWH
(VWDFODVHGHZRNQRVHFDOLHQWDVREUH
HOHPHQWRVGHVXSHUILFLHGHYLGULR
„5HFRPHQGDPRVHOXVRGHZRNVGH
EDVHSODQDVRODPHQWH6HHQFXHQWUDQ
GLVSRQLEOHVHQVXQHJRFLRPLQRULVWDORFDO
/DEDVHGHOZRNGHEHWHQHUHOPLVPR
GLiPHWURTXHHOHOHPHQWRGHVXSHUILFLH
SDUDDVHJXUDUXQFRQWDFWRDGHFXDGR
„$OJXQRVSURFHGLPLHQWRVGHFRFFLyQ
HVSHFLDOHVUHTXLHUHQUHFLSLHQWHV
GHFRFFLyQHVSHFtILFRVFRPRROODV
DSUHVLyQIUHLGRUDVHWF7RGRVORV
UHFLSLHQWHVGHFRFFLyQGHEHQWHQHUEDVHV
SODQDV\VHUGHOWDPDxRFRUUHFWR
„1RSHUPLWDTXHORVDOLPHQWRVKLHUYDQHQ
VHFR\DTXHORVUHFLSLHQWHVGHFRFFLyQ
SXHGHQDGKHULUVHDODVXSHUILFLHGH
FRFFLyQSURYRFDQGRGDxRVSHUPDQHQWHV
DODHVWXID
8VRGHORVFRQWUROHVGHOKRUQR
(VSRVLEOHTXHODVIXQFLRQHV\DSDULHQFLDVYDUtHQFRQUHODFLyQDVXPRGHORDORODUJRGHOPDQXDO
7HFOD$VDU$OWR%DMR
7HFOD29(1/,*+7/X]GHO+RUQR
3UHVLRQHSDUDVHOHFFLRQDUODIXQFLyQDVDU/HD
ODVHFFLyQ&yPR&RQILJXUDUHO+RUQRSDUD$VDU
3UHVLRQHSDUDHQFHQGHURDSDJDUODVOXFHVGHO
KRUQR
7HFODGH+RUQHDGR
7HFODV7,0(5212))(QFHQGHU$SDJDU
7HPSRUL]DGRU
3UHVLRQHSDUDVHOHFFLRQDUODIXQFLyQKRUQHDU/HD
ODVHFFLyQ&yPR&RQILJXUDUHO+RUQRSDUD+RUQHDU
7HFODGH&RFFLyQSRU&RQYHFFLyQ
8VHXQYHQWLODGRUSDUDKDFHUFLUFXODUDLUHHQHO
KRUQR/HDODVHFFLyQVREUH8VRGHOKRUQRSRU
FRQYHFFLyQ
3UHVLRQHSDUDFRQILJXUDUHOWHPSRUL]DGRU
GHODFRFLQD&RQVXOWHODVHFFLyQGH8VRGHO
7HPSRUL]DGRUGHOD&RFLQD
7HFOD&22.7,0(7HPSRUL]DGRUGHO
&RFFLyQ
3UHVLRQHSDUDPDQWHQHUFDOLHQWHVODVFRPLGDV
\DFRFLQDGDV/HDODVHFFLyQ&yPR&RQILJXUDUHO
+RUQRSDUD&DOHQWDU
3UHVLRQHHVWDWHFOD\OXHJRSUHVLRQHODVWHFODV
QXPpULFDVSDUDFRQILJXUDUODFDQWLGDGGHWLHPSR
GXUDQWHHOFXDOGHVHHTXHVXFRPLGDVHFRFLQH(O
KRUQRVHDSDJDUiFXDQGRHOWLHPSRGHFRFFLyQ
VHKD\DWHUPLQDGR
7HFOD6/2:&22.&RFFLyQ/HQWD
/X]GHO+RUQR(QFHQGLGD$SDJDGD
7HFOD:$50&DOHQWDU
3UHVLRQHSDUDODUJDVKRUDVGHFRFFLyQVLQVX
SUHVHQFLD/HDODVHFFLyQ&yPR&RQILJXUDUHO
+RUQRSDUDXQD&RFFLyQ/HQWD
7RXFKWKLVSDGWRVHWWKHRYHQWRVWDUW
DXWRPDWLFDOO\DWDWLPH\RXVHW
7HFOD352%(6RQGD
127$$OFRQILJXUDUORVWLHPSRVVyORVHUHDOL]DQ
DMXVWHVGHKRUDV\PLQXWRV(OWLHPSRPtQLPRTXH
VHSXHGHFRQILJXUDUHVGHXQPLQXWR
(OUHORMVHGHEHUiFRQILJXUDUHQODKRUDFRUUHFWD
GHOGtDSDUDTXHODVIXQFLRQHVDXWRPiWLFDVGHO
WHPSRUL]DGRUGHOKRUQRIXQFLRQHQGHIRUPD
DGHFXDGD/DKRUDGHOGtDQRVHSXHGHFDPELDU
GXUDQWHXQKRUQHDGRSRUWLHPSRRHOFLFORGH
OLPSLH]DDXWRPiWLFD
&RQVXOWHODVHFFLyQ3DUDFRQILJXUDUHOUHORM
6LVXKRUQRIXHFRQILJXUDGRSDUDXQ
IXQFLRQDPLHQWRSRUWLHPSR\VHSURGXFH
XQFRUWHGHFRUULHQWHHOUHORM\ODVIXQFLRQHV
SURJUDPDGDVVHUiQUHLQLFLDGDV/DKRUDGHOGtD
WLWLODUiHQODSDQWDOODFXDQGRKD\DKDELGRXQ
FRUWHGHFRUULHQWH
3UHVLRQHDOXVDUODVRQGDSDUDFRFLQDUGHIRUPD
DXWRPiWLFDHQODWHPSHUDWXUDGHFRPLGDLQWHUQD
GHVHDGD&RQVXOWHODVHFFLyQ8VRGHOD6RQGD
7HFOD6(/)&/($1$XWR/LPSLH]D
3UHVLRQHODDXWROLPSLH]DGHOKRUQR&RQVXOWHOD
VHFFLyQ8VRGHO+RUQRFRQ$XWR/LPSLH]D
7HFOD67($0&/($1/LPSLH]DDO9DSRU
3UHVLRQHHVWDWHFODSDUDXQDOLPSLH]DIiFLOGH
VXFLHGDGOHYHGHODFDYLGDGGHOKRUQRRODSXHUWD
&RQVXOWHODVHFFLyQ8VRGH/LPSLH]DDO9DSRU
7HFODGH7LHPSRGH&RFFLyQ
3UHVLRQHSDUDFDQFHODU72'$6ODVRSHUDFLRQHV
GHOKRUQRH[FHSWRHOUHORM\HOWHPSRUL]DGRU
7HFODGH3UXHEDHQDOJXQRVPRGHORV
3UHVLRQHSDUDVHOHFFLRQDUXQDPELHQWHFiOLGR
TXHVHD~WLOSDUDODHOHYDFLyQGHSURGXFWRV
IHUPHQWDGRVDEDVHGHOHYDGXUD
%RWyQ3,==$
3UHVLRQHODDOPRKDGLOOD3,==$
3UHVLRQHODVDOPRKDGLOODVQXPpULFDVSDUDVHOHFFLRQDU
SDUDSL]]DFRQJHODGD\SDUDSL]]DIUHVFD
3UHVLRQHODVDOPRKDGLOODVQXPpULFDVSDUD
FRQILJXUDUODWHPSHUDWXUDGHKRUQHDGR
3UHVLRQHHOERWyQ67$57LQLFLDU
(OWLHPSRGHKRUQHDGRHVWiGHWHUPLQDGRSRU
ODVLQVWUXFFLRQHVGHOSDTXHWH
&RORTXHODSL]]DHQODSRVLFLyQGHEDQGHMDVXSHULRU
GHOKRUQRVXSHULRU&XDQGRXWLOLFHXQUHFLSLHQWHGH
PHWDOXWLOLFHODSRVLFLyQGHEDQGHMDLQIHULRU
7HFOD%RUUDU$SDJDU
7HFODGHO&$-Ï1&$/(17$'25
(OFDMyQFDOHQWDGRUPDQWHQGUiODVFRPLGDV
FDOLHQWHV\FRFLQDGDVHQODWHPSHUDWXUDSDUD
VHUYLU6LHPSUHFRPLHQFHFRQFRPLGDFDOLHQWH
&RQVXOWHODVHFFLyQGH8VRGHOFDMyQFDOHQWDGRU
%/248(2'(/&21752/R%/248(2'(/$
&2&,1$
/DVWHFODVGHFRQWUROVHSRGUiQEORTXHDUGH
PRGRTXHQRVHSXHGDQDFWLYDUVLVHSUHVLRQHV
%ORTXHRGHO&RQWURO$OJXQRVPRGHORVFXHQWDQ
FRQ5DQJH/RFNRXW%ORTXHRGHOD&RFLQDTXH
WDPELpQDSDJDUiODVXQLGDGHVVXSHUILFLDOHV
&RQVXOWHODVHFFLyQ&yPR%ORTXHDUORV
&RQWUROHV
8VRGHOUHORMWHPSRUL]DGRUGHODFRFLQD
\EORTXHRGHOFRQWURO
3DUD&RQILJXUDUHO5HORM
(OUHORMVHGHEHUiFRQILJXUDUHQODKRUD
FRUUHFWDGHOGtDSDUDTXHODVIXQFLRQHV'HOD\
6WDUW,QLFLR'HPRUDGRIXQFLRQHQGHIRUPD
DGHFXDGD/DKRUDGHOGtDQRVHSXHGHFDPELDU
GXUDQWHXQDFRFFLyQGHPRUDGDRGXUDQWHHO
FLFORGHDXWROLPSLH]D
3UHVLRQHODWHFOD&ORFN5HORM
3UHVLRQHODVWHFODVQXPpULFDVKDVWDTXHOD
KRUDFRUUHFWDGHOGtDDSDUH]FDHQOD
SDQWDOOD6LODVWHFODVQXPpULFDVQRVH
WRFDQGHQWURGHXQPLQXWROXHJRGHKDEHU
WRFDGRODWHFOD&/2&.5HORMODSDQWDOOD
*($SSOLDQFHVFRP
YXHOYHDODFRQILJXUDFLyQRULJLQDO6LHVWR
VXFHGHSUHVLRQHODWHFOD&/2&.5HORM\
YXHOYDDLQJUHVDUODKRUDGHOGtD
3UHVLRQHODWHFOD6WDUW,QLFLDUKDVWDTXHOD
KRUDGHOGtDDSDUH]FDHQODSDQWDOOD(VWR
LQJUHVDODKRUDHLQLFLDHOUHORM
3DUDFRQWURODUODKRUDGHOGtDFXDQGR
ODSDQWDOODPXHVWUDRWUDLQIRUPDFLyQ
VLPSOHPHQWHSUHVLRQHODWHFOD&/2&.5HORM
/DKRUDGHOGtDDSDUHFHKDVWDTXHRWUDWHFOD
HVSUHVLRQDGD3DUDFDPELDUHOIRUPDWRGHOD
KRUDRDSDJDUODSDQWDOODGHOUHORMFRQVXOWHOD
VHFFLyQ6SHFLDO)HDWXUHV)XQFLRQHV(VSHFLDOHV
3DUD3URJUDPDUHO&RQWDGRUGH7LHPSR
(O7HPSRUL]DGRUGHOD&RFLQDFXHQWD
HQKRUDV\PLQXWRV
(O7HPSRUL]DGRUGHOD&RFLQDQR
FRQWURODODVRSHUDFLRQHVGHOKRUQR/D
FRQILJXUDFLyQPi[LPDGHO7HPSRUL]DGRU
GHOD&RFLQDHVGHKRUDV\PLQXWRV
3UHVLRQHODWHFOD7,0(5217HPSRUL]DGRU
(QFHQGLGR
3UHVLRQHODVWHFODVQXPpULFDVKDVWDTXHOD
FDQWLGDGGHWLHPSRTXHGHVHDDSDUH]FDHQ
ODSDQWDOOD3RUHMHPSORSDUDSURJUDPDU
KRUDV\PLQXWRVWRTXH\HQHVH
RUGHQ6LFRPHWHXQHUURUSUHVLRQHODWHFOD
7,0(52))7HPSRUL]DGRU$SDJDGR\
YXHOYDDFRPHQ]DU
3UHVLRQHODWHFOD67$57,QLFLDU
/XHJRGHSUHVLRQDUODWHFOD67$57,QLFLDU6(7
&RQILJXUDFLyQGHVDSDUHFHHVWROHLQGLFDTXH
HOWLHPSRHVWiHQFXHQWDUHJUHVLYDDXQTXHOD
SDQWDOODQRFDPELDKDVWDTXHKD\DSDVDGRXQ
PLQXWR/RVVHJXQGRVQRVHPRVWUDUiQHQOD
SDQWDOODKDVWDTXHVHUHDOLFHODFXHQWDUHJUHVLYD
GHO~OWLPRPLQXWR
&XDQGRHOFRQWDGRUGHODFRFLQDOOHJXHD
HOFRQWUROKDUiSLWLGRVDJXGRVVHJXLGRVGH
XQSLWLGRDJXGRFDGDVHJXQGRVKDVWDTXH
VHSUHVLRQHWHFOD7,0(52))7HPSRUL]DGRU
$SDJDGR
(OWRQRGHVHJXQGRVVHSXHGHFDQFHODU
VLJXLHQGRORVSDVRVHQODVHFFLyQGHFRQWUROGH
IXQFLRQHV(VSHFLDOHVGHVXKRUQRHQ7RQHVDW
WKH(QGRID7LPHG&\FOH7RQRVDO)LQDOGHXQ
&LFORSRU7LHPSR
3DUD5HLQLFLDUHO7HPSRUL]DGRUGHOD&RFLQD
6LODSDQWDOODD~QPXHVWUDHOWLHPSRUHVWDQWHOD
SXHGHFDPELDUSUHVLRQDQGRODWHFOD7,0(521
7HPSRUL]DGRU(QFHQGLGR\OXHJRSUHVLRQDQGR
ODVWHFODVQXPpULFDVKDVWDTXHHOWLHPSRTXH
GHVHDDSDUH]FDHQODSDQWDOOD
6LHOWLHPSRUHVWDQWHQRVHHQFXHQWUDHQOD
SDQWDOODUHORMLQLFLRGHPRUDGRRWLHPSRGH
FRFFLyQDSDUHFHQHQODSDQWDOODUHFXHUGHHO
WLHPSRUHVWDQWHSUHVLRQDQGRODWHFOD7,0(521
7HPSRUL]DGRU(QFHQGLGR\OXHJRSUHVLRQDQGR
ODVWHFODVQXPpULFDVSDUDLQJUHVDUHOQXHYR
WLHPSRTXHGHVHH
3DUD&DQFHODUHO7HPSRUL]DGRUGHOD&RFLQD
3UHVLRQHODWHFOD7,0(52))7HPSRUL]DGRU
$SDJDGR
&yPR%ORTXHDUORV&RQWUROHV
OR
&RQWURO/RFNRXW%ORTXHRGHO&RQWUROOH
3DUDEORTXHDUGHVEORTXHDUORVFRQWUROHV
SHUPLWLUiEORTXHDUODVWHFODVWiFWLOHVGHPRGR
0DQWHQJDSUHVLRQDGDODWHFOD&RQWURO
TXHQRVHSXHGDQDFWLYDUDOVHUWRFDGDV
/RFNRXW%ORTXHRGHO&RQWUROR5DQJH
$OJXQRVPRGHORVFXHQWDQFRQ5DQJH/RFNRXW
/RFNRXW%ORTXHRGHOD&RFLQDSRU
%ORTXHRGHOD&RFLQDTXHWDPELpQDSDJDUi
VHJXQGRV/DSDQWDOODGHOKRUQRPRVWUDUi
ODVXQLGDGHVVXSHUILFLDOHV$VHJ~UHVHGHTXH
´/RF2Q/RF´%ORTXHR(QFHQGLGR
WRGRVORVFRQWUROHVGHODXQLGDGVXSHUILFLDOHVWpQ
3DUDGHVEORTXHDUHOFRQWUROPDQWHQJD
DSDJDGRVDOXVDU5DQJH/RFNRXW%ORTXHRGH
SUHVLRQDGDODWHFOD&RQWURO/RFNRXW%ORTXHR
OD&RFLQD&XDOTXLHUXQLGDGVXSHUILFLDOTXH
GHO&RQWUROR5DQJH/RFNRXW%ORTXHRGHOD
HVWpFRQILJXUDGDHQODSRVLFLyQ´HQFHQGLGRµ
&RFLQDSRUVHJXQGRV/DSDQWDOODGHOKRUQR
PLHQWUDVTXH5DQJH/RFNRXW%ORTXHRGHOD
PRVWUDUi´/RF2))/RF´%ORTXHR$SDJDGR
&RFLQDHVWpDFWLYDGRVHHQFHQGHUiGHIRUPD
&XDQGRHVWDIXQFLyQHVWpHQFHQGLGDODVWHFODV
DXWRPiWLFDXQDYH]TXH5DQJH/RFNRXW
WiFWLOHVQRUHVSRQGHUiQH[FHSWRODWHFOD&OHDU
%ORTXHRGHOD&RFLQDHVWpGHVDFWLYDGR
2II%RUUDU$SDJDU
■/RVDMXVWHVVHJXDUGDUiQHQODPHPRULD
OXHJRGHXQFRUWHGHFRUULHQWH
&yPRXVDUHOKRUQR
3DUDHYLWDUSRVLEOHVTXHPDGXUDVFRORTXHODVEDQGHMDVHQODSRVLFLyQGHVHDGDDQWHVGHHQFHQGHUHOKRUQR
$QWHVGHFRPHQ]DU«
/DFDQWLGDGGHSRVLFLRQHV
GHODEDQGHMDSXHGHYDULDUHQ
UHODFLyQDOPRGHOR
/DVEDQGHMDVWLHQHQWRSHVGHPRGRTXH
FXDQGRVHODVFRORFDFRUUHFWDPHQWHHQORV
VRSRUWHVVHGHWHQGUiQDQWHVGHVDOLUVHGHOWRGR
\QRVHYROFDUiQ
&XDQGRFRORTXHRTXLWHUHFLSLHQWHVGHFRFFLyQ
WLUHGHODEDQGHMDKDVWDTXHVHGHWHQJD
(QDOJXQRVPRGHORVHOHOHPHQWRFDOHQWDGRU
SDUDKRUQHDGRVHHQFXHQWUDGHEDMRGHOSLVRGHO
KRUQR1XQFDFRORTXHXWHQVLOLRVGHFRFLQD
SLHGUDVSDUDSL]]DQLRWURVDUWtFXORVHQHO
SLVRGHOKRUQR
3DUDTXLWDUXQDEDQGHMDWLUHGHHOODLQFOLQHHO
H[WUHPRIURQWDOKDFLDDUULED\ViTXHOD
3DUDYROYHUDFRORFDUODGHSRVLWHHOH[WUHPR
GHODEDQGHMDWRSHVGHGHWHQFLyQVREUHHO
VRSRUWHLQFOLQHHOIUHQWHKDFLDDUULED\SUHVLRQH
ODEDQGHMDKDFLDDGHQWUR
35(&$8&,Ï1
&XDQGRXWLOLFHODEDQGHMDHQODSRVLFLyQPiV
EDMD$QHFHVLWDUiWHQHUFXLGDGRFXDQGROD
TXLWH5HFRPHQGDPRVTXHGHVOLFHODEDQGHMD
YDULDVSXOJDGDV\OXHJRXWLOL]DQGRGRV
DJDUUDGHUDVODTXLWHVRVWHQLHQGRGHDPERV
ODGRV/DEDQGHMDVHHQFXHQWUDPX\DEDMR\
XVWHGSXHGHTXHPDUVHVLFRORFDODPDQRHQOD
PLWDGGHODEDQGHMD\WLUDKDFLDDIXHUD7HQJD
PXFKRFXLGDGRGHQRTXHPDUVHODPDQRFRQOD
SXHUWDFXDQGRXWLOLFHODEDQGHMDHQODSRVLFLyQ
PiVEDMD$
1XQFDFRORTXHXWHQVLOLRVGH
FRFLQDSLHGUDVSDUDSL]]DQLRWURV
DUWtFXORVHQHOSLVRGHOKRUQR
3DUULOODGHH[WHQVLyQHQDOJXQRVPRGHORV
3RVLFLyQGH
DSHUWXUDWRWDO
5LHOIURQWDO
VXSHULRU
&XDQGRFRORTXHRTXLWHUHFLSLHQWHV
GHFRFFLyQVLHPSUHWLUHGHODSDUULOODKDFLD
DIXHUDGHVGHHOULHOIURQWDOVXSHULRUKDVWD
DOFDQ]DUODSRVLFLyQGHDSHUWXUDWRWDO
1RH[WLHQGDODSDUULOODUiSLGDPHQWH/RV
DOLPHQWRVSXHGHQGHVOL]DUVHGHVGHHOIUHQWH
GHODSDUULOOD
3DUDTXLWDUODSDUULOOD
$VHJ~UHVHGHLQWURGXFLUODSDUULOODKDVWDHO
IRQGRGHOKRUQRGHPRGRTXHODVSDOHWDV
ODWHUDOHVGHODUPD]yQGHODSDUULOODVH
GHVHQJDQFKHQGHODFDYLGDG
'HVOLFHODSDUULOODKDFLDXVWHGKDVWDTXH
OOHJXHDOWRSHSRVLFLyQGHWHQLGDGHO
VRSRUWHGHODSDUULOOD
,QFOLQHHOH[WUHPRIURQWDOKDFLDDUULED\
TXtWHOR
*UDVSKHUH
127$&XDQGRPDQLSXOHODSDUULOODGH
H[WHQVLyQQRSHUPLWDTXHODSRUFLyQ
GHVOL]DEOHVHDEUD(VWRSXHGHGDxDUORV
GHVOL]DGRUHV
3DUDYROYHUDFRORFDUODSDUULOOD
7RPHILUPHPHQWHDPERVODGRVGHO
DUPD]yQGHODSDUULOOD\ODSDUULOOD
GHVOL]DEOH
&RORTXHHOH[WUHPRFXUYRGHOHVWDQWHHQOD
SRVLFLyQGHVHDGDLQFOLQHHOIUHQWHKDFLD
DUULED\SUHVLRQHODSDUULOODKDFLDDGHQWUR
35(&$8&,Ï1
1XQFDXWLOLFHODSDUULOODFXDQGRVXDUPD]yQ
QRVHHQFXHQWUDFRPSOHWDPHQWHLQWURGXFLGR
HQHOKRUQR\WUDEDGRHQVXSRVLFLyQ
„&XDQGRODSDUULOODVHHQFXHQWUDELHQLQVWDODGD
\WUDEDGDHQVXOXJDUODVSDOHWDVODWHUDOHVGH
EORTXHRGHODUPD]yQGHODSDUULOODVHWUDEDUiQ
HQVXOXJDUHQORVVRSRUWHVGHOKRUQR6L
ODVSDOHWDVODWHUDOHVQRVHWUDEDURQHQVX
SRVLFLyQUHSLWDORVSDVRVDQWHULRUHV\YHULILTXH
TXHODVSDOHWDVODWHUDOHVVHKD\DQOLPSLDGR
\OXEULFDGRFRUUHFWDPHQWH9HU3DUULOODGH
H[WHQVLyQHQODVHFFLyQ&XLGDGR\OLPSLH]D
*($SSOLDQFHVFRP
3DSHOGHDOXPLQLR
1RXVHSDSHOGHDOXPLQLRSDUDFXEULUHOIRQGR
GHOKRUQR(ODOXPLQLRDWUDSDUiHOFDORUHQOD
SDUWHLQIHULRU\DOWHUDUiHOIXQFLRQDPLHQWRGHO
KRUQR(ODOXPLQLRVHSXHGHGHUUHWLU\GDxDU
GHIRUPDSHUPDQHQWHHOIRQGRGHOKRUQR
&XDOTXLHUGDxRSRUXVRLQDGHFXDGRGHO
DOXPLQLRQRHVWDUiFXELHUWRSRUODJDUDQWtDGHO
SURGXFWR
(ODOXPLQLRVHSXHGHXVDUSDUDUHWHQHUGHUUDPHV
FRORFDQGRXQDKRMDHQHOHVWDQWHLQIHULRUYDULDV
SXOJDGDVSRUGHEDMRGHODFRPLGD1RXVH
PiVDOXPLQLRTXHHOQHFHVDULR\QXQFDFXEUD
WRWDOPHQWHXQHVWDQWHGHOKRUQRFRQSDSHOGH
DOXPLQLR0DQWHQJDHODOXPLQLRSRUORPHQRVD
XQDSXOJDGD\PHGLDGHODVSDUHGHVGHOKRUQR
SDUDHYLWDUXQDPDODFLUFXODFLyQGHOFDORU
3UHFDOHQWDPLHQWR\FRORFDFLyQGHUHFLSLHQWH
3DUDHYLWDUSRVLEOHVTXHPDGXUDVFRORTXH
ODVEDQGHMDVHQODSRVLFLyQGHVHDGDDQWHVGH
HQFHQGHUHOKRUQR
3UHFDOLHQWHGHOKRUQRVLDVtORLQGLFDODUHFHWD
(OSUHFDOHQWDPLHQWRHVQHFHVDULRSDUDREWHQHU
EXHQRVUHVXOWDGRVFXDQGRKRUQHHSDVWHOHV
JDOOHWDVSDVWHOLWRV\SDQHV
6LYDDKRUQHDUFXDWURFDSDVGHSDVWHODOPLVPR
WLHPSRFRORTXHGRVFDSDVHQODEDQGHMD&\GRV
FDSDVHQODEDQGHMD('LVWULEX\DORVUHFLSLHQWHV
GHPRGRTXHQRTXHGHQGLUHFWDPHQWHXQR
HQFLPDGHORWUR
/RVUHVXOWDGRVGHKRUQHDGRVHUiQPHMRUHVVL
ORVDOLPHQWRVVHFHQWUDQELHQGHQWURGHOKRUQR
(OSDVWHO´$QJHOIRRGµHVODH[FHSFLyQ\GHEH
FRORFDUVHHQODEDQGHMDLQIHULRUGHOKRUQRSRVLFLyQ
$6LJDODVLQVWUXFFLRQHVGHOSDTXHWHGHDOLPHQWRV
SUHHPSDTXHWDGRVRFRQJHODGRVSDUDODXELFDFLyQ
GHORVUHFLSLHQWHV/RVUHFLSLHQWHVQRGHEHQWRFDUVH
HQWUHVtRWRFDUODVSDUHGHVGHOKRUQR6LQHFHVLWD
XWLOL]DUGRVEDQGHMDVGLVWULEX\DORVUHFLSLHQWHVGH
PRGRTXHQRTXHGHQGLUHFWDPHQWHXQRHQFLPD
GHORWUR'HMHDSUR[LPDGDPHQWHøsFPHQWUH
UHFLSLHQWHV\GHVGHHOIUHQWHSDUWHWUDVHUD\ODGRVGH
ODVSDUHGHVGHOKRUQR
&yPRFRQILJXUDUHOKRUQRSDUDKRUQHDGRRURVWL]DGR
3UHVLRQHHOERWyQ%$.(KRUQHDU
3UHVLRQHODVDOPRKDGLOODVQXPpULFDVKDVWD
TXHDSDUH]FDODWHPSHUDWXUDGHVHDGD
3UHVLRQHHOERWyQ67$57LQLFLDU
(OKRUQRVHLQLFLDUiDXWRPiWLFDPHQWH/D
SDQWDOODPRVWUDUi3U(PLHQWUDVUHDOL]DHO
SUHFDOHQWDPLHQWR&XDQGRHOKRUQRDOFDQ]DOD
WHPSHUDWXUDVHOHFFLRQDGDHOFRQWUROGHOKRUQR
HPLWLUiYDULRVSLWLGRV\ODSDQWDOODPRVWUDUiOD
WHPSHUDWXUDGHOKRUQR
127$ 8VWHGHVFXFKDUiHOYHQWLODGRU
GHFRQYHFFLyQHQDOJXQRVPRGHORVPLHQWUDVHO
KRUQRUHDOL]DHOSUHFDOHQWDPLHQWR
(OYHQWLODGRUVHGHWHQGUiFXDQGRHOKRUQRVH
KD\DSUHFDOHQWDGR\ODSDQWDOODPRVWUDUiOD
WHPSHUDWXUDFRQILJXUDGD(VWRHVQRUPDO
3DUDFDPELDUODWHPSHUDWXUDGHOKRUQRGXUDQWHHO
FLFOR%$.(KRUQHDUSUHVLRQHHOERWyQ%$.(
\OXHJRODVDOPRKDGLOODVQXPpULFDVSDUDFRQILJXUDU
ODQXHYDWHPSHUDWXUD
9HULILTXHHOQLYHOGHFRFFLyQGHORVDOLPHQWRV
FXDQGRKD\DDOFDQ]DGRHOWLHPSRPtQLPR
LQGLFDGRHQODUHFHWD&RFtQHORVPiVVLIXHVH
QHFHVDULR
3UHVLRQHHOERWyQ&/($52))ERUUDU
DSDJDGRFXDQGRVHKD\DILQDOL]DGRHO
KRUQHDGR\OXHJRTXLWHORVDOLPHQWRVGHO
KRUQR
*XtDSDUD'RUDU
&DUQHV
%LIH
$VDGRGH&RVWLOODDOE
'HVKXHVDGD\&RQ+XHVRV
-XJRVR
$3XQWR
7HPSHUDWXUD
GHO+RUQR
Û)
Û)
7HPSHUDWXUD
,QWHULRU
Û)
Û)
%LIHGH/RPRDOE
-XJRVR
Û)
Û)
%LIHGH/RPRDOE
-XJRVR
Û)
Û)
&HUGR
&RQ+XHVRV'HVKXHVDGDD/EV
Û)
Û)
&RUGHUR &RQ+XHVRVD/EV
$3XQWR Û)
Û)
'HVKXHVDGDDOE
$3XQWR Û)
Û)
$YH
3ROOR(QWHURDOE
Û)
Û)
3DYR(QWHUR
Û)
6LQ5HOOHQRDOE
Û)
6LQ5HOOHQRDOE
Û)
Û)
3HFKXJDGH3DYRDOE
Û)
Û)
/DVDYHVFRQSOXPDVJHQHUDOPHQWHUHTXLHUHQGHXQWLHPSRGHDVDGRDGLFLRQDOGHDPLQXWRV&XEUD
ODVSDWDV\ODSHFKXJDFRQSDSHOGHDOXPLQLRSDUDHYLWDUXQGRUDGRH[FHVLYR\TXHVHVHTXHODSLHO
&yPRXVDUHOKRUQR
&yPRFRQILJXUDUHOKRUQRSDUDDVDU
6LVXFRFLQDHVWiFRQHFWDGDDYROWLRV
SXHGHQDVDUVHILOHWHVMXJRVRVSUHFDOHQWDQGRHO
DVDGRU\FRORFDQGRODEDQGHMDGHOKRUQRHQ
XQDSRVLFLyQPiVHOHYDGD
8WLOLFH/2%URLODVDUEDMRSDUDFRFLQDUSRU
FRPSOHWRDOLPHQWRVFRPRDYHVRFRUWHV
JUXHVRVGHFDUQHVLQGRUDUORVGHPiV
'HMHODSXHUWDDELHUWDHQODSRVLFLyQ
GHGHWHQFLyQGHDVDGR/DSXHUWD
TXHGDDELHUWD\D~QDVtVH
PDQWLHQHODWHPSHUDWXUDDGHFXDGD
HQHOKRUQR
&RORTXHODFDUQHRSHVFDGRVREUHXQD
DVDGHUDGHQWURGHXQDUHMLOODGLVHxDGD
SDUDDVDU
3UHVLRQHHOERWyQ%52,/+,/2DVDUDOWR
EDMRXQDYH]SDUDFRQILJXUDU+,%URLO
DVDUDOWR
3DUDFDPELDUD/2%URLODVDUEDMR
SUHVLRQHHOERWyQ%52,/+,/2DVDUDOWR
EDMRGHQXHYR
3UHVLRQHHOERWyQ67$57LQLFLDU
&XDQGRKD\DILQDOL]DGRGHDVDUSUHVLRQH
HOERWyQ&/($52))ERUUDUDSDJDGR
6LJDODVSRVLFLRQHVGHODVEDQGHMDV
VXJHULGDVHQOD*XtDGHDVDGR
*XtDGHDVDGR
(OWDPDxRSHVRJURVRU
WHPSHUDWXUDLQLFLDO\
HOSXQWRGHFRFFLyQSUHIHULGR
DIHFWDUiQORVWLHPSRV
GHDVDGR(VWDJXtDHVWi
EDVDGDHQFDUQHVD
WHPSHUDWXUDGHUHIULJHUDGRU
‚(O0LQLVWHULRGH$JULFXOWXUDGH
ORV((88DILUPD´ODFDUQHGH
UHVMXJRVDHVSRSXODUSHURGHEH
VDEHUVHTXHDOFRFLQDUODDVyOR
ƒ)ƒ&DOJXQRVRUJDQLVPRV
TXHSURYRFDQLQWR[LFDFLyQ
DOLPHQWDULDSXHGHQVREUHYLYLUµ
)XHQWH6DIH)RRG%RRN<RXU
.LWFKHQ*XLGH86'$5HY
-XQLR
3UHFDOLHQWHODDVDGHUDGXUDQWHPLQXWRVSDUDPHMRUDUHOGHVHPSHxR
$OLPHQWR
1LYHO
GHFRFFLyQ
&DUQHGHUHV
-XJRVD
ƒ)ƒ&
$SXQWR
ƒ)ƒ&
%LHQFRFLGD
ƒ)ƒ&
7LSRRJURVRU
3RVLFLyQ
GHODEDQGHMD
&RPHQWDULRV
)LOHWHV²
(R)ORVDOLPHQWRV (VGLItFLOFRFLQDUILOHWHVGHPHQRV
*URVRUGHµFP
GHEHQHVWDUµDµ
GHODµFPGHJURVRU\TXH
>[email protected]
TXHGHQMXJRVRV6HFRFLQDQ
HOHPHQWRGHDVDGR
SRUFRPSOHWRDQWHVGHGRUDUVH
FRFLQDQSRUFRPSOHWR )LOHWHV²
(ORVDOLPHQWRVGHEHQ 3DUDHYLWDUTXHODFDUQD
µDµFPD
HVWDUGHµDµ
VHHQURVTXHFRUWHODJUDVDDVH
FPGHJURVRU
>[email protected]
HQURVTXHLQWHUYDORVGHµFP
HOHPHQWRGHDVDGR
)LOHWHV²
'R(ORVDOLPHQWRV µDµFPD
GHEHQHVWDUGHµDµ FPGHJURVRUR
>[email protected] SDWWLHVGHFDUQHSLFDGD HOHPHQWRGHDVDGR
3ROOR
3HFKXJDVLQKXHVR
3HFKXJDFRQKXHVR
&ORVDOLPHQWRVGHEHQ
HVWDUGHµDµ
>[email protected]
HOHPHQWRGHDVDGR
&ORVDOLPHQWRVGHEHQ
HVWDUGHµDµ
>[email protected]
HOHPHQWRGHDVDGR
$VDUVREUHHOODGRGHODSLHO
SULPHUR
)LOHWHVGH
SHVFDGR
µDµFPD
FPGHJURVRU
'R(ORVDOLPHQWRV
GHEHQHVWDUµDµ
>[email protected]
HOHPHQWRGHDVDGR
0DQLSXOH\JLUHFRQ
PXFKRFXLGDGR
&KXOHWDV
GHFHUGR
%LHQFRFLGD
ƒ)ƒ&
µFP
GHJURVRU
'ORVDOLPHQWRVGHEHQ
HVWDUGHµDµ
>[email protected]
HOHPHQWRGHDVDGR
3DUDHYLWDUTXHODFDUQD
VHHQURVTXHFRUWH
ODJUDVDDLQWHUYDORV
GHµFP
8WLOLFHODSRVLFLyQGHEDQGHMD$SDUDHOKRUQRPiVSHTXHxRFRQSRVLFLyQGHEDQGHMDV
£$MXVWHHOWHUPRVWDWRGHOKRUQRXVWHGPLVPR
*($SSOLDQFHVFRP
(VSRVLEOHTXHVXQXHYRKRUQRFRFLQHGHPDQHUDGLIHUHQWHDODTXHXVWHGVHHQFXHQWUDDFRVWXPEUDGR8WLOtFHORGXUDQWH
DOJXQDVVHPDQDVSDUDIDPLOLDUL]DUVHFRQVXVIXQFLRQHV6LOXHJRGHHVWHSHUtRGRFRQVLGHUDTXHODWHPSHUDWXUDGHOKRUQR
HVGHPDVLDGREDMDRGHPDVLDGRDOWDXVWHGSXHGHUHJXODUHOWHUPRVWDWR
1RXWLOLFHWHUPyPHWURVFRPRORVTXHVHYHQGHQHQODVWLHQGDVSDUDYHULILFDUODFRQILJXUDFLyQGHWHPSHUDWXUDGHOKRUQR
(VRVWHUPyPHWURVSXHGHQYDULDUHQWUH²JUDGRV
127$(VWHDMXVWHVyORDIHFWDODVWHPSHUDWXUDVGHKRUQHDGR\URVWL]DGRQRDIHFWDODVWHPSHUDWXUDVGHDVDGRR
GHDXWROLPSLH]D(ODMXVWHVHFRQVHUYDUiHQODPHPRULDD~QGHVSXpVGHXQFRUWHGHHQHUJtD
&yPRDMXVWDUHOWHUPRVWDWR
3UHVLRQHORVERWRQHV%52,/+,/2DVDU
DOWREDMR\%$.(KRUQHDUDOPLVPR
WLHPSRKDVWDTXHHQODSDQWDOODSXHGD
YHUVH6)
3UHVLRQHODWHFOD%$.(+RUQHDU(QOD
SDQWDOODVHPXHVWUDXQQ~PHUR
+RUQRV'REOHV3DUDDMXVWDUHOWHUPRVWDWR
GHOKRUQRVXSHULRUSUHVLRQHODWHFOD%$.(
+RUQHDUGHOKRUQRVXSHULRU3DUDDMXVWDU
HOWHUPRVWDWRGHOKRUQRLQIHULRUSUHVLRQHOD
WHFOD%$.(+RUQHDUGHOKRUQRLQIHULRU
/DWHPSHUDWXUDGHOKRUQRSXHGHVXELUVH
HQž)ƒ&REDMDUVHHQž)
ƒ&3UHVLRQHODVDOPRKDGLOODVQXPpULFDV
GHODPLVPDPDQHUDHQTXHODVOHH3RU
HMHPSORSDUDFDPELDUODWHPSHUDWXUDGHO
KRUQRž)ƒ&SUHVLRQH\
3UHVLRQHODWHFOD%$.(+RUQHDU
QXHYDPHQWHSDUDDOWHUQDUHQWUH
LQFUHPHQWDU\UHGXFLUODWHPSHUDWXUDGHO
KRUQR
&XDQGRKD\DILQDOL]DGRHODMXVWHSUHVLRQH
HOERWyQ67$57LQLFLDUSDUDYROYHUDOD
SDQWDOODGHODKRUD8WLOLFHHOKRUQRGHOD
PDQHUDQRUPDO
£(OWLSRGHPDUJDULQDXWLOL]DGRPRGLILFDHOKRUQHDGR
/DPD\RUtDGHODVUHFHWDVGHKRUQHDGRLQFOX\HQSURGXFWRVGHDOWRFRQWHQLGRJUDVRWDOHVFRPRODPDQWHFDRODPDUJDULQD
GHJUDVD6LVHUHGXFHHOFRQWHQLGRGHJUDVDHOUHVXOWDGRILQDOSXHGHVHUGLIHUHQWHDOHVSHUDGR
6LVHXWLOL]DQSURGXFWRVGHEDMRFRQWHQLGRJUDVRHQWRUWDVSDVWHOHVPDVDVJDOOHWDVRGXOFHVODUHFHWDSXHGHIUDFDVDU$
PHQRUFRQWHQLGRJUDVRPD\RUHVGLIHUHQFLDVHQHOUHVXOWDGRILQDO
/DVQRUPDVIHGHUDOHVH[LJHQTXHORVSURGXFWRVFRQGHQRPLQDFLyQGH´PDUJDULQDµWHQJDQXQFRQWHQLGRJUDVRGHDOPHQRV
HQUHODFLyQDOSHVR/RVSURGXFWRVGHEDMRFRQWHQLGRJUDVRFRQWLHQHQPHQRVJUDVD\PiVDJXD(OHOHYDGRFRQWHQLGRGHKXPHGDG
GHHVWRVSURGXFWRVDIHFWDODWH[WXUD\HOVDERUGHORVDOLPHQWRVKRUQHDGRV3DUDREWHQHUORVPHMRUHVUHVXOWDGRVFRQVXVUHFHWDV
WUDGLFLRQDOHVIDYRULWDVXWLOLFHPDUJDULQDXRWURVSURGXFWRVFRQXQFRQWHQLGRGHSRUORPHQRVGHDFHLWHYHJHWDO
&yPRXVDUHOKRUQRGHFRQYHFFLyQHQDOJXQRVPRGHORV
)XQFLRQDPLHQWRGHOYHQWLODGRUGHFRQYHFFLyQ
(QXQKRUQRGHFRQYHFFLyQXQYHQWLODGRU
KDFHFLUFXODUDLUHFDOLHQWHVREUHSRUGHEDMR\
DOUHGHGRUGHORVDOLPHQWRV
(VWDFLUFXODFLyQGHDLUHFDOLHQWHVHGLVWULEX\HGH
PDQHUDSDUHMDDWUDYpVGHODFDYLGDGGHOKRUQR
&RPRUHVXOWDGRORVDOLPHQWRVVHFRFLQDQ\
GRUDQHQIRUPDSDUHMDDPHQXGRHQPHQRV
WLHPSR
127$(QDOJXQRVPRGHORVHOYHQWLODGRUIXH
GLVHxDGRSDUDJLUDUHQDPEDVGLUHFFLRQHVFRQ
XQDSDXVDLQWHUPHGLD(VWRHVQRUPDO
(OYHQWLODGRUGHFRQYHFFLyQVHDSDJDFXDQGR
VHDEUHODSXHUWDGHKRUQR12'(-(ODSXHUWD
DELHUWDGXUDQWHSHUtRGRVSURORQJDGRVPLHQWUDV
XWLOL]DODFRFFLyQSRUFRQYHFFLyQ\DTXHSXHGH
DFRUWDUODYLGD~WLOGHOHOHPHQWRFDOHQWDGRUGH
FRQYHFFLyQ
&RFFLyQSRUFRQYHFFLyQHQDOJXQRVPRGHORV
(OKRUQRGHFRQYHFFLyQYLHQHFRQXQPRGR
GHFRFFLyQSRUFRQYHFFLyQ\SXHGHXWLOL]DUVH
SDUDKRUQHDGRSRUFRQYHFFLyQGHEDQGHMD
XKRUQHDGRSRUFRQYHFFLyQFRQEDQGHMDV
P~OWLSOHV
+RUQHDGRSRUFRQYHFFLyQFRQEDQGHMDVP~OWLSOHV
3RVLFLyQGHEDQGHMDVP~OWLSOHV
'HELGRDTXHHODLUHFDOLHQWHFLUFXODHQIRUPD
SDUHMDHQWRGRHOKRUQRORVDOLPHQWRVSXHGHQ
KRUQHDUVHFRQH[FHOHQWHVUHVXOWDGRVXVDQGR
EDQGHMDVP~OWLSOHV
(OKRUQHDGRFRQEDQGHMDVP~OWLSOHVSXHGH
LQFUHPHQWDUXQSRFRORVWLHPSRVGHFRFFLyQ
GHDOJXQRVDOLPHQWRVSHURHOUHVXOWDGRWRWDO
HVHODKRUURGHWLHPSR/DVJDOOHWDVPXIILQV
EL]FRFKRV\RWURVSDQHVUiSLGRVORJUDQ
UHVXOWDGRVPX\EXHQRVFRQHOKRUQHDGRFRQ
EDQGHMDVP~OWLSOHV
&XDQGRKRUQHHFRQEDQGHMDVFRORTXHXQD
HQODVHJXQGD%SRVLFLyQRWUDHQODFXDUWD'
SRVLFLyQ\ODWHUFHUDHQODVH[WD)SRVLFLyQ
3DUDKRUQHDGRFRQGRVEDQGHMDVFRORTXH
XQDHQODVHJXQGD%SRVLFLyQ&RORTXHODRWUD
EDQGHMDHQODTXLWD(SRVLFLyQ
+RUQHDGRSRUFRQYHFFLyQFRQEDQGHMDHQDOJXQRVPRGHORV
&XDQGRUHDOLFHXQKRUQHDGRSRUFRQYHFFLyQ
FRQVyOREDQGHMDFRORTXHORVDOLPHQWRVHQHO
FHQWURGHOKRUQR
&yPRFRQILJXUDUHOKRUQRSDUDKRUQHDGRSRUFRQYHFFLyQ
3UHVLRQHODWHFOD&219(&7,21&22.
&RFFLyQSRU&RQYHFFLyQSDUDXWLOL]DUHVWD
IXQFLyQ
3UHVLRQHODVDOPRKDGLOODVQXPpULFDVSDUD
FRQILJXUDUODWHPSHUDWXUDGHOKRUQR
3UHVLRQHHOERWyQ67$57LQLFLDU
127$6LOD)XQFLyQGH&RQYHUVLyQ$XWR5HFLSHŒ
VHHQFXHQWUDDFWLYDGDDXWRPiWLFDPHQWH
UHGXFLUiODWHPSHUDWXUDGHKRUQHDGRUHJXODUHQ
DSUR[LPDGDPHQWHž)KDVWDODWHPSHUDWXUD
GHFRQYHFFLyQDSURSLDGDHQHOPRGRGH
KRUQHDGRSRUFRQYHFFLyQ/HD&RQYHUVLyQFRQ
$XWR5HFLSHŒHQODVHFFLyQGH&DUDFWHUtVWLFDV
(VSHFLDOHV
3DUDFDPELDUODWHPSHUDWXUDGHOKRUQRSUHVLRQH
HOERWyQ&219(&7,21&22.\OXHJRODV
DOPRKDGLOODVQXPpULFDVSDUDFRQILJXUDUODQXHYD
WHPSHUDWXUD
&XDQGRHOKRUQRFRPLHQ]DDFDOHQWDUSRGUi
YHUVHODWHPSHUDWXUDFDPELDQWHFRPHQ]DQGR
Dƒ)ƒ&&XDQGRHOKRUQRDOFDQ]DOD
WHPSHUDWXUDFRQILJXUDGDVRQDUiQSLWLGRV
3UHVLRQHHOERWyQ&/($52))ERUUDU
DSDJDGRFXDQGRKD\DILQDOL]DGR
„0LHQWUDVFRFLQHSRUFRQYHFFLyQVHRLUi
XQYHQWLODGRU(OYHQWLODGRUVHGHWHQGUi
FXDQGRVHDEUDODSXHUWDSHURHOFDORU
QRVHDSDJDUi
„'XUDQWHHOKRUQHDGRSXHGHQHVFXFKDUVH
FKDVTXLGRVSURYHQLHQWHVGHOKRUQR
(VWRHVQRUPDO
*($SSOLDQFHVFRP
5HFLSLHQWHVSDUDFRFFLyQSRUFRQYHFFLyQ
&XDQGRKRUQHHJDOOHWDVREWHQGUi
PHMRUHVUHVXOWDGRVVLXVDXQD
SODQFKDSODQDSDUDJDOOHWDVHQ
OXJDUGHXQUHFLSLHQWHGHODGRV
EDMRV
$QWHVGHXWLOL]DUHOKRUQRGHFRQYHFFLyQYHULILTXH
TXHVXVHOHPHQWRVGHFRFFLyQGHMHQHVSDFLR
VXILFLHQWHSDUDODFLUFXODFLyQGHDLUHHQHOKRUQR
6LYDDKRUQHDUFRQYDULRVUHFLSLHQWHVGHMHXQ
HVSDFLRHQWUHHOORV$GHPiVDVHJ~UHVHGHTXH
ORVUHFLSLHQWHVQRVHWRTXHQHQWUHVtRWRTXHQODV
SDUHGHVGHOKRUQR
3DSHO\SOiVWLFR
/RVUHFLSLHQWHVGHSDSHO\SOiVWLFRUHVLVWHQWHV
DOFDORUUHFRPHQGDGRVSDUDXWLOL]DUHQ
KRUQHDGRQRUPDOWDPELpQSXHGHQXWLOL]DUVH
SDUDKRUQHDGRSRUFRQYHFFLyQSHURQRGHEHQ
XWLOL]DUVHDWHPSHUDWXUDVPiVHOHYDGDVTXHOD
WHPSHUDWXUDUHFRPHQGDGDSRUHOIDEULFDQWH
GHORVHOHPHQWRVGHFRFFLyQ7DPELpQSXHGHQ
XWLOL]DUVHHOHPHQWRVGHFRFFLyQSOiVWLFRV
UHVLVWHQWHVDWHPSHUDWXUDVGHƒ)ƒ&
0HWDO\YLGULR
&XDOTXLHUWLSRGHUHFLSLHQWHGHFRFFLyQIXQFLRQD
HQVXKRUQRGHFRQYHFFLyQVLQHPEDUJR
ORVUHFLSLHQWHVGHPHWDOVHFDOLHQWDQPiV
UiSLGDPHQWH\VHUHFRPLHQGDQSDUDKRUQHDGR
SRUFRQYHFFLyQ
„/DVEDQGHMDVRVFXUDVRFRQDFDEDGRPDWH
KRUQHDQDOLPHQWRVPiVUiSLGRTXHODV
EULOODQWHV
„/RVUHFLSLHQWHVGHYLGULRRFHUiPLFDFRFLQDQ
PiVGHVSDFLR
3DUDUHFHWDVFRPRSROORKRUQHDGRXWLOLFHXQ
UHFLSLHQWHFRQODGRVEDMRV(ODLUHFDOLHQWHQRSXHGH
FLUFXODUELHQDOUHGHGRUGHORVDOLPHQWRVHQXQ
UHFLSLHQWHGHODGRVDOWRV
&RQODIXQFLyQGHODSL]]DHQDOJXQRVPRGHORV
&yPRFRQILJXUDUHOKRUQRVXSHULRUSDUDSL]]DHQDOJXQRVPRGHORV
$MXVWHODSRVLFLyQGHODEDQGHMDSDUDHOWLSRGH
UHFLSLHQWHSDUDSL]]DTXHVHHVWiXVDQGRYHUWDEOD
3UHVLRQHHOERWyQ3,==$
3UHVLRQHODVDOPRKDGLOODVQXPpULFDVSDUD
VHOHFFLRQDUSDUDSL]]DFRQJHODGD\SDUD
SL]]DIUHVFD
3UHVLRQHODVDOPRKDGLOODVQXPpULFDVSDUD
FRQILJXUDUODWHPSHUDWXUDGHKRUQHDGR
3UHVLRQHHOERWyQ67$57LQLFLDU
(OWLHPSRGHKRUQHDGRHVWiGHWHUPLQDGR
SRUODVLQVWUXFFLRQHVGHOSDTXHWH
7LSRGHUHFLSLHQWH
GHSL]]D
5HFLSLHQWHFRQSL]]DIUHVFD
3L]]DFRORFDGDGLUHFWDPHQWH
VREUHODEDQGHMD
5HFLSLHQWHGHPHWDO
3RVLFLyQGH
ODEDQGHMD
%
%
$
&yPRXVDUODVRQGDHQDOJXQRVPRGHORV
(QPXFKRVDOLPHQWRVHVSHFLDOPHQWHDVDGRV\FDUQHVGHDYHODWHPSHUDWXUDLQWHUQDGHORVDOLPHQWRVHVODPHMRUSUXHEDSDUD
YHULILFDUHOJUDGRGHFRFFLyQ0HGLDQWHODVRQGDGHWHPSHUDWXUDVHHYLWDWHQHUTXHDGLYLQDUHOJUDGRGHFRFFLyQ
\VHORJUDHOSXQWRGHFRFFLyQH[DFWR
&DEOH
(QFKXIH
35(&$8&,Ï1
3DUDHYLWDUTXHPDGXUDVQRGHVHQFKXIHODVRQGDGH
ODERFDGHVDOLGDGHOKRUQRKDVWDTXHpVWHVHKD\D
HQIULDGR
(OXVRGHVRQGDVGLVWLQWDVDODVSURYLVWDVFRQHVWH
SURGXFWRSXHGHSURYRFDUOHVGDxRVDODVPLVPDVRDO
FRQWUROGHOKRUQR
/DVRQGDGHWHPSHUDWXUDFXHQWD
FRQXQDVRQGDVLPLODUDXQSLQFKR
HQXQH[WUHPR\XQHQFKXIHHQHO
RWURH[WUHPRTXHVHLQWURGXFHHQ
ODERFDGHVDOLGDGHOKRUQR
8WLOLFHODVPDQLMDVGHODVRQGD\HOHQFKXIHFXDQGR
ODVLQWURGX]FD\TXLWHGHORVDOLPHQWRV\GHODERFD
GHVDOLGD
„
3DUDHYLWDUGDxRVDODVRQGDQRXWLOLFHSLQ]DVSDUD
WLUDUGHOFDEOHFXDQGRORTXLWH
„
3DUDQRURPSHUODVRQGDYHULILTXHTXHORV
DOLPHQWRVHVWpQWRWDOPHQWHGHVFRQJHODGRVDQWHV
GHLQWURGXFLUOD
'HVSXpVGHSUHSDUDUODFDUQH\FRORFDUODHQXQ
SRVDIXHQWHVRVREUHODUHMLOODGHODDVDGHUDVLJDHVWDV
LQVWUXFFLRQHVSDUDXQDFRORFDFLyQDGHFXDGDGHOD
VRQGD
,QWURGX]FDODVRQGDFRPSOHWDPHQWHHQODFDUQH1R
GHEHWRFDUKXHVRJUDVDRFDUWtODJR
0DQLMDV 6RQGD
/HD\TXLWHODHWLTXHWD
„
1XQFDGHMHODVRQGDGHQWURGHOKRUQRGXUDQWHXQ
FLFORGHDXWROLPSLH]DRGHDVDGR
„
1RJXDUGHODVRQGDGHQWURGHOKRUQR
3DUDDVDGRVVLQKXHVRLQWURGX]FDODVRQGDGHQWUR
GHODSDUWHPiVFDUQRVD3DUDMDPyQRFRUGHURFRQ
KXHVRLQWURGX]FDODVRQGDHQHOFHQWURGHOP~VFXOR
JUDQGHPiVEDMR
,QWURGX]FDODVRQGDHQHOFHQWURGHSODWRVWDOHV
FRPRSDQGHFDUQHRHVWRIDGRV
,QWURGX]FDODVRQGDGHQWURGHODSDUWHPiVFDUQRVD
GHOPXVORLQWHUQRGHVGHDEDMR\HQIRUPDSDUDOHODD
ODSDWDGHXQSDYRHQWHUR
127$1RVHSRGUiQXWLOL]DUODVFRQILJXUDFLRQHVGH
DXWROLPSLH]DQLGHDVDGRVLODVRQGDGHWHPSHUDWXUD
VHHQFXHQWUDHQFKXIDGD
127$1RLQVHUWDUSRUFRPSOHWRODVRQGDGHQWURGHOD
FDUQHSXHGHSURYRFDUXQSREUHGHVHPSHxRGHFRFFLyQ
SRUTXHODVRQGDGHWHFWDUiHODLUHGHOKRUQR\QROD
WHPSHUDWXUDGHORVDOLPHQWRV
&yPRFRQILJXUDUHOKRUQRSDUDKRUQHDGRURVWL]DGRFXDQGRXVDODVRQGD
HQDOJXQRVPRGHORV
,QWURGX]FDODVRQGDSRUFRPSOHWRHQORV
DOLPHQWRV
OR
(QFKXIHODVRQGDGHQWURGHODERFDGHVDOLGD
GHOKRUQR9HULILTXHTXHHVWpLQWURGXFLGDKDVWD
HOIRQGR&LHUUHODSXHUWDGHOKRUQR9HULILTXH
TXHHOFDEOHGHODVRQGDQRWRTXHHOHOHPHQWR
DVDGRU
3UHVLRQHHOERWyQ352%(VRQGD
/DSDQWDOODPRVWUDUi´6HW3UREH7HPSµ
7HPSHUDWXUDGHOD6RQGD
3UHVLRQHODVDOPRKDGLOODVQXPpULFDV
SDUDFRQILJXUDUODWHPSHUDWXUDLQWHUQD
GHVHDGDGHORVDOLPHQWRVRGHODFDUQH/D
WHPSHUDWXUDLQWHUQDPi[LPDDODTXHSXHGHQ
FRQILJXUDUVHORVDOLPHQWRVHVž)ƒ&
3UHVLRQHODWHFOD67$57,QLFLDU
3UHVLRQHODWHFOD%$.(+RUQHDUR
&219(&7,21&RQYHFFLyQ
3UHVLRQHODVDOPRKDGLOODVQXPpULFDVSDUD
FRQILJXUDUODWHPSHUDWXUDGHVHDGDGHOKRUQR
3UHVLRQHHOERWyQ67$57LQLFLDU
/DSDQWDOODGHVWHOODUiVLODVRQGDVHHQFXHQWUD
HQFKXIDGDGHQWURGHODERFDGHVDOLGD\XVWHGQRKD
FRQILJXUDGRXQDWHPSHUDWXUDGHVRQGD
\SUHVLRQDGRHOERWyQ67$57LQLFLDU
3UHVLRQHODWHFOD352%(6RQGDSDUDUHFRUGDUOD
WHPSHUDWXUDGHODVRQGDRODWHFOD%$.(+RUQHDU
R&219(&7,21&RQYHFFLyQSDUDUHFRUGDUOD
WHPSHUDWXUDGHOKRUQR3DUDODWHPSHUDWXUDGH
ODVRQGDOXHJRGHTXHODWHPSHUDWXUDLQWHUQDGH
ODFRPLGDDOFDQFHORVž)ORVFDPELRVGHOD
WHPSHUDWXUDLQWHUQDDSDUHFHUiQHQODSDQWDOOD
&XDQGRODWHPSHUDWXUDLQWHUQDGHORV
DOLPHQWRVDOFDQ]DODFLIUDTXHXVWHGKD
FRQILJXUDGRODVRQGD\HOKRUQRVHDSDJDQ\
ORVFRQWUROHVGHOKRUQRFRPLHQ]DQDGHVWHOODU
3DUDGHWHQHUHOGHVWHOORSUHVLRQHHOERWyQ
&/($52))ERUUDUDSDJDGR8WLOLFHJXDQWHV
GHFRFLQDSDUDTXLWDUODVRQGDGHORVDOLPHQWRV
1RXWLOLFHSLQ]DVSDUDTXLWDUODSRUTXHSRGUtDQ
GDxDUOD
„6LODVRQGDVHTXLWDGHOKRUQRPLHQWUDV
VHHVWDEDFRFLQDQGRHOKRUQRQRVHDSDJDUi
DXWRPiWLFDPHQWH
3DUDFDPELDUODWHPSHUDWXUDGHOKRUQRGXUDQWHHO
FLFORGHKRUQHDGRURVWL]DGRSUHVLRQHHOERWyQ%$.(
KRUQHDUR&219(&7,21FRQYHFFLyQ\OXHJRODV
DOPRKDGLOODVQXPpULFDVSDUDFRQILJXUDUODQXHYD
WHPSHUDWXUD
„3XHGHXWLOL]DUHOWHPSRUL]DGRUGHFRFLQDDXQTXH
QRSXHGHQXVDUVHRSHUDFLRQHV
GHOKRUQRFRQWHPSRUL]DGRUPLHQWUDVVHXWLOLFHOD
VRQGD
&yPRXWLOL]DUODVFDUDFWHUtVWLFDVGHKRUQHDGR
\URVWL]DGRFRQWHPSRUL]DGRUHQDOJXQRVPRGHORV
*($SSOLDQFHVFRP
127$/RVDOLPHQWRVTXHVHHFKDQDSHUGHUFRQIDFLOLGDG³FRPROHFKHKXHYRVSHVFDGRUHOOHQRVFDUQHGHDYH\FHUGR³QRGHEHQ
GHMDUVHUHSRVDUSRUPiVGHKRUDDQWHV\GHVSXpVGHODFRFFLyQ/DWHPSHUDWXUDDPELHQWHSURPXHYHHOFUHFLPLHQWRGHEDFWHULDV
GDxLQDV9HULILTXHTXHODOX]GHOKRUQRHVWpDSDJDGDSRUTXHHOFDORUSURYHQLHQWHGHODERPELOODSXHGHDFHOHUDUHOFUHFLPLHQWRGH
EDFWHULDV
&yPRFRQILJXUDUXQLQLFLRLQPHGLDWR\XQDSDJDGRDXWRPiWLFR
OR
(OKRUQRVHHQFLHQGHLQPHGLDWDPHQWH
\FRFLQDORVDOLPHQWRVGXUDQWHXQSHUtRGRGH
WLHPSRVHOHFFLRQDGR$OILQDOL]DUHOWLHPSRGH
FRFFLyQHOKRUQRVHDSDJDDXWRPiWLFDPHQWH
3UHVLRQHHOERWyQ&219(&7,21&22.
+RUQHDGRSRU&RQYHFFLyQ
3UHVLRQHODVDOPRKDGLOODVQXPpULFDVSDUD
FRQILJXUDUODWHPSHUDWXUDGHVHDGDGHO
KRUQR
3UHVLRQHODWHFOD67$57,QLFLDU
3UHVLRQHHOERWyQ&22.7,0(WLHPSRGH
FRFFLyQ
127$6LVXUHFHWDUHTXLHUHSUHFDOHQWDPLHQWR
SXHGHQHFHVLWDUDJUHJDUWLHPSRDGLFLRQDO
DOWLHPSRGHFRFFLyQ
3UHVLRQHODVDOPRKDGLOODVQXPpULFDVSDUD
FRQILJXUDUHOWLHPSRGHFRFFLyQGHVHDGR
(OWLHPSRGHFRFFLyQPtQLPRTXHXVWHG
SXHGHFRQILJXUDUHVPLQXWR
/DWHPSHUDWXUDGHOKRUQRTXHKD
FRQILJXUDGR\HOWLHPSRGHFRFFLyQ
LQJUHVDGRDSDUHFHUiQHQODSDQWDOOD
3UHVLRQHHOERWyQ67$57LQLFLDU
(OKRUQRHVWDUiHQODSRVLFLyQ21(QFHQGLGR\
HQODSDQWDOODDSDUHFHUiHOFRQWHRGHODFRFFLyQ
\HOFDPELRGHWHPSHUDWXUDDSDUWLUGHORV
ƒ)/DSDQWDOODGHWHPSHUDWXUDFRPHQ]DUiD
FDPELDUXQDYH]TXHODWHPSHUDWXUDGHOKRUQR
DOFDQFHORVž)&XDQGRHOKRUQRDOFDQFHOD
WHPSHUDWXUDTXHSURJUDPyVRQDUiQSLWLGRV
(OKRUQRFRQWLQXDUiFRFLQDQGRGXUDQWHOD
FDQWLGDGGHWLHPSRFRQILJXUDGD\OXHJRGH
DSDJDUiGHIRUPDDXWRPiWLFD
6LIXHUDQHFHVDULRSUHVLRQHHOERWyQ
&/($52))ERUUDUDSDJDGRSDUDERUUDU
ODSDQWDOOD4XLWHORVDOLPHQWRVGHOKRUQR
5HFXHUGHDXQTXHHOKRUQRVHDSDJD
DXWRPiWLFDPHQWHORVDOLPHQWRVTXHVH
GHMHQHQHOKRUQRVHJXLUiQFRFLQiQGRVH
GHVSXpVGHDSDJDGRHOPLVPR
&yPRFRQILJXUDUXQLQLFLRUHWDUGDGR\XQDSDJDGRDXWRPiWLFR
OR
OKRUQRVHHQFHQGHUiHQHOKRUDULRTXH
(
XVWHGKD\DFRQILJXUDGRFRFLQDUiDOLPHQWRV
GXUDQWHXQSHUtRGRGHWLHPSRHVSHFtILFR
\OXHJRVHDSDJDUiDXWRPiWLFDPHQWH
$VHJ~UHVHGHTXHHOUHORMPXHVWUHODKRUD
FRUUHFWD
3UHVLRQHODWHFOD'(/$<67$57,QLFLR
5HWUDVDGR
3UHVLRQHODVDOPRKDGLOODVQXPpULFDV
SDUDFRQILJXUDUODWHPSHUDWXUDGHVHDGD
GHOKRUQR
3UHVLRQHODWHFOD67$57,QLFLDU
/DWHPSHUDWXUDGHOKRUQRTXHKD
FRQILJXUDGR\HOWLHPSRGHFRFFLyQ
LQJUHVDGRDSDUHFHUiQHQODSDQWDOOD
3UHVLRQHHOERWyQ67$57LQLFLDU
127$6LGHVHDYHULILFDUORVKRUDULRVTXHKD
FRQILJXUDGRSUHVLRQHHOERWyQ'(/$<67$57
LQLFLRUHWDUGDGRSDUDFRQWURODUODKRUDGH
LQLFLRFRQILJXUDGDRSUHVLRQHHOERWyQ&22.
7,0(WLHPSRGHFRFFLyQSDUDYHULILFDUOD
H[WHQVLyQGHFRFFLyQTXHKDFRQILJXUDGR
&XDQGRHOKRUQRVHHQFLHQGH21HQ
HOKRUDULRTXHKDFRQILJXUDGRODSDQWDOOD
PRVWUDUiODFXHQWDUHJUHVLYDGHOWLHPSR
GHFRFFLyQ\ODQXHYDWHPSHUDWXUD
3UHVLRQHODWHFOD&219(&7,21&22.
+RUQHDGRSRU&RQYHFFLyQXRWUDIXQFLyQ FRPHQ]DQGRHQƒ)ƒ&/DSDQWDOOD
GHWHPSHUDWXUDFRPHQ]DUiDFDPELDU
GHFRFFLyQGHVHDGD
FXDQGRODWHPSHUDWXUDGHOKRUQROOHJXHD
7RTXHORVODVWHFODVQXPpULFDVSDUD
ORVƒ)>ƒ&@&XDQGRHOKRUQRDOFDQ]DOD
SURJUDPDUODWHPSHUDWXUDGHOKRUQR
WHPSHUDWXUDFRQILJXUDGDVRQDUiQSLWLGRV
GHVHDGD
(OKRUQRVHJXLUiFRFLQDQGRGXUDQWHXQ
SHUtRGRGHWLHPSRGHWHUPLQDGR\OXHJR
3UHVLRQHODWHFOD67$57,QLFLDU
VHDSDJDUiDXWRPiWLFDPHQWH
3UHVLRQHODWHFOD&22.7,0(
6LIXHUDQHFHVDULRSUHVLRQHHOERWyQ
&/($52))ERUUDUDSDJDGRSDUD
7HPSRUL]DGRUGH&RFFLyQ
ERUUDUODSDQWDOOD4XLWHORVDOLPHQWRV
127$6LVXUHFHWDUHTXLHUHSUHFDOHQWDPLHQWR
GHOKRUQR5HFXHUGHDXQTXHHOKRUQRVH
SXHGHQHFHVLWDUDJUHJDUWLHPSRDGLFLRQDODO
DSDJDDXWRPiWLFDPHQWHORVDOLPHQWRV
WLHPSRGHFRFFLyQ
TXHVHGHMHQHQHOKRUQRVHJXLUiQ
3UHVLRQHODVDOPRKDGLOODVQXPpULFDVSDUD
FRFLQiQGRVHGHVSXpVGHDSDJDGR
FRQILJXUDUHOWLHPSRGHFRFFLyQGHVHDGR
HOPLVPR
(OWLHPSRGHFRFFLyQPtQLPRTXHXVWHG
SXHGHFRQILJXUDUHVPLQXWR
8VRGHODVIXQFLRQHVGHFRFFLyQOHQWD\FDOHQWDU
$'9(57(1&,$
5,(6*2'(,172;,&$&,Ï1$/,0(17$5,$3RUGHEDMRGHORVƒ)ƒ&SXHGHSURGXFLUVH
FUHFLPLHQWRGHEDFWHULDVHQORVDOLPHQWRV
‡6LHPSUHHPSLHFHFRQDOLPHQWRVFDOLHQWHV1RXWLOLFHFRQILJXUDFLRQHVGHPDQWHQHUFDOLHQWH
SDUDFDOHQWDUDOLPHQWRVIUtRV
‡1RFDOLHQWHDOLPHQWRVSRUPiVGHKRUDV
1RVHJXLUHVWDVLQVWUXFFLRQHVSXHGHSURYRFDUHQIHUPHGDGHVWUDQVPLWLGDVSRUORVDOLPHQWRV
&RQILJXUDFLyQGHO+RUQRSDUDXQD&RFFLyQ/HQWD
/DFRFFLyQOHQWDHVWiGLVHxDGDSDUDSHUtRGRV
SURORQJDGRVGHFRFFLyQVLQDWHQFLyQ
3UHVLRQHHOERWyQ6/2:&22.FRFFLyQOHQWD
/DSDQWDOODPRVWUDUi3RXOWU\$YH3DUD
FDPELDUD0HDWV&DUQHVSUHVLRQHODWHFOD
6/2:&22.&RFFLyQ/HQWDQXHYDPHQWH
3DUDXQDFRQILJXUDFLyQFRUUHFWDSUHVLRQHOD
*XtDGH&RFFLyQ/HQWD8VH0HDWV&DUQHVVL
QRHVWiVHJXURGHTXpFRQILJXUDFLyQXVDU
*XtDGHFRFFLyQOHQWD
$OLPHQWR
&DUQHGHUHV
$VDGRGHFXDUWR
GHODQWHUR
&RVWLOODV
&DUQHGHDYH
3ROORHQWHUR
7UR]RVGHSROOR
&HUGR
$VDGRGHSDOHWD
VLQKXHVR
&KXOHWDVGHFHUGR
HVWLORGHFDPSR
&KXOHWDVGHFHUGR
6RSD
6RSDGHFDUQH
YHJHWDO
&KLOH
&DQWLGDG
²øOEV
²NJ
ø²OEV
²NJ
OEVNJ
WUR]RV
DSUR[OEV
>[email protected]
²OEV
²NJ
ø²OEV
²NJ
²OEV
²NJ
FXDUWRV
GHJDOyQ
OLWHUV
FXDUWRV
GHJDOyQ
OLWHUV
3UHVLRQHODVDOPRKDGLOODVQXPpULFDVSDUD
FRQILJXUDUHOWLHPSRGHFRFFLyQGHVHDGR(O
WLHPSRGHFRFFLyQGHEHVHUGHSRUORPHQRV
KRUDVKDVWDXQPi[LPRKRUDV
PLQXWRV
3UHVLRQHHOERWyQ67$57LQLFLDU
127$6LRFXUUHXQFRUWHGHHQHUJtDGXUDQWH
ODFRFFLyQOHQWDODFRFLQDVHDSDJDUi
„(OSURJUDPDGHFRFFLyQOHQWDXWLOL]DXQDVHULH
3RVLFLyQ &RQILJ
GHOD
GHORV
EDQGHMD DOLPHQWRV
&
&DUQHV
&
&DUQHV
&
&DUQH
GHDYH
&
&DUQH
GHDYH
&
&DUQHV
&
&DUQHV
&
&DUQHV
&
&DUQHV
&
&DUQHV
7LHPSR
+RUDV
+,DOWD
²KUV
/2EDMD
²KUV
+,DOWD
²KUV
/2EDMD
²KUV
+,DOWD
²KUV
/2EDMD
²KUV
+,DOWD
²KUV
/2EDMD
²KUV
&RPHQWDULRV
$JUHJXHWD]DGHOtTXLGR
&RORTXHODVFRVWLOODVHQ
XQDVRODFDSD
$JUHJXHWD]DGHOtTXLGR
0HMRUFRORTXHEDMRXQDVDOVD
SDUDTXHQRVHVHTXH
+,DOWD
²KUV
/2EDMD
²KUV
+,DOWD
²KUV
/2EDMD
²KUV
+,DOWD
²KUV
/2EDMD
²KUV
$JUHJXH²WD]DGHOtTXLGR
+,DOWD
²KUV
/2EDMD
²KUV
+,DOWD
²KUV
/2EDMD
²KUV
$VHJ~UHVHGHTXHORVWUR]RV
GHFDUQHHVWpQVXPHUJLGRV
&RORTXHODVFRVWLOODVHQ
XQDVRODFDSD
&RORTXHODVFKXOHWDVHQ
XQDVRODFDSD
6XPHUMDORVIULMROHVSDUDTXH
QRVHVHTXHQ
FRPSOHMDGHFLFORVGHWHPSHUDWXUDSDUDREWHQHUORV
PHMRUHVUHVXOWDGRV3RUHVWDUD]yQVHUHFRPLHQGD
TXHHOSURJUDPDGHFRFFLyQOHQWDIXQFLRQHVLQ
FDQFHODFLRQHVQLUHLQLFLDFLRQHV6LVHUHLQLFLDOD
FDUDFWHUtVWLFDGHFRFFLyQOHQWDPLHQWUDVVHHQFXHQWUD
HQSURJUHVRODFDUQHSXHGHFRFLQDUVHGHPiV
„3DUDFDUQHMXJRVD\WLHUQDHOLMDFRUWHVGHFDUQHFRPR
DVDGRGHFXDUWRGHODQWHURRXQDVDGRGHSDOHWD
VLQKXHVR/RVFRUWHVGHFDUQHPiVPDJURVFRPR
HOFXDUWRWUDVHURVXSHULRUVRQPiVVHFRV\SXHGHQ
QHFHVLWDUOtTXLGRDGLFLRQDO
„8WLOLFHVyORSODWRVGHYLGULRRFHUiPLFD/DVROODV\
VDUWHQHVGHPHWDOWLHQGHQDWUDQVIHULUHOFDORUDORV
DOLPHQWRVGHPDVLDGRUiSLGR
„$MXVWHODFDQWLGDGGHDOLPHQWRVDOWDPDxRGHO
UHFLSLHQWH/OHQHHOUHFLSLHQWHKDVWDôSDUDPHMRUHV
UHVXOWDGRV8QDROODPX\JUDQGHGHMDHVFDSDUHO
YDSRUORTXHVHFDORVDOLPHQWRV
„6LHPSUHFXEUDODROODFRQXQDWDSDRFRQSDSHOGH
DOXPLQLR
„3XHGHXVDUVHXQDJDPDPiVDPSOLDGHUHFHWDV
FRQODFDUDFWHUtVWLFDGHFRFFLyQOHQWD3DUDPHMRUHV
UHVXOWDGRVGHEHQUHDOL]DUVHDOJXQRVDMXVWHV3DUD
UHFHWDVGHWDPDxRVPiVSHTXHxRVFRPLHQFHD
FRQWURODUHQHOWLHPSRPtQLPR3DUDUHFHWDVPiV
JUDQGHVRFXDQGRGREOHODVFDQWLGDGHVGHODV
UHFHWDVORVDOLPHQWRVSXHGHQFRFLQDUVHSRUSHUtRGRV
PiVSURORQJDGRV
„&XDQGRODFDUDFWHUtVWLFDGHFRFFLyQOHQWDILQDOL]DHO
KRUQRFDPELDDXWRPiWLFDPHQWHHOPRGR´ZDUPµ
PDQWHQHUFDOLHQWH6LVHGHVHDWLHPSRDGLFLRQDOSDUD
FRFFLyQOHQWDHVWHPRGRGHPDQWHQHUFDOLHQWHSXHGH
XWLOL]DUVHSDUDREWHQHUWLHPSRH[WUD
&yPRFRQILJXUDUHOKRUQRSDUDPDQWHQHUFDOLHQWH
/DIXQFLyQ:$50&DOHQWDUPDQWLHQHFDOLHQWHV
ODVFRPLGDVFRFLQDGDV
(VWDIXQFLyQQRIXHGLVHxDGDSDUDYROYHUD
FDOHQWDUFRPLGDIUtD
3DUDXVDUODIXQFLyQ:$50&DOHQWDUSUHVLRQHODWHFOD
:$50&DOHQWDU\OXHJRODWHFOD67$57,QLFLDU
3DUDXWLOL]DUODFDUDFWHUtVWLFD:$50FDOLHQWH
GHVSXpVGHKRUQHDGRSRUWHPSRUL]DGRUVLJD
HVWRVSDVRV
3UHVLRQHHOPRGRKRUQHDU
3UHVLRQHODVDOPRKDGLOODVQXPpULFDVSDUD
FRQILJXUDUODWHPSHUDWXUDGHOKRUQR
3UHVLRQHHOERWyQ&22.7,0(WLHPSRGH
FRFFLyQ
3UHVLRQHODVDOPRKDGLOODVQXPpULFDVSDUD
FRQILJXUDUHOWLHPSRGHFRFFLyQGHVHDGR
3UHVLRQHHOERWyQ:$50FDOLHQWH
3UHVLRQHHOERWyQ67$57LQLFLDU
127$/RVUHFLSLHQWHVRWDSDVGHSOiVWLFRR
HQYROWRULRVSOiVWLFRVVHGHUUHWLUiQVLVHORVFRORFD
GHQWURGHOKRUQR(VSRVLEOHTXHQRSXHGDTXLWDU
HOSOiVWLFRGHUUHWLGR\HVWRQRHVWiFXELHUWRSRUOD
JDUDQWtD
&yPRXVDUHOFDMyQFDOHQWDGRUHQDOJXQRVPRGHORV
$'9(57(1&,$
*($SSOLDQFHVFRP
5,(6*2'(,172;,&$&,Ï1$/,0(17$5,$3RUGHEDMRGHORVƒ)ƒ&SXHGHSURGXFLUVHFUHFLPLHQWRGH
EDFWHULDVHQORVDOLPHQWRV
‡6LHPSUHHPSLHFHFRQDOLPHQWRVFDOLHQWHV1RXWLOLFHFRQILJXUDFLRQHVGHPDQWHQHU
FDOLHQWHSDUDFDOHQWDUDOLPHQWRVIUtRV
‡1RFDOLHQWHDOLPHQWRVSRUPiVGHKRUDV
1RVHJXLUHVWDVLQVWUXFFLRQHVSXHGHSURYRFDUHQIHUPHGDGHVWUDQVPLWLGDVSRUORVDOLPHQWRV
(OFDMyQFDOHQWDGRUPDQWHQGUiDOLPHQWRVFDOLHQWHV\FRFLGRVDXQDWHPSHUDWXUDGHVHUYLFLR6LHPSUHHPSLHFHFRQDOLPHQWRVFDOLHQWHV1ROR
XVHSDUDFDOHQWDUDOLPHQWRVIUtRVFRQH[FHSFLyQGHVHFDUJDOOHWDVSDSLWDV\FHUHDO
&yPRXVDUHOFDMyQFDOHQWDGRU
3UHVLRQHODWHFOD:$50,1*'5$:(5212))
(QFHQGLGR$SDJDGRGHO&DMyQ&DOHQWDGRU´6HW
:DUPLQJ'UDZHUµ&RQILJXUDFLyQGHO&DMyQ
&DOHQWDGRUFRPLHQ]DDWLWLODU3UHVLRQHODWHFODGH
:$50,1*'5$:(56(77,1*&RQILJXUDFLyQGHO
&DMyQ&DOHQWDGRUSDUDFRQILJXUDUHOPLVPRHQ
´+,µ$OWR´67'µR´/2µ
3DUDFDQFHODUSUHVLRQHHOERWyQ:$50,1*
'5$:(5FDMyQFDOHQWDGRU
127$3UHVLRQDUHOERWyQ&/($52))ERUUDU
DSDJDGRQRDSDJDHOFDMyQFDOHQWDGRU
&XDQGRXVHHOFDMyQFDOHQWDGRU
(OFDMyQFDOHQWDGRUPDQWHQGUiDOLPHQWRVFDOLHQWHV
\FRFLGRVDXQDWHPSHUDWXUDGHVHUYLFLR6LHPSUHHPSLHFH
FRQDOLPHQWRVFDOLHQWHV1RORXVHSDUDFDOHQWDUDOLPHQWRV
IUtRVFRQH[FHSFLyQGHVHFDUJDOOHWDVSDSLWDV\FHUHDO
1RUHFXEUDHOFDMyQFDOHQWDGRURUHFLSLHQWHGHFRFFLyQFRQ
SDSHOPHWiOLFR(OSDSHOPHWiOLFRHVXQH[FHOHQWHDLVODQWH
GHFDORU\DWUDSDUiHOFDORUGHEDMRGHpO(VWRDOWHUDUiHO
GHVHPSHxRGHOFDMyQ\SRGUtDGDxDUHODFDEDGRLQWHULRU
3HUPLWDTXHHOFDMyQFDOHQWDGRUVHSUHFDOLHQWHGXUDQWH
DSUR[LPDGDPHQWHPLQXWRV
„1RFRORTXHOtTXLGRRDJXDHQHOFDMyQFDOHQWDGRU
„7RGRVORVDOLPHQWRVTXHVHFRORTXHQHQHOFDMyQ
FDOHQWDGRUGHEHQFXEULUVHFRQXQDWDSDRSDSHOPHWiOLFR
&XDQGRFDOLHQWHSDVWHOLWRV\SDQHVODWDSDGHEHFRQWDU
FRQXQDYHQWLODFLyQSDUDSHUPLWLUODVDOLGDGHKXPHGDG
„/RVDOLPHQWRVGHEHQPDQWHQHUVHHQVXUHFLSLHQWHFDOLHQWH
RWUDVSDVDUVHDXQSODWRGHVHUYLFLRUHVLVWHQWHDOFDORU
127$/RVUHFLSLHQWHVSOiVWLFRVRORVHQYROWRULRVSOiVWLFRVVH
GHUULWHQVLHQWUDQHQFRQWDFWRGLUHFWRFRQHOFDMyQUHFLSLHQWH
GHFRFFLyQRXWHQVLOLRFDOLHQWH(OSOiVWLFRGHUUHWLGRQRSXHGH
UHPRYHUVH\HVWRQRVHHQFXHQWUDFXELHUWRSRUODJDUDQWtD
„4XLWHODVFXFKDUDVGHVHUYLFLRHWFDQWHVGHFRORFDU
UHFLSLHQWHVHQHOFDMyQFDOHQWDGRU
7DEODGHVHOHFFLyQGHWHPSHUDWXUD
3DUDPDQWHQHUFDOLHQWHVGLIHUHQWHVWLSRVGHDOLPHQWRV
HVWDEOH]FDHOFRQWUROFRQODFRQILJXUDFLyQPiVHOHYDGD
„/DWHPSHUDWXUDWLSRFDQWLGDGGHDOLPHQWRV\
HOWLHPSRHQTXHVHPDQWHQJDQGHQWURGHOKRUQR
DIHFWDQODFDOLGDGGHORVDOLPHQWRV
„$ODEULUHOFDMyQHQIRUPDUHLWHUDGDHODLUHFDOLHQWHVH HVFDSDUi\ORVDOLPHQWRVVHHQIULDUiQ
„&RQJUDQGHVFDUJDVSXHGHVHUQHFHVDULRXWLOL]DUXQD FRQILJXUDFLyQGHOFDMyQFDOHQWDGRUPiVHOHYDGD\
FXEULUDOJXQRVGHORVDOLPHQWRVFRFLGRV
„1
RXWLOLFHUHFLSLHQWHVRHQYROWRULRVSOiVWLFRV
7LSRGHDOLPHQWR
&KLOH
(VWRIDGR
3DSDVDOKRUQR
3L]]D
7RWRSRV
:DIOHV
&RQILJXUDFLyQ
GHFRQWURO
+,
0('
+,
0('
/2
/2
3DUDYROYHUFUXMLHQWHVSURGXFWRVQRIUHVFRV
„&RORTXHORVDOLPHQWRVHQSODWRVREDQGHMDV
GHODGRVEDMRV
„3UHFDOLHQWHHQODFRQILJXUDFLyQ/2
„'HVSXpVGHPLQXWRVYHULILTXHVLHVWiQFUXMLHQWHV
$JUHJXHWLHPSRVLIXHVHQHFHVDULR
3DUDFDOHQWDUWD]RQHV\SODWRVGHVHUYLFLR
35(&$8&,Ï1
/RVSODWRVHVWDUiQFDOLHQWHV8WLOLFHDJDUUDGHUDV
RJXDQWHVFXDQGRTXLWHSODWRVFDOLHQWHV
3DUDFDOHQWDUWD]RQHV\SODWRVGHVHUYLFLRFRQILJXUHHO
FRQWUROHQ/2
„8WLOLFHVyORUHFLSLHQWHVUHVLVWHQWHVDOFDORU
„6LGHVHDFDOHQWDUSRUFHODQDILQDFRQVXOWH
DOIDEULFDQWHGHODYDMLOODVREUHVXWROHUDQFLDPi[LPDDO
FDORU
„8VWHGSXHGHFDOHQWDUSODWRVGHVHUYLFLRYDFtRVPLHQWUDV
SUHFDOLHQWDHOFDMyQ
8VRGHOKRUQRFRQDXWROLPSLH]D
$QWHVGHXQFLFORGH$XWR/LPSLH]D
$'9(57(1&,$
3(/,*52'(,1&(1',2/LPSLHODJUDVD\ODVXFLHGDG
UHEHOGHGHOSLVRGHOKRUQRDQWHVGHODDXWROLPSLH]D
1RKDFHUORSXHGHSURYRFDUXQLQFHQGLRHQHOKRUQR
/LPSLHFRQXQSDxRORVGHVHFKRV
UHEHOGHVDFXPXODGRVHQHOSLVRGHO
KRUQR
5HFRPHQGDPRVYHQWLODUVXFRFLQDFRQXQDYHQWDQD
DELHUWDRXWLOL]DQGRXQYHQWLODGRURFDPSDQD
GXUDQWHHOSULPHUFLFORGHDXWROLPSLH]D
4XLWHODDVDGHUDUHMLOODVRQGDWRGRVORVUHFLSLHQWHV
GHFRFFLyQ\FXDOTXLHUWUR]RGHSDSHOGHDOXPLQLRGHO
KRUQR
127$6
„6LHOKRUQRVHHQFXHQWUDHTXLSDGRFRQSDUULOODV
SDUDKRUQREULOORVDV\GHFRORUSODWHDGRVH
UHFRPLHQGDUHWLUDUODVPLVPDVDQWHVGHFRPHQ]DU
FRQHOFLFORGHDXWROLPSLH]D3RGUiQSHUPDQHFHU
HQHOKRUQRGXUDQWHHOFLFORGHDXWROLPSLH]DSHUR
VHRVFXUHFHUiQSHUGHUiQVXOXVWUH\VHUiGLItFLO
GHVOL]DUODV
„6LVXKRUQRHVWiHTXLSDGRFRQEDQGHMDVUHYHVWLGDV
GHSRUFHODQDJULVSXHGHQGHMDUVHGHQWURGHOKRUQR
GXUDQWHHOFLFORGHDXWROLPSLH]D
/DVXFLHGDGXELFDGDHQHOPDUFRIURQWDOGHODFRFLQD
\IXHUDGHODMXQWDGHODSXHUWDGHEHUiOLPSLDUVH
DPDQR/LPSLHHVWDViUHDVFRQDJXDFDOLHQWH
HVSRQMLOODVGHODQDGHDFHURHPEHELGDVHQMDEyQR
OLPSLDGRUHVWDOHVFRPR6RIW6FUXEŠ(QMXDJXHELHQ
FRQDJXDOLPSLD\VHTXH
1ROLPSLHODMXQWD(OPDWHULDOGHILEUDGHYLGULRGH
ODMXQWDGHODSXHUWDGHOKRUQRQRUHVLVWHSURGXFWRV
DEUDVLYRV(VHVHQFLDOTXHODMXQWDVHPDQWHQJD
LQWDFWD6LXVWHGQRWDTXHHVWiGHVJDVWDGD
UHHPSOiFHOD
9HULILTXHTXHODWDSDGHODERPELOODGHOX]GHOKRUQR
HVWpHQVXOXJDU\TXHODOX]GHOKRUQRHVWpDSDJDGD
,03257$17(/DVHPDQDFLRQHVSURGXFLGDVSRU
HOFLFORGHDXWROLPSLH]DGHFXDOTXLHUKRUQRDIHFWDQ
ODVDOXGGHDOJXQDVDYHVGHPDQHUDQRWRULD3URFXUH
OOHYDUVXVDYHVDRWUDKDELWDFLyQELHQYHQWLODGD
+RUQRGREOH\PRGHORVFDQDGLHQVHVVRODPHQWH
/DVXQLGDGHVGHVXSHUILFLHVHGHVDFWLYDQ
DXWRPiWLFDPHQWHGXUDQWHHOFLFORGHDXWROLPSLH]D
9HULILTXHTXHWRGRVORVFRQWUROHVGHXQLGDGHV
GHVXSHUILFLHHVWpQDSDJDGRVHQWRGRPRPHQWR
GXUDQWHHOFLFORGHDXWROLPSLH]D&XDOTXLHUXQLGDG
GHVXSHUILFLHFRQILJXUDGDHQXQDSRVLFLyQ´RQµ
HQFHQGLGRPLHQWUDVIXQFLRQDHOFLFORGHDXWR
OLPSLH]DVHDFFLRQDUiDXWRPiWLFDPHQWHGHVSXpVGH
WHUPLQDGRHOFLFOR\SXHGHSURYRFDUHOHQFHQGLGR
GHXQDXQLGDGGHVXSHUILFLH\TXHGDUVLQDWHQFLyQ
(VSHUHKDVWDTXHWHUPLQHHOFLFORGHDXWROLPSLH]D
SDUDFRQILJXUDU\XVDUODVXQLGDGHVGHVXSHUILFLH
&yPRFRQILJXUDUHOKRUQRSDUDXQDDXWROLPSLH]D
/DVSXHUWDVGHOKRUQRGHEHHVWDUFHUUDGDV\WRGRV
ORVFRQWUROHVGHEHQHVWDUFRUUHFWDPHQWHFRQILJXUDGRV
SDUDTXHHOFLFORIXQFLRQHHQIRUPDDGHFXDGD
3UHVLRQHHOERWyQ6(/)&/($1DXWROLPSLH]D
6HUHFRPLHQGDXQFLFORGHKRUDVSDUDOLPSLDU
GHUUDPHVSHTXHxRV\FRQWHQLGRV6HUHFRPLHQGD
XQFLFORGHDXWROLPSLH]DGHKRUDVSDUDXQ
KRUQRPiVVXFLR
6LQHFHVLWDXQFLFORGLIHUHQWHGHRKRUDVXWLOLFH
ODVDOPRKDGLOODVQXPpULFDVHLQJUHVHHOWLHPSRGH
OLPSLH]DGHVHDGR
(OWLHPSRGHOLPSLH]DSXHGHFRQILJXUDUVHHQWUHKRUDV
\KRUDVGHDFXHUGRFRQHOJUDGRGHVXFLHGDGGHO
KRUQR
3UHVLRQHHOERWyQ67$57LQLFLDU
/DVSXHUWDVGHOKRUQRVXSHULRUHLQIHULRUVHEORTXHDQ
DXWRPiWLFDPHQWH/RVHOHPHQWRVGHODHVWXIDWDPELpQ
VHEORTXHDQGXUDQWHODOLPSLH]D/DSDQWDOODPRVWUDUi
HOWLHPSRGHOLPSLH]DUHVWDQWH1RSRGUiQDEULUVH
ODVSXHUWDVGHOKRUQRRXWLOL]DUODHVWXIDKDVWDTXHOD
WHPSHUDWXUDGHVFLHQGDSRUGHEDMRGHODWHPSHUDWXUD
GHEORTXHR\VHDSDJXH/2&.(''225 SXHUWD
EORTXHDGDGHODSDQWDOODGHFRQWURO
/DSDODEUD/2&.(''225 3XHUWDEORTXHDGD
WLWLODUi\ODSDODEUD'2253XHUWDDSDUHFHUiVL
FRQILJXUDHOFLFORGHOLPSLH]D\ROYLGDFHUUDUODSXHUWD
GHOKRUQR
„6LXVWHGFRQILJXUDHOFLFORGHOLPSLH]D\VHROYLGDGH
FHUUDUODVSXHUWDVGHOKRUQRGHVWHOODUi/2&.('
'225 SXHUWDEORTXHDGD\ODSDODEUDGRRU
SXHUWDDSDUHFHUiHQODSDQWDOOD
„3DUDGHWHQHUHOFLFORGHOLPSLH]DSUHVLRQHHOERWyQ
&/($52))ERUUDUDSDJDGR&XDQGRVHDSDJD
/2&.(''225 SXHUWDEORTXHDGDLQGLFDQGR
TXHODWHPSHUDWXUDGHORVKRUQRVKDGHVFHQGLGRSRU
GHEDMRGHODWHPSHUDWXUDGHEORTXHRXVWHGSRGUi
DEULUODVSXHUWDV
+RUQRVGREOHV
„8VWHGSXHGHFRQILJXUDUXQFLFORGHOLPSLH]DHQ
DPERVKRUQRVDOPLVPRWLHPSRVLQHPEDUJRQR
HIHFWXDUiQODDXWROLPSLH]DDOPLVPRWLHPSR(O
~OWLPRKRUQRHQFRQILJXUDUVHUHWDUGDUiVXLQLFLR
DXWRPiWLFDPHQWHKDVWDODILQDOL]DFLyQGHOFLFORGH
OLPSLH]DGHOSULPHUKRUQR
„&XDQGRVHFRQILJXUHXQKRUQRSDUDODDXWROLPSLH]D
ODVGRVSXHUWDVGHOKRUQR\ORVFRQWUROHVGHODHVWXID
VHEORTXHDUiQ/RVKRUQRV\ODHVWXIDQRSXHGHQ
XVDUVHFXDQGRXQKRUQRHVWiFRQILJXUDGRSDUD
ODDXWROLPSLH]D
*($SSOLDQFHVFRP
/DVSXHUWDVGHOKRUQRGHEHHVWDUFHUUDGDV\WRGRVORVFRQWUROHVGHEHQHVWDUFRUUHFWDPHQWHFRQILJXUDGRVSDUDTXHHOFLFOR
IXQFLRQHHQIRUPDDGHFXDGD
&yPRFRQILJXUDUXQLQLFLRUHWDUGDGRGHOLPSLH]D
3UHVLRQHHOERWyQ'(/$<67$57LQLFLR
UHWDUGDGR
0HGLDQWHODVDOPRKDGLOODVQXPpULFDV
LQJUHVHODKRUDHQTXHGHVHDLQLFLDU
HOFLFORGHOLPSLH]D
/DSXHUWDGHOKRUQRVHFLHUUDDXWRPiWLFDPHQWH
1RSRGUiQDEULUVHODVSXHUWDVGHOKRUQRR
XWLOL]DUVHODHVWXIDKDVWDTXHODWHPSHUDWXUD
GHVFLHQGDSRUGHEDMRGHODWHPSHUDWXUDGH
EORTXHR\VHDSDJXH/2&.(''225 SXHUWD
EORTXHDGDGHODSDQWDOODGHFRQWURO
3UHVLRQHHOERWyQ67$57LQLFLDU
3UHVLRQHHOERWyQ6(/)&/($1DXWR
OLPSLH]D
0HGLDQWHODVDOPRKDGLOODVQXPpULFDV
LQJUHVHODKRUDHQTXHGHVHDLQLFLDU
HOFLFORGHOLPSLH]D
(OWLHPSRGHOLPSLH]DSXHGHFRQILJXUDUVHHQWUH
KRUDV\KRUDVGHDFXHUGRFRQHOJUDGRGH
VXFLHGDGGHOKRUQR
3UHVLRQHHOERWyQ67$57LQLFLDU
'HVSXpVGHXQFLFORGHOLPSLH]D
(VSRVLEOHTXHREVHUYHDOJXQDVFHQL]DVEODQFDVHQHO
KRUQR/tPSLHODVFRQXQSDxRK~PHGRGHVSXpVGHTXHHO
KRUQRVHHQIUtH
6LODVPDQFKDVEODQFDVSHUPDQHFHQUHPXpYDODV
FRQXQHVWURSDMRGHDFHUROOHQRGHMDEyQ\HQMXDJXH
JHQHURVDPHQWHFRQXQDPH]FODGHYLQDJUH\DJXD(VWRV
GHSyVLWRVVRQXVXDOPHQWHUHVLGXRVGHVDOTXHHOFLFORGH
OLPSLH]DQRSXHGHHOLPLQDU
6LHOKRUQRQRTXHGDOLPSLRGHVSXpVGHXQFLFORGH
OLPSLH]DUHSLWDHOFLFOR
„8VWHGQRSXHGHFRQILJXUDUHOKRUQRSDUDFRFFLyQKDVWD
TXHHOKRUQRHVWpORVXILFLHQWHPHQWHIUtRFRPRSDUDTXH
ODSXHUWDVHGHVEORTXHH
„0LHQWUDVHOKRUQRHVWpHQDXWROLPSLH]DXVWHGSXHGH
SUHVLRQDUHOERWyQ5(/2-SDUDPRVWUDUHQSDQWDOOD
ODKRUDGHOGtD3DUDYROYHUDODFXHQWDUHJUHVLYDGH
OLPSLH]DSUHVLRQHHOERWyQ$872/,03,(=$
3DUULOODVHVWiQGDU
6LUHVXOWDGLItFLOGHVOL]DUODVSDVHDFHLWHGHFRFFLyQFRQXQ
SDxRHQVXVFRVWDGRVODWHUDOHV\HQORVVRSRUWHVGHODV
SDUULOODVGHOKRUQR
3DUULOODGHH[WHQVLyQ
6LGHVOL]DUODPLVPDUHVXOWDGLItFLOYHU3DUULOODGHH[WHQVLyQ
HQODVHFFLyQ&XLGDGR\OLPSLH]D1RURFtHODSDUULOOD
GHH[WHQVLyQFRQSXOYHUL]DGRUSDUDFRFFLyQXRWURV
OXEULFDQWHVHQVSUD\
6LUHVXOWDGLItFLOTXLWDUODRFRORFDUODSDVHDFHLWHGHFRFFLyQ
FRQXQSDxRHQORVVRSRUWHVGHODVSDUULOODVGHOKRUQR1R
SDVHDFHLWHGHFRFFLyQHQORVGHVOL]DGRUHV
127$/XHJRGHOSULPHUFLFORGHOLPSLH]DDXWRPiWLFDODV
VXSHUILFLHVGHDFHURLQR[LGDEOHJULVFDPELDUiQGHFRORUHQ
ORVHVWDQWHVH[WHQVLEOHVHVPDOWDGRV(VWRHVQRUPDO1RVH
UHFRPLHQGDODOLPSLH]DDXWRPiWLFDGHHVWDQWHVH[WHQVLEOHV
GHQtTXHO\DTXHWRGRHOHVWDQWHSHUGHUiFRORUGHELGRDODV
WHPSHUDWXUDVGHODOLPSLH]DDXWRPiWLFD
8VRGHOD/LPSLH]DDO9DSRUHQDOJXQRVPRGHORV
'XUDQWHHOFLFORGH
OLPSLH]DDOYDSRU
HOIRQGRGHOKRUQR
VHYXHOYHORVXILFLHQWHPHQWHFDOLHQWHFRPRSDUD
RFDVLRQDUTXHPDGXUDV(VSHUHKDVWDTXHHOFLFORHVWp
WHUPLQDGRPLQXWRVDQWHVGHOLPSLDUODVVXSHUILFLHV
LQWHULRUHVGHOKRUQR6LHVWRQRVHFXPSOHVHSRGUi
VXIULUTXHPDGXUDV
35(&$8&,Ï1
(OFLFOR6WHDP&OHDQ/LPSLH]DDO9DSRUIDFLOLWDODOLPSLH]D
GHVXFLHGDGOHYHGHOLQWHULRUGHOKRUQRGHSRUFHODQDGH
OLPSLH]DHVWiQGDU
/DFRFLQDHVWDUiDWHPSHUDWXUDDPELHQWHDQWHVGHFRPHQ]DU
HOFLFOR6WHDP&OHDQ/LPSLH]DDO9DSRU6LHOKRUQRHVWi
GHPDVLDGRFDOLHQWHHQODSDQWDOODVHREVHUYDUi´FDOLHQWHµ\
HOFLFORQRVHDFWLYDUiKDVWDTXHHOKRUQRVHHQIUtH
(OFLFOR6WHDP&OHDQ/LPSLH]DDO9DSRUIXQFLRQDPHMRUHQ
QXHYRVGHUUDPHVRVXFLHGDGHV/DFRPLGDTXHPDGDHVPiV
GLItFLOGHHOLPLQDU
3DUD&RPHQ]DUHO&LFORGH/LPSLH]DDO9DSRU
5HWLUHORVHVWDQWHV\DFFHVRULRVGHOD
FDYLGDGGHOKRUQR1RFRORTXHXWHQVLOLRVX
RWURVDUWtFXORVHQHOKRUQRGXUDQWHHO&LFOR
GH/LPSLH]DDO9DSRU
9LHUWDRQ]DVGHDJXDHQHOSLVR
GHOKRUQR
9LHUWDWD]DR]GHDJXDDWHPSHUDWXUD
DPELHQWHHQHOiUHDLQWHUPHGLDGHOIRQGR
GHOKRUQR1RDJUHJXHVROXFLRQHVGH
OLPSLH]DQLTXtPLFRVGHQLQJ~QWLSRDO
DJXD6yORDJUHJXHDJXDDOXVDUHOFLFOR
6WHDP&OHDQ/LPSLH]DDO9DSRU6yOR
DJUHJXHDJXDDOXVDUHOFLFOR6HOI&OHDQ
$XWR/LPSLH]D
&LHUUHODSXHUWD
3UHVLRQHODWHFOD6WHDP&OHDQ/LPSLH]DDO
9DSRUOXHJRSUHVLRQH6WDUW,QLFLDU
/DSXHUWDGHOKRUQRVHFLHUUD
DXWRPiWLFDPHQWH8QFLFORGHPLQXWRV
FRPHQ]DUiODFXHQWDUHJUHVLYDHQOD
SDQWDOOD1RVHUiSRVLEOHDEULUODSXHUWDGHO
KRUQRKDVWDTXHHOFLFORILQDOLFHRKDVWD
TXHXVWHGSUHVLRQHODWHFOD&OHDU2II
%RUUDU$SDJDU\TXHODSXHUWDVH
GHVEORTXHH
&XDQGRHOFLFOR6WHDP&OHDQ/LPSLH]DDO
9DSRUHVWpFRPSOHWRODSXHUWDGH
GHVEORTXHDUiHOFRQWUROGHOKRUQRHPLWLUi
XQSLWLGR\ODOX]GH/LPSLH]DDO9DSRU
WLWLODUi3UHVLRQHODWHFOD&OHDU2II%RUUDU
$SDJDU\DEUDODSXHUWD
(OIRQGRGHOKRUQR\HODJXDUHVWDQWHD~Q
HVWDUiQPX\FDOLHQWHVDOILQDOGHOFLFOR(VWR
HVQRUPDO
5HWLUHODVXFLHGDGIUHJDQGRFRQXQFHSLOOR
RDOPRKDGLOODGHQ\ORQ6HSRGUiXVDUXQD
DOPRKDGLOODGHHVWURSDMRFRQMDEyQVyORHQ
HOLQWHULRUGHOKRUQRGHSRUFHODQD(OXVRGH
DOPRKDGLOODVDEUDVLYDVUD\DUiHOYLGULRGH
ODSXHUWD1ROLPSLHODVXFLHGDGQLHODJXD
GHODMXQWDGHODSXHUWD
5HWLUHHODJXDUHVWDQWHFRQXQDHVSRQMDR
WHODVHFD
'HMHODSXHUWDDELHUWDSDUDTXHVHVHTXH
FRQHODLUH
127$6,03257$17(6
‡ 6LXQFLFORGHOLPSLH]DDOYDSRUHVLQLFLDGR
VLQDJXDSUHVLRQHODWHFOD&OHDU2II
%RUUDU$SDJDUSDUDILQDOL]DUGLFKRFLFOR
(VSHUHDTXHODFRFLQDUHDOLFHODFRFFLyQD
WHPSHUDWXUDDPELHQWHDQWHVGHYHUWHUDJXD
HQHODJXDLQWHUPHGLDHLQLFLDURWURFLFORGH
YDSRU
‡ 1RDEUDODSXHUWDGXUDQWHHOFLFOR6WHDP
&OHDQ/LPSLH]DDO9DSRU8QSLWLGRGHHUURU
VRQDUiDODEULUODSXHUWD
‡ 3UHVLRQHODWHFOD&OHDU2II%RUUDU$SDJDU
HQFXDOTXLHUPRPHQWRSDUDILQDOL]DUHOFLFOR
‡ 6LSHUPDQHFHQGHSyVLWRVPLQHUDOHVHQHO
IRQGRGHOKRUQROXHJRGHODOLPSLH]DXVH
XQDWHODRHVSRQMDPRMDGDHQYLQDJUHSDUD
HOLPLQDU
‡ (VSRVLEOHTXHJRWHHDOJRGHDJXDGHVGHOD
SDUWHLQIHULRUGHODSXHUWDGHOKRUQR6LHVWR
VXFHGHOLPSLHODPLVPDDOILQDOL]DUHOFLFOR
‡ /DMXQWDGHODSXHUWDSRGUiHVWDUPRMDGD
FXDQGRHOFLFOR6WHDP&OHDQ/LPSLH]DDO
9DSRUILQDOLFH(VWRHVQRUPDO1ROLPSLHOD
MXQWD
‡ 6LD~QSHUPDQHFHVXFLHGDGOXHJRGHOD
OLPSLH]DGHOKRUQRFRQVXOWHODVHFFLyQGH
&XLGDGR\OLPSLH]DGHODFRFLQDHQHO0DQXDO
GHO3URSLHWDULRSDUDDFFHGHUDRSFLRQHV
DGLFLRQDOHV
&DUDFWHUtVWLFDVHVSHFLDOHVGHORVFRQWUROHVGHOKRUQR
*($SSOLDQFHVFRP
/RVQXHYRVFRQWUROHVFRQERWRQHVGHWRTXHFXHQWDQFRQFDUDFWHUtVWLFDVDGLFLRQDOHV/DVVLJXLHQWHVVRQODVFDUDFWHUtVWLFDV
\ODPDQHUDHQTXHXVWHGSXHGHDFWLYDUODV
/RVPRGRVGHFDUDFWHUtVWLFDVHVSHFLDOHVVyORSXHGHQDFWLYDUVHPLHQWUDVODSDQWDOODPXHVWUDODKRUD6HFRQVHUYDQHQOD
PHPRULDGHORVFRQWUROHVKDVWDTXHVHUHSLWDQORVSDVRV
3DUDLQJUHVDUXQDFDUDFWHUtVWLFDHVSHFLDOHQXQRGHORVGRVKRUQRVXVWHGGHEHSULPHURSUHVLRQDUORVERWRQHV%52,/+,
/2DVDUDOWREDMR\%$.(KRUQHDUGHOKRUQRVXSHULRUDOPLVPRWLHPSR/RVERWRQHV%52,/+,/2DVDUDOWREDMR\%$.(
KRUQHDUGHOKRUQRLQIHULRUQRDFWLYDQFDUDFWHUtVWLFDVHVSHFLDOHV
&XDQGRODSDQWDOODPXHVWUDVXRSFLyQSUHVLRQHHOERWyQ67$57LQLFLDU/DVFDUDFWHUtVWLFDVHVSHFLDOHVVHFRQVHUYDUiQHQOD
PHPRULDGHVSXpVGHXQFRUWHGHHQHUJtDFRQH[FHSFLyQGHO6DEEDWKTXHGHEHUHFRQILJXUDUVH
6HOHFFLyQGHWHPSHUDWXUDHQ)DKUHQKHLWR&HOVLXV
6XFRQWUROGHKRUQRHVWiFRQILJXUDGRSDUDXWLOL]DU
ODVVHOHFFLRQHVGHWHPSHUDWXUD)DKUHQKHLWSHUR
SXHGHPRGLILFDUVHSDUDXVDUVHOHFFLRQHVHQ
&HOVLXV
3UHVLRQHORVERWRQHV%52,/+,/2DVDUDOWR
EDMR\%$.(KRUQHDUGHOKRUQRVXSHULRUDO
PLVPRWLHPSRKDVWDTXHHQODSDQWDOOD
SXHGDYHUVH6)
3UHVLRQHORVERWRQHV&22.7,0(WLHPSRGH
FRFFLyQ\%52,/+,/2DVDUDOWREDMRDO
PLVPRWLHPSR(QODSDQWDOODSRGUiYHUVH)
)DKUHQKHLW
3UHVLRQHORVERWRQHV&22.7,0(WLHPSRGH
FRFFLyQ\%52,/+,/2DVDUDOWREDMRGH
QXHYRDOPLVPRWLHPSR(QODSDQWDOODSRGUi
YHUVH&&HOVLXV
3UHVLRQHHOERWyQ67$57LQLFLDU
6HxDOHVVRQRUDVDOILQDOL]DUXQFLFORFRQWHPSRUL]DGRU
$OILQDOL]DUXQFLFORFRQWHPSRUL]DGRUVHHVFXFKDQ
SLWLGRVFRUWRVVHJXLGRVSRUXQSLWLGRFDGD
VHJXQGRVKDVWDTXHVHSUHVLRQHHOERWyQ&/($5
2))ERUUDUDSDJDGR(VWHSLWLGRFRQWLQXRGH
VHJXQGRVSXHGHFDQFHODUVH
3DUDFDQFHODUHOSLWLGRFRQWLQXRGHVHJXQGRV
3UHVLRQHORVERWRQHV%52,/+,/2DVDUDOWR
EDMR\%$.(KRUQHDUGHOKRUQRVXSHULRUDO
PLVPRWLHPSRKDVWDTXHHQODSDQWDOOD
SXHGDYHUVH6)
3UHVLRQHHOERWyQ%52,/DVDU/DSDQWDOOD
PXHVWUD&217,%((3SLWLGRFRQWLQXR
3UHVLRQHHOERWyQ%52,/DVDUGHQXHYR/D
SDQWDOODPXHVWUD6,1*/(%((3SLWLGR~QLFR
(VWRFDQFHODHOSLWLGRFDGDVHJXQGRV
3UHVLRQHHOERWyQ67$57LQLFLDU
9ROXPHQGHOWRQR
(VWDFDUDFWHUtVWLFDSHUPLWHUHJXODUHOYROXPHQGH
ORVWRQRVSDUDORJUDUXQYROXPHQPiVDFHSWDEOH
([LVWHQWUHVQLYHOHVGHYROXPHQGLIHUHQWHV
3UHVLRQHORVERWRQHV%52,/+,/2DVDUDOWR
EDMR\%$.(KRUQHDUGHOKRUQRVXSHULRUDO
PLVPRWLHPSRKDVWDTXHHQODSDQWDOODSXHGD
YHUVH6)
3UHVLRQHHOERWyQ&22.7,0(WLHPSRGH
FRFFLyQ(QODSDQWDOODSRGUiYHUVH67'%((3
3,7,'267'(VWHHVHOQLYHOGHYROXPHQPHGLR
7RXFKWKH&22.7,0(SDGDJDLQ7KLV
FKDQJHVWKHYROXPHOHYHOHDFKWLPHWKH
SDGLVWRXFKHGDQGDWRQHZLOOVRXQGWR
SURYLGHDQLQGLFDWLRQRIWKHYROXPHOHYHO
&KRRVHWKHGHVLUHGVRXQGOHYHO/2%((3
67'%((3+,%((3RU2))
3UHVLRQHHOERWyQ67$57LQLFLDUSDUDDFWLYDUHO
QLYHOHOHJLGR
&DUDFWHUtVWLFDVHVSHFLDOHVGHORVFRQWUROHVGHOKRUQR
KRUDVKRUDVREORTXHRGHOUHORM
6XVFRQWUROHVHVWiQFRQILJXUDGRVSDUDXVDUXQUHORM
GHKRUDV
6LSUHILHUHWHQHUXQUHORMGHHVWLORPLOLWDUGHKRUDV
RDQXODUODYLVXDOL]DFLyQGHOUHORMVLJDORVVLJXLHQWHV
SDVRV
3UHVLRQHORVERWRQHV%52,/+,/2DVDUDOWR
EDMR\%$.(KRUQHDUGHOKRUQRVXSHULRUDO
PLVPRWLHPSRKDVWDTXHHQODSDQWDOODSXHGD
YHUVH6)
3UHVLRQHHOERWyQ&/2&.UHORMXQDYH](QOD
SDQWDOODSRGUiYHUVHKU6LHVWDHVODRSFLyQ
TXHGHVHDSUHVLRQHHOERWyQ67$57LQLFLDU
3UHVLRQHHOERWyQ&/2&.UHORMGHQXHYRSDUD
FDPELDUDOUHORMHVWLORPLOLWDUGHKRUDV(QOD
SDQWDOODSRGUiYHUVHKU6LHVWDHVODRSFLyQTXH
GHVHDSUHVLRQHHOERWyQ67$57LQLFLDU
3UHVLRQHHOERWyQ&/2&.UHORMGHQXHYRSDUDDQXODU
ODYLVXDOL]DFLyQGHOUHORM(QODSDQWDOODSRGUiYHUVH
2))DSDJDGR6LHVWDHVODRSFLyQTXHGHVHD
SUHVLRQHHOERWyQ67$57LQLFLDU
127$6LHOUHORMVHHQFXHQWUDHQHOPRGRVLQ
YLVXDOL]DFLyQXVWHGQRSRGUiXWLOL]DUODIXQFLyQGH
LQLFLRUHWDUGDGR
&RQYHUVLyQ$XWRPiWLFDGH5HFHWDVŒHQDOJXQRVPRGHORV
$OXVDUHOKRUQHDGRSRUFRQYHFFLyQODIXQFLyQGH
&RQYHUVLyQ$XWR5HFLSHŠSRGUiDXWRPiWLFDPHQWH
FRQYHUWLUWHPSHUDWXUDVGHKRUQHDGRUHJXODU
LQJUHVDGDVDWHPSHUDWXUDVGHKRUQHDGRSRU
FRQYHFFLyQ/DSDQWDOODQRPRVWUDUiODWHPSHUDWXUD
FRQYHUWLGD6LHPSUHPRVWUDUiODWHPSHUDWXUD
LQJUHVDGD
3
UHVLRQHODWHFOD&219(&7,21&22.&RFFLyQ
SRU&RQYHFFLyQKDVWDTXHODSDQWDOODPXHVWUH
&2121&RQYHUVLyQ(QFHQGLGDR&212))
&RQYHUVLyQ$SDJDGDVHJ~QVHGHVHH
3UHVLRQHHOERWyQ67$57LQLFLDU
3DUDDFWLYDURGHVDFWLYDUODIXQFLyQ
3UHVLRQHORVERWRQHV%$.(KRUQHDU\%52,/
+,/2DVDUDOWREDMRGHOKRUQRVXSHULRUDO
PLVPRWLHPSRKDVWDTXHHQODSDQWDOODSXHGD
YHUVH6)
$SDJDGROXHJRGHKRUDV
&RQHVWDRSFLyQHQFDVRGHGHMDUVHHOKRUQR
HQFHQGLGRDFFLGHQWDOPHQWHHOFRQWUROORDSDJD
HQIRUPDDXWRPiWLFDOXHJRGHKRUDVGXUDQWH
IXQFLRQHVGHKRUQHDGRRGHVSXpVGHKRUDV
GXUDQWHODIXQFLyQGHDVDGR
6LGHVHDDSDJDU2))HVWDIXQFLyQVLJDORVSDVRV
VLJXLHQWHV
3UHVLRQHORVERWRQHV%52,/+,/2DVDUDOWR
EDMR\%$.(KRUQHDUGHOKRUQRVXSHULRUDO
PLVPRWLHPSRKDVWDTXHHQODSDQWDOOD
SXHGDYHUVH6)
3UHVLRQHHOERWyQ'(/$<67$57LQLFLR
UHWDUGDGRKDVWDTXHDSDUH]FDQRVKGQQR
DSDJDGRHQODSDQWDOOD
3UHVLRQHHOERWyQ67$57LQLFLDUSDUDDFWLYDU
ODFDUDFWHUtVWLFDGHQRDSDJDGR\GHMDUHO
FRQWUROFRQILJXUDGRHQHVWHPRGRGH
FDUDFWHUtVWLFDVHVSHFLDOHV
&yPRXVDUODIXQFLyQ6DEEDWKKRUQRVVXSHULRUHLQIHULRU
'LVHxDGDSDUDXWLOL]DUVHGXUDQWHHO6DEEDWKXRWUDV)LHVWDV-XGtDVHQDOJXQRVPRGHORV
*($SSOLDQFHVFRP
/DIXQFLyQ6DEEDWKVRODPHQWHSXHGHXWLOL]DUVHSDUDKRUQHDUURVWL]DU1RHVSRVLEOHXWLOL]DUODSDUDFRQYHFFLyQDVDGRDXWROLPSLH]DRFRFFLyQFRQ
LQLFLRUHWDUGDGR
127$/DOX]LQWHULRUGHOKRUQRVHHQFLHQGHDXWRPiWLFDPHQWHHQDOJXQRVPRGHORVFXDQGRVHDEUHODSXHUWD\VHDSDJDFXDQGRVHODFLHUUD3XHGH
TXLWDUVHODERPELOODGHOX]9HUODVHFFLyQGH5HHPSOD]RGHERPELOODGHOX](QORVPRGHORVFRQLQWHUUXSWRUGHOX]HQHOSDQHOGHFRQWUROODOX]GHO
KRUQRSXHGHHQFHQGHUVH\GHMDUVHDVt
&XDQGRODSDQWDOODPXHVWUDŠ
HOKRUQRHVWiFRQILJXUDGRSDUD
6DEEDWK&XDQGRODSDQWDOOD
PXHVWUDŠHOKRUQRHVWi
KRUQHDQGRURVWL]DQGR
$VHJ~UHVHGHTXHHOUHORMPXHVWUHODKRUDFRUUHFWD\TXH
HOKRUQRHVWpDSDJDGR
3UHVLRQH\VRVWHQJDORVERWRQHV%52,/+,/2
DVDUDOWREDMR\%$.(KRUQHDUDOPLVPRWLHPSR
KDVWDTXHHQODSDQWDOODSXHGDYHUVH6)
127$6LHQODSDQWDOODDSDUHFHQ%DNHKRUQHDUR
%URLODVDUORVERWRQHV%52,/+,/2DVDUDOWR
EDMR\%$.(KRUQHDUQRVHSUHVLRQDURQDOPLVPR
WLHPSR3UHVLRQHHOERWyQ&/($52))ERUUDU
DSDJDGR\FRPLHQFHGHQXHYR
3UHVLRQHHOERWyQ'(/$<67$57LQLFLRUHWDUGDGR
KDVWDTXHDSDUH]FD6$EE$W+HQODSDQWDOOD
3UHVLRQHHOERWyQ67$57LQLFLDU\ŠDSDUHFHUiHQ
ODSDQWDOOD(OKRUQRVHHQFXHQWUDDKRUDHQHO
PRGR6DEiWLFR
3UHVLRQHHOERWyQ%$.(KRUQHDU1RVHGDUiXQD
VHxDO
0HGLDQWHODVDOPRKDGLOODVQXPpULFDVLQJUHVHOD
WHPSHUDWXUDGHVHDGDHQWUHƒ)ƒ&\ƒ)
ƒ&1RVHGDUiQLQJXQDVHxDORWHPSHUDWXUD
1RKD\XQDWHPSHUDWXUDSUHGHWHUPLQDGD
3UHVLRQHHOERWyQ67$57LQLFLDUHQHOKRUQR
FRUUHVSRQGLHQWH
'HVSXpVGHXQSHUtRGRDOHDWRULRGH
DSUR[LPDGDPHQWHVHJXQGRVDPLQXWRŠ
DSDUHFHUiHQODSDQWDOODLQGLFDQGRTXHHOKRUQR
HVWiKRUQHDQGRURVWL]DQGR6LŠQRDSDUHFHHQ
ODSDQWDOODFRPLHQFHGHQXHYRHQHOSDVR
3DUDDMXVWDUODWHPSHUDWXUDGHOKRUQRSUHVLRQHHOERWyQ
%$.(KRUQHDULQJUHVHODQXHYDWHPSHUDWXUDXVDQGR
ODVDOPRKDGLOODVQXPpULFDV\SUHVLRQHHOERWyQ67$57
LQLFLDU
127$/RVERWRQHV&/($52))ERUUDUDSDJDGR\
&22.7,0(WLHPSRGHFRFFLyQVHHQFXHQWUDQDFWLYRV
GXUDQWHODIXQFLyQ6DEEDWK
&yPRGHVDFWLYDUODIXQFLyQ6DEEDWK
3UHVLRQHHOERWyQ&/($52))ERUUDUDSDJDGR
6LHOKRUQRHVWiFRFLQDQGRHVSHUHXQSHUtRGR
DOHDWRULRGHDSUR[LPDGDPHQWHVHJXQGRVD
PLQXWRKDVWDTXHVyORŠDSDUH]FDHQODSDQWDOOD
3UHVLRQH\VRVWHQJDORVERWRQHV%52,/+,/2
DVDUDOWREDMR\%$.(KRUQHDUDOPLVPRWLHPSR
KDVWDTXHHQODSDQWDOODSXHGDYHUVH6)
3UHVLRQHHOERWyQ'(/$<67$57LQLFLRUHWDUGDGR
KDVWDTXHVKGQRQRVKGQDSDUH]FDQHQOD
SDQWDOOD
(OLMDVKGQLQGLFDQGRTXHHOKRUQRVHDSDJDUi
DXWRPiWLFDPHQWHGHVSXpVGHKRUDVRQR
VKGQLQGLFDQGRTXHHOKRUQRQRVHDSDJDUi
DXWRPiWLFDPHQWHGHVSXpVGHKRUDV
3UHVLRQH67$57LQLFLDUFXDQGRODRSFLyQGHVHDGD
DSDUHFHHQODSDQWDOODVKGQRQRVKGQ
127$(QFDVRGHFRUWHGHHQHUJtDFRQODIXQFLyQ
GH6DEEDWKDFWLYDGDGLFKDIXQFLyQVHDSDJDUi
DXWRPiWLFDPHQWHD~QFXDQGRYXHOYDODHQHUJtD(O
FRQWUROGHOKRUQRGHEHYROYHUDFRQILJXUDUVH$OJXQRV
PRGHORVFRQWLQXDUiQHOPRGR6DEEDWKVLQHPEDUJRVL
VHDEUHODSXHUWDVHDFWLYDUiODOX]GHOKRUQR
&yPRSRQHUVHSDUDFRFFLyQFDOFXODGD
127$(VWHSURFHGLPLHQWRGHEHOOHYDUVHDFDER$17(6
GHTXHFRPLHQFHHO6DEEDWKSDUDSRGHUXWLOL]DUOD
FDUDFWHUtVWLFDGHKRUQHDGRFRQWHPSRUL]DGRUGXUDQWH
HO6DEEDWKODXQLGDG12GHEHFRORFDUVHHQHOPRGR
6DEEDWKGXUDQWHXQKRUQHDGRFRQWHPSRUL]DGRU
3UHVLRQH\VRVWHQJDORVERWRQHV%52,/+,/2
DVDUDOWREDMR\%$.(KRUQHDUDOPLVPRWLHPSR
KDVWDTXHHQODSDQWDOODSXHGDYHUVH6)
127$6LHQODSDQWDOODDSDUHFHQ%DNHKRUQHDUR
%URLODVDUORVERWRQHV%52,/+,/2DVDUDOWR
EDMR\%$.(KRUQHDUQRVHSUHVLRQDURQDOPLVPR
WLHPSR3UHVLRQHHOERWyQ&/($52))ERUUDU
DSDJDGR\FRPLHQFHGHQXHYR
3UHVLRQHHOERWyQ%52,/+,/2DVDUDOWREDMR
SDUDFDPELDUODFRQILJXUDFLyQGHOSLWLGRDE((3OD
FRQILJXUDFLyQSUHGHWHUPLQDGDHVSLWLGRFRQWLQXR
TXHVHYLVXDOL]DHQODSDQWDOODFRPR&RQE((3
3UHVLRQHHOERWyQ67$57LQLFLDUSDUDJXDUGDUORV
FDPELRV
3UHVLRQHHOERWyQ%$.(KRUQHDU
3UHVLRQHHOERWyQ67$57LQLFLDUHQHOKRUQR
FRUUHVSRQGLHQWH
3UHVLRQH&22.7,0(WLHPSRGHFRFFLyQSDUDHO
KRUQRFRUUHVSRQGLHQWH
3UHVLRQHODVDOPRKDGLOODVQXPpULFDVSDUD
FRQILJXUDUHOWLHPSRGHVHDGRGHFRFFLyQHQWUH
PLQXWR\KRUDV\PLQXWRV
3UHVLRQHHOERWyQ67$57LQLFLDU
3UHVLRQHHOERWyQ&/2&.UHORMSDUDSRGHU
YLVXDOL]DUODKRUDDFWXDO(VWRHVSDUDSRGHU
YLVXDOL]DUODKRUDDFWXDOHQOXJDUGHODFXHQWD
UHJUHVLYDGHOWHPSRUL]DGRUGHFRFFLyQ(OKRUQR
IXQFLRQDUiDODWHPSHUDWXUDFRQILJXUDGDSDUDOD
FDQWLGDGGHWLHPSRFRQILJXUDGD\GHVSXpVVH
DSDJDUi(QHOPRPHQWRHQTXHHOKRUQRVH
DSDJDHOSLWLGRVRQDUiYHFHV
3
UHVLRQHODVDOPRKDGLOODVQXPpULFDVSDUD
FRQILJXUDUODWHPSHUDWXUDGHVHDGD
&XLGDGR\OLPSLH]DGHODFRFLQD
$VHJ~UHVHGHTXHWRGRVORVFRQWUROHVHVWpQDSDJDGRV\TXHODVVXSHUILFLHVHVWpQIUtDVDQWHVGHOLPSLDUFXDOTXLHUSDUWHGHODFRFLQD
$'9(57(1&,$
6LVHTXLWDODFRFLQDSDUDHIHFWXDUXQDOLPSLH]DUHSDUDFLRQHVR
FXDOTXLHURWUDUD]yQYHULILTXHTXH
HOGLVSRVLWLYRDQWLYROFDGXUDVVHFRORTXHGHPDQHUDDGHFXDGD
FXDQGRYXHOYDDLQVWDODUVHODFRFLQD
6LQRWRPDHVWDSUHFDXFLyQODFRFLQDSXHGHYROFDUVH
\SURYRFDUOHVLRQHV
&yPRTXLWDUHOHQYROWRULRGHSURWHFFLyQ\ODFLQWDGHHPEDODMH
&RQFXLGDGRWRPHXQDSXQWDGHOHQYROWRULR
GHSURWHFFLyQFRQVXVGHGRV\OHQWDPHQWHTXtWHORGHOD
VXSHUILFLHGHODSDUDWR1RXVHHOHPHQWRVILORVRVSDUD
TXLWDUHOHQYROWRULR4XLWHWRGRHOHQYROWRULRDQWHVGH
XVDUHODSDUDWRSRUSULPHUDYH]
3DUDDVHJXUDUVHGHQRGDxDUHODFDEDGRGHOSURGXFWR
ODPHMRUIRUPDGHTXLWDUHOSHJDPHQWRGHODFLQWDGH
HPSDTXHGHORVDSDUDWRVQXHYRVFRQVLVWHHQDSOLFDU
GHWHUJHQWHSDUDYDMLOODVOtTXLGR$SOLTXHFRQXQSDxR
VXDYH\GHMHUHPRMDU
127$'HEHUHWLUDUVHHODGKHVLYRGHWRGDVODVSDUWHV
6LVHFDOLHQWDVHUiLPSRVLEOHGHTXLWDU
3DQHOGHFRQWURO
6LDVtORGHVHDSXHGHGHVDFWLYDUORVERWRQHVGHWRTXH
DQWHVGHODOLPSLH]D
9HUODLQIRUPDFLyQVREUH%ORTXHRGHFRQWUROHVHQOD
VHFFLyQ&yPRXVDUHOUHORMHOWHPSRUL]DGRU\HOEORTXHR
GHFRQWUROHVGHHVWHPDQXDO
/LPSLHORVGHUUDPHVFRQXQSDxRK~PHGR
7DPELpQSXHGHXWLOL]DUXQOLPSLDGRUGHYLGULRV
4XLWHVXFLHGDGHVPiVUHEHOGHVFRQDJXDWLELD
MDERQRVD1RXWLOLFHDEUDVLYRVGHQLQJXQDFODVH
9XHOYDDDFWLYDUORVERWRQHVGHWRTXHGHVSXpVGHOD
OLPSLH]D
6XSHUILFLHVSLQWDGDV
/DVVXSHUILFLHVSLQWDGDVLQFOX\HQORVODGRVGHODFRFLQD
\ODSXHUWDODSDUWHVXSHULRUGHOSDQHOGHFRQWURO\HO
IUHQWHGHOFDMyQ/tPSLHODVFRQMDEyQ\DJXDRFRQXQD
VROXFLyQGHDJXD\YLQDJUH
1RXWLOLFHOLPSLDGRUHVGHKRUQRFRPHUFLDOHVSROYRV
OLPSLDGRUHVHVSRQMLOODVGHDFHURRDEUDVLYRVSRWHQWHV
VREUHFXDOTXLHUVXSHUILFLHSLQWDGD
6XSHUILFLHVGHDFHURLQR[LGDEOHHQDOJXQRVPRGHORV
1RXWLOLFHDOPRKDGLOODVGHDFHURSRUTXHUD\DQ
ODVXSHUILFLH
3DUDOLPSLDUODVXSHUILFLHGHDFHURLQR[LGDEOH
XWLOLFHDJXDWLELDMDERQRVDRXQOLPSLDGRUR
OXVWUDGRUGHDFHURLQR[LGDEOH6LHPSUHOLPSLH
ODVXSHUILFLHHQGLUHFFLyQGHODYHWD6LJDODV
LQVWUXFFLRQHVGHOSURGXFWRSDUDOLPSLDUOD
VXSHUILFLHGHDFHURLQR[LGDEOH
3DUDFRQVXOWDUVREUHODFRPSUDGHOLPSLDGRUHV
ROXVWUDGRUHVGHDSDUDWRVGHDFHURLQR[LGDEOHR
SDUDHQFRQWUDUODXELFDFLyQGHOGLVWULEXLGRUPiV
FHUFDQRDVXGRPLFLOLROODPHDQXHVWURQ~PHUR
JUDWXLWR
&HQWURQDFLRQDOGHUHSXHVWRV
*($SSOLDQFHVFRP
(VWXIDGHHVPDOWHGHSRUFHODQDHQDOJXQRVPRGHORV
(ODFDEDGRGHHVPDOWHGHSRUFHODQDHV
UHVLVWHQWHSHURSXHGHURPSHUVHVLVHXWLOL]D
LQFRUUHFWDPHQWH(VWHDFDEDGRHVUHVLVWHQWH
DOiFLGR6LQHPEDUJRQRGHEHSHUPLWLUVHTXH
DOJXQRVDOLPHQWRViFLGRVTXH
VHGHUUDPDQFRPRMXJRVGHIUXWDWRPDWHR
YLQDJUHSHUPDQH]FDQHQHODFDEDGR
6LVHGHUUDPDQiFLGRVHQODHVWXIDPLHQWUDVHVWi
FDOLHQWHXWLOLFHXQDWRDOODGHSDSHORXQSDxR
VHFRVSDUDOLPSLDUORHQHOPRPHQWR&XDQGR
ODVXSHUILFLHVHKD\DHQIULDGROLPSLHFRQDJXD
MDERQRVD(QMXDJXHELHQ
(QHOFDVRGHRWURVGHUUDPHVFRPRVDOSLFDGXUDV
GHJUDVDHWFOLPSLHFRQDJXDMDERQRVDRSROYRV
OLPSLDGRUHVFXDQGRODVXSHUILFLHVHKD\DHQIULDGR
(QMXDJXHELHQ3XODFRQXQSDxRVHFR
*($SSOLDQFHVFRP
$'9(57(1&,$
35(&$8&,Ï1
5HFHSWiFXOR
3RUWDOiPSDUD
%RPELOOD
GH*
/HQJHWD
&XELHUWDGHYLGULR
HQDOJXQDVPRGHORV
5HFHSWiFXOR
3RUWDOiPSDUD
%RPELOOD
GH*
/HQJHWD
&XELHUWDGHYLGULR
3(/,*52'('(6&$5*$(/e&75,&$248(0$'85$6$QWHVGHUHHPSOD]DUODERPELOOD
GHOKRUQRGHVFRQHFWHODDOLPHQWDFLyQGHHQHUJtDDOKRUQRGHVGHHOSDQHOSULQFLSDO
GHIXVLEOHVRGHOLQWHUUXSWRUGHFLUFXLWRV1RKDFHUORSXHGHSURYRFDUXQDGHVFDUJD
HOpFWULFDRXQDTXHPDGXUD
3(/,*52'(48(0$'85$6/DWDSDGHYLGULR\ODOiPSDUDGHOX]VHGHEHUiQUHWLUDUFXDQGR
HVWpQIUtDV7RFDUHOYLGULRFDOLHQWHVLQSURWHFFLyQHQODVPDQRVRFRQXQWUDSRK~PHGR
SXHGHRFDVLRQDUTXHPDGXUDV
5HHPSOD]RGHODERPELOODGHOKRUQRHQDOJXQRVPRGHORV
3DUDUHWLUDU
*LUHODFXELHUWDGHYLGULRHQVHQWLGRFRQWUDULR
DODVPDQHFLOODVGHOUHORMGHYXHOWDKDVWD
TXHODVOHQJHWDVGHODFXELHUWDGHYLGULR
OLEHUHQORVVXUFRVGHOSRUWDOiPSDUDV
&RORFDUVHJXDQWHVGHOiWH[SXHGHEULQGDU
XQPHMRUDJDUUH
8WLOL]DQGRJXDQWHVRXQSDxRVHFRUHPXHYD
ODERPELOODMDOiQGRODHQOtQHDUHFWD
3DUDUHHPSOD]DU
8WLOLFHXQDQXHYDERPELOODKDOyJHQDGH
YROWLRVQRH[FHGDYDWLRV
5HHPSODFHODOiPSDUDGHOX]FRQHOPLVPR
WLSRGHOiPSDUDTXHVHUHWLUy(QVXPRGHOR
FRUUHVSRQGHUiXQRGHORVGRVWLSRVTXH
ILJXUDQDODL]TXLHUGD3DUDGHWHUPLQDUFXiO
HVODOiPSDUDFRUUHFWDFRQWUROHODV
WHUPLQDOHVGHODOiPSDUD/DVOiPSDUDVFRQ
WHUPLQDOHVFRQFODYLMDVUHFWDVVRQOiPSDUDV
GH*/DVOiPSDUDVFRQWHUPLQDOHVFRQ
FODYLMDVFRQFXUYDVVRQOiPSDUDVGH*1R
ODVLQWHUFDPELH$VHJ~UHVHDOUHHPSOD]DUOD
OiPSDUDTXHVHDGHYROWVRYROWV
12GHYROWV
8WLOL]DQGRJXDQWHVRXQSDxRVHFRUHPXHYD
ODERPELOODGHVXSDTXHWH1RWRTXHOD
ERPELOODFRQORVGHGRVGHVQXGRV(ODFHLWH
SDUDSLHOGDxDUiODOiPSDUD\DFRUWDUiVX
WLHPSRGHGXUDFLyQ
HQDOJXQDVPRGHORV
5HFHSWiFXOR
8VH
JXDQWHV
RXQ
SDxR
(PSXMHODERPELOODHQOtQHDUHFWDGHQWURGHO
UHFHSWiFXORKDVWDHOWRSH
&RORTXHODVOHQJHWDVGHODFXELHUWDGH
YLGULRGHQWURGHORVVXUFRVGHO
SRUWDOiPSDUDV*LUHODFXELHUWDGHYLGULRHQ
VHQWLGRGHODVPDQHFLOODVGHOUHORMGH
YXHOWD
3DUDXQDPHMRULOXPLQDFLyQGHQWURGHO
KRUQROLPSLHIUHFXHQWHPHQWHODFXELHUWD
GHYLGULRXWLOL]DQGRXQSDxRK~PHGR(VWR
GHEHUtDKDFHUVHFXDQGRHOKRUQRHVWi
FRPSOHWDPHQWHIUtR
&RQHFWHQXHYDPHQWHHOVXPLQLVWURHOpFWULFR
DOKRUQR
5HHPSOD]RGHODERPELOODGHOKRUQRHQDOJXQRVPRGHORV
9HULILTXHTXHODWDSDGHODOiPSDUD\OD
ERPELOODVHKD\DQHQIULDGRSRUFRPSOHWR
3DUDTXLWDUODWDSD
+DJDJLUDUODOHQWHHQóGHYXHOWDHQ
VHQWLGRDQWLKRUDULRSDUDTXLWDUOD
3DUDYROYHUDFRORFDUODWDSD
$OLQHHODVOHQJHWDVGHODOHQWHIUHQWHDODV
OHQJHWDVGHODFDUFDVD\JLUHHQVHQWLGR
KRUDULRSDUDWUDEDU
1RTXLWHQLQJ~QWRUQLOORSDUDVDFDUODWDSD
&RORTXHXQDERPELOODGHYDWLRVRXQD
ERPELOODKDOyJHQDGHGRVHVSLJDVVHJ~Q
FRUUHVSRQGD
&XLGDGR\OLPSLH]DGHODFRFLQD
&yPROLPSLDUODSXHUWDGHOKRUQR
3DUDOLPSLDUODSDUWHLQWHUQDGHODSXHUWD
„'HELGRDTXHHOiUHDTXHVHHQFXHQWUD
GHQWURGHODMXQWDVHOLPSLDGXUDQWHHOFLFORGH
DXWROLPSLH]DQRHVQHFHVDULROLPSLDUODDPDQR
/DMXQWDHVWiGLVHxDGDFRQXQHVSDFLR
HQODSDUWHLQIHULRUSDUDSHUPLWLUXQD
DGHFXDGDFLUFXODFLyQGHDLUH
1RIURWHROLPSLHODMXQWDGHODSXHUWD
SRUTXHWLHQHXQDUHVLVWHQFLDPX\EDMD
DODDEUDVLyQ
6LVHDGYLHUWHTXHODMXQWDHVWi
GHVJDVWDGDUDtGDRGDxDGDRVLVH
KDGHVSOD]DGRGHVXOXJDUVHODGHEH
UHHPSOD]DU
„
(OiUHDTXHVHHQFXHQWUDIXHUDGHODMXQWD
\HOEXUOHWHGHODSXHUWDSXHGHQOLPSLDUVHFRQ
XQDHVSRQMLOODSOiVWLFDFRQMDEyQDJXDFDOLHQWH
\GHWHUJHQWH(QMXDJXHELHQFRQXQDVROXFLyQGH
DJXD\YLQDJUH
3DUDOLPSLDUODSDUWHH[WHUQDGHODSXHUWD
ODVHFFLyQGHYHQWLODFLyQGHODSXHUWDXWLOLFH
XQOLPSLDGRUDEUDVLYRVXDYH\XQDHVSRQMDSDUD
REWHQHUORVPHMRUHVUHVXOWDGRV
„
/DVVDOSLFDGXUDVGHVDOVDVMXJRVGHIUXWDVVDOVDV
GHWRPDWH\MXJRVGHDOLPHQWRVTXHFRQWLHQHQ
iFLGRVSXHGHQGHFRORUDUODVXSHUILFLHSRUORTXH
VHGHEHHQMXDJDUORVGHLQPHGLDWR&XDQGROD
VXSHUILFLHHVWpIUtDOLPSLH\HQMXDJXH
„
1RXWLOLFHOLPSLDGRUHVSDUDKRUQRVSROYRV
OLPSLDGRUHVRDEUDVLYRVSRWHQWHVHQODSDUWH
H[WHUQDGHODSXHUWD
„
8WLOLFHMDEyQ\DJXDSDUDOLPSLDUFXLGDGRVDPHQWH
ODSDUWHVXSHULRUORVODGRV\HOIUHQWHGHODSXHUWD
GHOKRUQR(QMXDJXHELHQ7DPELpQHVSRVLEOH
XWLOL]DUXQOLPSLDGRUGHYLGULRVSDUDOLPSLDUODSDUWH
H[WHULRUGHODSXHUWD1RSHUPLWDTXHFDLJDDJXD
VREUHODVDEHUWXUDVGHYHQWLODFLyQ
„
6LTXHGDDOJXQDPDQFKDSHUVLVWHQWHHQ
3XHUWDGHOKRUQRGHVPRQWDEOHHQDOJXQRVPRGHORV
/DSXHUWDHVPX\SHVDGD7HQJDFXLGDGRDOTXLWDU\
OHYDQWDUODSXHUWD
1ROHYDQWHODSXHUWDGHODPDQLMD
3DUDTXLWDUODSXHUWD
5DQXUD
7UDEDGH
ODELVDJUD
7LUHODVWUDEDVGHODELVDJUDKDFLD
DEDMRSDUDGHVWUDEDU
$EUDODSXHUWDSRUFRPSOHWR
3UHVLRQHODVWUDEDVGHODELVDJUDKDFLDDEDMRHQ
GLUHFFLyQGHOPDUFRGHODSXHUWDKDVWD
GHVWUDEDUODV3XHGHQHFHVLWDUVHXQDKHUUDPLHQWD
FRPRXQGHVWRUQLOODGRUSODQRSHTXHxR
7RPHFRQILUPH]DDPERVODGRVGHODSXHUWDGHOD
SDUWHVXSHULRU
&LHUUHODSXHUWDKDVWDODSRVLFLyQGHUHPRFLyQGH
SXHUWDTXHHVDPLWDGGHFDPLQRHQWUHOD
SRVLFLyQGHDVDGR\ODSXHUWDFHUUDGD
/HYDQWHODSXHUWDKDVWDTXHHOEUD]RGHOD
ELVDJUDKD\DVDOLGRGHODUDQXUD
3DUDYROYHUDFRORFDUODSXHUWD
7RPHFRQILUPH]DDPERVODGRVGHODSXHUWDGHOD
SDUWHVXSHULRU
3RVLFLyQGHUHPRFLyQ
&RQODSXHUWDHQ ([WUHPR
%UD]RGH
HOPLVPRiQJXOR LQIHULRUGH
ODELVDJUD
GHODSRVLFLyQGH ODUDQXUD
UHPRFLyQ
LQWURGX]FD
ODPXHVFDGHOEUD]R
GHODELVDJUDGHQWUR
0XHVFD
GHOH[WUHPRLQIHULRUGHOD
UDQXUDGHODELVDJUD/D
UDQXUDGHOEUD]RGHOD
ELVDJUDGHEH
HVWDUELHQFRORFDGDHQODSDUWHLQIHULRU
GHODUDQXUD
$EUDODSXHUWDSRUFRPSOHWR6LODSXHUWD
QRVHDEUHSRUFRPSOHWRODPXHVFDQRHVWiELHQ
FRORFDGDHQHOH[WUHPRLQIHULRUGH
ODUDQXUD
3UHVLRQHODVWUDEDVGHODELVDJUDKDFLDDUULED
FRQWUDHOPDUFRIURQWDOGHODFDYLGDGGHOKRUQR
KDVWDDOFDQ]DUODSRVLFLyQGHEORTXHR
7UDEDGH
ODELVDJUD
%UD]RGH
ODELVDJUD
3UHVLRQHODVWUDEDVGHODELVDJUD
KDFLDDUULEDSDUDEORTXHDU
&LHUUHODSXHUWDGHOKRUQR
*($SSOLDQFHVFRP
3XHUWDGHOKRUQRVXSHULRUGHVPRQWDEOHHQDOJXQRVPRGHORV
3DUDTXLWDUODSXHUWD
0DUFR
GHO
KRUQR
$EUDODSXHUWDSRUFRPSOHWR
/HYDQWHODWUDEDGHODELVDJUDKDFLDHOPDUFR
GHOKRUQRKDVWDTXHVHGHWHQJD
&LHUUHODSXHUWDHQJUDGRVVHVHQWLUiHO
WRSHGHODSXHUWD/DWUDEDGHODELVDJUD
KDUiFRQWDFWRFRQHOPDUFRGHOKRUQR
6REUHDPERVODGRVGHODSXHUWDSUHVLRQH
KDFLDDEDMRVREUHORVERWRQHVGHOLEHUDFLyQ
GHFDGDELVDJUD
/HYDQWHODSXHUWDKDFLDDUULEDKDVWDTXHVH
VDOJDGHODELVDJUD
0DUFR
GHOD
SXHUWD
%RWRQHVGH
OLEHUDFLyQ
7LUHGHORVEUD]RVGHODELVDJUDVXDYHPHQWH
SDUDOLEHUDUSUHVLyQVREUHODVOHQJHWDVGH
EORTXHR
3UHVLRQHODVWUDEDVGHODELVDJUDKDFLDDEDMR
GHQWURGHODELVDJUD
3UHVLRQHODVELVDJUDVKDFLDODXQLGDGSDUD
TXHVHFLHUUHQ
3DUDYROYHUDFRORFDUODSXHUWD
7LUHGHODVELVDJUDVKDFLDDEDMRHQVHQWLGR
FRQWUDULRGHOPDUFRGHOKRUQRKDVWDDOFDQ]DU
ODSRVLFLyQDELHUWDWRWDO
/HYDQWHODVWUDEDVGHODELVDJUDKDFLD
HOPDUFRGHOKRUQRKDVWDTXHVHGHWHQJDQ
/DVELVDJUDVVHOLEHUDQHQODSRVLFLyQ
GHJUDGRV/DVWUDEDVGHODELVDJUDKDUiQ
FRQWDFWRFRQHOPDUFRGHOKRUQR
'HVOLFHODSXHUWDGHQWURGHODVELVDJUDV
$VHJ~UHVHGHTXHORVERWRQHVYXHOYDQD
VDOLU
$EUDODSXHUWDSRUFRPSOHWR
3UHVLRQHODVWUDEDVGHODELVDJUDKDFLDDEDMR
GHQWURGHODELVDJUD
&LHUUHODSXHUWDGHOKRUQR
3UHVLRQH
KDFLD
DGHQWUR
7LUHKDFLD
DEDMR
&XLGDGR\OLPSLH]DGHODFRFLQD
%DQGHMDSODQD
0DQLMDV
3DUDKRUQRVGREOHVXVHODSDULOODFRQ
ODVGRVPDQLMDVIURQWDOHVHQHOKRUQR
VXSHULRU
%DQGHMDVGHOKRUQR
7RGDVODVEDQGHMDVGHOKRUQRSXHGHQOLPSLDUVHD
PDQRFRQXQOLPSLDGRUDEUDVLYRRXQDHVSRQMLOOD
GHDFHUR'HVSXpVGHOLPSLDUHQMXDJXHODV
EDQGHMDVFRQDJXDOLPSLD\VpTXHODVFRQXQSDxR
OLPSLR/DVEDQGHMDVUHYHVWLGDVGHSRUFHODQDJULV
SXHGHQSHUPDQHFHUHQHOKRUQRGXUDQWHHOFLFOR
GHDXWROLPSLH]DVLQVXIULUGDxRV/DVEDQGHMDVGHO
KRUQRGHQtTXHOSXHGHQSHUPDQHFHUHQHOKRUQR
GXUDQWHHOFLFORGHDXWROLPSLH]DSHURSHUGHUiQHO
OXVWUH\UHVXOWDUiGLItFLOGHVOL]DUODV6HUiQHFHVDULR
HQJUDVDUWRGRVORVH[WUHPRVGHODVEDQGHMDVFRQ
XQDFDSDGHDFHLWHYHJHWDOVXDYHGHVSXpVGH
OLPSLDUODVDPDQRRHQHOKRUQR(VWRD\XGDUiD
PDQWHQHUHOIiFLOGHVOL]DPLHQWRGHODVEDQGHMDV
3DUDKRUQRVGREOHVXVHODSDULOODVLQ
ODVGRVPDQLMDVIURQWDOHVHQHOKRUQR
LQIHULRU
3DUULOODGHH[WHQVLyQHQDOJXQRVPRGHORV
/DVSDUULOODVGHH[WHQVLyQVHSRGUiQOLPSLDUDPDQR
FRQXQOLPSLDGRUDEUDVLYRRHVWURSDMR'XUDQWHOD
OLPSLH]DHYLWHTXHLQJUHVHDJXDROLPSLDGRUHQODV
EDUUDVGHVOL]DQWHVGHH[WHQVLyQDORVFRVWDGRVGHOD
SDUULOOD
127$1RODODYHHQHOODYDYDMLOODV
6LUHVXOWDGLItFLOGHVOL]DUODSDUULOODRVLUHVXOWDGLItFLO
DFFLRQDUODSDOHWDGHEHOXEULFDUVHODSDUULOOD
XWLOL]DQGRHOOXEULFDQWHGHJUDILWRHQYLDGRFRQVX
KRUQR3DUDVROLFLWDUOXEULFDQWHGHJUDILWRDGLFLRQDO
OODPHDQXHVWURFHQWURQDFLRQDOGHUHSXHVWRVDO
FRQODUHIHUHQFLD:%7
6LUHWLUDURUHHPSOD]DUODSDUULOODUHVXOWDGLItFLO
OLPSLHOLJHUDPHQWHORVVRSRUWHVGHODSDUULOODFRQ
DFHLWHGHFRFLQD1RSDVHDFHLWHGHFRFFLyQHQORV
GHVOL]DGRUHV
3DUDOXEULFDUORVGHVOL]DGRUHV
127$1RURFtHODSDUULOODGHH[WHQVLyQFRQ
SXOYHUL]DGRUSDUDFRFFLyQXRWURVOXEULFDQWHVHQ
VSUD\
4XLWHODSDUULOODGHOKRUQR9HU3DUULOODGH
H[WHQVLyQHQODVHFFLyQ8VRGHOKRUQR
([WLHQGDSRUFRPSOHWRODSDUULOODVREUHXQD
PHVDRPRVWUDGRUGHHQFLPHUD3XHGH
FRORFDUVHSDSHOGHGLDULRGHEDMRGHODSDUULOOD
SDUDXQDOLPSLH]DVHQFLOOD
6LKD\UHVLGXRVHQODVJXtDVGHGHVOL]DPLHQWR
OtPSLHODVFRQXQDWRDOODGHSDSHO
127$7RGRHOOXEULFDQWHGHJUDILWRHOLPLQDGR
GXUDQWHODOLPSLH]DGHEHYROYHUDFRORFDUVH
VHHVWHSVWKURXJK
$JLWHHOOXEULFDQWHGHJUDILWRDQWHVGHDEULUOR
&RPHQ]DQGRFRQHOPHFDQLVPRGH
GHVOL]DPLHQWRL]TXLHUGRGHODSDUULOODFRORTXH
FXDWURJRWDVGHOXEULFDQWHVREUHODVGRV
JXtDVWUDVHUDVFHUFDQDVDORVFRMLQHWHVGH
DSR\R
5HSLWDHQHOPHFDQLVPRGHOODGRGHUHFKRGH
ODJXtD
/DGRL]TXLHUGR
*XtDODGRGHUHFKRDUULED
/DGRGHUHFKR
*XtDODGRGHUHFKRDUULED
$EUD\FLHUUHODJXtDYDULDVYHFHVSDUD
GLVWULEXLUHOOXEULFDQWH
9XHOYDDFRORFDUODWDSDGHOOXEULFDQWH\
DJtWHORQXHYDPHQWH'pYXHOWDODSDUULOOD\
UHSLWDORVSDVRV\
&LHUUHODSDUULOODJLUHODSDUULOODGHMDQGRHO
ODGRGHUHFKRKDFLDDUULED\FROyTXHODHQHO
KRUQR9HU3DUULOODGHH[WHQVLyQHQODVHFFLyQ
8VRGHOKRUQR
3DUDOXEULFDUODSDOHWD
$JLWHHOOXEULFDQWH\DSOLTXHHOPLVPRDODVSDUWHV
PyYLOHVGHORVPHFDQLVPRVGHODVSDOHWDVFRPRVH
PXHVWUD
*($SSOLDQFHVFRP
(OHPHQWRVFDOHQWDGRUHVGHOKRUQR
1ROLPSLHHOHOHPHQWRSDUDKRUQHDURHO
HOHPHQWRSDUDDVDU/DVVXFLHGDGHVVH
TXHPDUiQFXDQGRVHFDOLHQWHQORVHOHPHQWRV
3DUDOLPSLDUHOSLVRGHOKRUQRHOHYH
VXDYHPHQWHHOHOHPHQWRDKRUQHDU(QDOJXQRV
PRGHORVHOHOHPHQWRDKRUQHDUQRHVWi
H[SXHVWR\VHHQFXHQWUDGHEDMRGHOSLVRGHO
VXHOR/LPSLHFRQDJXDFDOLHQWH\MDEyQ
/LPSLHFRQXQSDxRORVGHVHFKRV
UHEHOGHVDFXPXODGRVHQHOSLVRGHO
KRUQR
9HQWLODFLyQGHOKRUQRHQHVWXIDVGHYLGULRUDGLDQWHV
7RGRVORVPRGHORVFXHQWDQFRQXQDYHQWLODFLyQSDUD
KRUQRXELFDGDGHWUiVGHODXQLGDGVXSHUILFLDOWUDVHUD
GHUHFKD(QKRUQRVGREOHVKD\XQDYHQWLODFLyQGH
KRUQRDGLFLRQDOSDUDHOKRUQRVXSHULRUGHWUiVGHOD
XQLGDGVXSHUILFLDOWUDVHUDL]TXLHUGD
(VWDiUHDSXHGHFDOHQWDUVHGXUDQWHHOXVRGHO
KRUQR
(VQRUPDOTXHVDOJDYDSRUGHODYHQWLODFLyQ
\SXHGHMXQWDUVHKXPHGDGGHEDMRGHODPLVPD
FXDQGRHOKRUQRHVWiHQXVR
/DYHQWLODFLyQHVLPSRUWDQWHSDUDORJUDUXQD
DGHFXDGDFLUFXODFLyQGHDLUH1XQFDEORTXHHHVWD
YHQWLODFLyQ
5HPRFLyQGHOFDMyQGHDOPDFHQDPLHQWRHQDOJXQRVPRGHORV
5LHO
*XtDGHWRSH
3DUDTXLWDUHOFDMyQ
7LUHGHOFDMyQKDFLDIXHUDKDVWDTXHVH
GHWHQJD
/HYDQWHHOIUHQWHGHOFDMyQKDVWDTXHODV
WUDEDVVDOJDQGHODVJXtDV
5HWLUHHOFDMyQ
3DUDYROYHUDFRORFDUHOFDMyQ
&RORTXHORVULHOHVGHOFDMyQHQODVJXtDV
(PSXMHHOFDMyQKDVWDTXHVHGHWHQJD
/HYDQWHHOIUHQWHGHOFDMyQ\HPSXMHKDVWD
TXHODVWUDEDVVXSHUHQODVJXtDV
%DMHHOIUHQWHGHOFDMyQ\HPSXMHKDFLDDEDMR
KDVWDTXHFLHUUH
&DMyQFDOHQWDGRUGHVPRQWDEOH2OODGHO&DMyQHQDOJXQRVPRGHORV
127$(QORVPRGHORVFRQFDMyQFDOHQWDGRU
HOpFWULFRDQWHVGHUHDOL]DUFXDOTXLHUFODVH
GHDMXVWHOLPSLH]DRUHSDUDFLyQGHVFRQHFWH
ODFRQH[LyQHOpFWULFDGHODFRFLQDGHVGHHO
SDQHOGHGLVWULEXFLyQGRPpVWLFRTXLWDQGR
HOIXVLEOHRGHVFRQHFWDQGRHOLQWHUUXSWRU
GHFLUFXLWRV9HULILTXHTXHHOHOHPHQWR
FDOHQWDGRUGHOFDMyQHVWpIUtR
127$'HMHTXHHOFDMyQFDOHQWDGRUVHHQIUtHQ
DQWHVGHTXLWDUHOUHFLSLHQWH
127$/LPSLHORVGHUUDPHVUiSLGDPHQWH
GHVSXpVGHFDGDXVR
„1XQFDFRORTXHXWLOLFHROLPSLHPHGLDQWHOD
FDUDFWHUtVWLFDGHDXWROLPSLH]DHOUHFLSLHQWH
GHOFDMyQHQHOKRUQRVXSHULRU
„(OFDMyQFDOHQWDGRUFXHQWDQFRQXQ
UHFLSLHQWHGHVPRQWDEOHSDUDXQDOLPSLH]D
IiFLO/LPSLHFRQDJXDMDERQRVDFDOLHQWH\
XQDHVSRQMDRUHSDVDGRU6HTXHFRQXQSDxR
VXDYH\OLPSLR9XHOYDDFRORFDUHOUHFLSLHQWH
HQHOFDMyQFDOHQWDGRURHOFDMyQGHOKRUQR
LQIHULRU
&yPROLPSLDUODHVWXIDGHYLGULRHQDOJXQRVPRGHORV
/LPSLH]DQRUPDOGHXVRGLDULR
6Ï/2XWLOLFHHOOLPSLDGRUGHHVWXIDVFHUiPLFDV
&(5$0$%5<7(ŠHQODHVWXIDGHYLGULR2WUDV
FUHPDVSXHGHQQRVHUWDQHIHFWLYDV
3DUDPDQWHQHU\SURWHJHUODVXSHUILFLHGHVX
HVWXIDGHYLGULRVLJDHVWRVSDVRV
/LPSLHODHVWXIDGHVSXpV
GHFDGDGHUUDPH8WLOLFH
HOOLPSLDGRUGHHVWXIDV
FHUiPLFDV&(5$0$%5<7(Š
$QWHVGHXVDUODHVWXIDSRUSULPHUDYH]
OtPSLHODFRQHOOLPSLDGRUGHHVWXIDV
FHUiPLFDV&(5$0$%5<7(Š(VWRD\XGDD
SURWHJHUODHVWXID\KDFHODOLPSLH]DPiV
VHQFLOOD
(OXVRGLDULRGHOOLPSLDGRUGHHVWXIDV
FHUiPLFDV&(5$0$%5<7(ŠD\XGDUiD
TXHODHVWXIDTXHGHFRPRQXHYD
$JLWHELHQODFUHPDGHOLPSLH]D$SOLTXH
XQDVJRWDVGHOOLPSLDGRUGHHVWXIDV
FHUiPLFDV&(5$0$%5<7(ŠGLUHFWDPHQWH
VREUHODHVWXID
8WLOLFHXQDWRDOODGHSDSHORXQSDxRGH
OLPSLH]D&(5$0$%5<7(ŠSDUDHVWXIDV
FHUiPLFDVSDUDOLPSLDUWRGDODVXSHUILFLH
GHODHVWXID
8VHXQSDxRVHFRRXQDWRDOODGHSDSHO
SDUDTXLWDUORVUHVWRVGHOOLPSLDGRU1R
KDFHIDOWDHQMXDJDU
127$(VPX\LPSRUWDQWHTXH12&$/,(17(
ODHVWXIDKDVWDTXHODKD\DOLPSLDGRSRU
FRPSOHWR
5HVLGXRVSHJDGRV
127$8VWHGSXHGH'$³$5ODVXSHUILFLHGH
YLGULRVLXWLOL]DHVSRQMLOODVTXHQRVHDQODV
UHFRPHQGDGDV
'HMHHQIULDUODHVWXID
8WLOLFHXQSDxRGHOLPSLH]D&(5$0$
%5<7(ŠSDUDHVWXIDVFHUiPLFDV
&RORTXHXQDVJRWDVGHOOLPSLDGRUGH
HVWXIDVFHUiPLFDV&(5$0$%5<7(Š
VREUHWRGDHOiUHDGHUHVLGXRVSHJDGRV
8WLOL]DQGRHOSDxRGHOLPSLH]D&(5$0$
%5<7(ŠSDUDHVWXIDVFHUiPLFDVLQFOXLGR
IURWHHOiUHDVXFLDDSOLFDQGRSUHVLyQ
VHJ~QVHDQHFHVDULR
5HVLGXRVSHJDGRVUHEHOGHV
'HMHHQIULDUODHVWXID
(OUDVSDGRUGHHVWXIDVFHUiPLFDV
&(5$0$%5<7(Š\WRGRVORV
LQVXPRVUHFRPHQGDGRVVH
HQFXHQWUDQGLVSRQLEOHVHQ
QXHVWUR&HQWURGH5HSXHVWRV
9HULQVWUXFFLRQHVEDMRODVHFFLyQ
´3DUDVROLFLWDUUHSXHVWRVµHQOD
SiJLQDVLJXLHQWH
127$1RXWLOLFHKRMDVGHVDILODGDV
RGDxDGDV
8WLOLFHHOUDVSDGRUGHILOR~QLFRDXQ
iQJXORDSUR[LPDGRGHGHJUHHV
FRQWUDODVXSHUILFLHGHOYLGULR\UDVSHOD
VXFLHGDG3XHGHVHUQHFHVDULRDSOLFDU
SUHVLyQDOUDVSDGRUSDUDTXLWDUOD
VXFLHGDG
'HVSXpVGHXWLOL]DUHOUDVSDGRUFRORTXH
XQDVJRWDVGHOLPSLDGRUGHHVWXIDV
FHUiPLFDV&(5$0$%5<7(ŠVREUHWRGD
HOiUHDGHVXFLHGDGTXHPDGD8WLOLFHHO
SDxRGHOLPSLH]D&(5$0$%5<7(ŠSDUD
TXLWDUODVXFLHGDGUHVWDQWH
3DUDSURWHFFLyQDGLFLRQDOGHVSXpVGH
KDEHUTXLWDGRWRGRVORVUHVWRVSXOD
WRGDODVXSHUILFLHFRQOLPSLDGRUGH
HVWXIDVFHUiPLFDV&(5$0$%5<7(Š\
XQDWRDOODGHSDSHO
6LTXHGDQUHVWRVUHSLWDORVSDVRV
LQGLFDGRVFRQDQWHULRULGDG
3DUDSURWHFFLyQDGLFLRQDOGHVSXpVGH
KDEHUTXLWDGRWRGRVORVUHVWRVSXOD
WRGDODVXSHUILFLHFRQOLPSLDGRUGH
HVWXIDVFHUiPLFDV&(5$0$%5<7(Š\
XQDWRDOOD
GHSDSHO
*($SSOLDQFHVFRP
0DUFDVGHPHWDO\UD\RQHV
7HQJDFXLGDGRGHQRGHVOL]DUROODV\
VDUWHQHVDWUDYpVGHVXHVWXID'HMDUi
PDUFDVGHPHWDOVREUHODVXSHUILFLHGHOD
HVWXID
(VWDVPDUFDVSXHGHQTXLWDUVHXWLOL]DQGR
OLPSLDGRUGHHVWXIDVFHUiPLFDV&(5$0$
%5<7(ŠFRQHOSDxRGHOLPSLH]D&(5$0$
%5<7(ŠSDUDHVWXIDVFHUiPLFDV
6LVHSHUPLWHTXHROODVFRQXQDFDSDILQD
GHDOXPLQLRRFREUHKLHUYDQHQVHFROD
FDSDSXHGHGHMDUXQDGHFRORUDFLyQ
QHJUDHQODHVWXID
(VWRGHEHTXLWDUVHGHLQPHGLDWRDQWHV
GHFDOHQWDUGHQXHYRRODGHFRORUDFLyQ
SXHGHOOHJDUDVHUSHUPDQHQWH
127$9HULILTXHFRQGHWHQLPLHQWRTXHODEDVH
GHODVROODVQRVHDiVSHUDSDUDQRUD\DUOD
HVWXID
6HOODGRGHODHVWXID
3DUDOLPSLDUHOVHOODGRGHODHVWXIDDOUHGHGRU
GHORVERUGHVGHYLGULRFRORTXHXQSDxR
K~PHGRVREUHORVPLVPRVGXUDQWHXQRV
PLQXWRV\OXHJROLPSLHFRQOLPSLDGRUHVQR
DEUDVLYRV
6XSHUILFLHGHYLGULRSRVLELOLGDGHVGHGDxRSHUPDQHQWH
/RVGHUUDPHVD]XFDUDGRV
FRPRJHODWLQDVGXOFH
FDUDPHORMDUDEHVRSOiVWLFRV
GHUUHWLGRVSXHGHQPDUFDU
ODVXSHUILFLHGHODHVWXIDQR
FXELHUWRSRUODJDUDQWtDD
PHQRVTXHHOGHUUDPHVH
TXLWHPLHQWUDVHVWiFDOLHQWH
'HEHWHQHUVHPXFKRFXLGDGR
DOUHPRYHUVXVWDQFLDV
FDOLHQWHV
$VHJ~UHVHGHXWLOL]DUXQ
UDVSDGRUQXHYR\DILODGR
1RXWLOLFHKRMDVGHVDILODGDVR
GDxDGDV
'DxRVSRUGHUUDPHVD]XFDUDGRV\SOiVWLFRGHUUHWLGR
$
SDJXHWRGDVODVXQLGDGHVGHVXSHUILFLH
4XLWHODVROODVFDOLHQWHV
8WLOL]DQGRXQJXDQWHGHFRFLQD
D8VHXQUDVSDGRUGHILOR~QLFR
UDVSDGRUSDUDHVWXIDVFHUiPLFDV
&(5$0$%5<7(ŠSDUDGHVSOD]DUHO
GHUUDPHDXQiUHDIUtDGHODHVWXID
1RXVHODVXQLGDGHVGHVXSHUILFLHGH
QXHYRKDVWDTXHWRGRVORVUHVWRVVH
KD\DQHOLPLQDGRSRUFRPSOHWR
127$6LODVXSHUILFLHGHYLGULR\DKDVXIULGR
PDUFDVRKHQGLGXUDVHOYLGULRGHODHVWXID
GHEHUiFDPELDUVH(QHVHFDVRVHUiQHFHVDULDOD
DWHQFLyQGHXQWpFQLFR
E4XLWHHOGHUUDPHFRQWRDOODVGHSDSHO
&XDOTXLHUGHUUDPHUHVWDQWHGHEHGHMDUVH
KDVWDTXHODVXSHUILFLHGHODHVWXIDVHKD\D
HQIULDGR
3DUDVROLFLWDUUHSXHVWRV
3DUDVROLFLWDUHOOLPSLDGRUGHHVWXIDV
FHUiPLFDV&(5$0$%5<7(Š\HOUDVSDGRUGH
HVWXIDVOODPHDQXHVWURQ~PHURJUDWXLWR
&HQWURQDFLRQDOGHSLH]DV /LPSLDGRUGHHVWXIDVFHUiPLFDV&(5$0$
%5<7(Š :;;
5DVSDGRUGHHVWXIDVFHUiPLFDV
&(5$0$%5<7(Š :;;
.LW :%;
(ONLWLQFOX\HODFUHPD\HOUDVSDGRUGHHVWXIDV
3DxRVGHOLPSLH]D&(5$0$%5<7(ŠSDUD
HVWXIDVFHUiPLFDV :;;
$QWHVGHOODPDUDOVHUYLFLRWpFQLFR«
&RQVHMRVSDUDLGHQWLILFDFLyQ\VROXFLyQGHSUREOHPDV
£$KRUUHWLHPSR\GLQHUR/HDODVWDEODVGHODVVLJXLHQWHV
SiJLQDV\TXL]iVQRQHFHVLWHOODPDUDOVHUYLFLRWpFQLFR
3UREOHPD
&DXVDVSRVLEOHV
4XpKDFHU
/DVXQLGDGHVGH
VXSHUILFLHQRPDQWLHQHQ
XQKHUYRUFRQVWDQWHR
ODFRFFLyQHVOHQWD 6HHVWiQXWLOL]DQGRUHFLSLHQWHV
GHFRFFLyQLQDGHFXDGRV
‡8VHUHFLSLHQWHVGHEDVHSODQD\TXHVHDMXVWHQ
DOGLiPHWURGHODXQLGDGGHVXSHUILFLHHOHJLGD
(QDOJXQDVUHJLRQHVODHQHUJtD
YROWDMHSXHGHVHUEDMD
‡&XEUDHOUHFLSLHQWHFRQXQDWDSDKDVWDREWHQHUHOFDORU
GHVHDGR
/RVHOHPHQWRVGH
(OIXVLEOHSXHGHKDEHUVH
VXSHUILFLHQRIXQFLRQDQ TXHPDGRRHOLQWHUUXSWRUGH
ELHQ
FLUFXLWRVSXHGHKDEHUVDOWDGR
‡&DPELHHOIXVLEOHRYXHOYDDFRQILJXUDUHOLQWHUUXSWRU
GHFLUFXLWRV
‡9HULILTXHTXHVHKD\DFRQILJXUDGRHOFRQWUROFRUUHFWR SDUDHOHOHPHQWRGHVXSHUILFLHTXHHVWiXWLOL]DQGR
/RVFRQWUROHVGHODHVWXID
HVWiQPDOFRQILJXUDGRV
/DXQLGDGGHVXSHUILFLH (VWRHVQRUPDO/DXQLGDGVLJXH
GHMDGHUHVSODQGHFHU
HQFHQGLGD\FDOLHQWH
FXDQGRVHFDPELDD
XQDFRQILJXUDFLyQPHQRU
5D\RQHVSXHGHQSDUHFHU
FRPRURWXUDVHQOD
VXSHUILFLHGHYLGULR
GHODHVWXID
6HHVWiQXVDQGRPpWRGRV
GHOLPSLH]DLQFRUUHFWRV
‡/RVUD\RQHVQRSXHGHQUHPRYHUVH/RVUD\RQHVPiVSHTXHxRV
VHYROYHUiQPHQRVYLVLEOHVFRPRUHVXOWDGRGHODOLPSLH]D
6HHVWiQXVDQGRUHFLSLHQWHV
FRQEDVHViVSHUDVRKD\
SDUWtFXODVJUXHVDVVDORDUHQD
HQWUHHOUHFLSLHQWH\ODVXSHUILFLH
GHODHVWXID
‡3DUDHYLWDUUD\RQHVXVHORVSURFHGLPLHQWRVGHOLPSLH]D
UHFRPHQGDGRV9HULILTXHTXHODVEDVHVGHORVUHFLSLHQWHV
HVWpQOLPSLDVDQWHVGHOXVR\XWLOLFHUHFLSLHQWHVFRQEDVHV
OLVDV
6HKDGHVOL]DGRXQUHFLSLHQWHD
WUDYpVGHODVXSHUILFLHGHODHVWXID
ÈUHDVGHGHFRORUDFLyQ
HQODHVWXID
1RVHOLPSLDURQORVGHUUDPHV
GHDOLPHQWRVDQWHVGHOXVR
VLJXLHQWH
6XSHUILFLHFDOLHQWHHQ
XQPRGHORFRQXQDHVWXID
GHFRORUFODUR
‡(VWRHVQRUPDO/DVXSHUILFLHSXHGHSDUHFHUGHFRORUDGD
FXDQGRHVWiFDOLHQWH(VWRHVWHPSRUDO\GHVDSDUHFHUi
DPHGLGDTXHVHHQIUtDHOYLGULR
3OiVWLFRGHUUHWLGR
VREUHODVXSHUILFLH
/DHVWXIDFDOLHQWHHQWUy
HQFRQWDFWRFRQSOiVWLFR
FRORFDGRVREUHODPLVPD
‡9HUODVHFFLyQ6XSHUILFLHGHYLGULRSRVLELOLGDGHVGHGDxR
SHUPDQHQWHHQODVHFFLyQ&yPROLPSLDUODHVWXID
GHYLGULR
‡9HUODVHFFLyQ&yPROLPSLDUODHVWXIDGHYLGULR
0DUFDVRKHQGLGXUDV 6HKDGHUUDPDGRXQDPH]FOD
HQODHVWXID
D]XFDUDGDFDOLHQWHHQODHVWXID
‡/ODPHDXQWpFQLFRFDOLILFDGRSDUDHOUHHPSOD]R
/DVXQLGDGHVGHVXSHUILFLH 6HHVWiQXWLOL]DQGRUHFLSLHQWHV
VHHQFLHQGHQ\DSDJDQ
GHFRFFLyQLQDGHFXDGRV
FRQPXFKDIUHFXHQFLD
‡8VHVyORUHFLSLHQWHVGHEDVHSODQDSDUDPLQLPL]DU
HOHQFHQGLGR\DSDJDGR
/DOX]GHOKRUQR
QRIXQFLRQD
/DERPELOODGHOX]HVWiIORMD
‡$MXVWHRFDPELHODERPELOOD
(OKRUQRQRIXQFLRQD
(OHQFKXIHGHODFRFLQD
QRHVWiLQWURGXFLGRGHOWRGR
HQHOWRPDFRUULHQWH
(OIXVLEOHSXHGHKDEHUVH
TXHPDGRRHOLQWHUUXSWRUGH
FLUFXLWRVSXHGHKDEHUVDOWDGR
/RVFRQWUROHVGHOKRUQRHVWiQ
PDOFRQILJXUDGRV
(OKRUQRHVWiPX\FDOLHQWH
‡9HULILTXHTXHHOHQFKXIHHOpFWULFRHVWpFRQHFWDGR
DXQWRPDFRUULHQWHFRQWHQVLyQ\DGHFXDGDFRQH[LyQ
DWLHUUD
‡&DPELHHOIXVLEOHRYXHOYDDFRQILJXUDUHOLQWHUUXSWRU
GHFLUFXLWRV
‡9HUODVHFFLyQ&yPRXVDUHOKRUQR
‡'HMHTXHHOKRUQRVHHQIUtHSRUGHEDMR
GHODWHPSHUDWXUDGHEORTXHR
*($SSOLDQFHVFRP
3UREOHPD
&DXVDVSRVLEOHV
/RVDOLPHQWRVQR
VHKRUQHDQRURVWL]DQ
FRUUHFWDPHQWH
/RVFRQWUROHVGHOKRUQRHVWiQ ‡ 9HUODVHFFLyQ&yPRXVDUHOKRUQR
PDOFRQILJXUDGRV
/DSRVLFLyQGHODEDQGHMDHV
LQFRUUHFWDRQRHVWiQLYHODGD
6HHVWiQXWLOL]DQGRUHFLSLHQWHV ‡ 9HUODVHFFLyQ&yPRXVDUHOKRUQR
GHFRFFLyQLQFRUUHFWRVR
GHWDPDxRLQDSURSLDGR
(OWHUPRVWDWRGHOKRUQRGHEH‡ 9HUODVHFFLyQ$MXVWHHOWHUPRVWDWRGHOKRUQRXVWHG
DMXVWDUVH
PLVPR
/RVDOLPHQWRVQR
VHDVDQGHPDQHUD
DGHFXDGD
/RVFRQWUROHVGHOKRUQRHVWiQ ‡ $VHJ~UHVHGHSUHVLRQDUHOERWyQ%52,/+,/2
PDOFRQILJXUDGRV
DVDUDOWDEDMD
6HHVWiXVDQGRXQDSRVLFLyQ
GHEDQGHMDLQDGHFXDGD
‡ 9HUOD*XtDGHDVDGR
/RVUHFLSLHQWHVQRVRQ
DGHFXDGRVSDUDDVDU
‡ 3DUDPHMRUHVUHVXOWDGRVXWLOLFHXQUHFLSLHQWHGLVHxDGR
SDUDDVDGR
/DVRQGDHVWiHQFKXIDGD
GHQWURGHODVDOLGDGHOKRUQR
HQDOJXQRVPRGHORV
‡ 'HVHQFKXIH\TXLWHODVRQGDGHOKRUQR
(QDOJXQDVUHJLRQHVODHQHUJtD ‡ 3UHFDOLHQWHHOHOHPHQWRSDUDDVDUGXUDQWHPLQXWRV
YROWDMHSXHGHVHUEDMD
‡ $VHSRUHOSHUtRGRGHWLHPSRPiVSURORQJDGRTXH
VHUHFRPLHQGHHQOD*XtDGHDVDGR
4XpKDFHU
‡ 9HUODVHFFLyQ&yPRXVDUHOKRUQR
/DWHPSHUDWXUD
(OWHUPRVWDWRGHOKRUQRGHEH ‡ 9HUODVHFFLyQ$MXVWHHOWHUPRVWDWRGHOKRUQRXVWHG
GHOKRUQRHVPX\DOWD DMXVWDUVH
PLVPR
RPX\EDMD
(OFDMyQGH
DOPDFHQDPLHQWR
HVWiWRUFLGR
(OVRSRUWHGHFDMyQWUDVHUR ‡ 9XHOYDDFRORFDUHOFDMyQ9HUODVLQVWUXFFLRQHVGH
VHHQFXHQWUDVREUHHOULHO
5HPRFLyQGHOFDMyQGHDOPDFHQDPLHQWRHQODVHFFLyQ
GHODJXtD
&XLGDGR\OLPSLH]DGHODFRFLQD
‡ 9HULILTXHTXHHOFDMyQHVWpELHQFRORFDGRVLVHORTXLWD
(OFDMyQGH
DOPDFHQDPLHQWR
QRFLHUUD
(OFDEOHGHHQHUJtDSXHGH
HVWDUREVWUX\HQGRHOFDMyQ
HQODSDUWHWUDVHUDLQIHULRU
GHODFRFLQD
‡ &DPELHODXELFDFLyQGHOFDMyQ\GHOFDEOHGHHQHUJtD
9HUODVLQVWUXFFLRQHVGH5HPRFLyQGHOFDMyQGH
DOPDFHQDPLHQWRHQODVHFFLyQ&XLGDGR\OLPSLH]D
GHODFRFLQD
(OVRSRUWHGHFDMyQWUDVHUR ‡ 9XHOYDDFRORFDUHOFDMyQ9HUODVLQVWUXFFLRQHVGH
VHHQFXHQWUDVREUHHOULHO
5HPRFLyQGHOFDMyQGHDOPDFHQDPLHQWRHQODVHFFLyQ
GHODJXtD
&XLGDGR\OLPSLH]DGHODFRFLQD
/DSXHUWDGHOKRUQR
DOLQHDGD
/DSXHUWDQRHVWiELHQ
‡ 'DGRTXHODSXHUWDGHOKRUQRHVGHVPRQWDEOHDYHFHVHVWiWRUFLGD
VHGHVHTXLOLEUDGXUDQWHODLQVWDODFLyQ
‡ 3DUDHQGHUH]DUODSXHUWDSUHVLRQHKDFLDDEDMRVREUHODHVTXLQD
VXSHULRU
$QWHVGHOODPDUDOVHUYLFLRWpFQLFR«
&RQVHMRVSDUDLGHQWLILFDFLyQ\VROXFLyQGHSUREOHPDV
3UREOHPD
&DXVDVSRVLEOHV
4XpKDFHU
(OUHORM\HOWHPSRUL]DGRU (OHQFKXIHGHODFRFLQDQRHVWi
‡9HULILTXHTXHHOHQFKXIHHOpFWULFRHVWpFRQHFWDGRDXQ
QRIXQFLRQDQ
LQWURGXFLGRGHOWRGRHQHOWRPDFRUULHQWH WRPDFRUULHQWHFRQWHQVLyQ\DGHFXDGDFRQH[LyQDWLHUUD
(OIXVLEOHSXHGHKDEHUVH
‡&DPELHHOIXVLEOHRYXHOYDDFRQILJXUDUHOLQWHUUXSWRU
TXHPDGRRHOLQWHUUXSWRU
GHFLUFXLWRV
GHFLUFXLWRVSXHGHKDEHUVDOWDGR
/RVFRQWUROHVGHOKRUQRHVWiQ
PDOFRQILJXUDGRV
‡9HUODVHFFLyQ&yPRXVDUHOWHPSRUL]DGRUGHFRFLQD
(OKRUQRQRUHDOL]D
ODDXWROLPSLH]D
/DWHPSHUDWXUDGHOKRUQRHVWi
PX\HOHYDGDSDUDFRQILJXUDU
ODIXQFLyQGHDXWROLPSLH]D
‡'HMHTXHODFRFLQDVHHQIUtH\YXHOYDDFRQILJXUDU
ORVFRQWUROHV
/RVFRQWUROHVGHOKRUQRHVWiQ
PDOFRQILJXUDGRV
‡9HUODVHFFLyQ8VRGHOKRUQRFRQDXWROLPSLH]D
/DVRQGDHVWiHQFKXIDGD
‡4XLWHODVRQGDGHOKRUQR
GHQWURGHODERFDGHVDOLGD
GHOKRUQRHQDOJXQRVPRGHORV
5XLGRGH´FUXMLGRVµ
R´FKDVTXLGRVµ
(VHOVRQLGRGHOPHWDO
FDOHQWiQGRVH\HQIULiQGRVH
GXUDQWHODVIXQFLRQHV
GHFRFFLyQ\OLPSLH]D
‡(VWRHVQRUPDO
+XPRH[FHVLYR
HQHOKRUQRGXUDQWH
FLFORGHOLPSLH]D
6XFLHGDGH[FHVLYD
‡3UHVLRQHHOERWyQ&/($52))ERUUDUDSDJDGR
$EUDODVYHQWDQDVSDUDTXHVDOJDHOKXPR(VSHUHHO
KDVWDTXHVHDSDJXH/2&.(''225 'HVSXpVGHTXH
VHHQIUtHHOKRUQROLPSLHHOH[FHVRGHVXFLHGDG\YXHOYDD
FRQILJXUDUHOFLFORGHOLPSLH]D
/DSXHUWDGHOKRUQR
QRVHDEUHGHVSXpVGHO
XQFLFORGHOLPSLH]D
(OKRUQRHVWiPX\FDOLHQWH
‡'HMHTXHHOKRUQRVHHQIUtHSRUGHEDMR
GHODWHPSHUDWXUDGHEORTXHR
(OKRUQRQRHVWiOLPSLR
GHVSXpVGHXQFLFOR
GHOLPSLH]D
/RVFRQWUROHVGHOKRUQRQRHVWiQ ‡9HUODVHFFLyQ8VRGHOKRUQRFRQDXWROLPSLH]D
FRQILJXUDGRVFRUUHFWDPHQWH
(OKRUQRHVWDEDPX\VXFLR
‡/LPSLHORVGHUUDPHVPiVUHEHOGHVDQWHVGHLQLFLDUHOFLFOR
GHOLPSLH]D/RVKRUQRVPX\VXFLRVSXHGHQQHFHVLWDUXQD
QXHYDDXWROLPSLH]DRXQDOLPSLH]DPiVSURORQJDGD
/DOX]GHEORTXHR
´/2&.('µGHVWHOOD
HQODSDQWDOOD
GHOKRUQR
6HKDVHOHFFLRQDGRHOFLFOR
GHDXWROLPSLH]DSHUR
ODSXHUWDQRHVWiFHUUDGD
‡&LHUUHODSXHUWDGHOKRUQR
/DOX]GHEORTXHR
´/2&.('µHVWi
HQFHQGLGDFXDQGR
GHVHDFRFLQDU
/DSXHUWDGHOKRUQR
HVWiEORTXHDGDSRUTXH
ODWHPSHUDWXUDGHQWUR
GHOPLVPRQRKDGHVFHQGLGR
GHEDMRGHODWHPSHUDWXUD
GHEORTXHR
‡3UHVLRQHHOERWyQ&/($52))ERUUDUDSDJDGR
'HMHHQIULDUHOKRUQR
´)³µ\XQQ~PHUR
ROHWUDGHVWHOODQ
HQODSDQWDOOD
+D\XQFyGLJRGHHUURU
GHIXQFLyQ
‡'HVHQFKXIHHOKRUQRSRUORPHQRVVHJXQGRV\OXHJR
YXHOYDDHQFKXIDUOR6LHOFyGLJRGHHUURUGHIXQFLyQ
VHUHSLWHOODPHDOVHUYLFLRWpFQLFR
*($SSOLDQFHVFRP
3UREOHPD
&DXVDVSRVLEOHV
4XpKDFHU
(OFRQWUROHPLWHXQD
VHxDOGHVSXpVGHLQJUHVDU
XQWLHPSRGHFRFFLyQ
RGHLQLFLR
/DSDQWDOODTXHGD
HQEODQFR
/DSDQWDOODGHVWHOOD
/DSDQWDOODQR
PXHVWUD´6)µ
$SDUHFH´3UREHµ
VRQGDHQODSDQWDOOD
DOJXQRVPRGHORV
&RUWHGHHQHUJtD
HOUHORMGHVWHOOD
(PLVLyQGHYDSRU
GHVGHODYHQWLODFLyQ
8QRORUD´TXHPDGRµ
R´DFHLWRVRµVDOH
GHODYHQWLODFLyQ
2ORUSHQHWUDQWH
6HR\HXQYHQWLODGRU
HQDOJXQRVPRGHORV
2OYLGyLQJUHVDU
‡ 3UHVLRQHHOERWyQ%$.(KRUQHDU\ODWHPSHUDWXUD
XQWHPSHUDWXUDGHKRUQHDGR GHVHDGDRHOERWyQ6(/)&/($1DXWROLPSLH]D
RXQKRUDULRGHOLPSLH]D
\HOWLHPSRGHOLPSLH]DGHVHDGR
(OIXVLEOHSXHGHKDEHUVHTXHPDGR‡ &DPELHHOIXVLEOHRYXHOYDDFRQILJXUDUHOLQWHUUXSWRU
RHOLQWHUUXSWRUGHFLUFXLWRV GHFLUFXLWRV
SXHGHKDEHUVDOWDGR
(OUHORMVHHQFXHQWUDHQ
‡ 9HUODVHFFLyQGH&DUDFWHUtVWLFDVHVSHFLDOHVGH
HOPRGRVLQYLVXDOL]DFLyQ
ORVFRQWUROHVGHOKRUQR
&RUWHGHHQHUJtD
‡ 5HFRQILJXUHHOUHORM
/RVERWRQHVGHFRQWUROGHOKRUQR ‡ /RVERWRQHV%52,/+,/2DVDUDOWREDMR\%$.(
QRVHSUHVLRQDURQFRUUHFWDPHQWH KRUQHDUGHEHQSUHVLRQDUVHDOPLVPRWLHPSR \VRVWHQHUVHGXUDQWHVHJXQGRV
(VWROHUHFXHUGDGHLQJUHVDU ‡ ,QJUHVHXQDWHPSHUDWXUDGHVRQGD
XQDWHPSHUDWXUDGHVRQGD
GHVSXpVGHHQFKXIDUOD
&RUWHGHHQHUJtDRVXELGD
‡ 5HFRQILJXUHHOUHORM6LHOKRUQRHVWDEDHQXVRXVWHG
GHWHQVLyQ
GHEHUHFRQILJXUDUORSUHVLRQDQGRHOERWyQ&/($52))
ERUUDUDSDJDGRFRQILJXUDQGRHOUHORM\
UHFRQILJXUDQGRFXDOTXLHUIXQFLyQGHFRFFLyQ
&XDQGRVHXWLOL]DQORVKRUQRV
‡ (VWRHVQRUPDO
HVQRUPDOYHUXQDHPLVLyQGHYDSRU
GHODYHQWLODFLyQGHOKRUQR$PHGLGD
TXHHOQ~PHURGHEDQGHMDVR
ODFDQWLGDGGHDOLPHQWRVDFRFLQDU
VHLQFUHPHQWDODFDQWLGDGGHYDSRU
YLVLEOHVHHOHYDUi
(VWRHVQRUPDOHQXQKRUQR ‡ 3DUDDFHOHUDUHOSURFHVRFRQILJXUHXQFLFORGH
QXHYR\GHVDSDUHFHFRQ
DXWROLPSLH]DGXUDQWHXQPtQLPRGHKRUDV9HU
HOWLHPSR
9HUODVHFFLyQ8VRGHOKRUQRFRQDXWROLPSLH]D
/DVSULPHUDVYHFHVTXH
‡ (VWRHVWHPSRUDO
VHXWLOL]DHOKRUQRHVQRUPDO
VHQWLUXQRORUSURYHQLHQWH
GHODLVODQWHTXHUHFXEUH
ODSDUWHLQWHUQDGHOKRUQR
8QYHQWLODGRUGHFRQYHFFLyQ‡ (VWRHVQRUPDO3DUDSRWHQFLDUDOPi[LPRXQDFRFFLyQ
SXHGHHQFHQGHUVH\DSDJDUVH SDUHMDHOYHQWLODGRUHVWiGLVHxDGRSDUDJLUDUHQDPEDV
DXWRPiWLFDPHQWH
GLUHFFLRQHVFRQXQDSDXVDHQWUHHOODV
‡ (OYHQWLODGRUGHFRQYHFFLyQIXQFLRQDGXUDQWHHO SUHFDOHQWDPLHQWRGHOFLFORGHKRUQHDGR(OYHQWLODGRU
VHDSDJDUiGHVSXpVGHTXHHOKRUQRKD\DDOFDQ]DGR
ODWHPSHUDWXUDFRQILJXUDGD(VWRHVQRUPDO
8QYHQWLODGRUGHUHIULJHUDFLyQ ‡ (VWRHVQRUPDO6HHQFHQGHUi\DSDJDUiXQYHQWLODGRU
SXHGHHQFHQGHUVH\DSDJDUVH GHUHIULJHUDFLyQSDUDHQIULDUODVSLH]DVLQWHUQDV3XHGH
DXWRPiWLFDPHQWH
IXQFLRQDUD~QGHVSXpVGHTXHHOKRUQRVHKD\D DSDJDGR
$QWHVGHOODPDUDOVHUYLFLRWpFQLFR«
&RQVHMRVSDUDLGHQWLILFDFLyQ\VROXFLyQGHSUREOHPDV
3UREOHPD
&DXVDVSRVLEOHV
4XpKDFHU
5HVXOWDGLItFLOGHVOL]DU /DVSDUULOODVGHFRORU
‡$SOLTXHXQDSHTXHxDFDQWLGDGGHDFHLWHYHJHWDOHQ
ODVEDQGHMDVGHOKRUQR SODWHDGREULOODQWHVHOLPSLDURQ XQDWRDOODGHSDSHO\IURWHORVERUGHVGHODVEDQGHMDV
HQXQFLFORGHDXWROLPSLH]D GHOKRUQR1RURFtHFRQ3DPŠXRWUROXEULFDQWHHQVSUD\
(OFDMyQQRVHGHVOL]D
ELHQRKD\TXHWLUDU
GHpO
(OFDMyQQRHVWiELHQ
DOLQHDGR
‡ ([WLHQGDHOFDMyQSRUFRPSOHWR\SUHVLyQHORKDVWD
HOIRQGR9HUODVHFFLyQ&XLGDGR\OLPSLH]DGHODFRFLQD
(OFDMyQHVWiPX\FDUJDGR ‡ 5HGX]FDHOSHVR5HGLVWULEX\DHOFRQWHQLGRGHOFDMyQ
RODFDUJDQRHVWiHTXLOLEUDGD
1RIXQFLRQDQHOFDMyQ (OIXVLEOHSXHGHKDEHUVH
‡ &DPELHHOIXVLEOHRYXHOYDDFRQILJXUDUHOLQWHUUXSWRU
FDOHQWDGRU
TXHPDGRRHOLQWHUUXSWRUGH GHFLUFXLWRV
FLUFXLWRVSXHGHKDEHUVDOWDGR
/RVFRQWUROHVHVWiQPDO
FRQILJXUDGRV
‡ 9HUODVHFFLyQ&yPRXVDUHOFDMyQFDOHQWDGRU
&RQGHQVDFLyQH[FHVLYD /tTXLGRHQHOFDMyQ
HQHOFDMyQ
$OLPHQWRVVLQFXEULU
‡ 4XLWHHOOtTXLGR
‡ 5HGX]FDODFRQILJXUDFLyQGHODWHPSHUDWXUD
/DFRQILJXUDFLyQGH
WHPSHUDWXUDHVWiPX\DOWD
‡ &XEUDORVDOLPHQWRVFRQXQDWDSDRFRQSDSHO
GHDOXPLQLR
/RVDOLPHQWRVVHVHFDQ /DKXPHGDGVHHVFDSD
HQHOFDMyQFDOHQWDGRU ‡ &XEUDORVDOLPHQWRVFRQXQDWDSDRFRQSDSHO
GHDOXPLQLR
‡ 3UHVLRQHHOFDMyQKDFLDDGHQWURKDVWDTXHHOVXMHWDGRU
HQJDQFKH
(OFDMyQQRHVWiWRWDOPHQWH
FHUUDGR
$FFHVRULRV
*($SSOLDQFHVFRP
¢'HVHDDOJRPiV"1RWRGRVORVDFFHVRULRVVHHQFXHQWUDQGLVSRQLEOHVSDUDWRGRV
ORVPRGHORV
8VWHGSXHGHHQFRQWUDUHVWRVDFFHVRULRV\PXFKRVPiVHQ*($SSOLDQFHVFRPROODPHDO
HQKRUDULRGHWUDEDMRQRUPDO7HQJDOLVWRHOQ~PHURGHPRGHOR
5HMLOODV
&DEH]DOHVRWDSDVGH
TXHPDGRUHVGHVXSHUILFLH
3HULOODV
(OHPHQWRVGHVXSHUILFLH\
EDQGHMDVFROHFWRUDV
R
%DQGHMDVGHOKRUQR
(OHPHQWRVGHOKRUQR
%RPELOODVGHOX]
3DUULOODGHH[WHQVLyQ
6LVXPRGHORLQFOX\HXQDSDUULOODGHH[WHQVLyQSXHGHLQFUHPHQWDUODIXQFLRQDOLGDGGHVXDOFDQFHDODGTXLULUSDUULOODVGHH[WHQVLyQDGLFLRQDOHV9LVLWHZZZJHDSSOLDQFHSDUWV
FRPROODPHDO\RUGHQHODSLH]DQ~PHUR:%76HGHEHWHQHUHQFXHQWDTXHODVSDUULOODVGHH[WHQVLyQQRFRUUHVSRQGHQDWRGRVORVWLSRVGHPRGHORV
£3UXHEHHVWRVRWURVH[FHOHQWHVSURGXFWRVSDUDTXHVXFRFLQDVHYHDHVWXSHQGD
.LWGHOLPSLH]D
GHDQDIHV
YLWURFHUiPLFRV
,QFOX\HOLPSLDGRU
UDVTXHWD\SDxR
7RDOOLWDV
GHOLPSLH]D
GHDQDIHV
YLWURFHUiPLFRV
7RDOOLWDVSDUD
SXOLUDUWHIDFWRV
GHDFHUR
LQR[LGDEOH
/LPSLDGRU
GHDUWHIDFWRV
GHDFHUR
LQR[LGDEOH
:;;*&6
:;;
:;;
30;
£$SURYHFKHDOPi[LPRVXEDQGHMDSDUDDVDU1RSDUDXVDUFRQPRGHORVGHFDMyQDVDGRU
£8WLOLFHVXEDQGHMD\WDSDGHUHMLOODSDUDDVDUKDPEXUJXHVDVIUXWRVGHPDUILOHWHVYHJHWDOHVSDQFHWD
FRVWLOODV\PXFKRPiV/DEDQGHMDLQIHULRUUHWLHQHHOH[FHVRGHJUDVDV\DFHLWHV
‡3LH]D*(JHQXLQD
‡)iFLOGHOLPSLDU
‡*DUDQWtDGHXQDxR
£2IHUWDGHWLHPSROLPLWDGR£(QYtRVLQFDUJR
&XDQGRVROLFLWHODEDQGHMDSDUDDVDUGHQWURGHORVGtDVGHKDEHUDGTXLULGRVXSURGXFWRGHFRFLQD*(
1ƒGHSLH]D
'LPHQVLRQHV
3HTXHxD
:%;
µ$[µ$[µ3
*UDQGH
:%;
µ$[µ$[µ3
([WUDJUDQGH
:%;
µ$[µ$[µ3
/DEDQGHMDSDUDDVDUJUDQGHHVWiQGDUQRHQWUDHQFRFLQDVGHSXOJDGDV
/DEDQGHMDH[WUDJUDQGHQRHQWUDHQKRUQRVGHSDUHGHVGHSXOJDGDVHPSRWUDGDVGHSXOJDGDVRFRFLQDVGHSXOJDGDV
/ODPHDORXWLOLFHHVWHIRUPXODULRSDUDHQYLDUVXVROLFLWXGSRUFRUUHR
*(3DUWV32%R[0HPSKLV71
BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
)RUPXODULRGHVROLFLWXGGHODEDQGHMDSDUDDVDU
&DQWLGDG BBBBBBBBBBBBBBBBBBB BBBBBBBBBBBBBBBBBBBB BBBBBBBBBBBBBBBBBBBB 1~PHURGHSLH]DBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
1~PHURGHPRGHORBBBBBBBBBBBB 1~PHURGHVHULH BBBBBBBBBBBBBBBB 0DUFDBBBBBBBBBBBBBB )HFKDGHFRPSUDBBBBBBBBB
1RPEUH BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB $SHOOLGRBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
'LUHFFLyQ BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
&LXGDG BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB (VWDGRBBBBBBBBBB &yGLJR3RVWDOBBBBBBBBBBBBBBBBBBBBBBBBB
7HOpIRQRBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB &RUUHRHOHFWUyQLFRBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
&KHFN BBBBBB
*LURSRVWDOBBBBBB
3DUDFRQVXOWDUVREUHORVSUHFLRVDFWXDOHVOODPHDO7RGDVODVyUGHQHVFRQWDUMHWDGHFUpGLWRVHGHEHUiQUHDOL]DU
HQIRUPDWHOHIyQLFD
1RWDV
*DUDQWtDGHFRFLQDHOpFWULFDGH*(
7RGRVORVVHUYLFLRVWpFQLFRVGHJDUDQWtDVRQRWRUJDGRVSRUQXHVWURV
&HQWURVGH6HUYLFLRGH)iEULFDRXQWpFQLFRDXWRUL]DGRSRU
&XVWRPHU&DUHŠ3DUDSURJUDPDUHOVHUYLFLRWpFQLFRYLVtWHQRVRQOLQH
HQ*($SSOLDQFHVFRPROODPHDO*(&$5(6
7HQJDHOQ~PHURGHVHULH\GHPRGHORDPDQRFXDQGROODPHSDUD
VROLFLWDUXQVHUYLFLRWpFQLFR
*($SSOLDQFHVFRP
$EURFKHVXUHFLERDTXt
6HQHFHVLWDXQDSUXHED
GHODIHFKDGHFRPSUDRULJLQDOSDUD
REWHQHUVHUYLFLRWpFQLFRFXELHUWRSRU
ODJDUDQWtD
3RUHOSHUtRGRGH *(RWRUJDUi
8QDxR
'HVGHODIHFKDGH
FRPSUDRULJLQDO
3DUDORV0RGHORV3URILOH
&LQFR$xRV
'HVGHODIHFKD
GHODFRPSUDRULJLQDO
&XDOTXLHUSLH]DGHODFRFLQDTXHIDOOHGHELGRDXQGHIHFWRGHORVPDWHULDOHVRPDQRGHREUD
'XUDQWHHVWDJDUDQWtDOLPLWDGDGHXQDxR*(WDPELpQRIUHFHHQIRUPDJUDWXLWDODPDQRGH
REUD\WUDEDMRVHQHOKRJDUSDUDUHHPSOD]DUODSLH]DGHIHFWXRVD
3DUDORV0RGHORV3URILOH
(OUHHPSOD]RGHXQDHVWXIDGHYLGULRVLVHDJULHWDGHELGRDXQFKRTXHWpUPLFR
RVLHOSDWUyQVHGHVJDVWD
(OUHHPSOD]RGHODXQLGDGGHODVXSHUILFLHUDGLDQWHVLVHTXHPDUD
'XUDQWHHVWDJDUDQWtDOLPLWDGDDGLFLRQDOGHFXDWURDxRVXVWHGVHUiUHVSRQVDEOHSRU
SRUFXDOTXLHUWUDEDMRRUHSDUDFLyQHQHOKRJDU
*(QRFXEULUi
„9LVLWDVDVXKRJDUSDUDHQVHxDUOHDXVDUHOSURGXFWR
„,QVWDODFLyQHQWUHJDRPDQWHQLPLHQWRLQDGHFXDGRV
„'DxRRIDOODVGHOSURGXFWRHQFDVRGHDEXVRXVR
LQDGHFXDGRXVRSDUDRWURVSURSyVLWRVTXHQRVHDQHO
DGHFXDGRRXVRFRPHUFLDO
„'DxRVDODHVWXIDGHYLGULRSURYRFDGRVSRUHOXVR
GHOLPSLDGRUHVGLVWLQWRVGHODVFUHPDV\SDxRV
UHFRPHQGDGRV
„'DxRVDODHVWXIDGHYLGULRSURYRFDGRVSRUGHUUDPHV
HQGXUHFLGRVGHPDWHULDOHVD]XFDUDGRVRSOiVWLFRGHUUHWLGR
TXHQRVHOLPSLDURQGHDFXHUGRFRQ
ODVLQVWUXFFLRQHVGHO0DQXDOGHO3URSLHWDULR
„5HHPSOD]RGHIXVLEOHVGRPpVWLFRVRODUHFRQILJXUDFLyQGH
LQWHUUXSWRUHVGHFLUFXLWR
„'DxRVDOSURGXFWRSURYRFDGRVSRUDFFLGHQWHVLQFHQGLRV
LQXQGDFLRQHVRIXHU]DPD\RU
„'DxRVLQFLGHQWDOHVRUHVXOWDQWHVSURYRFDGRVSRUSRVLEOHV
GHIHFWRVHQHVWHDUWHIDFWR
„'DxRVSURYRFDGRVGHVSXpVGHODHQWUHJD
„8QSURGXFWRQRDFFHVLEOHSDUDSUHVWDUHOVHUYLFLRWpFQLFR
VROLFLWDGR
(;&/86,Ï1'(*$5$17Ë$6,03/Ë&,7$6³6X~QLFR\H[FOXVLYRUHFXUVRHVODUHSDUDFLyQGHOSURGXFWRFRPR
VHHVWDEOHFHHQODSUHVHQWH*DUDQWtD/LPLWDGD/DVJDUDQWtDVLPSOtFLWDVLQFOX\HQGRJDUDQWtDVGHFRPHUFLDELOLGDG
\DSWLWXGSDUDXQREMHWLYRSDUWLFXODUVHHQFXHQWUDQOLPLWDGDVDXQDxRRDOSHUtRGRPiVFRUWRSHUPLWLGRSRUODOH\
(VWDJDUDQWtDVHH[WLHQGHDOFRPSUDGRURULJLQDO\FXDOTXLHUGXHxRSRVWHULRUSDUDSURGXFWRVDGTXLULGRVSDUD
XVRGRPpVWLFRGHQWURGHORV((886LHOSURGXFWRVHHQFXHQWUDHQXQDUHJLyQGRQGHQRKD\6HUYLFLR7pFQLFR
DXWRUL]DGRGH*(XVWHGVHUiUHVSRQVDEOHGHOFRVWRGHOYLDMHRXVWHGSXHGHWHQHUTXHOOHYDUHOSURGXFWRDXQ
6HUYLFLR7pFQLFR$XWRUL]DGRGH*(SDUDHIHFWXDUODUHSDUDFLyQ(Q$ODVNDODJDUDQWtDH[FOX\HHOFRVWRGHHQYtRR
YLVLWDVSDUDHIHFWXDUDUUHJORVHQVXKRJDU
$OJXQRVHVWDGRVQRSHUPLWHQODH[FOXVLyQROLPLWDFLyQGHGDxRVLQFLGHQWDOHVRUHVXOWDQWHV(VWDJDUDQWtD
OHRWRUJDGHUHFKRVOHJDOHVHVSHFtILFRV\XVWHGSXHGHFRQWDUFRQRWURVGHUHFKRVTXHSXHGHQYDULDUGHHVWDGRD
HVWDGR3DUDFRQRFHUVXVGHUHFKRVOHJDOHVFRQVXOWHDVXRILFLQDGHOFRQVXPLGRUORFDORHVWDWDO
RDO)LVFDO*HQHUDOGHVXHVWDGR
*DUDQWH*HQHUDO(OHFWULF&RPSDQ\/RXLVYLOOH.<
$SR\RDOFOLHQWH
3iJLQD:HEGH*($SSOLDQFHV
*($SSOLDQFHVFRP
¢7LHQHDOJXQDSUHJXQWDVREUHVXHOHFWURGRPpVWLFR"£3UXHEHODSiJLQD:HEGH*($SSOLDQFHVKRUDVDOGtD
FXDOTXLHUGtDGHODxR3DUDPD\RUFRQYHQLHQFLD\VHUYLFLRPiVUiSLGR\DSXHGHGHVFDUJDUORV0DQXDOHV
GHORV3URSLHWDULRVSHGLUSLH]DVRLQFOXVRKDFHUXQDFLWDHQOtQHDSDUDTXHYHQJDQDUHDOL]DUXQDUHSDUDFLyQ
6ROLFLWHXQDUHSDUDFLyQ
*($SSOLDQFHVFRP
(OVHUYLFLRGHH[SHUWRV*(HVWiDWDQVyORXQSDVRGHVXSXHUWD£(QWUHHQOtQHD\VROLFLWHVXUHSDUDFLyQFXDQGR
OHYHQJDFXDOTXLHUGtDGHODxR2OODPHDO*(&$5(6GXUDQWHKRUDVQRUPDOHVGHRILFLQD
5HDO/LIH'HVLJQ6WXGLR(VWXGLRGHGLVHxRSDUDODYLGDUHDO
*($SSOLDQFHVFRP
*(DSR\DHOFRQFHSWRGH'LVHxR8QLYHUVDO³SURGXFWRVVHUYLFLRV\DPELHQWHVTXHSXHGHQXVDUJHQWHGHWRGDV
ODVHGDGHVWDPDxRV\FDSDFLGDGHV5HFRQRFHPRVODQHFHVLGDGGHGLVHxDUSDUDXQDJUDQJDPDGHKDELOLGDGHV
\GLILFXOWDGHVItVLFDV\PHQWDOHV3DUDPiVGHWDOOHVFREUHODVDSOLFDFLRQHVGH*('LVHxR8QLYHUVDOLQFOX\HQGR
LGHDVGHGLVHxRSDUDODFRFLQDSDUDSHUVRQDVFRQGLVFDSDFLGDGHVPLUHQXHVWUDSiJLQD:HEKR\PLVPR
3DUDSHUVRQDVFRQGLILFXOWDGHVDXGLWLYDVIDYRUGHOODPDUDO7''*($&
*DUDQWtDVDPSOLDGDV
*($SSOLDQFHVFRP
&RPSUHXQDJDUDQWtDDPSOLDGD\REWHQJDGHWDOOHVVREUHGHVFXHQWRVHVSHFLDOHVGLVSRQLEOHVPLHQWUDVVXJDUDQWtD
HVWiD~QDFWLYD3XHGHFRPSUDUODHQOtQHDHQFXDOTXLHUPRPHQWRROODPDUDOGXUDQWHKRUDV
QRUPDOHVGHRILFLQD*(&RQVXPHU+RPH6HUYLFHVHVWDUiD~QDKtFXDQGRVXJDUDQWtDWHUPLQH
3LH]DV\DFFHVRULRV
*($SSOLDQFHVFRP
$TXHOORVLQGLYLGXRVFRQODFDOLILFDFLyQQHFHVDULDSDUDUHSDUDUVXVSURSLRVHOHFWURGRPpVWLFRVSXHGHQ
SHGLUTXHVHOHVPDQGHQODVSLH]DVRDFFHVRULRVGLUHFWDPHQWHDVXVKRJDUHVDFHSWDPRVODVWDUMHWDV
9,6$0DVWHU&DUG\'LVFRYHU+DJDVXSHGLGRHQOtQHDKR\KRUDVFDGDGtDROODPDUSRUWHOpIRQR
DOGXUDQWHKRUDVQRUPDOHVGHRILFLQD
/DVLQVWUXFFLRQHVGHVFULWDVHQHVWHPDQXDOFXEUHQORVSURFHGLPLHQWRVDVHJXLUSRUFXDOTXLHUXVXDULR&XDOTXLHU
RWUDUHSDUDFLyQGHEHUtDSRUUHJODJHQHUDOUHIHULUVHDSHUVRQDOFDOLILFDGRDXWRUL]DGR'HEHHMHUFHUVHSUHFDXFLyQ
\DTXHODVUHSDUDFLRQHVLQFRUUHFWDVSXHGHQFDXVDUFRQGLFLRQHVGHIXQFLRQDPLHQWRLQVHJXUDV
3yQJDVHHQFRQWDFWRFRQQRVRWURV
*($SSOLDQFHVFRP
6LQRHVWiVDWLVIHFKRFRQHOVHUYLFLRTXHUHFLEHGH*(SyQJDVHHQFRQWDFWRFRQQRVRWURVHQQXHVWUDSiJLQD
:HELQGLFDQGRWRGRVORVGHWDOOHVDVtFRPRVXQ~PHURGHWHOpIRQRRHVFUtEDQRVD
*HQHUDO0DQDJHU&XVWRPHU5HODWLRQV
*($SSOLDQFHV$SSOLDQFH3DUN
/RXLVYLOOH.<
5HJLVWUHVXHOHFWURGRPpVWLFR
*($SSOLDQFHVFRP
£5HJLVWUHVXQXHYRHOHFWURGRPpVWLFRHQOtQHD³FXDQGRXVWHGSUHILHUD(OUHJLVWUDUVXSURGXFWRDWLHPSR
OHSURSRUFLRQDUiVLVXUJLHUDODQHFHVLGDGXQDPHMRUFRPXQLFDFLyQ\XQVHUYLFLRPiVUiSLGREDMRORVWpUPLQRV
GHVXJDUDQWtD7DPELpQSXHGHHQYLDUVXWDUMHWDGHUHJLVWURSUHLPSUHVDTXHVHLQFOX\HHQHOPDWHULDOGH
HPEDODMH
Was this manual useful for you? yes no
Thank you for your participation!

* Your assessment is very important for improving the work of artificial intelligence, which forms the content of this project

Download PDF

advertisement