Bunn FPG-2 DBC Installation manual

Bunn FPG-2 DBC Installation manual
2012
PRODUCT
CATALOG
E9000.0000G
The Bunn-O-Matic® Corporation
A History of Innovation and Commitment
Understanding and responding to customer requirements has always been important to the
Bunn-O-Matic Corporation (BUNN®). Today, BUNN is a global partner you can count on
for profitable, reliable beverage equipment and outstanding post-purchase support wherever
customers are served.
Since 1957, BUNN has been at the forefront of beverage equipment innovation: inventing the
flat-bottom paper filter for commercial use, the pour-over coffee brewer, and the first commercial
iced tea brewer that uses fresh leaves versus instant mix. As customers entered the digital age,
BUNN also embraced sophisticated new technology to meet changing needs.
Today, we offer a complete product line of dispensed beverage equipment including coffee
brewers and grinders; single cup makers, liquid coffee dispensers, iced tea brewers; cappuccino,
granita, and juice machines; superautomatic espresso systems; precise temperature water
systems; water quality systems and paper filters.
Each product launch is driven by an ongoing commitment to delivering the highest possible
quality beverage in each cup, every time. With thousands of loyal commercial and home
product customers, the BUNN brand is synonymous with honesty, integrity, courtesy and total
value, all of which work together to uphold the company’s brand promise, A Partner You Can
Count On™.
The global headquarters are located in Springfield, Illinois, USA, where the company strives for
total customer satisfaction through superior equipment and unmatched service with support from
facilities in Iowa, the New York metro area, California, as well as in Mexico, Canada, United
Kingdom, Germany, China, Hong Kong, and Brazil.
1957 - First flat-bottom paper
filter for commercial use
1978 - The first fresh-brewed
ice tea brewer
1963 - The Pour-over
coffee brewer
1993 - First electronic
sensor frozen drink system
1988 - Precise termperature water system
2001 - Ground-breaking
BrewWISE®/Smart Funnel®
brewing system
1997 - Digital Brewer Control™ - introducdd industry
to pulse brew process
2010 - Tech-enabled, baristacrafted, single cup brewer
2005 - My Cafe®
single serve pod brewer
for tea and coffee
1
Single Serve Brewers
2
Air Infusion Brewer
8
Automatic Decanter
Brewers and Urns
15
Thermal Coffee
Brewers
42
Liquid Coffee High
Volume Systems
46
Iced Tea and Coffee
Brewers
63
Precise Temperature
Water Dispensers
65
Related Products
3
TABLE OF
CONTENTS
Pourover Brewers
23
Satellite Coffee
Brewers
34
Coffee Grinders
53
Hot Beverage Systems
72
39
Espresso Systems
57
Cold Beverage
Systems
61
Frozen Beverage
Systems
Servers ..........................................21,25-26,33
Iced Tea/Coffee Dispensers.......................51-52
Decanters and Warmers ................................ 66
Universal Airpot Racks ................................... 67
Stock Funnels ................................................ 68
Special Purpose Funnels ................................ 69
Drip Trays ................................................69-71
BUNNserve®
CATALOG ICON LEGEND
A BUNN Innovation
International models available
Detailed decsriptions are
available on pages 73-74.
Models listed as 120/208V or 120/240V must be connected to 208V or 240V
electrical service respectively. Please refer to the installation manual.
AGENCY SYMBOLS
UL
LISTED
UL Listed
Electrical Testing
Labs Sanitation
Electrical Testing
Labs Canada
Electrical Testing
Labs Safety
NSF International
Canadian Safety
UL Classified
Environmental &
Public Health
E9000.0000G 2/12 © 2004 Bunn-O-Matic Corporation
FEATURED
ITEMS
7
392®
Coffee Brewer
43
Liquid Coffee
Low Profile
56
iMIX-14
Multi-Beverage
50
ITCB High Volume
Tea and Coffee Brewer
64
Hot Water Dispenser
H5E Element
40
BUNN Espress®
Black and White 3 CTS
53
iMIX-3
Oatmeal
66
Glass Decanters
SINGLE
SERVE
My Café Pourover
My Café AP
My Café Automatic
My Café® Pod Brewers
Commercial-grade, single-cup system with the convenience of automatic pod disposal
MY CAFÉ AP
•Pod bin and drip tray can be modified for under-counter disposal of pods.
•Brews up to 16 ounces in less than a minute; Integrated cup booster allows for 5” or 8” cup.
•Control extraction utilizing pulse brew technology with BrewMETER®.
•Hot water button provides up to 10 ounces for cappuccino, cocoa and soups.
•Energy Saver Mode.
Ab
Ab
MY CAFÉ
•Poddrawerworkswithteaandcoffeepods,
––––––––– Accessories –––––––––
from 45 to 61 mm.
•Fastbrewcoffeeinabout30seconds;brewteainless
than one minute with button that provides steeping action.
•Brew4to12ounces(118-355mL)topreferredstrength
by adjusting the portion/volume control.
•Easytouseandmaintainwitharemovablewaterreservoir,
a drawer-style pod holder (2 included) and dishwasher
Brew Station and 1 Rack Assembly Rack Assembly
safe components.
Model
Product #
My Café AP
42300.0000
My Café AP
with Wrap
Volts
Amps
Watts
Brewing
Capacity
HxWxD
Shipping
Weight
Cord
Attached
120
11.9
1425
60-8 oz. cups
60-(237 mL)
15.8” x 9.7” x 16.4”
(40.1cm x 24.6cm x 41.7cm)
30 lbs.
(13.6 kg.)
Yes
12.5” x 8” x 10.5”
(31.7cm x 20.3cm x 26.7cm)
9.75 lbs.
(4.4 kg.)
Agencies
42300.0001
35400.0003
MCP
(Pourover)
35400.0004
(high altitude)
120
35400.0009
MCA
(Automatic)
Brew
Station
(with Standard
Header)
Rack
Assembly
35400.0010
(high altitude)
39501.0001
12
1440
60-8 oz. cups
60-(237 mL)
Yes
13.6” x 8” x 10.5”
(34.5cm x 20.3cm x 26.7cm)
20” x 26.2” x 16”
(50.8cm x 66.5cm x 40.6cm)
height dimension with graphic header
39502.0001
16” x 9.5” x 16”
(40.6cm x 24.1cm x 40.6cm)
11.35 lbs.
(5.1 kg.)
26 lbs.
(11.8 kg)
8 lbs.
(3.6 kg)
www.bunn.com
1
AIR
INFUSION
BREWER
click for videos
trifecta® Single Cup
Air Infusion™ Brewer
Tech-enabled, barista-crafted single cup brewer that heightens the quality of coffee and tea
Every coffee has a voice. With the trifecta, the barista creates an experience which unlocks the nuances
of that coffee. Using an Air Infusion single cup process, the trifecta brews so that each coffee’s unique
voice resonates.
trifecta BREWING PHASES
1. Wetting: The saturation of the coffee grounds can be controlled to get the percentage of water and
pause appropriate for that coffee.
2. Extraction: Air is injected into a pressurized chamber so that the grounds are agitated -- the result:
uniformity of extraction and a complex beverage that will be enjoyed by a coffee lover.
3. Hydrolysis: Air presses the beverage through a metal screen that filters
out coffee grounds while preserving coffee oils and aromatics for a
deep-bodied, unique coffee experience.
See trifecta grinder on page 38.
Visit www.trifectaexperience.com for more information.
2
Model
Product #
Volts
Amps
Watts
Brewing
Capacity
HxWxD
Weight
Cord
Attached
trifecta
41200.0000
120
11.45
13.75
cups
26.73” x 11.89” x 11.87”
(60.3cm x 30.2cm x 30.1cm)
41.7 lbs.
(13.4 kg)
Yes
www.bunn.com
Agencies
POUROVER
BREWER
VP17-1
A10
VP17-2 SS
VP17-2
Pourover Coffee Brewers
An integral part of any office coffee service program
•Requiresnoplumbing–completelyportable.Justpourcold
water in top and coffee brews immediately.
A10 MODEL
•Uses50oz.decanter.
•UseBUNNpaperfilters-ProductNo.20106.0000.
VPR MODEL
•Twoseparatelycontrolledwarmers.
•UseBUNNpaperfilters-ProductNo.20115.0000.
VP17
•Oneortwowarmers.
•UseBUNNpaperfilters-ProductNo.20115.0000.
VPR
Decanters sold separately, see page 66.
Model
Product #
VP17-1 SS
13300.0001
VP17-1 BLK
13300.0011
A10
(pourover)
21250.0000
(inc. glass decanter)
VP17-2 SS
13300.0002
VP17-2 BLK
13300.0012
HxWxD
17.8" x 8" x 17.7"
(45.2cm x 21.6cm x 44.96cm)
14.7” x 6.7” x 12.9”
(37.3cm x 17.0cm x 32.8cm)
18.9" x 8.5" x 17.8"
(48cm x 21.6cm x 45.2cm)
Weight
Finishes
23 lbs.
(10.5 kg)
Stainless
33200.0002
Watts
Brewing
Capacity
13.3
1600
3.9 gal.
(14.6 L)
9.5
1140
2.9 gal.
(11 L)
13.3
1600
3.9 gal.
(14.6 L)
21 lbs.
(9.6 kg)
14 lbs.
(6.4 kg)
24 lbs.
(10.9 kg)
33200.0015
(inc. 2 glass
decanters)
Amps
Black
Stainless
120
23 lbs.
(10.5 kg)
33200.0000
VPR-Black
Volts
20.7" x 16.2" x 8"
(52.6cm x 41.15cm x 20.3cm)
Black
24 lbs.
(10.9 kg)
13.1
1575
Cord
Attached
Agencies
UL
LISTED
UL
LISTED
Yes
3.9 gal.
(14.6 L)
(inc. 2 Easy Pour
decanters)
www.bunn.com
3
POUROVER
BREWER
VPS
VP17-3
VP17-3
Pourover Coffee Brewers
(VP17-3 only)
An integral part of any office coffee service program
•Requiresnoplumbing–completelyportable.Justpourcoldwaterintopandcoffeebrewsimmediately.
•Threeseparatelycontrolledwarmers.
•UseBUNNpaperfilters-ProductNo.20115.0000.
Decanters sold separately, see page 66.
4
Model
Product #
HxWxD
Weight
VPS-Black
04275.0031
19.8" x 23.5" x 8"
(50.1cm x 59.7cm x 20.3 cm)
26 lbs.
(11.8 kg)
VP17-3 SS
(3 lower)
13300.0003
VP17-3 BLK
(3 lower)
13300.0013
VP17-3 SS
(2 upper)
13300.0004
www.bunn.com
17.8" x 16.4" x 17.7"
(45.2cm x 41.7cm x 45cm)
18.9" x 8.5" x 17.7"
(48cm x 21.6cm x 45cm)
29 lbs.
(13.2 kg)
32 lbs.
(14.5 kg)
25 lbs.
(11.4 kg)
Volts
Amps
Watts
13.8
1660
120
13.3
1600
Capacity
Cord
Attached
3.9 gal.
(14.6 L)
Yes
Agencies
UL
LISTED
POUROVER
BREWER
VPR-TC
VPR-APS
Pourover Coffee Brewers
An integral part of any office coffee service program
VPR-APS
•Brews3.8gallons(14.4litres)ofperfectcoffeeperhour.
•Pouroverbrewerrequiresnoplumbing–completelyportable.Justpourcoldwaterinand
coffee brews immediately.
•Accommodates1.9to3litreairpots.
•Convenientairpotkeepscoffeehotforhours.
•Airpotsareeasilytransportedtoremotemeetingrooms,breakfastbars,etc.
•UseBUNNpaperfilters-ProductNo.20115.0000.
VPR-TC
•Brews3.8gallons(14.4litres)ofperfectcoffeeperhour.
•Pouroverbrewerrequiresnoplumbing–completelyportable.
Justpourcoldwaterinandcoffeebrewsimmediately.
•Accommodatesthermalcarafeupto8.5”(21.6cm)tall.
•UseBUNNpaperfilters-ProductNo.20115.0000.
Servers sold separately, see pages 21.
Model
Product #
VPR-APS
33200.0010
VPR-APS
(2.2L airpot
included)
33200.0014
VPR-TC
33200.0011
HxWxD
Weight
26.6" x 15.9" x 8"
(67.6cm x 40.4cm x 20.3cm)
23 lbs.
(10.4 kg)
21.3” x 15.9” x 8”
(54.1cm x 40.4cm x 20.3cm)
23 lbs.
(10.4 kg)
Volts
Amps
Watts
Capacity
Funnel
Type
Cord
Attached
120
11.5
1375
3.8 gal.
(14.4 L)
Black
Plastic
Yes
Agencies
UL
www.bunn.com
LISTED
5
POUROVER
BREWER
CW15 - APS
CW15 - TS
CW15-TC
Pourover Airpot and
Thermal Server Coffee Brewers
Brew directly into portable, vacuum-insulated servers that keep coffee at optimal flavor for hours
CW15-APS
•Brewsdirectlyinto1.9to2.5litreairpots.
•Easilytransportedtoremotemeetingrooms,breakfastbars,etc.
•UseBUNNpaperfilters-ProductNo.20115.0000.
CW15-TS
•Easilytransportedtoremotemeetingrooms,breakfastbars,etc.
•Serverstandaccommodatesupto4”(10.16cm)cup.
•UseBUNNpaperfilters-ProductNo.20115.0000.
CW15-TC
•Brews3.8gallons(14.4litres)perhour.
•Acceptsthermalcarafeupto8.5”tall(21.6cm).
•Useinquickturnenvironmentwherehighqualitycoffeeiscontinuouslyrefreshed.
•Modelsarespacesaving9”wide(22.9cm).
•UseBUNNpaperfilters-ProductNo.20115.0000.
Servers sold separately, see pages 21.
Model
Product #
23001.0000
CW15-APS
23001.0062
CW15-TS
CW15-TC
6
HxWxD
Weight
23.6" x 9" x 18.5"
(59.9cm x 22.9cm x 47cm)
28 lbs.
(12.7 kg)
23000.0000
27.6" x 9" x 18.5"
(70.1cm x 22.9cm x 47cm)
27 lbs.
(12.3 kg)
23001.0040
17.9" x 9" x 18.5"
(45.5cm x 22.9cm x 55.4cm)
28 lbs.
(12.7 kg)
www.bunn.com
Volts
Amps
Watts
Capacity
Funnel
Type
Cord
Attached
Agencies
Black
Plastic
120
11.4
1370
3.9 gal.
(14.6 L)
Gourmet
Funnel
Black
Plastic
UL
Yes
LISTED
POUROVER
BREWER
392® Coffee Brewers
Contemporary designed pourover system brews Gold Cup Standard coffee in about 3 minutes
•Spacesaving8.3”(21.1cm)wide.
•Pouroverbrewerrequiresnoplumbing–completelyportable.
•Allstainlesssteeltankconstruction.
•Twoseparatelycontrolledwarmers.
•Readylight.
•SplashGard®funneldeflectshotliquidsawayfromthehand.
•Includespaperfilterpackandpour-inpitcher.
Decanters sold separately, see page 66.
Model
Product #
Volts
Amps
Watts
Brewing
Capacity
Funnel
Type
HxWxD
Weight
Cord
Attached
392
37800.0105
120
13
1560
3.9 gal.
(14.7 L/hr)
Plastic
19.2" x 8.3" x 18.2"
(48.9cm x 21.1cm x 46.2cm)
24 lbs.
(10.9 kg)
Yes
Agencies
UL
www.bunn.com
LISTED
7
AUTOMATIC
DECANTER COFFEE BREWERS
AND URNS
AXIOMP-DV-3
AXIOM-DV-3
AXIOM-15-3
AXIOM® Coffee Brewers
Medium volume brewing solution featuring Digital Brewer Control, precise extraction control
•Large200oz..(5.9litres)tankprovidesback-to-backbrewingcapacity.
•Dualvoltageavailableonsomemodels.Canoperateat120V/15ampor120/208-240V/20amp.
•BrewLOGIC® technology calculates flow rate and adjusts brew time to maintain consistent pot levels
even in high lime areas.
•BrewWIZARD® technology simplifies brewer programming.
•Digitaltemperaturecontrolandaccuracy.
•Electronicdiagnosticsandbuiltintankdrainmakeserviceeasier.
•Automaticwarmershut-off.
•EnergySaverMode.
•UseBUNNpaperfilters–ProductNo.20115.0000.
Dual voltage available. Can operate at
Decanters sold separately, see page 66.
120V/15 amp or 120/208-240V/20 amp.
Ab
Ab
Ab
Model
Product #
Volts
Amps
Watts
Brewing
Capacity
AXIOM-15-3
38700.0000
120
15
1800
4.2 gal.
(15.9 L/hr)
AXIOM-35-3
38700.0001 120/240
17.5
3850
7.5 gal.
(28.4 L/hr)
120
AXIOM-DV-3
15
1800
38700.0008 120/208
15.5
2980
120/240
17.5
3850
120
15
1800
120/240
17.5
3850
120
15
1800
4.2 gal.
(15.9 L/hr)
17.5
3850
7.5 gal.
(28.4 L)
15
1800
4.2 gal.
(15.9 L)
38700.0009 120/208
15.5
2980
120/240
17.5
3850
38700.0003 120/240
120
AXIOM-DV-3
Lower Warmers
8
www.bunn.com
Cord
Attached
Agencies
No
4.2 gal.
(15.9 L)
2980
AXIOM-35-3
Lower Warmers
Weight
18.9" x 8.5" x 17.7"
(49cm x 21.6cm x 44.9cm)
30 lbs.
(13.6 kg)
21” x 8.5” x 17.7”
(53.3cm x 21.6cm x 44.9cm)
32 lbs.
(14.5 kg)
16.8" x 16.5" x 17.7"
(42.7cm x 41.9cm x 45cm )
31 lbs.
(14.1 kg)
18.9” x 8.5” x 17.7”
(48cm x 21.6cm x 44.9cm)
32 lbs.
(14.5 kg)
7.5 gal.
(28.4 L)
15.5
38700.0002
HxWxD
Yes
4.2 gal.
(15.9 L)
AXIOMP-3-DV
38700.0023 120/208
Pourover Feature
AXIOM-15-3
Lower Warmers
Funnel
Type
7.5 gal.
(28.4 L)
7.5 gal.
(28.4 L)
Yes
Plastic
No
Yes
UL
LISTED
AUTOMATIC
DECANTER COFFEE BREWERS
AND URNS
CWTF
Decanter Coffee Brewers
(CWTF only)
Medium volume brewing solution with simple switch controls
•CWTFmodelsfeaturehotwaterfaucetandpouroverbackuponallmodels.
•UseBUNNpaperfilters–ProductNo.20115.0000.
Decanters sold separately, see page 66.
Model
Product #
CWTF15
12950.0211
(1U, 1L)
CWT15
(no faucet)
12950.0356
(2U, 1L)
CWT20
(no faucet)
CWT35
(no faucet)
CWTF15-3
CWTF20-3
CWTF35-3
CWTF-DV
Volts
Brewing
Capacity
Amps
Watts
13
1570
13.9
1670
12950.0291
(2U, 1L)
17.9
2150
5.3 gal.
(19.9 L)
12950.0292
120/208-240
(2U, 1L)
17.1
3850
7.5 gal.
(28.4 L)
13.9
1670
3.9 gal.
(14.6 L)
120
12950.0213
(2U, 1L)
12950.0217
(2U, 1L)
120
12950.0283
(2U, 1L)
12950.0253
(2U, 1L)
12950.0261
(2U, 1L)
12950.0410
(2U, 1L)
17.9
3.9 gal.
(14.6 L)
2150
5.3 gal.
(19.9 L)
120/240
17.1
3850
7.5 gal.
(28.4 L)
120
13.9
1670
3.9 gal.
(14.6 L)
120/208
13.9
2640
6.7 gal.
(25.3 L)
120/240
15.6
3400
7.5 gal.
(28.4 L)
Funnel
Type
HxWxD
32.5 lbs.
(14.5 kg)
Plastic
30 lbs.
(13.6 kg)
Stainless
33 lbs.
(14.97 kg)
Plastic
Stainless
Plastic
Weight
18.9" x 8.5" x 17.8"
(48cm x 21.6cm x 45.2cm)
34 lbs.
(15.4 kg)
Agencies
Yes
No
Yes
UL
31 lbs.
(14.1 kg)
LISTED
30 lbs.
(13.6 kg)
32 lbs.
(14.5 kg)
Stainless
Cord
Attached
No
35 lbs.
(15.9 kg)
www.bunn.com
9
AUTOMATIC
DECANTER COFFEE BREWERS
AND URNS
CWTF
Decanter Coffee Brewers
A10A
(CWTF only)
Medium volume brewing solution with simple switch controls
•CWTFmodelsfeaturepouroverbackuponallmodels.
•UseBUNNpaperfilters–ProductNo.20115.0000.
•Lowprofileforundercabinetplacement.
A10A MODEL
•Uses50oz.decanter.
•Automaticwithpouroverfeature.
•UseBUNNpaperfilters-ProductNo.20106.0000.
Decanters sold separately, see page 66.
Model
CWTF15
CWTF15
(left warmers)
CWTF35
CWT15-3
(no faucet)
Product #
Volts
12950.0293
(1L)
12950.0298
(3L)
120/208240
12.3
1470
13.9
1670
17.1
3850
Brewing
Capacity
3.9 gal.
(14.6 L)
Plastic
7.5 gal.
(28.4 L)
Stainless
(3L)
(3L)
12950.0216
13.9
1670
120
3.9 gal.
(14.6 L)
CWTF35-3
12950.0232
17.9
(3L)
12950.0252
(3L)
120/240
16
120
CWTF-DV
A10A
(automatic)
10
HxWxD
Weight
16.8" x 8.5" x 17.8"
(42.7cm x 21.6cm x 45.2cm)
27 lbs.
(12.2 kg)
35 lbs.
(15.9 kg)
39 lbs.
(17.7 kg)
12950.0409
(3L)
21250.0004
(inc. glass
decanter)
www.bunn.com
2150
5.3 gal.
(19.9 L)
3850
7.5 gal.
(28.4 L)
1670
3.9 gal.
(14.6 L)
2640
6.7 gal.
(25.3 L)
13.9
120/208
120/240
15.6
2400
7.5 gal.
(28.4 L)
120
9.5
1140
2.9 gal.
(11 L)
Cord
Attached
35 lbs.
(15.9 kg)
17" x 16.5" x 17.7"
(43.2cm x 41.9cm x 45.2cm)
Yes
No
Yes
UL
36 lbs.
(16.4 kg)
35 lbs.
(15.9 kg)
Plastic
No
39 lbs.
(17.7 kg)
Stainless
Black
Agencies
32 lbs.
(14.5 kg)
Plastic
Stainless
(3L)
CWTF20-3
Funnel
Type
12950.0112
12950.0212
CWTF15-3
Watts
120
(3L)
12950.0381
Amps
14.7” x 6.7” x 12.9”
(37.3cm x 17.0cm x 32.8cm)
16 lbs.
(7.3 kg)
Yes
LISTED
AUTOMATIC
DECANTER COFFEE BREWERS
AND URNS
CWTF Twin
AXIOM Twin
Twin Decanter and AXIOM®
Coffee Brewers
CWTF
•Twinbrewheadsystems.
•Brews15gallons(56.8litres)ofperfectcoffeeperhour.
•Fourorsixindividuallycontrolled warmingstations.
•Pouroverfeatureonbothsides.
•UseBUNNpaperfilters-ProductNo.20115.0000.
AXIOM
•Twinbrewheadsystems.
•Brews15gallons(56.8litres)ofperfectcoffeeperhour.
•Sixindividuallycontrolledwarmers.
•Forhighlimeareas,BrewLOGIC® technology calculates flow rate and adjusts brew time to maintain
consistent pot levels.
Ab
•BrewWIZARD technology simplifies brewer programming.
®
Ab
•Electronicdiagnosticsandbuilt-intankdrainmakeserviceeasier.
•UseBUNNpaperfilters–ProductNo.20115.0000.
Decanters sold separately, see page 66.
Model
Product #
CWTF
2/2 Twin
23400.0001
CWTF
4/2 Twin
23400.0011
CWTF
0/6 Twin
23400.0020
AXIOM
4/2 Twin
38700.0014
AXIOM
0/6 Twin
38700.0015
Volts
120/240
120/208-240
Amps
Watts
27.7
6650
28.5
6850
28.5
6850
27.9
6700
Legs
4” satin
nickel legs
4”
black legs
Brewing
Capacity
15 gal.
(56.8 L/hr)
Cord
Agencies
Attached
HxWxD
Weight
19.3" x 16.5" x 19.8"
(49cm x 41.9cm x 50.3cm)
56 lbs.
(25.4 kg)
20.54" x 30.75" x 20.64"
(52.17cm x 78.11cm x 50.43cm)
74 lbs.
(33.6 kg)
19.1” x 16.4” x 17.7”
(48.5cm x 41.7cm x 44.9cm)
61 lbs.
(27.7 kg)
20.5” x 30.3” x 17.7”
(52.1cm x 77cm x 45cm )
74 lbs.
(33.6 kg)
UL
LISTED
No
www.bunn.com
11
AUTOMATIC
DECANTER COFFEE BREWERS
AND URNS
OL
OT
Automatic Brewers
OT/OL
VLPF
•Twoseparatelycontrolledwarmers.
•Designedtofunctionwellinloworunevenwaterpressuresituation.(OL models)
•OLmodelscanalsobeoperatedasapouroverunit.
•Faucetkitavailable.
•UseBUNNpaperfilters-ProductNo.20115.0000.
VLPF
•Twoindividuallycontrolledwarmers.
•UseBUNNpaperfilters-ProductNo.20115.0000.
Decanters sold separately, see page 66.
Model
Product #
Volts
Amps
Watts
Brewing
Capacity
OL 20
20820.0001
120
17
2050
6 gal.
(22.7 L)
3750
7.5 gal.
(28.4 L)
1570
4.2 gal.
(15.7 L)
17.4
2090
5.3 gal.
(19.9 L)
13.3
1600
3.9 gal.
(14.6 L)
OL 35
OT 15
20820.0002
120/240
20830.0000
15.6
13
120
12
OT 20
20830.0001
VLPF
07400.0005
www.bunn.com
120
HxWxD
Weight
Cord
Attached
23.5" x 12" x 18.5"
(59.7cm x 30.5cm x 47cm)
34 lbs.
(15.5 kg)
No
22.4" x 12" x 18.3"
(56.9cm x 30.5cm x 46.5cm)
17.4" x 23.5" x 13.1"
(44.2cm x 59.7cm x 33.3cm)
Agencies
UL
32.7 lbs.
(14.8 kg)
Yes
32.3 lbs.
(14.7 kg)
No
26.3 lbs.
(11.9 kg)
Yes
LISTED
AUTOMATIC
DECANTER COFFEE BREWERS
AND URNS
RT
RL
CRTF
Decanter Coffee Brewers
(RL only)
•Fiveseparatelycontrolledwarmers.
•Allstainlesssteel construction.
•Modelsavailablewithfaucet.Faucetkitsavailableforexistingmodels.
•Designedto functionwellinlowwaterpressuresituations,theRLmodelcanalsobeoperatedasa
pourover unit.
•CRTFmodelhashotwaterfaucetandpouroverfeature.
•UseBUNNpaperfilters-ProductNo.20115.0000.
Decanters sold separately, see page 66.
Model
Product #
RT
20835.0000
RTF
(w/faucet)
20835.0004
RL
20825.0000
CRTF5-35
13250.0023
CRTF5-35
13250.0025
HxWxD
21.2" x 24" x 18.5"
(53.8cm x 61cm x 47cm)
23.5" x 24" x 18.5"
(59.7cm x 61cm x 47cm)
17.1" x 24.5" x 18.2"
(43.4cm x 62.2cm x 46.2cm)
Weight
Volts
Amps
Watts
Funnel
Type
Brewing
Capacity
Cord
Attached
7.5 gal.
(28.4 L)
No
Agencies
42 lbs.
(19.1 kg)
46 lbs.
(20.9 kg)
44 lbs.
(20.0 kg)
Stainless
120/240
16.9
4050
48 lbs.
(21.8 kg)
Plastic
48 lbs.
(21.8 kg)
Stainless
UL
www.bunn.com
LISTED
13
AUTOMATIC
DECANTER COFFEE BREWERS
AND URNS
SRU
U3
Coffee Urns
3 GALLON URN
•Largewatertankholdsover10gallons.
•Drawoffhotwaterduringbrewingcyclewithoutaffectingdeliveryofcoffee.
•Brewsfullorhalfbatches.
•Topmountedcomponentseaseservice.
•UseBUNNpaperfilters-ProductNo.20109.0000.
TWIN 3 GALLON URN
•Uniquedesignassuresextremelylowevaporationlosstomaintainthebrewatitsflavorfulpeak.
•Largewatertankholdsover20gallons.
•UseBUNNpaperfilters-ProductNo.20109.0000.
Model
Product #
Volts
Amps
06325.0001
120/208
19.4
06325.0002
120/240
16.8
SRU
U3
20500.0000
(Single Serve)
14
120/208
Watts
Capacity
HxWxD
4025
11.4 gal.
(43.4 L)
33.5" x 14" x 24.6"
(85.1cm x 35.6cm x 62.5cm)
5825
16.3 gal.
(61.7 L)
6725
18.8 gal.
(71.2 L)
28
20500.0001
www.bunn.com
120/240
32.4" x 34.5" x 21"
(82.3cm x 87.6cm x 53.3cm)
Weight
Cord
Attached
Agencies
73 lbs.
(33.1 kg)
75 lbs.
(34.0 kg)
103 lbs.
(46.8 kg)
No
UL
LISTED
THERMAL
COFFEE BREWERS
ICB-DV
ICB-Twin
Infusion Series® Coffee Brewers
Space-saving brewer yields a variety of flavor profiles with Digital Brewer Control and precise
extraction control
•Threebrewbuttonsallowfor3separatebrewingprofiles.Twoprogrammablebatchswitchesforfulland
half batches.
•Brewsinto2.5to3.8litreairpotsand
1 and 1.5 gallon (3.8 and 5.7 L) baseless ThermoFresh® servers.
•LargesprayheadandBrewWISE® intelligence.
•EnergySaverMode.
Ab
Ab
•AlphanumericdisplaycommunicatesinEnglishandSpanish.DisplaycapableofshowingEnglishor
metric measurements.
•CompatiblewithBUNNlink®.
Ab
ICB-DV
•Brews5.1to11.9gallons(19.3to45litres)ofperfectcoffeeperhour.
•Large3-gallon(11.36litre)tankprovidesback-to-backbrewingcapacityat208-240Vapplications.
•Dualvoltageadaptable.Canoperateat120V/15ampor208-240V/20amp.
•Includesoverlaykitsforcustomizationofbrewerinterface.
•UseBUNNpaperfilters-ProductNo.20138.0000.
ICB-TWIN
•Brewsupto18.9gallons(71.5litres)ofperfectcoffee perhour.
•Large5.6gallon(21.2litre)tankprovidesback-to-backbrewingcapacity.
•UseBUNNpaperfilters-ProductNo.20138.0000.
Servers sold separately, see pages 21, 25, and 26.
Model
ICB-DV
ICB-DV
(Black)
ICB Twin
ICB Twin
(Black)
Product #
36600.0000
Volts
Amps
Watts
Brewing
Capacity
120
14
1700
5.1 gal.
(19.3 L)
120/208
13.8
2900
8.9 gal.
(33.7 L)
120/240
16.8
4050
11.9 gal.
(45 L)
36600.0004
Same as 36600.0000
37600.0000
120/240
25
37600.0002
120/208
28
37600.0004
120/240
25
6000
18.9 gal.
(71.5 L)
Funnel
Type
HxWxD
Weight
26.01” x 10.19” x 22.42”
(66.1cm x 25.9cm x 57cm)
47.5 lbs.
(21.5 kg)
Smart
Funnel
Cord
Attached
Yes
26.2" x 20.0" x 22.4"
(66.5cm x 50.8cm x 56.9cm)
Agencies
UL
LISTED
77 lbs.
(34.9 kg)
www.bunn.com
15
THERMAL
COFFEE BREWERS
ICB-DV Tall
ICB-Twin Tall
Infusion Series® Coffee Brewers Tall
Space-saving brewer yields a variety of flavor profiles with Digital Brewer Control and precise
extraction control
•Designedtobrewinto1gallonand1.5gallon(3.8and5.7litre)ThermoFresh® servers with base for
easy transport of coffee to other locations.
•EasyPulseinterfaceallowsautomaticprogrammingofpulseroutine.
•BrewWISE® intelligence.
•EnergySaverMode.
Ab
Ab
Ab
•DigitaldisplayinEnglish/Spanishforeasierprogrammingandcontrol.Advertisingmessagesand
machine status also displayed. Display capable of showing English or Metric measurements.
•CompatiblewithBUNNlink®.
Ab
ICB-DV TALL
•Brews5.1to11.9gallons(19.3to45litres)ofperfectcoffeeperhour.
•Large3-gallon(11.36litre)tankprovidesback-to-backbrewingcapacityat208-240Vapplications.
•Dualvoltageadaptable.Canoperate at120V/15ampor208-240V/20amp.
•Includesoverlaykitsforcustomizationofbrewerinterface.
•UseBUNNpaperfilters-ProductNo.20138.0000.
ICB-TWIN TALL
•Brewsupto18.9gallons(71.5litres)ofperfectcoffeeperhour.
•Large5.6gallon(21.2litre)tankprovidesback-to-backbrewingcapacity
•UseBUNNpaperfilters-ProductNo.20138.0000.
Servers sold separately, see pages 25-26.
Model
ICB-DV Tall
Product #
36600.0005
Volts
Amps
Watts
Brewing
Capacity
120
14
1700
5.1 gal.
(19.3 L)
120/208
13.8
2900
8.9 gal.
(33.7 L)
16.8
4050
11.9 gal.
(45 L)
25
6000
18.9 gal.
(71.5 L)
120/240
ICB Twin Tall
16
www.bunn.com
37600.0005
Funnel
Type
Smart
Funnel
HxWxD
Weight
34.4” x 10.1” x 19.9”
(87.4cm x 25.7cm x 50.5cm)
51 lbs.
(23.1 kg)
34.4” x 22.6” x 20.1”
(87.4cm x 57.4cm x 51.1cm)
85.5 lbs.
(38.8 kg)
Cord
Attached
Yes
Agencies
UL
LISTED
THERMAL
COFFEE BREWERS
AXIOM-DV-APS
AXIOM Twin APS
AXIOM® Airpot Brewers
(Single airpot brewers only)
Medium volume brewing solution featuring Digital Brewer Control, precise extraction control
and a variety of portable servers
•BrewWIZARD® technology simplifies brewer programming.
Ab
•Brewsdirectlyinto1.9to3literairpots.
•Convenientairpotskeepcoffeehotforhours.
•Electronicdiagnosticsandbuiltintankdrainforeaseofservice.
•Hotwaterfaucet.
•EnergySaverMode.
Ab
AXIOM-DV-APS
•Easilyconvertiblebyflippingaswitchto:
- 120 volt, 12.5 amp
- 120/208 volt, 13 amp
- 120/240 volt, 15 amp
•Brews4.2to7.5gallons(15.7to28.4litres)ofperfectcoffeeperhour.
•UseBUNNpaperfilters-ProductNo.20115.0000.
AXIOM-TWIN-APS
•Brews15gallons(56.8litres)ofperfectcoffeeperhour.
•Twinbrewheadsystem.
•UseBUNNpaperfilters-ProductNo.20115.0000.
Airpots sold separately, see page 21.
Model
AXIOM-DV-APS
AXIOM Twin APS
Product #
38700.0010
38700.0013
Volts
Amps
Watts
Brewing
Capacity
120
12.5
1500
4.2 gal.
(15.9 L)
120/208
13
2680
7.5 gal.
(28.4 L)
120/240
15
3550
7.5 gal.
(28.4 L)
120/240
26
6100
15 gal.
(56.8 L)
Funnel
Type
HxWxD
Weight
Plastic
Funnel
23.6” x 9” x 18.5”
(59.9cm x 22.9cm x 47cm)
36 lbs.
(16.3 kg)
Cord
Attached
Yes
Stainless
23.5” x 16” x 17.7”
(59.7cm x 40.6cm x 44.9cm)
Agencies
UL
LISTED
64 lbs.
(29 kg)
www.bunn.com
17
THERMAL
COFFEE BREWERS
WAVE 15-APS
legs extended to accommodate
2.5L push-button airpot
WAVE 15-S-APS (Silver)
SmartWAVE® Airpot Brewers
Low profile brewer featuring SmartWAVE technology, Digital Brewer Control,
and flexible server options
•Brews3.9gallons(14.8litres)ofperfect coffeeperhour.
•Brewinto1.9Lthermalcarafebrewerutilizingtheslide-outboostertray.
•Adjustablelegstoaccommodateupto3.0Lleveractionand2.5LpushbuttonBUNN airpots
(refer to usage table).
•SmartWAVE® technology increases turbulence in the brew funnel.
•Convenientairpotskeepcoffeehotandfreshforhoursandareeasilytransportedtoremoteservingareas.
•Hotwaterfaucet.
•EnergySaverMode.
Ab
Ab
STANDARD MODEL
•Four-digitLEDread-outforsimpleprogramming.
•UtilizethesameLEDread-outforbrewerstatus(Ready, Heating, Brewing).
•13pulsebrewroutineselectionsadjuststrengthprofileinconjunctionwiththeBrewMETER®.
•Largefunneltoaccommodateawiderangeofcoffeesanda17-holesprayheadtomaximize
turbulence and wetting.
•UseBUNNpaperfilters-Product
No. 20115.0000. Gourmet
funnel requires BUNN paper filter
Utilizing thermal
1.9L deluxe
20157.0000.
36029.0001
16.9”
Ab
carafe tray
SILVER MODEL
•Analogswitchesaccompaniedby
red/green LED for programming.
•Red/greenLEDprovidebrewer
status (Ready, Heating, Brewing).
•Choiceofthreepulsebrewroutines
to adjust your flavor profile.
•UseBUNNpaperfilters-Product
No. 20115.0000.
Airpots and thermal carafes sold
separately, see page 21.
1.9L economy
thermal carafe
16.9”
N/A
LP feature (lowest)
39430.0000
1.9L thermal pitcher
16.9”
N/A
LP feature (lowest)
32125.0000
2.5L lever-action
airpot
16.9”
N/A
Extend legs
32130.0000
3.0L lever-action
airpot
17.5”
.6”
Extend legs
28696.0002
2.2L pushbutton airpot
18”
1”
Extend legs
13041.0001
2.5L pushbutton airpot
18.5”
1.5”
Extend legs
23300.0010
2.5L thermal
server
18.5”
1.5”
39900.0005
Black
Plastic
39900.0013
Gourmet
WAVE 15-S-APS
39900.0006
WAVE-APS
39900.0008
www.bunn.com
39900.0009
16.9” x 8.7” x 17.1”
(43cm x 22.2cm x 43.5cm)
Weight
Funnel
Type
WAVE 15-APS
WAVE-S-APS
18
40163.0000
Product #
(Specialty)
N/A
Utilizing thermal
carafe tray
Model
WAVE 15-APS
HxWxD
thermal carafe
Volts
Amps
Watts
Brewing
Capacity
Cord
Attached
120
11.3
1350
3.9 gal.
(14.8 L)
Yes
120/240
9.4
2250
6.4 gal
(24.2 L)
No
24.2 lbs.
(11 kg)
Black
Plastic
Agencies
THERMAL
COFFEE BREWERS
CWTF APS-DV
CWTF APS
CWTF Twin APS
Airpot Brewers
(Single airpot brewers only)
Low profile brewer with simple switch controls and flexible server options
•Brewsdirectlyinto1.9to3litreairpots.
•Hotwaterfaucetwithpouroverfeature.
•UseBUNNpaperfilters-ProductNo.20115.0000.GourmetfunnelrequiresBUNNpaperfilter20157.0000.
CWTF-DV
•Voltageconvertseasilybyflippingaswitch.
Airpots sold separately, see page 21.
Model
Product #
Funnel
Type
Volts
Amps
120
Watts
Brewing
Capacity
1370
3.9 gal.
(14.6 L)
2340
6.7 gal.
(25.3 L)
3100
7.5 gal.
(28.4 L)
1370
3.9 gal.
(14.6 L)
2340
6.7 gal.
(25.3 L)
3100
7.5 gal.
(28.4 L)
11.4
23001.0058 Black Plastic 120/208
120/240
CWTF
DV-APS
13.1
120
Black Plastic
23001.0059 and Stainless 120/208
Steel
11.4
120/240
13.1
HxWxD
23001.0062
Pourover
23.6" x 9" x 18.5"
(59.9cm x 22.9cm x 47cm)
CWTF15-APS
11.4
1370
120
Gourmet
Funnel
23001.0007
15.4
23001.0008
23001.0052
23001.0023
23400.0041
CWTF Twin APS
23400.0046
29 lbs.
(13.2 kg)
3.8 gal.
(14.4 L)
38 lbs.
(17.3 kg)
23.6" x 9" x 18.5"
(59.9cm x 22.9cm x 47cm)
1850
Black Plastic
CWTF35-APS
5.1 gal.
(19.3 L)
120/
208-240
UL
LISTED
Yes
33 lbs.
(15.0 kg)
37 lbs.
(16.8 kg)
32 lbs.
(14.6 kg)
33 lbs.
(15.0 kg)
15
Gourmet
Funnel
No
28 lbs.
(12.7 kg)
23001.0006 Black Plastic
23001.0051
CWTF20-APS
Stainless
Steel
Agencies
37 lbs.
(16.7 kg)
Gourmet
Funnel
23001.0003 Black Plastic
23001.0017
Cord
Attached
36 lbs.
(16.3 kg)
23001.0000
Black Plastic
Pourover
CW15-APS
(no faucet)
Weight
3550
7.5 gal.
(28.4 L)
6250
15 gal.
(56.8 L)
15
37 lbs.
(16.8 kg)
No
Stainless
Steel
Gourmet
Funnel
120/240
26
23.5" x 16" x 19.7"
(59.7cm x 40.6cm x 50.0cm)
60 lbs.
(27.3 kg)
www.bunn.com
19
THERMAL
COFFEE BREWERS
AXIOM-DV-TC
CWTF15-TC
CWTF Twin-TC
Thermal Carafe Coffee Brewers
(CWTF-TCa only)
AXIOM-DV-TC
•Easilyconvertiblebyflippingaswitchto:
- 120 volt, 12.5 amp
- 120/208 volt, 13 amp
- 120/240 volt, 15 amp
•Brews4.2to7.5gallons(15.7to28.4litres)ofperfectcoffeeperhour.
•BrewWIZARD® technology simplifies brewer programming.
Ab
CWTF-TC
•Acceptsthermalcarafeupto8.5”tall(21.6cm).
•Useinquick-turnenvironmentwherehighqualitycoffeeiscontinuouslyrefreshed.
•UseBUNNpaperfilters-ProductNo.20115.0000.
CWTF TWIN-TC BREWER
•Acceptsthermalcarafeupto8.5”(21.6cm)tall.
•Useinquick-turnenvironmentwherehighqualitycoffeeiscontinuouslyrefreshed.
•Pouroverfeature.
•UseBUNNpaperfilters-ProductNo.20115.0000.
Thermal carafes sold separately, see page 21.
Model
AXIOM-DV-TC
38700.0011
Volts
Amps
Watts
120
12.5
1500
120/208
13
2680
120/240
15
3550
120
11.4
1370
CW15-TC
(no faucet)
23001.0040
CWTF15-TC
12950.0360
CWTF20-TC
12950.0380
120
15.4
1850
CWTF35-TC
12950.0379
120/
208-240
15
3550
CWTF Twin-TC
23400.0047
120/240
26
6250
120
11.4
1370
120/208
11.4
2340
120/240
13.1
3100
CWTF-TC DV
20
Product #
Pourover
23001.0069
www.bunn.com
Brewing
Capacity
Funnel
Type
HxWxD
4.2 gal.
(15.9 L)
7.5 gal.
(28.4 L)
7.5 gal.
(28.4 L)
3.9 gal.
(14.6 L)
5.3 gal.
(19.9 L)
7.5 gal.
(28.4 L)
15 gal.
(56.8 L)
3.9 gal.
(14.6 L)
6.7 gal.
(25.3 L)
7.5 gal.
(28.4 L)
Weight
Cord
Attached
Agencies
30 lbs.
(13.6 kg)
Yes
Black Plastic
SST
Black Plastic
17.2" x 16" x 22.5"
(43.7cm x 41cm x 57.2cm)
28 lbs.
(12.7 kg)
32 lbs.
(14.5 kg)
31 lbs.
(14.1 kg)
32 lbs.
(14.5 kg)
64 lbs.
(29.3 kg)
17.9" x 9" x 18.5"
(45.5cm x 22.9cm x 55.4cm)
29 lbs.
(13.2 kg)
17.9” x 9” x 18.5”
(45.5cm x 22.9cm x 55.4cm)
UL
No
LISTED
THERMAL
COFFEE BREWERS
Push-Button
Airpot
Lever-Action
Airpot
Vacuum
Pitcher
Thermal
Carafe
Economy
Thermal Carafe
Airpots and Thermal Carafes
Brew-through pump or lids allows direct brewing
PUSH-BUTTON AIRPOT
•Glassinsulation.
LEVER-ACTION AIRPOT
•Stainlesssteellining.
THERMAL CARAFE
•Holds1.9litresor64ounces.
•Unbreakablestainlesssteelinteriorandexterior.
•Superiorvacuuminsulation.
•FitsonBUNNThermalCarafeandTwinThermalCarafebrewers.
See page 67 for universal airpot racks and coffee-isers.
Model
2.2 litre
Push-Button Airpot
2.5 litre
Push-Button Airpot
2.5 litre
Lever-Action Airpot
3.0 litre
Lever-Action Airpot
3.8 litre
Lever-Action Airpot
1.9 litre
Thermal Carafe
(Black Lid)
1.9 litre
Thermal Carafe
(Orange Lid)
1.9 litre Economy Thermal
Carafe
(Black Lid)
Product #
Liner
28696.0002
28696.0000
13041.0001
Quantity
single unit
Glass
6 units/ case
6 units/ case
32125.0000
single unit
32125.0100
6 units/ case
32130.0000
single unit
32130.0100
6 units/ case
36725.0000
single unit
36725.0100
6 units/ case
36029.0000
2.2 litres
(74 oz.)
16.4" x 6.1" x 7.9"
(42cm x 16cm x 20cm)
2.5 litres
(84 oz..)
36252.0000
12 units/ case
40163.0000
single unit
40163.0100
12 units/ case
1.9 litre Economy Thermal
Carafe
(Orange Lid)
40163.0001
single unit
40163.0101
12 units/ case
1.9 litre Vacuum Pitcher
(Black Lid)
39430.0000
Stainless
Steel
single unit
6 units/case
Agencies
4.5 lbs. (2.04 kg)
24 lbs. (10.9 kg)
14.6" x 6.3" x 9"
(37cm x 16cm x 23cm)
25 lbs. (11.3 kg)
5.3 lbs. (2.4 kg)
32 lbs. (14.6 kg)
3.0 litres
(102 oz..)
15.5" x 6.3" x 9"
(39.4cm x 16cm x 23cm)
3.8 litres
(128 oz.)
17.6” x 6.3” x 9”
(44.7cm x 16cm x 23cm)
5.8 lbs. (2.6 kg)
35 lbs. (15.9 kg)
7 lbs. (3.2 kg)
41 lbs. (18.6 kg)
3.0 lbs. (1.36 kg)
12 units/ case
single unit
Weight
5 lbs. (2.3 kg)
single unit
Stainless
Steel
36252.0001
39430.0100
HxWxD
single unit
13041.0101
36029.0001
Capacity
8" x 6.4" x 8.2"
(20.3cm x 16.3cm x 21cm)
34 lbs. (15.4 kg)
3.0 lbs. (1.36 kg)
34 lbs. (15.4 kg)
2.5 lbs. (1.1 kg)
1.9 litres
(64 oz..)
7.1” x 6.6” x 8.64”
(18cm x 16.8cm x 21.9cm)
30 lbs. (13.6 kg)
2.5 lbs. (1.1 kg)
30 lbs. (13.6 kg)
11.3” x 6.5” x 5.5”
(28.7cm x 16.5cm x 14cm)
3.0 lbs. (1.36 kg)
17 lbs. (7.71 kg)
www.bunn.com
21
THERMAL
COFFEE BREWERS
CWTF-TS
TSR-1 and TSR-2
TS Booster
(shown with TS servers no base)
TSR
(Raised)
Thermal Coffee Brewers,
Servers and Stands
•Pouroverfeatureincludedonautomaticbrewermodels.
•Hotwaterfaucetavailable.
•Holdsupto4”(10.16cm)tallcup.
•UseBUNNpaperfilters–ProductNo.20115.0000.
THERMAL SERVER
•Convenientforkeepingcoffeehotforhours.
•Easilytransportedtoremotelocations.
•Dependingonbase,servercanholdupto6½”(16.51cm)cup.
THERMAL SERVER RACK
•Holdsoneortwo2.5litrethermalserverswithoutbase.
•Madeofdurable,easy-to-cleanplasticwithdriptraystocatchspillsandkeepservingareasclean.
Model
Product #
CW15-TS
HxWxD
23000.0000
(Pourover)
CWTF15-TS
23000.0006
(Automatic
w/faucet)
27.6" x 9" x 18.5"
(70.1cm x 22.9cm x 47cm)
Weight
Volts
Amps
Watts
Brewing
Capacity
Cord
Attached
120
11.4
1370
3.9 gal.
(14.6 L/hr)
Yes
27 lbs.
(12.3 kg)
32 lbs.
(14.6 kg)
Agencies
UL
LISTED
THERMAL SERVERS AND STANDS
Model
Product #
45882.0002
TS
45882.0000
TSR
23300.0009
(Raised)
23300.0010
TS
(no base)
23300.0006
BUNN Safety-Fresh Lid (Kit)
®
22
HxWxD
Weight
19.6" x 7.9" x 8.7"
(49.8cm x 20.1cm x 22.1cm)
6 lbs. (2.7 kg)
single unit
33 lbs. (15 kg)
6/case
21.8" x 7.9" x 8.9"
(55.4cm x 20cm x 22.6cm)
14.4" x 7" x 8.1"
(36.6cm x 17.8cm x 20.6cm)
22964.0000
6 lbs. (2.7 kg)
4 lbs. (1.8 kg)
Capacity
2.5 litres
(84 oz..)
25 lbs. (11.3 kg)
Agencies
single unit
6/case
1 lb. (.5kg)
single unit
TSR-1
18008.6001
25" x 7.5" x 8.5"
(63.5cm x 19.1cm x 21.6cm)
TSR-2
18008.6002
28.5" x 7.5" x 17"
(72.4cm x 19.1cm x 43.2cm)
8 lbs. (3.6 kg)
2 Thermal Servers
w/out Bases
TS Booster
18010.6000
6” x 9.25” x 8.25”
(15.2cm x 23.5cm x 21cm)
2 lbs. (.9 kg)
1 Thermal Server
w/out Base
www.bunn.com
Quantity
4.5 lbs. (2.1 kg)
1 Thermal Server
w/out Base
No Listing
SATELLITE
COFFEE BREWERS
Titan Dual Brewer
Titan Single Brewer
TITAN TF SERVER
•3Gallon(11.36L)capacity.
•Insulatedserverkeepscoffeehotforhours.
•Contemporarystylingandwrapprogramfor
maximum merchandising.
•Largecupclearanceallowsfordispensinginto
cups, decanters and thermal carafes.
•Integratedsightgaugeassemblyallowsforeasy
cleaning.
Titan TF Server
Titan™ Dual and Single Coffee Brewers
High volume brewing solution featuring Digital Brewer Control, precise extraction control
and portable servers
•Coffeeextractioncontrolledwithpre-infusionandpulsebrew,digitaltemperaturecontrol,andlarge
sprayhead; variable by-pass controls coffee strength.
•BrewMETER® allows automatic programming of pulse routine.
Ab
•Funnelhas28ounce(.8litre)capacityandpaperfilterretainerstoeliminatefold-over.
•Leftorrightfaucetforhotwater.
•UseBUNNpaperfilter–ProductNo.20111.0000.
Servers sold separately
Model
Product #
Volts
120/208
(3 phase)
Titan Dual
(1 phase)
120/208
(3 phase)
Brewing
Capacity
33.4
12000
34.3 gal.
(129.8 L)
40.1
8200
22.9 gal.
(86.7 L)
33.4
12000
22.5 gal.
(85.2 L)
8200
17 gal.
(64.4 L)
39300.0000
120/208
(1 phase)
Titan TF Server
Watts
39200.0000
120/208
Titan Single
Amps
39400.0001
40.1
HxWxD
Weight
40” x 35.6” x 21.7”
101.7cm x 90.5cm x 55.2cm)
148 lbs.
(67.1 kg)
Cord
Attached
Agencies
No
40.02” x 21.3” x 21.74”
(101.7cm x 54.1cm x 55.2cm)
107 lbs.
(48.5 kg)
23.7” x 13.7” x 17.1”
(60.2cm x 34.8cm x 43.4cm)
17.5 lbs.
(7.9 kg)
www.bunn.com
23
SATELLITE
COFFEE BREWERS
BrewWISE Dual TF
BrewWISE
Recipe Writer
BrewWISE Single TF
BrewWISE® ThermoFresh® Brewers
The TF brewers use Digital Brewer Control and feature vacuum-insulated ThermoFresh servers that
hold beverages at optimum flavor profile for hours without requiring the energy consumption of
traditional warming plates
•Storesindividualcoffeerecipes.
•LargesprayheadandBrewWISEintelligenceforsimplifiedprogramming.
Ab
•Variableby-passcontrolscoffeestrength.
•Simplify installationandcalibrationbycreatingcoffeerecipecardsanddedicatedfunnelswiththeRecipe
Writer using your PC (U.S. and English MS Windows® compatible).
Ab
•Equippedwithtankdrain.
•UseBUNNpaperfilter–ProductNo.20138.0000.
•CompatiblewithBUNNlink®.
Ab
Servers sold separately, see pages 25-26.
Model
Single TF
DBC
Product #
Volts
Amps
34800.0000
120/240
16.6
34800.0002
120/208
19.2
34800.0003
120/208
19.2
120/240
16.6
34800.0004
34800.0001
34800.0008
120
34800.0017
120
18.1
Watts
Brewing
Capacity
Funnel
Locks
34600.0002
Dual
TF
DBC
120/240
No
4000
11.4 gal.
(43.2 L)
34600.0006
2200
6.5 gal.
(24.6 L)
Yes
6600
34600.0007
27.4
27.4
59 lbs.
(26.8 kg)
SST
5700
SST
No
Black
18.9 gal.
(71.5 L)
SST
27.4
120/208
35.7” x 12.1” x 19.2”
(90.7cm x 30.7cm x 48.8cm)
Black
SST
35.7” x 21.8” x 20.2”
(91.7cm x 55.4cm x 51.3cm)
92.5 lbs.
(42 kg)
2.2” x 6.4” x 9.5”D
(5.6cm x 16.2cm x 21.4cm)
6.1 lbs.
(2.8 kg)
Black
16.3 gal.
(61.7 L)
Yes
SST
Black
Recipe
Writer
34444.0000
Recipe
Card
34447.0000
1.2 lbs.
Ad Card
34448.0000
1.2 lbs.
www.bunn.com
120
1
Cord
Attached
Black
No
34600.0004
Weight
Yes
No
34600.0003
34600.0005
24
27.5
HxWxD
Yes
34600.0000
34600.0001
Finish
Agencies
SATELLITE
COFFEE BREWERS
TF BASELESS SERVER
Digital Sight Gauge
with Count-up Timer
•IdealforusewiththeInfusion
Coffee Brewer (ICB)
•UsewiththeTFServer
Stand for easy dispensing
and 7.05” (17.9 cm) cup
clearance. Product No.
39795.0000
1.5 Gal TF Server
TF Server Stand
Baseless 1.5 Gal
TF Server
Digital ThermoFresh® Servers and Stand
ThermoFresh servers hold beverages at optimum flavor profile for hours without requiring the energy
consumption of traditional warming plates
•Four-hourdigitalcount-uptimer.
•Volumeindicatordisplay.
•Vacuuminsulated.
•Unique lid design features a pour spout for easy emptying and cleaning.
•Contemporarystylingandwrapprogramformaximummerchandising.
•Digitalsightgaugehasacount-uptimerthatbeginstocount-upinoneminuteincrementsto
specifically display how long the brewed beverage has been stored. Operates on four AAA batteries
with an average 1-year lifespan. Display shows low battery symbol.
•Translucent faucet guard provides increased visibility while dispensing.
•Brew-through lid.
•Soft grip handle for easy transportation.
TF SERVER WITH BASE
•Built-indriptrayiseasilyremovedforcleaningorprovidingextraclearanceforlargevessels.
•Largecup clearance.
•IdealforusewithSingleorDualDBCBrewers.
Model
Product #
42700.0000
42700.0001
Holding
Capacity
1 gal
(3.8 L)
Finish
SST
Black
HxWxD
Weight
20.6" x 9.3" x 13"
(52.3cm x 23.6cm x 33cm)
15 lbs.
(6.8 kg)
22.7” x 9.3” x 13”
(57.7cm x 23.6cm x 33cm)
16 lbs.
(7.3 kg)
12.6" x 9.1" x 12.7"
(32cm x 23.1cm x 32.3cm)
11 lbs.
(4.9 kg)
14.7” x 9.1” x 12.7”
(37.3cm x 23.1cm x 32.3cm)
12 lbs.
(5.4 kg)
8.7” x 9.4” x 12.9”
(22.1cm x 23.9cm x 32.8cm)
4.2 lbs.
(1.9 kg)
Cord Attached
Agencies
TF Server
42750.0000
42750.0001
42700.0050
Baseless
TF Server
42700.0051
42750.0050
42750.0051
TF Server Stand
39795.0003
1.5 gal
(5.7 L)
1 gal
(3.8 L)
1.5 gal
(5.7 L)
SST
Black
SST
Black
SST
Black
www.bunn.com
25
SATELLITE
TF BASELESS SERVER
•UsewiththeTFServerStandfor
easy dispensing. Product No.
39795.0003
COFFEE BREWERS
•Idealfor usewiththeInfusion
Coffee Brewer (ICB).
Baseless 1 Gal TF Server
1.5 Gal TF Server
TF Server Stand
For Use With
TF Servers
Page #
Single TF DBC
24
Dual TF DBC
with base - digital or
mechanical gauge
ICB Tall, ICB Twin Tall
16
ITCB (tall)
49
ITCB-DV HV, ITCB-Twin HV
baseless - digital or
mechanical gauge
50
ICB
15
ICB-Twin
ThermoFresh® Servers and Stand
ThermoFresh servers hold beverages at optimum flavor profile for hours without
requiring the energy consumption of traditional warming plates
•Vacuuminsulated.
•Easilytransportcoffeetoremotelocations.
•Fastflowfaucet.
•Brew-throughlid.
TF SERVER WITH BASE
•Built-indriptrayiseasilyremovedforcleaningorprovidingextraclearanceforlargevessels.
•Largecupclearance.
•IdealforusewithSingleorDualTFDBCBrewers.
Model
Product #
44000.0000
TF Server
44000.0001
44050.0000
44050.0001
44000.0050
Baseless
TF Server
44000.0051
44050.0050
44050.0051
TF Server Stand
26
39795.0003
www.bunn.com
Holding
Capacity
1 Gallon (3.8 L)
1.5 Gallon (5.7 L)
1 Gallon (3.8 L)
1.5 Gallon (5.7 L)
Finish
HxWxD
Weight
SST
20.8" x 9.3" x 13"
(52.8cm x 23.6cm x 33cm)
13 lbs.
(5.9 kg)
22.9" x 9.3" x 13"
(58.2cm x 23.6cm x 33cm)
14 lbs.
(6.4 kg)
12.8” x 9.1” x 13.1”
(32.5cm x 23.11cm x 33.3cm)
13 lbs.
(5.9 kg)
SST
14.9” x 9.1” x 13.1”
(37.8cm x 23.11cm x 33.3cm)
14 lbs.
(6.4 kg)
Black
8.7” x 9.4” x 12.9”
(22.1cm x 23.9cm x 32.8cm)
4.2 lbs.
(1.9 kg)
Black
SST
Black
SST
Black
Cord Attached
Agencies
SATELLITE
COFFEE BREWERS
BrewWISE
Single SH DBC
BrewWISE Dual SH DBC
BrewWISE® Soft Heat®
DBC® Brewers
Soft Heat technology automatically manages heat in the server docking system to ensure
optimum flavor profile for hours
•Brews½,1,or1½(1.9,3.8or 5.7litre)gallonbatches.
•Storesindividualcoffeerecipes.
•LargesprayheadandBrewWISEintelligenceforsimplifiedprogramming.
Ab
•Variableby-passcontrolscoffeestrength.
•Dualholdstwo1½gallon(5.7litre)SHservers.Singleholdsoneserver.
•Simplifyinstallationandcalibrationbycreatingcoffeerecipecardsanddedicatedfunnelswiththe
Recipe Writer using your PC (U.S. and English MS Windows® compatible).
Ab
•Equippedwithtankdrain.
•UseBUNNpaperfilter–ProductNo.20138.0000.
•CompatiblewithBUNNlink®.
Ab
Servers sold separately, see pages 29.
Model
Product #
Volts
Amps
Watts
17.5
4100
Faucet
Location
Brewing
Capacity
Finish
Cord
Agencies
Attached
HxWxD
Weight
35.8” x 9.3” x 23.1”
(90.9cm x 23.6cm x 58.7cm)
59 lbs.
(26.8 kg)
33600.0000
Single SH
DBC
33600.0001
(funnel lock)
11.4 gal.
(43.2 L)
33600.0013
Stainless
Black
Upper
33500.0000 120/240
Dual SH
DBC
29.1
18.9 gal.
(71.5 L)
6800
33500.0004
33500.0006
90 lbs.
(40.8 kg)
Stainless
Lower
No
35.8” x 18” x 21.2”
(90.9cm x 45.7cm x 53.8cm)
Black
89 lbs.
(40.4 kg)
Stainless
90 lbs.
(40.8 kg)
www.bunn.com
27
SATELLITE
COFFEE BREWERS
Single SH
Dual SH
Soft Heat® Brewers
Soft Heat technology automatically manages heat in the server docking system to ensure
optimum flavor profile for hours
•Variablebatchselectorknoballows½,1or1½gallon(1.9,3.8or5.7litre)batches.
•Electronicgrinderinterfaceinstructsgrinderonexact amountofcoffeeforselectedbrewbatchsize.
•Dualholdstwo1½gallon(5.7litre)SHservers.Singleholdsoneserver.
•SoftHeat® server heat control automatically shuts off once target temperature is reached. Can be set
to 175°-190°F (79.4° - 87.8°C).
•Remote1or2serverdockingstations(sold separately).
•Equippedwithtankdrain.
•UseBUNNpaperfilter–ProductNo.20138.0000.
Servers sold separately, see pages 29.
Model
Single SH
Product #
Volts
Amps
Watts
Capacity
27800.0001
120/208
18.3
3800
10.6 gal.
(40.1 L)
27800.0002
120/240
17.9
4300
11.4 gal.
(43.2 L)
120
17.5
2100
5.1 gal.
(19.3 L)
57 lbs.
(25.9 kg)
16.3 gal.
(61.7 L)
90 lbs.
(40.9 kg)
27800.0009
Dual SH
Stainless
27900.0001
120/208
27900.0002
120/240
27900.0020
28
Finish
www.bunn.com
Black
120/208
5900
28.3
6800
5900
18.9 gal.
(71.5 L)
HxWxD
Weight
Cord
Attached
Agencies
61 lbs.
(27.7 kg)
35.8” x 9.3” x 20.2”
(90.9cm x 23.6cm x 50.8cm)
35.8” x 18” x 20.5”
(91cm x 45.7cm x 52.1cm)
59 lbs.
(26.8 kg)
89 lbs.
(40.4 kg)
90 lbs.
(40.9 kg)
UL
No
LISTED
SATELLITE
COFFEE BREWERS
2SH Docking Station
1 SH Server
and Docking Station
Soft Heat® Servers and Stands
Soft Heat technology automatically manages heat in the server docking system to ensure
optimum flavor profile for hours
SOFT HEAT DOCKING STATION
•Remoteoneandtwoserverdockingstations.
•Instantpowercontactwithservers.
For Use With
SOFT HEAT® SERVER
Single SH DBC
Soft Heat
Server
•SoftHeat® servers supply controlled heat to coffee.
•LEDpowerindicator.
Dual SH DBC
Single SH
•Safety-Fresh® brew-through lid with vapor seal and spill prevention.
Model
Product #
Volts
Amps Watts
Capacity
Setting
27825.0000
1SH
Stand
27825.0003
2SH
Stand
0.75
27825.0004
27875.0000
27875.0003
90
1 SH
Server
4”
Stainless
120
1.5
180
4”
2 SH
Servers
Black
Stainless
Black
27
28
HxWxD
Weight
28.2” x 10” x 14”
(71.6cm x 25.4cm x 35.6cm)
13 lbs.
(5.9 kg)
Cord
Attached
Agencies
Yes
11.6” x 18.7” x 13.2”
(29.5cm x 47.5cm x 33.5cm)
22 lbs.
(10 kg)
16.6” x 8.5” x 14”
(42.2cm x 21.6cm x 35.6cm)
17 lbs.
(7.8 kg)
Stainless
27850.0004
Black
27850.0006
27850.0008
27850.0009
Finish
6”
27850.0001
SH
Server
Legs
Dual SH
Page #
1 1/2
Gal
45 Min.
Stainless
60
Min.
Black
Adjustable
Timer
27850.0016
240
Min.
27850.0022
120
Min.
No
Stainless
Black
www.bunn.com
29
SATELLITE
COFFEE BREWERS
Dual
Single
BrewWISE® GPR DBC® Brewers
Brewers that utilize Digital Brewer Control to manage the brewing process from start to
finish and feature portable server solutions
•Brews12.5gallons(47.3litres)perhour.
•Brews1⁄2,1or11⁄2gallon(1.9,3.8or5.7liter)batches.
•1.5GPRportableserver(s)(included) has a Safety-Fresh® brew-through lid with vapor seal
and spill protection.
Ab
•Storesindividualcoffeerecipessooperatorcaneasilybrewmanyvarieties.
•Coffeeextractioncontrolledwithpre-infusionandpulse-Brew,digitaltemperaturecontrol,andlarge
sprayhead; coffee strength controlled with variable by-pass.*
•OperateanycombinationofBrewWISE®equipmenterror-freewithwirelessbrewer-grinderinterface
through the Smart Funnel®.*
•Createcoffeerecipecardswithcustomrecipes,adcardswithmessagesthatdisplayonthebrewer
LCD, and dedicated funnels for special coffees with the BrewWISE Recipe Writer using your PC
(Windows® compatible).*
•Dualvoltagebrewercanbeconnectedto120V,120/208Vor120/240Velectrical.
•Troubleshootallswitchesandelectricalcomponentsfromthefrontpanelwithadvanceddiagnostic
service tools.
•Programmablefreshnessindication.
•Messagedisplayalertswhenfreshnesstimerexpiresandwhenwarmerswillautomatically shutoff.
•Programmablewarmercontrol.
•EnergySaverMode.*
•BUNNwarrantyincludes3yearspartsandlaboronelectroniccontrolboardsand2yearspartsand1
year labor on all other components.
DUAL GPR DBC
•Brews18.9gallons(71.5liters)perhour.
•Brews1⁄2,1,or11⁄2gallon(1.9,3.8or5.7liter)batches.
Ab
Model
Single GPR
DBC
Dual GPR
DBC
30
Product #
* For detailed descriptions of BUNN terms, please refer to pages 73-74.
Volts
Amps
Watts
Brewing
Capacity
120
15
1800
4.7 gal.
(17.8 L)
16.8
3400
9.5 gal.
(36 L)
36100.0010 120/208
35900.0010
www.bunn.com
120/240
19.2
4500
12.5 gal.
(47.3 L)
120/
208-240
25
- 29
5200
- 6800
14.8-18.9 gal.
(43.2 L)
Finish
Stainless
Cord
Agencies
Attached
HxWxD
Weight
29.6 x 9.2” x 20”
(75.2cm x 23.4cm x 50.8cm)
67 lbs.
(30.4 kg)
Yes
29.3 x 18” x 20”
(74.4cm x 45.7cm x 50.8cm)
90 lbs.
(40.8 kg)
No
UL
LISTED
SATELLITE
COFFEE BREWERS
Single
Dual
Single® and Dual® Brewers
•Brews½,1or1½gallon(1.9,3.8and5.7litre)batches.
•Adjustablebypassensuresperfectcoffeeregardlessofbatchsize.
•Electronictimerensures fastsetupandaccuratebrewlevels.
•ElectronicgrinderinterfaceinstructsG9THDgrinderonexactamountofcoffee
for selected brew batch size.
•1.5GPRportableserver(s)(included) has a Safety-Fresh® brew-through lid
with vapor seal and spill protection.
Ab
•Equippedwithtankdrain.
•UseBUNNpaperfilter–ProductNo.20138.0000.
Model
Product #
Volts
Amps
23050.0006
Watts
2100
120
17.5
23050.0007
2100
Single
5.1 gal.
(19.3 L)
23050.0010 120/208 18.3
3800
10.6 gal.
(40.1 L)
23050.0011 120/240 17.9
4300
11.4 gal.
(43.2 L)
5990
16.3 gal.
(67.7 L)
20900.0008
120/208 28.8
Dual
Brewing
Batch Funnel
Capacity Settings Type
One
Three
6890
18.9 gal.
(71.5 L)
HxWxD
29.3” x 9.25” x 19”
(74.4cm x 54.9cm x 48.3cm)
Stainless
Stainless
UL
LISTED
No
92 lbs.
(41.8 kg)
Plastic
29.3” x 18” x 19.3”
(74.4cm x 45.7cm x 49cm)
Three
Cord
Agencies
Attached
58 lbs.
(26.3 kg)
59 lbs.
(26.8 kg)
Stainless
One
Weight
57 lbs.
(25.9 kg)
Plastic
20900.0010
20900.0011 120/240 28.7
Finish
94 lbs.
(42.7 kg)
95 lbs.
(43.1 kg)
www.bunn.com
31
SATELLITE
COFFEE BREWERS
Single AXIOM
Single CWTF
1 Gallon Automatic Brewers
SINGLE AXIOM®
•Brews4.5to9.0gallons(17.0to34.1litres)ofperfectcoffeeperhour.
•1/2gallonand1gallon(1.9and3.8litre)batchesbrewedinto1.5GPRportableserver(included).
•Large200oz.(5.9litre)tank.
•Adjustsautomaticallytovaryingwaterpressure.
•Forhighlimeareas,BrewLOGIC® technology calculates flow rate and adjusts brew time to maintain
consistent pot levels.
Ab
•BrewWIZARD® technology simplifies brewer programming.
Ab
•Gourmetfunnelallowsuseofheavierthrowweightsofcoffee.
SINGLE CWTF
•Brewhalfgallonand1gallon(1.9and3.8litre)batchesintoincluded1.5GPRportableserver.
•Gourmetfunnelmodelsallowsuseofheavierthrowweightsofcoffee.
•1.5GPRportableserver(s)(included) has a Safety-Fresh® brew-through lid with vapor seal and spill protection.
•Halfgallon(1.9litre)pouroverbackup.
•GourmetfunnelrequiresBUNNpaperfilter20157.0000.
32
Model
Product #
Single
AXIOM-15
38700.0043
Single
AXIOM-35
38700.0045
Single
CWTF15
Single
CWTF35
Finish
Volts
Amps
Watts
Brewing
Capacity
120
13.8
1600
4.5 gal.
(17 L)
120/208-240
15.8
3650
7.5/9.0 gal.
(28.4/34.1 L)
35000.0004
120
13.8
1650
3.8 gal.
(14.4 L)
35000.0006
120/208-240
15.8
3650
7.5/9.0 gal.
(28.4/34.1 L)
Stainless
www.bunn.com
Funnel
Type
HxWxD
Weight
Cord
Agencies
Attached
Yes
30 lbs.
(13.6 kg)
Gourmet
Stainless
No
26.1” x 8.5” x 18.9”
(66.3cm x 21.6cm x 48cm)
46.5 lbs.
(21 kg)
Yes
No
UL
LISTED
SATELLITE
COFFEE BREWERS
RWS1
Warmer
1.5 GPR
Portable Server
Portable Servers and Warmers
PORTABLE SERVER
•1or1½gallon(3.8,5.7litre)capacities.
Page #
For Use With
•Easilytransportportableserversforremoteservice.
Single GPR DBC
•Safety-Fresh® brew-through lid with vapor seal
and spill protection GPR servers.
30
Dual GPR DBC
Single CWTF
GPR Server
WARMER
32
Single AXIOM
•Availablewithplastic,satinnickelorstainlesssteellegs.
Single
•LegsareadjustableonRWS1.
Dual
Model
Product #
1GPR
(bail handle)
12487.0001
1GPR
(side handle)
12487.0003
1GPR-FF
(bail handle,
fast flow faucet)
12487.0005
HxWxD
Weight
Finishes
Volts
Amps
31
Watts
Capacity
Cord
Attached
Agencies
8.5 lbs.
(3.9 kg)
14” x 8.5” x 12.7”
(35.6cm x 21.6cm x 32.2cm)
1 gal
(3.8 L)
9 lbs.
(4.1 kg)
Stainless
1.5GPR-FF
(top handle,
fast flow faucet)
20950.0004
RWS1
(plastic legs)
12203.0010
RWS1
12203.0014
(satin nickel legs)
18.1” x 8.5” x 12.7”
(46cm x 21.6cm x 32.2cm)
7.5” x 8.25” x 9.3”
(19.1cm x 21cm x 23.6cm)
10 lbs.
(4.5 kg)
1 1/2 gal
(5.7 L)
7 lbs.
(3.2 kg)
120
9 lbs.
(4.1kg)
0.8
100
1 or
1.5 GPR
Yes
UL
www.bunn.com
LISTED
33
GRINDERS
MHG
4 Position Storage System
Hopper Assembly
2 Position Storage System
Multi-Hopper Grinders
A superior coffee grinding system combines the ability to grind multiple coffees
with BrewWISE® Technology
•Convenient,front-loadinghoppers.
•Storesindividualcoffeegrindweights.
•Portioncontrolledfortherightamountofcoffee,withthreebatchsizesperhopper.
•Precisionburrsforconsistent,commercialqualitygrind.
•Easy-to-cleanremovablehoppers.
•LCDalphanumericdisplayshowscoffeenamesanddiagnostics.
•AccommodatesallBrewWISE® Smart Funnels®.
Ab
•SmartHopper® manages the grinding and brewing process from start to finish through a microchip.
•CreatecoffeerecipecardswithBrewWISErecipewriteronyourPC.
Ab
•CompatiblewithBUNNlink®; Four-year warranty on grinding burrs.
RACK AND HOPPER
•Rackshelpstoreanddisplaycoffeevarietiesandpromotefreshgroundcoffeeprogram.
•Hoppersserveasstoragecontainerswhennotinthegrinder.Lockinglidpreventstampering.
34
HxWxD
Weight
Volts
Amps
Watts
Capacity
Cord
Attached
29.1" x 9.4" x 17.5"
(73.9cm x 23.8cm x 44.5cm)
70 lbs.
(31.8 kg)
120
11
1320
6 lbs./hopper
(2.7 kg/
hopper)
Yes
36760.0000
11.37” x 9.76” x 15.74”
(28.88cm x 24.79cm x 39.98cm)
4.3 lbs.
(2.0 kg)
2 hoppers
4 Position Rack
36760.0001
24.25” x 9.76” x 15.74”
(61.6cm x 24.79cm x 39.98cm)
6.4 lbs.
(2.9 kg)
4 hoppers
Hopper
Assembly
36845.0000
11.75” x 4.23” x 15.9”
(29.85cm x 10.74cm x 4.39cm)
5 lbs.
(2.3 kg)
Model
Product #
MHG (SST)
35600.0000
MHG (Black)
35600.0002
2 Position Rack
www.bunn.com
Agencies
Ab
GRINDERS
G9WD-RH
Weight Driven Grinder
Weight-based, portion-control for the right amount of coffee every time, with 3 batch sizes
•Unparalleled grind weight accuracy.
•Hopper holds up to 6 lbs. (2.72 kg.).
•Precision burrs for consistent, commercial quality grind.
•LCD alphanumeric display shows machine status and diagnostics.
•Removable hopper for easy cleaning.
Funnels sold separately, see pages 68-69.
Model
Product #
40700.0001
G9WD-RH
40700.0002
HxWxD
Weight
Volts
Amps
Watts
29.8” x 8.14” x 19.3”
(75.7cm x 20.7cm x 49.0cm)
70 lbs.
(31.8 kg)
120
11
1128
Finish
Capacity
Cord
Attached
Stainless
6 lbs./
hopper
(2.7 kg/
hopper)
Yes
Black
Agencies
UL
www.bunn.com
LISTED
35
GRINDERS
G9HD
G9-2 HD
G9-2T DBC
Portion Control Grinders
•Portioncontrolledfortherightamountofcoffeeeverytime.
•Precisionburrsforconsistent,commercial-qualitygrind.
•G9THDmodelhasoptionalinterfacetoBUNNbrewersformultiplebatchsizes.
•TheG9THDandG92THDaccommodatelargerbrewfunnels.
•Four-year warranty on grinding burrs.
BrewWISE® DBC® GRINDER
•Storesindividualcoffeegrindprofiles.
•OperateanycombinationofBrewWISE® equipment error-free with wireless brewer-grinder interface
via Smart Funnel® and Dual Soft Heat® DBC® brewer.
Ab
•CompatiblewithBUNNlink .
Funnels sold separately, see pages 68-69.
®
Model
G9HD
(Analog)
G9T HD
(Analog)
G9T HD
(Brewer Interface)
G9-2 HD
(Brewer Interface)
G9-2 HD-S
(Analog)
G9-2T HD
(Brewer Interface)
G9-2T DBC
(Wireless interface)
36
Ab
Product #
HxWxD
Weight
05800.0001
22.3" x 8" x 17.8"
(63.5cm x 20.3cm x 45.2 cm)
62 lbs.
(28.1 kg)
05800.0013
05800.0003
05800.0027
24250.0000
24250.0011
33700.0001
www.bunn.com
Amps
Watts
Finish
Capacity
Stainless
ONE HOPPER
Agencies
9 lbs.
(4.1 kg.)
UL
67 lbs.
(30.4 kg)
TWO HOPPERS
120
25" x 8" x 17.8"
(63.5cm x 20.3cm x 45.2cm)
27.1" x 8" x 17.8"
(63.5cm x 20.3cm x 45.2 cm)
Cord
Attached
Black
27" x 8" x 17.8"
(68.6cm x 20.3cm x 45.2 cm)
24250.0021
33700.0000
Volts
9.4
1128
6 lbs./
hopper
(2.7 kg/
hopper)
68 lbs.
(30.9 kg)
67 lbs.
(30.4 kg)
Yes
Stainless
Black
LISTED
GRINDERS
LPG
Grinders
LPG-2
(FPG-2 DBC excluded)
LPG
•Low profiledesign.
•Professionalgrindprovidedbylarge3.19”
FPG
(81 mm) diameter burrs.
•Powered byquiet,high-torquemotor.
•Twohoppersallowforregularanddecaforspecialtybeans.(LPG-2)
•Four-yearwarrantyongrindingburrs.
FPG-2 DBC
French Press not available
FPG
•Accommodatesupto8”(20.3cm)tallFrenchpressorfunnelfordrip-stylebrewer.
•Multi-batchsettingallowsuserstospecifyaFrenchpressbrewsizeorgrindenoughcoffeeintoa
funnel to brew up to 3.0 litres of drip-style coffee.
•Professionalgrindprovidedbylarge3.19”(81mm)diametercommercialgrindingburrs
powered by quiet, high torque motor.
•DigitaltouchpadforfrontofmachineprogrammingandLCDread-out.(FPG-2 DBC)
•Four-yearwarrantyongrindingburrs.
•Canaccommodategourmetfunnel (34559.0000 or 34559.0001) for heavier throw weights.
Funnels sold separately, see pages 68-69.
Model
Product #
HxWxD
Weight
LPG
20580.0001
15.1" x 8.64" x 10"
(38.4cm x 21.95cm x 25.4cm)
23 lbs.
(10.5 kg)
LPG2E
26800.0000
LPG2E
w/4” SS legs
26800.0001
FPG-2 DBC
36400.0000
17.5" x 8.6" x 11"
(44.5cm x 21.84cm x 27.94cm)
21.8" x 8.6" x 11"
(55.4cm x 21.84cm x 28cm)
28 lbs.
(12.7 kg)
Volts
36800.0000
20” x 8.6” x 10”
(50.8cm x 21.8cm x 25.4cm)
Watts
Capacity
3
360
6 lbs.
(2.7 kg.)
3.5
420
3 lbs./hopper
(1.4 kg)
120
30 lbs.
(13.6 kg)
31 lbs.
(14.06 kg)
30 lbs.
(13.6 kg)
Cord
Attached
3.5
420
Agencies
UL
LISTED
Yes
Not listed
3 lbs./hopper
(1.4 kg/hopper)
120
FPG
Amps
UL
LISTED
Yes
6 lbs./hopper
(2.7 kg/hopper)
www.bunn.com
37
GRINDERS
G1 HD
G2 trifecta
Bulk Coffee Grinders
G2 HD
G3 HD
(G2 and G3 only)
G1, G2, G3 HD GRINDERS
•Turboactiondrawscoffeethroughgrindchamberforgreatergrindingefficiency.
•Grindsonepoundinunder30seconds.
•Widerangeofgrindscanbeselected.
•Convenientcleaning leverensurescompleteclean outofgrindchamber.
•Bagswitchpreventsgrindingbeforebagisinplace.
•Heavy-dutyprecisionburrsforquality,finergrinds.
•Four-yearwarrantyongrindingburrs.
G2 trifecta® GRINDER
•Chuteassemblyaccommodatestrifectabrewcup.
•Expandedrangeofprecisegrindscanbeselected.
•Maybeusedasabulkgrinderinbehind-the-counterapplications.
•Hopperholds2lbs.(.91kg)offreshcoffeebeans.
38
Model
Product #
HxWxD
Weight
G1 HD Black
22104.0000
G1 HD Red
22104.0001
22.7" x 7.3" x 16"
(57.9cm x 18.54cm x 40.64cm)
57 lbs.
(15.9 kg)
G2 HD Black
22102.0000
G2 HD Red
22102.0001
G2 trifecta
41900.0000
G3 HD Black
22100.0000
G3 HD Red
22100.0001
www.bunn.com
26.4" x 7.3" x 16"
(67.1cm x 18.54cm x 40.64cm)
26.5” x 7.3” x 15.9”
(67.3cm x 18.54cm x 40.4cm)
26.8" x 7.4" x 16"
(68.1cm x 18.54cm x 40.64cm)
Volts
Watts
Capacity
Cord
Attached
Agencies
1 lb.
(.45 kg)
120
59 lbs.
(26.8 kg)
Amps
9
1080
2 lbs.
(.9 kg)
3 lbs.
(1.4 kg)
Yes
UL
LISTED
ESPRESSO
COFFEE BREWERS
Tiger Cool Froth EXT
Tiger S2
Tiger Cool Froth
(external milk)
(with milk drawer)
BUNN Espress® Cool Froth® and S2
Simple solution for exceptional espresso beverages from a sleek, compact super-automatic
•Upto180shotsperhourfromlessthan16”(41cm)ofcounterspace.
•Intelligentmodularbrewingchamberforconsistentflavorprofile.
•Simulatesbaristatampingandpolishingmotiontoprovideuniformextraction.
•Twogrindersforvarietyofespressobeans.
•Eachhopperholds1.75lbs.(.8kg)offreshbeans.
•Adjustsfor4.5to7.4inch(11.4to18.8cm)cupclearance.
•BrewsESEpods.
•Intuitivecontrolpadguidesuserthroughstepsformakingdrinks.
•Easydailycleaning.
BUNN ESPRESS TIGER COOL FROTH
•Innovativemilkdeliverysystemdeliversundilutedfoamforafuller,richerflavorexperience.
•Perfectlyfoamscoldmilkforgreattastingicedcappuccino.
•Yourchoiceofmanydrinkselections:espresso,cappuccino,latteandicedcappuccino,andmore.
•Availablewithaself-contained1gallon(3.79L)milkdrawer.
•EXT(externalmilk)modelallowsmilkfromtwosources,expandingyourbeveragemenu.(see page 41)
BUNN ESPRESS TIGER S2
•Intellisteam® wand shuts steam off when the milk reaches the preset temperature. No need to monitor
temperature with a thermometer.
Ab
Model
Cord
Attached
Product #
HxWxD
Weight
Volts
Amps
Watts
Tiger Cool Froth
35800.0008
103 lbs.
(46.7 kg)
16
1850
Yes
35800.0009
25.5” x 15.8” x 18.1”
64.8cm x 40.1cm x 45.9cm)
120
Tiger Cool Froth
208
12
2400
Yes/no plug
Tiger Cool Froth EXT external milk
35800.0010
16
1850
Yes
35800.0011
88 lbs.
(40 kg)
120
Tiger Cool Froth EXT external milk
19.3” x 15.8” x 18.1”
49cm x 40.1cm x 45.9cm)
208
12
2400
Yes/no plug
Tiger S2 with steam wand
35800.0006
16
1850
Yes
Tiger S2 with steam wand
35800.0007
103 lbs.
(46.7 kg)
120
208
12
2400
Yes/no plug
25.5” x 15.8” x 18.1”
64.8cm x 40.1cm x 46cm
Agencies
www.bunn.com
39
ESPRESSO
COFFEE BREWERS
Black & White 3 CTS
Espresso Water Conditioner Assembly
Purity C300 w/Variable Bypass Head
Product No.:45961.0000
Replacement Cartridge
C300 Water Conditioner Cartridge
Product No.: 45961.0008
BUNN Espress® Black & White 3 CTS
Simple solution for exceptional espresso beverages from a sleek, compact super-automatic
•Handsome chrome housing.
•Dispense spout adjusts from 3” to 6.8”.
•Easy to use touch screen with beautiful graphics to guide operator through functions.
•Simple daily cleaning process with reminder and lockout.
•Intellisteam® wand automatically steams to proper milk temperature - no need to monitor with a
thermometer.
Ab
•Two hoppers, each with a capacity of 3.3 lbs. (1.5 kg)
for your choice of fresh espresso beans.
•Adjusts for 4.5 to 7.4 inch (11.4 to 18.8 cm) cup clearance.
•Heavy duty grinder.
•Stainless steel brew chamber.
•Built-in troubleshooting menu.
•Modular design of systems - maintenance is fast and easy.
40
Cord
Attached
Model
Product #
HxWxD
Weight
Volts
Amps
Watts
B&W3-CTS
43500.0010
28.7” x 20.5” x 23.6”
(72.9cm x 52.1cm x 59.9cm)
202 lbs.
(91.6 kg)
208
16
1850
Yes
240
12
2400
Yes/no plug
www.bunn.com
Agencies
ESPRESSO
COFFEE BREWERS
Steamer
Espresso Refrigerator
Cup Heater
Steamer, Cup Warmer
and Espresso Refrigerator
STEAMER
•Intellisteam® wand shuts steam off when the milk reaches the preset temperature.
Ab
•Consistentsteamtemperatureforback-to-backsteaming.
•Standaloneunitproducesdrysteamthatminimizesmilkdilutionandwillnotinterferewiththebrewing
capacity of your espresso machine.
•Programmablefortimedhotwaterdispense.
•.85gallon(3.2litres)boiler.
CUP HEATER
•Standaloneconvectionheatunitheatscupstomaintainespressotemperaturewhenserving.
ESPRESSO REFRIGERATOR
•Designedtoaccommodatetwostandard onegallon(3.79litre)milkjugs.
•WorksinconjunctionwiththeBUNNEspress® Tiger EXT models to deliver higher volume or two types of milk.
•Optionalside-by-sideorbelow-counterdesign.
Model
Product #
HxWxD
Weight
Steamer
35800.0401
15.4” x 9.7” x 17.7”
(39cm x 24.6cm x 45cm)
62 lbs.
(28.1 kg)
Cup Heater
35800.0400
15.4” x 10” x 15”
(39cm x 25.4cm x 38.1cm)
22 lbs.
(10 kg)
Espresso Refrigerator
35800.0403
16.7” x 9” x 22.3”
(42.4 cm x 23cm x 56.6cm)
40 lbs.
(18.1 kg)
Volts
Amps
Watts
Cord
Attached
15.8
1900
Yes
0.5
60
Yes
1.35
155
Yes
Agencies
120
115
www.bunn.com
41
LIQUID
COFFEE
SYSTEMS
BIB compartment view
LCR-3 HV
Liquid Coffee Refrigerated Dispenser High Volume
High volume Coffee-On-Demand dispenser meets the requirements of banquets,
convention centers, and hotels
•Refrigerated product cabinet extends product flavor profile, adjustable to maintain 41º to 65ºF (5º to 18ºC)
in the product compartment.
•Digital Brewer Control for programming and user interface.
•Holds up to three 1-gallon (3.79 L) BIBs.
•Delivers 6 oz.. (177 mL) per second of hot coffee on demand, 30-145 gallons (113-548.9 L) of coffee
per hour (varies by voltage and incoming water temperature).
• 3-phase or single phase operation.
•In two flavor mode, the optional
“Auto-Switching” function automatically
switches from an empty BIB to a secondary
BIB (left and middle pump only).
•Three buttons allow operator to dispense
three independent ratios.
•Each dispense button allows the option of up
to 3 portion sizes via rotary selection switch.
•18 gallon (82L) tank capacity.
•Manual hot water faucet.
Model
Product # Product Ratios
Dispense Connector
Rate/Sec.
Type
40800.0001
40800.0002
42
www.bunn.com
POWER
Phase
120/208
1 Phase
Heater Watts Total Amps
7820
37.6
CAPACITY
Cups/Hr** Gal.
641
25:1 - 100:1
6 oz..
Scholle 1910
QCD-II
25.0
120/240
1 Phase
10400
43.2
853
33.3
120/208 Y
3 Phase
12000
32.8
961
37.6
120/240 Y
3 Phase
15000
37.6
1280
49.6
**Capacity measured with a 5 oz.. cup and can be increased by preheating incoming water to 140ºF maximum.
HxWxD
Weight
Volts/Amps/Watts/
Capacity
Cord
Attached
40" x 33" x 23.6"
(101.6cm x 83.8cm x 59.9cm)
225 lbs.
(102.1 kg)
See chart above.
No
Scholle
QC
40800.0000
LCR-3 HV
Volts
Agencies
LIQUID
COFFEE
SYSTEMS
LCA - PC
(LCA is also available
with portion control)
LCA-1
LCA-2
LCA-2, IC
Liquid Coffee Ambient Dispensers
(LCA-2 only)
Coffee-On-Demand dispenser meets the requirements of banquets,
convention centers, and hotels
LCA-1 LP
•Compact,low-profiledesignaccommodatesavarietyofspaces.(Under18”tall.)
•Accommodatesone½gallon(1.9L)bag-in-box(BIB)container.
LCA-2, LCA-2 IC
•Accommodatesall½gallon(1.9litre)andmostonegallon(3.8litre)BIBcontainers.
•Insulatedproductcabinet.
•Convenientfliptrayfordispensingintodecantersorcarafes.
•CompatiblewithBUNNlink®.
Ab
LCA-2
•Globalmulti-voltdesigniseasilyconvertedtoratingsfrom100to240volts(50-60hertz).
•FlavorGard® technology continuously monitors extract-to-water ratio.
•Easy-to-programonetouch portioncontrolmodelisavailableforself-serveapplications.
•Equippedwithtankdrain.
LCA-2 IC
•Connectstoambientwatersupplyforafinalcoffeebeverageservedoverice.
Dispense Rate/Sec.
Model
Product #
1.8 oz..
2.5 oz..*
Connector
Volts
Type
Amps Watts
Capacity
HxWxD
Weight
17.8” x 10.6” x 19.5”
(45.2cm x 26.9cm x 49.5cm)
42 lbs.
(19.1 kg)
Cord
Agencies
Attached
Product Ratios
Scholle
1910LX
LiquiBox
QC/D II
44100.0000
LCA-1, LP 44100.0001
44100.0002
25:1 - 100:1
34400.0001
34400.0002 25:1 - 45:1
45:1 34400.0003
100:1
34400.0004 25:1 - 45:1
LCA-2, PC
45:1 100:1
36500.0002 25:1 - 45:1
36500.0003
115 cups
2
240
810 cups
14.2
1700
125 cups
208
240
22.6
25.8
4700
6200
385 cups
512 cups
120
14.2
1700
125 cups
Yes
208
240
22.6
25.8
4700
6200
385 cups
512 cups
No
Scholle QC
Scholle
1910LX
45:1 100:1
36500.0004 25:1 - 45:1
Yes
25:1 - 65:1
65:1 - 100:1
25:1 - 65:1
LiquiBox
QC/D II
All models can be changed to these
electrical configurations.
36500.0001
1320
120
LCA-2, IC 37700.0000
LCA-2
11
65:1 - 100:1
25:1 - 65:1
65:1 - 100:1
25:1 - 65:1
All models can be changed to these
electrical configurations.
30" x 12.2" x 24.9"
(76.2cm x 31cm x 63.3cm)
83 lbs.
(37.2 kg)
No
Scholle
1910LX
LiquiBox
QC/D II
www.bunn.com
43
LIQUID
COFFEE
SYSTEMS
LCR - PC
(LCR is also available
with portion control)
LCR-2
Liquid Coffee Refrigerated Dispensers
Coffee-On-Demand dispenser meets the requirements of banquets,
convention centers, and hotels
•Refrigeratedproductcabinetmaintains38–42°F(3–55°C)inproductcompartment.
•Accommodatesall½gallon(1.9litre)andmostonegallon(3.8litre)BIBcontainers.
•Convenientfliptrayallowsfordispensingintodecantersorcarafes.
•Globalmulti-voltdesigniseasilyconvertedtoratingsfrom100to240volts(50-60hertz).
•FlavorGard® technology continuously monitors extract-to-water ratio.
•Easy-to-programonetouchportioncontrolmodelisavailableforself-serveapplications.
•Equippedwithtankdrain.
•CompatiblewithBUNNlink®.
Ab
Dispense Rate/Sec.
Model
Product #
1.8 oz..
2.5 oz..*
Connector
Type
Volts
Amps Watts Capacity
HxWxD
Weight
Cord
Agencies
Attached
Product Ratios
34400.0036
34400.0037
LCR-2
34400.0038
34400.0039
45:1 100:1
25:1 45:1
45:1 100:1
25:1 45:1
65:1 100:1
25:1 65:1
65:1 100:1
25:1 65:1
Scholle
120
LCR-2,
PC
36500.0037
36500.0038
36500.0039
45:1 100:1
25:1 45:1
45:1 100:1
25:1 45:1
65:1 100:1
25:1 65:1
65:1 100:1
25:1 65:1
All models can be changed to these
electrical configurations.
44
www.bunn.com
1700
125
cups
Yes
385
cups
512
cups
No
LiquiBox
QC/D II
4100
208
All models can be changed to these
electrical configurations.
36500.0036
14.2
25.8
240
6200
38" x 12.2" x 24.9"
(96.5cm x 31cm x 63.2cm)
114 lbs.
(51.7 kg)
Scholle
120
14.2
1700
125
cups
Yes
385
cups
512
cups
No
LiquiBox
QC/D II
208
4700
25.8
240
6200
LIQUID
COFFEE
SYSTEMS
LCC-2 LP
LCA-2 LP
Liquid Coffee Low Profile Dispensers
Coffee-On-Demand dispenser meets the requirements of banquets,
convention centers, and hotels
•Attractiveappearancewithshorterprofile.
•Dispenseover120(5oz..)cupsperhour.
•Accommodatestwo.5gallonBIBcontainers.
•Servestwocoffeeproductsandhotwater.
•LEDlightsalertwhenmoreconcentrateisneeded.
•RinseLEDlightsalertwhencleaningisneeded.
•Setupforcontinuousdispense(by the cup) for self-serve applications or portion-control
to fill cups or carafes.
LCC-2 LP
•Chilledproductcabinetutilizesthermoelectrics foroptimalperformance.
•Accommodatestwo.5gallonBIBcontainerssizedapproximately7.5”Hx5.25”Wx4”D.
Dispense Rate/Sec.
Model
Product #
1.7 oz..
Connector
Type
HxWxD
Weight
Volts
23.2" x 15.8" x 20.9"
(58.9cm x 40.1cm x 53cm)
65 lbs.
(29.5 kg)
120
Amps Watts Capacity
Cord
Attached
Agencies
Product Ratios
38800.0004
Scholle
1910LX
38800.0005
QCDII
38800.0006
Scholle Q/C
LCC-2, LP
38800.0007
Rapak
25:1 - 100:1
38800.0000
Scholle
1910LX
38800.0001
QCDII
38800.0002
Scholle Q/C
38800.0003
Rapak
12
1440
120
cups
Yes
LCA-2, LP
www.bunn.com
45
ICED TEA
& COFFEE
ITB
ITB Dual Dilution
ITB-LP
Infusion Series® 3 Gallon Iced Tea Brewers
Space-saving brewer yields a variety of flavor profiles and batch options
with Digital Brewer Control
•Largetankprovidesback-to-backbrewingcapacity,allowing3or5gallon(11.4to18.9litre)teabatches.
•Brews16.3to26.7gallons(61.7to101.1litres)perhourfromrealtealeaves.
•Threerecipebuttonsandfull/halfoptionsformaximumflexibility.
•Singlebuttongraphicoverlaytocustomizeuserinterface.
•Digitaltemperaturecontrol,pre-infusion,pulsebrewandcoldbrewlockout.
•EasyPulseinterfaceallowsautomaticprogrammingofpulseroutine.
•Brewcounterkeepstrackofbatchesbrewed.
•Quickbrew(Q)funneltipforeasyconversion.
STANDARD ITB
•BrewsintoBUNNteadispensers(except TDS-5).
DUAL DILUTION ITB
•Meetyourvolumeneeds;brew3gallons(11.4litres)oficedteaintoeachdispenserandserveupto6
gallons (22.7 litres) within a narrow footprint.
•Rotatingbrewbasket,baseadapter,color-codeddecals,anddedicateddilutionnozzlesincluded.
•SpecificallydesignedtoaccommodateandbrewintotwoBUNNTDO-N-3.5gallondispensers(can
also brew directly into standard tea dispensers).
SWEETENER MODEL
•Independently set each brew button’s sweetener.
•Adjust sweetener volume with the Sweet Meter.
•“Out of Sweetener” indicator
•Separate sweetener inlet - use existing CO2 systems or external 3rd party pump for sweetener delivery.
LOW PROFILE BREWER
•BrewsdirectlyintoTDO-3.5gallonLPdispenserwithbrew-throughlid.
(see page 54 for server and stand)
•Compact,low-profilestylingforvarietyofspaces.
Dispensers sold separately, see page 52.
Model
ITB
(29” trunk)
ITB
(with sweetner)
ITB
(Dual Dilution)
ITB
46
Product #
41400.0000
41400.0001
HxWxD
41400.0003
ITB-LP
41400.0004
www.bunn.com
Volts
Amps
Watts
Brewing
Capacity
1700
16.3 gal.
(61.7 L)
Cord
Attached
Agencies
34” x 11.6” x 22”
(86.4cm x 29.5cm x 58.4cm)
44 lbs.
(20 kg)
41400.0002
(Dual Dilution, with
sweetner)
Weight
34” x 12.2” x 22.6”
(86.4cm x 30.9cm x 57.4cm)
28.75” x 11.57” x 21.87”
(73cm x 29.38cm x 55.55cm)
43 lbs.
(19.5 kg)
UL
120
14
Yes
LISTED
ICED TEA
& COFFEE
TB3Q
TB3
TB3Q-LP
3 Gallon Iced Tea Brewers
(TB3 & TB3Q only)
Fresh iced tea brewing solution with simple switch operation
for a wide variety of dispensers
TB3 AND TB3Q
•Brews3gallons(11.6litres)atatimedirectlyintoanystyleserver.
•Quickbrew(Q)modelsavailableforshorterbrewingcycles.
•Dispensersoldseparately(except TB3Q w/TD4T).
•UseBUNNpaperfilters-ProductNo.20100.0000.
LOW PROFILE TEA BREWER
•BrewsdirectlyintoTDO-3.5gallonLPdispenser(included)withbrew-throughlid.
(see page 54 for server and stand)
TB3/TB3Q
•Sleek,compact,low-profilestylingtoaccommodateavarietyofspaces.
•Quickbrew(Q)modelforavailableshorterbrewingcycle.
Dispensers sold separately, see page 52.
Model
TB3
(29” trunk)
TB3
(25.75” trunk)
TB3
(Ready Light, 29”
trunk)
TB3Q
(Quick Brew, 29”
trunk)
TB3Q w/TD4T
(29” trunk)
TB3Q
Product #
HxWxD
Weight
36700.0009
34" x 11.6" x 22"
(86.4cm x 29.5cm x 58.4cm)
43 lbs.
(19.5 kg)
36700.0030
31” x 11.6” x 22”
(78.7cm x 29.5cm x 58.4cm)
42 lbs.
(19.1 kg)
36700.0059
TB3Q-LP
36700.0100
TB3-LP
36700.0102
TB3
(with Sweetener
29” trunk)
34" x 11.6" x 22"
(86.4cm x 29.5cm x 58.4cm)
36700.0043
TD4, TDS-3, TDO-4
29"
trunk
TD4,TD4T, TDS-3, TDS-3.5, TDO4, TDO-5, TDO-N-3.5, TDO-N-4
Amps
Watts
Brewing
Capacity
Cord
Attached
Agencies
16.3 gal.
(61.7 L)
14.4
42 lbs.
(19.1 kg)
54 lbs.
(24.5 kg)
36700.0041
(Quick Brew, 25.75”
trunk)
25.75"
trunk
43 lbs.
(19.5 kg)
36700.0055
36700.0013
Volts
Tea Dispensers
31” x 11.6” x 22”
(78.7cm x 29.5cm x 58.4cm)
41 lbs.
(18.6 kg)
28.75” x 11.5” x 21.87”
(73cm x 29.4cm x 55.6cm)
43 lbs.
(19.5 kg)
34" x 11.6" x 22"
(86.4cm x 29.5cm x 58.4cm)
44 lbs.
(19.9 kg)
1730
UL
120
LISTED
Yes
26.7 gal.
(101.1 L)
14.2
1700
14.4
1730
14.4
1730
16.3 gal.
(61.7 L)
www.bunn.com
47
ICED TEA
& COFFEE
TB6
Twin 3 Gallon Iced Tea Brewer
Fresh iced tea brewing solution with simple switch operation for a wide variety of dispensers
•Brews16.3to26.7gallons(61.7to101.1litres)perhourfromrealtealeaves.
•Meetyourvolumeneeds;brew3gallons(11.4litres)oficedteaintoeachdispenserandserveupto6
gallons (22.7 litres) within a narrow footprint.
•SpecificallydesignedtoaccommodateandbrewintotwoBUNNNarrowTeaDispensers(can also
brew directly into standard tea dispensers).
•Includesrotatingbrewbasket,baseplatformadapter,dedicateddilutionnozzlesandbrewselection
switch.
•Colorcodeddecalshelptheoperatorproperlyalignthebrewbasket,dispenserandchoosethe
correct selection.
•Quickbrew(Q)modelavailableforshorterbrewingcycles.
•TB6hasadjustablesteeptimeformorecontroloverflavorextraction.
Dispensers sold separately, see page 52.
Model
Product #
TB6
36700.0300
TB6Q
48
36700.0301
www.bunn.com
HxWxD
Weight
34” x 12.2” x 22.6”
(86.4cm x 30.9cm x 57.4cm)
43 lbs.
(19.5 kg)
Volts
120
Amps
14.4
Watts
1730
Brewing
Capacity
16.3 gal.
(61.7 L)
26.7 gal.
(101.1 L)
Cord
Attached
Yes
Agencies
UL
LISTED
ICED TEA
& COFFEE
ITCB
Infusion Series® Tea and Coffee Brewers
Space-saving combination brewer yields a variety of beverages with
Digital Brewer Control and precise extraction control
•Largetankprovidesback-to-backbrewingcapacityandallows3or5gallon(11.4to18.9litres)tea
batches.
•Twoprogrammablebatchswitchesallowfullandhalfbatchbrewingoficedtea.
•BrewsintoallBUNNicedteadispensers(except TDS-5) and 1.9 to 3.8 litre airpots.
•BrewWISE® intelligence.
•Brewcounterforbatchesbrewed.
•Equippedwithtankdrain.
•Blackplasticcoffeefunnelandseparateteafunnel.
•StainlesssteelSmartFunnel® available. Product No. 32643.0000
•CompatiblewithBUNNlink®.
•UseBUNNpaperfilters-ProductNo.20100.0000.
Ab
Ab
SWEETENER MODEL
•Independently set each brew button’s sweetener.
•Adjust sweetener volume with the Sweet Meter.
•“Out of Sweetener” indicator
•Separate sweetener inlet - use existing CO2 systems or external
3rd party pump for sweetener delivery.
ITCB
Tea Dispensers
25.75"
trunk
TD4, TDS-3, TDO-4
29"
trunk
TD4,TD4T, TDS-3, TDS-3.5, TDO-4,
TDO-5, TDO-N-3.5, TDO-N-4
Airpots and dispensers sold separately, see pages 21 and 52.
Model
ITCB-DV
(29” trunk)
ITCB-DV
(29” trunk, flip tray)
ITCB-DV
(25.75” trunk)
ITCB-DV
(25.75” trunk, Sweetner)
ITCB-DV
(25.75” trunk, flip tray)
ITCB-DV
(29” trunk,
7-hole sprayhead)
Tall Booster
Short Booster
Product #
HxWxD
Weight
35700.0000
35700.0019
34.04" x 10.12" x 23.22"
(86.5cm x 25.7cm x 58.98cm)
Volts
Amps
Watts
Coffee
Brewing
Capacity
120
14
1700
4.5 gal.
(17 L)
120/208
13
2650
120/240
15
3500
120
14
1700
35700.0001
35700.0033
30.87" x 10.12" x 23.22"
(78.4cm x 25.7cm x 58.98cm)
50 lbs.
(27.2
kg)
35700.0020
35700.0002
34.04" x 10.12" x 23.22"
(86.5cm x 25.7cm x 58.98cm)
35976.0003
13.8” x 9” x 12.75”
(35.1cm x 22.9cm x 32.3cm)
35976.0002
10.55” x 9” x 12.75”
(26.8cm x 22.9cm x 32.3cm)
120/208
13
2650
120/240
15
3500
120
14
1700
120/208
13
2650
120/240
15
3500
Tea
Brewing
Capacity
Cord
Attached
26.7 gal.
(101 L)
Yes
Agencies
7.5 gal.
(28.4 L)
4.5 gal.
(17 L)
UL
LISTED
7.5 gal.
(28.4 L)
4.5 gal.
(17 L)
7.5 gal.
(28.4 L)
6 lbs.
(2.7 kg)
www.bunn.com
49
ICED TEA
& COFFEE
ITCB-DV HV
ITCB-Twin HV
Infusion Series® Tea and Coffee
High Volume Brewers
Space-saving combination brewer yields a variety of beverages with Digital Brewer Control
and precise extraction control
•Largetankprovidesback-to-backbrewingcapacityandallows3or5gallon(11.4to18.9
litres) tea batches.
•Twoprogrammablebatchswitchesallowfullandhalfbatchbrewingoficedtea.
•BrewsintoallBUNNicedteadispensers(except TDS-5) and 1.9 to 3.8 litre airpots.
•BrewWISE® intelligence.
•Brewcounterforbatchesbrewed.
•Equippedwithtankdrain.
•Blackplasticcoffeefunnelandseparateteafunnel.
•CompatiblewithBUNNlink®.
•UseBUNNpaperfilters-ProductNo.20100.0000.
SWEETNER MODEL
•Independently set each brew button’s sweetener.
•Adjust sweetener volume with the Sweet Meter.
•“Out of Sweetener” indicator
•Separate sweetener inlet - use existing CO2 systems or external 3rd party pump for sweetener delivery.
Servers and dispensers sold separately, see pages 25-26, and 52.
Model
ITCB-DV HV
ITCB- Twin HV
50
Product #
43000.0000
43100.0000
www.bunn.com
HxWxD
34.4" x 10.12" x 23.8"
(87.4cm x 25.7cm x 60.5cm)
34.4" x 20.1" x 23.8"
(87.4cm x 51.2cm x 60.5cm)
Weight
55 lbs.
(24.9 kg)
93 lbs.
(42.2 kg)
Volts
Amps
Watts
Coffee
Brewing
Capacity
120
14
1700
5.1 gal.
(19.3 L)
208
13.8
2900
8.9 gal.
(33.7 L)
240
16.8
4050
11.9 gal.
(45.05 L)
120
14
1700
4.5 gal.
(17 L)
Tea
Brewing
Capacity
26.7 gal.
(101 L)
Cord
Attached
Agencies
UL
Yes
LISTED
ICED TEA
& COFFEE
TCD-1
TCD-2
IC3
TU5Q
Iced Tea and Iced Coffee Brewer
and Dispensers
TCD
•Venturivalvecreatessiphonthatpullsproductthroughtomixingvalve.
•Rearshut-offvalveforcleaningdispenser.
•Acceptsonegallon(3.8litre)jugs intopofcontainerorBIB.
•Built-inpressureregulatorprovidesconsistentproduct-to-waterratio.
•Mixesarangeof5:1to15:1concentratetowaterratio.
•Forusewithteaconcentrateonly.
IC3
•Brewsdirectlyintoanystyleportableserverupto20”tall(50.8cm).
•Heightiseasilychangedbyaddingorremovingtrunkextensions.
•Breweither2or3gallons(7.57to11.36litres)oficedcoffeeatatime.
•Tailorsflavortocustomerpreference.
5 GALLON TEA BREWER
•Generatestopprofitsthroughlargevolumesales.
•Breweither3or5gallons(11.36to18.93litres)oficedteaatatime.
•Canbesetuptobrewconcentrateonlyforeasiertransport.
Dispensers sold separately, see page 54.
TEA CONCENTRATE DISPENSERS
Model
Product #
HxWxD
Weight
TCD-1
37750.0000
22.9" x 12.8" x 18.1"
(58.2cm x 32.5cm x 46cm)
17.1 lbs.
(7.8 kg)
TCD-2
37750.0002
22.9” x 12.8” x 18.9”
(58.2cm x 32.5cm x 48cm)
19.6 lbs.
(8.9 kg)
Volts
Amps
Watts
Dispensing Capacity
Agencies
45 gal.
(170.3 L)
No electrical required
67 gal.
(253.6 L)
ICED COFFEE BREWERS
Model
Product #
HxWxD
Weight
Volts
Amps
Watts
Brewing
Capacity
Cord
Attached
IC3
24450.0000
37.1" x 12" x 24"
(94.2cm x 30.5cm x 60.96cm)
58 lbs.
(26.3 kg)
120/208
19.5
4050
20 gal.
(75.7 L)
N/A
Trunk Extension &
Rear Panel
24427.0000
.08 lbs.
(.04 kg)
Agencies
Needed to accommodate the taller ICD4T dispenser.
5 GALLON ICED TEA BREWERS
TU5Q
24400.0000
38.5" x 11.5" x 24"
(97.8cm x 29.6cm x 60.96cm)
51 lbs.
(23.2 kg)
120
15
1800
28.5 gal.
(107.9 L)
Yes
UL
LISTED
www.bunn.com
51
ICED TEA
& COFFEE
TD4
TD4T
TDO-4
TDS-5
TDO-N-3.5
ICD-3
TDO-3.5 LP
TDO-5
LP Stand
Iced Tea/Coffee Dispensers
4 GALLON SQUARE TEA DISPENSERS
Model
Product #
TD4 (solid lid)
03250.0003
TD4 (brew-through lid)
03250.0006
TD4T (solid lid, tall)
03250.0004
TD4T (brew-through lid, tall)
03250.0005
TD4T (brew-through lid, tall, no decal)
03250.0018
HxWxD
17.1" x 9.1" x 15.7"
(43.4cm x 23.1cm x 39.9cm)
22" x 9.1" x 15.7"
(55.9cm x 23.1cm x 39.9cm)
Weight
Capacity
Handles
4 Gallons
(15.1 L)
Side
12 lbs.
(5.4 kg)
11 lbs.
(5.0 kg)
13 lbs.
(5.9 kg)
43, 3.5, 4 GALLON CYLINDER STYLE TEA/COFFEE DISPENSERS
52
TDS-3
33000.0000
19" x 9.8" x 12.8"
(48.3cm x 24.9cm x 32.5cm)
9.4 lbs.
(4.3kg)
3 Gallons
(11.4 L)
TDS-3.5
33000.0008
20.4" x 9.8" x 12.8"
(51.8cm x 24.9cm x 32.5cm)
10 lbs.
(4.5kg)
3.5 Gallons
(13.2 L)
TDS-5
33000.0001
25.6” x 9.8” x 14.8”
(65cm x 37.8cm x 37.6cm)
12 lbs.
(5.4 kg)
5 Gallons
(18.9 L)
ICD-3
33000.0002
20.6" x 9.8" x 14"
(52.3cm x 37.8cm x 35.6cm)
10 lbs.
(4.5kg)
3 Gallons
(11.4 L)
TDO-5
34100.0001
12 lbs.
(5.4 kg)
5 Gallons
(18.9 L)
TDO-5 (brew-through lid)
34100.0003
14 lbs.
(6.4 kg)
5 Gallons
(18.9 L)
TDO-4
34100.0000
TDO-4 (brew-through lid)
34100.0002
19" x 10.7" x 13.7"
(48.3cm x 27.2cm x 34.8cm)
12 lbs.
(5.4 kg)
4 Gallons
(15 L)
TDO-3.5 (low profile)
37100.0000
9.75” x 10.7” x 13.7”
(24.8cm x 27.2cm x 34.8cm)
8 lbs.
(3.6 kg)
3.5 Gallons
(13.2 L)
TDO-N-3.5
39600.0001
21.6” x 6.2” x 13.5”
(54.9cm x 15.7cm x 34.3cm)
TDO-N-3.5 (with feet)
39600.0025
21.8” x 6.2” x 13.5”
(55.4cm x 15.7cm x 34.3cm)
TDO-N-4
39600.0002
21” x 6.1” x 23.6”
(53.3cm x 15.2cm x 60cm)
LP Server Stand
37675.0001
9.3” x 11.5” x 14”
(23.5cm x 29.2cm x 35.6cm)
www.bunn.com
22” x 10.7” x 13.7”
(55.9cm x 27.2cm x 34.8cm)
12.3 lbs.
(5.6 kg)
3.5 Gallons
(13.2 L)
4 Gallons
(15 L)
8.6 lbs.
(3.9 kg)
Side
Front/Back
Agencies
HOT
BEVERAGE
SYSTEMS
iMIX-3 PC
iMIX-3
iMIX-3S+
iMIX-3S
iMIX-3 (Oatmeal)
iMIX® Dispensers with 3 Hoppers
Sleek, eye-catching powdered beverage dispenser featuring advanced
mixing technology delivers exceptional hot drinks
•Three,8-pound(3.6kg)hoppers.
•Lightedfrontgraphicsformerchandising.
•Large4.4gallonhotwatertank.
•Cupclearanceof7.25”(18.4cm).
•Highspeed,heavy-dutywhipperforcompleteproductmixing.
Chai Display
Product No.: 37457.0002
•Frontofmachineaccessforeasyservice,setupandcalibration.
•Spring-loaded,allmetalaugerdrivesystemforeasyhopperinstallation.
Top hinge
units available
•Left,rightortop-hingeddooroption.
•Highspeed,heavy-dutywhipperforcompleteproductmixing.
iMIX
Hot Chocolate Display
Product No.: 37457.0002
•Low powderproductdetectionsystem.
•RPMfeedback.
Ab
•Nightmodepreventspilferage.
•CompatiblewithBUNNlink®.
Ab
iMIX-3S (OATMEAL)
Steamer Display
Product No.: 37457.0003
•Servesthreeinstantoatmeals.
•Top-hingeddesignminimizesmachinefootprint.
iMIX-3S+
•Setaspushandholdorsinglesizeportioncontrol.
•Displayallowsadjustmentsandserviceoperationaltestingfromfrontofmachine.Alsocommunicates
advertising messages, machine status and technical support contact information.
Model
Product #
HxWxD
Weight
Volts
Amps Watts
36900.0000
36900.0001
iMIX-3
36900.0003
36900.0004
Cappuccino
32.8" x 12.6" x 24.1"
(83.3cm x 32cm x 61.2cm)
36900.0002
iMIX-3S
38600.0000
iMIX-3S
(Oatmeal)
38600.0054
iMIX-3S+
38600.0001
iMIX-3
36900.0050
iMIX-3S
38600.0051
iMIX-3S+
38600.0050
Finish
Capacity
Cord
Attached
4.5 gal.
(17 L)
Yes
Agencies
Black
SST
Steamer
Hot Chocolate
36900.0005
iMIX-3 PC
Display
Specialty Tea
35.1” x 12.6” x 24.1”
(89.2cm x 32cm x 61.2cm)
90 lbs.
(40.8 kg)
120
15
1800
Black
Cappuccino
(top hinge unit)
35.1” x 12.6” x 24.1”
(89.2cm x 32cm x 61.2cm)
www.bunn.com
53
HOT
BEVERAGE
SYSTEMS
iMIX-5
iMIX-4
iMIX-5S
iMIX-5S+
iMIX® Dispensers with 4 or 5 Hoppers
Sleek, eye-catching powdered beverage dispenser featuring advanced mixing technology
delivers exceptional hot drinks
•iMIX-5:Five,8-pound(3.6kg)hoppers
iMIX-4: Four, 8-pound (3.6 kg) hoppers
•Lightedfrontgraphicsformerchandising.
•7.3gallon(27.63litre)hotwatertank.
•Cupclearanceof7.25”(18.4cm).
•Variablespeedmotorsallowcontrolofproductconsistency
in mixing chamber (.75 to 6.6 grams of powder per second).
•Highspeed,heavy-dutywhipper.
•Frontofmachineaccessforeasyservice.
•Spring-loaded,allmetalaugerdrivesystemforeasyhopperinstallation.
•Lightedfrontgraphicsformerchandising.
•Left,rightortop-hingeddooroption.
•Easilyremovablesidepanelsforcompleteaccesstoservicecomponents.
•CompatiblewithBUNNlink®.
Ab
iMIX-5
•Lowpowderproductdetectionsystem.
•RPMfeedback.
Ab
•Nightmodepreventspilferage.
iMIX-5S+
•Setaspushandholdorsinglesizeportioncontrol.
•Displayallowsadjustmentsandserviceoperationaltestingfromfrontofmachine.Alsocommunicates
advertising messages, machine status and technical support contact information.
54
Model
Product #
HxWxD
Weight
iMIX-4
37000.0004
32.8” x 19.5” x 24”
(83.3cm x 49.5cm x 61cm)
132 lbs.
(59.9 kg)
iMIX-5
37000.0000
32.8” x 19.5” x 24”D
(83.3cm x 49.5cm x 61cm)
iMIX-5S
38100.0000
iMIX-5S+
38100.0003
iMIX-4
37000.0050
iMIX-5
37000.0020
iMIX-5S
38100.0075
iMIX-5S+
38100.0050
www.bunn.com
32.8” x 19.5” x 24”
(83.3cm x 49.5cm x 61cm)
Amps
Watts
Finish
Capacity
Cord
Attached
120
15
1800
Black
4.5 gal.
(17 L)
Yes
135 lbs.
(61.2 kg)
132 lbs.
(59.9 kg)
(top hinge unit)
35.1” x 19.5” x 24”
(83.3cm x 49.5cm x 61cm)
Volts
135 lbs.
(61.2 kg)
Agencies
HOT
BEVERAGE
SYSTEMS
FMD-1
FMD-2
FMD-3
FMD-5
FMD-3
Fresh Mix Dispensers
•FMD-1:One,8-pound(3.6kg)hopper
FMD-2: Two, 4-pound (1.81 kg) hoppers
FMD-3: Three, 4-pound (1.81 kg) hoppers
FMD-4: One, 8-pound (3.6 kg) hopper;
Three, 4-pound (1.81 kg) hoppers
FMD-5: Five, 4-pound (1.81 kg) hoppers
•Variablespeedhoppermotorsofferawiderangeofproductmixratios
(.75 to 6.6 grams of powder per second).
•Lightedgraphicsformerchandising.
•Adjustablelegsanddriptrayallowupto7”(17.8cm)openingforservingcup.
•Speciallydesignedmixingsystemguaranteesperfectbeverageseverytime.
•Improvedautomaticrinsereducesrun-onafterbeverageisdispensed.
•Electricalandplumbingcomponentseasilyaccessiblethroughfrontandtop.
FMD DBC DISPENSER
•Easy-to-program,one-touchportioncontrolforthreecupsizes.
•Fastfill–perfectforquickservicerestaurants.
•Eachmixingchamberhasindependentpowdertowaterratio.
•Systemsetup is passwordprotected.
•Simplesetupandhopperthrowcalibrationsystem.
Model
Product #
HxWxD
SET00.0196
FMD-1 BLK
FMD-2 BLK
SET00.0203
SET00.0200
30" x 7.9" x 21"
(76.2cm x 20.1cm x 53.3cm)
SET00.0197
FMD-3 SST
SET00.0198
FMD-3 Soup
28600.0000
FMD-3 DBC
BLK
29250.0000
FMD-4 BLK
34900.0002
FMD-5 BLK
34900.0000
Volts
Amps
Watts
86 lbs.
(39.0 kg)
30” x 11.3” x 23.3”
(76.2cm x 28.7cm x 59.2cm)
29.3” x 18.6” x 21.2”
(74.4cm x 47.2cm x 53.8cm)
Display
4.2 gal.
(15.9 L)
Yes
Agencies
Standard
Mug Display
Café Latte
120
15
1800
Soup
85 lbs.
(38.6 kg)
Café Latte
123 lbs.
(55.8 kg)
Cord
Attached
Hot
Chocolate
84 lbs.
(38 kg)
118 lbs.
(53.5 kg)
Capacity
Standard
75 lbs.
(34 kg)
81 lbs.
(36.7 kg)
SET00.0207
FMD-3 BLK
Weight
Cappuccino
www.bunn.com
55
HOT
BEVERAGE
SYSTEMS
iMIX-14
iMIX-5S+ H&C
iMIX®-14 Hot Beverage System
Top hinge
unit available
Expands hot powdered offerings and promotes increased customer attention with
contemporary styling and digital advertising board
•Capacity:Four6.5-pound(2.94kg)hoppersforbasepowders
Two 2-pound (.91 kg) hoppers for flavor concentrate powders
•7”diagonaltouchscreencommunicatesadvertisingmessages,machinestatus,technicalsupport
contact information and provides programming for settings and service adjustment.
•LEDbacklitdoorandcontemporarystylingcreatestrikingcountertoppresence.
•7-gallonhotwatertanktomeetpeakservingtimes.
•Cupclearanceat6.75”(17.1cm)toaccommodatepopularcupsizes.
•Frontofmachineaccessforsetupandcalibration,tankdrain,dumpvalves,augerandwhipper
motors and control board for easy service.
iMIX® Hot and Iced Beverage Dispenser
Sleek powdered beverage dispenser featuring advanced mixing technology
delivers exceptional hot or cold drinks
•3dispensenozzlesforhotdrinksand2foricedcappuccinowithsplithot/icedcappuccinolighteddisplay.
•Capacity:five,8-pound(3.6kg)hoppers.
•Large,lightedfrontgraphicsformerchandising.
•One3gal.(11.35L)andone2gal(7.57L)hotwatertank,withindividuallycontrolledthermostats,
adjustable from 50° to 200°F, for optimum drink quality for hot and cold products.
•Cupclearanceat7.25”(18.4cm)toaccommodatepopularcupsizes[adjustableto8.12”(20.6cm)].
•Variablespeedmotorsallowcontrolofproductconsistencyinmixingchamber(.75to6.6gramsof
powder per second).
•Keyservicecomponentseasilyaccessiblethroughfront,top,andsides.
•Highspeed,heavy-dutywhipperforcompleteproductmixing.
•Frontofmachineaccesstotankdrain,dumpvalves,augerandwhippermotorsandcontrolboard
for easy service.
•Keylockonthedoorpreventstampering.
•Spring-loaded,allmetalaugerdrivesystemforeasyhopperinstallation.
•Canbesetaspushandholdorsinglesizeportioncontrol.
•Displayallowsadjustmentsandserviceoperationaltestingfromfrontofmachine.Alsocommunicates
advertising messages, machine status and technical support contact information.
Model
Product #
HxWxD
Weight
MIX-14
43800.0102
32.6” x 19.2” x 24”
(82.9cm x 48.8cm x 61cm)
137 lbs.
(62.1 kg)
40900.0000
32.8” x 19.5” x 24”
(83.3cm x 49.5cm x 61cm)
iMIX-5S+H&I
40900.0050
56
www.bunn.com
(top hinge unit)
35.1” x 19.5” x 24”
(83.3cm x 49.5cm x 61cm)
135 lbs.
(61.2 kg)
Volts
Amps
Watts
Finish
Capacity
Cord
Attached
120
15
1800
Black
4.5 gal.
(17 L)
Yes
Agencies
COLD
BEVERAGE
SYSTEMS
JDF-2S
JDF-2SPCLD
(Lighted Door with Portion Control)
Cold Beverage Systems - Juice
Cold beverage dispenser with High Intensity® mixing delivers superior drinks consistently
•Onedispenserdeliversbothfrozenandambientproductsincreasingprofitsbyloweringcosts.
•DrinkconsistencyassuredwiththeBUNNHighIntensity® mixing technology.
Ab
•Pumpsandmixes2+1to11+1concentratedbeverages,including4+1highviscosity
and 5+1 juices accurately and consistently.
•Quickdispensewith1.0to1.5ounces(29.6to44.4ml)persecondflowrate.
•7”cupclearanceaccommodatesmostjuicecontainers.
•8lb.(3.6kg)icebankprovidessuperiorcolddrinkcapacity.
•Advancedconcentratepumpdesignedforeasysetup,accuracyanddurability.
•Modulardispensedeckmakesservicefast,simple.
•Bothpush-buttonandsingle-sizeportioncontrol.
•Dualdispensemodelallowssimultaneousdispensefrombothdispenseheads(juice display only).
•Threesizeportioncontrol,lighteddoormodelsavailable.
•LighteddoorunitsusehighefficiencyLEDlighting.
•Preventivemaintenancekit:39690.0000.
•Extendeddriptray44015.1000.(see page 71)
Model
Product #
JDF-2S
(with air filter)
37900.0001
JDF-2S
(dual dispense)
JDF-2SLD
JDF-2S
(dual dispense)
JDF-2SPCLD
(portion control)
JDF-2SLD
(dual dispense)
HxWxD
Weight
Volts
Amps
Lighted
Display
Dispense
Capacity
Cord
Attached
push
button
4 (5 oz..)
drinks/
min.
Yes
Agencies
No
37900.0025
37900.0008
37900.0026
37900.0016
33.1” x 10” x 25.5”
(84.1cm x 25.4cm x 64.8cm)
103 lbs.
(46.7 kg)
120
4.5
Yes
37900.0027
www.bunn.com
57
COLD
BEVERAGE
SYSTEMS
JDF-4PCLD
JDF-4S
(Lighted Door with Portion control)
JDF-4LD
(Lighted Door)
Cold Beverage Systems - Juice
Cold beverage dispenser with High Intensity® mixing delivers superior drinks consistently
•Onedispenserdeliversbothfrozenand ambientproductsincreasingprofitsbyloweringcosts.
•DrinkconsistencyassuredwiththeBUNNHighIntensity® mixing technology.
Ab
•Pumpsandmixes2+1to11+1concentratedbeverages,including4+1highviscosityand5+1juices
accurately and consistently.
•Quickdispensewith 1.0to1.5ounces(29.6to44.4ml)persecondflowrate.
•7”(17.8cm)cupclearanceaccommodatesmostjuicecontainers.
•18lb.(8.2kg) icebankprovidessuperiorcolddrinkcapacity.
•Advancedconcentratepumpdesignedforeasysetup,accuracyanddurability.
•Twomodulardispensedecksmakesservicefastandsimple.
•Bothpush-buttonandsingle-sizeportioncontrolinthesamemachine.
•Dualdispenseallowsimultaneousdispensefrombothdispenseheads(juice display only).
•Threesizeportioncontrol,lighteddoormodelsavailable.
•Doorlockstandard.
•Coldwateroptionavailable.
•LighteddoorunitsusehighefficiencyLEDlighting.
•Preventivemaintenancekit:39690.0000.
•Extendeddriptray40789.1000.(see page 71)
58
Model
Product #
JDF-4S
37300.0000
JDF-4S
(with cold water)
37300.0002
JDF-4SLD
37300.0004
JDF-4SLD
(with cold water)
37300.0006
JDF-4SPCLD
(portion control)
37300.0023
www.bunn.com
HxWxD
Weight
Volts
Amps
Lighted
Display
Dispense
Capacity
Cord
Attached
push button
3 (12 oz.)
drinks/
min.
Yes
No
33.1” x 15.7” x 25.5”
(84.1cm x 39.9cm x 64.8cm)
129 lbs.
(58.5 kg)
120
6
Yes
Agencies
COLD
BEVERAGE
SYSTEMS
JDF-2SIC
JDF-2SICLD
JDF-4SIC
JDF-4SICLD
(Lighted Door)
(Lighted Door)
Cold Beverage Systems - Iced Coffee
Cold beverage dispenser with High Intensity® mixing delivers superior drinks consistently
•Onedispenserdeliversbothfrozenandambientproductsincreasingprofitsbyloweringcosts.
•DrinkconsistencyassuredwiththeBUNNHighIntensity® mixing technology.
Ab
•Pumpsandmixes2+1to11+1concentratedbeverages,including4+1highviscosityand5+1
juices accurately and consistently.
•Quickdispensewith1.0to1.5ounces(29.6to44.4ml)persecondflowrate.
•7”cupclearanceaccommodatesmostjuicecontainers.
•JDF-28lb.(3.6kg)andJDF-418lb.(8.2kg)icebankprovidessuperiorcolddrinkcapacity.
•Advancedconcentratepumpdesignedforeasysetup,accuracyanddurability.
•Modulardispensedeckmakesservicefastandsimple.
•Bothpush-buttonandsingle-sizeportioncontrolinthesamemachine.
•Threesizeportioncontrol,lighteddoormodelsavailable.
•LighteddoorunitsusehighefficiencyLEDlighting.
•Preventivemaintenancekit:39690.0000.
•JDF-2Sextendeddriptray44015.1000andJDF-4Sextendeddriptray40789.1000.(see page 71)
Model
Product #
JDF-2S
(Iced Coffee)
37900.0002
JDF-2SLD
(Iced Coffee)
37900.0009
JDF-4S
(Iced Coffee)
37300.0013
JDF-4S
(Iced Coffee)
(with cold water)
37300.0016
JDF-4SLD
(Iced Coffee)
37300.0020
H x W x Dn
Weight
33.1” x 10” x 25.5”
(84.1cm x 25.4cm x 64.8cm)
103 lbs.
(46.7 kg)
Volts
Amps
Lighted
Display
No
Yes
129 lbs.
(58.5 kg)
No
6
Capacity
Cord
Attached
Agencies
4 (5 oz.)
drinks/
min.
4.5
120
33.1” x 15.7” x 25.5”
(84.1cm x 39.9cm x 64.8cm)
Dispense
Pushbutton
Yes
3 (12 oz.)
drinks/
min.
Yes
www.bunn.com
59
COLD
BEVERAGE
SYSTEMS
iMIX-5 IC
iMIX-5S+ IC
iMIX-3 IC
iMIX-3S+ IC
Iced Cappuccino Display
Product No.: 37457.0006
iMIX® Dispensers - Iced Coffee
Sleek, eye-catching powdered beverage dispenser featuring advanced mixing
technology delivers exceptional cold drinks
•Three,8-pound(3.6kg)hoppers
•Lightedfrontgraphicsformerchandising.
•Large4.4gallonhotwatertank.
•Cupclearanceof7.25”(18.4cm).
•Highspeed,heavy-dutywhipperforcompleteproductmixing.
•Frontofmachineaccessforeasyservice,setupandcalibration.
•Spring-loaded,allmetalaugerdrivesystemforeasyhopperinstallation.
•Leftorright-hingeddooroption.
•Keyservicecomponentseasilyaccessiblethroughfront,topandside.
•Highspeed,heavy-dutywhipperforcompleteproductmixing.
IMIX AND IMIX-5
•RPMfeedback.
Ab
•Nightmodepreventspilferage.
•CompatiblewithBUNNlink®.
Ab
IMIX-3S+ AND IMIX-5S+
•Canbesetaspushandholdorsinglesizeportioncontrol.
•Displayallowsadjustmentsandserviceoperationaltestingfromfrontofmachine.Alsocommunicates
advertising messages, machine status and technical support contact information.
60
Model
Product #
HxWxD
Weight
iMIX-3 IC
36900.0026
iMIX-3S+ IC
38600.0006
32.8" x 12.6" x 24.1"
(83.3cm x 32cm x 61.2cm)
90 lbs.
(40.8 kg)
iMIX-5 IC
37000.0002
iMIX-5S+ IC
38100.0010
www.bunn.com
32.8” x 19.5” x 24”
(83.3cm x 49.5cm x 61cm)
135 lbs.
(61.2 kg)
Volts
Amps
Watts
Finish
Capacity
Cord
Attached
120
15
1800
Black
4.5 gal.
(17 L)
Yes
Agencies
FROZEN
BEVERAGE
Ultra-2
Ultra-2 CF Valve
SYSTEMS
All models
come with
extended
handle
Ultra™ Gourmet Ice® Systems
Frozen beverage dispenser with reversing auger technology for superior mixing and freezing
•Torquesensorytechnologymaintainsconsistentproductthicknessforsuperiorbeverages.
•Reversing auger design quickens freeze time and reduces air mixing with product.
•Verysimpletoprogram,cleaningandpreventivemaintenancerunwithtouchpaddisplay.
•Internallymonitoredrefrigerationsystem.
•Liquidautofillmodelsavailable.PleasecontactyourBUNNsales representative.
•CompatiblewithBUNNlink®.
Ab
ULTRA-2
•Full2-yearpartsand1-yearlaborwarranty.5-yearpartsand1yearlaborwarrantyoncompressor
and 3-year parts and labor warranty on electronics. See the product manual for additional details.
ULTRA-2 CF VALVE
•Constantflowcontrolforaccuratebrixingofproduct.
ULTRA-2 HP
Enhanced-performance frozen beverage dispenser shortens freeze down times
•HighPerformanceversusstandardmodelcomparison:
Ambient Room Temp. Ultra-2 HP is:
70ºF
17% Faster freeze down time
80ºF
21% Faster freeze down time
90ºF
32% Faster freeze down time
Note: The higher the ambient temperature, the greater the improvement over the standard model.
Model
Product #
HxWxD
Weight
Volts
Amps
Watts
34000.0001
31.9" x 16" x 24.5"
(81cm x 40.6cm x 62.2cm)
34000.0008
34000.0063
ULTRA-2
(flat lid)
34000.0521
Stainless/
White
31.9” x 16” x 27.5”
(81cm x 40.6cm x 69.9cm)
Stainless/
Black
34000.0522
Black
34000.0012
Stainless/
White
34000.0013
29.9” x 16” x 24.5”
(75.96cm x 40.6cm x 62.2cm)
34000.0081
34000.0080
34000.0067
ULTRA-2
with Autofill
Hoppers
137 lbs.
(62.0 kg)
120
12
1440
Black
31.9” x 16” x 24.5”
(81cm x 40.6cm x 62.2cm)
Yes
All Black
Stainless/
White
34000.0068
All Black
34000.0069
Stainless/
Black
34000.0073
2 Hoppers
@ 3.0 gal.
each
Agencies
Stainless/
White
Stainless/
Black
34000.0079
ULTRA-2 HP
Cord
Attached
All Black
(painted frame, Spanish)
34000.0520
ULTRA-2
(CF Valve)
Capacity
Stainless/
White
Stainless/
Black
34000.0000
ULTRA-2
Finish
(painted frame, Spanish)
Black
www.bunn.com
61
FROZEN
BEVERAGE
SYSTEMS
AFPO-2 SL
Ultra-2 PAF
(Autofill System - total pumping and
metering system for liquid product)
Ultra-1
Ultra™ Gourmet Ice® Systems
Frozen beverage dispenser with reversing auger technology
for superior mixing and freezing
•Torque sensory technology maintains consistent product thickness for superior beverages.
•Reversing auger design quickens freeze time and reduces air mixing with product.
•Verysimpletoprogramandrunwithtouchpaddisplay,whichalsoguidescleaning
and preventive maintenance.
•Internallymonitoredrefrigerationsystem.
•Liquidautofillmodelsavailable.PleasecontactyourBUNNsalesrepresentative.
•CompatiblewithBUNNlink®.
Ab
ULTRA-1
•Full2-yearpartsand1-yearlaborwarranty.5-yearpartsand1yearlaborwarrantyoncompressorand
3-year parts and labor warranty on electronics. (See the product manual for additional details.)
ULTRA-2 PAF
•Powderedautofillproducthoppersrefillproductatarateof1.1fluidoz./sec.
•Full3-yearpartsandlaborwarrantyonelectronicsand5-yearpartswarrantyoncompressor.
(See the product manual for additional details.)
•HighefficiencyLEDlightingsystem.
Model
Product #
HxWxD
Weight
Volts
Amps
Watts
39800.0000
ULTRA-1
39800.0002
31.9” x 7.9” x 24.2”
(81cm x 20.1cm x 61.5cm)
76.4 lbs.
(34.7 kg)
7.5
900
SST/Black
1 Hoppers
@ 3.0 gal.
each
42" x 16" x 25"
(106.7cm x 40.6cm x 63.5cm)
177.6 lbs.
(80.6 kg)
7.8” x 17.5” x 12.7”
(19.8cm x 44.5cm x 32.3cm)
35 lbs.
(15.9 kg)
SST/White
120
12
1440
Black
5 lbs. dry
product
34000.0501
62
AFPO-2, SL
28400.0004
AFPO-2
28400.0007
www.bunn.com
Cord
Attached
Black
34000.0500
ULTRA-2 PAF
Capacity
SST/White
39800.0004
34000.0504
(no logo)
Finish
4
480
Black
5 lbs. dry
product
Yes
Agencies
PRECISE
TEMPERATURE
SYSTEMS
OHW
HW2
H5X
H5E-DV PC
H10X
Precise Temperature Water Dispensers
(HW2, H5 and HW10)
•Pourovermodeltank size:80oz..(2.37litres)
•Precisetemperature72°-212°F(22.2°C-100°C)ensuresconsistentresults.(OHW models)
•Includesdriptray.(HW2 and OHW models)
•Highquality,easy-to-cleanstainlesssteelexteriorandtankforalonglife.
•Includesdry-plugpreventionforeasyinstallation.(H10X models)
•Pourovermodelplugsintoany120voltoutlet,noplumbingneeded.
•H5modelscanbefrontorsidewallmounted.
•DriptrayavailableforH5models.ProductNo.02497.0000
POUROVER & MEDIUM VOLUME MACHINES
Model
Product #
OHW
02550.0003
HW2
02500.0001
HW2 Black
02500.0005
Volts
Amps
Watts
8.6
1040
120
ºF
Settings
200
15
1800
Capacity
HxWxD
Weight
80 oz..
(2.37 L)
16.9” x 6.5” x 10.8”
(42.9cm x 16.8cm x 27.4cm)
13 lbs.
(5.9 kg)
24” x 7.1” x 14.3”
(60.96cm x 18.03cm x 36.3cm)
23 lbs.
(10.43
kg)
4.2 gal.
(15.9 L)
HW2 (Oatmeal) 02500.0012
Cord
Agencies
Attached UL LISTED
UL
LISTED
Yes
LARGE VOLUME MACHINES
Model
H5E-18-120
Product #
12500.0020
12500.0033
Volts
Amps
Watts
120
15.4
1850
H5E-40-240
12500.0024
240
16.9
H5E-40-208
12500.0025
208
19.5
120
15.4
1850
240
16.9
4050
120
15.4
1800
240
16.9
208
19.5
ºF
Settings
39100.0001
H5X-DV PC
39100.0005
H5X-40-240
12500.0026
H5X-40-208
12500.0027
hot water
input 140º
HxWxD
Weight
Cord
Attached
Agencies
85/115
72
32 lbs.
(14.1 kg)
varies with application
4050
200
39100.0000
H5E-DV PC
cold water
input 35º
90
212
4050
212
3.7 gal.
(14 L)
8.1 gal.
(31 L)
7.3 gal.
(27.6 L)
14.7 gal.
(55.6 L)
3.7 gal.
(14 L)
8.1 gal.
(31 L)
7.3 gal.
(27.6 L)
14.7 gal.
(55.6 L)
3.7 gal.
(14 L)
8.1 gal.
(31 L)
9.9 gal.
(37.5 L)
18.6 gal.
(70.4 L)
33 lbs.
(15.0 kg)
44 lbs.
(20.0 kg)
35 lbs.
(15.9 kg)
UL
28.5" x 7.1" x 17.5"
(72.4cm x 18.03cm x 44.5cm)
LISTED
No
H5X-18-120
12500.0028
120
15.4
1850
H5X-60-208
12500.0032
208
29
6050
H5M-18-120
12500.0046
120
15.4
1850
200
3.7 gal.
(14 L)
8.1 gal.
(31 L)
H10X-80-208
26300.0001
208
38.7
H10X-80-240
26300.0000
240
33.5
8050
212
13.2 gal.
(50 L)
24.8 gal.
(93.9 L)
32 lbs.
(14.1 kg)
34.4" x 10.2" x 24.5"
(87.4cm x 25.9cm x 62.2cm)
66.7 lbs.
(30.3 kg)
www.bunn.com
63
PRECISE
TEMPERATURE
SYSTEMS
H5E Element
Precise Temperature Water Dispensers
•Digitalthermostatprovidesconsistentandaccuratetemperaturesof60º-212ºF(15.6º-100ºC).
•Newcontemporary,space-savingdesign.
•LEDdisplayprovidessimpletemperatureadjustment.
•Programmable“EnergySaverMode”reducesoperatingcostduringidleperiods.
•Thinsulate® tank insulation provides increased energy efficiency.
•Theperfecttoolforaddedcontroloverqualitycoffeeandtea.
LARGE VOLUME MACHINES
Model
Product #
Volts
Amps
Watts
43600.0000
H5E Element
H5E Element
White
H5E Element
Red
H5E Element
Copper
H5E Element
Black
64
ºF
Settings
cold water
input 35º
hot water
input 140º
200
varies with application
43600.0002
212
7.3 gal.
(27.6 L)
43600.0007
200
varies with application
43600.0011
212
7.3 gal.
(27.6 L)
43600.0004
200
varies with application
212
7.3 gal.
(27.6 L)
43600.0005
200
varies with application
43600.0009
212
7.3 gal.
(27.6 L)
43600.0006
200
varies with application
212
7.3 gal.
(27.6 L)
43600.0008
43600.0010
www.bunn.com
208
19.5
4050
HxWxD
Weight
28.5" x 7.1" x 17.5"
(72.4cm x 18.03cm x 44.5cm)
32 lbs.
(14.1 kg)
Cord
Attached
Agencies
14.7 gal.
(55.6 L)
14.7 gal.
(55.6 L)
14.7 gal.
(55.6 L)
14.7 gal.
(55.6 L)
14.7 gal.
(55.6 L)
UL
No
LISTED
RELATED
PRODUCTS
Water Quality Filter Systems
Quality beverages begin with quality water
BUNN® water quality filtration systems, when used with BUNN brewing equipment, ensure that your customers are getting the
best tasting beverage possible. The Easy Clear® filters are manufactured to BUNN specifications and address water problems
such as taste and odor; sediment, limescale and hardness.
New EQHP Model #
New EQHP Part #
New Configuration
Capacity @ Flow Rate
Replacement Cartridges
EQHP10L
39000.0001
10000 gal @ 1.5 gpm
39000.1001
EQHP10
39000.0004
10000 gal @ 1.5 gpm
39000.1004
EQHP25L
39000.0002
25,000 gal @ 2.1 gpm
39000.1002
EQHP25
39000.0005
25,000 gal @ 2.1 gpm
39000.1005
EQHP35L
39000.0011
35,000 gal @ 3.34 gpm
39000.1011
EQHP54L
39000.0003
54,000 gal @ 5 gpm
39000.1003
EQHP54
39000.0006
54,000 gal @ 5 gpm
39000.1006
EQHP-TWIN 70L*
39000.0012
70,000 gal @ 6.68 gpm
EQHP-TWIN 108SP**
39000.0013
108,000 gal @ 10 gpm
Scale-Pro
39000.0010
Recommended 6 month change-out
(2) 39000.1011
(2) 39000.1006
(1) 39000.1010
39000.1010
EQHP-ESP
39000.0008
422 gal @10.5 gpg @.5gpm
39000.1008
EQHP-SFTN
39000.0009
1350 grains
39000.1009
EQHP-TEA
39000.0007
4350 grains
39000.1007
*Requires two (2) cartridges; **Requires three (3) cartridges
Paper Filters
Selection of coffee filters is a vital step in brewing perfect coffee - don’t
settle for anything less than BUNN quality coffee filters. Using the results
of years of research, BUNN manufactures the best filters from high
quality, heavy weight paper, so the water flows properly through the
coffee. BUNN filters are uniquely designed for strength so the sides are taller,
and you don’t end up with overflow and grounds in your coffee.
BUNN’s paper stock used in the manufacturing of our coffee filters is produced
using an elemental chlorine-free (ECF) bleaching method.
Filter Type
Product #
Urn
Filters
Other
Filters
Number per
Bag
Bags
per
Case
Number
Cluster
Overall Measure x
Base Diameter
(inches)
Packed
per
Case
Case
Weight
(lbs./kg)
Cases per
Skid/Tier
500
2
50
9 3/4 x 4 1/4
1000
4.2/1.91
180/15
500
2
50
9 /2 x 3 /4
1000
4.2/1.91
180/15
500
2
50
1
9 /4 x 4 /4
1000
4.5/2.04
180/15
20122.0000
Regular
C, S, R, O, VLPF, VPR, VPS, VP-17
Regular Narrow
C, S, R, O, VLPF, VPR, VPS, VP-17
Regular Fast Flow
C, S, R, O, VLPF, VPR, VPS, VP-17
20106.0000
A10/Retail - 8 & 10 cup brewers
500
2
50
8 /2 x 3
1000
3.4/1.54
231/21
20109.0000
Urn - U3, SRU, IC-3
252
1
36
17 3/4 x 7 1/4
252
5.5/2.49
88/11
20112.0000
Narrow Base Urn
250
1
25
18 1/2 x 6 1/4
250
5.5/2.49
88/11
20124.0000
Urn, 3 gallon
252
1
36
19 x 7 /4
252
6.1/2.77
88/11
20111.0000
Urn, 6 gallon
252
1
36
20 x 7 /4
252
6.6/2.99
84/12
20125.0000
Urn, 6 gallon
250
1
25
21 x 8 3/4
250
7.5/3.4
72/9
20113.0000
Urn, 10 gallon
250
1
25
23 3/4 x 8 3/4
250
9.3/4.22
54/9
20131.0000
Urn, 10 gallon
252
1
36
24 /4 x 10 /4
252
9.7/4.40
36/6
20120.0000
System III
252
2
36
15 /8 x 5 /8
504
8.5/3.86
108/12
20100.0000
Tea - Tea Brewers, Single & Dual Coffee
brewers, 1 1/2 gallon urns, ITCB,System II
20157.0000
Gourmet C Funnel
20138.0000
Gourmet - Iced Tea, Dual, Dual SH,
Dual TF, 1 1/2 gallon urns
20115.0000
Decanter
Filters
Description
20116.0000
500
252
1
2
1
3
1
1
3
1
1
36
3
3
12 /4 x 5 /4
500
4.7/2.13
150/15
12 1/2 x 4 3/4
1000
8.25/3.74
60
13 3/4 x 5 1/4
504
5.5/2.49
108/12
3
50
1
1
www.bunn.com
65
RELATED
PRODUCTS
Easy Pour® Decanters
WX2
WS2
WL2
Glass and Stainless
NCD Decanter
WX1
Coffee Decanters and Warmers
Easy Pour® is an exclusive BUNN design that assures convenient
serving with a drip-proof, fast pouring lip from front or either side
EASY POUR®
•Containerandhandleareaonepiecemoldeddesignforextrastrengthanddurability.
WL2 with Easy Pour®
•Clear,high-impact-resistantmaterialcomplieswithFDAregulationsforfoodcontact.
•Baseishighqualitystainlesssteel.
•EasyPour® decanters can be private labeled. Please contact your BUNN sales representative for more information.
GLASS DECANTERS
•Reliable,shatter-resistant,andperfectlybalanced(Laboratory-grade,stress-freeglass)
•State-of-the-artconnectionprocessusedwthfoodgradepolymericmaterialsismoreearth-friendlyandeliminates
the need for vinyl gaskets or “O” rings
WARMER
•Warmersareanidealwaytomerchandisethearomaandappearanceofyourfresh-brewedcoffeeindecanters
at remote serving stations.
•Completelineofsingle,side-by-sideandstep-upwarmerstofityourservingneeds.
•Eachwarmerhasaseparate“on/off”switchandmaintainscoffeeatoptimumservingtemperature.
DECANTERS
Model
Product #
Handle
Easy Pour
64 oz..
06100.0101
Black
06101.0101
Orange
42400.0101
Black
42401.0101
Orange
06026.0000
Black
06041.0000
Orange
34116.0001
Black
Glass
64 oz..
Stainless 64 oz..
NCD 64 oz..
Shipping Weight
Number in Case
Agency
1.0 lb. (0.5 kg)
1
1.5 lbs. (0.7 kg)
1.0 lb. (0.5 kg)
WARMERS
Model
WS2
Product #
Finish
12882.0004
Stainless
12882.0006
Black
11402.0001
WL2
11402.0004
11402.0006
WX1
Stainless
Number of
Warmers
Two
06450.0004
66
06310.0004
www.bunn.com
7 lbs.
(3.2 kg)
Brewer
HxWxD
For use with S, ST
& STF brewers
6" x 7.5" x 17.8"
(15.24cm x 19.05cm x 45.21cm)
For use with C, CW
& VP17, etc. brewers
5.2" x 8" x 18"
(13.21cm x 20.32cm x 45.72cm)
Black
One
Stainless
WX2
Shipping
Weight
Two
3 lbs.
(1.4 kg)
4 lbs.
(1.8 kg)
For use with S, ST
& STF brewers
6.5" x 2.53" x 7"
(16.51cm x 6.4cm x 17.8cm)
For use with S, ST
& STF brewers
14" x 2.53" x 7"
(35.6cm x 6.4cm x 17.8cm)
Agency
UL
LISTED
RELATED
PRODUCTS
UNIV-3 APR
UNIV-2 APR
Universal Airpot Racks
Colorful, versatile merchandising system for airpots
AIRPOT RACKS
•Holdspush-buttonorlever-actionairpots.
•Displayscanbecombinedortakenaparteasilyforgreaterflexibility.
•Sturdy,carbon-steelwireconstructionwithvinylcoatingresists
corrosion, easy to clean.
•Sponge-linedtraystocatchdripsandspills.
* Please refer to specification sheets found on-line at
www.bunn.com for detailed drawings.
UNIV-4 APR
UNIVERSAL AIRPOT RACKS
Model
UNIV-2 APR
Product #
HxWxD
Weight
35728.0000
14.1” x 7.5” x 24.1”
(35.8cm x 19.1cm x 61.2cm)
5 lbs. (2.3 kg)
35728.0001
6.9” x 14.9” x 11.2”
(17.5cm x 37.9cm x 28.5cm)
4.5 lbs. (2 kg)
35728.0002
6.9” x 22.9” x 11.2”
(17.5cm x 58.2cm x 28.5cm)
6 lbs. (2.7 kg)
3 airpots
35728.0003
14.0” x 14.9” x 24.9”
(35.6cm x 37.9cm x 63.3cm)
10 lbs. (4.5 kg)
4 airpots
35728.0004
14.0” x 22.9” x 24.9”
(35.6cm x 58.2cm x 63.3cm)
13 lbs. (5.9 kg)
5 airpots
35728.0005
14.0” x 22.9” x 24.9”
(35.6cm x 58.2cm x 63.3cm)
15 lbs. (6.8 kg)
6 airpots
(1 upper, 1 lower)
(2 lower)
UNIV-3 APR
UNIV-4 APR
UNIV-5 APR
UNIV-6 APR
(3 lower)
(2 upper, 2 lower)
(3 upper, 2 lower)
(3 upper, 3 lower)
Capacity
2 airpots
www.bunn.com
67
RELATED
PRODUCTS
Stock Funnels
BLACK PLASTIC FUNNEL
TITAN™ FUNNEL
BLACK PLASTIC SPLASHGARD®
FUNNEL WITH DECALS
URN FUNNEL
Product #: 38766.0002
•ForusewithA10brewer.
Product #: 20583.0003
•ForusewithCDBC,CWT,AXIOM® and
SmartWAVE® brewers.
Product #: 40114.0000
•ForusewithTitan™ brewers
Product #: 07022.0012
•ForusewithSRUandU3brewers
GOURMET C FUNNEL
BLACK PLASTIC ITCB FUNNEL
Product #: 03021.0008
•ForusewithITCBwhenbrewingcoffee.
BLACK PLASTIC SINGLE/DUAL
FUNNEL
Product #: 22735.0000
•ForusewithSingle®, Dual® and Soft
Heat® brewers.
Product #: 34559.0000 (7.12 inch width)
•ForusewithCDBC,CWTAXIOM® and
SmartWAVE® brewers
Product #: 34559.0001 (7.62 inch width)
•ForusewithCDBCTwin,CWTTwinand
AXIOM® Twin brewers
•Universaldesign–handlemaybemoved
to appropriate side
•Allowsbrewingwithheavierthrowweights
of coffee.
TRANSLUCENT COFFEE FUNNEL
STAINLESS STEEL
SPLASHGARD® FUNNEL
Product #: 20216.0000 (7.12 inch width)
•ForusewithCDBC,CWTAXIOM® and
SmartWAVE® brewers.
Product #: 20217.0000 (7.62 inch width)
•ForusewithCDBCTwin,CWTTwinand
AXIOM® Twin brewers.
STAINLESS STEEL DUAL/SINGLE
FUNNEL
Product #: 20201.1201
•For use with Single®, Dual®, and Soft
Heat® brewers.
SMART FUNNEL®
Product #: 32643.0000
•ForusewithBrewWISE® ThermoFresh®,
Soft Heat®, DBC® and ICB brewers.
Product #: 20583.0002 (standard)
•ForusewithS,VP,andCWTFbrewers
Product #: 29351.0000 (wide)
•ForusewithF,O,R,andXbrewers
TRANSLUCENT TEA FUNNEL
Product #: 03021.0004 (standard )
•ForusewithITCB,TB3andTU3brewers
Product #: 03021.0005 (quick dispense)
•ForusewithITB,TB3QandTU3Qbrewers
TRANSLUCENT DUAL DILUTION
TEA FUNNEL
Product #: 03021.0013 (standard )
•ForusewithTB6brewer
Product #: 03021.0014 (quick dispense)
•ForusewithTB6Qbrewer
NOTE: All funnels shown (excluding #38766.0002)
are designed with SplashGard ® to help deflect hot
liquids away from the hand.
Ab
68
www.bunn.com
RELATED
PRODUCTS
Special Purpose Funnels
TRANSLUCENT POUCH PACK
FUNNEL
Product #: 35282.0001
•ForusewithTU3Q.
Product #: 35282.0002
•ForusewithTU3,TB3.
•Use with rectangular tea pouch pack.
•See through material guards against
hot water spills when removed.
UNIVERSAL STAINLESS POUCH
PACK FUNNEL
Product #: 29151.0000 (black handle)
Product #: 29151.0001 (orange handle)
•Interchangeablehandleallowsusein
all BUNN decanter brewers.
POUCH PACK FUNNEL FOR
SATELLITE BREWERS
Product #: 35282.0000 (black)
•ForDualsandSingles.
POUCH PACK FUNNEL SMALL BREW CHAMBER
Product #: 02073.0010 (black)
•ForusewithF,O,R&Xbrewers.
Product #: 04274.0012 (black)
Product #: 04274.0010 (brown)
•ForusewithS,VP,&CWTFbrewers.
POUCH PACK FUNNEL LARGE BREW CHAMBER
Product #: 02074.0010 (black)
•ForusewithF,O,R&Xbrewers.
Product #: 02774.0011 (black)
Product #: 02774.0010 (brown)
•ForusewithS,VP,&CWTFbrewers.
Drip Trays (Coffee)
SINGLE®, SINGLE SH BREWERS
and SINGLE SH STAND
Product #: 26830.0000 Kit
Product #: 26918.1000 Drip Tray
Product #: 26801.0000 Drip Tray Cover
RWS1 WARMER
Product #: 20213.0103 Kit
Product #: 20213.0301 Bracket
Product #: 20213.0200 Drip Tray
Product #: 03229.0000 Drip Tray Cover
DUAL®, DUAL SH BREWERS
and 2SH STAND
Product #: 27150.0000 Kit
Product #: 26971.1000 Drip Tray
Product #: 26916.0000 Drip Tray Cover
RWS2 WARMER
Product #: 20213.0100 Kit
Product #: 20213.0200 Bracket
Product #: 20213.0200 Drip Tray
Product #: 03229.0000 Drip Tray Cover
DUAL® BREWERS
Product #: 20213.0101 Kit
•IncludesDripTray,DripTrayCover,and
Bracket.
LCR-3 HV
Product #: 41656.0000 Kit
•IncludesDripTray,DripTrayCover,and
Bracket.
ThermoFresh® SERVER
Product #: 35008.0000 Drip Tray
Product #: 35014.0000 Drip Tray Cover
www.bunn.com
69
RELATED
PRODUCTS
Drip Trays (Coffee) cont.
NEW ThermoFresh® SERVER
Product #: 38931.0000 Drip Tray
Product #: 38932.0000 Drip Tray Cover
SRU COFFEE URN
Product #: 06465.0000 Kit
•Includeseverythignshown.
Drip Trays (Tea)
TCD
and
TDO
Product #: 38029.1000 Kit
Product #: 03207.0004 Drip Tray
Product #: 26801.0000 Drip Tray Cover
TDO-N
Product #: 39626.0000 Drip Tray
Product #: 39627.0000 Drip Tray Cover
U3 COFFEE URN
Product #: 07284.0000 Kit
Product #: 07286.0000 Drip Tray
Product #: 07285.0000 Drip Tray Cover
FMD-1
AIRPOT RACK
Product #: 25368.0000 Drip Tray
Product #: 25367.0000 Drip Tray
Sponge Liner
Drip Trays (Hot Water)
HW2, H5M, H5E,
Drip Trays (Fresh Mix)
and
and
FMD-2
Product #: 02571.0000 Drip Tray
Product #: 28966.0000 Drip Tray Cover
FMD-3
Product #: 28699.0000 Drip Tray
Product #: 28267.0000 Drip Tray Cover
H5X
Product #: 02497.0000 Kit
Product #: 02545.0000 Drip Tray Only
Product #: 02546.0000 Drip Tray Cover
Product #: 02547.0000 Foot, Rubber
(Not pictured. Four (4) are required.)
OHW
Product #: 02497.0001 Kit
Product #: 02571.0000 Drip Tray
Product #: 02572.0000 Drip Tray Cover
Product #: 02547.0000 Foot, Rubber
FMD-4
and
FMD-5
Product #: 34716.0000 Drip Tray
Product #: 34717.0000 Drip Tray Cover
iMIX-3
Product #: 36984.0000 Drip Tray
Product #: 36985.0000 Drip Tray Cover
(Not pictured. Four (4) are required.)
iMIX-4
and
iMIX-5
Product #: 36670.0000 Drip Tray
Product #: 36739.0000 Drip Tray Cover
70
www.bunn.com
RELATED
PRODUCTS
Drip Trays
(Gourmet Juice)
JDF-2 S
Product #: 38765.1000 Kit
Product #: 38764.0000 Drip Tray
Product #: 26801.0000 Drip Tray Cover
Drip Trays
(Gourmet Ice)
ULTRA-2 WHITE
Product #: 28086.0000 Drip Tray
Product #: 32068.0000 Drip Tray Cover
ULTRA-2 BLACK
JDF-2 S EXTENDED
Product #: 44015.1000 Kit
Product #: 26801.0000 Drip Tray Cover
•Increasescupclearancetp10.25”.
Product #: 28086.0001 Drip Tray
Product #: 32068.0001 Drip Tray Cover
JDF-4
Product #: 33814.1001 Drip Tray
Product #: 33811.0000 Drip Tray Cover
JDF-4 S
Product #: 38764.1001 Kit
JDF-4 S EXTENDED
Product #: 40789.1000 Kit
Product #: 33811.0000 Drip Tray Cover
•Increasescupclearancetp10.25”.
www.bunn.com
71
MINIMIZE THE COST OF EQUIPMENT OWNERSHIP
Choose BUNNserve and be
assured of authorized support
so you can serve the wonderful
beverages your customers demand.
•
•
•
•
•
Availability — 24/7/365!
Project Management
Customer Centric Metrics
Information Management
Global Coverage
Equipment
Logistics and
Installations
Calibrations and
Preventative
Maintenance
Asset Tracking
and
Ser vice Histor y
Technical
Suppor t and
Onsite Repairs
Equipment
Removal and
Replacements
72
www.bunn.com
EXCLUSIVE BUNN PROGRAMMING
and
DESIGN FEATURES
Bypass (and variable bypass): A function, like dilution, that reduces strength of a
concentrate but it is intended for hot beverages. Generally, hot water is blended with
coffee concentrate. Variable bypass allows different bypass rates for various brew
volumes (small, medium and large) within a recipe.
Cold brew lock-out: A programming feature that prevents brewing when actual water
temperature is below the Ready temperature.
Dilution: A function used to reduce strength of a concentrate for cold beverages.
Generally cold tap water is blended with tea or coffee concentrate.
Drip Time: Setting of time from the end of the spray head flow until the funnel flow stops
(also applies to funnel lock).
Easy Pulse: This is a simplified version of Pulse Brew. It is programmed by selecting the
time period of brew water dispense. Easy Pulse allows the operator to input a set time
for which the brewer software will determine a pulse sequence.
Extraction: Water-soluble materials dissolve and move out of the coffee grounds and
into the water. Part of the brewing process that includes Wetting and Hydrolysis.
Funnel lock: A safety feature to prevent funnel removal during drip time.
Hydrolysis: A chemical reaction where the materials created during extraction break
down further into water-soluble proteins and sugars. Part of the brewing process that
includes Wetting and Extraction.
Pre-Infusion: A minor adjustment to a brew cycle when an initial volume is dispensed,
followed by a pause to allow for saturation of the material, then the remainder of the
brew cycle progresses. This is also described as a “pre-soak.”
Pulse Brew: A method used to increase the water contact time during a brew cycle. Pulse
Brew can be programmed manually, by set time or through BrewMETER adjustments.
This method is very useful for smaller volumes.
Satellite Brewer: A system that includes a mother brewing system that remains in one
location (e.g., kitchen) and dispenses into portable, or removable, servers for remote
service.
Wetting: Grounds begin to absorb hot water from the sprayhead and release gasses
from the coffee. Part of the brewing process that includes Extraction and Hydrolysis.
BrewLOGIC : A programming feature that compensates for flow rate variations to
maintain consistent dispense levels when water quality is a consideration.
®
BrewMETER®: A programming feature that simplifies Pulse Brew and allows extraction
manipulation with the touch of a button.
BrewWISE®: A programming feature with Radio Frequency Identification (RFID)
communications between grinder, funnel and brewer for custom warmer and recipe
management without error. Works in conjunction with SMART Hopper, SMART Funnel,
and a Recipe Writer/Card.
BrewWISE® Recipe Writer/Card: Creates recipe cards or dedicated funnels for coffees,
dramatically reducing equipment installation and calibration time. A box connects to a
Windows® PC with a standard serial port and uses BUNN software to transfer information
to the cards or a SMART Funnel, then to-and-from the BUNN BrewWISE brewer and
grinder. Ensures consistently high quality coffee flavor at every location and can also
make cards for advertising messages onto the brewer’s display.
BrewWIZARD® – A programming feature that provides quick access to the most utilized
setup parameters including a lock-out feature to prevent brewing when actual water
temperature is below the Ready temperature. Features include: brew lock-out, brew
ounces, enable ads, enter service number, and BrewMETER®.
BUNNLink®: An automated monitoring and communication system that detects pending
service problems and forwards alerts for service.
Smart Funnel®: A funnel designed with a microchip that can receive information from
an enabled grinder and transfer that information to an enabled brewer, managing the
grinding and brewing process from start to finish. A SMART Funnel can be programmed
to accept dedicated recipe information, reducing labor costs and minimizing brewing
errors. Used in conjunction with BrewWISE technology.
Smart Hopper®: A hopper designed with a microchip that communicates the type
of coffee contained in the hopper to an enabled grinder, managing the grinding and
brewing process from start to finish. Used in conjunction with BrewWISE technology.
SmartWAVE®: Turbulence is an important element in brewing perfect coffee. SmartWAVE
is a BUNN exclusive product design that uses technology to increase turbulence in
the brew funnel, providing more contact between water and coffee and uniformity of
extraction.
Soft Heat®: A docking server system with technology that thermostatically controls and
automatically shuts off heat in the docking system once the preset temperature is reached
and additionally monitors server volume. This is more beneficial than traditional warmer
plates that heat continuously.
SplashGard®: An exclusive design with a shield next to the funnel handle that deflects
hot liquids away from the user’s hand.
ThermoFresh®: BUNN offers a full line of vacuum-insulated servers and brewers that
brew directly into these servers that keep coffee at optimal flavor for hours and save on
energy consumption and by not requiring warming plates.
ABBREVIATION KEY FOR MODEL DESCRIPTIONS
1L/2U – 1 Lower, 2 Upper
Warmers
FMD – Fresh mix
dispenser
PO – Pourover Feature
2W1PH – 2 Wire 1 Phase
G – Gallon
PWR CRD – Power Cord
3L – 3 Lower Warmers
GF – Gourmet Funnel
3W3PH – 3 Wire 3 Phase
GRY – Gray
QTEA FNL – Quick Tea
Funnel
6HL – 6 Hole
GP – Group
7HL – 7 Hole
HDL – Handle
QK CONN – Quick
Connect
“A”– “Automatic”
(water line required)
HIALT – High Altitude
RSD – Raised
HILM – High Lime
RDY LT – Ready Light
“P”– “Pourover”
(plug-in operation)
HL – Hole
REM – Removable
HPR – Hopper
RSVR – Reservoir
HWV – Hot Water Valve
RT – Right
INTFC – Interface
SRVR – Server
LAF – Liquid autofill
SB – Shipboard
LTD SW – Lighted Switch
SIDEHNDL – Side Handle
L – Liter
SNGL – Single
LEVR – Lever Action
SMT FNL – Smart Funnel
LF – Lower Faucet
SMK FNL – Smoked
Funnel
ADP – Adapter
AFI – Auto Fill Installed
APS – Airpot Server
ASSY – Assembly
AUX – Auxillary
BASE, BA – Base
BLK – Black Finish
BRKT – Bracket
BRW – BrewWise Recipe
Writer
LP – Low profile
H&C – Hot and cold
BW – BrewWise
MB – MultiBrewWISE
CS – Case
MECH – Mechanical
DBC®: Digital Brewer Control. BUNN was among the first in the dispensed beverage
industry to introduce advanced beverage technology to the industry with Digital Brewer
Control systems that allow users to precisely and consistently meet specific flavor profiles
while also reducing training and labor costs.
CL – Cluster
MHG – Multi hopper
grinder
Easy Pour®: An exclusive design used in decanters to assure convenient serving with a
drip-proof, fast pouring lip from front or either side.
CTNR – Container
Cool Froth®: Technology used in BUNN super automatic espresso systems that perfectly
foams cold milk for great tasting iced beverages.
FlavorGard : Technology that continuously monitors extract-to-water ratio and assures
flavor consistency.
®
High Intensity®: Technology that mixes high viscosity concentrates throughly, consistently,
and accurately to the required brix setting. The consistent results ensure the best quality
beverage in the cup and contribute to maximum profits in the beverage program.
Infusion Series : A product line of coffee/tea brewers that allow different brewing
profiles from the same machine/footprint, saving valuable counter space.
®
Intellisteam®: Technology that allows the customer to see the milk frothing in the BUNN
super automatic espresso systems with an integrated temperature sensor that simply cuts
off steam through a wand when the milk reaches the preset temperature, eliminating the
need to manually use a thermometer.
RPM Feedback: Technology on auger motors in BUNN specialty drink systems that
monitor the auger revolutions per minute (RPM) and controls powder dosing for each
beverage, eliminating product waste and ensuring consistency cup-to-cup.
Safety-Fresh®: A brew-through lid with a vapor seal to maintain freshness and a spill
prevention design.
CWV – Cold Water Valve
PR - Pourover
SH – Soft Heat
SPHD – Sprayhead
SF – Stainless Steel Funnel
SS – Self Serve
SST – Stainless Steel Finish
MNL – Manual
SWTNR – Sweetener
MP – Multi Phase
TC – Thermal Carafe
MTG – Mounting
TS – Thermal Server
NKL – Nickel
TF – Thermo Fresh
NO LITE – No Fresh Light
TRK – Trunk
NO BASE – Without Base
WB – Wall Bracket
NODTRAY – No Drip Tray
WD – Weight driven
DT – Drip Tray
NO WRMR – No Warmer
WRMR – Warmer
DV – Dual voltage
ORN – Orange
WHT – White
EXP – Export
PAF – Powder autofill
FF – Fast Flow
PC – Portion Control
WHT/SST – White/
Stainless
FTG – Fitting
PF – Plastic Funnel
FLSH – Flashing Lamp
PK – Pack
FR – Front
PKG – Package,
Packaging
CONN – Connect
CONC – Concentrate
CVRSN – Conversion
DGTL – Digital
DBC– Digital Brewer
Control
FNL KIT – Funnel Kit
FLK – Funnel Locks
POSN – Position
73
TRADEMARKS
392; Air Infusion, AutoPOD, AXIOM, BrewLOGIC, BrewMETER, Brew Better Not Bitter, BrewWISE, BrewWIZARD,
BUNN Espress, BUNN Family Gourmet, BUNN Gourmet, BUNN Pour-O-Matic, BUNN, BUNN with the stylized red line,
BUNNlink, Bunn-OMatic, Bunn-O-Matic, BUNNserve, BUNNSERVE with the stylized wrench design, Cool Froth, DBC,
Dr. Brew stylized Dr. design, Dual, Easy Pour, EasyClear, EasyGard, FlavorGard, Gourmet Ice, Gourmet Juice, High
Intensity, iMIX, Infusion Series, Intellisteam, My Café, PowerLogic, Quality Beverage Equipment Worldwide, Safety-Fresh,
savemycoffee.com, Scale-Pro, Silver Series, Single, Smart Funnel, Smart Hopper, SmartWAVE, Soft Heat, SplashGard,
The Mark of Quality in Beverage Equipment Worldwide, ThermoFresh, A Partner You Can Count On, Air Brew, Air
Infusion, Beverage Bar Creator, Beverage Profit Calculator, Brew better, not bitter., BUNNSource, Coffee At Its Best,
Cyclonic Heating System, Digital Brewer Control, Nothing Brews Like a BUNN, Pouring Profits, Respect Earth, Respect
Earth with the stylized leaf and coffee cherry design, Signature Series, Tea At Its Best, Phase Brew, The Horizontal Red
Line, Titan, trifecta, Ultra, Velocity Brew are either trademarks or registered trademarks of Bunn-O-Matic Corporation.
BUNN SUSTAINABILITY FEATURES
RoHS Compliant: In keeping with our Sustainability
Mission, BUNN electronics design can be made with NO
hazardous substances and part assemblies are recyclable
wherever possible.
Lead-free Solder is specified in the production of all
electronic control boards.
Energy Saver Modes will lower power usage by disabling
warmers and tank heater during periods of inactivity.
LED Lighting is being specified where possible for product
displays. LED lights use considerable less energy than
fluorescent or incandescent lighting and have a longer life.
Corrugated, Biodegradable Materials are gradually
replacing Styrofoam packing.
HFC-free Foam Insulation (no hydro fluorocarbons) is
now used exclusively to insulate Soft Heat® servers and the
cabinets of liquid coffee and cold beverage dispensers.
GENERAL TERMS
Bypass (and variable bypass): A function, like dilution,
that reduces strength of a concentrate but it is intended for
hot beverages. Generally, hot water is blended with coffee
concentrate. Variable bypass allows different bypass rates
for various brew volumes (small, medium and large) within
a recipe.
Funnel lock: A safety feature to prevent funnel removal
during drip time.
Cold brew lock-out: A programming feature that prevents
brewing when actual water temperature is below the Ready
temperature.
Pre-Infusion: A minor adjustment to a brew cycle when an
initial volume is dispensed, followed by a pause to allow for
saturation of the material, then the remainder of the brew
cycle progresses. This is also described as a “pre-soak.”
Dilution: A function used to reduce strength of a
concentrate for cold beverages. Generally cold tap water is
blended with tea or coffee concentrate.
74
Hydrolysis: A chemical reaction where the materials
created during extraction break down further into watersoluble proteins and sugars. Part of the brewing process
that includes Wetting and Extraction.
Drip Time: Setting of time from the end of the spray head flow
until the funnel flow stops (also applies to funnel lock).
Pulse Brew: A method used to increase the water contact
time during a brew cycle. Pulse Brew can be programmed
manually, by set time or through BrewMETER adjustments.
This method is very useful for smaller volumes.
Easy Pulse: This is a simplified version of Pulse Brew. It is
programmed by selecting the time period of brew water
dispense. Easy Pulse allows the operator to input a set time
for which the brewer software will determine a pulse sequence.
Satellite Brewer: A system that includes a mother brewing
system that remains in one location (e.g., kitchen) and
dispenses into portable, or removable, servers for remote
service.
Extraction: Water-soluble materials dissolve and move out
of the coffee grounds and into the water. Part of the brewing
process that includes Wetting and Hydrolysis.
Wetting: Grounds begin to absorb hot water from the
sprayhead and release gasses from the coffee. Part of the
brewing process that includes Extraction and Hydrolysis.
www.bunn.com
RESPECT
Sustainability Through Responsibility
As a leading manufacturer of quality beverage equipment, we
recognize that our business operation impacts the total environment.
Respect Earth reflects a continual focus by BUNN® on preserving Earth
for future generations through responsible product design and our entire
supply chain.
EARTH ®
Features of our new beverage equipment
designs and packaging include:
Energy Saver Mode
RoHS Compliance
HFC-Free Insulation
LED Lighting
Biodegradable Packing Material
Lead-free Solder
Vacuum Servers
Compostable Pods in the MY CAFÉ®
Single Serve Systems
Scan to download
Thinsulate® Tank Insulation
Also available
@ bunn.com
Help the environment and communicate with us electronically!!
Friend Us
Fan Us
Follow Us
Was this manual useful for you? yes no
Thank you for your participation!

* Your assessment is very important for improving the work of artificial intelligence, which forms the content of this project

Download PDF

advertisement