GE GTM18GBEES 28 in. W 18.1 cu. ft. Top Freezer Refrigerator Owner's Manual


Add to my manuals
64 Pages

advertisement

GE GTM18GBEES 28 in. W 18.1 cu. ft. Top Freezer Refrigerator Owner's Manual | Manualzz
Top-Freezer
Refrigerators
GEAppliances.com
Top-Freezer
Congélateur supérieur
Refrigerators
Réfrigérateurs
Owner’s Manual and
Installation Instructions
Manuel d’utilisation
et d’installation
Models 16,17,18
Congelador superior
Refrigeradores
Manual del propietario
e instalación
La section française commence à la page 23
La sección en español empieza en la página 45
Safety Instructions . . . . . . . . . . 2, 3
Mesures de sécurité . . . . . . 23–24 Información de seguridad 45–46
Operating Instructions
Instructions de
fonctionnement
Instrucciones de operación
Instructions d’installation
Instrucciones para la
instalación
Automatic Icemaker . . . . . . . . . . . . . . . .5
Care and Cleaning . . . . . . . . . . . . . . . . .6
Energy Smart Models . . . . . . . . . . . . . . .3
Shelves . . . . . . . . . . . . . . . . . . . . . . . . . . . .4
Storage Drawers . . . . . . . . . . . . . . . . 4, 5
Temperature Controls . . . . . . . . . . . . . .4
Installation Instructions
Preparing to Install
the Refrigerator . . . . . . . . . . . . . . . . . . . .7
Reversing the Door Swing . . . . . 11–14
Water Line Installation . . . . . . . . . 8–10
Troubleshooting Tips
Before You Call For Service ...... 16, 17
Normal Operating Sounds . . . . . . . . 16
Consumer Support
Consumer Support . . . . . . Back Cover
Notes . . . . . . . . . . . . . . . . . . . . . . . . . 18-21
Warranty for
Canadian Customers . . . . . . . . . . . . . 18
Warranty for U.S. Customers. . . . . . 22
Bacs de rangement . . . . . . . . . . . 26, 27
Clayettes . . . . . . . . . . . . . . . . . . . . . 25, 26
Energy Smart Models . . . . . . . . . 24
Commandes de
la température . . . . . . . . . . . . . . . . . . . 25
Entretien et nettoyage . . . . . . . . . . . . 28
Machine à glaçons
automatique . . . . . . . . . . . . . . . . . . . . . 27
Installation de la
conduite d’eau . . . . . . . . . . . . . . . . 30–33
Inversion de
l’ouverture des portes . . . . . . . . .34–38
Préparation à l’installation
du réfrigérateur . . . . . . . . . . . . . . . . . . 29
En cas de panne
Avant d’appeler
un réparateur. . . . . . . . . . . . . . . . . . 41, 42
Bruits normaux
de fonctionnement . . . . . . . . . . . . . . . 40
Soutien au consommateur
Control . . . . . . . . . . . . . . . . . . . . . . . . . . 47
Cuidado y limpieza . . . . . . . . . . . . . . 50
Energy Smart Models . . . . . . . . . . . . . 48
Estantes . . . . . . . . . . . . . . . . . . . . . . 47, 48
Gavetas de
almacenamiento . . . . . . . . . . . . . . 48, 49
Máquina de
hielos automática . . . . . . . . . . . . . . . . 49
Cómo invertir el
vaivén de la puerta . . . . . . . . . . . . 57–58
Instalación de la
tubería del agua . . . . . . . . . . . . . . 52–56
Preparación para
instalar el refrigerador. . . . . . . . . . . . 51
Consejos para la solución
de problemas
Antes de solicitar
un servicio . . . . . . . . . . . . . . . . . . . . 60, 61
Sonidos normales
de operación . . . . . . . . . . . . . . . . . . . . . 60
Garantie . . . . . . . . . . . . . . . . . . . . . . . . . 43 Soporte al consumidor
Soutien au consommateur . . . . . . . 44 Garantía . . . . . . . . . . . . . . . . . . . . . . . . 62
Soporte al consumidor . . . . . . . . . . . 63
Write the model and serial
numbers here:
Écrivez ici le numéro de modèle et le
numéro de série :
Escriba aquí el modelo y el número
de serie:
Model # __________________________
Serial # __________________________
<RXFDQ¿QGWKHPRQDODEHORQ
the upper left side of the fresh food
compartment.
Modèle # ________________________
Modelo # ________________________
Série # __________________________
Vous les trouvez sur une étiquette
dans le coin supérieur gauche du
compartiment réfrigérateur.
Serie # __________________________
Encuentre estos números en la etiqueta
en el lado izquierdo de la parte superior
del compartimiento del refrigerador.
197D8622P005
49-60691 03-13 GE
IMPORTANT SAFETY INFORMATION.
READ ALL INSTRUCTIONS BEFORE USING.
WARNING!
Use this appliance only for its intended purpose as described in this Owner’s Manual.
SAFETY PRECAUTIONS
When using electrical appliances, basic safety precautions should be followed, including the following:
„ This refrigerator must be properly installed
and located in accordance with the Installation
Instructions before it is used.
„ Do not attempt to or allow children to climb, stand
or hang on the shelves in the refrigerator. They
could damage the refrigerator and seriously injure
themselves.
„ Do not touch the cold surfaces in the freezer
compartment when hands are damp or wet. Skin
may stick to these extremely cold surfaces.
„'RQRWVWRUHRUXVHJDVROLQHRURWKHUÀDPPDEOH
vapors and liquids in the vicinity of this or any other
appliance.
„In refrigerators with automatic icemakers, avoid
contact with the moving parts of the ejector
mechanism, or with the heating element located on
WKHERWWRPRIWKHLFHPDNHU'RQRWSODFH¿QJHUVRU
hands on the automatic icemaking mechanism while
the refrigerator
is plugged in.
„.HHS¿QJHUVRXWRIWKH´SLQFKSRLQWµDUHDVFOHDUDQFHV
between the doors and between the doors and
cabinet are necessarily small. Be careful closing doors
when children are in the area.
„ Unplug the refrigerator before cleaning and making
repairs.
NOTE: We strongly recommend that any servicing be
SHUIRUPHGE\DTXDOL¿HGLQGLYLGXDO
„ Turning the control to the OFF position does not
remove power to the light circuit.
„ Do not refreeze frozen foods which have
thawed completely.
„ Before replacing a burned-out light bulb, the
refrigerator should be unplugged in order to avoid
FRQWDFWZLWKDOLYHZLUH¿ODPHQW$EXUQHGRXWOLJKW
bulb may break when being replaced.)
„Do not allow children to play with refrigerator or
tamper with controls.
DANGER! RISK OF CHILD ENTRAPMENT
PROPER DISPOSAL OF THE REFRIGERATOR
&KLOGHQWUDSPHQWDQGVXȺRFDWLRQDUHQRWSUREOHPVRI
the past. Junked or abandoned refrigerators are still
GDQJHURXV«HYHQLIWKH\ZLOOVLWIRU´MXVWDIHZGD\Vµ
If you are getting rid of your old refrigerator, please
follow the instructions below to help prevent accidents.
Before You Throw Away Your Old
Refrigerator or Freezer:
„7DNHRȺWKHGRRUV
„ Leave the shelves in place so that children may not
easily climb inside.
„ If the refrigerator has a lock make it unusable.
2
Refrigerants
All refrigeration products contain refrigerants, which
under federal law must be removed prior to product
disposal. If you are getting rid of an old refrigeration
product, check with the company handling the disposal
about what to do.
IMPORTANT SAFETY INFORMATION.
READ ALL INSTRUCTIONS BEFORE USING.
WARNING!
GEAppliances.com
HOW TO CONNECT ELECTRICITY
'RQRWXQGHUDQ\FLUFXPVWDQFHVFXWRUUHPRYHWKHWKLUGJURXQGSURQJIURPWKHSRZHUFRUG
For personal safety, this appliance must be properly grounded.
The power cord of this appliance is equipped with a
SURQJJURXQGLQJSOXJZKLFKPDWHVZLWKDVWDQGDUG
SURQJJURXQGLQJZDOORXWOHWWRPLQLPL]HWKH
possibility of electric shock hazard from this appliance.
+DYHWKHZDOORXWOHWDQGFLUFXLWFKHFNHGE\DTXDOL¿HG
electrician to make sure the outlet is properly grounded.
Where a standard 2-prong wall outlet is encountered, it
is your personal responsibility and obligation to have it
replaced with a properly grounded 3-prong wall outlet.
The refrigerator should always be plugged into its own
individual electrical outlet which has a voltage, wattage
and frequency that match the rating plate.
This provides the best performance and also prevents
overloading house wiring circuits which could cause a
¿UHKD]DUGIURPRYHUKHDWHGZLUHV
Never unplug your refrigerator by pulling on the power
FRUG$OZD\VJULSSOXJ¿UPO\DQGSXOOVWUDLJKWRXWIURP
the outlet.
Repair or replace immediately all power cords that have
become frayed or otherwise damaged. Do not use a
cord that shows cracks or abrasion damage along its
length or at either end.
When moving the refrigerator away from the wall, be
careful not to roll over or damage the power cord.
USE OF EXTENSION CORDS
Because of potential safety hazards under certain conditions, we strongly recommend against the use of
an extension cord.
+RZHYHULI\RXPXVWXVHDQH[WHQVLRQFRUGLWLVDEVROXWHO\QHFHVVDU\WKDWLWEHD8/OLVWHGLQWKH8QLWHG6WDWHVRU
D&6$OLVWHGLQ&DQDGDZLUHJURXQGLQJW\SHDSSOLDQFHH[WHQVLRQFRUGKDYLQJDJURXQGLQJW\SHSOXJDQGRXWOHW
DQGWKDWWKHHOHFWULFDOUDWLQJRIWKHFRUGEHDPSHUHVPLQLPXPDQGYROWV
READ AND FOLLOW THIS SAFETY INFORMATION CAREFULLY.
SAVE THESE INSTRUCTIONS
About Energy Smart™ Models
What Energy Smart™ Does
,IWKH$&0$SSOLDQFH&RPPXQLFDWLRQ
Module) is connected to your refrigerator
and is receiving utility rate information,
then the Energy Smart™ feature alters the
performance of the refrigerator. It minimizes
energy consumption when directed by the
1XFOHXVVROGVHSDUDWHO\RU6PDUW0HWHU7KLV
feature can cause changes in the refrigerator
or freezer compartment temperatures
and can cause changes in rate of ice cube
production.
Energy SmartTM Switch
Models with the EnergySmart ™ feature
have an additional button and LED light on
the controls as shown. The LED will be ON
during high rate periods and OFF during low
or normal rate periods. The button is used
WRGLVDEOHWKH(QHUJ\6PDUWŒIHDWXUHVHH
´(QHUJ\6PDUWŒRYHUULGHµVHFWLRQ
Energy Smart™ Override
Press and hold the Energy Smart™ button
for 3 seconds to override the Energy Smart™
IHDWXUH7KHDGMDFHQW/('ZLOOÀDVKWKUHH
WLPHVWRFRQ¿UPDVXFFHVVIXORYHUULGHRIWKH
feature. This will prevent the feature from
altering the performance of your refrigerator
for 18 hours. During this 18 hour period, the
LED will remain OFF. Eighteen hours after
the feature has been disabled, the Energy
Smart™ feature will return to its normal
operating routine.
3
About the temperature control dial.
Turning the dial to 2ȹVWRSVFRROLQJLQERWKFRPSDUWPHQWV³IUHVKIRRGDQGIUHH]HU,WGRHVQRWVKXWRȺSRZHU
to the refrigerator.
Temperature Control Dial RQVRPHPRGHOV
F
OF
F
The temperature control dial adjust refrigerator from warmest to coldest.
The recommended factory setting is shown in illustration to the left. For colder temperature
WXUQGLDOFORFNZLVHWRZDUGVQRZÀDNH)RUZDUPHUWHPSHUDWXUHWXUQGLDOFRXQWHUFORFNZLVH
DZD\IURPVQRZÀDNHDOORZKRXUVIRUDGMXVWPHQW
OF
OF
F
OF
F
Recommened
factory setting
Coldest setting
Warmest setting
About the fresh food compartment shelves.
Shelf supports at various levels allow you to custom-space your shelves. Not all features are on all models.
2 Lift up and out
1 Tilt up
Half-Width Shelves
One end of the shelf rests on a molded side-wall
VXSSRUWDEUDFNHWRQWKHRWKHUHQGKRRNVLQWRD
track on the rear cabinet wall.
7RUHPRYHOLIWWKHVKHOIXSDWIURQWWKHQRȺWKH
support and out of the track.
To replace, select desired shelf height. With shelf front
raised slightly, hook the bracket’s top lug into the track,
then lower the shelf onto the support.
NOTE: The shelf to the right of the track is
GHVLJQHGWRKRRNLQWRWKHULJKWKDQGVORWWKH
shelf to the left is designed to hook into the lefthand slot.
Full-Width Shelves
Some models have a stationary tempered glass
shelf, a spillproof shelf or two steel wire stationary
shelves. These shelves can be moved to another
place in the fresh food compartment.
When placed correctly on the shelf supports, the
shelf will stop before coming completely out of
the refrigerator and will not tilt when you place
food on it or remove food from it.
Pull forward
To remove the full-width shelves
Spillproof Shelves RQVRPHPRGHOV
Spillproof shelves have special edges
to help prevent spills from dripping
to lower shelves. To remove or replace
the shelves, see the above instructions.
About the freezer compartment shelves.
Step Shelf RQVRPHPRGHOV
To remove the step shelf:
Lift left side of shelf slightly.
1
2
3
Move shelf to the left to free its right ends
from holes in the cabinet wall.
Lower right side of shelf, move shelf to the
right and take it out.
To replace the step shelf:
:LWKVKHOIWLOWHGDVVKRZQ¿WOHIWHQGVRI
shelf into holes in cabinet wall.
4
Lift left side of shelf slightly, swing shelf up,
¿WULJKWHQGVRIVKHOILQWRKROHVLQFDELQHW
wall, and lower shelf into place.
About the storage drawers.
GEAppliances.com
Not all features are on all models.
Fruit and Vegetable Drawers
Snacks Drawer
The snacks drawer can be
moved to the most useful
location for your family’s
needs.
Excess water that may
accumulate in the bottom of the
drawers should be emptied and
the drawers wiped dry.
About storage drawer and cover removal.
Not all features are on all models.
Adjustable Humidity Drawer RQVRPHPRGHOV
Slide the control all the way to the
HIGH setting to provide high humidity
recommended for most vegetables.
Slide the control all the way to the LOW
setting to provide lower humidity levels
recommended for most fruits.
Drawer and Cover Removal
Drawers can be removed easily by grasping
the sides and lifting up slightly while pulling
drawers past the stop location.
To remove the cover,OLIWLWRȺLWVVXSSRUWV
pull it forward, tilt it and take it out.
Twin Drawer Shelf
To remove:
Remove the drawers.
Reach in, push the front of glass cover up,
and at the same time, pull it forward as far
as it will come.
Tilt it and take it out. Avoid cleaning the cold
glass cover with hot water because the extreme
WHPSHUDWXUHGLȺHUHQFHPD\FDXVHLWWREUHDN
5HPRYHWKHGUDZHUIUDPH$OZD\VUHPRYH
the glass cover before you take out the
drawer frame.)
/LIWWKHIUDPHRȺWKHVXSSRUWVDWHDFKVLGHDQG
back, pull it forward, tilt it and take it out.
To replace:
Lower the frame until it rests on the
supports at each side and back.
Replace the glass cover, pushing its rear
HGJH¿UPO\LQWRWKHUHDUIUDPHFKDQQHODQG
gently lowering the front into place.
Replace the drawers.
About the automatic icemaker
A newly-installed refrigerator may take 12–24 hours to begin making ice.
Automatic Icemaker RQVRPHPRGHOV
Icemaker
The icemaker will produce approximately
70-100 cubes. in a 24-hour period, depending
on the freezer compartment temperature, room
temperature, number of door openings and other
use conditions.
If the refrigerator is operated before the water
connection is made to the icemaker, set the
Feeler Arm
switch OFF or move the feeler arm to the STOP
Power Switch
XSSRVLWLRQ
When the refrigerator has been connected to the
water supply, set the switch ON position or move
the feeler arm to the ON GRZQSRVLWLRQ
7KHLFHPDNHUZLOO¿OOZLWKZDWHUZKHQLWFRROVWR
15°F. A newly-installed refrigerator may take 12 to
24 hours to begin making ice cubes.
Once the icemaker starts to make ice, it may take
Feeler Arm
in the STOP
XSWRKRXUVWR¿OOWKHELQGHSHQGLQJRQWKH
XSSRVLWLRQ
Feeler Arm in the
temperature settings and number of door openings.
ON
OFF
ONGRZQSRVLWLRQ
You will hear a buzzing sound each time the
LFHPDNHU¿OOVZLWKZDWHU
7KURZDZD\WKH¿UVWIHZEDWFKHVRILFHWRDOORZ
the water line to clear.
Be sure nothing interferes with the sweep of the
feeler arm.
:KHQWKHELQ¿OOVWRWKHOHYHORIWKHIHHOHUDUPWKH
icemaker will stop producing ice.
It is normal for several cubes to be joined
together.
If ice is not used frequently, old ice cubes will
become cloudy, taste stale, shrink or fuse together.
Icemaker accessory kit:
If your refrigerator did not already come equipped
with an automatic icemaker, an icemaker
accessory kit is available at extra cost.
&KHFNWKHEDFNRIWKHUHIULJHUDWRUIRUWKHVSHFL¿F
icemaker kit needed for your model.
5
Care and cleaning of the refrigerator.
Cleaning the Outside
The door handles and trimRQVRPHPRGHOV&OHDQZLWKD
cloth dampened with soapy water. Dry with a soft cloth.
Keep the outside clean. Wipe with a clean cloth lightly
dampened with kitchen appliance wax or mild liquid dish
detergent. Dry and polish with a clean, soft cloth.
Do not wipe the refrigerator with a soiled dish cloth or wet
towel. These may leave a residue that can erode the paint.
Do not use scouring pads, powdered cleaners, bleach or
cleaners containing bleach because these products can
VFUDWFKDQGZHDNHQWKHSDLQW¿QLVK
The stainless steel doors and door handles RQVRPH
models) can be cleaned with a commercially available
stainless steel cleaner. Cleaners with oxalic acid such as
Bar Keepers Friend Soft Cleanser™ will remove rust, tarnish
and small blemishes. Use only a liquid cleanser free of grit
and rub in the direction of the brush lines with a damp soft
sponge. Do not use appliance wax or polish on the stainless
steel.
Cleaning the Inside
To help prevent odors, leave an open box of baking soda in
the fresh food and freezer compartments.
Unplug the refrigerator before cleaning.
If this is not practical, wring excess moisture out of sponge
or cloth when cleaning around switches, lights or controls.
8VHZDUPZDWHUDQGEDNLQJVRGDVROXWLRQ³DERXWD
WDEOHVSRRQPORIEDNLQJVRGDWRDTXDUWOLWHURIZDWHU
This both cleans and neutralizes odors. Rinse and wipe dry.
After cleaning the door gaskets, apply a thin layer of
petroleum jelly to the door gaskets at the hinge side. This
helps keep the gaskets from sticking and bending out of
shape.
$YRLGFOHDQLQJFROGJODVVVKHOYHVRQVRPHPRGHOVZLWK
KRWZDWHUEHFDXVHWKHH[WUHPHWHPSHUDWXUHGLȺHUHQFH
may cause them to break. Handle glass shelves carefully.
Bumping tempered glass can cause it to shatter.
Do not wash any plastic refrigerator parts in the
dishwasher.
Condenser
There is no need for routine condenser cleaning in normal
home operating environments. However, in environments
that may be particularly dusty
or greasy, the condenser should
be cleaned periodically for
HȻFLHQWUHIULJHUDWRURSHUDWLRQ
To clean the condenser, turn
the temperature control dial to
OFF. Sweep away or vacuum up dust.
Cleaning the condenser coils.
6
For best results, use a brush specially designed for this
purpose. It is available at most appliance parts stores.
Moving the Refrigerator
Be careful when moving the refrigerator away from
WKHZDOO$OOW\SHVRIÀRRUFRYHULQJVFDQEHGDPDJHG
particularly cushioned coverings and those with embossed
surfaces.
Turn the leveling legs at each front corner of the refrigerator
counterclockwise until the rollers support
the refrigerator. Pull the refrigerator straight out and return it
to position by pushing it straight in. Moving
the refrigerator in a side direction may result in damage to
WKHÀRRUFRYHULQJRUUHIULJHUDWRU
When pushing the refrigerator back, make sure you don’t
UROORYHUWKHSRZHUFRUGRULFHPDNHUVXSSO\OLQHRQVRPH
models).
After rolling the refrigerator back into place, turn the
legs clockwise until the legs again bear the weight of the
refrigerator.
Light Bulb Replacement
To replace a burned-out bulb, unplug the refrigerator from
its electrical outlet, unscrew the bulb when cool and replace
it with an appliance bulb of the same or lower wattage.
Turning the control to the OFF position does not remove
power to
the light circuit.
Preparing for Vacation
For long vacations or absences, remove food and unplug
the refrigerator. Move the temperature control dial to the
OFF position, and clean the interior with a baking soda
VROXWLRQRIRQHWDEOHVSRRQPORIEDNLQJVRGDWRRQH
TXDUWOLWHURIZDWHU/HDYHWKHGRRUVRSHQ
Move the feeler arm to the STOPXSSRVLWLRQRUPRYHWKH
switch to the OFF position on the power switch model, and
VKXWRȺWKHZDWHUVXSSO\WRWKHUHIULJHUDWRU
,IWKHWHPSHUDWXUHFDQGURSEHORZIUHH]LQJKDYHDTXDOL¿HG
VHUYLFHUGUDLQWKHZDWHUVXSSO\V\VWHPRQVRPHPRGHOVWR
prevent serious property damage
GXHWRÀRRGLQJ
Preparing to Move
Secure all loose items such as grille, shelves and drawers by
taping them securely in place to prevent damage. Be sure
the refrigerator stays in an upright position during moving.
Installation Instructions Models 16, 17, 18
If you have questions, call 1.800.GE.CARES or visit our Website at: GEAppliances.com
In Canada, call 1.800.561.3344 or Visit our Website at: www.geappliances.ca
BEFORE YOU BEGIN
CLEARANCES
Read these instructions completely and carefully.
Allow the following clearances for ease of installation,
proper air circulation and plumbing and electrical
connections.
•
IMPORTANT – Save these instructions for
local inspector’s use.
•
• Sides 3/4” 19 mm)
• Top 1” 25 mm)
• Back 2” 50 mm)
IMPORTANT – Observe all governing
codes and ordinances.
•
•
•
•
•
•
Note to Installer – Be sure to leave these
instructions with the Consumer.
Note to Consumer – Keep these instructions
for future reference.
Skill level – Installation of this appliance requires
basic mechanical skills.
Completion time – Refrigerator Installation
15 minutes
Reversing the Door Swing
1 hour
Proper installation is the responsibility of the installer.
Product failure due to improper installation is not
covered under the Warranty.
ROLLERS AND LEVELING LEGS
Leveling legs near each front corner of the refrigerator
DUHDGMXVWDEOH7KH\¿UPO\SRVLWLRQWKHUHIULJHUDWRUDQG
prevent it from moving when the doors are opened.
Leveling legs should be set so the front of the refrigerator
is raised just enough that the doors close easily when
opened about halfway.
Turn the leveling legs clockwise to raise the refrigerator,
counterclockwise to lower it.
Rollers next to the leveling legs allow you to move the
refrigerator away from the wall for cleaning.
Turn the legs counterclockwise until the weight of the
refrigerator is transferred from them to the rollers. After
rolling the refrigerator back into place, turn the legs
clockwise until the legs again bear the weight of the
refrigerator.
WATER SUPPLY TO THE ICEMAKER (on
some models)
If the refrigerator has an icemaker, it will have to be
connected to a cold water line. A water supply kit
FRQWDLQLQJFRSSHUWXELQJVKXWRȺYDOYH¿WWLQJVDQG
instructions) is available at extra cost from your dealer,
by visiting our Website at GEAppliances.comLQ&DQDGD
at www.geappliances.ca) or from Parts and Accessories,
1.800.661.1616.
REFRIGERATOR LOCATION
• Do not install the refrigerator where the temperature will
JREHORZƒ)ƒ&EHFDXVHLWZLOOQRWUXQRIWHQHQRXJK
to maintain proper temperatures.
‡,QVWDOOLWRQDÀRRUVWURQJHQRXJKWRVXSSRUWLWIXOO\
loaded.
7
Installation Instructions
1 INSTALLING THE WATER LINE (ON SOME MODELS)
WHAT YOU WILL NEED (CONT.)
BEFORE YOU BEGIN
GE SmartConnect™ Refrigerator Tubing Kits are available
in the following lengths:
6’ P²:;;
15’ P²:;;
25’ P²:;;
Be sure that the kit you select allows at least 8’PDV
described above.
Recommended copper water supply kits are WX8X2,
WX8X3 or WX8X4, depending on the amount of tubing
you need. Approved plastic water supply lines are GE
SmartConnect™5HIULJHUDWRU7XELQJ:;;
WX08X10015 and WX08X10025).
When connecting your refrigerator to a GE Reverse
Osmosis Water System, the only approved installation is
with a GE RVKit. For other reverse osmosis water systems,
follow the manufacturer’s recommendations.
NOTE: The only GE approved plastic tubing is that
supplied in GE SmartConnect™ Refrigerator Tubing kits.
Do not use any other plastic water supply line because
the line is under pressure at all times. Certain types of
plastic will crack or rupture with age and
cause water damage to your home.
This water line installation is not warranted by the
refrigerator or icemaker manufacturer. Follow these
instructions carefully to minimize the risk of expensive
water damage.
:DWHUKDPPHUZDWHUEDQJLQJLQWKHSLSHVLQKRXVH
plumbing can cause damage to refrigerator parts and
OHDGWRZDWHUOHDNDJHRUÀRRGLQJ&DOODTXDOL¿HGSOXPEHU
to correct water hammer before installing the water
supply line to the refrigerator.
• A GE water supply kit FRQWDLQLQJWXELQJVKXWRȺYDOYH
DQG¿WWLQJVOLVWHGEHORZLVDYDLODEOHDWH[WUDFRVWIURP
your dealer or from Parts and Accessories,
1.800.661.1616.
• A cold water supply. The water pressure must be
EHWZHHQDQGSVL²EDU
• Power drill.
• 1/2” or adjustable wrench.
• Straight and Phillips
blade screwdriver.
• Two 1/4” outer diameter compression nuts and
2 ferrules (sleeves)³WRFRQQHFW
WKHFRSSHUWXELQJWRWKHVKXWRȺ
valve and the refrigerator water valve.
OR
• If you are using a GE SmartConnect™ Refrigerator
7XELQJNLWWKHQHFHVVDU\¿WWLQJVDUHSUHDVVHPEOHG
to the tubing.
‡,I\RXUH[LVWLQJFRSSHUZDWHUOLQHKDVDÀDUHG¿WWLQJ
at the end, you will need an adapterDYDLODEOHDW
plumbing supply stores) to connect the water line to the
refrigerator OR \RXFDQFXWRȺWKHÀDUHG¿WWLQJ
with a tube cutter and then use a compression
¿WWLQJ'RQRWFXWIRUPHGHQGIURP*(6PDUW&RQQHFW™
Refrigerator tubing.
To prevent burns and product damage, do not hook up
the water line to the hot water line.
If you use your refrigerator before connecting the water
line, make sure the switch is set to OFF or the feeler arm
is in the STOPXSSRVLWLRQ
Do not install the icemaker tubing in areas where
temperatures fall below freezing.
:KHQXVLQJDQ\HOHFWULFDOGHYLFHVXFKDVDSRZHUGULOO
during installation, be sure the device is double insulated
or grounded in a manner to prevent the hazard of electric
shock, or is battery powered.
All installations must be in accordance with local
plumbing code requirements.
WHAT YOU WILL NEED
• Copper or GE SmartConnect™ Refrigerator Tubing kit,
1/4” outer diameter to connect the refrigerator to the
water supply. If using copper, be sure both ends of the
tubing are cut square.
To determine how much tubing you need: measure
the distance from the water valve on the back of the
refrigerator to the water supply pipe. Then add 8’ P%HVXUHWKHUHLVVXȻFLHQWH[WUDWXELQJDERXW’ [2.4
m] coiled into 3 turns of about 10” [25 cm] diameter) to
allow the refrigerator to move out from the wall after
installation.
• 6KXWRȹYDOYH to connect to the cold water line.
7KHVKXWRȺYDOYHVKRXOGKDYHDZDWHULQOHWZLWKD
minimum inside diameter of 5/32” at the point of
connection to the COLD WATER LINE. Saddle-type
VKXWRȺYDOYHVDUHLQFOXGHGLQPDQ\ZDWHUVXSSO\NLWV
Before purchasing, make sure a saddle-type valve
complies with your local plumbing codes.
8
Installation Instructions
1 INSTALLING THE WATER LINE (CONT.)
,QVWDOOWKHVKXWRȺYDOYHRQWKHQHDUHVWIUHTXHQWO\XVHGGULQNLQJZDWHUOLQH
4 ROUTE THE TUBING
1 SHUT OFF THE MAIN WATER SUPPLY
AND UNPLUG REFRIGERATOR
Route the tubing between the cold water line and the
refrigerator.
Route the tubing through a hole drilled in the wall or
ÀRRUEHKLQGWKHUHIULJHUDWRURUDGMDFHQWEDVHFDELQHW
as close to the wall as possible.
NOTE:%HVXUHWKHUHLVVXȻFLHQWH[WUDWXELQJDERXW
feet [244 cm] coiled into 3 turns of about 10” [25 cm]
diameter) to allow the refrigerator to move out from
the wall after installation.
7XUQRQWKHQHDUHVWIDXFHWFRXQWHUFORFNZLVHORQJ
enough to clear the line of water.
2 DRILL THE HOLE FOR THE VALVE
Choose a location for the valve that is easily
accessible. It is best to connect into the side of a
vertical water pipe. When it is necessary to connect
into a horizontal water pipe, make the connection to
the top or side, rather than at the bottom, to avoid
GUDZLQJRȺDQ\VHGLPHQWIURPWKHZDWHUSLSH
5 CONNECT THE TUBING TO THE VALVE
3ODFHWKHFRPSUHVVLRQQXWDQGIHUUXOHVOHHYHIRU
copper tubing onto the end of the tubing and connect
LWWRWKHVKXWRȺYDOYH
Make sure the tubing is fully inserted into the valve.
Tighten the compression nut securely.
For plastic tubing from a GE SmartConnect™
Refrigerator Tubing kit, insert the molded end of the
WXELQJLQWRWKHVKXWRȺYDOYHDQGWLJKWHQFRPSUHVVLRQ
nut until it is hand tight, then tighten one additional
turn with a wrench. Overtightening may cause leaks.
Drill a 1/4”KROHLQWKHZDWHUSLSHHYHQLIXVLQJDVHOI
piercing valve), using a sharp bit. Remove any burrs
resulting from drilling the hole in the pipe. Take care
not to allow water to drain into the drill. Failure to
drill a 1/4” hole may result in reduced ice production
or smaller cubes.
Saddle-Type
6KXWRȺ9DOYH
Compression
Nut
SmartConnect™
Tubing
Packing Nut
3 FASTEN THE SHUTOFF VALVE
Outlet Valve
)DVWHQWKHVKXWRȺYDOYHWRWKHFROGZDWHUSLSHZLWK
the pipe clamp.
NOTE: Commonwealth of Massachusetts Plumbing
Codes 248CMR shall be adhered to. Saddle valves
are illegal and use is not permitted in Massachusetts.
Consult with your licensed plumber.
Tighten the clamp screws until the sealing washer
begins to swell.
NOTE: Do not overtighten or you may crush the
tubing.
6 FLUSH OUT THE TUBING
Washer
Pipe Clamp
Inlet End
7XUQWKHPDLQZDWHUVXSSO\RQFRXQWHUFORFNZLVHDQG
ÀXVKRXWWKHWXELQJXQWLOWKHZDWHULVFOHDU
Clamp
Screw
Saddle-Type
6KXWRȺ9DOYH
)HUUXOHVOHHYH
6KXWWKHZDWHURȺDWWKHZDWHUYDOYHDIWHUDERXW
RQHTXDUWOLWHURIZDWHUKDVEHHQÀXVKHGWKURXJK
the tubing.
Vertical Cold
Water Pipe
NOTE: Commonwealth of Massachusetts Plumbing
Codes 248CMR shall be adhered to. Saddle valves
are illegal and use is not permitted in Massachusetts.
Consult with your licensed plumber.
9
Installation Instructions
1 INSTALLING THE WATER LINE (CONT.)
7 CONNECT THE TUBING TO THE
8 TURN THE WATER
REFRIGERATOR
ON AT THE
SHUTOFF VALVE
NOTES:
• Before making the connection to the refrigerator, be
sure the refrigerator power cord is not plugged into
the wall outlet.
‡:HUHFRPPHQGLQVWDOOLQJDZDWHU¿OWHULI\RXUZDWHU
supply has sand or particles that could clog the screen
of the refrigerator’s water valve. Install it in the water
line near the refrigerator. If using GE SmartConnect™
Refrigerator Tubing kit, you will need an additional tube
:;;WRFRQQHFWWKH¿OWHU'RQRWFXWSODVWLF
WXEHWRLQVWDOO¿OWHU
Remove the access cover.
Tighten any connections
that leak.
9 PLUG IN THE REFRIGERATOR
Arrange the coil of tubing so that it does not vibrate
against the back of the refrigerator or against the wall.
Push the refrigerator back to the wall.
10 START THE ICEMAKER
On slide switch models, set the icemaker power
switch to the 0N position. On feeler arm models,
move the feeler arm to the ONGRZQSRVLWLRQ7KH
icemaker will not begin to operate until it reaches its
RSHUDWLQJWHPSHUDWXUHRIƒ)²ƒ&RUEHORZ
It will then begin operation automatically.
5HPRYHWKHSODVWLFÀH[LEOH
cap from the water valve
UHIULJHUDWRUFRQQHFWLRQ
Power
switch
3ODFHWKHFRPSUHVVLRQQXWDQGIHUUXOHVOHHYHRQWR
the end of the tubing as shown. On GE SmartConnect™
Refrigerator Tubing kit, the nuts are already assembled
to the tubing.
Insert the end of the tubing into the water valve
connection as far as possible. While holding the tubing,
WLJKWHQWKH¿WWLQJ
For plastic tubing from a GE SmartConnect™
Refrigerator Tubing kit, insert the molded end of the
WXELQJLQWRWKHVKXWRȺYDOYHDQGWLJKWHQFRPSUHVVLRQ
nut until it is hand tight, then tighten one additional
turn with a wrench. Overtightening may cause leaks.
Fasten the tubing into the clamp provided to hold it in a
vertical position. You may need to pry open the clamp.
1/4”
Copper
Tubing
ON
Power switch model
Feeler Arm in the
STOPXSSRVLWLRQ
Feeler Arm in
the ONGRZQSRVLWLRQ
Feeler arm model
NOTE: In lower water pressure conditions, the water
valve may turn on up to 3 times to deliver enough
water to the icemaker.
Tubing
Clamp
1/4” Compression
Nut
)HUUXOHVOHHYH
Refrigerator Connection
OFF
SmartConnect™
Tubing
Reattach the access cover.
10
Installation Instructions
2 REVERSING THE DOOR SWING
IMPORTANT NOTES
2
REMOVE THE FREEZER DOOR
2.1 Tape the door shut with masking tape.
When reversing the door swing:
• Read the instructions all the way through before starting.
• Handle parts carefully to avoid scratching paint.
• Set screws down by their related parts to avoid using
them in the wrong places.
• Provide a non-scratching work surface for
the doors.
IMPORTANT: Once you begin, do not move the cabinet
until door-swing reversal is completed.
These instructions are for changing the hinges from
WKHULJKWVLGHWRWKHOHIWVLGH³LI\RXHYHUZDQWWRFKDQJH
the hinges back to the right side, follow these same
instructions and reverse all references to left and right.
2.2 With a 5/16” hex-head socket driver, remove the
screws that hold the top hinge to the cabinet.
2.3 Lift the hinge straight up to free the hinge pin
from the socket in the top of the door and set it
aside, along with its screws.
Top Hinge
TOOLS REQUIRED
Phillips screwdriver
Masking tape
2.4 Remove the tape and tilt the door away from the
FDELQHW/LIWLWRȺWKHFHQWHUKLQJHSLQ
5/16” hex-head
socket driver
Putty knife or thinblade screwdriver
T20 or T25 Torxdriver
QHHGHGIRUVRPH
models)
2.5 Set the door on a non-scratching surface with the
outside up.
5/16” open-end
wrench
2.6 Transfer the 2 screws from the opposite side of
the cabinet to the screw holes vacated by the top
hinge removal.
1 BEFORE YOU START
1.1 Unplug the refrigerator from its electrical outlet.
1.2 Empty all door shelves, including the dairy
compartment.
CAUTION: 'RQRWOHWHLWKHUGRRUGURSWRWKHÀRRU7R
do so could damage the door stop.
11
Installation Instructions
2 REVERSING THE DOOR SWING (CONT.)
3 REMOVE THE FRESH FOOD DOOR (CONT.)
3 REMOVE THE FRESH FOOD DOOR
3.5 Transfer the two screws from the opposite side of the
cabinet to the screw holes vacated by the center hinge
removal.
3.1 Tape the door shut with masking tape.
3.67UDQVIHUWKHZDVKHULI\RXUPRGHOKDVRQHWRWKH
opposite side.
3.2 Using a 5/16” hex-head socket screwdriver and a
5/16” open-end wrench, remove the two screws
holding the center hinge to the cabinet. Lift the
center hinge to free its pin from the socket in the
top of the door, and set hinge and screws aside.
Be careful not to lose the center hinge spacer and
washer.
3.7 Take one of the screws removed in step 2 and start
it in the outermost screw hole on the opposite side.
'RQRWGULYHLWDOOWKHZD\GRZQ³OHDYHHQRXJKVSDFH
under the screw head for thickness of the bracket.
4 REVERSING THE HARDWARE
3.3 Remove the tape and tilt the door away from the
cabinet. Lift the door from the pin in the bottom
KLQJHEUDFNHW,IWKHSODVWLFZDVKHUVWLFNVWRWKHGRRU
bottom, put it back on the hinge.)
4.1 Move the bottom hinge bracket and plastic washer from
the right side to the left side.
Plastic
Washer
Switch the hinge pin to the
opposite side of the bracket.
Hinge
Bracket
3.4 Set the door outside-up on a non-scratching surface.
12
Installation Instructions
4 REVERSING THE HARDWARE (CONT.)
5 REVERSING THE DOOR HANDLES (CONT.)
4.2 Interchange hinge and screws at top right with
screws at top left of cabinet. Do not tighten screws on
hinge side at this time.
5.1.3 Remove plug button from the top hinge hole on the
left side of the door and insert it into the hole on the
opposite side that was vacated by removal of the top
hinge.
Plug Button
Installing the hinge
on the left.
5.1.4 Pull the plug button from the front of the door and
transfer it to the opposite side.
Installing the hinge
on the right.
NOTES:
• Some hinges have four holes. Which holes you use
for installing the hinge depends on which side you
install the hinge.
• The outer edge of the hinge should be parallel to
the edge of the case for correct installation.
Plug Button
To reattach the
handle on the
opposite side.
5.2 Transfer door stop
5 REVERSING THE DOOR HANDLES
5.2.1 Move the plastic door stop and screws from
the right side to the left side.
5.1 Transfer fresh food door handle
Plastic Door Stop
5.1.1 Remove the handle plug using a tape-tipped
putty knife under the edge, and remove the
screw underneath. Remove the two screws
holding the handle to the top of the door.
Right Side
Left Side
Top
5.2.2 Move the metal door stop from the right
side to the left side and transfer the screw
to the opposite side of the door.
Plug
Left Side
Metal Door Stop
Right Side
5.1.2 Remove the handle.
5.3 Reinstall fresh food door handle
5.3.1 Attach the handle to the right side of the
door with screws at the top
and under the handle plug.
5.3.2 Reinstall the handle plug.
13
Installation Instructions
2 REVERSING THE DOOR SWING (CONT.)
5 REVERSING THE DOOR HANDLES (CONT.)
5.4 Transfer Freezer Door Handle
5.4.1 Remove the screw
holding the handle
to the top of the
door and the two
screws holding the
handle to the bottom
of the door.
5.4.2 Remove the handle.
6 RE-HANGING THE DOORS (CONT.)
6.1.2 Insert the pin on the center hinge into the socket in the
top of the door. Place the spacer, then the washer, on
the hinge pin.
Hinge Pin
NOTE: The center hinge must
be turned over as shown when
mounted on the left side.
TOP
Top
Plastic Washer
and Spacer
6.1.3 Tilt the door toward the cabinet. As the door is brought
into position, slide the hinge under the head of the screw
which earlier had been partly driven into the outermost
hole. Insert the remaining screw, then tighten both
screws securely.
BOTTOM
Bottom
5.4.3 Remove the screw from the
right top edge of the door
and insert it into the handle
screw hole on the left side.
6.2 Re-hang the freezer door
6.2.1 Lower the freezer door
onto the center
hinge pin. Be sure Center Hinge
Pin
the washer and
spacer are in place
on the pin.
5.4.4 Transfer the door stop as shown in preceding
section 5.2.
5.4.5 Attach the handle to the
right edge of the door with
screws at top and bottom,
using bottom holes vacated
by removal of the door stop
screws.
Plastic Washer
and Spacer
6.2.2 Tilt the door toward the cabinet, lifting the top hinge so
WKHSLQ¿WVLQWRWKHVRFNHWRQWKHWRSRIWKHGRRU
6 RE-HANGING THE DOORS
6.1 Re-hang the fresh food door
6.1.1 Lower the fresh food door onto the
bottom hinge pin. Be sure the washer
is in place on the pin.
6.2.3. Make sure the door is slightly above the top of the
cabinet and the gap between the doors is even
across the front. Tighten the top hinge screws. Do not
overtighten these screws–tighten them until they are
just snug, then turn them another one-half turn.
Plastic
Washer
Hinge
Bracket
14
Installation Instructions
3 CONNECTING ENERGY SMART APPLIANCE
1 REMOVE LABEL OVER INTERCONNECT CABLE CONNECTOR ON ACCESS COVER
REMOVE WHEN
CONNECTING TO ACM
LABEL
2 CONNECT APPLIANCE TO ACM
2.1 Locate interconnect cable.
This accessory is part of ACM
kit.
2.2 Plug interconnect cable into
connector on access cover as
shown.
2.3 Plug opposite end of
interconnect cable into ACM.
2.4 Refer to ACM kit instructions
to connect ACM to NucleusTM
energy manager or Smart Meter
3 PLACE ACM
NOTE: The ACM can be placed on top, back, or side of refrigerator. ACM can also be
LQVWDOOHGZLWKRXWGLUHFWFRQWDFWZLWKUHIULJHUDWRUIRUH[DPSOHLQDGMRLQLQJFDELQHWV
See ACM manual for further ACM installation details.
15
Normal operating sounds.
GEAppliances.com
1HZHUUHIULJHUDWRUVVRXQGGLȺHUHQWIURPROGHUUHIULJHUDWRUV0RGHUQUHIULJHUDWRUVKDYHPRUHIHDWXUHV
and use newer technology.
Do you hear what I hear? These sounds are normal.
„ 7KHQHZKLJKHȻFLHQF\
HUMMM...
WHOOSH...
compressor may run
faster and longer than
your old refrigerator and
you may hear a high-pitched hum or pulsating sound
while it is operating.
„ You may hear a whooshing sound when the doors close.
This is due to pressure equalizing within the refrigerator.
„ You may hear the fans spinning at high
speeds.
7KLVKDSSHQVZKHQWKHUHIULJHUDWRULV¿UVW
plugged in, when the doors are opened
frequently or when
a large amount of food is added to the refrigerator or freezer
compartments. The fans are helping to maintain the correct
temperatures.
CLICKS, POPS,
CRACKS and CHIRPS
„ You may hear cracking or popping sounds when the
UHIULJHUDWRULV¿UVWSOXJJHGLQ7KLVKDSSHQVDVWKH
refrigerator cools to the correct temperature.
„ The compressor may cause a clicking or chirping sound
ZKHQDWWHPSWLQJWRUHVWDUWWKLVFRXOGWDNH
up to 5 minutes).
„ Expansion and contraction of cooling coils during and after
defrost can cause a cracking or popping sound.
WATER SOUNDS
„ 7KHÀRZRIUHIULJHUDQWWKURXJKWKHIUHH]HUFRROLQJFRLOVPD\
make a gurgling noise like boiling water.
„ Water dropping on the defrost heater can cause a sizzling,
popping or buzzing sound during the defrost cycle.
„ A water dripping noise may occur during the defrost cycle as ice
melts from the evaporator and flows into the drain pan.
„
Closing the door may cause a gurgling sound due to pressure
equalization.
„ On models with an icemaker, after an icemaking cycle, you
For additional information on normal
icemaker operating sounds, see the
About the automatic icemaker section.
may hear the ice cubes dropping into the ice bucket.
Before you call for service…
Troubleshooting Tips
Save time and money! Review the charts on the following
SDJHV¿UVWDQG\RXPD\QRWQHHGWRFDOOIRUVHUYLFH
Problem
Possible Causes
Refrigerator does not
operate
Refrigerator in defrost cycle.
• Wait about 30 minutes for defrost cycle to end.
Temperature control dial
• Move the temperature control dial to a temperature
in OFF position.
setting.
Refrigerator is unplugged.
• Push the plug completely into the outlet.
The fuse is blown/circuit
• Replace fuse or reset the breaker.
breaker is tripped.
Energy Smart™ feature is
• Wait about 2 hours for normal operation to continue
altering refrigerator performance
Roller screws or leveling legs
• See Rollers and Leveling Legs.
need adjusting.
Temperature control dial
• See About the temperature control dial.
not set cold enough.
Warm weather or frequent
• Set the temperature control dial one step colder.
door openings.
See About the temperature control dial.
Door left open.
• Check to see if package is holding door open.
Package blocking air duct in
• Check to see if package is blocking air duct in freezer
freezer compartment.
compartment.
Energy Smart™ feature is
• See About Energy Smart™ Models
altering refrigerator performance
Vibration or rattling (slight
vibration is normal)
Fresh food or freezer
compartment too warm
16
What To Do
Before you call for service…
Troubleshooting Tips
Problem
Possible Causes
What To Do
Motor operates for
long periods or cycles
RQDQGRȹIUHTXHQWO\
(Modern refrigerators
with more storage space
and a larger space and
a larger freezer require
more operating time.
They start and stop
often to maintain even
temperatures.)
Normal when refrigerator
LV¿UVWSOXJJHGLQ
Often occurs when large
amounts of food are
placed in refrigerator.
Door left open.
Hot weather or frequent
door openings.
Temperature control dial
set at the coldest setting.
Grille and condenser
need cleaning.
Door left open.
Too frequent or too long
door openings.
• Wait 24 hours for the refrigerator to completely
cool down.
• This is normal.
Icemaker is not on.
• Move the feeler arm to the ONGRZQSRVLWLRQ
or on the power switch model, move the switch to the ON position
• See Installing the water line.
Frost or ice crystals
on frozen food
(frost within package
is normal)
Automatic icemaker
does not work
(on some models)
Frequent “buzzing” sound
Cubes too small
Slow ice cube freezing
Ice cubes have
odor/taste
Moisture forms on
cabinet surface
between the doors
Moisture collects inside (in
humid weather, air carries
moisture into refrigerator
when doors are opened)
Refrigerator has odor
• Check to see if package is holding door open.
• This is normal.
• See About the temperature control dial.
• See Care and cleaning.
• Check to see if package is holding door open.
:DWHUVXSSO\WXUQHGRȹRU
not connected.
Freezer compartment
• Wait 24 hours for the refrigerator to completely
too warm.
cool down.
Piled up cubes in the storage
• Level cubes by hand.
bin cause the icemaker
WRVKXWRȹ
Icemaker is on but the water
•Move the feeler arm to the STOP (up) position or move the
supply to the refrigerator has
power switch to the OFF position. Keeping it on will damage.
not been connected.
the water valve.
:DWHUVKXWRȹYDOYHFRQQHFWLQJ •Call the plumber to clear the valve.
refrigerator to water line may
be clogged.
Door left open.
• Check to see if package is holding door open.
Temperature control dial
• See About the temperature control dial.
not set cold enough.
Energy SmartTM feature is
• See About Energy SmartTM Models..
altering refrigerator performance
Ice storage bin needs cleaning. • Empty and wash bin. Discard old cubes.
Food transmitting odor/taste
• Wrap foods well.
to ice cubes.
Interior of refrigerator
• See Care and cleaning.
needs cleaning.
Not unusual during
• Wipe surface dry and reset temperature control dial
periods of high humidity.
one setting colder.
Too frequent or too
long door openings.
Foods transmitting
odor to refrigerator.
Interior needs cleaning.
• Foods with strong odors should be tightly wrapped.
‡.HHSDQRSHQER[RIEDNLQJVRGDLQWKHUHIULJHUDWRU
replace every three months.
• See Care and cleaning.
17
NOTES
18
NOTES
19
NOTES
20
NOTES
21
Refrigerator Warranty. )RUFXVWRPHUVLQWKH8QLWHG6WDWHV
All warranty service provided by our Factory Service Centers,
or an authorized Customer Care® technician. To schedule
service, on-line, 24 hours a day, visit us at GEAppliances.com, or
FDOO*(&$5(63OHDVHKDYHVHULDOQXPEHUDQG
model number available when calling for service.
Staple your receipt here.
Proof of the original purchase
date is needed to obtain
service under the warranty.
For The Period Of: GE Will Replace:
GE and GE PROFILE MODELS:
One Year
Any part of the refrigerator which fails due to a defect in materials or workmanship.
From the date of the
During this limited one-year warranty, GE will also provide, free of charge, all labor and
original purchase
related service to replace the defective part.
Thirty Days
Any part RIWKHZDWHU¿OWHUFDUWULGJHZKLFKIDLOVGXHWRDGHIHFWLQPDWHULDOVRUZRUNPDQVKLS
:DWHU¿OWHULILQFOXGHG 'XULQJWKLVlimited thirty-day warranty, GE will also provide, free of charge, a replacement water
)URPWKHRULJLQDO
¿OWHUFDUWULGJH
purchase date of
the refrigerator
GE PROFILE MODELS ONLY:
Five Years
*(3UR¿OHPRGHOVRQO\
From the date of the
original purchase
Any part of the sealed refrigerating system WKHFRPSUHVVRUFRQGHQVHUHYDSRUDWRU
and all connecting tubing) which fails due to a defect in materials or workmanship.
During this OLPLWHG¿YH\HDUVHDOHGUHIULJHUDWLQJV\VWHPZDUUDQW\GE will also provide,
free of charge, all labor and related service to replace the defective part in the sealed
refrigerating system.
What GE Will Not Cover:
„ Service trips to your home to teach you how to use the
product.
„ Improper installation, delivery or maintenance.
„ 5HSODFHPHQWRIWKHZDWHU¿OWHUFDUWULGJHLILQFOXGHGGXH
WRZDWHUSUHVVXUHWKDWLVRXWVLGHWKHVSHFL¿HGRSHUDWLQJ
range or due to excessive sediment in the
water supply.
„ Failure of the product if it is abused, misused, or used for
other than the intended purpose or used commercially.
„ 5HSODFHPHQWRIWKHOLJKWEXOEVLILQFOXGHGRUZDWHU¿OWHU
cartridge, if included, other than as noted above.
„ Loss of food due to spoilage.
„ Replacement of house fuses or resetting of circuit breakers.
„ 'DPDJHWRWKHSURGXFWFDXVHGE\DFFLGHQW¿UHÀRRGV
or acts of God.
„ 'DPDJHWRWKH¿QLVKPXVWEHUHSRUWHGZLWKLQKRXUV
following delivery of the appliance.
„ Incidental or consequential damage caused by possible
defects with this appliance.
„ 'DPDJHWR¿QLVKLQFOXGLQJUXVWWDUQLVKRUVPDOO
blemishes, after delivery.
„ Product not accessible to provide required service.
„ Products which are not defective, broken, or which are
working as described in the Owner’s Manual.
(;&/86,212),03/,(':$55$17,(6³<RXUVROHDQGH[FOXVLYHUHPHG\LVSURGXFWUHSDLUDVSURYLGHGLQ
this Limited Warranty. Any implied warranties, including the implied warranties of merchantability or
¿WQHVVIRUDSDUWLFXODUSXUSRVHDUHOLPLWHGWRRQH\HDURUWKHVKRUWHVWSHULRGDOORZHGE\ODZ
This warranty is extended to the original purchaser and any succeeding owner for products purchased for home
use within the USA. If the product is located in an area where service by a GE Authorized Servicer is not available,
you may be responsible for a trip charge or you may be required to bring the product to an Authorized GE
Service location for service. In Alaska, the warranty excludes the cost of shipping or service calls to your home.
Some states do not allow the exclusion or limitation of incidental or consequential damages. This warranty gives
\RXVSHFL¿FOHJDOULJKWVDQG\RXPD\DOVRKDYHRWKHUULJKWVZKLFKYDU\IURPVWDWHWRVWDWH7RNQRZZKDW\RXU
OHJDOULJKWVDUHFRQVXOW\RXUORFDORUVWDWHFRQVXPHUDȺDLUVRȻFHRU\RXUVWDWH·V$WWRUQH\*HQHUDO
Warrantor: General Electric Company. Louisville, KY 40225
22
INSTRUCTIONS IMPORTANTES DE SÉCURITÉ.
LISEZ TOUTES LES INSTRUCTIONS AVANT
D’UTILISER VOTRE RÉFRIGÉRATEUR.
AVERTISSEMENT!
N’utilisez cet appareil qu’aux fins prévues dans le présent Manuel du Propriétaire.
MESURES DE SÉCURITÉ
Pour utiliser un appareil électroménager électrique, vous devez prendre des mesures de sécurité,
en particulier :
„ Vous devez bien installer et placer votre
réfrigérateur, conformément aux Instructions
d’installation avant de l’utiliser.
„ N’essayez pas ou ne permettez pas aux enfants
de grimper, se tenir ou se suspendre aux tablettes
du réfrigérateur.
„ Ne touchez jamais les surfaces froides dans le
compartiment congélation quand vos mains sont
humides ou mouillées. Votre peau peut coller à
ces surfaces extrêmement froides.
„ Ne conservez jamais ou n’utilisez jamais d’essence
ou d’autres liquides ou gaz inflammables à
proximité de votre réfrigérateur ou de tout autre
appareil électroménager.
„ Dans les réfrigérateurs qui ont des machines
à glaçons, évitez tout contact avec les éléments
mobiles du mécanisme d’éjection ou avec
l’élément chauffant situé à la partie inférieure de
la machine à glaçons. Ne mettez jamais vos doigts
ou vos mains sur le mécanisme de fabrication
automatique de glaçons quand le réfrigérateur est
branché.
„ Ne laissez jamais vos doigts dans des endroits où
ils risquent d’être pincés. L’écartement entre les
portes et l’armoire est nécessairement petit. Faites
attention de fermer les portes quand des enfants
se trouvent à proximité.
„ Débranchez votre réfrigérateur avant de le
nettoyer et de le réparer.
NOTE: Nous vous recommandons fortement de
faire accomplir tout service par un technicien
qualifié.
„
Le courant du circuit de la lampe n’est pas
interrompu même en tournant le bouton de la
commande de température vers la position OFF
(arrêt).
„ Ne recongelez jamais des aliments congelés qui
ont complètement dégelé.
„ Le réfrigérateur doit être débranché avant de
remplacer l’ampoule afin d’éviter tout contact
avec un fil de câble sous tension.
„
Ne laissez pas les enfants jouer avec le réfrigérateur
ni les commandes.
DANGER! RISQUE DE PRISE AU PIÈGE D’ENFANT
BONNE MISE AU REBUT DE VOTRE RÉFRIGÉRATEUR
L’enfermement et l’asphyxie des enfants ne sont pas
des histoires du passé. Les réfrigérateurs jetés ou
abandonnés sont toujours dangereux... même s’ils ne
doivent rester là que “quelques jours”. Si vous vous
débarrassez de votre vieux réfrigérateur, suivez les
instructions suivantes pour prévenir tout accident.
Avant de jeter votre vieux réfrigérateur ou
congélateur :
Réfrigérants
Tous les appareils de réfrigération contiennent des
réfrigérants qui, conformément aux lois fédérales,
doivent être enlevés avant toute élimination de
l’appareil. Si vous vous débarrassez de vieux appareils
de réfrigération, vérifiez, auprès de la société qui
s’occupe de leur élimination, ce que vous devez faire.
„ Enlevez les portes.
„ Laissez les clayettes en place, pour éviter que des
enfants puissent facilement grimper et se tenir dans
votre réfrigérateur.
„ Si le réfrigérateur est doté d’une fonction de
verrouillage, assurez-vous de la désactiver.
23
INSTRUCTIONS IMPORTANTES DE SÉCURITÉ.
LISEZ TOUTES LES INSTRUCTIONS AVANT
D’UTILISER VOTRE RÉFRIGÉRATEUR.
www.electromenagersge.ca
AVERTISSEMENT!
BRANCHEMENT ÉLECTRIQUE
Ne coupez ou n’enlevez jamais, en n’importe quelles conditions, la troisième broche (mise à la terre) de votre cordon
d’alimentation. Pour votre sécurité personnelle, vous devez bien mettre à la terre cet appareil électroménager.
Le cordon d’alimentation de cet appareil est muni
Le rendement de votre réfrigérateur sera meilleur
d’une fiche à trois broches (bipolaire avec terre) qui se
et vous éviterez ainsi de surcharger les circuits
met dans une prise murale à trois trous (bipolaire avec électriques et de surchauffer le câblage de votre
terre), pour réduire le risque de secousse électrique
maison, et éviterez ainsi tout risque d’incendie
occasionné par cet appareil.
provoqué par des câbles surchauffés.
Faites vérifier la prise murale et le circuit électrique
Ne débranchez jamais votre réfrigérateur en tirant
par un électricien qualifié pour vous assurer que la
sur le cordon d’alimentation. Tenez toujours la fiche
prise murale est bien mise à la terre.
fermement et enlevez-la de la prise en tirant droit.
Si vous avez une prise murale à deux broches
Réparez ou remplacez immédiatement tout cordon
seulement (sans terre), vous êtes personnellement
d’alimentation usé ou endommagé. N’utilisez jamais
responsable et obligé de la faire remplacer par une
de cordon fissuré ou usé sur sa longueur ou à l’une de
bonne prise murale avec terre, bien mise à la terre.
ses extrémités.
Le réfrigérateur doit toujours être branché dans une
Pour écarter votre réfrigérateur du mur, faites
prise murale individuelle dont la tension, la puissance
attention dene pas écraser ou d’endommager le
et la fréquence correspondent aux indications de la
cordon d’alimentation.
plaque d’identification.
UTILISATION DE RALLONGES ÉLECTRIQUES
Nous vous recommandons fortement de ne pas utiliser de rallonge électrique, à cause d’un danger de risques
possibles de sécurité dans certaines conditions.
Cependant, si vous devez absolument utiliser un cordon rallonge électrique, il est absolument requis que vous utilisiez
un cordon rallonge trifilaire, avec mise à la terre, certifié UL (aux États-Unis) ou ACNOR (au Canada), avec prise et fiche
à trois conducteurs, et à notation électrique de 15 ampères (minimum) et 120 volts.
LISEZ ET SUIVEZ SOIGNEUSEMENT CES MESURES DE SÉCURITÉ.
CONSERVEZ CES INSTRUCTIONS
Au sujet des modèles Energy Smart™ Rôle
Du Energy Smart™ Si un Module de
Communication (ACM) est branché à votre
réfrigérateur et que ce dernier reçoit l’information
du niveau utilitaire, alors la caractéristique Energy
Smart™ modifie le rendement du réfrigérateur.
Elle réduit la consommation énergétique au
minimum avec la gestion du Nucleus (vendu
séparément) ou Smart Meter. Cette caractéristique
peut modifier la température des compartiments
du réfrigérateur ou du congélateur et modifier le
taux de production des glaçons.
Interrupteur Energy Smart™ Les modèles Dotés de la Caractéristique
EnergySmart™ possèdent un bouton
additionnel et un témoin à DEL situés sur
le panneau de commande, comme illustré.
Le témoin à DEL sera ILLUMINÉ pendant les
périodes de rendement intensives et sera
ÉTEINT pendant les périodes de rendement
normal ou faible. Ce bouton est utilisé pour
désactiver la caractéristique EnergySmart™
(voir le chapitre “Désactivation de la
caractéristique EnergySmart™”).
Désactivation de la caractéristique EnergySmart™
Appuyer et maintenir le bouton Energy Smart™
enfoncé pendant 3 secondes pour désactiver la
caractéristique Energy Smart™. Le témoin à DEL
adjacent clignotera trois fois pour confirmer la réussite
de la désactivation de la caractéristique. Cette
24
désactivation évite la modification du rendement du
réfrigérateur pendant 18 heures. Au cours de cette
période de 18 heures, le témoin à DEL sera éteint. La
caractéristique Energy Smart™ effectuera un retour
vers la routine de fonctionnement normale.
Bouton de commande de la température
Tournez le bouton à la position OFF pour arrêter le refroidissement dans les deux compartiments réfrigérateur et
congélateur, mais cela ne coupe pas l’alimentation du réfrigérateur.
Cadran de température (sur certains modèles)
OF
F
OF
F
OF
Réglage en usine
recommandé
F
OF
F
Le cadran de température permet de régler la température du plus chaud au plus froid. Le
réglage en usine recommandé est illustré à gauche. Pour refroidir davantage, tournez le cadran
vers la droite vers le flocon de neige. Pour obtenir une température moins froide, tournez
le cadran vers la gauche (contraire au flocon de neige) et attendez 24 heures afin que la
température atteigne le degré désiré.
Réglage plus froid
Réglage moins froid
Clayettes du compartiment réfrigérateur
Les clayettes se placent à différents niveaux vous permettant de personnaliser l’espace de rangement. Toutes les
caractéristiques ne sont pas disponibles sur tous les modèles.
Clayettes demi-largeur
2 Soulevez pour dégager
1 Relevez
Un côté de la clayette repose sur le support
moulé dans la cloison latérale; un support de
l’autre côté permet d’accrocher la clayette
dans un rail de la cloison arrière.
Pour enlever la clayette, relevez-la à l’avant
et retirez-la du support et du rail.
Pour remettre la clayette, sélectionnez
la hauteur désirée. Relevez légèrement la
clayette à l’avant, fixez le crochet supérieur
dans le rail, puis abaissez la clayette sur le
support.
Clayettes pleine largeur
Quelques modèles sont équipés de tablettes
en verre trempé fixes, une tablette antigoutte
ou de tablettes fixes bimétalliques. Vous
pouvez déplacer ces clayettes à un autre
Relevez l’arrière/Tirez-la vers l’avant endroit du compartiment réfrigérateur.
Pour enlever les clayettes pleine
largeur
Certains modèles possèdent une clayette
coulissante métallique, une clayette en verre
trempée fixe, une clayette anti-déversement
ou deux clayettes fixes métalliques.
Clayettes antidébordement
Les clayettes antidébordement comportent
des rebords spéciaux pour aider à prévenir
l’égouttement sur les clayettes inférieures.
REMARQUE: La clayette à droite du rail est
conçue pour s’accrocher dans l’encoche de
droite; la clayette à gauche du rail est conçue
pour s’accrocher dans l’encoche de gauche.
Relevez l’arrière
Tirez-la vers l’avant et vers le bas
Pour enlever une clayette pleine largeur
lorsque la porte du compartiment réfrigérateur
ne peut pas s’ouvrir complètement.
Consultez les instructions ci-dessus pour
enlever ou réinstaller les clayettes.
Clayettes du compartiment congélateur
Clayette étagée
1
2
3
Pour enlever la clayette étagée :
Relevez légèrement le côté gauche de
la clayette.
Déplacez la clayette vers la gauche pour
libérer son côté droit des trous de la cloison
de la caisse.
Abaissez le côté droit de la clayette,
déplacez-la vers la droite pour l’enlever.
Pour remettre la clayette étagée :
La clayette étant inclinée comme il est illustré
sur la figure, insérez les extrémités gauches
de la clayette dans les trous de la cloison de
la caisse.
Relevez légèrement le côté gauche de la
clayette, relevez-la et insérez les extrémités
droites de la clayette dans les trous de la
cloison de la caisse. Abaissez la clayette pour
la mettre en place.
25
Bacs de rangement
Toutes les caractéristiques ne sont pas disponibles sur tous les modèles.
Bac à collation
Le bac à collation peut être
placé à l’emplacement
qui convient le mieux aux
besoins de votre famille.
Bacs à légumes et à fruits
Lorsque l’eau s’accumule au fond
des bacs, videz-les et essuyez-les.
Enlèvement du bac de rangement et du couvercle
Toutes les caractéristiques ne sont pas disponibles sur tous les modèles.
Bac à légume à humidité réglable (sur certains modèles)
Faites glisser le réglage en position HIGH
(élevée) pour obtenir l’humidité maximum qui est
recommandée pour la plupart des légumes.
Faites glisser le réglage en position LOW
(basse) pour obtenir l’humidité minimum qui est
recommandée pour la plupart des fruits.
Enlèvement du bac de rangement et du couvercle
Vous pouvez enlever facilement les bacs en
relevant légèrement les côtés lorsque le bac
dépasse la position de butée stop.
Clayette du bac double
Pour enlever les bacs:
Enlevez les deux bacs.
Relevez l’avant du couvercle en verre
par-dessous et en même temps, tirez-le
vers l’avant aussi loin que possible.
Inclinez-le et enlevez-le. Évitez de nettoyer
le couvercle en verre froid avec de l’eau
chaude, car la grande différence de
température peut le briser.
Enlevez le cadre du bac (enlevez toujours le
couvercle en verre avant d’enlever le cadre).
Pour enlever le couvercle, soulevez-le de ses
supports, tirez-le vers l’avant, inclinez-le pour
l’enlever.
Soulevez le cadre des supports de chaque côté
et derrière, tirez-le vers l’avant. Inclinez-le pour
le retirer.
Pour remettre les bacs:
Placez le cadre pour qu’il repose sur les
supports de chaque côté et derrière.
Remettez le couvercle en verre, appuyez
fermement le bord arrière dans la rainure
arrière du cadre et abaissez doucement le
devant du couvercle pour le mettre en place.
Replacez les bacs.
Machine à glaçons automatique
Un réfrigérateur nouvellement installé prend de 12 à 24 heures pour commencer à produire des glaçons.
Machine à glaçons
ON
OFF
Interrupteur
Le bras palpeur
est en position
ON (marche)
en bas
26
Levier
détecteur
Le bras
palpeur est
en position
STOP (arrêt)
en haut
Machine à glaçons automatique
(sur certains modèles)
La machine à glaçons produit sept glaçons
par cycle, environ 70 à 100 glaçons par 24
heures, selon la température du compartiment
congélation, la température de la pièce, le
nombre de fois que la porte est ouverte et les
autres conditions d’utilisation.
Si vous utilisez votre réfrigérateur avant son
raccordement à l’alimentation d’eau, réglez
l’interrupteur à OFF (arrêt) ou déplacez le levier
à la position STOP (vers le haut).
Dès que le réfrigérateur est relié à l’alimentation
d’eau, placez l’interrupteur à la position ON
(marche), déplacez le levier vers le bas.
Après avoir raccordé le réfrigérateur à
l’alimentation d’eau, amenez le bras palpeur
en position ON (marche) en bas.
Déplacez le levier à la position ON (vers le bas) ou
déplacez l’interrupteur coulissant vers la position
ON (marche) La machine à glaçons se remplit
d’eau quand elle atteint 15°F. Un réfrigérateur
nouvellement installé prend de 12 à 24 heures
pour commencer à produire des glaçons.
Jetez les premiers lots de glaçons pour
permettre à la conduite d’eau de se purger.
Assurez-vous que rien ne gène la course du
bras palpeur.
Quand le bac se remplit jusqu’au niveau du
bras palpeur, la machine à glaçons s’arrête de
produire des glaçons.
Il est normal de trouver des glaçons qui soient
soudés ensemble.
Si vous n’utilisez pas souvent vos glaçons, les
vieux glaçons deviennent opaques, prennent
un mauvais goût et rétrécissent.
Trousse accessoire de machine à glaçons
Si votre réfrigérateur n’est pas déjà équipé
d’une machine à glaçons automatique, vous
pouvez acheter une trousse accessoire de
machine à glaçons.
Vérifiez derrière votre réfrigérateur le modèle
de trousse à glaçons que vous devez acheter
pour votre réfrigérateur.
Soins et nettoyage de votre réfrigérateur
www.electromenagersge.ca
Nettoyage de l’extérieur
efficace de votre réfrigérateur.
Les poignées de porte et les garnitures (sur certains modèles).
Nettoyez avec un linge trempé dans de l’eau savonneuse.
Séchez avec un linge doux.
Pour nettoyer le condensateur, tournez le bouton de réglage de
température à OFF (arrêt) et balayez ou passez l’aspirateur pour
éliminer la poussière.
Conservez l’extérieur propre. Essuyez avec un linge propre
légèrement humecté de cire à appareil électroménager ou de
détersif liquide à vaisselle doux. Séchez et polissez avec un linge
doux, propre.
Pour obtenir de bons résultats, utilisez une brosse spécialiement
conçue à cette fin. Vous la trouverez en vente dans la plupart
des magasins de pièces d’appareils électroménagers.
N’essuyez jamais votre réfrigérateur avec un torchon sale ou
une serviette mouillée. Cela peut laisser un résidu qui risque
d’endommager la peinture. N’utilisez jamais de tampon à
récurer, de nettoyant en poudre, d’eau de javel ou de produit
nettoyant contenant un agent de blanchiment, car ces produits
peuvent rayer et endommager la peinture.
Faites attention quand vous écartez votre réfrigérateur du mur.
Vous pouvez endommager votre revêtement de plancher, en
particulier s’il est matelassé ou s’il a une surface en relief.
Vous pouvez nettoyer les portes et les poignées de porte
en acier inoxydable (sur certains modèles) avec un nettoyant
d’acier inoxydable vendu sur le marché. Les nettoyants qui
contiennent de l’acide oxalique, tels que Bar Keepers Friend
Soft Cleanser, éliminent la rouille, le ternissement et les petites
taches. Utilisez uniquement un nettoyant liquide exempt
d’abrasif et frottez dans la direction des lignes de brossage à
l’aide d’une éponge souple imbibée.
N’utilisez pas de cire pour appareils ménagers sur l’acier
inoxydable.
Nettoyage de l’intérieur
Écartement du réfrigérateur
Tournez les pieds de nivellement à chaque coin avant du
réfrigérateur vers la gauche pour que les roulettes supportent
le poids du réfrigérateur. Tirez le réfrigérateur en ligne droite
et remettez-le en place en poussant en ligne droite. Vous
pouvez endommager le revêtement de plancher ou votre
réfrigérateur en le déplaçant latéralement.
Lorsque vous remettez en place votre réfrigérateur, assurezvous de ne pas le rouler sur le cordon d’alimentation ou la
conduite d’eau de la machine à glaçons (sur certains modèles).
Après avoir remis le réfrigérateur en place en le faisant rouler,
tournez les pieds vers la droite pour qu’ils supportent de
nouveau le poids du réfrigérateur.
Remplacement de l’ampoule
Pour aider à empêcher les odeurs, laissez une boîte ouverte de
bicarbonate de soude dans les compartiments réfrigération et
congélation.
Pour remplacer une ampoule grillée, débranchez le réfrigérateur,
dévissez l’ampoule après l’avoir laissé refroidir et remplacez-la
par une ampoule pour appareil électroménager de puissance
identique ou moindre.
Débranchez votre réfrigérateur avant de le nettoyer.
Si ce n’est pas pratique, enlevez toute humidité au moyen d’une
éponge ou d’un chiffon pour nettoyer autour des commutateurs,
des lumières ou des réglages.
Le courant du circuit de la lampe n’est pas interrompu même
en tournant le bouton de la commande de température vers la
position OFF (arrêt).
Utilisez une solution d’eau chaude et de bicarbonate de soude
15 ml (soit une cuillère à soupe environ) de bicarbonate de
soude dans 1 litre (soit une pinte) d’eau). Cette solution nettoie
tout en neutralisant les odeurs. Rincez et séchez en essuyant.
Après avoir nettoyé les joints de porte, appliquez une mince
couche de vaseline sur les joints du côté charnières afin de les
empêcher de coller et de se déformer.
Évitez de nettoyer les clayettes froides en verre (sur certains
modèles) à l’eau chaude, parce qu’elles risquent de se casser à
cause de la grande différence de températures. Manipulez avec
soins le verre. Vous pouvez briser
en éclats le verre trempé en le
heurtant.
Ne lavez aucune pièce en matière
plastique de votre réfrigérateur
dans votre machine à laver la
vaisselle.
Nettoyage du serpentin du
condenseur.
Le condenseur
Vous n’avez pas besoin de nettoyer souvent le condenseur
en milieu domestique normal. Cependant, en milieu
particulièrement gras ou poussiéreux, vous devez nettoyer
périodiquement le condenseur pour obtenir un fonctionnement
Préparation de départ en vacances
Pour de longues vacances ou absences, enlevez tous vos
aliments et débranchez votre réfrigérateur. Mettez le bouton
de commande de la température en position OFF et nettoyez
l’intérieur avec une solution de bicarbonate de soude, de 15 ml
(une cuillère à soupe) de bicarbonate de soude pour 1 litre (une
pinte) d’eau. Laissez les portes ouvertes.
Déplacez le levier à la position STOP (vers le haut) ou mettez
l’interrupteur à la position OFF (arrêt) pour le modèle à
interrupteur coulissant, et fermez l’arrivée d’eau du réfrigérateur.
Si la température risque de descendre en dessous du point
de congélation, demandez à un technicien qualifié de purger
votre système d’alimentation d’eau (sur certains modèles) pour
empêcher des inondations pouvant occasionner des dégâts
sérieux.
Préparation de déménagement
Fixez en place toutes les pièces mobiles, comme la grille, les
clayettes et les tiroirs, à l’aide de ruban adhésif, pour empêcher
tout dommage.
Assurez-vous que votre réfrigérateur soit en position droite
pendant le déménagement.
27
Instructions d’installation Modèles 16, 17, 18
Si vous avez des questions, appelez le 1.800.561.3344 ou visitez notre site Web à l’adresse: www.
electromenagersge.ca
DÉGAGEMENTS
AVANT DE COMMENCER
Prévoyez les dégagements suivants pour faciliter
l’installation, la bonne circulation d’air et les raccordements
de plomberie et d’électricité.
• Côtés : 19 mm (3/4 po)
• Dessus : 25 mm (1 po)
• Arrière : 50 mm (2 po)
Veuillez lire toutes les directives attentivement.
•
IMPORTANT – Conservez ces instructions
pour l’inspecteur local.
•
IMPORTANT – Respectez toutes les
•
Note à l’installateur – Assurez-vous de laisser ces
•
Note au consommateur – Conservez ces
ordonnances et les codes locaux.
•
•
•
•
instructions au consommateur.
ROULETTES ET PIEDS DE NIVELLEMENT
instructions pour référence future.
Niveau de compétence – L’installation de cet appareil
nécessite des compétences mécaniques de base.
Temps d’installation – Installation du réfrigérateur:
15 minutes
Inversion du sens d’ouverture
des portes :
1 heure
L’installateur est responsable de bien installer ce
réfrigérateur.
Toute panne du produit due à une mauvaise installation
n’est pas couverte par la garantie.
Les pieds de nivellement situés à proximité des coins
avant du réfrigérateur sont réglables. Ils maintiennent
fermement le réfrigérateur en place et l’empêchent
de bouger lors de l’ouverture des portes. Les pieds de
nivellement doivent être réglés de sorte que l’avant
du réfrigérateur soit suffisamment relevé pour que les
portes se ferment facilement lorsqu’elles se trouvent à
mi-parcours.
Tournez les pieds de nivellement vers la droite
pour relever le réfrigérateur, vers la gauche pour
l’abaisser.
Les roulettes situées à proximité des pieds de
nivellement vous permettent de déplacer le
réfrigérateur du mur pour le nettoyage.
ALIMENTATION D’EAU DE LA MACHINE
À GLAÇONS (SUR CERTAINS MODÈLES)
Tournez les pieds vers la gauche jusqu’à ce que le
poids du réfrigérateur soit transféré sur les roulettes.
Après avoir remis le réfrigérateur en place, tournez les
pieds vers la droite jusqu’à ce qu’ils supportent le poids
du réfrigérateur.
Si votre réfrigérateur a une machine à glaçons, il faut
le brancher à une conduite d’eau froide. Vous pouvez
acheter une trousse d’alimentation d’eau GE (contenant
la tuyauterie, le robinet d’arrêt, les joints et les instructions)
chez votre revendeur ou en vous adressant à notre site
Web à l’adresse www.electromenagersge.ca ou à notre
service de Pièces et accessoires au numéro de téléphone
1.800.661.1616.
EMPLACEMENT DU RÉFRIGÉRATEUR
• N’installez jamais votre réfrigérateur dans un
emplacement où la température ambiante sera inférieure
à 16°C (60°F). Il ne se mettra pas en marche suffisamment
souvent pour maintenir des températures convenables.
• Installez votre réfrigérateur sur un plancher suffisamment
solide pour le porter lorsqu’il est plein.
28
Instructions d’installation
1 INSTALLATION DE LA CONDUITE D’EAU (SUR CERTAINS MODÈLES)
AVANT DE COMMENCER
CE DONT VOUS AUREZ BESOIN (SUITE)
Assurez-vous que votre trousse ait au moins 2,4 m (8 pieds)
comme indiqué ci-dessus.
NOTE: Les seuls tuyaux en matière plastique approuvés
par GE sont ceux qui font fournis dans les trousses GE
SmartConnect™ Refrigerator Tubing. N’utilisez jamais un
autre tuyau en matière plastique, car le tuyau d’alimentation
d’eau est tout le temps sous pression. Certaines catégories de
tuyaux en matière plastique peuvent devenir cassants avec
l’âge et peuvent se fendre, en occasionnant des dommages
d’inondation dans votre maison.
• Vous pouvez acheter une trousse d’alimentation d’eau GE
(contenant un tuyau, un robinet d’arrêt et les joints énumérés
ci-dessous) chez votre distributeur local ou en le commandant
au service de pièces et accessoires, au 1.800.661.1616.
• Une alimentation d’eau froide. La pression de l’eau doit être
entre 20 et 120 p.s.i. (1,4 et 8,1 bar).
• Une perceuse électrique.
• Une clé de 1/2 po ou une clé
anglaise.
• Un tournevis à lame plate et un
tournevis Phillips.
Nous recommandons les trousses d’alimentation d’eau en cuivre
WX8X2, WX8X3, WX8X4, selon le montant de conduite dont vous
avez besoin. Nous approuvons les conduites d’eau en matière
plastique GE SmartConnect™ Refrigerator Tubing (WX08X10006,
WX08X10015 et WX08X10025).
Si vous installez un système d’eau GE Reverse Osmosis dans votre
réfrigérateur, la seule installation approuvée est celle de la trousse
GE RVKIT. Pour les autres systèmes d’osmose de l’eau, suivez les
recommandations du fabricant.
Cette installation de conduite d’eau n’est pas garantie par le
fabricant de réfrigérateur ou de machine à glaçons. Suivez
soigneusement ces instructions pour minimiser le risque de
dommages onéreux d’inondation.
Les coups de bélier (eau qui donne des coups dans les tuyaux) dans
la tuyauterie de la maison peuvent occasionner des dommages
aux pièces de votre réfrigérateur, ainsi que des fuites ou des
inondations. Appelez un plombier certifié pour corriger les coups de
bélier avant d’installer la conduite d’eau de votre réfrigérateur.
Pour prévenir toute brûlure et tout dommage à votre réfrigérateur,
ne branchez jamais la conduite d’eau à une canalisation d’eau
chaude.
Si vous utilisez votre réfrigérateur avant son raccordement à
l’alimentation d’eau, assurez-vous que l’interrupteur est positionné
sur OFF (arrêt) ou que le levier est positionné sur STOP (vers le haut).
N’installez jamais les tuyaux de la machine à glaçon dans des
endroits où la température risque de descendre en dessous du
point de congélation.
Si vous utilisez un outil électrique (comme une perceuse électrique)
pendant l’installation, assurez-vous que l’isolement ou le câblage de
cet outil empêche tout danger de secousse électrique.
Vous devez procéder à toutes vos installations conformément aux
exigences de votre code local de plomberie.
• Deux écrous à compression d’un diamètre extérieur de 1/4
po et deux bagues (manchons)³SRXUEUDQFKHUOHWX\DXHQ
cuivre au robinet d’arrêt et au robinet d’eau du réfrigérateur.
OU BIEN
• Si vous utilisez une trousse GE SmartConnect™ Refrigerator
Tubing, les garnitures nécessaires sont déjà montées au tuyau.
• Si votre canalisation d’eau actuelle a un raccord évasé à
une extrémité, vous aurez besoin d’un adaptateur (que vous
trouverez dans votre magasin de matériel de plomberie) pour
brancher le tuyau d’eau au réfrigérateur, OU BIEN vous pouvez
couper le raccord évasé à l’aide d’un coupe-tube, puis utiliser
un raccord à compression. Ne coupez jamais l’extrémité finie
d’un tuyau de la trousse GE SmartConnect™ Refrigerator Tubing.
CE DONT VOUS AUREZ BESOIN
• Tuyaux en cuivre ou rousse GE SmartConnect ™
Refrigerator Tubing, diamètre extérieur de 1/4 po pour
brancher le réfrigérateur à l’alimentation d’eau. Si vous
utilisez un tuyau en cuivre, assurez-vous que les deux
extrémités du tuyau soient coupées bien droit.
Pour trouver la longueur de tuyau dont vous aurez besoin :
mesurez la distance qui va du robinet d’eau situé derrière le
réfrigérateur jusqu’au tuyau d’alimentation d’eau. Ajoutez
2,44 m (8 pieds). Assurez-vous qu’il y ait assez de tuyau en
trop (environ 2,44 m [8 pieds] enroulés trois fois en cercles
d’environ 25 cm [10 po] de diamètre) pour vous permettre de
décoller le réfrigérateur du mur après l’installation.
Les trousses GE SmartConnect™ Refrigerator Tubing sont
disponibles dans les dimensions suivantes :-1,8 m (6 pi) – WX08X10006
4,6 m (15 pi) – WX08X10015
7,6 m (25 pi) – WX08X10025
• Un robinet d’arrêt pour brancher le tuyau d’eau froide. Le
robinet d’arrêt doit avoir une entrée d’eau avec un diamètre
intérieur minimal de 0,45 cm (5/32 po) au point de jonction avec
LA CONDUITE D’EAU FROIDE. Des robinets d’arrêt à étrier sont
souvent inclus dans les trousses d’alimentation d’eau. Avant
d’acheter, assurez-vous que le robinet à étrier se conforme à
vos codes de plomberie locaux.
29
Instructions d’installation
DE LA CONDUITE D’EAU (SUITE)
1 INSTALLATION
Installez le robinet d’arrêt sur la canalisation d’eau potable la plus fréquemment utilisée.
4 ACHEMINEZ LE TUYAU
1 FERMEZ L’ALIMENTATION
Acheminez le tuyau du tuyau d’eau froide au réfrigérateur.
PRINCIPALE D’EAU ET DÉBRANCHEZ
LE RÉFRIGÉRATEUR
Faites passer le tuyau par un trou percé dans le mur
ou le plancher (derrière le réfrigérateur ou au niveau de
l’armoire de cuisine adjacente), aussi près du mur que
possible.
Ouvrez le robinet le plus proche en sens inverse des
aiguilles d’une montre suffisamment longtemps pour
purger le tuyau.
NOTE: Assurez-vous qu’il y ait assez de tuyau en trop
(environ 2,4 m [8 pieds] enroulés trois fois en cercles
d’environ 25 cm [10 po] de diamètre) pour vous permettre
de décoller le réfrigérateur du mur après l’installation.
2 PERCEZ UN TROU POUR LE ROBINET
Choisissez, pour le robinet, un emplacement facilement
accessible. Il vaut mieux le brancher de côté à un tuyau
vertical. Si vous devez le brancher à un tuyau horizontal,
faites le branchement en haut ou de côté, plutôt qu’en
bas du tuyau, pour éviter de recevoir des sédiments du
tuyau d’alimentation d’eau.
5 BRANCHEZ LE TUYAU AU ROBINET
Placez un écrou de compression et une bague
(manchon) à l’extrémité du tuyau et branchez-les au
robinet d’arrêt.
Percez un trou de 1/4 po dans le tuyau d’eau, à l’aide
d’un foret dur. Enlevez toute barbure due au perçage du
trou dans le tuyau. Faites attention de ne pas laisser
de l’eau couler dans votre perceuse électrique. Si vous
ne percez pas un trou de 1/4 po, vous obtiendrez une
alimentation d’eau réduite et des glaçons plus petits.
Assurez-vous que le tuyau soit bien inséré dans le
robinet. Serrez fort l’écrou de compression.
Pour le tuyau en matière plastique d’une trousse GE
SmartConnect™ Refrigerator Tubing, insérez l’extrémité
moulée du tuyau dans le robinet d’arrêt et serrez
l’écrou de compression à la main, puis serrez un autre
demi tour avec une clé. Si vous serrez trop fort, vous
pouvez occasionner des fuites.
Écrou de
compression
Robinet d’arrêt
à étrier
Tuyau
SmartConnect™
3 FIXEZ LE ROBINET D’ARRÊT
Fixez le robinet d’arrêt au tuyau d’eau froide à l’aide du
collier de serrage.
Presse-joint
Serrez les vis du collier jusqu’à ce que la rondelle
d’étanchéité commence à enfler.
Robinet de sortie
Bague (manchon)
NOTE: Ne serrez pas trop. Vous risquez d’écraser le tuyau
de cuivre.
Rondelle
Collier de serrage
6 PURGEZ LE TUYAU
Entrée
Ouvrez le robinet d’alimentation principale d’eau en sens
inverse des aiguilles d’une montre et purgez le tuyau
jusqu’à ce que l’eau soit claire.
Vis du collier
Robinet d’arrêt
à étrier
Fermez l’eau au niveau du robinet d’eau après écoulement
d’environ 1 litre (1 quart) d’eau par le tuyau.
Tuyau vertical
d’eau froide
30
Instructions d’installation
1 INSTALLATION DE LA CONDUITE D’EAU (SUITE)
8 FERMEZ L’EAU
7 BRANCHEZ LE TUYAU À VOTRE
AU NIVEAU DU
ROBINET D’ARRÊT
RÉFRIGÉRATEUR
NOTES:
• Avant de brancher le tuyau à votre réfrigérateur,
assurez-vous que le cordon d’alimentation électrique
du réfrigérateur ne soit pas branché à la prise murale.
• Nous vous recommandons de poser un filtre à eau
si votre alimentation d’eau contient du sable ou des
particules qui peuvent boucher la grille du robinet
d’eau de votre réfrigérateur. Installez-le sur la conduite
d’eau près de votre réfrigérateur. Si vous utilisez une
trousse GE SmartConnect™ Refrigerator Tubing, vous
aurez besoin d’un tuyau additionnel (WX08X10002)
pour brancher le filtre. Ne coupez jamais un tuyau en
matière plastique pour installer votre filtre.
Enlevez le
couvercle d’accès.
Enlevez le
capuchon en
matière plastique
flexible du robinet
d’arrêt d’eau (branchement du
réfrigérateur).
Placez l’écrou de compression
et la bague (manchon) à
l’extrémité du tuyau comme
l’indique l’illustration. Si
vous utilisez une trousse GE
SmartConnect™ Refrigerator
Tubing, les écrous sont déjà assemblés au tuyau.
Resserrez tout joint qui fuit.
9 BRANCHEZ VOTRE RÉFRIGÉRATEUR
Disposez la spirale de tuyau en cuivre de manière à ce
qu’elle ne vibre pas contre l’arrière de votre réfrigérateur
ou contre le mur. Mettez votre réfrigérateur à sa place
contre le mur en le poussant.
10 METTEZ EN MARCHE LA MACHINE À
GLAÇONS
Déplacez le levier à la position ON (vers le bas) ou
déplacez l’interrupteur coulissant vers la position
ON (marche)La machine à glaçons ne se met en
marche que lorsqu’elle atteint une température de
fonctionnement de –9°C (15°F) ou moins. Elle commence
immédiatement à fonctionner.
Interrupteur
d’alimentation
ON
Insérez l’extrémité du tuyau dans le branchement du
robinet d’arrêt d’eau, le plus loin que possible. Tout en
tenant le tuyau, serrez le raccord.
Si vous utilisez un tuyau en matière plastique d’une
trousse GE SmartConnect™ Refrigerator Tubing,
insérez l’extrémité moulée du tuyau dans le robinet
d’arrêt et serrez l’écrou de compression à la main,
puis serrez un autre tour avec une clé. Si vous serrez
trop fort, vous pouvez occasionner des fuites.
Fixez le tuyau au collet fourni pour le tenir en position
verticale. Il est possible que vous ayez à disjoindre le collet.
Tuyau de 0,63 cm (1/4 po)
Modèle de commutateur de puissance
Le bras
palpeur est en
position ON
(marche) en
bas
Collet à
tuyau
Écrou de
compression
de 0,63 cm (1/4
po)
Le bras palpeur
est en position
STOP (arrêt) en
haut
NOTE: Si votre pression d’eau est trop faible, le robinet
peut se remettre en marche jusqu’à trois fois pour
envoyer suffisamment d’eau à la machine à glaçons.
Collet
(manchon)
Tuyau SmartConnect™
OFF
Branchement
au
réfrigérateur
Remettez le
couvercle d’accès:
31
Instructions d’installation
2 INVERSION DE L’OUVERTURE DES PORTES
2 ENLÈVEMENT DE LA PORTE DU
NOTES IMPORTANTES
CONGÉLATEUR
Pour inverser le sens d’ouverture des portes :
• Lisez toutes les directives avant de commencer.
• Manipulez les pièces avec précaution pour éviter de rayer
la peinture.
• Posez les vis à côté des pièces correspondantes pour ne
pas les utiliser aux mauvais endroits.
• Posez les portes sur un plan de travail qui ne risque pas de
rayer la peinture.
IMPORTANT : Une fois commencée votre inversion du sens
d’ouverture des portes, ne déplacez jamais votre réfrigérateur
avant d’avoir terminé.
Ces directives s’appliquent à l’inversion des charnières
du côté droit au côté gauche. Si vous voulez remettre les
charnières à droite, suivez les mêmes directives en inversant
toutes les références aux côtés gauche et droit.
2.1 Maintenez la porte fermée avec du ruban à masquer.
2.2 À l’aide d’un tourne-écrou hex. de 5/16 po, enlevez les
vis qui retiennent la charnière supérieure à la caisse.
2.3 Enlevez la charnière en la soulevant pour libérer
l’axe de charnière du trou sur le dessus de la porte et
mettez-la de côté avec ses vis.
OUTILS REQUIS
Tournevis Phillips
Charnière supérieure
Tourne-écrou à douille de 5/16 po
2.4 Enlevez le ruban et inclinez la porte en l’éloignant de
la caisse. Soulevez-la de l’axe de charnière centrale.
Ruban-cache
Tournevis à tête de force
T 20 ou T 25, (nécessaire
pour cértains modèles)
Couteau à mastiquer ou
tournevis à lame mince
Clé ouverte de 5/16 po
2.5 Placez la porte sur une surface antiégratignure avec
la surface extérieure vers le haut.
1 AVANT DE COMMENCER
1.1 Débranchez le réfrigérateur.
2.6 Transférez les 2 vis du côté opposé de la caisse
dans les trous laissés libres par l’enlèvement de la
charnière supérieure.
1.2 Videz tous les balconnets y compris le compartiment
laitier.
ATTENTION: Ne laissez pas tomber la porte sur le sol ce
qui pourrait endommager la butée de porte.
32
Instructions d’installation
2 INVERSION DE L’OUVERTURE DES PORTES (SUITE)
3 ENLÈVEMENT DE LA PORTE DU
3 ENLÈVEMENT DE LA PORTE DU
RÉFRIGÉRATEUR
RÉFRIGÉRATEUR
3.5 Transférez les deux vis du côté opposé de la caisse dans
les trous laissés libres par l’enlèvement de
la charnière centrale.
3.6 Transférez la rondelle (si votre modèle en possède une)
au côté opposé.
3.1 Maintenez la porte fermée avec du ruban à masquer.
3.2 À l’aide d’un tourne-écrou hex. de 5/16” po et
d’une clé ouverte de 5/16” po, enlevez les deux vis
maintenant la charnière centrale à la caisse. Relevez
la charnière centrale pour libérer son axe du trou
au-dessus de la porte et mettez la charnière et ses vis
de côté. Assurez-vous de ne pas perdre la rondelle et
la pièce d’espacement de la charnière centrale.
3.7 Prenez l’une des vis enlevées à l’étape 2 et insérez-la
dans le trou extérieur du côté opposé. Ne l’insérez pas
complètement. Laissez suffisamment d’espace sous la
tête de la vis pour pour l’épaisseur du support.
3.3 Enlevez le ruban et inclinez la porte en l’éloignant de
la caisse. Relevez la porte de l’axe dans le support de
charnière inférieure (si la rondelle en plastique colle au
bas de la porte, replacez-la sur la charnière).
4 INVERSION DE LA QUINCAILLERIE
4.1 Déplacez le support de la charnière inférieure et la
rondelle en plastique du côté droit au côté gauche.
Rondelle en
plastique
Support de
charnière
3.4 Placez la porte avec l’extérieur vers le haut sur une
surface antiégratignure.
Changez l’axe de charnière au
côté opposite de la charnière.
33
Instructions d’installation
5 INVERSION DES POIGNÉES DE PORTE
(SUITE)
4 INVERSION DE LA QUINCAILLERIE (SUITE)
4.2 Intervertissez la charnière et les vis dans le coin
supérieur droit avec les vis du coin supérieur gauche
de la caisse. Ne serrez pas les vis du côté de la
charnière pour l’instant.
5.1.3 Enlevez les vis du côté droit du dessus de la
porte et insérez-les dans les trous des vis de
poignée du côté opposé.
Vis pour
trous de
poignée
Installation de la charnière
à gauche
5.1.4 Enlevez le capuchon du support de la charnière
supérieure sur le côté gauche de la porte et
insérez-le dans le trou du côté opposé,
laissé libre par l’enlèvement de la charnière
supérieure.
Installation de la charnière
à droite
REMARQUES:
• Certaines charnières possèdent quatre trous. Les
trous à utiliser pour l’installation de la charnière
dépendent du côté où vous installez la charnière.
• Le bord extérieur de la charnière doit être parallèle
avec le bord de la caisse pour une installation
correcte.
Capuchon
Pour fixer la
poignée sur le
côté opposé.
5.2 Transfert de la butée de porte
5.2.1 Transférez la butée de porte en plastique et les vis
du côté droit vers le côté gauche.
5 INVERSION DES POIGNÉES DE PORTE
5.1 Transfert de la poignée de porte du réfrigérateur.
5.1.1 Enlevez le capuchon de la poignée à l’aide d’un
couteau à mastic en plaçant la pointe, qui a été
recouverte de ruban, sous le bord et enlevez la vis
qui se trouve en dessous du capuchon. Enlevez les
deux vis maintenant la poignée sur le dessus de la
porte.
Côté
gauche
Butée de porte
en plastique
Côté droit
5.2.2 Transférez la butée de porte en métal du côté
droit vers le côté gauche, puis transférez la vis du
côté opposé de la porte.
Dessus
Côté
gauche
Capuchon
Butée de porte
en métal
Côté droit
5.3 Remise de la poignée de la porte du
réfrigérateur
5.1.2 Enlevez la poignée.
5.3.1 Fixez la poignée au côté droit
de la porte avec les vis sur le
dessus et sous le capuchon de la
poignée.
5.3.2 Remettez le capuchon de la
poignée.
34
Instructions d’installation
2 INVERSION DE L’OUVERTURE DES PORTES (SUITE)
TOP
6 REMONTAGE DES PORTES
BOTTOM
6.1.2 Insérez l’axe sur la
charnière centrale, dans
l’emplacement sur le
dessus de la porte. Mettez
la pièce d’espacement,
Rondelle en plastique
puis la rondelle sur l’axe
et pièce d’espacement
de charnière. REMARQUE: La
charnière centrale doit être retournée comme il est
illustré lors du montage du côté gauche.
5 INVERSION DES POIGNÉES DE PORTE
(SUITE)
5.4 Transfert de la
poignée de la porte du
congélateur
5.4.1 Enlevez la vis maintenant
la poignée sur le dessus
de la porte et les deux vis
maintenant la poignée sur le
dessous de la porte.
Dessous
5.4.2 Enlevez la poignée.
6.1.3 Inclinez la porte vers la
caisse. Lorsque la porte est
amenée en position, faites
coulisser la charnière sous
la tête de la vis qui a été
insérée précédemment dans
le trou extérieur de la caisse.
Insérez la vis restante, puis
serrez bien les deux vis.
5.4.3 Enlevez la vis du côté supérieur droit de la porte
et insérez-la dans le trou de la poignée sur le côté
gauche.
6 REMONTAGE DES PORTES (SUITE)
6.2 Remontage de la porte du congélateur
5.4.4 Transférez la butée de porte comme il est illustré à
la section 5.2 précédente.
6.2.1 Placez la porte du congélateur sur l’axe de charnière
centrale. Assurez-vous que la rondelle et la pièce
d’espacement sont bien placées sur l’axe.
Axe de
charnière
centrale
5.4.5 Fixez la poignée au côté droit de la porte avec les
vis sur le dessus et le dessous, en utilisant les trous
inférieurs laissés libres par l’enlèvement des vis de la
butée de porte.
Rondelle en
plastique et pièce
d’espacement
6.2.2 Inclinez la porte vers
la caisse, relevez la
charnière supérieure
pour que l’axe s’insère
dans l’emplacement sur
le dessus de la porte.
6 REMONTAGE DES PORTES
6.1
Axe de
charnière
Remontage de la porte du réfrigérateur
6.1.1 Placez la porte du réfrigérateur sur l’axe de
charnière inférieure.
Rondelle
Assurez-vous que la
en
rondelle se trouve bien
plastique
sur l’axe.
6.2.3. Assurez-vous que la porte se trouve légèrement
au-dessus de la caisse
et que l’écartement
entre les portes est le
même. Serrez les vis de
la charnière supérieure.
Ne serrez pas trop fort
ces vis. Serrez-les pour
qu’elles soient bien en
place puis vissez d’un demi-tour supplémentaire.
Axe de
charnière
35
Instructions d’installation
3 CONNEXION APPAREIL ENERGY SMART
1 RETIRER L’ÉTIQUETTE DU CONNECTEUR DE CÂBLE D’INTERCONNEXION SITUÉ SUR LE
PANNEAU DE SERVICE
Retirer lors de la connexion
au module de
communication
L’ÉTIQUETTE
2 BRANCHEMENT DE L’APPAREIL AU MODULE DE COMMUNICATION
2.1 Repérer le câble
d’interconnexion. Cet accessoire
est compris dans la trousse du
module de communication.
2.2 Brancher le câble
d’interconnexion au connecteur
du panneau de service, comme
illustré.
2.3 Brancher l’extrémité opposée du
câble d’interconnexion dans le
module de communication.
2.4 Consulter les instructions
de la trousse du module
de communication pour le
branchement du module
de communication vers le
NucleusMC ou Smart Meter.
3 EMPLACEMENT DU MODULE DE COMMUNICATION
REMARQUE: Le module de communication peut être installé sur le dessus, à l’arrière ou sur le
côté du réfrigérateur. Le module de communication peut également être installé
sans contact direct avec le réfrigérateur, par exemple, dans une armoire adjacente.
Consulter le manuel du module de communication pour obtenir plus de détails sur
l’installation du module de communication.
36
Bruits normaux de fonctionnement
www.electromenagersge.ca
Les réfrigérateurs plus récents font des bruits différents de ceux des
anciens. Les réfrigérateurs modernes présentent plus de fonctions
et sont plus avancés sur le plan technologique.
Entendez-vous ce que j’entends? Ces bruits sont normaux.
HUMMM...
OUUCH....
OUIR !
„ Le nouveau compresseur à rendement élevé peut
fonctionner plus longtemps et plus vite que votre
ancien réfrigérateur et vous pouvez entendre un
son modulé ou un ronflement aigu pendant son
fonctionnement.
„ Vous pouvez entendre un sifflement lorsque les portes se
ferment. Cela vient de l’équilibrage de pression dans le
réfrigérateur.
CLICS, CLAQUEMENTS,
CRAQUEMENTS et
GRÉSILLEMENTS
„ Vous pouvez entendre des craquements ou des
claquements lorsque le réfrigérateur est branché pour
la première fois. Cela se produit lorsque le réfrigérateur
se refroidit à la bonne température.
„ Le compresseur peut causer un clic ou un grésillement
lors de la tentative de redémarrage (cela peut prendre
5 minutes).
„ L’expansion et la contraction des serpentins de
refroidissement pendant et après le dégivrage peuvent
causer un craquement ou un claquement.
„ Sur les modèles équipés d’une machine à glaçons,
après un cycle de fabrication de glaçons, vous pouvez
entendre les glaçons tomber dans le bac.
„ Vous pouvez entendre les ventilateurs tourner à hautes
vitesses. Cela se produit lorsque le réfrigérateur vient d’être
branché, lorsque les portes sont ouvertes fréquemment
ou lors de l’ajout d’une grande quantité d’aliments
dans les compartiments congélateur ou réfrigérateur.
Les ventilateurs permettent de maintenir les bonnes
températures.
BRUITS D’EAU
„ Le passage de l’agent frigorifique dans les serpentins de
refroidissement du congélateur peut être accompagné
d’un gargouillement semblable à celui de l’eau en
ébullition.
„ L’eau tombant sur l’élément chauffant de dégivrage
peut faire un bruit de grésillement, de claquement ou de
bourdonnement pendant le cycle de dégivrage.
„ Un bruit de suintement d’eau peut être entendu pendant
le cycle de dégivrage lorsque la glace de l’évaporateur
fond et tombe dans le bac de récupération.
„ Fermer la porte peut causer un gargouillement en raison
de l’équilibrage de pression.
Pour obtenir plus d’information sur les
bruits normaux de fonctionnement de la
machine à glaçons, veuillez consultez la
section Machine à glaçons automatique.
37
Avant d’appeler un réparateur…
En cas de panne
Économisez votre temps et votre argent! Consultez les
tableaux des pages suivantes, vous éviterez peut-être
d’appeler un réparateur.
Problème
Causes possibles
Solutions
Votre réfrigérateur ne
fonctionne pas
Votre réfrigérateur se trouve
dans son cycle de dégivrage.
• Attendez environ 40 minutes la fin du dégivrage.
Bouton de réglage de température • Placez le bouton de commande de la température
en position 0 ou OFF (arrêt).
à un réglage de température.
Vibrations ou bruits
de casse (une petite
vibration est normale)
Le moteur fonctionne
pendant de longues
périodes ou se
met en marche et
s’arrête fréquemment
(Les réfrigérateurs
modernes, qui ont
davantage d’espace de
rangement
et un compartiment
congélation plus grand,
nécessitent plus de
temps de
fonctionnement. Ils se
mettent en marche et
s’arrêtent souvent
pour maintenir
des températures
constantes.)
Le compartiment
réfrigération ou
congélation est
trop chaud
Le réfrigérateur est débranché.
• Poussez la fiche complètement dans la prise murale.
Le fusible a sauté ou
le disjoncteur a sauté.
• Changez le fusible ou rebranchez le disjoncteur.
La caractéristique Energy Smart™
modifie le rendement du
réfrigérateur.
• Attendre environ deux heures avant le retour du
fonctionnement normal.
Les vis des roulettes ou les
pieds de nivellement ont
besoin d’être réglés.
• Voyez la section Roulettes et pieds de nivellement.
C’est normal quand on met
en marche le réfrigérateur
pour la première fois.
• Attendez 24 heures que le réfrigérateur se refroidisse
complètement.
Cela arrive souvent quand
on met beaucoup d’aliments
dans le réfrigérateur.
• C’est normal.
La porte est restée ouverte.
• Vérifiez qu’un paquet d’aliments n’empêche pas la porte
de bien se fermer.
Il fait chaud ou vous
ouvrez souvent la porte.
• C’est normal.
Les boutons de réglage de
température sont mis à leur
position la plus froide.
• Voyez la section Bouton de commande de la température.
Vous devez nettoyer le
condenseur et la grille.
• Voyez la section Entretien et nettoyage.
La caractéristique
Energy Smart™ modifie
le rendement du réfrigérateur.
• Voir Au sujet des modèles Energy Smart™
Le bouton de commande de
• Voyez la section Bouton de commande de la température.
température n’est pas placé à une
position suffisamment froide.
Il fait chaud ou vous
ouvrez souvent la porte.
• Mettez le bouton de réglage de température un numéro
plus froid. Consultez Boutons de réglage de température.
La porte est restée ouverte.
• Vérifiez qu’un paquet d’aliments n’empêche pas la porte
de bien se fermer.
Un article bloque l’évent dans
• Vérifiez si un article ne bloque pas la fermeture
le compartiment du congélateur.
de la porte.
Du givre ou des cristaux
de glace se forment sur
les aliments congelés
(du givre à l’intérieur
des paquets d’aliments
est normal)
38
La porte est restée ouverte.
Vous ouvrez la porte trop
souvent ou trop longtemps.
• Vérifiez qu’un paquet d’aliments n’empêche pas la porte
de bien se fermer.
www.electromenagersge.ca
Problème
Causes possibles
Solutions
La machine à glaçons
automatique ne
fonctionne pas
(sur certains modèles)
La machine à glaçons
• Déplacez le levier à la position ON (vers le bas) ou déplacez
n’est pas en position ON (marche). l’interrupteur coulissant vers la position ON (marche).
L’alimentation d’eau est arrêtée • Consultez Installation de la conduite d’eau.
ou n’est pas branchée.
Le compartiment
• Attendez 24 heures que le réfrigérateur soit
congélateur est trop chaud.
complètement froid.
Une accumulation de glaçons
dans le tiroir à glaçons peut
causer un arrêt de la machine
à glaçons.
• Égalisez les glaçons à la main.
Bourdonnement
fréquent
La machine à glaçons
marche, mais l’arrivée d’eau
au réfrigérateur n’a pas
été raccordée.
• Éteignez la machine à glaçons. Amenez le bras palpeur
en position STOP (arrêt) en haut.
Glaçons trop petits
Le robinet d’arrêt d’eau
• Appelez un plombier pour nettoyer le robinet.
raccordant le réfrigérateur à la
conduite d’eau peut être obstrué.
La formation des
glaçons est lente
La porte est restée ouverte.
• Vérifiez qu’un paquet d’aliments n’empêche pas la porte
de bien se fermer.
La caractéristique
Energy Smart™modifie
le rendement du réfrigérateur.
• Voir Au sujet des modèles Energy Smart™
Le bouton de commande de la
• Voyez Bouton de commande de la température.
température ne se trouve pas à
une position suffisamment froide.
Les glaçons ont une
odeur ou un goût
Le bac à glaçons doit
être nettoyé.
• Videz et lavez le bac à glaçons. Jetez les vieux glaçons.
Les aliments donnent de
l’odeur ou du goût aux glaçons.
• Emballez bien les aliments.
L’intérieur du réfrigérateur
a besoin d’être nettoyé.
• Consultez Soins et nettoyage de votre réfrigérateur.
De l’humidité se forme
C’est normal pendant
sur la surface de l’armoire les périodes de grande humidité.
du réfrigérateur entre
les portes
De l’humidité se forme
à l’intérieur (quand il
fait humide, l’air
transporte de l’humidité
à l’intérieur du
réfrigérateur quand
vous ouvrez les portes)
Vous ouvrez les portes trop
souvent ou trop longtemps.
Le réfrigérateur sent
Les aliments donnent une
odeur au réfrigérateur.
• Essuyez complètement la surface, puis réglez la
température du compartiment réfrigération un chiffre
plus haut et vérifiez à nouveau 24 heures plus tard.
• Vous devez bien empaqueter les aliments qui sentent
fort.
• Conservez une boîte ouverte de bicarbonate de soude
dans votre réfrigérateur; remplacez-la tous les trois mois.
L’intérieur a besoin
d’un nettoyage.
• Consultez Soins et nettoyage de votre réfrigérateur.
39
Notes
40
Notes
41
Notes
42
Notes
43
Garantie du réfrigérateur. (pour les produits achetés aux États-Unis)
Toutes les réparations en vertu de la garantie sont fournis par
nos Centre de Service d’Usine ou par un technicien autorisé
Customer Care®. Pour prévoir une réparation, consultez notre site
GEAppliances.com ou appelez le 800.GE.CARE5 (800.432.2737).
Veuillez avoir votre numéro de série et votre numéro de modèle à
portée de main lorsque vous appelez pour obtenir un service.
Pendant la période de
garantie de :
Agrafez votre facture ici.
Pour bénéficier du service
de réparation sous garantie,
une preuve de la date d’achat
initial est nécessaire.
GE remplacera :
MODÈLES GE PROFILE™ AND GE CAFÉ™
Un An
A compter de la date d’achat
initial
Toute pièce du réfrigérateur qui s’avère défectueuse en raison d’un défaut de matériau ou de
fabrication. Pendant la validité de la présente garantie limitée d’un an, GE fournira également
gratuitement la main d’œuvre et le service pour réparer la pièce défectueuse.
Trente jours
Toute pièce de la cartouche filtrante qui ne fonctionne pas à cause d’un vice de matériau ou de main
(filtre à eau, si inclus) A compter de d’œuvre. Pendant la validité de la présente garantie limitée de 30 jours, GE fournira gratuitement une
la date d’achat initial
cartouche filtrante de remplacement.
MODÈLES GE PROFILE UNIQUEMENT
Cinq Ans
(modèles GE profile
uniquement) A compter de
la date d’achat
Toute pièce du système fermé du réfrigérateur (compresseur, condenseur, évaporateur et tous
les tuyaux de raccordement) qui s’avère défectueuse en raison d’un défaut de matériau ou de
fabrication. Pendant la validité de la présente garantie limitée de cinq an, GE fournira également
gratuitement la main d’œuvre et le service pour réparer la pièce défectueuse dans le système fermé
du réfrigérateur.
Ce qui n’est pas couvert par GE :
■ Les déplacements à votre domicile pour vous expliquer
l’utilisation de ce produit
■ Une installation, livraison ou maintenance défectueuse.
■ Une panne du produit par abus d’utilisation, par mauvaise
utilisation, par modification ou s’il a été utilisé dans un but autre
que celui pour lequel il a été fabriqué.
■ Détérioration des aliments.
■ Le remplacement des fusibles ou le réenclenchement du
disjoncteur du domicile.
„ Les dommages au fini doivent être signalés dans les 48
heures suivant la livraison de l’électroménager.
■ Les dommages au fini y compris la rouille, le ternissement ou
les petites taches, après livraison.
■ Les produits qui ne sont pas défecteux, brisés ou qui
fonctionnent selon la description du Manuel d’utilisation.
■ Le remplacement de la cartouche filtrante, si incluse, à cause
d’une pression d’eau en dehors de la gamme de fonctionnement
recommandée ou à cause d’une concentration excessive de
sédiments dans l’eau d’alimentation.
■ Le remplacement des ampoules, si incluses, ou la cartouche
filtrante, si incluse, et dans des conditions autres que celles
susmentionnées.
■ Tout dommage causé par accident, incendie, inondation ou une
catastrophe naturelle.
■ Tout dommage fortuit ou indirect causé par des défauts
éventuels de cet appareil.
■ Le service s’il est impossible d’avoir accès au produit.
EXCLUSION DES GARANTIES TACITES - Votre recours exclusif est l’échange du produit suivant les modalités de
la Garantie Limitée. Toutes garanties tacites, y compris les garanties de valeurs marchandes ou d’adéquation
à des fins particulières, sont limitées à une durée d’un an ou à la durée la plus courte autorisée par la loi.
Cette garantie est étendue à l’acheteur d’origine et aux propriétaires suivants pour tout produit acheté pour une
utilisation domestique aux États-Unis. Si le produit est installé dans une région où ne se trouve aucun réparateur
autorisé GE, vous devrez peut-être assumer les frais de transport ou apporter l’appareil à un centre de service
autorisé GE. En Alaska, cette garantie exclut le coût d’expédition ou de dépannage à votre domicile.
Certains états n’acceptent pas d’exclusion ou de limites aux dommages indirects consécutifs. Certains droits
particuliers vous sont dévolus en vertu de la présente garantie et peuvent s’accompagner d’autres droits qui
varient selon votre lieu de résidence. Pour connaître vos droits juridiques, veuillez consulter le bureau local ou le
bureau d’état des affaires aux consommateurs ou le Procureur Général de votre état.
Garant : General Electric Company. Louisville, KY 40225
44
IMPORTANTE INFORMACIÓN DE SEGURIDAD.
LEA TODAS LAS INSTRUCCIONES ANTES DE SU USO.
¡ADVERTENCIA!
Use este aparato sólo con el fin para el cual fue diseñado como se describe en este Manual del propietario.
PRECAUCIONES DE SEGURIDAD
Al usar aparatos eléctricos, se deben seguir precauciones básicas de seguridad, incluyendo las siguientes:
„ No intente ni permita que los niños se trepen,
paren o cuelguen de los estantes del refrigerador.
Este refrigerador debe instalarse y ubicarse
correctamente según las Instrucciones de
instalación antes de su uso.
„ No intente ni permita que los niños se trepen,
paren o cuelguen de los estantes del refrigerador.
Podrían dañar el refrigerador y sufrir graves
daños.
„ No toque las superficies frías en el
compartimiento del congelador con las manos
húmedas o mojadas. La piel se puede pegar a
estas superficies extremadamente frías.
„ No almacene o use gasolina u otros vapores y
líquidos inflamables en las áreas cercanas a este
o a cualquier otro aparato.
„ En los refrigeradores con máquinas de hielo
automáticas, evite el contacto con las partes en
movimiento del mecanismo eyector, o con el
elemento calefactor localizado en la parte inferior
del dispositivo para hacer hielo. No coloque
los dedos o las manos en el mecanismo de la
máquina de hielos mientras el refrigerador esté
conectado.
„ Mantenga los dedos alejados de las áreas
estrechas; los espacios entre las puertas y entre
las puertas y los gabinetes son necesariamente
pequeños. Tenga cuidado al cerrar las puertas
cuando haya niños en el área.
„ Desconecte el refrigerador antes de limpiar y
hacer reparaciones.
NOTA: Recomendamos enfáticamente que
cualquier servicio sea realizado por un individuo
calificado.
„ Girar el control de temperatura a la posición
apagado no retira la corriente del circuito de luz.
„ No vuelva a congelar alimentos que se han
descongelado por completo.
„ Antes de reemplazar una lámpara de luz
quemada, se deberá desenchufar el refrigerador
a fin de evitar el contacto con el filamento que
aún tiene corriente. (Una lámpara de luz quemada
se puede quebrar al ser reemplazada).
„ No permita que los niños jueguen con el
refrigerador ni que fuercen los controles.
£3(/,*525,(6*2'(48(/261,³266(48('(1
ATRAPADOS
ELIMINACIÓN APROPIADA DEL REFRIGERADOR
Los problemas de que los niños se queden
atrapados y se sofoquen no son cosas del pasado.
Los refrigeradores desechados o abandonados
siguen siendo peligrosos, aún si sólo están por “unos
pocos días”. Si está desechando su refrigerador
viejo, por favor siga las instrucciones a continuación
para ayudarle a evitar accidentes.
Antes de desechar su viejo refrigerador o
congelador:
Refrigerantes
Todos los aparatos de refrigeración contienen
refrigerantes, los cuales se deben retirar antes de
la eliminación del producto de acuerdo con la ley
federal. Si va a desechar algún aparato antiguo
de refrigeración, consulte con la compañía a
cargo de desechar el aparato para saber qué
hacer.
„ Quítele las puertas.
„ Deje los estantes en su lugar, de manera que los
niños no puedan subirse fácilmente al interior.
„ Si el refrigerador cuenta con una traba, deje esta
última fuera de uso.
45
IMPORTANTE INFORMACIÓN DE SEGURIDAD.
LEA TODAS LAS INSTRUCCIONES ANTES DE SU USO.
¡ADVERTENCIA!
CÓMO CONECTAR LA ELECTRICIDAD
Bajo ninguna circunstancia, no corte ni retire la tercera pata (conexión a tierra) del cable de electricidad. Por seguridad
personal, este aparato debe estar correctamente conectado a tierra.
El cable eléctrico de este aparato está provisto de un
frecuencia equivalentes los que figuran en su etiqueta de
enchufe de tres patas (conexión a tierra) que encaja en un características técnicas.
tomacorriente estándar de 3 orificios (conexión a tierra)
Esto ofrece el mejor desempeño y también evita
para minimizar la posibilidad de peligro de un choque
sobrecargar los circuitos eléctricos de la casa que podrían
eléctrico de este aparato.
causar un incendio a partir de los cables recalentados.
Haga que el tomacorriente de la pared y el circuito sean
Nunca desconecte su refrigerador halando del cable
revisados por un electricista calificado para asegurar que
eléctrico. Siempre tome el enchufe firmemente y hálelo
el tomacorriente tiene la conexión a tierra apropiada.
directamente del tomacorriente.
Cuando haya un tomacorriente estándar de dos patas,
Repare o reemplace de inmediato todos los cables
es su responsabilidad y obligación personal reemplazarlo
eléctricos que se hayan desgastado o dañado. No use
con un tomacorriente adecuado de tres orificios
un cable que tenga grietas o daños de abrasión en su
correctamente conectado a tierra.
longitud o en cualquier extremo.
El refrigerador debería estar siempre conectado a un
Al retirar el refrigerador de la pared, tenga cuidado de no
enchufe específico con un índice de voltaje, vataje y
enrollar o dañar el cable eléctrico.
USO DE CABLES DE EXTENSIÓN
Debido a peligros potenciales de seguridad bajo ciertas condiciones, nos oponemos al uso de cables de extensión.
Sin embargo, si debe usar un cable de extensión, es absolutamente necesario que sea un tipo de cable de extensión
para aparatos con conexión a tierra de tres cables, que esté en la lista de UL (en los Estados Unidos) o en la lista CSA (en
Canadá), que tenga un enchufe de tipo conexión a tierra y salida y que el grado eléctrico del cable sea de 15 amperios
(mínimo) y 120 voltios.
LEA Y SIGA CUIDADOSAMENTE ESTA INFORMACIÓN DE SEGURIDAD.
CONSERVE ESTAS INSTRUCCIONES
Sobre los Modelos Energy Smart™
Qué Hace Energy Smart™
Si el ACM (Módulo de Comunicación del
Electrodoméstico) está conectado a su refrigerador
y recibe información del índice de utilidad, entonces
la función Energy Smart™ altera el funcionamiento
del refrigerador. Minimice el consume de energía
cuando es dirigido por Nucleous (Núcleo) (que se
vende por separado) o el Metro Inteligente (Smart
Meter). Esta función puede ocasionar cambios en las
temperaturas del refrigerador y del compartimiento
del freezer y puede ocasionar cambios en el nivel de
producción de cubos de hielo.
Los modelos con la función EnergySmart ™
cuentan con un botón adicional y una luz LED en los
controles, como se muestra. El LED estará en ON
(Encendido) durante períodos con índices altos y en
OFF (Apagado) durante períodos con índices bajos o
normales. El botón se usa para desactivar la función
EnergySmart ™ (consulte la sección “cómo anular la
función “EnergySmart ™”).
Interruptor Energy Smart™
Anular Energy Smart™
Mantenga presionado el botón Energy Smart™
durante tres segundos para anular la función Energy
Smart™. El LED adyacente titilará tres veces para
confirmar que la función fue anulada con éxito. Esto
evitará que la función altere el funcionamiento del
46
refrigerador por 18 horas. Durante este período de
18 horas, el LED permanecerá en OFF (Apagado).
Dieciocho horas después de que la función fue
anulada, la función Energy Smart™ regresará a su
rutina de funcionamiento normal.
Sobre el dial de control de la temperatura.
GEAppliances.com
Girar el dial a 0/Off interrumpe el enfriamiento en ambos compartimientos: el compartimiento de alimentos
frescos y el congelador, aunque no apaga el suministro de corriente hacia el refrigerador.
F
F
OF
Dial de control de temperatura (en algunos modelos)
El dial de control de temperatura ajusta la temperatura del refrigerador desde la más elevada hasta
la más baja. En la ilustración de la izquierda se indica la configuración de fábrica recomendada. Para
una temperatura más baja, gire el dial hacia el copo de nieve. Para una temperatura más elevada,
gire el dial en sentido contrario a las agujas del reloj, alejándose del copo de nieve. Deje transcurrir
24 horas para su ajuste.
OF
OF
F
OF
F
Configuración
recomendada de fábrica
Configuración
más caliente
Configuración
más fría
Sobre los estantes del compartimiento de alimentos frescos.
Los soportes de los estantes en diferentes niveles le permiten adaptar el espacio de los estantes según sus necesidades. No
todas las características están presentes en todos los modelos.
Estantes medios
Un extremo del estante descansa sobre un soporte
2 Levante hacia
moldeado en el costado; el soporte en el otro extremo
arriba y hacia
se engancha en un riel en la parte posterior de la pared
afuera
del gabinete.
Para retirar, levante el estante en la parte delantera,
luego saque del soporte y fuera del riel.
Algunos modelos cuentan con un estante fijo de vidrio
templado, un estante a prueba de derrames o dos
1 Incline hacia arriba estantes fijos con cables de acero.
Levante la parte posterior
Tire a la frente
Estantes de ancho completo
Algunos modelos tienen un estante deslizante
en alambre de acero, un estante de vidrio
temperado estacionario, un estante a prueba
de salpicaduras o dos estantes estacionarios
en alambre de acero. Estos estantes se pueden
mover hacia otro lugar en el compartimiento de
alimentos frescos.
El estante deslizante de tamaño completo tiene
frenos. Cuando se coloca correctamente en
Estantes a Prueba de Derrames (en algunos modelos)
Los estantes a prueba de derrames poseen
extremos especiales que ayudan a evitar derrames
sobre repisas inferiores.
Para retirar
los estantes
de tamaño
completo
Para reemplazar, seleccione la
altura deseada para el estante.
Con el estante delantero levantado
ligeramente, enganche la oreja
superior del soporte en el riel, luego
baje el estante hasta el soporte.
NOTA: El estante hacia la derecha del riel está
diseñado para engancharse en la ranura de la
derecha; el estante hacia la izquierda está diseñado
para engancharse en la ranura izquierda.
los soportes del estante,
el estante frena antes de
salirse completamente
del refrigerador y no se
inclinará cuando coloque o
retire alimentos del mismo.
Para retirar o reemplazar los estantes, consulte las
instrucciones que figuran más arriba.
Sobre los estantes del compartimiento del congelador.
1
2
3
Para retirar el estante de escalón:
Levante el lado izquierdo del escalón
ligeramente.
Mueva el estante hacia la izquierda para
liberar los extremos derechos de los orificios
en la pared del gabinete.
Baje el costado derecho del estante, mueva el
estante hacia la derecha y sáquelo.
Para reemplazar el estante de escalón:
Levante el costado izquierdo del estante
ligeramente, mueva el estante hacia arriba,
ajuste los extremos del lado derecho del
estante en los orificios de la pared del
gabinete y baje el estante a su lugar.
Con el estante inclinado como aparece, ajuste
los extremos del lado izquierdo del estante en
los orificios de la pared del gabinete.
47
Sobre las gavetas de almacenamiento.
No todas las características están presentes en todos los modelos.
Gavetas para frutas y vegetales
Gaveta de refrigerios
Se debe retirar el exceso de agua
que se pueda acumular al fondo
de las gavetas y se deben secar
las gavetas.
La gaveta de refrigerios se
puede mover a la posición
más útil según las necesidades
de su familia.
Sobre la remoción de la gaveta de almacenamiento y cubierta.
No todas las características están presentes en todos los modelos.
Gaveta preservadora de humedad ajustable (en algunos modelos)
Deslice el control completamente hasta
la posición HIGH (alto) para ofrecer la alta
humedad recomendada para la mayoría de los
vegetales.
Lleve el control por completo hasta la posición
LOW (bajo) para ofrecer los niveles bajos de
humedad recomendados para la mayoría de las
frutas.
Gaveta de tamaño completo con cubierta plástica
Para retirar la cubierta, levante de los
soportes, hale hacia delante, inclínela y
sáquela.
Estante para las gavetas gemelas
Para retirar:
Retire las gavetas.
Empuje el frente de la cubierta de vidrio
hacia arriba, y al mismo tiempo, hale hacia
delante tanto como se pueda.
Inclínela y sáquela. Evite limpiar la cubierta
de vidrio fría con agua caliente ya que la
diferencia de temperaturas extremas podría
causar que se quiebre.
Retire el marco de la gaveta. (Siempre retire
la cubierta de vidrio antes de sacar el marco
de la gaveta.)
Levante el marco de los soportes en cada
costado y atrás, hale hacia delante, incline y
saque.
Para reemplazar:
Baje el marco hasta que descanse sobre los
soportes en cada costado y atrás.
Reemplace la cubierta de vidrio, empujando
su borde posterior firmemente en el canal
del marco posterior y suavemente baje el
frente hacia su lugar.
Reemplace las gavetas.
Sobre la máquina de hielos automática.
Un refrigerador recientemente instalado puede tomar entre 12 y 24 horas para empezar a hacer hielo.
Hielera
ON
OFF
Brazo con
Interruptor Sensor
de Encendido
Brazo de llenado
hacia la posición
ON (hacia abajo)
48
Brazo de
llenado
hacia la
posición
STOP (hacia
arriba)
La máquina de hielos producirá siete cubos por
ciclo, aproximadamente entre 70 y 100 cubos
en un período de 24 horas, dependiendo de la
temperatura del compartimiento del congelador, la
temperatura del cuarto, el número de veces que se
abre la puerta y otras condiciones de uso.
Si el refrigerador se opera antes de hacer la
conexión del agua hacia la máquina de hielo,
coloque el interruptor en la posición OFF (Apagado)
o mueva (hacia arriba) el brazo indicador en la
posición STOP (Detener).
Cuando el refrigerador fue desconectado del
suministro de agua, mueva el interruptor a
la posición ON (Encendido) y mueva el brazo
indicador a la posición ON (Encendido) (hacia
abajo).
Escuchará un zumbido cada vez que la máquina
de hielos se llene de agua.
La máquina de hielos se llenará de agua cuando
se enfríe hasta 15°F. Un refrigerador recién
instalado se puede tomar entre 12 y 24 horas para
empezar a hacer cubos de hielo.
Deseche los primeros cubos de hielo para permitir
que la línea del agua se limpie. Asegúrese de
que nada interfiera con el movimiento del brazo
indicador.
Cuando el contenedor se llene al nivel del brazo
indicador, la máquina de hielos dejará de producir
hielos.
Es normal que varios cubos de hielo se junten.
Si el hielo no se usa con frecuencia, los cubos de
hielo viejo se volverán turbios, con sabor rancio y
se encogerán.
Kit de accesorios de la máquina de hielos
Si su refrigerador no viene ya equipado con
una máquina de hielos automática, existe un kit
accesorio para la máquina de hielos que está
disponible por un costo adicional.
Revise en la parte posterior del refrigerador en
busca del kit para la máquina de hielos específica
que necesita para su modelo.
Cuidado y limpieza del refrigerador.
Limpieza exterior
Las manijas de la puerta y accesorio (en algunos modelos).
Limpie con un paño humedecido con agua jabonosa. Seque
con un paño seco.
Mantenga el exterior limpio. Límpielo con un paño
ligeramente humedecido con cera de cocina para
electrodomésticos o detergente líquido suave para platos.
Seque y brille con un paño limpio y seco.
No limpie el refrigerador con un paño sucio para platos
o con una toalla mojada. Estos pueden dejar residuos
y pueden erosionar la pintura. No use almohadillas
de restregar, limpiadores en polvo, blanqueadores o
limpiadores que contengan blanqueadores ya que estos
productos pueden raspar y debilitar el acabado de pintura.
Los puertas y las manijas de las puertas de acero
inoxidable (en algunos modelos) pueden ser limpiados con
un limpiador para acero inoxidable para usos comerciales.
Los limpiadores con ácido oxálico tales como Bar Keepers
Friend Soft Cleanser™ eliminarán el óxido, deslustres y
pequeñas manchas. Use sólo un limpiador líquido libre de
material abrasivo y frote en la dirección de las líneas del
cepillo con una esponja suave y húmeda. No utilice cera para
electrodomésticos sobre el acero inoxidable.
Limpieza interior
Para ayudar a evitar olores, deje una caja abierta de
bicarbonato en los compartimientos de alimentos frescos y en
el congelador.
Desconecte el refrigerador antes de limpiarlo. Si esto no es
práctico, escurra la humedad excesiva con una esponja o paño
al limpiar alrededor de los interruptores, luces o controles.
8VHXQDVROXFLyQGHDJXDWLELD\ELFDUERQDWR³XQDFXFKDUDGD
(15 ml) de bicarbonato para un cuarto (1 litro) de agua. Esto
limpia y neutraliza los olores. Enjuague y seque.
Después de limpiar los empaques de la puerta, aplique una
capa delgada de vaselina en los empaques de la puerta
en el costado de la bisagra. Esto ayuda a evitar que los
empaques se peguen y se doblen hasta perder su forma.
Evite limpiar los estantes de vidrio fríos (en algunos modelos)
con agua caliente ya que la diferencia de las temperaturas
extremas puede causar que se quiebren. Manipule los
estantes de vidrio con cuidado. Golpear el vidrio templado
puede causar que se quiebre.
No lave ninguna parte plástica del refrigerador en la lavadora
de platos.
Condensador
No hay necesidad de una
limpieza de rutina del
condensador en ambientes
de operación de hogares
la limpieza de la bobina
normales. Sin embargo, en
condensador
ambientes que puedan ser
particularmente polvorientos o grasosos, el condensador
debe limpiarse periódicamente para una operación eficiente
del refrigerador.
GEAppliances.com
Para limpiar el condensador, gire el dial de control de la
temperatura a OFF. Barra o aspire el polvo.
Para mejores resultados use un cepillo especialmente
diseñado para este fin. Está disponible en la mayoría de
tiendas de partes de electrodomésticos.
Mover el refrigerador
Tenga cuidado al mover el refrigerador lejos de la pared.
Todos los tipos de cubiertas de piso se pueden dañar,
particularmente las cubiertas acojinadas y aquellas con
superficies con diseños en relieve.
Hale el refrigerador en línea recta y regréselo a su posición
empujándolo de la misma forma. Mover el refrigerador
en una dirección lateral puede resultar en daños a la
superficie del piso o al refrigerador.
Cuando empuje de nuevo el refrigerador, asegúrese de no
pisar el cable eléctrico o la línea de suministro a la máquina
de hielos (en algunos modelos).
Después de rodar el refrigerador a su posición, gire las
patas del refrigerador en el sentido de las manecillas del
reloj hasta que las patas sostengan nuevamente el peso del
refrigerador.
Reposición de la bombilla
Para reemplazar una bombilla quemada, desconecte el
refrigerador del tomacorriente eléctrico, desenrosque la
bombilla cuando esté fría y reemplácela con una bombilla
para refrigeradores de similar o inferior voltaje.
Girar el control a la posición OFF no desconecta la corriente
del circuito de la luz.
Cómo prepararse para las vacaciones
Para una largas vacaciones o ausencias, retire los alimentos
y desconecte el refrigerador. Gire el dial de control de la
temperatura hacia la posición OFF (apagado), y limpie el
interior con una solución de una cucharada de bicarbonato
(15 ml) y un cuarto (1 litro) de agua. Deje las puertas
abiertas.
Mueva el brazo indicador a la posición STOP (Alto) (hacia
arriba), o mueva el interruptor a la posición OFF (Apagado)
en el modelo con interruptor deslizable y cierre el suministro
de agua hacia el refrigerador.
Si la temperatura puede caer por debajo del punto de
congelamiento, haga que una persona calificada drene
el sistema del suministro de agua (en algunos modelos)
para evitar serios daños a la propiedad causados por
inundaciones.
Cómo prepararse para trasladarse
Asegure todos los artículos sueltos como la rejilla, los
estantes y cajones pegándolos con cinta en su lugar para
evitar daños.
Asegúrese de que el refrigerador permanezca en una
posición vertical durante el traslado.
49
Instrucciones para la instalación
Modelos 16, 17, 18
Si tiene preguntas, llame al 800.GE.CARES (800.432.2737) o bien visite nuestra página Web: GEAppliances.com
ANTES DE INICIAR
ÁREA
Lea estas instrucciones completa y cuidadosamente.
Permita el siguiente espacio para una fácil instalación,
apropiada circulación del aire y conexiones de plomería y
eléctricas.
•
IMPORTANTE – Guarde estas
instrucciones para uso del inspector local.
•
IMPORTANTE – Observe todos los códigos
•
Nota al instalador – Asegúrese de dejar estas
• Costados 3/4” (19 mm)
• Arriba 1” (25 mm)
• Atrás 2” (50 mm)
y órdenes de ley.
•
•
•
•
•
instrucciones con el consumidor.
Nota al consumidor – Conserve estas
instrucciones para referencia futura.
Nivel de destreza – La instalación de este aparato
requiere de destrezas mecánicas básicas.
Tiempo de ejecución – Instalación del refrigerador
15 minutos
Invertir el vaivén de la puerta
1 hora
La instalación apropiada es la responsabilidad del
instalador.
La falla del producto debido a una instalación
inadecuada no está cubierta por la garantía.
RODILLOS Y PATAS NIVELADORAS
Las patas niveladoras cerca de cada esquina
delantera del refrigerador son ajustables. Éstas colocan
firmemente el refrigerador y evitan que se mueva
cuando las puertas se abran. Las patas niveladoras se
deben colocar de manera que el frente del refrigerador
se levante lo suficiente para que las puertas se cierren
fácilmente cuando se abran hasta la mitad.
Gire las patas niveladoras en el sentido de las
manecillas del reloj para levantar el refrigerador, y en
el sentido contrario para bajarlo.
Los rodillos al lado de las patas niveladoras le
permiten mover el refrigerador lejos de la pared para
limpiarlo.
SUMINISTRO DE AGUA HACIA LA
MÁQUINA DE HIELOS (en algunos modelos)
Gire las patas en el sentido contrario de las manecillas
del reloj hasta que el peso del refrigerador se traslade
de éstas hacia los rodillos. Después de rodar el
refrigerador de nuevo hacia su lugar, gire las patas
en el sentido de las manecillas del reloj hasta que las
patas sostengan nuevamente el peso del refrigerador.
Si el refrigerador tiene una máquina de hielos, se tendrá
que conectar a una tubería de agua potable fría. Un kit
de suministro de agua (contiene tubería de cobre, válvula
de cierre, accesorios e instrucciones) está disponible con
un costo adicional a través de su proveedor, visitando
nuestra página Web GEAppliances.com o bien a través
de Partes y Accesorios, 1.800.661.1616.
UBICACIÓN DEL REFRIGERADOR
• No instale el refrigerador donde la temperatura baje de
60°F (16°C) ya que no correrá con suficiente frecuencia
para mantener las temperaturas apropiadas.
• Instálela en un piso fuerte para que lo soporte con carga
completa.
50
Instrucciones para la instalación
1 CÓMO INSTALAR LA TUBERÍA DEL AGUA (EN ALGUNOS MODELOS)
ANTES DE INICIAR
QUÉ NECESITA (CONT.)
Los kits de cobre recomendados para el suministro de
agua son WX8X2, WX8X3 o WX8X4, dependiendo de la
cantidad de tubería necesaria. Las tuberías plásticas
aprobadas para el suministro de agua son las tuberías
para el refrigerador SmartConnect™ de GE (WX08X10006,
WX08X10015 y WX08X10025).
Al conectar su refrigerador a un Sistema de Agua de
Ósmosis Inversa de GE, la única instalación aprobada es
con un kit de Ósmosis Inversa de GE. Para otros sistemas
de agua de ósmosis inversa, siga las instrucciones del
fabricante.
Esta instalación de la tubería del agua no está
garantizada por el fabricante del refrigerador o
de la máquina de hielos. Siga estas instrucciones
cuidadosamente para minimizar el riesgo de un daño
costoso debido al agua.
El martilleo del agua (agua golpeando contra la tubería)
en la tubería de la casa puede causar daños a las partes
del refrigerador y conducir a un goteo o inundación por
el agua. Llame a un plomero calificado para corregir el
martilleo del agua antes de instalar la tubería del agua
al refrigerador.
Para evitar quemaduras y daños con el producto,
no conecte la tubería del agua a la tubería del agua
caliente.
Si usa su refrigerador antes de conectar el suministro de
agua, asegúrese de que el interruptor esté en la posición
OFF de apagado o que el brazo indicador esté en la
posición STOP (Alto) (hacia arriba).
No instale la tubería de la máquina de hielos en lugares
donde la temperatura caiga por debajo del nivel de
congelamiento.
Al usar cualquier aparato eléctrico (como un taladro
eléctrico) durante la instalación, asegúrese de que el
aparato esté aislado o conectado de manera que evite
el peligro de una descarga eléctrica, o se opere por
baterías.
Todas las instalaciones se deben realizar según los
requisitos del código local de plomería.
Los kits de tubería para el refrigerador SmartConnect™ de
GE están disponibles en las siguientes longitudes:
6’ (1,8 m) – WX08X10006
15’ (4,6 m) – WX08X10015
25’ (7,6 m) – WX08X10025
Asegúrese de que el kit que haya seleccionado permita al
menos 8 pies (2,4 m) como se describe arriba.
NOTA: La única tubería de plástico aprobada de GE
es la que viene provista con los kits de tubería para el
refrigerador SmartConnect de GE. No use ninguna otra
tubería plástica para el suministro del agua ya que la
tubería está bajo presión todo el tiempo. Ciertos tipos
de plástico se fracturarán o se romperán con el tiempo
y causarán daños en su casa debido al agua.
• Un kit de suministro de agua de GE (contiene tubería,
válvula de cierre y accesorios enumerados abajo) está
disponible a un costo adicional en su tienda o por
medio de Partes y Accesorios, 1.800.661.1616.
• Un suministro de agua fría.
La presión del agua debe
estar entre 20 y 120 p.s.i.
(1,4-8,1 bar).
• Taladro eléctrico.
• Llave de 1/2” o ajustable.
• Destornillador plano y de estrella.
• Dos tuercas de compresión de
1/4” de diámetro exterior y 2
férulas (mangas) – para conectar
la tubería de cobre a la válvula de
cierre y la válvula del agua del refrigerador.
O BIEN
• Si está usando un kit de tubería para el refrigerador
SmartConnect™ de GE, los accesorios necesarios ya
vienen preinstalados en la tubería.
• Si su tubería existente de cobre para el agua tiene
un accesorio con vuelo en el extremo, necesitará un
adaptador (disponible en las tiendas de suministros de
plomería) para conectar la línea del agua al refrigerador
O BIEN, podrá cortar el accesorio con vuelo con
un cortador de tubos y luego usar un accesorio de
compresión. No corte el extremo formado de la tubería
para el refrigerador SmartConnect™ de GE.
QUÉ NECESITA
• Kit de tubería de cobre para el refrigerador o
SmartConnect™ de GE, 1/4” de diámetro externo para
conectar el refrigerador al suministro de agua. Si usa
cobre, asegúrese de que ambos extremos de la tubería se
corten uniformemente.
Para determinar la cantidad de tubería que necesita: mida
la distancia desde la válvula del agua en la parte posterior
del refrigerador hasta el tubo de suministro de agua. Luego
agregue 8 pies (2,4 m). Asegúrese de que haya suficiente
tubería adicional (unos 8 pies [2,4 m] enrollado en tres
vueltas de unas 10 pulgadas [25 cm] de diámetro) para
permitir que el refrigerador se pueda mover de la pared
después de la instalación.
• Válvula de cierre para conectar a la línea del agua fría.
La válvula de cierre deberá tener una entrada de agua
con un diámetro interno mínimo de 5/32” en el punto
de conexión a la TUBERÍA DEL AGUA FRÍA. Las válvulas
de apagado tipo silla vienen incluidas en muchos kits
de suministro de agua. Antes de comprar, asegúrese
de que una válvula tipo silla cumple con los códigos de
plomería en su localidad.
51
Instrucciones para la instalación
1 CÓMO INSTALAR LA TUBERÍA DEL AGUA (EN ALGUNOS MODELOS)
Instale la válvula de cierre en la tubería del agua de consumo más frecuentemente utilizada.
4 DIRIJA LA TUBERÍA
1 CIERRE EL SUMINISTRO PRINCIPAL
DE AGUA Y DESENCHUFE EL
REFRIGERADOR
Dirija la tubería entre la línea del agua fría y el refrigerador.
Dirija la tubería a través de un orificio perforado en la
pared o en el piso (detrás del refrigerador o del gabinete
de la base adyacente) lo más cerca posible a la pared.
NOTA: Asegúrese de que haya suficiente tubería
adicional (unos 8 pies [2,4 m] enrollada en tres vueltas de
alrededor de 10” [25 cm] de diámetro) para permitir que
el refrigerador se pueda mover de la pared después de la
instalación.
Abra el grifo más cercano en contra del sentido de
las agujas del reloj por suficiente tiempo para limpiar
la tubería del agua.
2 SELECCIONE LA UBICACIÓN DE LA
VÁLVULA
Seleccione una ubicación para la válvula que sea
fácilmente accesible. Es mejor conectarla en el
costado de una tubería vertical de agua. Cuado sea
necesario conectarla en una tubería horizontal de
agua, haga la conexión en la parte superior o al lado,
en vez de hacerlo en la parte de abajo, para evitar
retirar cualquier sedimento de la tubería del agua.
Perfore un orificio de 1/4” en la tubería del agua
(incluso si está usando una válvula auto perforadora),
usando una broca afilada. Retire cualquier sobrante
que resulte de perforar el orificio en la tubería. Tenga
cuidado de no permitir que se filtre agua hacia el
taladro. No perforar un orificio de 1/4” puede resultar
en menor producción de hielo o cubos más pequeños.
5 CONECTE LA TUBERÍA A LA VÁLVULA
Coloque la tuerca de compresión y férula para la
tubería de cobre (manga) en el extremo de la tubería
y conéctela a la válvula de cierre.
Asegúrese de que la tubería esté complemente
insertada en la válvula. Apriete la tuerca de
compresión firmemente.
Para tubería de plástico de un kit de tubería para
el refrigerador SmartConnect™ de GE, inserte el
extremo moldeado de la tubería en la válvula de
cierre y apriete la tuerca de compresión hasta que
esté firmemente apretada a mano, luego apriete otro
giro con una llave. Apretar demasiado puede causar
fugas.
Válvula de
cierre tipo silla
Tuerca de
compresión
Tubería
SmartConnect™
Tuerca de
empaque
3 INSTALE LA VÁLVULA DE CIERRE
Válvula de salida
Una la válvula de cierre a la tubería de agua fría con
la abrazadera para el tubo.
Apriete los tornillos de la abrazadera hasta que la
arandela sellante empiece a hincharse.
NOTA: No apriete demasiado la tubería ya que podría
romperse.
Arandela
Abrazadera
del tubo
6 LAVE LA TUBERÍA
Abra el suministro principal de agua en contra del
sentido de las agujas del reloj y lave la tubería hasta
que el agua esté limpia.
Cierre el agua en la válvula después de que un cuarto
(1 litro) de agua se haya eliminado por la tubería.
Extremo
de entrada
Tornillo
de la
abrazadera
Válvula de
cierre tipo silla
Férula (manga)
Tubería
vertical de
agua fría
52
Instrucciones para la instalación
1 CÓMO INSTALAR LA TUBERÍA DEL AGUA (CONT.)
7 CONECTE LA TUBERÍA AL
8 ABRA LA LLAVE DEL AGUA EN LA
REFRIGERADOR
VÁLVULA DE CIERRE
Apriete cualquier conexión que pueda presentar fugas.
NOTAS:
• Antes de hacer la conexión al refrigerador, asegúrese
de que el cable de corriente del refrigerador no esté
conectado en el tomacorriente de la pared.
• Recomendamos instalar un filtro de agua si su suministro
de agua tiene arena o partículas que podrían obstruir
la malla de la válvula de agua del refrigerador. Instálelo
en la tubería del agua cerca al refrigerador. Si usa un
kit de tubería para el refrigerador SmartConnect™ de
GE, necesitará un tubo adicional (WX08X10002) para
conectar el filtro. No corte la tubería plástica para instalar
el filtro.
Retire la cubierta del acceso.
Retire la tapa flexible de
plástico de la válvula del agua
(conexión del refrigerador).
Coloque la tuerca de compresión y
la férula (manga) en el extremo de
la tubería como se muestra. En el
kit de tubería para el refrigerador
SmartConnect™ de GE, las tuercas ya
vienen armadas con la tubería.
Inserte el extremo de la tubería en
la conexión de la válvula del agua lo
más que se pueda. Mientras sostiene la tubería, apriete el
accesorio.
Para tubería de plástico de un kit de tubería para el
refrigerador SmartConnect™ de GE, inserte el extremo
moldeado de la tubería en la válvula de cierre y apriete la
tuerca de compresión hasta que esté firmemente apretada
a mano, luego apriete otra vuelta con una llave. Apretar
demasiado puede causar fugas.
Una la tubería a la abrazadera provista para sostenerla
en una posición vertical. Quizás necesite apalancar la
abrazadera.
9 CONECTE EL REFRIGERADOR
Organice el cable de la tubería de manera que no vibre
contra la parte trasera del refrigerador o contra la pared.
Empuje el refrigerador hacia la pared.
10 INICIE LA MÁQUINA DE HIELO
Mueva el brazo de llenado a la posición ON (hacia abajo).
La máquina de hielos no empezará a operar hasta que
alcance su temperatura de operación de 15°F (–9°C) o
menor. Luego, empezará a operar automáticamente.
Interruptor
de
encendido
Brazo de
llenado
hacia la
posición
STOP (hacia
Brazo de llenado arriba)
hacia la posición
ON (hacia abajo)
Tuerca de
compresión de
1/4”
NOTA: En condiciones de menor presión del agua,
la válvula de agua puede encenderse hasta 3 veces
para suministrar suficiente agua a la máquina de
hielos.
Férula
(manga)
Tubo de
SmartConnect™
OFF
Modelo de conmutador de alimentación
Abrazadera de
la tubería
Tubería de 1/4”
ON
Conexión del
refrigerador
Reemplace la cubierta de acceso.
53
Instrucciones para la instalación
2 CÓMO INVERTIR EL VAIVÉN DE LA PUERTA
NOTAS IMPORTANTES
2 RETIRE LA PUERTA DEL CONGELADOR
Al invertir el vaivén de la puerta:
• Lea las instrucciones completamente antes de
empezar.
• Maneje las partes con cuidado para evitar raspar la
pintura.
• Ponga los tornillos con su parte correspondiente para
evitar usarlas en el lugar equivocado.
• Disponga de una superficie de trabajo que no se raspe
para las puertas.
IMPORTANTE: Una vez que empiece, no mueva el
gabinete hasta que haya completado el proceso de
invertir el vaivén de la puerta.
Estas instrucciones son para cambiar las bisagras del
lado derecho al izquierdo, si alguna vez desea cambiar
las bisagras al lado derecho nuevamente, siga las
mismas instrucciones e invierta toda las referencias
hacia la izquierda y derecha.
2.1 Pegue la puerta cerrada con cinta de enmascarar.
2.2 Con un destornillador de casquillo de cabeza
hexagonal de 5/16,” retire los tornillos que sostienen
la bisagra superior del gabinete.
2.3 Levante la bisagra directamente hacia arriba para
liberar el pasador de la bisagra del casquillo en la
parte superior de la puerta y colóquela a un lado,
junto con los tornillos correspondientes.
Bisagra
superior
HERRAMIENTAS REQUERIDAS
Destornillador de estrella
Cinta de enmascarar
2.4 Retire la cinta y levante la puerta hacia fuera del
gabinete. Levántela del pasador de la bisagra central.
Destornillador de casquillo
con cabeza de 5/16”
Cuchillo para masilla
(espátula) o destornillador
delgado
Destornillador
Torx® T20 ó T25,
(necesitado para
algunos modela)
2.5 Coloque la puerta sobre una superficie que no raye
con la parte exterior hacia arriba.
Llave abierta de
5/16”
2.6 Traslade los dos tornillos del lado opuesto
del gabinete hacia los orificios de los tornillos
desocupados al retirar la bisagra superior.
1 ANTES DE INICIAR
1.1 Desconecte el refrigerador del tomacorriente
eléctrico.
1.2 Desocupe todos los estantes de la puerta, incluyendo
el compartimiento de lácteos.
PRECAUCIÓN: No permita que ninguna puerta se
caiga al piso, ya que esto podría dañar el freno de la
puerta.
54
Instrucciones para la instalación
2 CÓMO INVERTIR EL VAIVÉN DE LA PUERTA (CONT.)
3 RETIRE LA PUERTA DE ALIMENTOS
3 RETIRE LA PUERTA DE ALIMENTOS
3.1 Pegue la puerta cerrada con cinta de enmascarar.
3.5 Traslade los dos tornillos del
lado opuesto del gabinete
a los orificios de los tornillos
desocupados al retirar la bisagra
central.
3.6 Traslade la arandela (si su
modelo la incluye) hacia el
costado opuesto.
FRESCOS (CONT.)
FRESCOS
3.7 Tome uno de los tornillos
retirados en el paso 2 y
colóquelo en el orificio
para tornillo más exterior
en el lado opuesto. No
atornille por completo, deje
suficiente espacio bajo la
cabeza del tornillo para el grosor del soporte.
3.2 Usando un destornillador de casquillo de cabeza hexagonal
de 5/16” y una llave abierta de 5/16,” retire los dos tornillos
que sostienen la bisagra central al gabinete. Levante la
bisagra central para liberar el pasador del casquillo en la parte
superior de la puerta y coloque la bisagra y los tornillos a un
lado. Tenga cuidado de no perder el espaciador y la arandela
de la bisagra central.
4 CÓMO INVERTIR LOS ELEMENTOS DE
SOPORTES
4.1 Mueva el soporte de la bisagra inferior y la arandela
plástica del lado derecho al izquierdo.
Arandela
Plástica
Cambie el pasador de la
bisagra al lado opuesto
del soporte.
3.3 Retire la cinta e incline la puerta hacia fuera del
gabinete. Levante la puerta del pasador en el soporte
de la bisagra inferior. (Si la arandela plástica se pega al
fondo de la puerta, colóquela de nuevo en la bisagra.)
4.2 Intercambie la bisagra y los tornillos en la parte superior
derecha con los tornillos en la parte superior izquierda
del gabinete. No apriete los tornillos en el lado de la
bisagra en este momento.
3.4 Coloque la puerta con el exterior hacia arriba en una
superficie que no raye.
Instalación de la bisagra
a la izquierda.
Instalación de la bisagra
a la derecha.
NOTAS:
• Algunas bisagras tienen cuatro orificios. Los orificios
a utilizar para la instalación de la bisagra dependen
del lado que instale la bisagra.
• El borde externo de la bisagra deberá estar paralelo
al borde de la caja para una instalación correcta.
55
Instrucciones para la instalación
2 CÓMO INVERTIR EL VAIVÉN DE LA PUERTA (CONT.)
5 CÓMO INVERTIR LAS MANIJAS DE
5 CÓMO INVERTIR LAS MANIJAS DE
LAS PERTAS (CONT.)
5.2 Traslade el freno de la puerta
LAS PERTAS
5.1 Traslade la manija de la puerta de
5.1.1 alimentos
Retire el tapónfrescos
de la manija por debajo del borde
5.2.1 Desplace la traba plástica de la puerta y los
tornillos del lado derecho al lado izquierdo.
usando un cuchillo de masilla con la punta forrada
con cinta, y retire el tornillo que está por debajo. Retire
los dos tornillos que sostienen la manija con la parte
superior de la puerta.
Lado
izquierdo
Traba plástica de Lado
derecho
la puerta
5.2.2 Desplace la traba metálica de la puerta del lado
derecho al lado izquierdo y desplace el tornillo al
lado opuesto de la puerta.
Parte superior
Tapón
Lado
izquierdo
Traba metálica
de la puerta
Lado
derecho
5.3 Cómo reinstalar la manija de la puerta
de los alimentos frescos
5.1.2 Retire la manija.
5.3.1 Pegue la manija en el lado
derecho de la puerta con los
tornillos que están en la parte
superior y debajo del tapón
de la manija.
5.3.2 Vuelva a instalar el tapón de
la manija.
5.1.3 Retire el botón de la bisagra superior del lado izquierdo
de la puerta e insértelo en el orificio en el lado opuesto
que se desocupó al retirar la bisagra superior.
Tapón
5.4 Traslade la manija de la puerta del
congelador
5.1.4 Retire el tapón del frente de la puerta y trasládelo al lado
opuesto.
Tapón
5.4.1 Retire el tornillo que
sostiene la manija con la
parte superior de la puerta
y los dos tornillos que
sostienen la manija con la
parte inferior de la puerta.
5.4.2 Retire la manija.
Para volver
a instalar
la manija
en el lado
opuesto.
Parte TOP
superior
Parte BOTTOM
inferior
56
Instrucciones para la instalación
5 CÓMO INVERTIR LAS MANIJAS DE LA
PUERTA (CONT.)
6 CÓMO VOLVER A COLGAR LAS
PUERTAS (CONT.)
5.4.3 Retire el tornillo del borde
superior derecho de la puerta
e insértelo en el orificio del
tornillo de la manija en el lado
izquierdo.
6.1.3 Incline la puerta hacia el gabinete. A medida que la
puerta vuelve a su posición, deslice la bisagra debajo
de la cabeza del tornillo que anteriormente se había
insertado parcialmente en el orificio más externo.
Inserte el tornillo restante, luego apriete ambos tornillos
firmemente.
5.4.4 Traslade el freno de la puerta, como se muestra
en la sección 5.2 anterior.
6 CÓMO VOLVER A COLGAR LAS
PUERTAS (CONT.)
5.4.5 Una la manija al borde
derecho de la puerta con
tornillos en la parte superior
e inferior, usando los orificios
que quedan al retirar los
tornillos del freno de la puerta.
6.2
Vuelva a colgar la
puerta del congelador
Pasador de
6.2.1 Baje la puerta la bisagra
del congelador central
al pasador
de la bisagra central.
Cerciórese de que la
arandela y el espaciador
estén en su lugar en el pasador.
6 CÓMO VOLVER A COLGAR LAS
PUERTAS
6.1 Vuelva a colgar la puerta de los
alimentos frescos
Arandela plástica y
espaciador
6.2.2 Incline la puerta hacia el gabinete, levantando
la bisagra superior de manera que el pasador se
ajuste en el casquillo en la parte superior de la
puerta.
6.1.1 Baje la puerta de los alimentos frescos al pasador
de la bisagra inferior. Asegúrese de que la
arandela esté en su lugar en el pasador.
Arandela plástica
Soporte
de la
bisagra
6.2.3 Cerciórese de que la puerta esté ligeramente
por encima de la parte superior del gabinete y
el espacio entre las puertas esté uniforme por el
frente. Apriete los tornillos de la bisagra superior. No
apriete demasiado estos tornillos, apriételos hasta
que estén ajustados, luego dé otro medio giro.
Pasador de la bisagra
6.1.2 Inserte el pasador
en la bisagra central
en el casquillo de la
parte superior de la
puerta. Coloque el
Arandela plástica y espaciador
espaciador, luego
la arandela en el
pasador de la bisagra. NOTA: La bisagra central
debe girarse como se muestra al instalarse en el
lado izquierdo.
57
Instrucciones para la instalación
3 CONEXIÓN DE APARATOS DE ENERGÍA INTELIGENTE
1 RETIRE LA ETIQUETA QUE SE ENCUENTRA SOBRE EL CONECTOR DEL CABLE DE
INTERCONEXIÓN EN LA TAPA DE ACCESO
Retire al conectar
al ACM
etiqueta
2 CONECTE EL ELECTRODOMÉSTICO AL ACM
2.1 Ubique el cable de interconexión.
Este accesorio es parte del kit
del ACM.
2.2 Enchufe el cable de
interconexión en el conector
en la tapa de acceso como se
muestra.
2.3 Enchufe el extremo opuesto del
cable de interconexión en el
ACM.
2.4 Consulte las instrucciones del kit
del ACM para conectar el ACM al
Núcleo (NucleusTM) o al Metro
Inteligente (Smart Meter).
3 UBIQUE EL ACM
NOTA: El ACM se puede ubicar sobre, detrás o al costado del refrigerador. El ACM también
se puede instalar sin contacto directo con el refrigerador (por ejemplo en los gabinetes
adjuntos). Para más detalles sobre la instalación del ACM, consulte el manual del ACM.
58
Sonidos normales de operación.
GEAppliances.com
Los refrigeradores más nuevos producen sonidos diferentes a los modelos más antiguos. Los refrigeradores modernos tienen más
funciones y usan tecnología más reciente.
¿Usted escucha lo que yo escucho? Estos sonidos son normales.
HUMMM...
WHOOSH...
„ El nuevo compresor de alta eficiencia puede funcionar más rápido
y durar más que el de su refrigerador anterior y puede escuchar un
zumbido de tono alto o un sonido pulsante mientras opera.
„ Puede escuchar un sonido de soplido cuando las puertas se cierran.
Esto se debe a que la presión se está estabilizando dentro del
refrigerador.
CHASQUIDOS, ESTALLIDOS,
CRUJIDO, GORJEOS
„ Puede escuchar sonidos como de crujido o estallidos cuando el
refrigerador se conecta por primera vez. Esto pasa a medida que el
refrigerador se enfría hasta la temperatura correcta.
„ El compresor puede causar un chasquido o un gorjeo cuando intenta
volver a arrancar (esto puede tomar hasta 5 minutos).
„ Expansión y contracción de las bobinas durante o después del ciclo de
descongelación puede causar sonidos como de crujido o estallidos.
„ En modelos con máquina de hielos, después de completar un ciclo de
hacer hielo, se pueden escuchar los cubos de hielo cuando caen a la
bandeja de hielos.
„ Puede escuchar los ventiladores moviéndose a gran velocidad.
Esto pasa cuando el refrigerador se conecta por primera vez,
cuando las puertas se abren frecuentemente o cuando se
guarda gran cantidad de alimentos en el refrigerador o en los
compartimientos del congelador. Los ventiladores están ayudando
a ntener las temperaturas correctas.
SONIDOS DE AGUA
„ El fluido del refrigerante a través de las bobinas puede producir un
sonido de borboteo como de agua hirviendo.
„ El agua que cae en el calentador de descongelación puede
causar un chisporroteo, estallido o zumbido durante el ciclo de
descongelación.
„ Un ruido de agua cayendo se puede escuchar durante el ciclo de
descongelación a medida que el hielo se derrite del evaporador y
fluye hacia la bandeja de drenaje.
„ El cierre de las puertas puede producir un sonido de gorgoteo
debido a la estabilización de la presión.
Para información adicional sobre los ruidos normales
de la máquina de hielos, consulte la sección Sobre la
máquina de hielos automática.
59
Antes de llamar a solicitar servicio…
Consejos para la solución de problemas¡
Ahorre tiempo y dinero! Revise las tablas en las siguientes páginas
primero y quizás no necesite llamar a solicitar el servicio.
Problema
Posibles causas
Qué hacer
El refrigerador no opera
El refrigerador está en
• Espere unos 30 minutos hasta que el ciclo
el ciclo de descongelado.
de descongelado termine.
El dial de control de la temperatura • Mueva el dial de control de la temperatura
está en posición 0 o en la posición a un nivel de temperatura.
OFF.
a un nivel de temperatura.
El refrigerador está desconectado. • Empuje el enchufe completamente en el tomacorriente.
El fusible está quemado / el
• Reemplace el fusible o fije el interruptor.
interruptor automático se saltó.
La función Energy Smart™ está • Espere aproximadamente 2 horas para que el
alterando el funcionamiento del refrigerador
funcionamiento normal continúe.
Vibración o traqueteo (una Los rodillos o patas
• Consulte la sección Rodillos y patas niveladoras.
vibración ligera es normal) niveladoras necesitan ajuste.
Hielo o cristales de hielo en La puerta se deja abierta.
• Revise si un paquete está reteniendo la puerta abierta.
los alimentos congelados
Abrir la puerta con mucha
(El hielo dentro de un
frecuencia o por mucho tiempo.
paquete es normal)
Los cubos son
muy pequeños
La válvula de cierre del agua que • Llame al plomero para que limpie la válvula.
conecta el refrigerador a la línea
del agua puede estar obstruida.
La función Energy Smart™ está
alterando el funcionamiento del
refrigerador funcionamiento
normal continúe.
Normal cuando el refrigerador
El motor opera con
se conecta inicialmente.
frecuencia por largos
periodos o ciclos de
Con frecuencia ocurre cuando
forma intermitente (Los
grandes cantidades de alimentos
refrigeradores modernos se almacenan en el refrigerador.
con más espacio de
La puerta se deja abierta.
almacenamiento y un
El clima caliente o abrir
congelador más grande
requieren de más tiempo la puerta frecuentemente.
de operación. Arrancan
El dial de control de la temperatura
y paran con frecuencia
están en en el nivel más frío.
para mantener
La rejilla y el condensador
temperaturas uniformes.) necesitan limpieza.
60
• Consulte Sobre los Modelos Energy Smart™
• Espere 24 horas hasta que el refrigerador se enfríe
por completo.
• Esto es normal.
• Revise si un paquete está reteniendo la puerta abierta.
• Esto es normal.
• Consulte la sección Sobre el dial de control de la temperatura.
• Consulte la sección Cuidado y limpieza.
GEAppliances.com
Problema
Posibles causas
Qué hacer
El compartimiento de
alimentos frescos o el
congelador no están muy
fríos
El control de la temperatura no está
en un nivel suficientemente frío.
El clima caliente o abrir
la puerta frecuentemente.
La puerta se deja abierta.
Un paquete está obstruyendo
el conducto del aire en el
compartimiento del congelador.
La máquina de hielos no
• Consulte la sección Sobre el dial de control de la temperatura.
La maquina de hielos
automática no funciona
(en algunos modelos)
Zumbido
frecuente
Congelamiento lento de
los cubos de hielo
Los cubos de hielo tienen
olor / sabor
El suministro del agua está
apagado o no está conectado.
El compartimiento del
congelador no es muy frío.
Hay cubos amontonados en
el recipiente de almacenamiento
que causan que la máquina de
hielos se apague.
La máquina de hielos está en
la posición de encendido, pero
el suministro de agua hacia el
refrigerador no está conectado.
La puerta se deja abierta.
El dial de control de la temperatura no
está en un nivel suficientemente frío.
La función Energy Smart™ está
alterando el funcionamiento del
refrigerador
El recipiente de almacenamiento
de hielos necesita limpieza.
Hay alimentos que trasmiten
olor / sabor a los cubos de hielo.
El interior del refrigerador
necesita limpieza.
No es raro durante
periodos de alta humedad.
• Fije el control de la temperatura a un nivel más frío.
Consulte la sección Sobre los controles.
• Revise si un paquete está reteniendo la puerta abierta.
• Revise si hay un paquete bloqueando el conducto
del aire en el compartimiento del congelador.
• Mueva el brazo indicador a la posición ON
(Encendido) (hacia abajo), o mueva el interruptor está
encendido, deslizable a la posición ON (Encendido).
• Consulte la sección Cómo instalar la tubería del agua.
• Espere 24 horas para que el refrigerador se enfríe
completamente.
• Nivele los cubos con la mano.
• Mueva el brazo de llenado a la posición STOP (UP) (hacia
arriba). Mantener el brazo en la posición OFF (hacia
abajo) dañará la válvula del agua.
• Revise si un paquete está reteniendo la puerta abierta.
• Consulte la sección Sobre el dial de control de la temperatura.
• Consulte Sobre los Modelos Energy Smart™
• Desocupe el recipiente y lávelo. Deseche los cubos viejos.
• Envuelva bien los alimentos.
• Consulte la sección de Cuidado y limpieza.
Se forma humedad en
la superficie del gabinete
entre las puertas
Humedad se forma al
Abrir la puerta con mucha
interior (en clima húmedo, frecuencia o por mucho tiempo.
el aire lleva la humedad
al refrigerador cuando las
puertas se abren)
• Seque la superficie, luego fije el control de la
temperatura a un nivel más frío.
El refrigerador tiene olor
Hay alimentos que trasmiten
olor / sabor al refrigerador.
• Los alimentos con olores fuertes deben envolverse firmemente.
• Mantenga una caja abierta de bicarbonato
en el refrigerador, reemplácela cada tres meses.
El interior necesita limpieza.
• Consulte la sección de Cuidado y limpieza.
61
Garantía del refrigerador.
Todos los servicios de garantía los proporcionan nuestros Centros de Reparación
de Fábrica o nuestros técnicos Customer Care ® autorizados. Para concertar una
cita de reparación, en línea, 24 horas al día, visíte nos al GEAppliances.com, o llame
al 800.GE.CARES (800.432.2737). Cuando llame para solicitar servicio, por favor
tenga a mano el número de serie y el número de modelo.
Por el período de:
Grape aquí su recibo. Se
requiere facilitar prueba de
la fecha de compra original
para obtener un servicio
bajo la garantía.
GE reemplazará:
MODELOS GE y GE PROFILE:
Un año
A partir de la fecha
de la compra original
Cualquier parte del refrigerador que falle debido a defectos en los materiales o en
la fabricación. Durante esta garantía limitada de un año, GE también proporcionará, sin costo
alguno, toda la mano de obra y el servicio relacionado para reemplazar partes defectuosas.
Treinta días
(Filtro de agua, si incluido)
A partir de la fecha
de la compra original
del refrigerador
Cualquier parte del cartucho del filtro de agua que falle debido a defectos en los materiales o en
la fabricación. Durante esta garantía limitada de treinta días, GE también proporcionará, sin costo
alguno, un cartucho de filtro de agua de repuesto.
MODELOS DE GE PROFILE SOLAMENTE:
Cinco años (Modelos
de GE Profile solamente)
A partir de la fecha
de la compra original
Cualquier parte del sistema sellado de refrigeración (compresor, condensador, evaporador y tuberías
de conexión) que fallen debido a defectos en los materiales o fabricación. Durante esta garantía
limitada de cinco años del sistema sellado de refrigeración, GE también proporcionará, sin costo
alguno, toda la mano de obra y el servicio relacionado para reemplazar partes defectuosas en
el sistema sellado de refrigeración.
Lo que GE no cubrirá:
„ Viajes de servicio a su hogar para enseñarle cómo usar
el producto.
„ Instalación o entrega inapropiada, o mantenimiento
impropio.
„ Fallas del producto si hay abuso, mal uso, o uso para
otros propósitos que los propuestos, o uso para fines
comerciales.
„ Pérdida de alimentos por averías.
„ Reemplazo de fusibles de su hogar o reajuste de
interruptores de circuito.
„ Cualquier daño sobre la terminación deberá ser
informado dentro de las 48 horas luego de la entrega del
electrodoméstico.
„ Cualquier daño sobre la terminación que incluya óxido,
deslustres o pequeñas manchas, luego de la entrega.
„ Productos que no presenten defectos ni estén rotos, o que
estén funcionando de acuerdo con lo descrito en el Manual
del Propietario
„ Reemplazo del cartucho del filtro de agua, si incluido,
debido a presión de agua afuera de las limites de operación
especificados o sedimento excesivo en el suministro de agua.
„ Reemplazo de las bombillas, si incluidas, o del cartucho de
filtro de agua, si incluido, diferente a como se especifica
anteriormente.
„ Daño al producto causado por accidente, fuego,
inundaciones o actos de Dios.
„ Daño incidental o consecuencial causado por posibles
defectos con el aparato.
„ Producto no accesible para facilitar el servicio requerido.
(;&/86,Ï1'(*$5$17Ë$6,03/Ë&,7$6³6X~QLFR\H[FOXVLYRGHUHFKRHVODUHSDUDFLyQGHOSURGXFWRWDO\
como se indica en esta Garantía limitada. Cualquier garantía implícita, incluyendo las garantías implícitas
de comerciabilidad o adecuación para un fin determinado, están limitadas a un año o el período de tiempo
más breve permitido por la ley.
Esta garantía se extiende al comprador original y cualquier comprador posterior de productos comprados para uso residencial dentro
de Estados Unidos. Si el producto está situado en un área que no dispone de servicio por parte
de un proveedor de servicio autorizado de GE, podría tener que hacerse cargo de los costes de envío o bien podría solicitársele
que lleve el producto a una centro de servicio de GE autorizado para realizar la reparación. En Alaska, la garantía excluye el costo
de envío o las visitas de servicio a su casa.
Algunos estados no permiten la exclusión o las limitaciones de daños incidentales o consecuenciales. Esta garantía da
derechos legales específicos, y usted podría tener otros derechos que variarán de estado a estado. Para saber cuáles son sus derechos
legales, consulte a la oficina de asuntos del consumidor local o la oficina del Attorney General en su localidad.
62
Garante: General Electric Company. Louisville, KY 40225
Soporte al Consumidor.
Página Web de GE Appliances
GEAppliances.com
www.Hotpoint.com
¿Tiene alguna pregunta sobre su electrodoméstico? ¡Pruebe la página Web de GE Appliances 24 horas al día,
cualquier día del año! Para mayor conveniencia y servicio más rápido, ya puede descargar los Manuales de los
Propietarios, pedir piezas o incluso hacer una cita en línea para que vengan a realizar una reparación.
Solicite una reparación
GEAppliances.com
www.Hotpoint.com
El servicio de expertos GE está a tan sólo un paso de su puerta. ¡Entre en línea y solicite su reparación cuando
le venga bien 24 horas al día cualquier día del año! O llame al 800.GE.CARES (800.432.2737) durante horas
normales de oficina.
Real Life Design Studio
(Estudio de diseño para la vida real)
GEAppliances.com
*(DSR\DHOFRQFHSWRGH'LVHxR8QLYHUVDO³SURGXFWRVVHUYLFLRV\DPELHQWHVTXHSXHGHQXVDUJHQWHGHWRGDV
las edades, tamaños y capacidades. Reconocemos la necesidad de diseñar para una gran gama de habilidades
y dificultades físicas y mentales. Para más detalles cobre las aplicaciones de GE Diseño Universal, incluyendo
ideas de diseño para la cocina para personas con discapacidades, mire nuestra página Web hoy mismo. Para
personas con dificultades auditivas, favor de llamar al 800.TDD.GEAC (800.833.4322).
Garantías ampliadas
GEAppliances.com
Compre una garantía ampliada y obtenga detalles sobre descuentos especiales disponibles mientras su garantía
está aún activa. Puede comprarla en línea en cualquier momento, o llamar al (1.888.261.2133) durante horas
normales de oficina. GE Consumer Home Services estará aún ahí cuando su garantía termine.
Piezas y accesorios
GEAppliances.com
www.Hotpoint.com
Aquellos individuos con la calificación necesaria para reparar sus propios electrodomésticos pueden
pedir que se les manden las piezas o accesorios directamente a sus hogares (aceptamos las tarjetas
VISA, MasterCard y Discover). Haga su pedido en línea hoy, 24 horas cada día o llamar por teléfono
al 1.800.661.1616 durante horas normales de oficina.
Las instrucciones descritas en este manual cubren los procedimientos a seguir por cualquier usuario. Cualquier
otra reparación debería, por regla general, referirse a personal calificado autorizado. Debe ejercerse precaución
ya que las reparaciones incorrectas pueden causar condiciones de funcionamiento inseguras.
Póngase en contacto con nosotros
GEAppliances.com
www.Hotpoint.com
Si no está satisfecho con el servicio que recibe de GE, póngase en contacto con nosotros en nuestra página
Web indicando todos los detalles así como su número de teléfono o escríbanos a:
General Manager, Customer Relations
GE Appliances, Appliance Park
Louisville, KY 40225
Registre su electrodoméstico
GEAppliances.com
www.Hotpoint.com
£5HJLVWUHVXQXHYRHOHFWURGRPpVWLFRHQOtQHD³FXDQGRXVWHGSUHILHUD(OUHJLVWUDUVXSURGXFWRDWLHPSROH
proporcionará, si surgiera la necesidad, una mejor comunicación y un servicio más rápido bajo los términos de
su garantía. También puede enviar su tarjeta de registro pre-impresa que se incluye en el material de embalaje.
63
Consumer Support.
GE Appliances Website
GEAppliances.com
In the U.S.: www.Hotpoint.com
Have a question or need assistance with your appliance? Try the GE Appliances Website 24 hours a day,
any day of the year! For greater convenience and faster service, you can now download Owner’s Manuals,
order parts, or even schedule service on-line. In Canada: www.geappliances.ca
Schedule Service
GEAppliances.com
In the U.S.: www.Hotpoint.com
Expert GE repair service is only one step away from your door. Get on-line and schedule your service at your
convenience 24 hours any day of the year! Or call 800.GE.CARES (800.432.2737) during normal business hours.
In Canada, call 1.800.561.3344
Real Life Design Studio
In the U.S.: GEAppliances.com
*(VXSSRUWVWKH8QLYHUVDO'HVLJQFRQFHSW³SURGXFWVVHUYLFHVDQGHQYLURQPHQWVWKDWFDQEHXVHGE\SHRSOHRI
all ages, sizes and capabilities. We recognize the need to design for a wide range of physical and mental abilities
and impairments. For details of GE’s Universal Design applications, including kitchen design ideas for people with
disabilities, check out our Website today. For the hearing impaired, please call 800.TDD.GEAC (800.833.4322).
In Canada, contact: Manager, Consumer Relations, Mabe Canada Inc.
Suite 310, 1 Factory Lane
Moncton, N.B. E1C 9M3
Extended Warranties
In the U.S.: GEAppliances.com
Purchase a GE extended warranty and learn about special discounts that are available while your warranty is still
in effect. You can purchase it on-line anytime, or call 1.888.261.2133 during normal business hours. GE Consumer
Home Services will still be there after your warranty expires.
Parts and Accessories
GEAppliances.com
In the U.S.: www.Hotpoint.com
Individuals qualified to service their own appliances can have parts or accessories sent directly to their homes (VISA,
MasterCard and Discover cards are accepted). Order on-line today, 24 hours every day or by phone at
1.800.661.1616 during normal business hours.
Instructions contained in this manual cover procedures to be performed by any user. Other servicing generally
should be referred to qualified service personnel. Caution must be exercised, since improper servicing may cause
unsafe operation.
Customers in Canada should consult the yellow pages for the nearest Mabe service center, or call 1.800.661.1616.
Contact Us
GEAppliances.com
In the U.S.: www.Hotpoint.com
If you are not satisfied with the service you receive from GE, contact us on our Website with all the details including
your phone number, or write to:
General Manager, Customer Relations
GE Appliances, Appliance Park
Louisville, KY 40225
In Canada: www.geappliances.ca, or write to: Director, Consumer Relations, Mabe Canada Inc.
Suite 310, 1 Factory Lane
Moncton, N.B. E1C 9M3
Register Your Appliance
GEAppliances.com
In the U.S.: www.Hotpoint.com
5HJLVWHU\RXUQHZDSSOLDQFHRQOLQH³DW\RXUFRQYHQLHQFH7LPHO\SURGXFWUHJLVWUDWLRQZLOODOORZIRU
enhanced communication and prompt service under the terms of your warranty, should the need arise.
You may also mail in the pre-printed registration card included in the packing material.
In Canada: www.geappliances.ca
Printed in the United States
Printed on Recycled Paper

advertisement

Was this manual useful for you? Yes No
Thank you for your participation!

* Your assessment is very important for improving the workof artificial intelligence, which forms the content of this project

Related manuals

advertisement