sc-8850
Sound canvas
Nederlandstalige handleiding
Veilig gebruik van het toestel
VEILIG GEBRUIK VAN HET TOESTEL
INSTRUCTIES TER VOORKOMING VAN BRAND, ELEKTRISCHE SCHOKKEN OF VERWONDING VAN PERSONEN
Over
WAARSCHUWING en
OPGEPAST
:RUGW JHEUXLNW YRRU LQVWUXFWLHV GLH GH
JHEUXLNHU ZLM]HQ RS OHYHQVJHYDDU RI
WAARSCHUWING HUQVWLJH YHUZRQGLQJHQ ELM RQMXLVW
JHEUXLNYDQKHWWRHVWHO
OPGEPAST
:RUGW JHEUXLNW YRRU LQVWUXFWLHV GLH GH
JHEUXLNHU ZLM]HQ RS KHW ULVLFR RS
YHUZRQGLQJHQ RI PDWHULsOH VFKDGH ELM
RQMXLVWJHEUXLNYDQKHWWRHVWHO
0DWHULsOHVFKDGHYHUZLMVWQDDUVFKDGH
RI DQGHUH RQJXQVWLJH HIIHFWHQ GLH DDQ
KHWKXLVHQGHKHOHLQERHGHOKXLVGLHUHQ
LQEHJUHSHQZRUGHQWRHJHEUDFKW
U
S
I
+HW V\PERRO PDDNW GH JHEUXLNHU DWWHQW RS EHODQJULMNHN
G
LQVWUXFWLHV RI ZDDUVFKXZLQJHQ 'H MXLVWH EHWHNHQLV YDQ KHW
Over de Symbolen
V\PERROZRUGWEHSDDOGGRRUGHWHNHQLQJLQGHGULHKRHN+HW
T
V\PERROKLHUOLQNVGXLGWRSDOJHPHQHYHUZLWWLJLQJHQRIZDDU H
E
+HW V\PERRO PDDNW GH JHEUXLNHU DWWHQW RS ]DNHQ GLH
QRRLWPRJHQZRUGHQXLWJHYRHUGYHUERGHQ]LMQ'HWHNHQLQJU
LQGHFLUNHOJHHIWDDQZDWHUSUHFLHVYHUERGHQLV+HWV\PERRON
KLHU OLQNV EHWHNHQW GDW KHW WRHVWHO QRRLW PDJ ZRUGHQI
T
JHGHPRQWHHUG
+HW ● V\PERRO PDDNW GH JHEUXLNHU DWWHQW RS ]DNHQ GLHS
PRHWHQZRUGHQXLWJHYRHUG'HWHNHQLQJLQGHFLUNHOJHHIWDDQA
ZDW HU SUHFLHV GLHQW WH JHEHXUHQ +HW V\PERRO KLHU OLQNVF
EHWHNHQW GDW GH VWHNNHU YDQ GH VWURRPNDEHO PRHW ZRUGHQE
L
XLWJHWURNNHQ
Y
1((067(('6+(792/*(1'(,1$&+7
Waarschuwing
001
‡ /HHV RQGHUVWDDQGH LQVWUXFWLHV HQ GH JHEUXLNHUV
KDQGOHLGLQJYRRUDOHHUKHWWRHVWHOWHJHEUXLNHQ
002a
‡ 2SHQ KHW WRHVWHO QLHW HQ YHUDQGHU QLHWV DDQ GH
ELQQHQNDQW
003
‡ 3UREHHU KHW WRHVWHO QLHW WH KHUVWHOOHQ RI HU RQGHU
GHOHQLQWHYHUYDQJHQEHKDOYHZDQQHHUHULQGLW
KDQGERHNGDDURYHUVSHFLILHNHLQVWUXFWLHVVWDDQ
$OOHRQGHUKRXGPRHWZRUGHQJHGDDQGRRUXZ
YHUNRSHUKHWGLFKWVELM]LMQGH5RODQG6HUYLFH
&HQWHURIHHQHUNHQGH5RODQGYHUGHOHUGLHXYLQGW
RSGH´LQIRUPDWLHµSDJLQD
004
‡ +HWWRHVWHOQRRLWJHEUXLNHQRIRSVODDQRSSODDWVHQ
GLH
‡ RQGHUKHYLJ]LMQDDQH[WUHPHWHPSHUDWXUHQEY
GLUHFW]RQOLFKWLQHHQJHVORWHQYRHUWXLJ
GLFKWELMHHQYHUZDUPLQJVEXLVRIERYHQRS
YHUZDUPLQJVWRHVWHOOHQ
‡ YRFKWLJ]LMQEYEDGNDPHUVZDVNDPHUVRIRS
QDWWHYORHUHQ
‡ QDW]LMQ
‡ EORRWJHVWHOG]LMQDDQUHJHQ
‡ VWRIILJ]LMQ
‡ RQGHUKHYLJ]LMQDDQIHOOHWULOOLQJHQ
007
‡ 3ODDWVKHWWRHVWHOVWHHGVRSHHQYODNNHHQVWDELHOH
RQGHUJURQG3ODDWVKHWQRRLWRSVWDWLHYHQGLH
RQVWDELHO]LMQRIRSKHOOHQGHRSSHUYODNNHQ
Waarschuwing
008a
‡ +HW WRHVWHO PRHW ZRUGHQ DDQJHVORWHQ RS GH
VWURRPEURQGLHEHVFKUHYHQLVLQKHWKDQGERHNRI
GLHRSKHWWRHVWHOLVDDQJHJHYHQ
009
‡ =RUJHUYRRUKHWVWURRPVQRHUQLHWWHEHVFKDGLJHQ
%XLJKHWQLHWWHYHUGRRUJDHUQLHWRSVWDDQ
SODDWVHUJHHQ]ZDUHYRRUZHUSHQRSHQ](HQ
EHVFKDGLJGVWURRPVQRHUNDQHOHNWULVFKHVFKRNNHQ
RIEUDQGYHURRU]DNHQ(HQEHVFKDGLJGVWURRP
VQRHUPDJQLHWPHHUJHEUXLNWZRUGHQ
010
‡ 'LW WRHWVHO NDQ DOOHHQ RI LQ FRPELQDWLH PHW HHQ
YHUVWHUNHUHQKRRIGWHOHIRRQRIOXLGVSUHNHUVHHQ
JHOXLGVQLYHDXSURGXFHUHQGDWSHUPDQHQWJHKRRU
YHUOLHVNDQYHURRU]DNHQ:HUNQLHWWHODQJPHW
HHQ KRRJ YROXPH RI PHW HHQ RQFRPIRUWDEHO
YROXPH6WRSRQPLGGHOOLMNPHWKHWJHEUXLNYDQGLW
WRHVWHOHQUDDGSOHHJHHQRRUVSHFLDOLVWZDQQHHUX
JHKRRUYHUOLHV JHZDDU ZRUGW RI DOV XZ RUHQ
EHJLQQHQWHIOXLWHQ
011
‡ =RUJ HU YRRU GDW HU JHHQ YRRUZHUSHQ EY
EUDQGEDDUPDWHULDDOPXQWHQVSHOGHQRIYORHLVW
RIIHQZDWHUIULVGUDQNHQ]LQKHWWRHVWHOELQQHQ
GULQJHQ
013
‡ ,Q JH]LQQHQ PHW NOHLQH NLQGHUHQ PRHW HHQ
YROZDVVHQHGHNLQGHUHQEHJHOHLGHQWRW]HLQVWDDW
]LMQRPDOOHUHJHOVWHYROJHQGLHHVVHQWLHHO]LMQRP
KHWWRHVWHOYHLOLJWHJHEUXLNHQ
014
‡ %HVFKHUPKHWWRHVWHOWHJHQKHYLJHVFKRNNHQ
/DDWKHWQLHWYDOOHQ
3
Veilig gebruik van het toestel
Waarschuwing
015
‡ 6OXLW KHW VWURRPVQRHU YDQ KHW WRHVWHO QLHW VDPHQ
DDQRSHHQXLWJDQJYDQHHQRQUHGHOLMNDDQWDO
DQGHUHWRHVWHOOHQ:HHVYRRUDOYRRU]LFKWLJPHWKHW
JHEUXLNYDQYHUOHQJVQRHUHQ³KHWWRWDOHYHUPRJHQ
GDWJHEUXLNWZRUGWGRRUDOOHWRHVWHOOHQGLHRSKHW
YHUOHQVJQRHU]LMQDDQJHVORWHQPDJKHWYHUPRJHQ
ZDWWDPSHUHYDQKHWYHUOHQJVQRHUQLHWRYHUVFKU
LMGHQ7HKRJHEHODVWLQJHQNXQQHQGHLVRODWLHYDQ
KHWYHUOHQJVQRHUGRHQRSZDUPHQHQPRJHOLMN
GRHQVPHOWHQ
016
‡ 5DDGSOHHJ XZ YHUNRSHU KHW GLFKWVELM]LMQGH
5RODQG6HUYLFH&HQWHURIHHQHUNHQGH5RODQG
YHUGHOHUGLHXYLQGWRSGH´LQIRUPDWLHµSDJLQD
YRRUDOHHUXKHWWRHVWHOLQKHWEXLWHQODQGJHEUXLNW
Opgepast
101a
‡ 6WHO KHW WRHVWHO RS LQ HHQ SODDWV ZDDU YROGRHQGH
YHQWLODWLHLV
102b
‡ $OOHHQGHVWHNNHUYDQKHWVWURRPVQRHUYDVWQHPHQ
ZDQQHHUPHQKHWWRHVWHORSGHVWURRPDDQVOXLWRI
DIVOXLW
104
‡ =RUJHUYRRUGDWVQRHUHQHQNDEHOVQLHWLQGHZDU
UDNHQ'HVQRHUHQHQNDEHOVPRHWHQRRNEXLWHQKHW
EHUHLNYDQNLQGHUHQZRUGHQJHSODDWVW
106
‡ 3ODDWVJHHQ]ZDUHYRRUZHUSHQRSKHWWRHVWHORIJD
HUQLHWRSVWDDQ
107b
‡ +HW VWURRPVQRHU RI GH VWHNNHU QRRLW PHW QDWWH
KDQGHQYDVWQHPHQELMKHWDDQRIDIVOXLWHQYDQKHW
WRHVWHO
108a
‡ .RSSHOGHVWHNNHUORVYDQKHWWRHVWHOHQRQWNRSSHO
DOOHVQRHUHQYDQH[WHUQHWRHVWHOOHQZDQQHHUXKHW
WRHVWHOYHUSODDWVW
109a
‡ =HW GH VWURRP XLW HQ WUHN KHW VWURRPVQRHU XLW
YRRUDOHHUXKHWWRHVWHOUHLQLJWS
110a
‡ %LM NDQV RS RQZHHU PRHW X KHW VWURRPVQRHU ORV
NRSSHOHQ
4
Belangrijke opmerkingen
Gelieve naast de onderwerpen beschreven in “VEILIG
Bijkomende voorzorgsmaatregelen
GEBRUIK VAN HET TOESTEL” op pagina 3, eveneens
551
‡ *HOLHYH HU DDQ WH GHQNHQ GDW GH LQKRXG YDQ HHQ
JHKHXJHQRQKHUURHSHOLMNYHUORUHQNDQJDDQGRRUIRXWLHYH
ZHUNLQJRIGRRUKHWRQMXLVWHJHEUXLNYDQKHWWRHVWHO2P
X]HOIWHJHQKHWYHUOLHVYDQEHODQJULMNHJHJHYHQVWH
EHVFKHUPHQUDGHQZLMDDQRPUHJHOPDWLJHHQEDFNXS
NRSLHRSHHQDQGHU0,',DSSDUDDWEYHHQVHTXHQFHUWH
PDNHQYDQGHEHODQJULMNHJHJHYHQVGLHLQKHWJHKHXJHQ
YDQKHWWRHVWHO]LMQRSJHVODJHQ
volgende zaken te lezen en in acht te nemen
Stroomtoevoer
Stroomtoevoer: gebruik van batterijen
‡ 'LW WRHVWHO PDJ QLHW ZRUGHQ JHEUXLNW RS KHW]HOIGH
VWURRPFLUFXLW YDQHHQGHUZHONWRHVWHOGDWOLMQUXLV
JHQHUHHUW]RDOVHHQHOHNWULVFKHPRWRURIHHQYDULDEHO
YHUOLFKWLQJVV\VWHHP
‡ =HWGHVWURRPYDQDOOHWRHVWHOOHQXLWYRRUDOHHUGLWWRHVWHO
DDQDQGHUHWRHVWHOOHQDDQWHVOXLWHQ2SGH]HPDQLHU
YRRUNRPWPHQKHWVOHFKWIXQFWLRQHUHQHQRIEHVFKD
GLJLQJYDQOXLGVSUHNHUVRIDQGHUHDSSDUDWXXU
Plaatsing
‡ +HW JHEUXLN YDQ GLW WRHVWHO LQ GH EXXUW YDQ VWURRPYHU
VWHUNHUVRIDQGHUHDSSDUDWXXUPHWVWHUNHVWURRPWUDQVIRU
PDWRUHQNDQEURPYHURRU]DNHQ2PGLWSUREOHHPRSWH
ORVVHQPRHWXGHULFKWLQJYDQKHWWRHVWHOYHUDQGHUHQRI
KHWWRHVWHOYHUGHUYDQGHLQWHUIHUHQWLHEURQYHUZLMGHUHQ
‡ 'LW DSSDUDDW NDQ LQWHUIHUHUHQ PHW UDGLR HQ WHOHYLVLH
RQWYDQJVW*HEUXLNGLWDSSDUDDWQLHWLQGHEXXUWYDQ
]XONHRQWYDQJHUV
‡ +HWWRHVWHOQLHWEORRWVWHOOHQDDQGLUHFW]RQOLFKWQLHWLQGH
EXXUWSODDWVHQYDQDSSDUDWHQGLHZDUPWHDIJHYHQODDW
KHWQLHWDFKWHULQHHQDIJHVORWHQYRHUWXLJRIVWHOKHWQLHW
EORRWDDQH[WUHPHWHPSHUDWXUHQ2YHUPDWLJHKLWWHNDQ
KHWWRHVWHOYHUYRUPHQRIRQWNOHXUHQ
‡ *HEUXLN KHW WRHVWHO QLHW RS QDWWH SODDWVHQ ZDDU KHW LV
EORRWJHVWHOGDDQUHJHQRIDQGHUYRFKWRPHHQPRJHOLMNH
SDQQHWHYHUPLMGHQ
Onderhoud
401a
‡ 9RRUKHWDOOHGDDJVVFKRRQPDNHQUHLQLJWPHQKHWWRHVWHO
PHWHHQ]DFKWHGURJHGRHNRIPHWHHQGRHNGLHPHWHHQ
EHHWMHZDWHULVEHYRFKWLJG9RRUKHWYHUZLMGHUHQYDQ
KDUGQHNNLJYXLOZRUGWHHQGRHNJHEUXLNWGLHLQHHQ
]DFKWHQLHWELMWHQGHGHWHUJHQWLVJHGUHQNW'DDUQDKHW
WRHVWHODIGURJHQPHWHHQ]DFKWHGURJHGRHN
‡ *HEUXLNQRRLWEHQ]LQHYHUGXQQHUVDOFRKRORIRSORVPLG
GHOHQYDQRPKHWHYHQZHONHVRRUWRPRQWNOHXULQJHQRI
YHUYRUPLQJWHYRRUNRPHQ
‡ -DPPHU JHQRHJ LV KHW QLHW DOWLMG PRJHOLMN RP GH LQKRXG
YDQGHJHJHYHQVWHKHUVWHOOHQGLHLQHHQDQGHU0,',
DSSDUDDW]LMQRSJHVODJHQEYHHQVHTXHQFHUHHQV]H
YHUORUHQ]LMQJHJDDQ5RODQG&RUSRUDWLRQLVQLHWYHUDQW
ZRRUGHOLMNYRRU]XONYHUOLHVYDQJHJHYHQV
553
‡ %HKDQGHO GH NQRSSHQ VFKXLYHQ HQ DQGHUH FRQWUROHIXQF
WLHVHYHQHHQVDOVGHMDFNVHQGHDDQVOXLWLQJHQYDQKHW
WRHVWHOPHWGHQRGLJHYRRU]LFKWLJKHLG(HQUXZHEHKDQ
GHOLQJNDQDDQOHLGLQJJHYHQWRWVOHFKWIXQFWLRQHUHQ
‡ 1RRLWRSGHGLVSOD\VODDQRIHUVWHUNHGUXNRSXLWRHIHQHQ
•‡ %LM KHW DDQVOXLWHQ RI DINRSSHOHQ YDQ GH NDEHOV PRHW GH
FRQQHFWRU]HOIYDVWJHQRPHQZRUGHQQRRLWDDQGHNDEHO
WUHNNHQ2SGH]HPDQLHUZRUGWNRUWVOXLWLQJHQEHVFKD
GLJLQJYDQGHLQWHUQHHOHPHQWHQYDQGHNDEHO
YRRUNRPHQ
‡ :DQQHHU KHW WRHVWHO QRUPDDO ZHUNW ]DO KHW HHQ NOHLQ
EHHWMHZDUPWHDIJHYHQ
‡ 3UREHHU KHW YROXPH YDQ KHW WRHVWHO ELQQHQ UHGHOLMNH
SHUNHQWHKRXGHQ]RGDWGHEXUHQQLHWJHVWRRUGZRUGHQ
0LVVFKLHQYHUNLHVWXKHWJHEUXLNYDQHHQKRRIGWHOHIRRQ
ZDDUGRRUX]LFKJHHQ]RUJHQPRHWPDNHQRYHUGHJHQHQ
GLHXRPULQJHQYRRUDO¶VDYRQGVODDW
‡ :DQQHHU X KHW WRHVWHO PRHW YHUYRHUHQ PRHW KHW LQGLHQ
PRJHOLMNLQGHRRUVSURQNHOLMNHYHUSDNNLQJVDPHQPHWGH
SDGVZRUGHQLQJHSDNW,VGLWQLHWPRJHOLMNGDQPRHWX
JHOLMNDDUGLJHYHUSDNNLQJVPDWHULDOHQJHEUXLNHQ
‡ *HEUXLNNDEHOVYDQ5RODQGRPKHWWRHVWHODDQWHVOXLWHQ
,QGLHQXHHQDQGHUVRRUWDDQVOXLWLQJVNDEHOJHEUXLNWPRHW
PHQYROJHQGH]DNHQLQDFKWQHPHQ
‡ 6RPPLJHDDQVOXLWLQJVNDEHOVEHYDWWHQUHVLVWRUHQ*HEUXLN
JHHQNDEHOVPHWUHVLVWRUHQYRRUGHDDQVOXLWLQJYDQGH6&
+HWJHEUXLNYDQ]XONHNDEHOVNDQUHVXOWHUHQLQHHQ
H[WUHHPODDJRI]HOIVRQPRJHOLMNWHKRUHQNODQNYROXPH
&RQWDFWHHUGHNDEHOIDEULNDQWYRRUPHHULQIRUPDWLHRYHU
GHVSHFLILFDWLHVYDQXZNDEHO
5
Hoofdkenmerken
Compatibel met General MIDI 1/General MIDI 2/GS Format
'LWWRHVWHOLVHHQNODQNPRGXOHGLHFRPSDWLEHOLVPHW*HQHUDO0,',HQ+HWNDQ
ZRUGHQJHEUXLNWYRRUKHWQDVSHOHQYDQRPKHWHYHQZHONHVRQJJHJHYHQV*HQHUDO
0,',VFRUHVGLHKHW*HQHUDO0,',ORJRGUDJHQ'LWWRHVWHOLVHYHQHHQVFRPSDWLEHO
PHWKHW5RODQG*6IRUPDW+HWNDQZRUGHQJHEUXLNWYRRUKHWQDVSHOHQYDQRPKHW
HYHQZHONHVRQJJHJHYHQVGLHKHW*6ORJRGUDJHQ
64-Part/128-multitimbrale stemmen
'H6&LVHHQNODQNPRGXOHPHWSDUWVHQPXOWLWLPEUDOHVWHPPHQ(HQHQ
NHOWRHVWHONDQGHNODQNHQYDQHHQJURRWRUNHVWSURGXFHUHQ+HWLVHHQLGHDOHNODQN
PRGXOHRPVDPHQPHWFRPSXWHUVRIVHTXHQFHUVWHJHEUXLNHQ
'LWJHOGWDOOHHQZDQQHHUGH86%FRQQHFWRURIGHVHULsOHFRQQHFWRUZRUGWJHEUXLNW:DQQHHUPHQGH
0,',FRQQHFWRUHQJHEUXLNW]LMQHUPD[LPDDOSDUWVEHVFKLNEDDU
Hoogkwalitatieve klanken
'H6&EHYDWKRRJNZDOLWDWLHYHNODQNHQHQYHUVFKLOOHQGHVHWVPHW
GUXPNODQNHQ'H]HNODQNHQEHYDWWHQGH]HOIGHNODQNHQDOVGH6&PN,,GH6&
HQGH6&3URZDDUGRRUGHVRQJGDWDYDQGH]HPRGXOHVFRUUHFWNXQQHQZRUGHQ
QDJHVSHHOGS
$OQDDUJHODQJGHJHJHYHQVLVKHWPRJHOLMNGDWGH6&GH]HPHWHHQNOHLQYHUVFKLOQDVSHHOW
Een volledige selectie van effecten
'HHIIHFWHQYDQGH6&EHYDWWHQYHUVFKLOOHQGHLQYRHJHIIHFWHQGLHRSVSHFL
ILHNHSDUWVNXQQHQZRUGHQWRHJHSDVWVRRUWHQJDOPVRRUWHQFKRUXVVRRUWHQ
HFKRHQHHQEDQGHTXDOL]HU'DDUHQERYHQNDQPHQGHSDUDPHWHUVYDQHONHIIHFW
DDQGHNODQNYDQXZVPDDNDDQSDVVHQSS
User-klanken
'RRUKHWEHZHUNHQYDQNODQNSDUDPHWHUV]RDOVYLEUDWRILOWHUHQHQYHORSHNDQX
NODQNHQDDQXZVPDDNDDQSDVVHQ'H6&EHVFKLNWRYHUXVHUNODQNHQHQ
XVHUGUXPVHWVZDDUPHHXXZHLJHQNODQNHQHQGUXPVHWVNDQPDNHQS
Voorzien van een USB-connector
'H6&LVYRRU]LHQYDQHHQ86%FRQQHFWRUHQHHQVHULsOHFRQQHFWRUZDDUPHH
PHQUHFKWVWUHHNVRSHHQ$SSOH0DFLQWRVKFRPSXWHURIHHQ3&NDQDDQVOXLWHQ:DQ
QHHUXVHTXHQFLQJVRIWZDUHJHEUXLNWNDQXVRQJGDWDQDVSHOHQHQEHZHUNHQS
S
Groot LCD-scherm voor de instellingen
2SKHWJURWHJUDILVFKH/&'VFKHUPNDQX]HHUJRHGGHVSHHOVWDWXVYDQHONHSDUW
JUDILVFKDIOH]HQ
Aansluiten op andere toestellen
'RRUGHDXGLRLQJDQJVILFKHVPHWDDQSDVVLQJYDQKHWLQJDQJVYROXPHNDQXRSHHQ
DQGHUHNODQNEURQDDQVOXLWHQHQGHNODQNHQVDPHQPHWGHHLJHQNODQNYDQGH6&
ZHHUJHYHQYDQXLWGHDXGLRXLWJDQJVILFKHV(UZRUGHQWZHHSDDUDXGLRXLW
JDQJVILFKHVPHHJJHOHYHUGS
6
Hoofdkenmerken
General MIDI 1
ILJ
*HQHUDO0,',LVHHQUHHNVDDQEHYHOLQJHQZDDULQPHQHHQPDQLHU]RHNWRPGH
EHSHUNLQJHQYDQHLJHQGRPVRQWZHUSHQWHRP]HLOHQHQGH0,',HLJHQVFKDSSHQYDQ
NODQNJHQHUHUHQGHWRHVWHOOHQWHVWDQGDDUGL]HUHQ.ODQNJHQHUHUHQGHWRHVWHOOHQHQ
PX]LHNEHVWDQGHQGLHDDQGH*HQHUDO0,',VWDQGDDUGYROGRHQGUDJHQKHW*HQHUDO
0,',ORJR
0X]LHNEHVWDQGHQGLHKHW*HQHUDO0,',ORJRGUDJHQNXQQHQ
ZRUGHQDIJHVSHHOGGRRURPKHWHYHQZHONNODQNJHQHUHUHQG*HQHUDO0,',WRHVWHO
HQJHYHQGDDUELMVWHHGVGH]HOIGHPX]LNDOHXLWYRHULQJ
General MIDI 2
ILJD
*HQHUDO0,',
LVHHQUHHNVVSHFLILFDWLHVGLHJHGHWDLOOHHUGHIXQFWLRQHOH
GHILQLWLHVJHHIW]RDOVYRRUNODQNEHZHUNLQJHQHIIHFWHQGLHQLHWLQ*HQHUDO0,',
ZHUGHQRPVFKUHYHQHQGLHHHQKRJHUHJUDDGYDQXLWYRHULQJVH[SUHVVLHHQFRPSDWL
ELOLWHLWPRJHOLMNPDNHQ$DQJH]LHQ*HQHUDO0,',FRPSDWLEHOLVPHW*HQHUDO0,',
NDQPHQKLHUPHHRSHHQEHWURXZEDUHPDQLHUPX]LHNEHVWDQGHQDIVSHOHQGLHKHW
*HQHUDO0,',ORJRGUDJHQ
GS format
ILJ
+HW*6)RUPDW
LVHHQUHHNVVSHFLILFDWLHVYDQ5RODQGYRRUKHWVWDQGDDUGL]HUHQ
YDQGHXLWYRHULQJYDQNODQNJHQHUHUHQGHWRHVWHOOHQ1DDVWKHWOHYHUHQYDQRQGHU
VWHXQLQJYRRUDOOHVZDWGRRU*HQHUDO0,',LVEHSDDOGELHGWKHWXLWHUVWFRPSDWL
EHOH*6)RUPDWHYHQHHQVHHQXLWJHEUHLGDDQWDONODQNHQYRRU]LHWKHWLQGHEHZHUN
LQJYDQGHNODQNHQHQJHHIWKHWHHQJURRWDDQWDOGHWDLOVEHWUHIIHQGHHHQJURRWJDPPD
DQGHUHNHQPHUNHQPHWLQEHJULSYDQHIIHFWHQ]RDOVJDOPHQFKRUXV
+HW*6)RUPDWZHUGRQWZRUSHQPHWKHWRRJRSGHWRHNRPVWHQNDQ]RGRHQGHJH
PDNNHOLMNQLHXZHNODQNHQLQ]LFKRSQHPHQHQZDQQHHUGH]HZRUGHQJHPDDNW
QLHXZHKDUGZDUHNHQPHUNHQRQGHUVWHXQHQ
*6
LVHHQJHUHJLVWUHHUGKDQGHOVPHUNYDQ5RODQG&RUSRUDWLRQ
0LFURVRIW:LQGRZVHQ:LQGRZV17]LMQJHUHJLVWUHHUGHKDQGHOVPHUNHQYDQ0LFURVRIW&RUSRUDWLRQ
$SSOHLVHHQJHUHJLVWUHHUGKDQGHOVPHUNYDQ$SSOH&RPSXWHU,QF
0DFLQWRVKLVHHQJHUHJLVWUHHUGKDQGHOVPHUNYDQ$SSOH&RPSXWHU,QF
3&6HULHVLVHHQKDQGHOVPHUNYDQ1(&&RUSRUDWLRQ
$OOHQDPHQYDQSURGXFWHQGLHLQGLWGRFXPHQWZRUGHQYHUQRHPG]LMQKDQGHOVPHUNHQRIJHUHJLVWUHHUGH
KDQGHOVPHUNHQYDQKXQUHVSHFWLHYHOLMNHHLJHQDDUV
7
Gebruik van het handboek
Afspraken over het gebruik van dit handboek
,QGHYHUNODUHQGHWHNVWZRUGHQGHQDPHQYDQSDUDPHWHUVHQYDQDQGHUHRQGHUZHU
SHQDDQJHGXLG]RDOV]HLQGHGLVSOD\YHUVFKLMQHQEY´&KR5DWHµ$DQJH]LHQGLW
RQJHEUXLNHOLMNHDINRUWLQJHQ]LMQ]DOGHYROOHGLJHQDDPHYHQHHQVYHUPHOGZRUGHQ
EY´&KRUXV5DWHµ
'HZDDUGHQGLHYRRUSDUDPHWHUVNXQQHQZRUGHQLQJHVWHOGHQGLHODWHUNXQQHQ
ZRUGHQDDQJHSDVW]XOOHQDOVYROJWZRUGHQDDQJHGXLG´²64²µ'HSDUDPHWHUV
GLHXLWVOXLWHQGVSHFLILHNHZDDUGHQNXQQHQKHEEHQZRUGHQDOVYROJWYRRUJHVWHOG
200/400 Hz.'HZDDUGHQGLHLQKHWYHW]LMQJHGUXNW]RDOVEY64,]LMQGHVWDQGDDUG
ZDDUGHQ.QRSSHQRIWRHWVHQRSKHWSDQHHOZRUGHQWXVVHQYLHUNDQWHKDNHQJH]HW
EY>(',7@RI>92/80(@
'H6&LVRRNYRRU]LHQYDQIXQFWLHWRHWVHQ>)@²>)@'HZHUNLQJYDQGH]HWRHW
VHQLVDIKDQNHOLMNYDQGHIXQFWLHGLHLQKHW/&'VFKHUPWHOH]HQLV'LWKDQGERHNYHU
ZLMVWQDDUGH]HWRHWVHQPHW>3$57$@>)@HQ]
'LWKDQGERHNEHYDWYRRUEHHOGHQYDQGHGLVSOD\YDQGH6&+LHUELMPRHWPHQ
HUHFKWHUPHHUHNHQLQJKRXGHQGDWKHWYRRUEHHOGOLFKWMHVNDQYHUVFKLOOHQYDQGH
ZHUNHOLMNHGLVSOD\GLHXRSXZLQVWUXPHQW]LHW
'HYHUGXLGHOLMNLQJHQLQGLWKDQGERHN]LMQYRRU]LHQYDQLOOXVWUDWLHVGLHWRQHQZDWHU
LQGHGLVSOD\PRHWYHUVFKLMQHQ/HWHUHFKWHURSGDWXZWRHVWHONDQYRRU]LHQ]LMQYDQ
HHQQLHXZHUHYHUEHWHUGHYHUVLHYDQKHWV\VWHHPEYQLHXZHUHNODQNHQEHYDW+HW
LVGXVPRJHOLMNGDWZDWHURSXZVFKHUPYHUVFKLMQWQLHWKHOHPDDORYHUHHQNRPWPHW
GDWJHQHZDWLQKHWKDQGERHNVWDDW
Wanneer u reeds vertrouwd bent met de SC-8850
:DQQHHUXHHQEDVLVNHQQLVKHHIWYDQGHZHUNLQJYDQGH6&PRHWXDOOHHQQRJ
GHWerkingsprocedurelijstSUDDGSOHJHQRPGHJHZHQVWHZHUNLQJYRRUHONH
PRGXVWHYLQGHQ*HEUXLNGH]HOLMVWZDQQHHUXHHQSURFHGXUHYHUJHWHQEHQW
BijlagenSEHYDWHYHQHHQVDQGHUHOLMVWHQHQLQIRUPDWLHGLHYRRUXYDQQXWNXQ
QHQ]LMQ
De index gebruiken van de MIDI-werking
'LWKDQGERHNJHHIWUHJHOPDWLJYRRUEHHOGHQYDQGHZHUNLQJYDQGH6&YLD
0,',YDQXLWHHQH[WHUQWRHVWHORIHHQVHTXHQFHUSURJUDPPD$OGH]HYRRUEHHOGHQ
]LMQVDPHQJHYDWLQHHQLQGH[=LHIndex (Werking via MIDI)S
8
Inhoud
Veilig gebruik van het toestel ............................. 3
Belangrijke opmerkingen .................................... 5
Hoofdkenmerken.................................................. 6
Hoe dit handboek gebruiken............................... 8
Paneelbeschrijvingen............................... 11
9RRUSDQHHO $FKWHUSDQHHO Aansluiten op een computer/MIDI-klavier.......... 12
Aansluiten op een computer............................. 12
(HQFRPSXWHUDDQVOXLWHQPHWGH86%FRQQHFWRU (HQFRPSXWHUDDQVOXLWHQPHWGHVHULsOHFRQQHFWRU (HQFRPSXWHUDDQVOXLWHQPHWGH0,',FRQQHFWRUHQ +RH0,',FRPPDQGR·VZRUGHQXLWJHZLVVHOG
PHWHHQFRPSXWHU +RRUWXJHOXLG" Aansluiten van de hoofdtelefoon ..................... 19
Aansluiten op de audio-ingangsfiches ............ 19
Aansluiten op een MIDI-klavier ......................... 20
$DQVOXLWLQJHQPDNHQ 'HVWURRP$DQ8LW]HWWHQ +RRUWXJHOXLG" Aansluiten van een andere MIDI-klankbron op de
SC-8850............................................................ 22
$DQVOXLWLQJHQPDNHQ Opnieuw instellen van de fabrieksinstellingen
(Initializeren)..................................................23
Alle instellingen tot de fabrieksinstelling terugbrengen (Factory Preset) ............................... 23
Initializeren voor General MIDI/GS Format ...... 24
De verschillende klanken proberen ........ 27
De verschillende klanken van de SC-8850
proberen.............................................................. 27
1DDU'HPRVRQJVOXLVWHUHQ 'HPRVRQJV 'HEDVLVNODQNHQKRRIGNODQNHQEHOXLVWHUHQ
3+5$6(35(9,(: 'HYDULDWLHNODQNHQEHOXLVWHUHQ 'HGUXPVHWNODQNHQEHOXLVWHUHQ Parts en klanken .......................................37
De klank van elke part wisselen ....................... 37
6RRUWHQSDUWV :HONH0,',,1]DOGRRUHHQSDUWZRUGHQJHEUXLNW" (HQSDUWVHOHFWHUHQ %DVLVNODQNHQVHOHFWHUHQ1RUPDOHSDUW 9DULDWLHNODQNHQVHOHFWHUHQ1RUPDOHSDUW 0,',FRPPDQGR·VJHEUXLNHQRPLQVWUXPHQWHQWHVHOHFW
HUHQXLWDQGHUHWRHVWHOOHQRIVHTXHQFHVRIWZDUH 'UXPVHWVVHOHFWHUHQ'UXPSDUW 0,',FRPPDQGR·VJHEUXLNHQRPGUXPVHWVWHVHOHFWHUHQ
XLWDQGHUHWRHVWHOOHQRIVHTXHQFHVRIWZDUH 'H]HOIGHNODQNHQVHOHFWHUHQDOVGH
6&3UR6&6& .ODQNHQPHWOHJDWR Een MIDI-kanaal aan een part toewijzen .......... 46
Relatie tussen het aantal simultane noten en
stemmen ..................................................48
Parts en parameters .................................49
Parameters instellen die alle parts beïnvloeden
(Edit All-scherm) ............................................. 49
3URFHGXUH 3DUDPHWHUV )XQFWLHYDQHONHSDUDPHWHU De functies van parameters die individueel voor
elke part zijn ingesteld (Edit-scherm) .......... 51
3URFHGXUH 3DUDPHWHUV )XQFWLHYDQHONHSDUDPHWHU Parameters instellen die de SC-8850 zelf beïnvloeden (Utility-scherm) ................................. 62
3URFHGXUH )XQFWLHYDQHONHSDUDPHWHU Een klank of een drumset creëren ..........64
Probeer een originele klank ............................. 64
'HHOHPHQWHQYDQHHQNODQNYHUDQGHUHQRPHHQQLHXZH
NODQNWHFUHsUHQ 3DUDPHWHUVYRRUKHWEHZHUNHQYDQHHQNODQN (HQNODQNFUHsUHQHQEHZDUHQ8VHULQVWUXPHQW Een drumset creëren en bewaren (User-drum)70
'UXP(GLW (HQJHFUHsHUGHGUXPVHWEHZDUHQ8VHUGUXPVHW Parameterinstellingen voor de klankbron ....... 32
+HWYROXPHDDQSDVVHQ92/80(/(9(/ 'HSDQDDQSDVVHQ6WHUHRSRVLWLH 'HWRRQDDUGWUDQVSRQHUHQ.(<6+,)7 (HQEHSDDOGHSDUWDOOHSDUWVXLW]HWWHQ$OO3DUWV087( (HQVSHFLILHNHSDUWEHOXLVWHUHQ62/2 'H]HOIGHNODQNHQVHOHFWHUHQDOVGH
6&3UR6&6& 9
Inhoud
Organisatie van effecten op de SC-8850 ....... 77
Bijlagen ....................................................139
Systeemeffecten................................................. 77
Problemen oplossen ....................................... 139
Invoegeffecten (EFX) ......................................... 78
MIDI.................................................................... 145
Systeemeffecten gebruiken..................... 79
:DWLV0,'," :DWLV*0" 0,',FRPPDQGR·VGLHGRRUGH6&NXQQHQZRUGHQ
RQWYDQJHQ Reverb/Chorus/Delay......................................... 79
3DUDPHWHUVLQVWHOOHQYRRU5HYHUE&KRUXV'HOD\
VRRUWHQKRHYHHOKHLG/HYHO 5HYHUESDUDPHWHUVHQKXQIXQFWLHV &KRUXVSDUDPHWHUVHQKXQIXQFWLHV 'HOD\SDUDPHWHUVHQKXQIXQFWLHV Als er een boodschap verschijnt.................... 156
Equalizer ............................................................. 86
Instrumentenlijst .............................................. 167
(TXDOL]HULQVWHOOLQJHQPDNHQ (TXDOL]HUSDUDPHWHUV Drumsetlijst ...................................................... 187
Invoegeffecten gebruiken ........................ 88
GM 2 Drumsetlijst............................................. 215
Instellen van het soort invoegeffect, diepte
(Level) en andere parameters ........................ 88
,QYRHJHIIHFWSDUDPHWHUVHQKXQIXQFWLHV Invoegeffecten Aan/Uitzetten............................ 89
6KRUWFXWWRHWVHQ Soorten invoegeffecten ..................................... 91
Bekabelingsdiagrammen van de computer... 157
Werkingsprocedurelijst ................................... 158
'H]HYHQGLVSOD\VFKHUPHQYDQGH6& GM 2 Instrumentenlijst .................................... 213
Invoegeffectenlijst............................................ 216
Omzettingstabel van effectparameterwaarden ........................................ 224
MIDI-implementatie .......................................... 226
Specificaties ............................................227
De effectparameters veranderen met controllers
....................................................................... 129
Index.........................................................229
,QVWHOSURFHGXUH 'HIXQFWLHYDQHONHSDUDPHWHU Werking via MIDI .............................................. 234
De SC-8850-instellingen bewaren en opladen.. 134
De instellingen van de SC-8850 naar een
computer sturen............................................ 134
(HQ%XON'XPSYHUVWXUHQ ,QGLYLGXHOHJHJHYHQVYHUVWXUHQ SC-8850-instellingen wegschrijven naar of opladen uit de User Area (Edit All-scherm) ... 137
6&LQVWHOOLQJHQLQGH8VHU$UHDZHJVFKULMYHQ 6&LQVWHOOLQJHQXLWGH8VHU$UHDRSODGHQ 10
Beschrijving van het paneel
■ Voorpaneel
ILJH
92/80(UHJHODDU
GLVSOD\
32:(5VFKDNHODDU
)WRHWV
3+21(6MDFN
,QVWUXPHQW
)WRHWV
)WRHWV
3$57WRHWV
9$5,$7,21WRHWV
(;,7WRHWV
3$57WRHWV
(',7WRHWV
,167580(17WRHWV
'580WRHWV
(17(5WRHWV
())(&76WRHWV
6+,)7WRHWV
9$/8(GLDO
,1&5(0(17WRHWV
'(&5(0(17WRHWV
)WRHWV
087(WRHWV
62/2WRHWV
,167580(170$3WRHWV
■ Achterpaneel
ILJH
FRPSXWHUVFKDNHODDU
6WHOGH]HVFKDNHODDULQQDDUJHODQJKHWW\SHYDQFRPSXWHUGDWRSGH&RPSXWHUFRQQHFWRU
DDQJHVORWHQLVRIQDDUJHODQJGHVRIWZDUHGLHXJHEUXLNW6FKDNHOKHWWRHVWHOXLWYRRUGDWXGH]H
VFKDNHODDUYHU]HW$OVXGH0,',FRQQHFWRUVZLOJHEUXLNHQ]HWGH]HVFKDNHODDUGDQRS0,',
0,',,1FRQQHFWRU
0,',,1FRQQHFWRU
0,',287FRQQHFWRU
0,',287FRQQHFWRU
86%FRQQHFWRU
6(5,$/FRQQHFWRU86%FRQQHFWRU
$8',2,138792/80(UHJHODDU
,1387MDFN
287387MDFN
$&,1FRQQHFWRU
+LHURSNDQXHHQVSHFLDOH&RPSXWHUNDEHORIHHQ86%NDEHODSDUWYHUNRFKWDDQVOXLWHQ
:HONW\SHYDQNDEHOXQRGLJKHEWKDQJWDIYDQXZFRPSXWHU
:DQQHHUGH&RPSXWHUVFKDNHODDURS0,',VWDDW
NDQGH&RPSXWHUFRQQHFWRURIGH86%NDEHOQLHWJHEUXLNWZRUGHQ
287387MDFN
0HWGHIDEULHNVLQVWHOOLQJHQZRUGWHUJHHQJHOXLGXLWJHVWXXUGYDQXLWGH2XWSXWMDFNV
11
Aansluiten op een computer/MIDI-klavier
Aansluiten op een computer
(U]LMQGULHPDQLHUHQRPGH6&RSXZFRPSXWHUDDQWHVOXLWHQPHWEHKXOSYDQ
GH86%FRQQHFWRUHQGHMIDI-connectorenRIGHseriële connector,QGLHQXGH
86%FRQQHFWRUHQRIGHVHULsOHFRQQHFWRUJHEUXLNWNDQXWRWSDUWVJHEUXLNHQLQ
GLHQXGH0,',FRQQHFWRUHQJHEUXLNWNDQXSDUWVJHEUXLNHQ:DQQHHUXGH
0,',FRQQHFWRUHQJHEUXLNWPRHWXEHVFKLNNHQRYHUHHQFRPSXWHULQWHUIDFHSDQHHO
DGDSWRUGDWYRRU]LHQLVYDQ0,',FRQQHFWRUHQ]RDOVGH5RODQG6XSHU038,,
HQ],QGLHQXGH86%RIGHVHULsOHFRQQHFWRUHQJHEUXLNWNDQXHHQVSHFLDOHNDEHO
JHEUXLNHQRPGH6&UHFKWVWUHHNVRSGHFRPSXWHUDDQWHVOXLWHQPDDUXZVRIW
ZDUHPRHWPHWGH86%SRRUWRIGHVHULsOHSRRUWRYHUHHQVWHPPHQ=LHHoe MIDIcommando’s worden uitgewisseld met een computerS
=HWVWHHGVKHWYROXPHGLFKW
HQVFKDNHODOOHDSSDUDWHQ
XLWYRRUGDWXDDQVOXLWLQJHQ
PDDNW=RYRRUNRPWX
VFKDGHHQRIGHIHFWHQDDQ
OXLGVSUHNHUVHQDQGHUH
DSSDUDWXXU
■ Een computer aansluiten met de USB-connector
86%LVGHDINRUWLQJYDQ8QLYHUVDO6HULDO%XVHQLVHHQQLHXZHLQWHUIDFHZDDUPHHYHU
VFKLOOHQGHVRRUWHQUDQGDSSDUDWXXUDDQHHQFRPSXWHUNXQQHQZRUGHQDDQJHVORWHQ
'RRU86%NDQXPHWHHQHQNHOH86%NDEHOYHUVFKLOOHQGHUDQGWRHVWHOOHQDDQVOXLWHQ
HQZRUGHQGHJHJHYHQVVQHOOHUYHUVWXXUGGDQPHWGHYURHJHUHVHULsOHSRRUWHQ
'DDUHQERYHQNDQGHUDQGDSSDUDWXXUDDQJHVORWHQHQRQWNRSSHOGZRUGHQWHUZLMOGH
VWURRPQRJDDQVWDDWHQ]DOGHFRPSXWHUGH]HKDQGHOLQJHQRQPLGGHOOLMNGHWHFWHUHQ
9RRUVRPPLJHVRRUWHQUDQGDSSDUDWXXU]LMQLQVWHOOLQJHQRIDQGHUHKDQGHOLQJHQ
YHUHLVW
ILJH
IN 1
OUT
MIDI-klavier (PC-180, PC-160 enz.)
USB-kabel
(apart verkocht)
PC
USB-connector ( | ❍ | ❍ | )
PC
12
Apple Macintosh
USB-poort
Apple Macintosh Series
:DQQHHUXXZFRPSXWHU
PHWGH6&YHUELQGW
YLDHHQ86%NDEHOLVKHW
QLHWQRGLJRPXZ
FRPSXWHUXLWWHVFKDNHOHQ
Aansluiten op een computer/MIDI-klavier
1
=HWGHVWURRPYDQGH6&XLWHQ]HWGH&20387(5VFKDNHODDURS
>86%@
6FKDNHOKHWWRHVWHOXLW
YRRUGDWXGH&20387(5
VFKDNHODDUYHU]HW'H
LQVWHOOLQJYDQGH]H
VFKDNHODDUZRUGWYDQ
NUDFKWELMKHWRSVWDUWHQ
ILJ
2
3
6OXLWGH86%NDEHODDQRSGH86%FRQQHFWRURIGH86%SRRUWYDQXZFRP
SXWHU
6OXLWKHWDQGHUHXLWHLQGHYDQGH86%NDEHODDQRSGH86%FRQQHFWRUYDQ
GH6&
IDe USB-driver installeren
2PXZFRPSXWHURSGH6&DDQWHVOXLWHQYLDHHQ86%NDEHOPRHWXHHUVWGH
86%GULYHU0,',GULYHUDDQVOXLWHQ'H86%GULYHUVWDDWRSGHELMJHOHYHUGH&'
520
'H86%GULYHULVVRIWZDUHGLHJHJHYHQVXLWZLVVHOWWXVVHQXZFRPSXWHUWRHSDVVLQJ
VHTXHQFHUVRIWZDUHHQ]HQGH6&ZDQQHHUXZFRPSXWHUPHWHHQ86%NDEHO
RSGH6&LVDDQJHVORWHQ
'H86%GULYHUVWXXUWJHJHYHQVYDQKHWWRHSDVVLQJVSURJUDPPDQDDUGH6&HQ
VWXXUW0,',FRPPDQGR·VYDQGH6&QDDUKHWWRHSDVVLQJVSURJUDPPD
:DQQHHUXGH6&HQ
GH3&YHUELQGWYLDGH86%
NDEHONDQXHQNHO
WRHVWHOOHQJHEUXLNHQGLH
FRPSDWLEHO]LMQPHW
:LQGRZV
ILJH
MIDItoepassing
USB-poort
USB
Driver
USB-kabel
MIDI-klankmodule
Computer
0HHUGHWDLOVLYPKHWLQVWDOOHUHQYDQGH86%GULYHUYLQGWXLQKHWERHNMHYRRUGH
LQJHVORWHQSoftware Library voor de SC-8850
Voorzorgen bij het gebruik van een USB-aansluiting
=HOIVLQGLHQGH86%FRQQHFWRUYDQGH6&RSXZFRPSXWHULVDDQJHVORWHQ]DOGH]HQLHW
FRUUHFWZHUNHQWHQ]LMGHGULYHUJHVFKLNWLVYRRUXZFRPSXWHU*HEUXLNVWHHGVHHQFRPSXWHU
ZDDUYDQGH]HZHUNLQJZHUGJHFRQWUROHHUG
0LVVFKLHQPRHWXDOOHUOHL
LQVWHOOLQJHQPDNHQRSXZ
FRPSXWHUGXVOHHV
DDQGDFKWLJGHKDQGOHLGLQJ
YDQGHVRIWZDUHHQPDDN
GHQRGLJHLQVWHOOLQJHQ
13
Aansluiten op een computer/MIDI-klavier
■ Een computer aansluiten met de seriële connector
9RRUGDWXDDQVOXLWLQJHQ
PDDNWPHWDQGHUH
DSSDUDWHQPRHWXKHW
YROXPHGLFKW]HWWHQHQKHW
WRHVWHOXLWVFKDNHOHQRP
GHIHFWHQRIVFKDGHDDQGH
OXLGVSUHNHUVWHYRRUNRPHQ
ILJH
IN 1
OUT
MIDI-klavier (PC-180, PC-160 enz.)
Computer-kabel
(apart verkocht)
PC
Seriële connector ( | ❍ | ❍ | )
PC
1
Apple Macintosh
Modempoort of Printerpoort
Apple Macintosh-serie
=HWGHVWURRPYDQGH6&XLWHQ]HWGH&20387(5VFKDNHODDUDDQ
GLH]LFKDFKWHUDDQGH6&EHYLQGW
ILJH
Apple Macintosh-serie
PC-2
MIDI
PC-1
Mac
PC
PC-2
MIDI
PC-1
Mac
6HOHFWHHUGH´0DFµSRVLWLHLQGLHQXHHQ$SSOH0DFLQWRVKFRPSXWHUJHEUXLNWRIVH
OHFWHHUGH´3&µSRVLWLHLQGLHQXHHQ3&JHEUXLNW
'HEDXGVQHOKHLGYDQHHQPC LV.ESV
14
6FKDNHOKHWWRHVWHOXLW
YRRUGDWXGH&20387(5
VFKDNHODDUYHU]HW'H
LQVWHOOLQJYDQGH]H
VFKDNHODDUZRUGWYDQ
NUDFKWELMKHWRSVWDUWHQ
'HMXLVWHLQVWHOOLQJYDQGH
&20387(5VFKDNHODDU
KDQJWDIYDQKHWW\SHYDQ
FRPSXWHU
Aansluiten op een computer/MIDI-klavier
2
6OXLWGHFRPSXWHUNDEHODDQRSGHVHULsOHSRRUW3&RIGHPRGHPRISULQW
HUSRRUW$SSOH0DFLQWRVKFRPSXWHUDDQGHDFKWHU]LMGHYDQXZFRPSXWHU
3
6OXLWKHWDQGHUHXLWHLQGHYDQGHFRPSXWHUNDEHODDQRSGHVHULsOHFRQQHFWRU
6(5,$/YDQGH6&
8KHEWHHQFRPSXWHUNDEHO
DSDUWYHUNRFKWQRGLJGLH
JHVFKLNWLVYRRUGH
FRPSXWHUGLHXJHEUXLNW
=LHBekabelingsdiagrammen van de
computerS
De seriële MIDI-sturing installeren
2PXZFRPSXWHURSGH6&DDQWHNXQQHQVOXLWHQPHWHHQFRPSXWHUNDEHOPRHW
XHHUVWGHVHULsOH0,',VWXULQJLQVWDOOHUHQ0,',GULYHU'HVHULsOH0,',VWXULQJ
VWDDWRSGHELMJHOHYHUGH&'520
'HVHULsOH0,',VWXULQJLVVRIWZDUHGLHJHJHYHQVXLWZLVVHOWWXVVHQXZFRPSXWHUWRH
SDVVLQJVHTXHQFHUVRIWZDUHHQ]HQGH6&ZDQQHHUXZFRPSXWHUPHWHHQ
FRPSXWHUNDEHORSGH6&LVDDQJHVORWHQ
'HVHULsOH0,',VWXULQJVWXXUWJHJHYHQVYDQKHWWRHSDVVLQJVSURJUDPPDQDDUGH6&
HQVWXXUW0,',FRPPDQGR·VYDQGH6&QDDUKHWWRHSDVVLQJVSURJUDPPD
ILJH
MIDI
Application
Serial Port
Serial
MIDI
Driver
Computer
Computer Cable
MIDI Sound Module
0HHUGHWDLOVLYPKHWLQVWDOOHUHQYDQGHVHULsOH0,',VWXULQJYLQGWXLQKHWERHNMH
YRRUGHLQJHVORWHQSoftware Library voor de SC-8850
0LVVFKLHQPRHWXDOOHUOHL
LQVWHOOLQJHQPDNHQRSXZ
FRPSXWHUGXVOHHV
DDQGDFKWLJGHKDQGOHLGLQJ
YDQGHVRIWZDUHHQPDDN
GHQRGLJHLQVWHOOLQJHQ
15
Aansluiten op een computer/MIDI-klavier
■ Een computer aansluiten met de MIDI-connectoren
,QGLHQXGH0,',FRQQHFWRUHQJHEUXLNWPRHWXEHVFKLNNHQRYHUHHQFRPSXWHULQWHU
IDFHSDQHHODGDSWRUGDWYRRU]LHQLVYDQ0,',FRQQHFWRUHQ]RDOVGH5RODQG6XSHU
038,,HQ]
ILJH
Computer
6FKDNHOKHWWRHVWHOXLW
YRRUGDWXGH&20387(5
VFKDNHODDUYHU]HW'H
LQVWHOOLQJYDQGH]H
VFKDNHODDUZRUGWYDQ
NUDFKWELMKHWRSVWDUWHQ
MIDI
interface
adaptor
MIDI OUT
De instelling
is MIDI
SC-8850
=HWGH&20387(5VFKDNHODDUDFKWHUDDQRSGH6FRS>0,',@$OVX0,',NDEHOVJHEUXLNWLVGH
6&EHSHUNWWRWPD[LPDDOSDUWV,QGLHQXXLWYRHULQJHQZLOPDNHQPHWPHHUGDQSDUWVPRHWX
HHQ86%RIHHQFRPSXWHUNDEHOJHEUXLNHQ
16
6FKDNHOKHWWRHVWHOXLW
YRRUGDWXGH&20387(5
VFKDNHODDUYHU]HW'H
LQVWHOOLQJYDQGH]H
VFKDNHODDUZRUGWYDQ
NUDFKWELMKHWRSVWDUWHQ
Aansluiten op een computer/MIDI-klavier
■ Hoe MIDI-commando’s worden uitgewisseld met een
computer
$IKDQNHOLMNYDQGHSRVLWLHYDQGH&20387(5VFKDNHODDU]DOGH0,',JHJHYHQV
VWURRPDOVYROJWYHUVFKLOOHQ
Wanneer de COMPUTER-schakelaar op USB staat
ILJDH
+HWDDQWDO3DUWVYDQGH
NODQNJHQHUDWRUGDWXNDQ
DDQVWXUHQYLDGH86%
FRQQHFWRURIGH6HULsOH
FRQQHFWRUKDQJWDIYDQGH
JHEUXLNWHVRIWZDUH'LW
EHWHNHQWGDWZDQQHHUXGH
86%FRQQHFWRURIGH6HULsOH
FRQQHFWRUJHEUXLNWXQLHW
QRRG]DNHOLMN3DUWV]DO
NXQQHQVSHOHQ/HHV
DDQGDFKWLJGHKDQGOHLGLQJ
YDQXZVRIWZDUH
THRU-functie : ON
USB
MIDI OUT 2
MIDI OUT 1
Part-groep A
Part A1 - A16
MIDI IN 1
GM/GS
Klankgenerator
Part-groep B
Part B1 - B16
MIDI IN 2
GM/GS
Klankgenerator
Part-groep C
Part C1 - C16
GM/GS
Klankgenerator
Part-groep D
Part D1 - D16
GM/GS
Klankgenerator
SC-8850
17
Aansluiten op een computer/MIDI-klavier
Wanneer de COMPUTER-schakelaar op SERIAL staat (PC of Mac)
ILJH
THRU-functie : ON
Macintosh IIci
SERIAL
MIDI OUT 2
MIDI OUT 1
Part-groep A
Part A1 - A16
MIDI IN 1
GM/GS
Klankgenerator
Part-groep B
Part B1 - B16
MIDI IN 2
GM/GS
Klankgenerator
Part-groep C
Part C1 - C16
GM/GS
Klankgenerator
Part-groep D
Part D1 - D16
GM/GS
Klankgenerator
SC-8850
De Thru-functie van de computersoftware
2PGHJHJHYHQVGLHLQ0,',,1ZRUGHQRQWYDQJHQQDDUGHNODQNJHQHUDWRUWHNXQ
QHQ]HQGHQPRHWGH7KUXIXQFWLHYDQGHFRPSXWHUVRIWZDUHDDQVWDDQ:DQQHHUGH
7KUXIXQFWLHDDQVWDDWZRUGHQGHJHJHYHQVGLHLQ0,',,1ZRUGHQRQWYDQJHQ
GRRUGHFRPSXWHUJHVWXXUGHQZRUGHQ]HGRRUGHNODQNJHQHUDWRUJHVSHHOG
■ Hoort u geluid?
$OVGH6&RSXZFRPSXWHULVDDQJHVORWHQHQXKRRUWJHHQJHOXLGNDQGLWYHU
VFKLOOHQGHRRU]DNHQKHEEHQ2PXWHKHOSHQGLWSUREOHHPRSWHORVVHQLVHHQGLD
JUDPYRRU]LHQ=LHBijlagenGeen geluidS
18
+RHXGH]H7KUXIXQFWLH
DDQ]HWOHHVWXLQGH
KDQGOHLGLQJYDQGH
VRIWZDUHGLHXJHEUXLNW
Aansluiten op een computer/MIDI-klavier
Aansluiten van de hoofdtelefoon
*HEUXLNHHQKRRIGWHOHIRRQYDQ²RKPLPSHGDQWLH'HNODQN]DO]HOIVZDQQHHU
GHKRRIGWHOHIRRQLVDDQJHVORWHQYDQXLWGHDXGLRXLWJDQJVILFKHVZRUGHQXLWJH
VWXXUG
ILJH
Stereo hoofdtelefoon
'HKHDGSKRQHMDFNVWXXUW
KHWJHOXLGYDQ287387
XLW'LWEHWHNHQWGDWKHW
JHOXLGYDQ3DUWVGLH
WRHJHZH]HQ]LMQDDQ
287387QLHWWHKRUHQ]DO
]LMQGRRUGHKRRIGWHOHIRRQ
S
Aansluiten op de audio-ingangsfiches
'HXLWJDQJVILFKHVYDQDQGHUH0,',NODQNEURQQHQNXQQHQRSGH]HILFKHVZRUGHQ
DDQJHVORWHQ+HWDXGLRVLJQDDOGDWKLHUELQQHQNRPWZRUGWJHPHQJGPHWGHNODQN
YDQGH6&HQYDQXLWGHDXGLRRXWSXWILFKHVXLWJHVWXXUG
$OVGHVLJQDDOLQYRHUQDDUGLWWRHVWHOWHJURRWRIWHNOHLQLVPRHWXGLWDDQSDVVHQPHW
GHvolumeknop van de audioinvoer'UDDLGHNQRSQDDUOLQNVRPKHWYROXPHWH
YHUPLQGHUHQDOVKHWLQJDQJVVLJQDDOWHJURRWLV
ILJH
SC-8850
Audio (Geluidskaart, CD-speler, enz)
OUT PUT
Volumeknop voor Audio-input
INPUT
19
Aansluiten op een computer/MIDI-klavier
Aansluiten op een MIDI-klavier
■ Aansluitingen maken
'LWRQGHUGHHOYHUGXLGHOLMNWKRHPHQGH6&DDQHHQ0,',NODYLHUPRHWDDQ
VOXLWHQHQKRHPHQGHNODQNHQPRHWVSHOHQ=LHSJDOVXHHQVHTXHQFHURIHHQ3&
RSKHWWRHVWHOZLODDQVOXLWHQ
=HWGH&20387(5VFKDNHODDUDDQGHDFKWHU]LMGHYDQGH6&RSMIDI
ILJH
9RRUGDWXDDQVOXLWLQJHQ
PDDNWPHWDQGHUH
DSSDUDWHQPRHWXKHW
YROXPHGLFKW]HWWHQHQKHW
WRHVWHOXLWVFKDNHOHQRP
GHIHFWHQRIVFKDGHDDQGH
OXLGVSUHNHUVWHYRRUNRPHQ
MIDI OUT
MIDI-klavier
(PC-160, PC-180, enz.)
'HQLHXZHLQVWHOOLQJYDQ
GH&20387(5VFKDNHODDU
ZRUGWYDQNUDFKWELMKHW
RSVWDUWHQ=HWKHWWRHVWHO
XLWYRRUGDWXGH
&20387(5VFKDNHODDU
YHU]HW
De instelling
is MIDI
OUTPUT1 (R)
OUTPUT1 (L)
SC-8850
0HWGHIDEULHNVLQVWHOOLQJHQ
ZRUGWHUJHHQJHOXLG
XLWJHVWXXUGYLDGHRXWSXW
MDFNVSS
Links
INPUT
Actieve luidsprekers
20
Rechts
LINE IN
Stereo-installatie
=RUJGDWXGH/52XWSXW
MDFNVYDQGH6&HQGH
/5LQSXWMDFNVYDQXZ
DXGLRDSSDUDWXXUFRUUHFW
RSHONDDUDDQVOXLW$OVX
OLQNVHQUHFKWVYHUZLVVHOW
]DORRNKHWVWHUHREHHOG
RPNHUHQ
Aansluiten op een computer/MIDI-klavier
■ De stroom AAN/UIT zetten
:DQQHHUGHDDQVOXLWLQJHQ]LMQJHPDDNWPRHWXGHVWURRPYDQXZYHUVFKLOOHQGH
WRHVWHOOHQDDQ]HWWHQLQGHDDQJHGXLGHYROJRUGH
+LHUYHUGXLGHOLMNHQZHKRHXGH6&NDQDDQVOXLWHQRSHHQDXGLRUHSURGXFWLH
V\VWHHPVWHUHRVHWRIYHUVWHUNWHOXLGVSUHNHUV$OVXHHQKRRIGWHOHIRRQJHEUXLNWNDQ
XGHXLWOHJRYHUGHZHUNLQJYDQXZDXGLRUHSURGXFWLHV\VWHHPRYHUVODDQ
De stroom aanzetten
1
9RRUDOHHUXGHVWURRPDDQ]HWPRHWXKHWYROXPHYDQGH6&HQXZ
DXGLRWRHVWHOOHQXZYHUVWHUNHUOXLGVSUHNHUV\VWHHPRPODDJGUDDLHQ
2
'UXNRSGHVWURRPNQRSRPGH6&DDQWH]HWWHQ
3
=HWGHVWURRPDDQYDQXZDXGLRV\VWHHP
4
=HWKHWYROXPHYDQHONWRHVWHORSGHJHZHQVWHVWDQG
De stroom uitzetten
1
2
9RRUDOHHUXGHVWURRPXLW]HWPRHWXKHWYROXPHYDQGH6&HQXZ
DXGLRWRHVWHOOHQXZYHUVWHUNHUOXLGVSUHNHUV\VWHHPRPODDJGUDDLHQ
'RRUGHWRHVWHOOHQLQGH
YHUNHHUGHYROJRUGHDDQWH
]HWWHQORRSWXKHWULVLFRRS
HQVFKDGHDDQOXLGVSUHNHUV
HQDQGHUHWRHVWHOOHQ
:DQQHHUXGH6&
DDQVOXLWRSXZDXGLR
V\VWHHPNDQHHQWHKRRJ
YROXPHXZOXLGVSUHNHUV
EHVFKDGLJHQ+RXHU
UHNHQLQJPHHGDWOXLG
VSUHNHUVYDQHHQJHZRRQ
DXGLRV\VWHHPYHHONZHWV
EDDUGHU]LMQGDQOXLGVSUHNHUV
GLHRQWZRUSHQ]LMQYRRU
PX]LHNLQVWUXPHQWHQ
'LWWRHVWHOLVXLWJHUXVWPHW
HHQEHYHLOLJLQJVFLUFXLW1D
KHWRSVWDUWHQGXXUWKHW
HYHQHQNHOHVHFRQGHQ
YRRUGDWGHQRUPDOH
ZHUNLQJEHJLQW
$OVGLWWRHVWHORQGHUHHQ
EHSDDOGHKRHNVWDDWZDDUELM
GHGLVSOD\PRHLOLMNOHHVEDDU
LVUHJHOGDQKHW/&'
&RQWUDVWS
=HWGHDXGLRWRHVWHOOHQXLWHQ]HWGDDUQDGH6&XLW
■ Hoort u geluid?
1DGDWXGHDDQVOXLWLQJHQKHHIWJHPDDNW]RDOVEHVFKUHYHQLQAansluitingen maken
]HWXGHVWURRPDDQHQYHUKRRJWXKHWYROXPHJHOHLGHOLMNWHUZLMOXRSKHWNODYLHU
VSHHOW%HZHHJWGHVWDDILQGLFDWRUYDQGH6&"=RMDGDQRQWYDQJWGH6&GH
0,',FRPPDQGR·VRSHHQMXLVWHPDQLHU
0HQKRRUWHHQNODQNRSGH6&ZDQQHHUGH>92/80(@NQRSLQJHGUXNWLVGH
3UHYLHZIXQFWLH,QGLHQXJHHQJHOXLGKRRUWZDQQHHUXRSXZNODYLHUVSHHOWNDQX
GH]HIXQFWLHJHEUXLNHQRPWHFRQWUROHUHQRIKHWYROXPHYDQGHYHUVWHUNHUHQGH
DDQVOXLWLQJHQYDQGHOXLGVSUHNHUVFRUUHFW]LMQ
$OVGHVWDDILQGLFDWRUYDQKHWWRHVWHOQLHWEHZHHJWZRUGHQHUJHHQ0,',FRPPDQ
GR·VYDQXLWXZ0,',NODYLHURQWYDQJHQ&RQWUROHHUGHLQVWHOOLQJHQYDQXZ0,',
NODYLHUHQGHDDQVOXLWLQJHQYDQGH0,',NDEHOV
=HOIVDOVXJHOXLGKRRUWHQGHVWDDILQGLFDWRUHQEHZHJHQQLHWEHWHNHQWGLWGDWGHSDUWV
GLHJHVSHHOGZRUGHQRSKHWPRPHQWQLHWZRUGHQJHWRRQG2PGHVWDDILQGLFDWRUHQ
WHEHNLMNHQPRHWXPART>
@RI>
@JHEUXLNHQRPGHSDUWRSQLHXZWHVHOHFWHUHQ
RIWHJHOLMNHUWLMGPART>
@HQ>
@ALLLQGUXNNHQRPQDDUKHW$OO3DUWVFKHUP
WHJDDQHQ>3$57@>)@GUXNNHQRPGHYROXPHOHYHOVYDQDOOHSDUWVWHEHNLMNHQ
7HQ]LMX]HRSVODDWNHUHQ
V\VWHHPSDUDPHWHUVHQXVHU
SDUDPHWHUVWHUXJQDDUKXQ
VWDQGDDUGZDDUGHZDQQHHU
XGH6&XLWVFKDNHOW
$OVXGH]HLQVWHOOLQJHQZLO
RSVODDQ]LHSC-8850instellingen bewaren en
opladenS
0HWGHIDEULHNVLQVWHOOLQJHQ
]DOGLWWRHVWHOJHOXLG
SURGXFHUHQLQUHVSRQVRS
JHOLMNZHONNDQDDO²
RQJHDFKWKHW]HQGNDQDDOGDW
RSXZNODYLHULVLQJHVWHOG
S'LWNRPWGRRUGDW
HONH3DUWWRHJHZH]HQLVDDQ
KHWRYHUHHQNRPVWLJH0,',
NDQDDO+HWFLMIHURQGHUGH
EDONLQGLFDWRULVKHW3DUW
QXPPHU
21
Aansluiten op een computer/MIDI-klavier
Aansluiten van een andere MIDIklankbron op de SC-8850
■ Aansluitingen maken
*HEUXLNHHQDI]RQGHUOLMNYHUNRFKWH0,',NDEHORPGH0,',287FRQQHFWRUYDQ
GH6&RSGH0,',,1FRQQHFWRUYDQHHQDQGHUH0,',NODQNEURQDDQWHVOXLWHQ
Wanneer de COMPUTER-schakelaar op [SERIAL (PC, Mac)] of [USB] staat
ILJH
SERIAL
MIDI-klankmodule 1
MIDI-klankmodule 2
USB
2P0,',ERRGVFKDSSHQ
XLWWHVWXUHQYDQXLW0,',
287HQGLHQWXRSXZ
FRPSXWHUGHEHVWHP
PLQJHQYRRUGH0,',
ERRGVFKDSSHQLQWHVWHOOHQ
MIDI OUT1
MIDI IN
Part-groep A
Part A1 - A16
GM/GS
Klankgenerator
MIDI IN
Part-groep B
MIDI OUT2
Part B1 - B16
GM/GS
Klankgenerator
Part-groep C
Part C1 - C16
GM/GS
Klankgenerator
Part-groep D
Part D1 - D16
GM/GS
Klankgenerator
SC-8850
:DQQHHUPHQPHWHHQVHULsOHNDEHODDQVOXLWNDQ0,',287QLHWJHEUXLNWZRUGHQ
Wanneer de COMPUTER-schakelaar op [MIDI] staat
ILJH
SERIAL
USB
MIDI OUT 1
MIDI OUT 2
Part-groep A
Part A1 - A16
MIDI IN 1
GM/GS
Klankgenerator
9DQXLWGHFRQQHFWRUV0,',
287HQZRUGHQHU
0,',ERRGVFKDSSHQ
YHU]RQGHQQDDUGH
DDQJHVORWHQDSSDUDWXXU
6WHOLQXZVHTXHQFLQJ
VRIWZDUHGHRXWSXWSRRUW
YDQKHWVSRRULQRSMIDI
OUTHQGHERRGVFKDSSHQ
]XOOHQZRUGHQXLWJHVWXXUG
YDQXLW0,',287HQGH
6&]HOI]DOQLHWVSHOHQ
'LWPDDNWKHWPDNNHOLMNRP
GH6&WHJHEUXLNHQLQ
FRPELQDWLHPHWDQGHUH
NODQNPRGXOHV8NDQ
HFKWHUQLHWGHGDWDYDQppQ
VSRRUWHJHOLMNHUWLMGQDDUGH
6&HQQDDU0,',287
XLWVWXUHQ
Part-groep B
Part B1 - B16
MIDI IN 2
GM/GS
Klankgenerator
Part-groep C
Part C1 - C16
GM/GS
Klankgenerator
Part-groep D
Part D1 - D16
GM/GS
Klankgenerator
SC-8850
$OVPHQKHWWRHVWHOPHWHHQ0,',NDEHODDQVOXLWNDQ3DUW&HQ'QLHWJHEUXLNWZRUGHQ
22
:DQQHHUGH&20387(5
VFKDNHODDUDFKWHUDDQRSGH
6&RS0,',VWDDW
ZRUGHQHUJHHQGDWD
XLWJHZLVVHOGYLDGH86%RI
GH6HULDOFRQQHFWRU
Opnieuw instellen van de fabrieksinstellingen (Initializeren)
+HWLVPRJHOLMNGDWXGHZLM]LJLQJHQGLHXKHEWJHPDDNWQLHWLQKHWJHKHXJHQYDQGH
6&ZHQVWRSWHVODDQ$OVGLWKHWJHYDOLVNDQXRSHHQYRXGLJHZLM]HGHLQVWHO
OLQJHQQDDUKXQRRUVSURQNHOLMNHVWDDWWHUXJEUHQJHQ
IAlle instellingen tot de fabrieksinstelling
terugbrengen (Factory Preset)
'RRUGH]HKDQGHOLQJZRUGHQDOOHLQVWHOOLQJHQYDQGH6&WRWGHIDEULHNVLQVWHO
OLQJHQJHwQLWLDOL]HHUG
1
'UXNWHJHOLMNHUWLMGRSGH>(',7@HQPART>
2
'UXN>,1,7@>)@
3
'UXNVAR.>
@RIINST>
HQVHOHFWHHUInitialize All
@NQRSSHQUTIL
+RXHUUHNHQLQJPHHGDW
GLWRRNGH6\VWHHPSDUD
PHWHUVSHQGH8VHU
SDUDPHWHUVPEW8VHU
,QVWUXPHQWHQ8VHU'UXP
6HWLQLWLDOLVHHUWSS
@RPGHFXUVRURPKRRJHQRPODDJWHEHZHJHQ
ILJH
6&52//EDU
'LWGXLGWRSGHSODDWVYDQGHSDUDPHWHULQKHWJHKHHOYDQGHSDUDPHWHU
$OVGLW]ZDUWHYLHUNDQWMH]LFKRQGHUDDQEHYLQGWRIDOVHUJHHQ]ZDUWYLH
EHWHNHQWGLWGDWHUJHHQDQGHUHSDUDPHWHUV]LMQGDQGHJHWRRQGHSDUDP
4
'UXN>(17(5@
'HGLVSOD\YUDDJW´Initialize Sure?µ
5
'UXN>(17(5@RPWHLQLWLDOL]HUHQ
'UXN>(;,7@RPDIWHVOXLWHQ]RQGHUWHLQLWLDOL]HUHQ
Shortcut-toetsen
8NDQGHLQVWHOOLQJHQYDQGH6&JHPDNNHOLMNLQLWLDOL]HUHQGRRUPLGGHOYDQGH
>6+,)7@NQRS
1
'UXNPART>
@WHUZLMOX>6+,)7@LQJHGUXNWKRXGW
'HGLVSOD\YUDDJW´Initialize Sure?µ
2
'UXN>(17(5@RPWHLQLWLDOL]HUHQ
'UXN>(;,7@RPDIWHVOXLWHQ]RQGHUWHLQLWLDOL]HUHQ
23
Opnieuw instellen van de fabrieksinstellingen (Initializeren)
3
,QLWLDOL]HUHQYRRUKHW*HQHUDO0,',*6)RUPDW
+LHUYHUGXLGHOLMNHQZHGHLQLWLDOL]DWLHSURFHGXUHGLHXPRHWJHEUXLNHQZDQQHHUXGH
6&QDDUGHEDVLVLQVWHOOLQJHQYDQ*HQHUDO0,',*6PRHWLQLWLDOL]HUHQ
,QKHWEHJLQYDQ*HQHUDO0,',*6PX]LHNEHVWDQGHQEHYLQGHQ]LFKJHJHYHQVZDDU
GRRUGHNODQNJHQHUDWRU]LFK]HOIJDDWLQLWLDOL]HUHQ*06\VWHP2Q*06\VWHP
2QRI*65HVHWS'LWEHWHNHQWGDWZDQQHHUXPX]LHNEHVWDQGHQYDQDIKHWEHJLQ
DIVSHHOWGHLQLWLDOL]DWLHDXWRPDWLVFKJHEHXUW]RGDWXGH]HKDQGHOLQJQLHWPHHUPHW
GHNQRSSHQRSKHWSDQHHOPRHWGRHQ
Initializeren voor GS (GS Reset)
1
'UXNWHJHOLMNHUWLMGGH>(',7@HQPART>
2
'UXN>,1,7@>)@
3
'UXNVAR.>
@RIINST>
HQVHOHFWHHUInitialize GS
@NQRSSHQUTILLQ
@RPGHFXUVRURPKRRJHQRPODDJWHEHZHJHQ
ILJ
4
'UXN>(17(5@
'HGLVSOD\YUDDJW´Initialize Sure?µ
5
'UXN>(17(5@RPWHLQLWLDOL]HUHQ
'UXN>(;,7@RPDIWHVOXLWHQ]RQGHUWHLQLWLDOL]HUHQ
Shortcut-toetsen
8NDQGHLQVWHOOLQJHQYDQGH6&JHPDNNHOLMNLQLWLDOL]HUHQGRRUPLGGHOYDQGH
>6+,)7@NQRS
1
'UXNPART>
@WHUZLMOX>6+,)7@LQJHGUXNWKRXGW
'HGLVSOD\YUDDJW´Initialize Sure?µ
2
'UXN>(17(5@RPWHLQLWLDOL]HUHQ
'UXN>(;,7@RPDIWHVOXLWHQ]RQGHUWHLQLWLDOL]HUHQ
24
=HOIVDOVGH6&JHwQL
WLDOLVHHUGZRUGWYRRU
*HQHUDO0,',*6ZRUGHQ
GH6\VWHHPSDUDPHWHUV
SQLHWJHZLM]LJG
CursorYHUZLMVWQDDUGH
SRLQWHUGLHGHPRPHQWHHO
JHVHOHFWHHUGHSDUDPHWHU
DDQGXLGW%LMYRRUEHHOGDOV
XHHQSDUDPHWHUVHOHFWHHUW
GDQJDDWGHFXUVRUQDDUGLH
SDUDPHWHUHQYHUVFKLMQW
GLHSDUDPHWHULQEORN
KLJKOLJKWHG
Opnieuw instellen van de fabrieksinstellingen (Initializeren)
Initializeren voor het General MIDI 1 (GM1 System On)
1
'UXNWHJHOLMNHUWLMGGH>(',7@HQPART>
2
'UXN>,1,7@>)@
3
'UXNVAR.>
@NQRSSHQUTILLQ
@RIINST>
@WRPGHFXUVRURPKRRJHQRPODDJWHEHZH
JHQHQVHOHFWHHUInitialize GM
ILJ
4
'UXN>(17(5@
'HGLVSOD\YUDDJW´Initialize Sure?µ
5
'UXN>(17(5@RPWHLQLWLDOL]HUHQ
'UXN>(;,7@RPDIWHVOXLWHQ]RQGHUWHLQLWLDOL]HUHQ
Shortcut-toetsen
8NDQGHLQVWHOOLQJHQYDQGH6&JHPDNNHOLMNLQLWLDOL]HUHQGRRUPLGGHOYDQGH
>6+,)7@NQRS
1
'UXNPART>
@WHUZLMOX>6+,)7@LQJHGUXNWKRXGW
'HGLVSOD\YUDDJW´Initialize Sure?µ
2
'UXN>(17(5@RPWHLQLWLDOL]HUHQ
'UXN>(;,7@RPDIWHVOXLWHQ]RQGHUWHLQLWLDOL]HUHQ
25
Opnieuw instellen van de fabrieksinstellingen (Initializeren)
Initializeren voor het General MIDI 2 (GM2 System On)
1
'UXNWHJHOLMNHUWLMGGH>(',7@HQPART>
2
'UXN>,1,7@>)@
3
'UXNVAR.>
@RIINST>
@NQRSSHQUTILLQ
@RPGHFXUVRURPKRRJHQRPODDJWHEHZHJHQ
HQVHOHFWHHUInitialize GM2
ILJ
4
'UXN>(17(5@
'HGLVSOD\YUDDJW´Initialize Sure?µ
5
'UXN>(17(5@RPWHLQLWLDOL]HUHQ
'UXN>(;,7@RPDIWHVOXLWHQ]RQGHUWHLQLWLDOL]HUHQ
Shortcut-toetsen
8NDQGHLQVWHOOLQJHQYDQGH6&JHPDNNHOLMNLQLWLDOL]HUHQGRRUPLGGHOYDQGH
>6+,)7@NQRS
1
'UXNPART>
@WHUZLMOX>6+,)7@LQJHGUXNWKRXGW
'HGLVSOD\YUDDJW´Initialize Sure?µ
2
'UXN>(17(5@RPWHLQLWLDOL]HUHQ
'UXN>(;,7@RPDIWHVOXLWHQ]RQGHUWHLQLWLDOL]HUHQ
26
De verschillende klanken proberen
De verschillende klanken van de SC-8850 proberen
'H6&EHYDWHHQJURRWJDPPDNODQNHQZDDURQGHUQLHWDOOHHQNODQNHQYDQ
PX]LHNLQVWUXPHQWHQ]RDOVYDQSLDQRRUJHOHQJLWDDUPDDUHYHQHHQVNODQNHIIHFWHQ
]RDOVYRJHOVHQWHOHIRRQEHOOHQ,QGH6&ZRUGWHONYDQGH]HNODQNHQHHQInstrumentJHQRHPG
+LHURQGHUYROJWKRHXGHNODQNHQYDQGH]HLQVWUXPHQWHQNDQXLWSUREHUHQ
■ Naar Demo-songs luisteren
'H6&EHYDWGULHGHPRVRQJVZDDUGRRUXGHULMNHYHUVFKHLGHQKHLGYDQGH
NODQNHQNDQEHOXLVWHUHQGLHLQGH6&]LMQLQJHERXZG8NDQHHQHQNHOHGHPR
VRQJRIDOOHVRQJVQDHONDDUEHOXLVWHUHQ
1
'UXNWHJHOLMNHUWLMGGH>(',7@HQPART>
2
'UXN>'(02@>)@
@NQRSSHQ87,/LQ
ILJ
3
'UXNVAR.>
@RIINST>
@RPGHFXUVRURPKRRJRIRPODDJWHEHZHJHQ
HQVHOHFWHHUGHVRQJGLHXZLOVSHOHQ
$OVXAll SongVHOHFWHHUWZRUGHQDOOHVRQJVQDHONDDUDIJHVSHHOG
ILJ
4
'UXN>(17(5@
$OOHUHFKWHQYRRUEH
KRXGHQ2QJHRRUORRIG
JHEUXLNYDQGLWPDWHULDDO
YRRUDQGHUHGRHOHLQGHQ
GDQKHWEHOXLVWHUHQLQ
SHUVRRQOLMNHKXLVOLMNH
NULQJLVHHQLQEUHXNRSGH
WRHSDVEDUHZHWJHYLQJ
'HGLVSOD\YUDDJW´Start Demo Play?µ
5
'UXN>(17(5@RPGHGHPRWHVSHOHQ
'UXN>(;,7@RPDIWHVOXLWHQ]RQGHUGHGHPRWHVSHOHQ
6
'UXN>(;,7@RPKHWDIVSHOHQWHVWRSSHQ
9DQGHZHHUJHJHYHQ
PX]LHNZRUGHQHUJHHQ
GDWDXLWJHVWXXUGYLD0,',
287
27
De verschillende klanken proberen
Shortcut-toetsen
8NDQKHWVFKHUPYDQGHGHPRVRQJVJHPDNNHOLMNVHOHFWHUHQGRRUPLGGHOYDQGH
>6+,)7@NQRS
1
2
'UXN>(',7@WHUZLMOX>6+,)7@LQJHGUXNWKRXGW
'UXNVAR.>
@RIINST>
@RPGHFXUVRURPKRRJHQRPODDJWHEHZHJHQ
HQVHOHFWHHUGHVRQJGLHXZLOVSHOHQ
$OVXAll SongVHOHFWHHUWZRUGHQDOOHVRQJVQDHONDDUDIJHVSHHOG
3
'UXN>(17(5@
'HGLVSOD\YUDDJW´Start Demo Play?µ
4
'UXN>(17(5@RPGHGHPRWHVSHOHQ
'UXN>(;,7@RPDIWHVOXLWHQ]RQGHUGHGHPRWHVSHOHQ
5
'UXN>(;,7@RPKHWDIVSHOHQWHVWRSSHQ
■ Demo-songs
THE SECRET PLACE
Idecs Music Software
Copyright © 1999, Roland Corporation
WALL FIVE MIX
HEIGO TANI
Copyright © 1999, Roland Corporation
Blue X
Yuuki Kato (Music Brains, Inc.)
Copyright © 1999, Roland Corporation
Profiel
Idecs Music Software
'H]HSURIHVVLRQHOHNODQNSURGXFWLHJURHSEOLMIWYRRUQLHXZHRSZLQGLQJ]RUJHQLQGHZH
UHOGYDQPX]LHNEHVWDQGHQGRRUGH60)JHJHYHQVFUHDWLHVGLH]HELHGHQ'RRUGHRYHU
ZHOGLJHQGHNZDOLWHLWYDQKXQPX]LHNNHQQHQ]HHHQHQRUPHQDYROJLQJRQGHUGHJH
EUXLNHUVYDQPX]LHNEHVWDQGHQ'DDUQDDVWEHVWULMNHQKXQDQGHUHDFWLYLWHLWHQLQGH
PX]LHNZHUHOGELMQDHONJHELHGFRPSRQHUHQDUUDQJHUHQSURGXFHQHQRQGHUZLMV
HEIGO TANI
%HJRQ]LMQFDUULqUHDOV'-LQLQHHQGLVFRLQKHWXLWJDQJVJHELHG5RSSRQJLLQ7RN\R
9DQDIGDWPRPHQWFRPSRQHHUGHDUUDQJHHUGHHQSURGXFHHUGHKLMHHQJURWHYHUVFKHL
GHQKHLGYDQZHUNHQ+LMWUDGRSPHWGHJURWHPHHVWHU´'-:DGDµHQGHWHFKQRKRXVH
JURHSHQ´&R)XVLRQµHQ´$720µ+LMEUDFKWHHQJURRWDDQWDODQDORJHSODWHQXLWYRRU
$PHULNDDQVHHQ'XLWVHODEHOV1D]LMQWRXULQ(XURSDLQMXQLEUDFKWKLM]LMQHHUVWH
DOEXPXLW´&2)8µRQGHUGHQDDP´&R)XVLRQµYDQ6XEOLPH5HFRUGVYDQ-DSDQLQVHS
WHPEHU
Music Brains, Inc.
'LWPX]LHNEHGULMIZHUGRSDSULORSJHULFKWLQ7RN\RZDWWHYHQVRRNKXQEHODQ
JULMNVWHZHUNEDVLVLV=HPDNHQ&'·VYLGHR%*0&0DQLPDWLHPX]LHNNDUDRNHHQ]
LQKXQHLJHQRSQDPHVWXGLR=HRQWZLNNHOHQHYHQHHQVHOHNWURQLVFKHPX]LHNLQVWUXPHQW
HQVWXUHQVSHOHUVSXEOLFHUHQKDQGERHNHQHQ]9RRU5RODQG60)PX]LHNEHVWDQGHQ
KHEEHQ]HYHUVFKLOOHQGHYHUVFKLOOHQGHKRRJJHZDDUGHHUGHQXPPHUVJHPDDNWGLHKDQ
GHOGHQRYHUGHUHDOLWHLWLQGHPX]LHN
28
9DQGHZHHUJHJHYHQ
PX]LHNZRUGHQHUJHHQ
GDWDXLWJHVWXXUGYLD0,',
287
De verschillende klanken proberen
■ De basisklanken (Hoofdklanken) beluisteren
(PHRASE PREVIEW)
2SGH6&ZRUGHQNODQNHQYDQHHQQRUPDOH3DUWPHWEHKXOSYDQWZHHQXP
PHUVEHSDDOGKHW,QVWUXPHQWQXPPHUJHWRRQGRQGder INSTHQKHW9DULDWLRQ
QXPPHU>YDULDWLHQXPPHU@JHWRRQGRQGHUVAR.'HNODQNHQPHWKHW9DULDWLRQ
QXPPHU]LMQGHEDVLVNODQNHQHoofdklanken
2SGH6&NDQXGRRUHHQGUXNRSHHQHQNHOHNQRSGH]HNODQNHQLQHHQDDQJH
SDVWHIUDVHEHOXLVWHUHQ
1
=RUJHUYRRUGDWKHWPart Basic-schermJHVHOHFWHHUGLV
2
'UXNINST>
@RPGHFXUVRUQDDUINSTWHYHUSODDWVHQ
ILJ
3
'UDDLDDQGH>9$/8(@NQRSRIGUXNRS>'(&@RI>,1&@RPGHNODQNHQWH
VHOHFWHUHQ$OVXRS>'(&@GUXNWZRUGWKHW,QVWUXPHQWQXPPHUNOHLQHUHQ
DOVXRS>,1&@GUXNWZRUGWKHW,QVWUXPHQWQXPPHUJURWHU0HQNDQHHQ
,QVWUXPHQWQXPPHUYDQWRWVHOHFWHUHQ
4
9RRUKHWNLH]HQYDQ
NODQNHQYDQXLWHHQDQGHU
WRHVWHORIYDQXLWHHQ
VHTXHQFHUSURJUDPPD]LH
MIDI-commando’s
gebruiken om instrumenten te selecteren uit
andere toestellen of
sequence softwareS
+HW3DUW%DVLFVFKHUPLVKHW
VFKHUPGDWYHUVFKLMQWZDQ
QHHUXGH6&DDQ]HW8
NDQYDQXLWDQGHUHVFKHU
PHQWHUXJNHUHQQDDUKHW
3DUW%DVLFVFKHUPGRRURS
>(;,7@WHGUXNNHQ$OVGH
3$57GLVSOD\RSALLVWDDW
GUXNGDQWHJHOLMNHUWLMGRS
PART>
@HQ>
@ALL
RPGHPARTGLVSOD\ZHHU
QRUPDDOWHNULMJHQ
8NDQGHZDDUGHVQHOOHU
ODWHQYHUDQGHUHQDOVXGH
>,1&@RI>'(&@WRHWV
LQJHGUXNWKRXGWWHUZLMOX
RSGHDQGHUHWRHWV>'(&@
RI>,1&@GUXNW
'UXNRSGH>92/80(@NQRSRPGHNODQNWHEHOXLVWHUHQ
'HJHVHOHFWHHUGHNODQNZRUGWLQHHQDDQJHSDVWHIUDVHJHVSHHOG6WDQGDDUG
LQVWHOOLQJ
$OVXPHWGHIDEULHNVLQ
VWHOOLQJHQRSGH
>92/80(@NQRSGUXNW
KRRUWXHHQSKUDVHPHWGH
NODQNGLHLQGHGLVSOD\
VWDDW8NDQLQVWHOOHQGDWHU
VOHFKWVHHQEHSDDOGHQRRW
ZRUGWJHVSHHOG9RRU
GHWDLOV]LHParameters
instellen die de SC-8850
zelf beïnvloeden (Utilityscherm)S
29
De verschillende klanken proberen
■ De Variation-klanken beluisteren
1
=RDOVXZHHWEHYDWGH6&PHHUGDQNODQNHQ
1DDVWGHEDVLVKRRIGNODQNHQYDQGH6&LVKHWWRHVWHORRNYRRU]LHQYDQVariationNODQNHQGLHLHWZDWYHUVFKLOOHQYDQGHEDVLVNODQNHQ
'HNODQNHQYDQGH6&ZRUGHQGRRUWZHHQXPPHUVJHVHOHFWHHUGKHWInstrumentnummerHQKHWVariation-nummer,QZDWKLHUERYHQZHUGEHVFKUHYHQYH
UDQGHUWKHW,QVWUXPHQWQXPPHUZDQQHHUPHQGH>9$/8(@VFKLMIRIGH>'(&@HQ
>,1&@NQRSSHQJHEUXLNWRPGHEDVLVNODQNHQWHVHOHFWHUHQ+LHURQGHUZRUGWEHV
FKUHYHQKRHPHQKHW9DULDWLRQQXPPHUNDQYHUDQGHUHQRPYHUVFKLOOHQGH9DULD
WLRQNODQNHQWHEHOXLVWHUHQ
9RRUKHWNLH]HQYDQ
NODQNHQYDQXLWHHQDQGHU
WRHVWHORIYDQXLWHHQ
VHTXHQFHUSURJUDPPD]LH
MIDI-commando’s
gebruiken om instrumenten te selecteren uit
andere toestellen of
sequence softwareS
=RUJHUYRRUGDWKHWPart Basic-schermJHVHOHFWHHUGLV
3DUW%DVLFVFKHUPS
,QGLWYRRUEHHOGYHUDQGHUHQZHGHEDVLVNODQNKRRIGNODQNLQ017 Organ 1]RDOV
EHVFKUHYHQLQGHYRULJHSDUDJUDDIDe basisklanken beluisteren (hoofdklanken)
2
'UXNVAR.>
@RPGHFXUVRUQDDUVAR WHYHUSODDWVHQ
ILJ
3
'UDDLDDQGH>9$/8(@NQRSRIGUXN>'(&@RI>,1&@RPNODQNHQWHVHOHFW
HUHQ
$OVXRS>'(&@GUXNWZRUGWKHW9DULDWLRQQXPPHUNOHLQHUHQDOVXRS>,1&@GUXNW
ZRUGWKHW9DULDWLRQQXPPHUJURWHU=HOIVWXVVHQGHRUJHONODQNHQNDQXGHYHOHYDUL
DWLHVKRUHQ
4
'UXNRSGH>92/80(@NQRSRPGHNODQNHQWHFRQWUROHUHQ
3UREHHUDQGHUHNODQNHQRSGH]HOIGHPDQLHU
,QGH InstrumentenlijstSVWDDQGHLQVWUXPHQWHQGLHLQGH6&]LMQYRRU
]LHQ+HW,QVWUXPHQWQXPPHUVWHPWRYHUHHQPHWKHWQXPPHULQGH3&NRORPYDQ
GHWDEHOKHW9DULDWLRQQXPPHUVWHPWRYHUHHQPHWKHWQXPPHUGDWLQGH&&NR
ORPVWDDW+HWDDQWDOYDULDWLHVLVDIKDQNHOLMNYDQGHNODQN8]DORSPHUNHQGDWKHW
RUJHO,QVWUXPHQWQXPPHUGDWZHMXLVWKHEEHQEHOXLVWHUGYHHOYDULDWLHNODQNHQ
KHHIW=LHYRRUPHHUGHWDLOVDe instrumentenlijst gebruikenS
30
8NDQGHZDDUGHVQHOOHU
ODWHQYHUDQGHUHQDOVXGH
>,1&@RI>'(&@WRHWV
LQJHGUXNWKRXGWWHUZLMOX
RSGHDQGHUHWRHWV>'(&@
RI>,1&@GUXNW
De verschillende klanken proberen
■ De drumsetklanken beluisteren
'HVHOHFWLHYDQGHNODQNHQYDQGH'UXP3DUWJHEHXUWRSHHQDQGHUHPDQLHUGDQGLH
YDQHHQQRUPDOH3DUW
%LM'UXPVHWVZRUGWHHQYHUVFKLOOHQGHNODQNWRHJHZH]HQDDQHONHQRRWYDQKHWNOD
YLHU'H6&KHHIWYHUVFKLOOHQGH'UXPVHWVHQXNDQGH'UXPVHWVZLM]LJHQRS
GH]HOIGHPDQLHUGLHXJHEUXLNWRPKRRIGNODQNHQYRRUHHQQRUPDOH3DUWWHVHOHFWH
UHQ
1
=RUJHUYRRUGDWKHWPart Basic-schermJHVHOHFWHHUGLV
2
'UXNPART>
@RI>
@RPHHQ'UXP3DUWWHVHOHFWHUHQ
9RRUKHWNLH]HQYDQGUXP
VHWVYDQXLWHHQDQGHU
WRHVWHORIYDQXLWHHQ
VHTXHQFHUSURJUDPPD]LH
MIDI-commando’s
gebruiken om drumsets
te selecteren van andere
toestellen of sequence
softwareS
'H'UXP3DUWVYDQGHIDEULHNVLQVWHOOLQJHQVWDDQRS3DUW$%&'
3
3DUW%DVLFVFKHUPS
'UXNINST>
@RPGHFXUVRUQDDUINST WHYHUSODDWVHQ
ILJ
4
'UDDLDDQGH>9$/8(@NQRSRIGUXNRS>'(&@RI>,1&@RPGHNODQNHQWH
VHOHFWHUHQ$OVXRS>'(&@GUXNWZRUGWKHW'UXPVHWQXPPHUNOHLQHUHQDOVXRS
>,1&@GUXNWZRUGWKHW'UXPVHWQXPPHUJURWHU
5
'UXNRSGH>92/80(@NQRSRPGHNODQNWHEHOXLVWHUHQ
'HJHVHOHFWHHUGHGUXPVHWZRUGWLQHHQDDQJHSDVWHIUDVHJHVSHHOG6WDQGDDUGLQ
VWHOOLQJ
'HDrumsetlijstS
WRRQWZHONHNODQNHULV
WRHJHZH]HQDDQZHONH
WRHWV9RRUGHWDLOV]LHHoe
gebruikt u de Drumset
lijstS
$OVXPHWGHIDEULHNVLQ
VWHOOLQJHQRSGH
>92/80(@NQRSGUXNW
KRRUWXHHQSKUDVHPHWGH
NODQNGLHLQGHGLVSOD\
VWDDW8NDQLQVWHOOHQGDWHU
VOHFKWVHHQEHSDDOGHQRRW
ZRUGWJHVSHHOG9RRU
GHWDLOV]LHParameters
instellen die de SC-8850
zelf beïnvloeden (Utilityscherm)S8NDQRRN
GHNODQNYDQLQGLYLGXHOH
QRWHQEHOXLVWHUHQLQKHW
'UXPVFKHUP
31
De verschillende klanken proberen
Parameterinstellingen voor de klankbron
■ Het volume aanpassen (VOLUME, LEVEL)
$OVGH6&DDQHHQDXGLRUHSURGXFWLHV\VWHHPLVDDQJHVORWHQYHUVWHUNHUVOXLG
VSUHNHUVHQ]NDQXRSXZDXGLRV\VWHHPKHWYROXPHDDQSDVVHQ:DQQHHUXHFKWHU
KHWYROXPHZLODDQSDVVHQWHUZLMOXVSHHOWNDQXGLWRSWZHHPDQLHUHQYDQXLWGH6&
GRHQ
VOLUME-knop
1
'UDDLGH>92/80(@NQRSQDDUUHFKWVRPKHWYROXPHWHYHUKRJHQHQQDDU
OLQNVRPKHWYROXPHWHYHUODJHQ
ILJ
VOLUME
(PUSH)
PREVIEW
Het volumeniveau aanpassen (Part Level)
1
=RUJHUYRRUGDWKHWPart Basic-schermJHVHOHFWHHUGLV
2
'UXN>(',7@
3
'UXN>(',7@>)@
4
'UXNVAR.>
@RIINST>
@RPGHFXUVRUQDDUPart LevelWHYHUSODDWVHQ
3DUW%DVLFVFKHUPS
3DUW/HYHOS
ILJ
5
'UDDLDDQGH>9$/8(@NQRSRIGUXNRS'(&@RI>,1&@RPKHWQLYHDXDDQ
WHSDVVHQ
$OVXRS>'(&@GUXNWYHUODDJWKHWYROXPHHQDOVXRS>,1&@GUXNWYHUKRRJWKHWYR
OXPH
,QGHGLVSOD\ZRUGWRQGHUPart LevelGH3DUWDDQJHGXLG
32
8NDQGHZDDUGHVQHOOHU
ODWHQYHUDQGHUHQDOVXGH
>,1&@RI>'(&@WRHWV
LQJHGUXNWKRXGWWHUZLMOX
RSGHDQGHUHWRHWV>'(&@
RI>,1&@GUXNW
De verschillende klanken proberen
+HWYROXPHYDQHHQ3DUWYHUDQGHUHQPHW0,',FRPPDQGR·V
<Voorbeeld> Het volume van Part 1 op 110 instellen
0,',&+
&&
■ De Pan (stereopositie) aanpassen
'HSDQUHJHOWGHVWHUHRSRVLWLHYDQGHNODQNZDQQHHUPHQHHQVWHUHRZHHUJDYH
V\VWHHPJHEUXLNW%LMYRRUEHHOGGHGUXPVHWHQGHEDVNXQQHQLQKHWPLGGHQ
ZRUGHQJHSODDWVWGHJLWDDUUHFKWVHQKHWNODYLHUOLQNV
1
=RUJHUYRRUGDWKHWPart Basic-schermJHVHOHFWHHUGLV
2
'UXN>(',7@
3
'UXN>(',7@>)@
4
'UXNVAR.>
@RIINST>
'HFRQWUROQXPPHUVYDQ
GHFRQWUROFKDQJHVZRUGHQ
DDQJHGXLGDOV&&
&RQWURO&KDQJHS
3DUW%DVLFVFKHUPS
@RPGHFXUVRUQDDUPart PanWHYHUSODDWVHQ
3DUW3DQS
ILJ
5
8NDQKHWSDUWOHYHO
LQYRHUHQDOVHHQZDDUGH
YDQ²
'UDDLDDQGH>9$/8(@NQRSRIGUXN>'(&@RI>,1&@RPGHSDQLQWH
VWHOOHQ
2PHHQNODQNLQKHWPLGGHQWHSODDWVHQPRHWXGH3DQZDDUGHRS]HWWHQ$OVGH
/ZDDUGHYHUKRRJWZRUGWGHNODQNPHHUQDDUOLQNVJHSODDWVWHQDOVGH5ZDDUGH
YHUKRRJWZRUGWGHNODQNPHHUQDDUUHFKWVJHSODDWVW0HQNDQHHQZDDUGHEHSDOHQ
WXVVHQ/HQ5ZDDUELMKHWPLGGHQLV
:DQQHHUPHQ>'(&@EOLMIWLQGUXNNHQZRUGWRndUDQGRPJHVHOHFWHHUGHQZRUGW
HONHQRRWLQHHQZLOOHNHXULJHVWHUHRSRVLWLHJHSODDWVW
8NDQGHZDDUGHVQHOOHU
ODWHQYHUDQGHUHQDOVXGH
>,1&@RI>'(&@WRHWV
LQJHGUXNWKRXGWWHUZLMOX
RSGHDQGHUHWRHWV>'(&@
RI>,1&@GUXNW
%LMVRPPLJHLQVWUXPHQWHQ
NDQXQRJVWHHGVHHQEHHWMH
JHOXLGXLWGHDQGHUH
OXLGVSUHNHUKRUHQRRNDO
VWDDWGH3DQYROOHGLJOLQNV
RIUHFKWV
$OVXLQPRQROXLVWHUW
KHEEHQGH3DQLQVWHOOLQJHQ
JHHQHIIHFW
33
De verschillende klanken proberen
'H3DQYDQHHQ3DUWYHUDQGHUHQPHW0,',FRPPDQGR·V
<Voorbeeld> De pan van Part 2 op L30 instellen
0,',&+
&&
$DQJH]LHQ/XLWHUVWOLQNVLVKHWPLGGHQHQ5XLWHUVWUHFKWVLVZRUGWGHEHUHN
HQLQJDOVYROJWJHPDDNW 'H3DQYDQHHQ3DUWYHUDQGHUHQQDDU5DQGRPPHW0,',FRPPDQGR·V
<Voorbeeld> De pan van Part 1 op random instellen
$OVPHQGHSDQRSUDQGRPLQVWHOWNDQPHQJHHQ&RQWURO&KDQJHFRPPDQGRJH
EUXLNHQ]RDOVLQKHWKLHUERYHQJHJHYHQYRRUEHHOG
9HU]HQGKHWYROJHQGH6\VWHP([FOXVLYHFRPPDQGR
ILJEH
address
data checksum
F0 41 10 42 12 [ 40 11 1C ] [ 00 ] [ 13 ] F7
Part 1
checksum
random
34
$OVX3DQLQVWHOWRS5
ZRUGWGH]HDOVYROJW
EHUHNHQG De verschillende klanken proberen
■ De toonaard transponeren (KEY SHIFT)
0HW.H\6KLIWNDQXGHWRRQKRRJWHYDQHHQNODQNPHWKDOYHWRQHQGRHQYHUVSULQJHQ
]RGDWPHQJHPDNNHOLMNGHWRRQKRRJWHYDQHHQVRQJNDQYHUDQGHUHQ
1
=RUJHUYRRUGDWKHWPart Basic-schermJHVHOHFWHHUGLV
2
'UXN>(',7@
3
'UXN>(',7@>)@
4
'UXNVAR.>
@RIINST>
@RPGHFXUVRUQDDUKey ShiftWHYHUSODDWVHQ
.H\6KLIWS
ILJ
5
3DUW%DVLFVFKHUPS
'UDDLDDQGH>9$/8(@NQRSRIGUXNRS'(&@RI>,1&@RPGHWRRQDDUGDDQ
WHSDVVHQ
:DQQHHUXRS>(',7@>)@
GUXNWYHUVFKLMQWGHKey
ShiftSDUDPHWHUQLHWRSKHW
VFKHUP+RXGVAR.>
@
LQJHGUXNWHQUROKHWVFKHUP
DI
$OVXRS>'(&@GUXNWYHUODDJWGHWRRQKRRJWHHQDOVXRS>,1&@GUXNWYHUKRRJWGH
WRRQKRRJWH
0HQNDQ“RFWDYHQLQVWDSSHQYDQHHQKDOYHWRRQYHUVFKXLYHQ
■ Een bepaalde Part/alle Parts uitzetten (MUTE)
8NDQppQRIPHHUGHUH
SDUWVXLWVFKDNHOHQ
Part Mute
1
'UXNPART>
2
'UXN>087(@
@RI>
@RPHHQSDUWWHVHOHFWHUHQGLHXZLOXLW]HWWHQ
All Mute
1
2
'UXNWHJHOLMNHUWLMGPART>
VHOHFWHUHQ
@HQ>
@ALLRPKHWAll Part-schermWH
'UXN>087(@
35
De verschillende klanken proberen
■ Een specifieke part (SOLO) beluisteren
1
'UXNPART>
2
'UXN>62/2@
@RI>
@RPGHSDUWWHVHOHFWHUHQGLHXZLOEHOXLVWHUHQ
■ Dezelfde klanken selecteren als de
SC-88Pro/SC-88/SC-55
'H6&LVYRRU]LHQYDQYLHUNODQNPDSSHQGH6&PDSGLH]LMQHLJHQRULJL
QHOHNODQNHQEHYDWGH6&3URPDSGLHGH]HOIGHNODQNHQEHYDWDOVGH6&3UR
GH6&PDSGLHGH]HOIGHNODQNHQEHYDWDOVGH6&HQGH6&PDSGLHYRRU
QDPHOLMNGH]HOIGHNODQNHQEHYDWDOVGH6&6&PN,,
:DQQHHUX>,1670$3@GUXNWNDQXGHNODQNPDSYHUDQGHUHQYRRUGHSDUWGLH
JHVOHFWHHUGLV.LHVXLWGH6&PDS6&PDS6&3URPDS
>
@ZRUGWOLQNVYDQGHJHVHOHFWHHUGHLQVWUXPHQWPDSJHWRRQG
ILJ
'RRUHHUVWPART>
@HQ>
@ALLHQGDDUQD>,1670$3@WHGUXNNHQNDQPHQ
GHNODQNPDSYRRUDOOHSDUWVVQHOYHUDQGHUHQ'HNODQNPDSLQVWHOOLQJHQ]XOOHQYRRU
DOOHSDUWVYHUDQGHUHQ
36
$OV>
@QLHWLQKHWAll
Part-schermVWDDWZRUGHQ
GHPDSLQVWHOOLQJHQYDQ
HONHSDUWWRHJHSDVW
Parts en klanken
'H6&NDQYHUVFKLOOHQGHNODQNHQWHJHOLMNHUWLMGSURGFXHUHQ8LWVOXLWHQG
ZDQQHHUHHQ86%FRQQHFWRURIHHQVHULsOHFRQQHFWRUJHEUXLNWZRUGW(HQLQVWUX
PHQW]RDOVGH6&GDWWHJHOLMNHUWLMGYHHONODQNHQYDQXLWHHQHQNHOWRHVWHONDQ
SURGXFHUHQZRUGWHHQmultitimbrale klankgeneratorJHQRHPG(HQWLPEUHLVHHQ
LQVWUXPHQWDOHNODQN'HPRJHOLMNKHLGRPNODQNHQWHJHOLMNHUWLMGWHVSHOHQEHWHN
HQWGDWXYHUVFKLOOHQGHLQVWUXPHQWHQWHJHOLMNHUWLMGNDQJHEUXLNHQ8NDQPHWDQ
GHUHZRRUGHQHHQRSHHQRUNHVWOLMNHQGHQVHPEOHPHWPX]LNDOHSDUWLMHQFUHsUHQ
%LMGH6&ZRUGWHHQNODQNGLHYRRUHONH3DUWZRUGWJHVHOHFWHHUGHHQInstrumentJHQRHPG,QVWUXPHQWHQOLMVWS8NDQGHGRRUXJHNR]HQNODQNHQDDQHON
YDQGH3DUWVWRHZLM]HQHQ]RXZHLJHQHQVHPEOHFUHsUHQ
De klank van elke part wisselen
■ Soorten parts
'H6&LVYRRU]LHQYDQ3DUWV3DUWVZRUGHQRQGHUYHUGHHOGLQ*URHS$$
$*URHS%%%*URHS&&&HQ*URHS'''PHW]HVWLHQSDUWV
LQHHQJURHS
(U]LMQWZHHVRRUWHQSDUWVQRUPDOHSDUWVHQGUXPSDUWV'LWYHUVFKLOQRHPHQZHGH
3DUWPRGXV1RUPDOHSDUWVZRUGHQJHEUXLNWYRRUKHWVSHOHQYDQPHORGLHHQ
EDVOLMQHQ'UXPSDUWVZRUGHQJHEUXLNWYRRUKHWVSHOHQYDQSHUFXVVLHLQVWUXPHQWHQ
,QGHIDEULHNVLQVWHOOLQJHQLVHONHSDUWDOVYROJWLQGHSDUWPRGXVJH]HW
1RUPDOHSDUW $$$$%%%%&&&&''
''
'UXPSDUW
$%&'
8NDQGH3DUW0RGHLQVWHO
OLQJHQZLM]LJHQ9RRUPHHU
LQIRUPDWLH]LHPart Mode
S
:DQQHHUPHQWHJHOLMNHUWLMGPART>
@HQ>
@ALLLQGUXNWRPKHW$OO3DUW
VFKHUPWHVHOHFWHUHQNDQPHQGHYROXPHQLYHDX·VYDQGHPHHUYRXGLJHSDUWVJHOLMN
WLMGLJEHNLMNHQ+LHUGRRUNDQXGHRQWYDQJVWVWDWXVYDQHONHSDUWFRQWUROHUHQ
ILJH
Part Group D
Part Group C
Part Group B
Part Group A
:DQQHHUPHQLQKHW$OO3DUWVFKHUP>)@²>)@GUXNWNDQPHQGHRQWYDQJVWVWDWXV
YDQGHYROJHQGHSDUWVFRQWUROHUHQ
>$@>)@$²$
>$%@>)@
$²$%²%
>&'@>)@
&²&'²'
>3$57@>)@ $²$%²%&²&'²'
37
Parts en klanken
■ Welke MIDI IN zal door een part worden gebruikt?
'H6&LVYRRU]LHQYDQWZHH0,',,1FRQQHFWRUHQ(ONH0,',,1NDQJHJHYHQV
RQWYDQJHQYRRUSDUWVGLWEHWHNHQWGDWZDQQHHUGH0,',,1FRQQHFWRUHQJHEUXLNW
ZHUGHQRPDDQVOXLWLQJHQWHPDNHQHUPD[LPDDOSDUWVNXQQHQZRUGHQJHVSHHOG
:DQQHHUGH0,',FRQQHFWRUHQZHUGHQJHEUXLNWDOVDDQVOXLWLQJNDQPHQJHHQ
XLWYRHULQJHQVSHOHQPHWSDUWV*HZRRQOLMNZRUGW0,',,1JHEUXLNWRPGH
SDUWV$WRW$WHVSHOHQHQZRUGW0,',,1JHEUXLNWRPGHSDUWV%WRW%WH
VSHOHQ
3DUWVZRUGHQRQGHUYHUGHHOGLQ*URHS$$$HQ*URHS%%%PHW
]HVWLHQSDUWVLQHONHJURHS+HW0,',NDQDDOGDWDDQHONHSDUWLVWRHJHZH]HQZRUGW
HYHQHHQVZHHUJHJHYHQLQWZHHJURHSHQQDPHOLMNDOV$$RI%%,QGHID
EULHNVLQVWHOOLQJHQNRPHQJURHSHQ$HQ%RYHUHHQPHWGHWZHH0,',,1FRQQHFWRUHQ
HQYDQGH6&0HWDQGHUHZRRUGHQGH0,',FRPPDQGR·VGLHZRUGHQRQW
YDQJHQLQ0,',,1ZRUGHQQDDUGHSDUWVYDQ*URHS$JHVWXXUGHQGH0,',FRP
PDQGR·VGLHZRUGHQRQWYDQJHQLQ0,',,1ZRUGHQQDDUGHSDUWVYDQ*URHS%
JHVWXXUG%LMYRRUEHHOG0,',FRPPDQGR·VRSNDQDDOGLHRQWYDQJHQZRUGHQLQ
0,',,1]XOOHQSDUWYDQ*URHS%%GRHQNOLQNHQLQGHIDEULHNVLQVWHOOLQJHQ
■ Een part selecteren
9RRUDOHHUHHQNODQNWHVHOHFWHUHQRIHIIHFWLQVWHOOLQJHQWHPDNHQYRRUHHQSDUWHQ]
PRHWXGHSDUWVHOHFWHUHQZDDURSGHLQVWHOOLQJHQ]XOOHQZRUGHQWRHJHSDVW
1
2
=RUJHUYRRUGDWKHWPart Basic-schermJHVHOHFWHHUGLV
'UXNPART>
@RI>
@RPHHQSDUWWHVHOHFWHUHQ
'HSDUWVGLHRSKHWVFKHUPZRUGHQJHWRRQGPART]XOOHQYHUDQGHUHQWXVVHQ$
²$%²%&²&HQ'²'
ILJ
Wisselen tussen Groep A, B, C en D
'RRU>3$57$@>)@>3$57%@>)@>3$57&@>)@RI>3$57'@>)@WHGUXN
NHQYHUVSULQJWGHJHWRRQGHSDUWWXVVHQJURHS$%&HQ'
38
3DUW%DVLFVFKHUPS
Parts en klanken
■ Basisklanken selecteren (Normale part)
,QGH6&ZRUGHQNODQNHQYDQHHQQRUPDOHSDUWPHWEHKXOSYDQWZHHQXPPHUV
JHVSHFLILHHUGKHW,QVWUXPHQWQXPPHUHQKHW9DULDWLRQQXPPHU'HNODQNHQ
PHWHHQ9DULDWLRQQXPPHUJHWRRQGRQGHUVAR.YDQ]LMQGHEDVLVNODQNHQ
hoofdklanken
1
2
3
=RUJHUYRRUGDWKHWPart Basic-schermJHVHOHFWHHUGLV
'UXNPART>
GUXPSDUW
'UXNINST>
@RI>
@RPHHQQRUPDOHSDUWWHVHOHFWHUHQGLWLVJHHQ
@RPGHFXUVRUQDDUINSTWHYHUSODDWVHQ
9RRUKHWNLH]HQYDQ
NODQNHQYDQXLWHHQDQGHU
WRHVWHORIYDQXLWHHQ
VHTXHQFHUSURJUDPPD]LH
MIDI-commando’s
gebruiken om instrumenten te selecteren uit
andere toestellen of
sequence softwareS
3DUW%DVLFVFUHHQS
ILJH
Instrumentnummer
4
Instrumentnaam (Hoofdklank)
'UDDLDDQGH>9$/8(@NQRSRIGUXN>'(&@RI>,1&@RPNODQNHQWHVHOHFW
HUHQ
$OVXRS>'(&@GUXNWZRUGWKHW,QVWUXPHQWQXPPHUNOHLQHUHQDOVXRS>,1&@GUXNW
ZRUGWKHW,QVWUXPHQWQXPPHUJURWHU0HQNDQHHQ,QVWUXPHQWQXPPHUYDQWRW
VHOHFWHUHQ
6RPPLJHNODQNHQYDQGH
6&NXQQHQQLHWERYHQ
RIRQGHUHHQEHSDDOGH
WRRQKRRJWHJHVSHHOG
ZRUGHQ'LWNRPWRPGDW
GHNODQNHQJHFUHsHUG
ZHUGHQRSEDVLVYDQKHW
WRRQKRRJWHEHUHLNYDQGH
HFKWHLQVWUXPHQWHQ
■ Variatieklanken selecteren (Normale part)
'H6&LVYRRU]LHQYDQhoofdklankenEDVLVNODQNHQHQVariation-klanken
NODQNHQPHWYHUVFKLOOHQGHQXDQFHULQJHQ+LHUZRUGWEHVFKUHYHQKRHX9DULDWLRQ
NODQNHQPRHWVHOHFWHUHQ
1
2
3
=RUJHUYRRUGDWKHWPart Basic-schermJHVHOHFWHHUGLV
'UXNPART>
GUXPSDUW
'UXNINST>
@RI>
@RPHHQQRUPDOHSDUWWHVHOHFWHUHQGLWLVJHHQ
@RPGHFXUVRUQDDUINSTWHYHUSODDWVHQ
3DUW%DVLFVFKHUPS
ILJ
4
'UDDLDDQGH>9$/8(@NQRSRIGUXN>'(&@RI>,1&@RPKHW,QVWUXPHQW
QXPPHURIGH9DULDWLRQNODQNWHVHOHFWHUHQGLHXYHUNLHVW
'LWLVGH]HOIGHSURFHGXUHDOVGLHYRRUKHWVHOHFWHUHQYDQHHQEDVLVNODQNKRRIGNODQN
39
Parts en klanken
5
'UXNVAR.>
@RPGHFXUVRUQDDUVARWHYHUSODDWVHQ
ILJ
6
$OVXZLOWHUXJNHUHQQDDU
GHKRRIGNODQN]HWGDQKHW
YDULDWLHQXPPHUWHUXJRS
LQKHW9DULDWLRQ6HOHFW
VFKHUPHQGUXNRSINST
>
@RPGHNODQNWH
NLH]HQ
'UDDLDDQGH>9$/8(@NQRSRIGUXN>'(&@RI>,1&@RPGH9DULDWLRQNODQNWH
VHOHFWHUHQ
:DQQHHUXRSINST>
@
GUXNWRPKHWLQVWUXPHQW
QXPPHUWHNLH]HQZRUGW
GHNODQNYDQKHWRYHUHHQ
NRPVWLJHYDULDWLHQXPPHU
JHNR]HQ
ILJH
Variatienummer
Instrumentnaam (Variatie)
De instrumentenlijst gebruiken
'HNODQNHQLQVWUXPHQWHQGLHYRRU]LHQ]LMQLQGH6&VWDDQLQGHinstrumentenlijstS(ONHNODQNLQVWUXPHQWYDQGH6&KHHIWWZHHQXPPHUVHHQinstrumentnummerHQHHQVariation-nummer'HNODQNHQPHWKHW9DULDWLRQ
QXPPHU]LMQKRRIGNODQNHQHQGHNODQNHQPHWDQGHUHQXPPHUVGDQ]LMQ
9DULDWLRQNODQNHQ
,QGHinstrumentenlijst kan u zowel het intsrumentnummer als het Variation-nummer controleren.
9RRUEHHOG!
$OVXZLOWHUXJNHUHQQDDU
KHWVFKHUPYDQGHKRRIG
NODQN]HWGDQKHW9DULDWLH
QXPPHUWHUXJRSLQGH
9DULDWLRQ6HOHFWPRGHHQ
GUXNGDQRSGHINST
>
@WRHWVHQ
ILJ
CC00 PC SC-8850 Map Voices
2 [Pro]
000 093 Bowed Glass
2 [Pro]
SoftBellPad
001
2 [Pro]
JP8 Sqr Pad
002
2 [Pro]
7thBelPad
003
2
Steel Glass
004
2
Bottle Stack
005
&&
3&
6&0DS
6&3UR0DS
6&0DS
6&0DS
9RLFHV
2SPHUNLQJ
2SPHUNLQJ
2SPHUNLQJ
2SPHUNLQJ
2SPHUNLQJ
40
SC-88Pro Map Voices
Bowed Glass
2 [88]
SoftBellPad
2
JP8 Sqr Pad
2
7thBelPad
2
---------
SC-88 Map
Voices
Bowed Glass
2 [55]
----2
----2
----2
---------
Voices
SC-55 Map
2
Bowed Glass
---------------------
9DULDWLRQQXPPHUZDDUGHYDQ&RQWUROOHUQXPPHU
+RRIGNODQNHQPHW9DULDWLRQQXPPHU]LMQLQKHWYHWJHGUXNW
,QVWUXPHQWQXPPHU3URJUDPQXPPHU
.ODQNHQYDQ6&
.ODQNHQYDQ6&3UR
.ODQNHQYDQ6&PDS
.ODQNHQYDQ6&PDS
*HHQNODQNLQKHW9DULDWLRQQXPPHU
$DQWDOVWHPPHQGDWGRRUKHWLQVWUXPHQWZRUGWJHEUXLNW
.ODQNHQPHWOHJDWR
>3UR@
=HOIGHNODQNHQDOVGH6&3URPDS
>@
=HOIGHNODQNHQDOVGH6&PDS
>@
=HOIGHNODQNHQDOVGH6&PDS
SHUFXVVLHNODQNHQGLHQLHWPHORGLVFKJHVSHHOGNXQQHQ
ZRUGHQ
9RLFHVS
Parts en klanken
■ MIDI-commando’s gebruiken om instrumenten te
selecteren uit andere toestellen of sequence software
0HQNDQVHTXHQFHVRIWZDUHLQGHFRPSXWHUJHEUXLNHQRPGHNODQNHQYDQGH6&
WHVHOHFWHUHQ
'RRUKHWLQYRHUHQYDQKHWVariation-nummerHQKHWInstrumentnummerSNDQ
XNODQNHQVSHFLILsUHQLQXZVHTXHQFHSURJUDPPD0HUNHFKWHURSGDWDIKDQNHOLMN
YDQXZVRIWZDUHGHPDQLHUZDDURSGHQXPPHUVZRUGWJHWRRQGNDQYHUVFKLOOHQ,Q
GH6&EHJLQQHQYDULDWLRQQXPPHUVPHWHHQHQEHJLQQHQGHLQVWUXPHQWQXP
PHUVPHWHHQ
9DULDWLRQQXPPHUVNRPHQRYHUHHQPHWMIDI Bank-nummersHQLQVWUXPHQWQXP
PHUVNRPHQRYHUHHQPHWMIDI Program-nummers
ILJH
SC-8850 Map
065
064
User Tone
User Tone
User Tone
User Tone
User Tone
User Tone
User Tone
User Tone
User Tone
User Tone
008
Upright P w
Comp Clav.
Variatienummer
Variatieklanken
003
002
001
000
Atk Clav.2
Mild Piano
UprightPiano
Piano 1
001
Atk Clav.1
Clav. 2
Pop Celesta
Clav.
Celesta
008
009
Glockenspiel
010
004
003
002
001
000
Eruption
Explosion
Lasergun
Machine Gun
Gun Shot
Capital-klanken
128
Instrumentnummer
.ODQNHQPHWOHJDWRS
MIDI Banknummers
KHEEHQHHQXSSHU06%
HQHHQORZHU/6%
JHGHHOWH'H]HKHEEHQHON
HHQZDDUGHYDQ
]RGDWX[ EDQNHQNDQVSHFLILsUHQ
+HWXSSHUJHGHHOWHYDQKHW
%DQNQXPPHUVWHPW
RYHUHHQPHWKHW9DULDWLH
QXPPHUYDQGH6&
+HWORZHUJHGHHOWHZLVVHOW
WXVVHQ6&PDS6&
PDS6&3URPDSHQ6&
PDS
Echte MIDI-commando’s
*HEUXLNGHYROJHQGHSURFHGXUHRP0,',FRPPDQGR·VLQHHQVHTXHQFHSURJUDPPD
WHFUHsUHQHQWHYHUVWXUHQ
>@'HZDDUGHYDQ&RQWURO&KDQJH 0,',%DQNQXPPHUKRRJVWHKHWYDULD
WLRQQXPPHUYDQGH6&
>@'HZDDUGHYDQ&RQWURO&KDQJH 0,',%DQNQXPPHUODDJVWH
PDSLQVWHOOLQJRSKHWSDQHHO6&
PDS6&PDS6&3URPDS6&
PDS
>@3URJUDP&KDQJHZDDUGH
0,',3URJUDPQXPPHUKHWLQVWUXPHQW
QXPPHUYDQGH6&
$OVXHHQ,QVWUXPHQW
QXPPHULQJHHIWGDWGH6&
QLHWKHHIW]DOGHNODQN
QLHWYHUDQGHUHQ=LHGH
InstrumentenlijstRSS
ZDQQHHUXNODQNHQNLHVW
=LHYRRUPHHUGHWDLOVGHYROJHQGHSDUDJUDDIBank Select LSB
>@HQ>@]LMQGH%DQN6HOHFWFRPPDQGR·V%DQN6HOHFWFRPPDQGR·V]LMQHHQVRRUW
YDQ&RQWURO&KDQJHFRPPDQGRSHQGHYHUZHUNLQJYDQGH%DQN6HOHFW]DO
ZRUGHQXLWJHVWHOGWRWHUHHQ3URJUDP&KDQJHFRPPDQGRRQWYDQJHQZRUGW
%LMYRRUEHHOGDOVXKHWLQVWUXPHQW3LDQRZZLOVHOHFWHUHQPHW9DULDWLRQQXPPHU
,QVWUXPHQWQXPPHUGDQPRHWXGHYROJHQGHJHJHYHQVQDDUGH6&VWXUHQ
8LWJHGUXNWLQGHFLPDOHQ
>@'HZDDUGHYDQ&RQWURO&KDQJH%DQNQXPPHUKRRJVWH9DULDWLRQQXP
PHU
>@'HZDDUGHYDQ&RQWURO&KDQJH
>@3URJUDP&KDQJHZDDUGH
3URJUDPQXPPHU,QVWUXPHQWQXPPHU
0HUNRSGDWKHWFLMIHUGDW
HIIHFWLHIDOV3URJUDP
QXPPHUYHU]RQGHQZRUGW
ppQPLQGHULVGDQKHW
3URJUDPQXPPHU
41
Parts en klanken
Bank Select LSB
'H6&YHUZHUNWKHWODDJVWHGHHOYDQKHW%DQN6HOHFWFRPPDQGR/6%DOVYROJW
S
/HDVWVLJQLILFDQWE\WH/6%
'HLQVWHOOLQJHQYDQGHINST MAPGLH]LMQJHPDDNWYDQXLWKHW
6&SDQHHOZRUGHQJHEUXLNW$OV>
@OLQNVYDQSC-55
LQGHINST MAP YDQKHWSDQHHOJHWRRQGZRUGWGDQLVGH6&
PDSJHVHOHFWHHUG$OV>
@OLQNVYDQSC-88JHWRRQG
ZRUGWGDQLVGH6&PDSJHVHOHFWHHUG$OV>
@OLQNVYDQ
SC-88ProJHWRRQGZRUGWGDQLVGH6&3URPDSJHVHOHFW
HHUG$OV>
@OLQNVYDQSC-8850JHWRRQGZRUGWGDQLVGH
6&PDSJHVHOHFWHHUG
'H6&PDSLVJHVHOHFWHHUGHQ>
@YHUVFKLMQWOLQNVYDQ
SC-55LQGHNST MAP
'H6&PDSLVJHVHOHFWHHUGHQ>
@YHUVFKLMQWOLQNVYDQ
SC-88LQGHINST MAP
'H6&3URPDSLVJHVHOHFWHHUGHQ>
@YHUVFKLMQWOLQNVYDQ
SC-88ProLQGHINST MAP
'HSC-8850PDSLVJHVHOHFWHHUGHQ>
@YHUVFKLMQWOLQNVYDQ
SC-8850LQGHINST MAP
+RHYHUDQGHUWPHQGHNODQNYDQHHQSDUWPHWEHKXOSYDQ0,',FRPPDQGR·V
<Voorbeeld> De klank van Part 2 instellen op de SC-88 map 017 Organ 1 (Variation
000)
0,',&+ &&
&&
3&
6HOHFWHHUWYDULDWLRQQXPPHU
6HOHFWHHUWGH6&PDS
6HOHFWHHUWLQVWUXPHQWQXPPHU
+RHYHUDQGHUWPHQGHYDULDWLRQNODQNYDQHHQSDUWPHWEHKXOSYDQ0,',FRPPDQ
GR·V
<Voorbeeld>De klank van Part 1 instellen op deSC-8850 map 006 Detuned EP3
(Variation 009)
0,',&+ &&
&&
3&
6HOHFWHHUWYDULDWLRQQXPPHU
6HOHFWHHUWGH6&PDS
6HOHFWHHUWLQVWUXPHQWQXPPHU
+RHYHUDQGHUWPHQGHPDSHQGHYDULDWLRQNODQNYDQHHQSDUWPHWEHKXOSYDQ
0,',FRPPDQGR·V
<Voorbeeld>De klank van Part 3 instellen op deSC-88Pro map 039 Acid Bass
(Variation 008)
0,',&+ &&
&&
3&
42
6HOHFWHHUWYDULDWLRQQXPPHU
6HOHFWHHUWGH6&3URPDS
6HOHFWHHUWLQVWUXPHQWQXPPHU
Parts en klanken
■ Drumsets selecteren (Drumpart)
'HNODQNHQYDQHHQGUXPSDUWZRUGHQRSHHQDQGHUHPDQLHUJHVHOHFWHHUGGDQGLH
YDQHHQQRUPDOHSDUW
,QHHQGUXPVHWZRUGHQYHUVFKLOOHQGHNODQNHQDDQHONHQRRWYDQKHWNODYLHU
WRHJHZH]HQ:DQQHHUXHHQGUXPSDUWVHOHFWHHUWHQKHWNODYLHUEHVSHHOW]DOHONH
QRRWHHQDQGHUHNODQNKHEEHQ'LWLV]RRPGDWKHWQLHWQRGLJLVRPGHWRRQKRRJWH
YDQHHQGUXPNODQNWHVSHFLILsUHQ
'UXPVHWVNXQQHQRSGH]HOIGHZLM]HZRUGHQJHVHOHFWHHUGDOVGLHYDQKHWVHOHFWHUHQ
YDQKRRIGNODQNHQYRRUHHQQRUPDOHSDUW'LWEHWHNHQWGDWHUYRRUGUXPSDUWVJHHQ
YDULDWLRQQXPPHUVZRUGHQJHEUXLNW
1
=RUJHUYRRUGDWKHWPart Basic-schermJHVHOHFWHHUGLV
2
'UXNPART>
@RI>
3DUW%DVLFVFKHUPS
@RPHHQGUXPSDUWWHVHOHFWHUHQ
,QGHIDEULHNVLQVWHOOLQJHQ]LMQGHGUXPSDUWVLQJHVWHOGRSSDUW$%&
'
3
'UXNINST>
@RPGHFXUVRUQDDUINSTWHYHUSODDWVHQ
ILJ
4
5
'UDDLDDQGH>9$/8(@NQRSRIGUXN>'(&@RI>,1&@RPGHGUXPVHWWH
VHOHFWHUHQ
$OVXRS>'(&@GUXNWZRUGWKHWGUXPVHWQXPPHUNOHLQHUHQDOVXRS>,1&@GUXNW
ZRUGWKHWGUXPVHWQXPPHUJURWHU
=LHDrumsetlijstSYRRUGHYHUVFKLOOHQGHVRRUWHQGUXPVHWV
43
Parts en klanken
Hoe gebruikt u de Drumset lijst
(ONHGUXPNODQN'UXPLQVWUXPHQWLVWRHJHZH]HQDDQHHQYHUVFKLOOHQGHQRRWYDQGH
GUXPVHW
'HGUXPVHWVYDQGH6&ZRUGHQRSJHVRPGLQGHdrumsetlijstSZDDULQ
KHWQXPPHUHQGHQDDPYDQHONHNODQNLQGHGUXPVHWZRUGWEHVFKUHYHQ
3HQGHYROJHQGHSDJLQD·VEHYDWWHQOLMVWHQYDQGH6&VHWV6&GUXP
VHWV6&GUXPVHWVHQ6&GUXPVHWVPHWKHWQXPPHUHQGHQDDPYDQHONH
NODQN
9RRUEHHOG!
ILJH
22
23
C1 24
25
26
28
29
27
30
31
PC1
STANDARD 1
MC-500 Beep 1
MC-500 Beep 2
Concert SD
Snare Roll
Finger Snap 2
High Q
Slap
Scratch Push [EXC7]
Scratch Pull [EXC7]
Sticks
PC2
STANDARD 2
<<<<Finger Snap
<<<<<-
PC3
[Pro] STANDARD L/R
<<<<<<<<<<-
PC9
ROOM
<<<<Finger Snap
<<<<<-
32
33
34
35
3&
.H\V
>3UR@
>@
>@
>(;&@
'UXPVHWQXPPHU3URJUDPQXPPHU
1RWHQXPPHU
=HOIGHDOVSHUFXVVLHNODQNYDQSTANDARD 16HW3&
*HHQNODQN
=HOIGHDOVSHUFXVVLHNODQNYDQ6&3UR
=HOIGHDOVSHUFXVVLHNODQNYDQ6&
=HOIGHDOVSHUFXVVLHNODQNYDQ6&
3HUFXVVLHNODQNYDQKHW]HOIGHQXPPHUNDQQLHWWHJHOLMNHUWLMGJHKRRUG
ZRUGHQ
7RQHQGLHPHWWZHHVWHPPHQ]LMQJHPDDNW
■ MIDI-commando’s gebruiken om drumsets te
selecteren van andere toestellen of sequence
software
8NDQRSGH]HOIGHPDQLHUDOVKHWVHOHFWHUHQYDQLQVWUXPHQWHQGUXPVHWVVHOHFWHUHQ
GRRUKHWYHU]HQGHQYDQ0,',FRPPDQGR·VYDQXLWHHQVHTXHQFHSURJUDPPD:DQ
QHHUHHQ3URJUDP&KDQJHFRPPDQGRRQWYDQJHQZRUGW]DOGHGUXPVHWYHUDQGHU
HQ9HUVWXXUHHQ3URJUDP&KDQJHFRPPDQGRRSKHWNDQDDOGDWGRRUGHGUXPSDUW
ZRUGWRQWYDQJHQ,QGHIDEULHNVLQVWHOOLQJHQLV3DUWGHGUXPSDUW0,',RQWYDQJ
VWNDQDDO,QGH6&NRPHQGHGUXPVHWQXPPHUVJHWRRQGRQGHUINST.
RYHUHHQPHWGH3URJUDPQXPPHUVS
=HWGHQRRWQXPPHUVYDQGHULWPHJHJHYHQVGLHZRUGHQDIJHVSHHOGJHOLMNPHWGH
QRRWQXPPHUVYDQGHGRRUXJHEUXLNWHGUXPVHWYDQGH6&S
ILJH
Naam en nummer van de Drum Set (Program-nummer)
44
STANDARD 1
ROOM
TR-808
User Set
User Set
001
009
026
065
066
Parts en klanken
+RHYHUDQGHUWPHQGHGUXPVHWYDQHHQSDUWPHWEHKXOSYDQ0,',FRPPDQGR·V
<Voorbeeld> De klank van Part 10 tinstellen op de SC-8850 map 013 ROOM L/R
0,',&+ &&
6HOHFWHHUWYDULDWLRQQXPPHU
&&
6HOHFWHHUWGH6&PDS
3&
6HOHFWHHUWLQVWUXPHQWQXPPHU
■ Dezelfde klanken selecteren als die van de SC-88Pro/SC88/SC-55
'H6&EHYDWYLHUPDSSHQHHQ6&PDSGLHGHRULJLQHOHNODQNHQEHYDWHHQ
6&3URPDSGLHGH]HOIGHNODQNHQEHYDWDOVGH6&3URHHQ6&PDSGLHGH
]HOIGHNODQNHQEHYDWDOVGH6&HQHHQ6&PDSGLHQDJHQRHJGH]HOIGHNODQNHQ
EHYDWDOVGH6&6&PN,,9HUDQGHUGHPDSDOVXGH]HOIGHNODQNHQZLOJH
EUXLNHQDOVGLHYDQGH6&3UR6&RI6&
1
2
3
=RUJHUYRRUGDWKHWPart Basic-schermJHVHOHFWHHUGLV
'UXNPART>
@RI>
@RPHHQSDUWWHVHOHFWHUHQ
3DUW%DVLFVFKHUPS
'UXN>,1670$3@RPGHPDSWHYHUDQGHUHQ
>
@ZRUGWJHWRRQGDDQGHOLQNHUNDQWYDQGHJHVHOHFWHHUGHLQVWUXPHQWHQPDS
ILJ
$OVXGHPDSYDQDOOHSDUWVRSGH6&3UR6&6&PDSZLOLQVWHOOHQPRHW
XWHJHOLMNHUWLMGPART>
@HQ>
@ALLLQGUXNNHQRPGHPARTGLVSOD\RSWH
]HWWHQALLWH]HWWHQ9RHUGDQVWDSXLW
$OV>
@QLHWLQKHWAll
Part-schermVWDDWZRUGHQ
GHPDSLQVWHOOLQJHQYDQ
HONHSDUWWRHJHSDVW
45
Parts en klanken
■ Klanken met legato
'H6&YRRU]LHWLQNODQNHQPHWOHJDWRGLHXLWHUVWJHVFKLNW]LMQRPOHJDWRWH
VSHOHQHQGLHRSHHQUHDOLVWLVFKHZLM]HGH]HLQVWUXPHQWDOHXLWYRHULQJVWHFKQLHNNXQ
QHQVLPXOHUHQ
2PGLWNHQPHUNWHEHJULMSHQPRHWPHQHYHQVWLOVWDDQELMGHPDQLHUZDDURSVQDDULQ
VWUXPHQWHQNODQNHQYRRUWEUHQJHQ*HZRRQOLMNKRRUWPHQDOOHHQHHQNRUWH
DDQJHVODJHQNODQNWHONHQVZDQQHHUGHVQDDUWRWWULOOHQZRUGWJHEUDFKW'DDUQDYROJW
HHQYHHO]DFKWHUHDDQVODJYULMHNODQNGLH]RODQJEOLMIWYRRUWGXUHQDOVGHVQDDUWULOW
'HNODQNHQPHWOHJDWRVLPXOHUHQGH]HYDULDEHOHDDQVODJHQYDQVQDDUNODQNHQGRRU
KHWZLVVHOHQGDDQHQXLW]HWWHQYDQEHSDDOGHVSHFLDOHVWHPPHQLQHHQLQVWUXPHQWDO
QDDUJHODQJGHPDQLHUZDDURSKHWNODYLHUEHVSHHOGZRUGW
,QVWUXPHQWHQPHWHHQ:DDQKHWHLQGHYDQKXQQDPHQ]RDOV9LROLQ]LMQGHNODQNHQ
PHWOHJDWR
3UREHHUHHQYDQGH]HNODQNHQRPWHEHOXLVWHUHQKRHKHWSULQFLSHZHUNW6SHHOHHQ
QRRWHQKRXGWXZYLQJHURSGHWRHWVWHUZLMOXHHQDQGHUHQRRWVSHHOW8PRHWQXHHQ
GXLGHOLMNHDDQVODJKRUHQELMGHHHUVWHQRRWGLHXVSHHOWWHUZLMOGHWZHHGHELMQDJHHQ
DDQVODJFRPSRQHQWHQEHYDWHQYHHO]DFKWHUNOLQNW
2SGLWPRPHQWZRUGWLJHWRRQGJHYROJGGRRU:HQGHLQVWUXPHQWQDDP
ILJ
$OVXGHDDQVODJHONHNHHUZLOKRUHQPRHWXJHZRRQXZYLQJHUYDQGHHHUVWHWRHWV
KDOHQYRRUDOHHUXGHYROJHQGHQRRWVSHHOW
2SGLWPRPHQWZRUGWLQLHWJHWRRQGJHYROJGGRRU:HQGHLQVWUXPHQWQDDP
ILJ
/HJDWRFRQWURONDQXQLHW
SHULQVWUXPHQWLQHQ
XLWVFKDNHOHQ.LHVHHQ
LQVWUXPHQWHQHGLWGHNODQN
QDDUXZHLJHQYRRUNHXU
Een MIDI -kanaal aan een part
toewijzen
$DQHONYDQGHSDUWVYDQGH6&LVHHQLQVWUXPHQWHQHHQkanaalWRHJHZH]HQ
0,',NDQDOHQ]LMQRQWZRUSHQRPQRWHQWHRQGHUVFKHLGHQGLHGRRUYHUVFKLOOHQGHLQ
VWUXPHQWHQLQHHQHQVHPEOHPRHWHQZRUGHQJHVSHHOG*HZRRQOLMNLVKHWQLHWQRGLJ
RPKHWNDQDDOYDQHHQSDUWWHYHUDQGHUHQZDQQHHUPHQGH6&JHEUXLNW+HW
NDQQRFKWDQVLQWHUHVVDQW]LMQRPWZHHSDUWVRSKHW]HOIGHNDQDDOLQWHVWHOOHQ]RGDW
WZHHNODQNHQWHJHOLMNHUWLMGGH]HOIGHPX]LHNOLMQVSHOHQ*HEUXLNGHYROJHQGHSURFH
GXUHRPKHW0,',NDQDDOYDQHHQSDUWWHYHUDQGHUHQ
ILJH
MIDI IN
46
MIDI-kanaal 1
MIDI-kanaal 2
Klank 1
Klank 2
MIDI-kanaal 15
Klank 15
MIDI-kanaal 16
Klank 16
Parts en klanken
*HEUXLNGHYROJHQGHSURFHGXUHRPKHW0,',NDQDDOYDQHHQSDUWWHYHUDQGHUHQ
1
2
=RUJHUYRRUGDWKHWPart Basic-scherm JHVHOHFWHHUGLV
'UXNPART>
@RI>
3DUW%DVLFVFKHUPS
@RPGH3DUWWHVHOHFWHUHQZDDUYDQXKHW0,',
NDQDDOZLOYHUDQGHUHQ
+HWVFKHUPGDWGHSDUWQXPHUDDQJHHIWYHUDQGHUWWXVVHQ$²$%²%&
²&DQG'²'
3
'UXN>(',7@
4
'UXN>(',7@>)@
5
'UXNVAR.>
@RIINST>
@RPGHFXUVRUQDDURx MIDI CHWHYHUSODDWVHQ
ILJ
6
'UDDLDDQGH>9$/8(@NQRSRIGUXNRS>'(&@RI>,1&@RPHHQ0,',
NDQDDOWHVHOHFWHUHQGDWXZLOWRHZLM]HQDDQGHSDUWGLHXLQVWDSKHEW
JHVHOHFWHHUG
'HGLVSOD\GLHKHW0,',NDQDDOQXPPHUWRRQWYHUDQGHUWELQQHQHHQEHUHLNYDQA01
– A16A - -B01 – B16B - -C01 – C16C - -D01 – D16HQD - -6HOHFWHHUKHW
JHZHQVWH0,',NDQDDOQXPPHU3DUWVZDDUYRRUA - -B - -C - -RID - -LVJHVHOHFW
HHUG]XOOHQDOOH0,',FRPPDQGR·VPHWXLW]RQGHULQJYDQGHV\VWHPH[FOXVLYHFRP
PDQGR·VQHJHUHQHQ]XOOHQGXVQLHWZHHUNOLQNHQ
ILJH
MIDI-kanaal
2PKHW0,',NDQDDOYDQ
HHQSDUWWHZLM]LJHQYLD
0,',JHEUXLNWXGH
´5[&+$11(/µV\VWHP
H[FOXVLYHPHVVDJHS
47
Parts en klanken
Relatie tussen het aantal simultane
noten en stemmen
'HNODQNHQYDQGH6&EHVWDDQXLWHHQKHGHQGLHVoices>VWHPPHQ@JHQRHPG
ZRUGHQ+HWDDQWDO9RLFHVGDWWHJHOLMNHUWLMGNDQNOLQNHQLVEHSHUNWHQLQKHWJHYDO
YDQGH6&NXQQHQVLPXOWDQHVWHPPHQZRUGHQJHEUXLNW6RPPLJHNODQ
NHQLQVWUXPHQWHQJHEUXLNHQVWHPHQDQGHUHJHEUXLNHQPHHUVWHPPHQLQVWUX
PHQWHQOLMVWS'HEHODQJULMNVWHUHGHQRPPHHUGDQWZHHVWHPPHQWHJHEUXLNHQ
LVRPYHUVFKLOOHQGHWLPEUHVWHSURGXFHUHQGLHGRRUYHUVFKLOOHQGHVQHOKHLGVZDDUGHQ
NXQQHQZRUGHQYRRUWJHEUDFKWRIRPULMNHUHNODQNVWUXFWXUHQYRRUWWHEUHQJHQGRRU
GHPHHUYRXGLJHNODQNHQLQODJHQWHOHJJHQ
,QGLHQHUPHHUGDQVWHPPHQWHJHOLMNHUWLMGZRUGHQJHEUXLNWZRUGWHUYRRUUDQJ
JHJHYHQDDQQRWHQGLHODWHUNOLQNHQHQZRUGHQGHQRWHQGLHHHUGHUNORQNHQXLWJH]HW
EHJLQQHQGHPHWGHHHUVWHQRRW,QGLHQXXLWVOXLWHQGHHQVWHPPLJHLQVWUXPHQWHQJH
EUXLNWNDQXQRWHQWHJHOLMNHUWLMGVSHOHQPDDUZDQQHHUVRPPLJHLQVWUXPHQWHQ
PHHUGDQWZHHVWHPPLJ]LMQ]DOXJHHQQRWHQWHJHOLMNHUWLMGNXQQHQVSHOHQ=HOIV
LQGLHQHHQ0,',1RWH2IIFRPPDQGRSRQWYDQJHQZRUGW]XOOHQGHVWHPPHQ
JHEUXLNWZRUGHQ]RODQJGHNODQNZRUGWJHKRRUG+LHUPRHWXYRRUDORSOHWWHQLQ
KHWJHYDOYDQHHQNODQNPHWHHQODQJHUHOHDVHS
48
$OVXVRQJGDWDGLHDDQJH
PDDNW]LMQYRRUHHQ
VWHPPLJHZHHUJDYH
DIJHVSHHOGZRUGHQRSHHQ
NODQNJHQHUDWRUPHWPLQGHU
VWHPPHQ]XOOHQVRPPLJH
QRWHZHJYDOOHQHQ]DOKHW
PX]LNDOHUHVXOWDDWQLHW]LMQ
]RDOVKHWKRRUW'H6&
KHHIWVWHPPHQGH
6&3URHQGH6&
KHEEHQVWHPPHQGH
6&KHHIWVWHPPHQHQ
GH6&PN,,KHHIW
VWHPPHQ
Parts en parameters
Parameters instellen die alle parts
beïnvloeden (Edit All-scherm)
3DUDPHWHUVGLHDOOHSDUWVEHwQYORHGHQZRUGHQLQJHVWHOGLQKHWEdit All-scherm'H
SURFHGXUHLVDOVYROJW
■ Procedure
1
'UXNWHJHOLMNHUWLMGPART>
@HQ>
@ALLLQRPKHWAll Part-schermWH
VHOHFWHUHQHQGUXNGDDUQD>(',7@RPKHWEdit All-schermWHVHOHFWHUHQ.
+HWEdit All-scherm
YHUVFKLMQWZDQQHHUXRS
>(',7@GUXNWLQKHWAll
Part-scherm8NDQKHW
RRNRSURHSHQGRRULQKHW
(GLWVFKHUPWHJHOLMNHUWLMG
RSPART>
@HQ>
@
ALLWHGUXNNHQ
8NDQRRN>(',7@LQGUXNNHQLQKHWPart Basic-schermHQGDDUQDWHJHOLMNHUWLMG
PART>
@HQ>
@ALLLQGUXNNHQ
9RRUGHWDLOVRYHUGH
SDUDPHWHUVGLHXKLHUNDQ
LQVWHOOHQ]LHParameters
S
ILJ
2
3
4
5
3DUW%DVLFVFKHUPS
'UXN>(',7@>)@
'UXNVAR.>
@RIINST>
@RPGHFXUVRURPKRRJRIRPODDJWHEHZHJHQ
HQVHOHFWHHUGHSDUDPHWHUGLHXZHQVWWHZLM]LJHQ
'UDDLDDQGH>9$/8(@NQRSRIGUXN>'(&@RI>,1&@RPGHZDDUGHYDQGH
SDUDPHWHULQWHVWHOOHQ
'UXN>(;,7@ZDQQHHUXNODDUEHQWPHWKHWPDNHQYDQLQVWHOOLQJHQRPGH
SURFHGXUHWHEHsLQGLJHQ
1DGDWXGHZDDUGHLQVWDS
KHEWLQJHVWHOGNDQX
WHJHOLMNHUWLMGRS>'(&@HQ
>,1&@GUXNNHQRPGH
PRPHQWHHOJHWRRQGH
SDUDPHWHUZDDUGHWH
YHU]HQGHQS
9RRUGHWDLOVRYHUGH
WRHWVHQ>:5,7(@)HQ
>/2$'@)]LH SC-8850instellingen in de User
Area wegschrijven
S
49
Parts en parameters
■ Parameters
3DUDPHWHUVYRRUDOOHSDUWV
0DVWHU/HYHO
0DVWHU/HYHO
0DVWHU3DQ
0DVWHU3DQ
0.H\6KLIW
0DVWHU.H\6KLIW
07XQH
0DVWHU7XQH
'HYLFH,'
'HYLFH,'1XPEHU
■ De functie van elke parameter
'HKLHURQGHUJHPDDNWHLQVWHOOLQJHQYRRUGHYROJHQGHSDUDPHWHUV]LMQYDQWRHSDV
VLQJRSDOOHSDUWV
■0DVWHU/HYHO
²127
3DVWKHWYROXPHDDQYDQDOOHSDUWV$OVPHQGHZDDUGHYHUKRRJWJDDWKHWYROXPH
RPKRRJ
+HWEDVLVYROXPHYDQGHJHKHOH6&ZRUGWJHUHJHOGGRRUGH>92/80(@NQRS
$OVGH>92/80(@NQRSRSPLQLPXPVWDDW]DOHUJHHQNODQN]LMQ]HOIVQLHWZDQQHHU
GH]H/(9(/LQVWHOOLQJZRUGWYHUKRRJG
■0DVWHU3DQ
/²0²5
0DVWHU3DQVWHOWGHVWHUHRSRVLWLHYDQGHNODQNLQYRRUDOOHSDUWV$OVXGH6&
LQPRQREHOXLVWHUWKHEEHQGHSDQLQVWHOOLQJHQJHHQHIIHFW:DQQHHUGH/ZDDUGH
YHUKRRJWZRUGWGHNODQNPHHUQDDUOLQNVJHSODDWVWHQZDQQHHUGH5ZDDUGHYHU
KRRJWZRUGWGHNODQNPHHUQDDUUHFKWVJHSODDWVW2PGHNODQNLQKHWPLGGHQWH
SODDWVHQPRHWXGHSDQZDDUGHRS]HWWHQ
■0.H\6KLIW0DVWHU.H\6KLIW
²±0²RFWDYHQ
.H\6KLIWSDVWGHWRRQKRRJWHYDQGHNODQNDDQLQVWDSSHQYDQHHQKDOYHWRRQ%LM
YRRUEHHOGDOVXVRQJJHJHYHQVYDQHHQVHTXHQFHSURJUDPPDDIVSHHOWNDQXGH.H\
6KLIWSDUDPHWHUJHEUXLNHQRPGHWRRQDDUGYDQGHVRQJWHYHUDQGHUHQ]RQGHUGHLQ
VWHOOLQJHQYDQKHWVHTXHQFHSURJUDPPDWHYHUDQGHUHQ2IDOVXPHH]LQJWPHWVH
TXHQFHJHJHYHQVNDQX.H\6KLIWDDQSDVVHQRPGHVRQJLQGHWRRQDDUGWH]HWWHQGLH
KHWPHHVWELMXZVWHPSDVW$OVGHJHWRRQGHZDDUGHHHQVWDSRPKRRJRPODDJJDDW
]DOGHWRRQKRRJWHPHWHHQKDOYHWRRQRPKRRJRPODDJJDDQ'LWEHWHNHQWGDW
VWDSSHQJHOLMN]LMQDDQHHQRFWDDI0HWHHQLQVWHOOLQJYDQEOLMIWGHWRRQKRRJWHRQ
YHUDQGHUG
■07XQH0DVWHU7XQH
²440.0²+]
:DQQHHUXLQHHQHQVHPEOHVSHHOWPHWDQGHUHLQVWUXPHQWHQRIGH6&PRHWDI
VWHOOHQRSGHWRRQKRRJWHYDQHHQDQGHULQVWUXPHQWPRHWXGHLQVWHOOLQJYDQGH0DV
WHU7XQHDDQSDVVHQELQQHQHHQEHUHLNYDQ²+]'HJHWRRQGHZDDUGH
HJ+]JHHIWGHIUHTXHQWLHZHHUYDQGHWRRQKRRJWHYDQQRRW$QRRWQXP
PHU
■'HYLFH,''HYLFH,'QXPPHU
²17²
+HW'HYLFH,'QXPPHU>WRHVWHO,'QXPPHU@LVHHQLGHQWLILFDWLHQXPPHUGDWJH
EUXLNWZRUGWYRRUKHWYHU]HQGHQHQRQWYDQJHQYDQ([FOXVLYHFRPPDQGR·V'H6&
RQWYDQJWXLWVOXLWHQG([FOXVLYHFRPPDQGR·VDOV]LMQHLJHQWRHVWHO,'QXPPHU
RYHUHHQNRPWPHWKHWWRHVWHO,'QXPPHUYDQKHWFRPPDQGR'LWEHWHNHQWGDWZDQ
QHHUPHQ([FOXVLYHFRPPDQGR·VWXVVHQWRHVWHOOHQZLOYHU]HQGHQPHQHUYRRUPRHW
]RUJHQGDWKXQWRHVWHO,'QXPPHUVRYHUHHQVWHPPHQ
+HWWRHVWHO,'QXPPHULVHHQQXPPHUYDQ,QGHIDEULHNVLQVWHOOLQJHQLVKHW
QXPPHU
50
%LMVRPPLJHLQVWUXPHQWHQ
NDQXQRJHHQEHHWMHJHOXLG
KRUHQXLWGHDQGHUHOXLG
VSUHNHU]HOIVDOVGH3DQ
KHOHPDDOOLQNVRIUHFKWV
VWDDW
=HOIVDOVXGH.H\6KLIW
YRRUDOOH3DUWVDDQSDVW]DO
GHWRRQKRRJWHYDQGH
'UXP3DUWQLHWYHUDQGHUHQ
*HEUXLN.H\6KLIWRPGH
WRRQKRRJWHYDQppQHQNHOH
SDUWDDQWHSDVVHQS
$OVX5RODQG60)PXVLF
ILOHVZLODIVSHOHQ]RUJGDQ
GDWKHWGHYLFH,'QXPPHU
RSVWDDW$QGHUV]DOGH
ZHHUJDYHQLHWFRUUHFW]LMQ
+HWLVQLHWPRJHOLMNRP
YRRULQGLYLGXHOHSDUWVHHQ
DSDUWGHYLFH,'QXPPHULQ
WHVWHOOHQ
Parts en parameters
De functies van parameters die individueel
voor elke part zijn ingesteld (Edit-scherm)
3DUDPHWHUVYRRULQGLYLGXHOHSDUWVZRUGHQLQJHVWHOGLQKHWEdit-scherm+HW(GLW
VFKHUPEHYDWQHJHQSDUDPHWHUJURHSHQEFFECTEDITMODIFYS.TUNEMOD
BENDCAFCC1HQU.INST*HEUXLNGHYROJHQGHSURFHGXUHRPGHLQVWHOOLQJHQWH
PDNHQ
■ Procedure
1
2PSDUDPHWHUVLQWHVWHOOHQYRRUHHQLQGLYLGXHOHSDUWPRHWXHUYRRU]RU
JHQGDWKHWPart Basic-schermJHVHOHFWHHUGLVHQGDDUQDPART>
@RI>
@
LQGUXNNHQRPGHSDUWWHVHOHFWHUHQ
2
+HWEdit-schermYHUVFKLMQW
ZDQQHHUXLQKHW3DUW
%DVLFVFKHUPRS>(',7@
GUXNW
'UXN>(',7@
+HWHGLWVFKHUPYHUVFKLMQW
3DUW%DVLFVFKHUPS
ILJ
3
'HWDLOVRYHUGHU.INST
SDUDPHWHUVYLQGWXLQEen
klank creëren en bewaren
(User-instrument)S
'UXN>)@²>)@RPGHYROJHQGHSDUDPHWHUJURHSHQWHVHOHFWHUHQ
>)@
())(&7
6781(
&$)
>)@
(',7
02'
&&
>)@
02',)<
%(1'
8,167
>)@
→
→
→
1DGDWXLQVWDSRS>(',7@
KHEWJHGUXNWNDQXRRNGH
SDUWVWDWXVZLM]LJHQGRRU
WHJHOLMNHUWLMGRSGHWRHWVHQ
PART>
@HQ>
@
ALLWHGUXNNHQ
'UXNRS>→@>)@RPQDDU
KHWYROJHQGHLWHPRSKHW
VFKHUPWHJDDQ
9RRUPHHUGHWDLOVRYHUHONHSDUDPHWHU]LHWat elke parameter doetS
4
5
6
'UXNVAR.>
@RIINST>
@RPGHFXUVRURPKRRJRIRPODDJWHEHZHJHQ
HQVHOHFWHHUGHSDUDPHWHUGLHXZLOZLM]LJHQ
'UDDLDDQGH>9$/8(@NQRSRIGUXN>'(&@RI>,1&@RPGHZDDUGHYDQGH
SDUDPHWHULQWHVWHOOHQ
:DQQHHUXNODDUEHQWPHWLQVWHOOLQJHQPDNHQGUXNWX>(;,7@RPGHSURFH
GXUHWHEHsLQGLJHQ
1DGDWXGHZDDUGHLQVWDS
KHEWLQJHVWHOGNDQX
WHJHOLMNHUWLMGRS>'(&@HQ
>,1&@GUXNNHQRPGH
PRPHQWHHOJHWRRQGH
SDUDPHWHUZDDUGHWH
YHU]HQGHQS
51
Parts en parameters
■ Parameters
3DUDPHWHUVYRRUHONHSDUW
■EFFECT
5HYHUE6HQG
&KRUXV6HQG
'HOD\6HQG
3DUW(4
();
5HYHUE6HQG/HYHO
&KRUXV6HQG/HYHO
'HOD\6HQG/HYHO
3DUW(TXDOL]HU
,QVHUWLRQ(IIHFWV
■EDIT
3DUW/HYHO
3DUW3DQ
0,',&+
3DUW0RGH
030RGH
.H\6KLIW
)LQH7XQH
%HQG5DQJH
0RG'HSWK
9HOR'HSWK
9HOR2IIVHW
.H\5DQJH/
.H\5DQJH+
&&&1XPEHU
2XW$VJQ
3DUW/HYHO
3DUW3DQ
0,',FKDQQHO
3DUW0RGH
0RQR3RO\0RGH
.H\6KLIW
)LQH7XQH
%HQG5DQJH
0RGXODWLRQ'HSWK
9HORFLW\6HQVLWLYLW\'HSWK
9HORFLW\6HQVLWLYLW\2IIVHW
.H\ERDUG5DQJH/RZ
.H\ERDUG5DQJH+LJK
&&&RQWUROOHU1XPEHU
2XWSXW$VVLJQ
■MODIFY
9LE5DWH
9LE'HSWK
9LE'HOD\
&XWRII)UHT
5HVRQDQFH
$WWDFN7LPH
'HFD\7LPH
5HOHDVH7LPH
9LEUDWR5DWH
9LEUDWR'HSWK
9LEUDWR'HOD\
&XWRII)UHTXHQF\
5HVRQDQFH
$WWDFN7LPH
'HFD\7LPH
5HOHDVH7LPH
9RRUGHWDLOVRYHUGHSDUDPHWHUVYDQGHMODIFYJURHS]LH+RRIGVWXNEen klank of een drum-
set creërenSDUDJUDDIParameters voor klankbewerking S
■S.TUNE
6FDOH7XQH&
6FDOH7XQH&
6FDOH7XQH'
6FDOH7XQH'
6FDOH7XQH(
6FDOH7XQH)
6FDOH7XQH)
6FDOH7XQH*
6FDOH7XQH*
6FDOH7XQH$
6FDOH7XQH$
6FDOH7XQH%
52
6FDOH7XQLQJ&
6FDOH7XQLQJ&
6FDOH7XQLQJ'
6FDOH7XQLQJ'
6FDOH7XQLQJ(
6FDOH7XQLQJ)
6FDOH7XQLQJ)
6FDOH7XQLQJ*
6FDOH7XQLQJ*
6FDOH7XQLQJ$
6FDOH7XQLQJ$
6FDOH7XQLQJ%
Parts en parameters
■ MOD
0RG5DQJH
0RG&XWRII
0RG$PS
0RG/)25DWH
0RG/)23LWFK
0RG/)279)
0RG/)279$
0RGXODWLRQ5DQJH
0RGXODWLRQ&XWRII)UHTXHQF\
0RGXODWLRQ$PSOLWXGH
0RGXODWLRQ/)25DWH
0RGXODWLRQ/)23LWFK
0RGXODWLRQ/)279)
0RGXODWLRQ/)279$
■ BEND
%QG5DQJH
%QG&XWRII
%QG$PS
%QG/)25DWH
%QG/)23LWFK
%QG/)279)
%QG/)279$
%HQG5DQJH
%HQG&XWRII)UHTXHQF\
%HQG$PSOLWXGH
%HQG/)25DWH
%HQG/)23LWFK
%HQG/)279)
%HQG/)279$
■CAF
&$I5DQJH
&$I&XWRII
&$I$PS
&$I/)25DWH
&$I/)23LWFK
&$I/)279)
&$I/)279$
&KDQQHO$IWHUWRXFK5DQJH
&KDQQHO$IWHUWRXFK&XWRII)UHTXHQF\
&KDQQHO$IWHUWRXFK$PSOLWXGH
&KDQQHO$IWHUWRXFK/)25DWH
&KDQQHO$IWHUWRXFK/)23LWFK
&KDQQHO$IWHUWRXFK/)279)
&KDQQHO$IWHUWRXFK/)279$
■CC1
&&5DQJH
&&&XWRII
&&$PS
&&/)25DWH
&&/)23LWFK
&&/)279)
&&/)279$
&&5DQJH
&&&XWRII)UHTXHQF\
&&$PSOLWXGH
&&/)25DWH
&&/)23LWFK
&&/)279)
&&/)279$
■U.INST
9LE5DWH
9LE'HSWK
9LE'HOD\
&XWRII)UHT
5HVRQDQFH
$WWDFN7LPH
'HFD\7LPH
5HOHDVH7LPH
9LEUDWR5DWH
9LEUDWR'HSWK
9LEUDWR'HOD\
&XWRII)UHTXHQF\
5HVRQDQFH
$WWDFN7LPH
'HFD\7LPH
5HOHDVH7LPH
9RRUGHWDLOVRYHUGHSDUDPHWHUVYDQGHU.INSTJURHS]LH+RRIGVWXNEen klank of een drumset
creëren SDUDJUDDIParameters voor klankbewerking SHQEen klank creëren en
bewaren (User-instrument)S
53
Parts en parameters
■ De functie van elke parameter
'HYROJHQGHSDUDPHWHUVEHSDOHQKRHHONHSDUWUHDJHHUWRSKHWRQWYDQJHQYDQ0,',
FRPPDQGR·V
■EFFECT
❏Reverb Send (Reverb Send Level)
²40²
6WHOWKHW5HYHUE6HQGQLYHDXYDQHONLQVWUXPHQWLQ
❏Chorus Send (Chorus Send Level)
0²
6WHOWKHW&KRUXV6HQGQLYHDXYDQHONLQVWUXPHQWLQ
❏Delay Send (Delay Send Level)
6WHOWKHWGHOD\6HQGQLYHDXYDQHONLQVWUXPHQWLQ
0²
❏Part EQ (Part Equalizer)
2IIOn
(TXDOL]HUDDQXLWNDQYRRULQGLYLGXHOHSDUWVZRUGHQLQJHVWHOG$OVGHSDUWHTXDOL]
HUDDQVWDDWZRUGWGHHTXDOL]HUWRHJHSDVWRSGHNODQNHQYDQGHSDUWV$OVGHSDUW
HTXDOL]HUXLWVWDDWZRUGWGHHTXDOL]HUQLHWWRHJHSDVWRSGHNODQNHQYDQGHSDUWV,Q
GHIDEULHNVLQVWHOOLQJHQLVGHHTXDOL]HUJDLQRSLQJHVWHOG'LWEHWHNHQWGDWGHHTXDO
L]HUJHHQHIIHFWKHHIW]HOIVQLHWZDQQHHUGH3DUW(4DDQVWDDW
❏EFX (Insertion Effects)
=HWGH,QVHUWLRQHIIHFWHQ$$18,7
'H3DUW(4DDQXLW]HWWHQ
YLD0,',ERRGVFKDSSHQ
]LHS
Off2Q
■EDIT
❏Part Level
²100²
3DVWKHWYROXPHYDQHHQLQGLYLGXHOHSDUWDDQ$OVPHQGHZDDUGHYHUKRRJW]DOKHW
YROXPHRPKRRJJDDQ
+HWEDVLVYROXPHYDQGHJHKHOH6&ZRUGWJHUHJHOGGRRUGH>92/80(@NQRS
$OVGH>92/80(@NQRSRSPLQLPXPVWDDW]DOHUJHHQNODQN]LMQ]HOIVQLHWZDQQHHU
GH]H/(9(/LQVWHOOLQJZRUGWYHUKRRJG
❏Part Pan
5QG/²0²5
3DQVWHOWGHVWHUHRSRVLWLHYDQGHNODQNLQZDQQHHUPHQHHQVWHUHRV\VWHHPJHEUXLNW
'HGUXPVHWHQGHEDVZRUGHQELMYRRUEHHOGLQKHWPLGGHQJHSODDWVWGHJLWDDUDDQGH
UHFKWHUNDQWHQKHWNODYLHUUHFKWV$OVXGH6&LQPRQREHOXLVWHUWKHEEHQGH
SDQLQVWHOOLQJHQJHHQHIIHFW:DQQHHUGH/ZDDUGHYHUKRRJWZRUGWGHNODQNPHHU
QDDUOLQNVJHSODDWVWHQZDQQHHUGH5ZDDUGHYHUKRRJWZRUGWGHNODQNPHHUQDDU
UHFKWVJHSODDWVW2PGHNODQNLQKHWPLGGHQWHSODDWVHQPRHWXGHSDQZDDUGHRS
]HWWHQ$OVX3$1>
@EOLMIWLQGUXNNHQELMKHWLQVWHOOHQYDQHONHSDUWZRUGWRnd
UDQGRPJHVHOHFWHHUGHQ]DOHONHQRRWLQHHQZLOOHNHXULJHVWHUHRSRVLWLHZRUGHQJH
SODDWVW
❏Rx MIDI CH (MIDI channel)
6SHFLILHHUWKHW0,',NDQDDOGDWDDQHONHSDUW]DOZRUGHQWRHJHZH]HQ'HNDQDDOVH
OHFWLHYHUDQGHUWELQQHQHHQEHUHLNYDQA01²A16A - -B01²B16B - -C01²C16
C - -D01²D16DQGD - -HQD - -6HOHFWHHUKHWJHZHQVWH0,',NDQDDOQXPPHU3DUWV
ZDDUYRRUA - -B - -C - -RID - -LVJHVHOHFWHHUG]XOOHQDOOH0,',FRPPDQGR·VPHW
XLW]RQGHULQJYDQGHV\VWHPH[FOXVLYHFRPPDQGR·VQHJHUHQHQ]XOOHQGXVQLHW
NOLQNHQ
54
(TXDOL]HULQVWHOOLQJHQ
PDNHQ]LHS
'HWDLOVRYHULQYRHJHIIHFWHQ
YLQGWXLQInvoegeffecten
(EFX)SRILQInvoegeffecten gebruikenS
%LMGH'UXP6HWVOLJWGH
SDQSRVLWLHYDVWYRRUHON
SHUFXVVLHLQVWUXPHQW$OVX
GHSDQYDQHHQ'UXP6HW
ZLM]LJWYHUVFKXLIWGH
JOREDOHVHWQDDUOLQNVRI
UHFKWV
%LMVRPPLJHLQVWUXPHQWHQ
NDQXQRJHHQEHHWMHJHOXLG
KRUHQXLWGHDQGHUHOXLG
VSUHNHU]HOIVDOVGH3DQ
KHOHPDDOOLQNVRIUHFKWV
VWDDW
Parts en parameters
❏Part Mode
1RUPDO'UXP'UXP
9RRUSDUWVGLHFRQYHQWLRQHOHLQVWUXPHQWDOHNODQNHQVSHOHQPRHWX1RUPDO1RUPDO
PRGXVVHOHFWHUHQ9RRUSDUWVGLHSHUFXVVLHRIGUXPVVSHOHQPRHWX'UXPRI
'UXPVHOHFWHUHQ'UXPSDUWVKHEEHQYRRUHONYHUVFKLOOHQG0,',QRRWQXPPHUHHQ
DQGHUHNODQNLQVWUXPHQWS$QGHUVJH]HJGNDQHHQHQNHOHSDUWHHQJURRW
DDQWDOYHUVFKLOOHQGHNODQNHQYDQSHUFXVVLHLQVWUXPHQWHQVSHOHQDrumsetlijst
S
(ONHSDUW²NDQRIZHOYRRUQRUPDOHNODQNHQQRUPDOSDUWRIYRRUHHQGUXPVHW
JHEUXLNWZRUGHQ
'HPRGXVYDQHHQGUXPSDUWNDQRIZHO'UXPRI'UXP]LMQ$DQJH]LHQGH]HOIGH
GUXPVHWDXWRPDWLVFKZRUGWJHVHOHFWHHUGYRRUSDUWVPHWGH]HOIGHSDUWPRGXV
EHWHNHQWGLWGDWPHQWRWGUXPVHWVWHJHOLMNHUWLMGNDQJHEUXLNHQ
$OVXGHSDUWPRGXVYDQ3DUWHQ3DUWELMYRRUEHHOGUHVSHFWLHYHOLMNLQVWHOWRS
'UXPHQ'UXPNDQX67$1'$5'VHOHFWHUHQYRRU3DUWHQ-$==YRRU3DUW
$OVGHSDUWPRGXVYDQ]RZHO3DUWDOVYDQ3DUWRS'UXPZHUGHQLQJHVWHOG
GDQ]RXELMKHWVHOHFWHUHQYDQ67$1'$5'YRRU3DUWHYHQHHQV67$1'$5'
YRRU3DUWZRUGHQJHVHOHFWHHUG
❏M/P Mode (Mono/Poly Mode)
0RQRPoly
$OVHHQSDUWRS0RQR0RQRPRGXVLVLQJHVWHOG]DOGH]HSDUWVOHFKWVHHQQRRW
WHJHOLMNHUWLMGVSHOHQ+HWLVYHUVWDQGLJRP0RQRPRGXVWHVHOHFWHUHQYRRUSDUWVGLH
HHQQDWXXUOLMNPRQRIRQLVFKLQVWUXPHQWVSHOHQ]RDOVHHQWURPSHWRIHHQVD[6HOHFW
HHU3RO\3RO\PRGXVYRRUSDUWLMHQGLHDNNRRUGHQVSHOHQ
❏Key Shift
²±0²
.H\6KLIWSDVWGHWRRQKRRJWHYDQGHNODQNDDQLQVWDSSHQYDQHHQKDOYHWRRQ%LM
YRRUEHHOGDOVXVRQJJHJHYHQVYDQHHQVHTXHQFHSURJUDPPDDIVSHHOWNDQXGH.H\
6KLIWSDUDPHWHUJHEUXLNHQRPGHWRRQDDUGYDQGHVRQJWHYHUDQGHUHQ]RQGHUGHLQ
VWHOOLQJHQYDQKHWVHTXHQFHSURJUDPPDWHYHUDQGHUHQ2IDOVXPHH]LQJWPHWVH
TXHQFHJHJHYHQVNDQX.H\6KLIWDDQSDVVHQRPGHVRQJLQGHWRRQDDUGWH]HWWHQGLH
KHWPHHVWELMXZVWHPSDVW$OVGHJHWRRQGHZDDUGHHHQVWDSRPKRRJRPODDJJDDW
]DOGHWRRQKRRJWHPHWHHQKDOYHWRRQRPKRRJRPODDJJDDQ'LWEHWHNHQWGDW
VWDSSHQJHOLMN]LMQDDQHHQRFWDDI0HWHHQLQVWHOOLQJYDQEOLMIWGHWRRQKRRJWHRQ
YHUDQGHUG
❏Fine Tune
²0.0²FHQWV
*HEUXLNGH]HSDUDPHWHUDOVXGHWXQLQJYDQHHQSDUWQDXZNHXULJZLODDQSDVVHQ
3RVLWLHYHLQVWHOOLQJHQYHUKRJHQGHWRRQKRRJWHQHJDWLHYHLQVWHOOLQJHQYHU
ODJHQGHWRRQKRRJWH,QGLHQWZHHRIPHHUSDUWVRSKHW]HOIGH0,',NDQDDOHQGH
]HOIGHNODQN]LMQLQJHVWHOGIHQPHQ]HWKXQ)LQH7XQLQJLQVWHOOLQJHQXLWHONDDUNDQ
PHQHHQULMNHGLHSWHHQZLQGDDQGHNODQNWRHYRHJHQ
❏Bend Range
“²+2²
'H]HSDUDPHWHUEHSDDOWGHPDQLHUZDDURSGHNODQNYHUDQGHUWZDQQHHUGH3LWFK
%HQGFRPPDQGR·VRQWYDQJHQZRUGHQ,QGHIDEULHNVLQVWHOOLQJHQYHUDQGHUWGH]H
SDUDPHWHUGHWRRQKRRJWH0HWHHQLQVWHOOLQJYDQNDQPHQRFWDDIYHUDQGHUHQHQ
PHWHHQLQVWHOOLQJYDQNDQPHQRFWDYHQYHUDQGHUHQ0HWHHQLQVWHOOLQJYDQ
YHUDQGHUWGHWRRQKRRJWHQLHW
%HQG5DQJHLVGH]HOIGHSDUDPHWHUDOV%QG5DQJHZDDUYRRUPHQ>%(1'@>)@PRHWGUXNNHQS'H
ODDWVWLQJHVWHOGHSDUDPHWHU]DODOWLMGYDQNUDFKWEOLMYHQZHONHSDUDPHWHUXRRNLQVWHOW
'H3DUW0RGHZLM]LJHQYLD
0,',ERRGVFKDSSHQ]LH
S
$OVXELMHHQ'UXP3DUWGH
0RQR3RO\0RGH
LQVWHOOLQJZLM]LJWKHHIWGLW
JHHQHIIHFWRSKHWJHOXLG
=HOIVDOVXGH.H\6KLIW
YRRUDOOH3DUWVDDQSDVW]DO
GHWRRQKRRJWHYDQGH
'UXP3DUWQLHWYHUDQGHUHQ
*HEUXLN0.H\6KLIWRP
GHWRRQKRRJWHYDQDOOH
SDUWVWHYHUVFKXLYHQS
2PGHWRRQKRRJWHYDQDOOH
SDUWVWHUHJHOHQJHEUXLNWX
GH0DVWHU7XQHSDUDPHWHU
S
%LMVRPPLJHNODQNHQJDDW
GHWRRQKRRJWHPLVVFKLHQ
QLHW]RKRRJDOVEHSDDOG
GRRUGH5DQJHLQVWHOOLQJ
❏Mod Depth (Modulation Depth)
²10²
'H]HSDUDPHWHUSDVWYLEUDWRWRHRSGHNODQNZDQQHHU0RGXODWLRQFRPPDQGR·VRQW
YDQJHQZRUGHQ'RRUKRJHUHZDDUGHQNDQKHWPRGXODWLHHIIHFWYHUJURRWZRUGHQ
0RG'HSWKLVGH]HOIGHSDUDPHWHUDOV0RG/)23LWFKZDDUYRRUPHQ>02'@>)@PRHWGUXNNHQS
'HODDWVWLQJHVWHOGHSDUDPHWHU]DODOWLMGYDQNUDFKWEOLMYHQZHONHSDUDPHWHUXRRNLQVWHOW
55
Parts en parameters
❏Velo Depth (Velocity Sensitivity Depth)
²64²
❏Velo Offset (Velocity Sensitivity Offset)
²64²
'HNUDFKWZDDUPHHXHHQQRRWRSHHQ0,',NODYLHUVSHHOWZRUGWYHU]RQGHQDOVHHQ
0,',9HORFLW\JHJHYHQ.UDFKWLJJHVSHHOGHQRWHQKHEEHQHHQKRJHUHVQHO
KHLGVZDDUGH'H9HOR'HSWKHQ9HOR2IIVHWSDUDPHWHUVEHSDOHQGHYHUKRXGLQJWXV
VHQGHNUDFKWZDDUPHHKHWNODYLHUZRUGWEHVSHHOGHQGHJHOXLGVVWHUNWHYDQGH
GDDUXLWYROJHQGHNODQN
$OV9HOR'HSWKYHUKRRJW]XOOHQNOHLQHYHUVFKLOOHQLQGHG\QDPLHNYDQXZVSHOHHQ
JURRWYHUVFKLOPDNHQLQGHJHOXLGVVWHUNWHYDQGHNODQN)LJ$OV9HOR'HSWKYHU
ODDJW]XOOHQ]HOIVJURWHYHUVFKLOOHQLQGHG\QDPLHNYDQXZVSHOVOHFKWVHHQNOHLQYHU
VFKLOPDNHQLQGHJHOXLGVVWHUNWHYDQGHNODQN)LJ
,QGLHQ9HOR2IIVHWKRJHUGDQZRUGWJH]HW]XOOHQ]HOIV]DFKWJHVSHHOGHQRWHQGLW
]LMQQRWHQPHWHHQODJHVQHOKHLGOXLGNOLQNHQ)LJ,QGLHQ9HOR2IIVHWODJHUGDQ
ZRUGWJH]HW]XOOHQ]HOIVWHYLJJHVSHHOGHQRWHQGLW]LMQQRWHQPHWHHQKRJHVQHOKHLG
]DFKWNOLQNHQ)LJ
ILJH
Velo Depth = 32, Velo Offset = 64
Het eigenlijke geluidsniveau
Het eigenlijke geluidsniveau
Velo Depth = 64, Velo Offset = 64
Fig. 1
Fig. 2
MIDI Velocity
Fig. 3
Fig. 4
MIDI Velocity
MIDI Velocity
Velo Depth = 64, Velo Offset = 127
Het eigenlijke geluidsniveau
Het eigenlijke geluidsniveau
Velo Depth = 64, Velo Offset = 96
Fig. 5
56
MIDI Velocity
Velo Depth = 64, Velo Offset = 32
Het eigenlijke geluidsniveau
Het eigenlijke geluidsniveau
Velo Depth = 127, Velo Offset = 64
MIDI Velocity
Fig. 6
MIDI Velocity
+HWLVPRJHOLMNGDWXELM
VRPPLJHLQVWHOOLQJHQJHHQ
JHOXLGNULMJW9HUKRRJLQ
GDWJHYDOGH9HOR'HSWKRI
GH9HOR2IIVHW
Parts en parameters
❏Key Range L (Keyboard Range Low)
C-1²*
❏Key Range H (Keyboard Range High)
&²G9
'H.H\5DQJHSDUDPHWHUVEHSDOHQKHWEHUHLNYDQGHWRRQKRRJWHZDDULQKHWLQVWUX
PHQW]DONOLQNHQ.H\ERDUG5DQJH/RZGHODDJVWHQRRWHQ.H\ERDUG5DQJH+LJK
GHKRRJVWHQRRWEHSDOHQKHWEHUHLNYDQGHQRWHQGLH]XOOHQNOLQNHQ'H]HZDDUGHQ
ZRUGHQJHWRRQGDOVWRHWVQDPHQ0HQNDQHHQZDDUGHYDVWOHJJHQWXVVHQ&HQ*
²HQGHPLGGHQ&LV&
ILJH
Nootnaam
C-1
A0 C1
C2
C3
C4
C5
C6
C7
C8
G9
0
21 24
36
48
60
72
84
96
108
127
MIDI-nootnummer
%LMYRRUEHHOGDOVPHQWZHHSDUWVDDQKHW]HOIGH0,',NDQDDOWRHZLMVWHQGH.H\
ERDUG5DQJHYDQHHQYDQEHLGHRS&²%HQGHDQGHUHRS&²*LQVWHOWNDQPHQ
YHUVFKLOOHQGHNODQNHQDDQHONHSDUWWRHZLM]HQHQWZHHYHUVFKLOOHQGHNODQNHQDDQ
HONH]LMGHYDQ&VSHOHQ2IXNDQKHWNODYLHUEHUHLNYDQWZHHSDUWVODWHQRYHUODSSHQ
HQGHWZHHNODQNHQLQODJHQOHJJHQ
ILJH
B3 C4
Instrument 1
Instrument 2
❏CC1 C.Number (CC1 Controller Number)
²16²
6WHOKHW&RQWUROOHUQXPPHULQGDWGH&&SDUDPHWHUVS]DOVWXUHQYLD0,',
%LMYRRUEHHOGDOVX&&&1XPPHURS]HW]DOGHZDDUGHYDQHHQLQNRPHQG0,',
&RQWUROOHUQXPPHUFRPPDQGRGHNODQNEHwQYORHGHQ]RDOVEHSDDOGGRRUGHLQ
VWHOOLQJYDQGH&&SDUDPHWHU
❏Out Asgn (Output Assign)
OUT-1287287/2875
%HSDDOGHXLWJDQJVILFKHYDQZDDUXLWGHNODQNYDQHONHSDUW]DOZRUGHQXLWJHVWXXUG
,QGHIDEULHNVLQVWHOOLQJHQ]LMQDOOHSDUWVRS287JH]HW
287
287
287/
2875
'HNODQN]DOVDPHQPHWGHHIIHFWNODQNLQVWHUHRZRUGHQXLWJH]RQGHQYDQ
XLWGH$XGLRRXWSXWILFKHV287387
'HGLUHFWHNODQN]DO]RQGHUGHHIIHFWNODQNLQVWHUHRZRUGHQXLWJH]RQGHQ
YDQXLWGH$XGLRRXWSXWILFKHV287387
'HGLUHFWHNODQN]DO]RQGHUHIIHFWHQXLWJH]RQGHQYDQXLWGH$XGLR
RXWSXW/ILFKHV287387/'H3DQLQVWHOOLQJKHHIWJHHQHIIHFW
'HGLUHFWHNODQN]DO]RQGHUHIIHFWHQXLWJH]RQGHQYDQXLWGH$XGLR
RXWSXW5ILFKHV2873875'H3DQLQVWHOOLQJKHHIWJHHQHIIHFW
:DQQHHU.H\ERDUG5DQJH
+LJKLQJHVWHOGLVRSHHQ
QRRWQDDPGLHODJHULVGDQ
.H\ERDUG5DQJH/RZ]DO
HUJHHQJHOXLG]LMQ+RX
KLHUUHNHQLQJPHH
'HKHDGSKRQHVMDFNVWXXUW
KHWJHOXLGXLWYDQGH$XGLR
RXWSXWMDFNV287387
'LWEHWHNHQWGDWKHWJHOXLG
YDQ3DUWVGLHWRHJHZH]HQ
]LMQDDQ$XGLRRXWSXW
MDFNV287387QLHWWH
KRUHQ]XOOHQ]LMQYLDGH
KRRIGWHOHIRRQ
+HWJHOXLGYDQGH$XGLR
RXWSXWMDFNV287387
ZRUGWXLWJHVWXXUGPHWHHQ
YDVWYROXPHRQJHDFKWGH
SRVLWLHYDQGH>92/80(@
NQRS
'H2XWSXW$VVLJQYHUDQ
GHUHQYLD0,',
ERRGVFKDSSHQ]LHS
57
Parts en parameters
■MODIFY
9RRUPHHUGHWDLOVEHWUHIIHQGHGHMODIFYSDUDPHWHUV]LH+RRIGVWXNEen klank of een drumset
creëren SDUDJUDDIParameters voor klankbewerking S
■S.TUNE C–B
❏Scale Tuning C–B
²±0²
6FDOH7XQLQJLVHHQSDUDPHWHUGLHQDXZNHXULJHDDQSDVVLQJHQPDDNWDDQGHWRRQ
KRRJWHYDQHONHQRRWLQHHQRFWDDI'H]HLQVWHOOLQJHQJHOGHQYRRUHHQRFWDDIYDQQR
WHQHQSDVVHQGHWRRQKRRJWHYDQGH]HQRRWLQDOOHRFWDYHQWHJHOLMNHUWLMGDDQ
:DQQHHUPHQ6FDOH7XQLQJJHEUXLNWNDQPHQXLWYRHULQJHQVSHOHQPHWHHQJURWH
YHUVFKHLGHQKHLGDDQVWHPPLQJHQLQSODDWVYDQPHWHHQ]HOIGHVWHPPLQJ+LHURQGHU
JHYHQZHGULHLQVWHOOLQJHQDOVYRRUEHHOG
(TXDO7HPSHUDPHQW!
'H]HVWHPPLQJYHUGHHOWKHWRFWDDILQGULHJHOLMNHGHOHQHQLVLQGH:HVWHUVHPX]LHN
GHPHHVWJHEUXLNWHYRUPYDQVWHPPLQJ'HVWDQGDDUGLQVWHOOLQJYDQGH6&
6FDOH7XQHIXQFWLHLV(TXDO7HPSHUDPHQW
-XVW,QWRQDWLRQ7RQLFRI&!
,QGH]HVWHPPLQJNOLQNHQGHKRRIGGULHNODQNHQ]XLYHULQYHUJHOLMNLQJPHWHTXDO
WHPSHUDPHQW'LWHIIHFWZRUGWHFKWHUDOOHHQEHUHLNWLQppQWRRQDDUGHQGHGULHNODQ
NHQ]XOOHQGXEEHO]LQQLJNOLQNHQZDQQHHUPHQWUDQVSRQHHUW+LHURQGHUYLQGWXHHQ
YRRUEHHOGYDQGHLQVWHOOLQJHQPHWJURQGWRRQ&
$UDELDQVW\OH6FDOH!
0HQNDQHHQJURWHYHUVFKHLGHQKHLGYDQVWHPPLQJHQYHUNULMJHQZDQQHHUPHQGH
6FDOH7XQLQJIXQFWLHJHEUXLNW+LHURQGHUYLQGWXGHLQVWHOOLQJHQYRRUHHQVWHPPLQJ
PHW$UDELVFKHWRRQODGGHUV
9RRUEHHOGLQVWHOOLQJHQZDDUGHQLQKRQGHUGVWHQ
1RRW
QDDP
&
&
'
'
(
)
)
*
*
$
$
%
(TXDO
-XVWLQWRQDWLRQ $UDELVFKHWRRQODGGHU
WHPSHUDPHQW JURQGWRRQ&
■02'%(1'&$I&&
+LHUZRUGWKHWVDPHQJDDQYHUNODDUGYDQWZHHSDUWVGLHHHQSDUDPHWHUQDDPYRU
PHQ
<De eerste helft van de parameternaam>
❏Mod ~ (Modulation ~)
:DQQHHUXGHPRGXODWLHKHQGHORIKHWPRGXODWLHZLHOYDQHHQ0,',NODYLHU
EHZHHJWZRUGHQPRGXODWLHFRPPDQGR·VYHU]RQGHQGLHGHNODQNZLM]LJHQ'H0RG
aSDUDPHWHUVEHSDOHQGHPDQLHUZDDURSGHNODQN]DOYHUDQGHUHQZDQQHHUGH]H
FRPPDQGR·VRQWYDQJHQZRUGHQ,QGHIDEULHNVLQVWHOOLQJHQYDQGH]HSDUDPHWHUV
ZRUGWYLEUDWRRSGHNODQNWRHJHSDVW
❏Bnd ~ (Bend ~)
:DQQHHUXGHSLWFKEHQGKHQGHOEXLJHQYDQGHWRRQKRRJWHRIKHWSLWFKZLHOYDQ
HHQ0,',NODYLHUEHZHHJWZRUGHQSLWFKEHQGFRPPDQGR·VYHU]RQGHQGLHGHNODQN
ZLM]LJHQ'H%HQGaSDUDPHWHUVEHSDOHQGHPDQLHUZDDURSGHNODQN]DOYHUDQGHUHQ
ZDQQHHUGH]HFRPPDQGR·VRQWYDQJHQZRUGHQ,QGHIDEULHNVLQVWHOOLQJHQYDQGH]H
SDUDPHWHUVZRUGWGHWRRQKRRJWHJHZLM]LJG
58
Parts en parameters
❏CAf ~ (Channel aftertouch ~)
6RPPLJH0,',NODYLHUHQYHU]HQGHQFRPPDQGR·VGLHPHQDIWHUWRXFKQDDDQVODJ
QRHPWZDQQHHUPHQGUXNXLWRHIHQWRSKHWNODYLHUQDGDWPHQHHQQRRWKHHIW
JHVSHHOG.DQDDODIWHUWRXFKRRNNDQDDOGUXNJHQRHPGYHUVWXXUWVOHFKWVHHQJH
JHYHQVZDDUGH]HOIVZDQQHHUHUWZHHRIPHHUQRWHQZRUGHQLQJHGUXNW:DQQHHUHHQ
NODQNJHQHUDWRUGLWFRPPDQGRRQWYDQJWNDQGH]HGHNODQNRSYHUVFKLOOHQGH
PDQLHUHQZLM]LJHQ'H&$IaSDUDPHWHUVEHSDOHQKRHGHNODQN]DONOLQNHQZDQQHHU
HUHHQFRPPDQGRRQWYDQJHQZRUGW'HIDEULHNVLQVWHOOLQJHQJHYHQJHHQYHUDQGHU
LQJZDQQHHUGLWFRPPDQGRRQWYDQJHQZRUGW
&RQWUROHHURIXZ0,',NODYLHUDGWHUWRXFKFRPPDQGR·VNDQYHU]HQGHQ
❏CC1 ~
%LMVRPPLJH0,',NODYLHUHQLVKHWPRJHOLMNRPFRQWUROOHUQXPPHUVWRHWHZLM]HQ
:DQQHHUGH]HVFKXLYHQZRUGHQYHUSODDWVWZRUGHQFRPPDQGR·VYDQKHWJHVSHFL
ILHHUGHFRQWUROOHUQXPPHUYHU]RQGHQZDDUGRRUGHNODQN]DOYHUDQGHUHQ'H&&a
SDUDPHWHUVEHSDDOWKRHGHNODQN]DOYHUDQGHUHQZDQQHHUFRPPDQGR·VYDQKHW
RYHUHHQNRPVWLJHFRQWUROOHUQXPPHURQWYDQJHQZRUGHQ
*HEUXLNHHUVWGH&&&RQWUROOHU1XPEHUSDUDPHWHUSRPKHWFRQWUROOHUQXP
PHUWHVHOHFWHUHQGDWXJDDWWRHZLM]HQ
<De tweede heflt van de parameternaam >
GH]HLQVWHOOLQJHQKHEEHQJHHQHIIHFWZDQQHHU]HRSVWDDQ
❏~ Range
-24 ~ +24 (Bend Range is +/-0–+24)
'H]HSDUDPHWHUVEHSDOHQGHPD[LPDOHWRRQKRRJWHYHUDQGHULQJGLHSODDWVYLQGWZDQ
QHHUKHWRYHUHHQNRPVWLJHFRPPDQGRZRUGWRQWYDQJHQ(HQLQVWHOOLQJYDQODDW
HHQYHUDQGHULQJYDQRFWDDIWRHHQHHQLQVWHOOLQJYDQODDWHHQYHUDQGHULQJYDQ
RFWDYHQWRH$OVGHLQVWHOOLQJLV]DOGHWRRQKRRJWHQLHWYHUDQGHUHQ
❏~ Cutoff (~Cutoff frequency)
-64–+63
'H]HSDUDPHWHUVEHSDOHQKRHGHDIVQLMIUHTXHQWLH]DOYHUDQGHUHQZDQQHHUKHW
RYHUHHQNRPVWLJHFRPPDQGRZRUGWRQWYDQJHQ+RJHUHZDDUGHQGRHQGHDIVQLMIUH
TXHQWLHVWLMJHQ3RVLWLHYHLQVWHOOLQJHQPDNHQGHNODQNKHOGHUGHUHQQHJDWLHYH
LQVWHOOLQJHQPDNHQGHNODQN]DFKWHU
%LMVRPPLJHNODQNHQJDDW
GHWRRQKRRJWHPLVVFKLHQ
QLHW]RKRRJDOVEHSDDOG
GRRUGH5DQJHLQVWHOOLQJ
❏~ Amp (~Amplitude)
-64–+63
'H]HSDUDPHWHUVEHSDOHQGHPDQLHUZDDURSGHNODQN]DOYHUDQGHUHQZDQQHHUKHW
RYHUHHQNRPVWLJHFRPPDQGRZRUGWRQWYDQJHQ'RRUKRJHUHZDDUGHQNDQPHQGH
YROXPHVWLMJLQJYHUJURWHQ
❏~ LFO Rate
-64–+63
'H]HSDUDPHWHUVEHSDOHQGHPDQLHUZDDURSGH/)2IUHTXHQWLH]DOYHUDQGHUHQZDQ
QHHUKHWRYHUHHQNRPVWLJHFRPPDQGRZRUGWRQWYDQJHQHQSDVVHQGHVQHOKHLGDDQ
ZDDUDDQGHNODQNJHPRGXOHHUGRIJHYDULHHUGZRUGW'RRUKRJHUHZDDUGHQNDQPHQ
GHPRGXODWLHRIYDULDWLHYHUVQHOOHQ
❏~ LFO Pitch
0–10–127
'H]HSDUDPHWHUVEHSDOHQGHPDQLHUZDDURSGHGLHSWHYDQKHWYLEUDWRHIIHFWF\
FOLVFKHPRGXODWLHYDQGHWRRQKRRJWH]DOYHUDQGHUHQZDQQHHUKHWRYHUHHQNRPVWLJH
FRPPDQGRZRUGWRQWYDQJHQ'RRUKRJHUHZDDUGHQNDQPHQKHWPRGXODWLHHIIHFW
YHUJURWHQ
❏~ LFO TVF
0–127
'H]HSDUDPHWHUVEHSDOHQGHPDQLHUZDDURSGHGLHSWHYDQKHWJURZOHIIHFWF\
FOLVFKHPRGXODWLHYDQGHWRRQ]DOYHUDQGHUHQZDQQHHUKHWRYHUHHQNRPVWLJHFRP
PDQGRZRUGWRQWYDQJHQ'RRUKRJHUHZDDUGHQNDQPHQKHWJURZOHIIHFWYHUJURWHQ
❏~ LFO TVA
0–127
'H]HSDUDPHWHUVEHSDOHQGHPDQLHUZDDURSGHGLHSWHYDQKHWWUHPRORHIIHFWF\
FOLVFKHPRGXODWLHYDQKHWYROXPH]DOYHUDQGHUHQZDQQHHUKHWRYHUHHQNRPVWLJH
FRPPDQGRZRUGWRQWYDQJHQ'RRUKRJHUHZDDUGHQNDQPHQKHWWUHPRORHIIHFWYHU
JURWHQ
59
Parts en parameters
■U.INST
9RRUPHHUGHWDLOVEHWUHIIHQGHGHU.INSTSDUDPHWHUV]LH+RRIGVWXNEen klank of een drumset
creëren SDUDJUDDIParameters voor klankbewerking S
9HU]HQGKHWYROJHQGH6V\VWHP([FOXVLYHFRPPDQGRRPGHHTXDOL]HUYDQHHQSDUW
XLWWH]HWWHQPHWEHKXOSYDQ0,',FRPPDQGR·V
ILJFH
address
data checksum
F0 41 10 42 12 [ 40 4x 20 ] [ ] [ ] F7
$GGUHVV
[
=LHRRNMIDI Implementation(QJHOVWDOLJH
KDQGOHLGLQJS
[(4212))
3DUW1XPEHU
'DWD
²
2)) 21
&KHFNVXP =LHHet controletotaal berekenenS
<Voorbeeld> De equalizer van Part 3 uitzetten
9HU]HQGKHWYROJHQGH6\VWHP([FOXVLYHFRPPDQGR
ILJGH
address
data checksum
,QGH0,',LPSOHPHQ
WDWLRQZRUGWKHWpartnummerEHVFKUHYHQDOVKHW
block-nummer9RRUGH
RYHUHHQVWHPPLQJWXVVHQ
SDUWQXPPHUHQEORFN
QXPPHU]LH(QJHOVWDOLJH
KDQGOHLGLQJS
F0 41 10 42 12 [ 40 43 20 ] [ 00 ] [ 5D ] F7
Part 3
checksum
EQ OFF
$OVXGHHTXDOL]HUDDQZLO]HWWHQPRHWXGHZDDUGHYDQGHJHJHYHQVRS01]HWWHQ
9HU]HQGKHWYROJHQGH6\VWHP([FOXVLYHFRPPDQGRRPHHQQRUPDOH3DUWLQHHQ
GUXPSDUWWHYHUDQGHUHQPHWEHKXOSYDQ0,',FRPPDQGR·V
ILJDH
address
data checksum
F0 41 10 42 12 [ 40 1x 15 ] [ ] [ ] F7
$GGUHVV
[
'DWD
[86()255+<7+03$57
3DUW1XPEHU
²
1RUPDO 'UXP 'UXP
&KHFNVXP =LHHet controletotaal berekenenS
<Voorbeeld> De Part-modus van Part 11 op Drum2 instellen
9HU]HQGKHWYROJHQGH6\VWHP([FOXVLYHFRPPDQGR
ILJEH
address
data checksum
F0 41 10 42 12 [ 40 1A 15 ] [ 02 ] [ 0F ] F7
Part 11
checksum
Drum2
2PHHQGUXPVHWWHVHOHFWHUHQQDGDWXGHSDUWPRGXVKHEWJHVHOHFWHHUGPRHWXHHQ
SURJUDPFKDQJHQDDUSDUWYHU]HQGHQ
60
0HWGHIDEULHNVLQVWHOOLQJHQ
VWDDWGHHTXDOL]HUYDQHONH
3DUWDDQ
=LHRRNMIDI Implementation(QJHOVWDOLJH
KDQGOHLGLQJS
Parts en parameters
.ODQNYDQXLW287387VWXUHQPHWEHKXOSYDQ0,',FRPPDQGR·V
0HWGHVWDQGDDUGLQVWHOOLQJHQZRUGWHUJHHQNODQNJHVWXXUGYDQXLW2XWSXWILFKHV
$OVXNODQNYDQXLW287387ZLOVWXUHQZDQQHHUXHHQVRQJVSHHOWPRHWXGHSDUW
SDUDPHWHUVLQVWHOOHQ
'HSDUWSDUDPHWHUVPRHWHQHFKWHULQKXQRRUVSURQNHOLMNHVWDDWKHUVWHOGZRUGHQ
ZDQQHHUHUHHQUHVHWFRPPDQGRRQWYDQJHQZRUGWYDQXLWHHQDQGHUWRHVWHORIYDQXLW
GHVHTXHQFHUVRIWZDUH$OVXGH]HLQVWHOOLQJHQZLOJHEUXLNHQWHUZLMOXHHQVRQJ
VSHHOWGDQPRHWXGHYROJHQGHV\VWHPH[FOXVLYHFRPPDQGR·VLQGHVRQJJHJHYHQV
VFKULMYHQ
=LHRRNMIDI Implementation(QJHOVWDOLJH
KDQGOHLGLQJS
ILJDH
address
data checksum
F0 41 10 42 12 [ 40 4x 21 ] [ ] [ ] F7
$GGUHVV
[
'DWD
[287387$66,*1
3DUW1XPEHU
²
287387 287387 287387/ 2873875
&KHFNVXP =LHHet controletotaal berekenenS
<Voorbeeld> De klank van part 1 vanuit OUTPUT2 sturen
9HU]HQGKHWYROJHQGH6\VWHP([FOXVLYHFRPPDQGR
ILJEH
address
data checksum
F0 41 10 42 12 [ 40 41 21 ] [ 01 ] [ 5D ] F7
Part 1
checksum
OUTPUT-2
$OVXRRNGHNODQNYDQDQGHUHSDUWVYDQXLW287387ZLOVWXUHQPRHWXKHWKLHU
ERYHQEHVFKUHYHQH[FOXVLYHFRPPDQGRYRRUHONHSDUWLQYRHUHQ
61
Parts en parameters
Parameters instellen die de SC-8850
zelf beïnvloeden (Utility-scherm)
,QKHWUtility-schermNDQXsysteemparametersLQVWHOOHQGLHGHJDQVH6&
EHwQYORHGHQ'HV\VWHHPSDUDPHWHUVLQKHW8WLOLW\VFKHUP]LMQGHYROJHQGH
PrevwMode:
Prevw Note:
Prevw Velo:
LCD Contrast:
Startup:
3UHYLHZ0RGH
3UHYLHZ1RWH1DPH
3UHYLHZ9HORFLW\
/&'&RQWUDVW
6WDUWXS
■ Procedure
1
'UXNWHJHOLMNHUWLMGRSGH>(',7@HQPART>
@NQRSSHQUTIL
+HWUtility-schermYHUVFKLMQW
ILJ
2
3
4
5
'UXN>6<67(0@>)@
'UXNVAR.>
@RIINST>
@RPGHFXUVRURPKRRJRIRPODDJWHEHZHJHQ
HQVHOHFWHHUGHSDUDPHWHUGLHXZLOYHUDQGHUHQ
'UDDLDDQGH>9$/8(@NQRSRIGUXN>'(&@RI>,1&@RPGHZDDUGHYDQGH
SDUDPHWHULQWHVWHOOHQ
'UXN>(17(5@
'HLQVWHOOLQJHQYDQGHV\VWHHPSDUDPHWHUV]LMQEHZDDUG
62
'HWDLOVRYHUSDUDPHWHUVLQ
BULKSINITS
DQGDEMOSYLQGWX
LQGHRYHUHHQNRPVWLJH
KRRIGVWXNNHQ
Parts en parameters
■ De functie van de parameters
■Prevw Mode (Preview Mode)
6LQJOHPhrase
$OVXRSGH>92/80(@NQRSGUXNWNDQXGHNODQNGLHXLQKHWVFKHUPKHHIWJHVH
OHFWHHUGEHOXLVWHUHQDOVHHQIUDVH3KUDVHRIDOVHHQHQNHOHQRRW6LQJOH0HWGH3UH
YZPRGXVVHOHFWHHUWXRIGHNODQNDOVHHQIUDVHRIHHQHQNHOHQRRW]DONOLQNHQ'H
VWDQGDDUGLQVWHOOLQJLV3KUDVH
■Prevw Note (Preview Note Name)
&²A4²*
$OVXRSGH>92/80(@NQRSGUXNWWHUZLMOGHPreview ModeRS6LQJOHLVLQJHVWHOG
]DOKHWLQVWUXPHQWNOLQNHQGDWLQGHGLVSOD\ZRUGWJHWRRQG'H3UHYZ1RWHSDUDPH
WHUEHSDDOWGHQRRWGLHPHQ]DOKRUHQ'H$QRRWLQKHWPLGGHQYDQKHWNODYLHULV$
$OVX.H\6KLIWKHEW
LQJHVWHOGZRUGWGH
WRRQKRRJWHYHUVFKRYHQ
S
■Prevw Velo (Preview Velocity)
²100²
6WHOWGHVQHOKHLGLQYDQGHQRRWGLHNOLQNWDOVPHQRSGH>92/80(@NQRSGUXNW*H
ZRRQOLMNUHVXOWHUHQKRJHUHVQHOKHGHQLQHHQOXLGHUHNODQNS9HORFLW\6HQVLWLYL
W\HQ]
■LCD Contrast
²8²
$IKDQNHOLMNYDQGHKRHNZDDULQKHWWRHVWHOLVJHSODDWVWLVKHWVRPVPRHLOLMNRPGH
GLVSOD\DIWHOH]HQ,QGLHQGLWKHWJHYDOLVPRHWXKHWFRQWUDVWYDQGHGLVSOD\DDQSDV
VHQ+RJHUHZDDUGHQPDNHQGHOHWWHUVGRQNHUGHU
■Startup (Start up)
GS Reset8VHU
:DQQHHUGHVWURRPYDQGH6&DDQJH]HWZRUGWEHSDDOWGH]HLQVWHOOLQJRIGH6&
]DORSVWDUWHQLQGHWRHVWDQGGLHKHWODDWVWHLQGHXVHU]RQHZHUGJHVFKUHYHQRI
GDWKHWWRHVWHO]DORSVWDUWHQDOVRIKHWQHWHHQ*65HVHWFRPPDQGRKHHIWJHNUHJHQ
'H]HLQVWHOOLQJLVVWDQGDDUG*65HVHW
9RRUKHWZHJVFKULMYHQYDQ
GDWDLQGHXVHUDUHD]LH
SC-8850 instellingen
wegschrijven naar of
opladen uit de User Area
(Edit All-scherm)S
63
Een klank of drumset creëren
Probeer een originele klank
,QGH6&NDQXGHZDDUGHQYDQHHQJURRWDDQWDOSDUDPHWHUVYHUDQGHUHQRP]R
GHPHHVWJHVFKLNWHNODQNYRRUXZVSHOWHFUHsUHQ(HQparameterLVLHWVZDWGH
NODQNEHwQYORHGW+HWSURFHVZDDULQGHSDUDPHWHUZDDUGHQZRUGHQYHUDQGHUG
QRHPWPHQediting EHZHUNHQ.ODQNSDUDPHWHUVKHEEHQLQYORHGRSKHWYROXPH
KHWWLPEUHHQGHWRRQKRRJWHYDQHHQNODQN
0HQNDQGHYROJHQGHSDUDPHWHUVLQVWHOOHQ
9LEUDWR
5DWH
'HSWK
'HOD\
)LOWHU
&XWRII)UHTXHQF\
5HVRQDQFH
(QYHORSH
$WWDFN7LPH
'HFD\7LPH
5HOHDVH7LPH
'HWDLOVRYHUHONHSDUDPHWHU
YLQGWXLQ Parameters
voor het bewerken van
een klankS
■ De elementen van een klank veranderen om een
nieuwe klank te creëren
1
=RUJHUYRRUGDWKHWPart Basic-schermJHVHOHFWHHUGLV
2
'UXNPART>
3
@RI>
@RPHHQSDUWWHVHOHFWHUHQ
'HSDUDPHWHUVGLHGHNODQNYHUDQGHUHQ]LMQLQJHVWHOGYRRULQGLYLGXHOH
SDUWV0HQNDQHFKWHUHHUVWVAR.>
@RIINST>
@RPGHFXUVRUQDDU
VAR.WHYHUSODDWVHQRIINSTHQGDQDDQGH>9$/8(@VFKLMIGUDDLHQRI
>'(&@>,1&@JHEUXLNHQRPGHNODQNWHVHOHFWHUHQ
4
'UXN>(',7@
5
'UXN>02',)<@>)@
ILJ
6
7
8
64
'UXNVAR.>
@RIINST>
@RPGHFXUVRURPKRRJRIRPODDJWHEHZHJHQ
HQVHOHFWHHUGHSDUDPHWHUGLHXZLODDQSDVVHQ
'UDDLDDQGH>9$/8(@NQRSRIGUXN>'(&@RI>,1&@RPGHZDDUGHYDQGH
SDUDPHWHULQWHVWHOOHQ
'UXN>(;,7@RPGHSURFHGXUHWHVWRSSHQZDQQHHUXNODDUEHQWPHWKHW
PDNHQYDQLQVWHOOLQJHQ
+HW3DUW%DVLFVFKHUPLV
KHWVFKHUPGDWYHUVFKLMQW
ZDQQHHUXGH6&
DDQ]HW8NDQYDQXLW
DQGHUHVFKHUPHQWHUXJ
NHUHQQDDUKHW3DUW%DVLF
VFKHUPGRRURS>(;,7@WH
GUXNNHQ$OVGH3$57
GLVSOD\RSALLVWDDWGUXN
GDQWHJHOLMNHUWLMGRSPART
>
@HQ>
@ALLRPGH
PARTGLVSOD\ZHHU
QRUPDDOWH]HWWHQ
Een klank of drumset creëren
■ Parameters voor het bewerken van een klank
,QGH6&ZRUGHQYRRUHONHSDUWSDUDPHWHULQVWHOOLQJHQJHPDDNW0HWDQGHUH
ZRRUGHQSDUDPHWHUZDDUGHQKRUHQELMSDUWVHQQLHWELMNODQNHQ,QVWUXPHQWHQ
%LMYRRUEHHOGDOVPHQGH9LEUDWR5DWHRSLQVWHOWHQGDDUQDYRRUGLHSDUWHHQDQ
GHUHNODQNVHOHFWHHUWGDQ]DOGH9LEUDWR5DWHYDQWRHJHSDVWZRUGHQRSGH]RSDV
JHVHOHFWHHUGHNODQNHQQLHWGHRRUVSURQNHOLMNHZDDUGHYDQ'DDURPQRHPW
PHQSDUDPHWHUVGLHELMSDUWVKRUHQPart-parameters
Vibrato
9LEUDWRLVHHQHIIHFWGDWJHPDDNWZRUGWGRRUGHWRRQKRRJWHWHPRGXOHUHQ+HWWRH
SDVVHQYDQYLEUDWRPDDNWGHNODQNH[SUHVVLHYHU
■Vib Rate (Vibrato Rate)
²0²
'H]HSDUDPHWHUSDVWGHVQHOKHLGIUHTXHQWLHDDQYDQGHWRRQKRRJWHPRGXODWLH3RV
LWLHYHLQVWHOOLQJHQPDNHQGHWRRQKRRJWHPRGXODWLHVQHOOHUQHJDWLHYHLQVWHOO
LQJHQPDNHQ]HODQJ]DPHU
3DUDPHWHUV]RDOV9LEUDWR
)LOWHUHQ(QYHORSHNDQX
QLHWDOOHHQYRRU3DUWV
LQVWHOOHQPDDURRNYRRU
NODQNHQ,QVWUXPHQWV
.ODQNHQGLHXFUHsHUWGRRU
GH]HSDUDPHWHUVWH
ZLM]LJHQQRHPHQZHUser
InstrumentsHQGH]H
NXQQHQRSJHVODJHQ
ZRUGHQLQGH6&PDS
PHPRU\DUHDS
■Vib Depth (Vibrato Depth)
²0²
'H]HSDUDPHWHUSDVWGHGLHSWHDDQYDQGHWRRQKRRJWHPRGXODWLH3RVLWLHYHLQ
VWHOOLQJHQPDNHQGHWRRQKRRJWHPRGXODWLHGLHSHUQHJDWLHYHLQVWHOOLQJHQPDNHQ
]HOLFKWHU
■Vib Delay (Vibrato Delay)
²0²
'H]HSDUDPHWHUSDVWGHWLMGDDQGLHKHWYLEUDWRHIIHFWQRGLJKHHIWRPWHEHJLQQHQ
3RVLWLHYHLQVWHOOLQJHQYHUOHQJHQGHWLMGWRWKHWYLEUDWRHIIHFWEHJLQWQHJDWLHYH
YHUNRUWHQGHWLMG
ILJH
Delay
Depth
Note On
Rate
Filter
'RRUGHILOWHULQVWHOOLQJHQWHYHUDQGHUHQNDQXKHWWLPEUHWRRQYDQGHNODQNFRQ
WUROHUHQ+HWVRRUWILOWHUVYDQGH6&ZRUGW/RZ3DVV)LOWHUVJHQRHPGHQODWHQ
XLWVOXLWHQGIUHTXHQWLHVGRRUGLHODJHU]LMQGDQHHQJHVSHFLILHHUGHIUHTXHQWLH'H]H
IUHTXHQWLHZRUGW&XWRII)UHTXHQF\DIVQLMIUHTXHQWLHJHQRHPG'RRUGHLQVWHOOLQJ
YDQGH&XWRII)UHTXHQF\WHYHUDQGHUHQNDQPHQGHNODQNKHOGHUGHURIGRQNHUGHU
PDNHQ'H&XWRII)UHTXHQF\NDQJHVWXXUGGRRUGHHQYHORSHQDYHUORRSYDQWLMGYH
UDQGHUHQ'RRUGHLQVWHOOLQJHQYDQGHILOWHUHQGHHQYHORSHWHYHUDQGHUHQNDQPHQ
NODQNHQFUHsUHQPHWEHZHJLQJHQH[SUHVVLH
ILJH
Hoge frequenties
Low
pass
filter
Afsnijfrequentie
Lage frequenties
65
Een klank of drumset creëren
■Cutoff Freq (Cutoff Frequency / afsnijfrequentie)²0²
3RVLWLHYHLQVWHOOLQJHQYDQGH&XWRII)UHTYHUKRJHQGHDIVQLMIUHTXHQWLH1HJDWLHYHLQ
VWHOOLQJHQYHUODJHQGHDIVQLMIUHTXHQWLH:DQQHHUXGH]HZDDUGHODQJVGHSRVLWLHYH
]LMGHYHUKRRJW]XOOHQPHHURYHUWRQHQGRRUJHODWHQZRUGHQHQ]DOGHNODQNKDUGHU
KHOGHUGHUZRUGHQ+RHYHUGHUGHZDDUGHLQKHWQHJDWLHIJDDWKRHPLQGHURYHU
WRQHQHUGRRUJHODWHQHQKRH]DFKWHUGRQNHUGHUGHNODQN]DOZRUGHQ
%LMVRPPLJHNODQNHQ]XOOHQ
SRVLWLHYHLQVWHOOLQJHQ
YRRUGH&XWRII)UHTKHW
JHOXLGQLHWPHUNEDDU
YHUDQGHUHQ
ILJH
Eigenschappen v/d Low pass filter
Level
Frequentie
Afsnijfrequentie
■Resonance/resonantie
²0²
:DQQHHUGH5HVRQDQFHZDDUGHYHUKRRJGZRUG]XOOHQGHRYHUWRQHQLQGHEXXUW
YDQGHDIVQLMIUHTXHQWLHEHQDGUXNWZRUGHQZDDUGRRUHHQNODQNRQWVWDDWPHWHHQ
VWHUNNDUDNWHU
ILJH
Level
Frequentie
Afsnijfrequentie
Laag
Hoog
Resonance
Envelope
+HWYROXPHYDQHHQLQVWUXPHQWYHUDQGHUWQDYHUORRSYDQWLMGYDQDIKHWPRPHQWGDW
GHQRRWEHJLQWWHNOLQNHQWRWKHWPRPHQWZDDURSGHQRRWYHUGZLMQW'H]HYHUDQGHU
LQJNDQLQHHQJUDILHNJHWHNHQGZRUGHQ]RDOVZHHUJHJHYHQLQKHWYROJHQGHGLD
JUDP'H]HYRUPLVYRRUHONLQVWUXPHQWXQLHNHQLVYRRURQVHHQEHODQJULMNHOHPHQW
YRRUKHWRQGHUVFKHLGHQYDQGHNODQNHQGLHZHKRUHQ'H]HYRUPZRUGWGHHQYHORSH
JHQRHPG
'HHQYHORSHVYDQNODQNHQYDQPX]LHNLQVWUXPHQWHQNXQQHQYHUDQGHUHQLQIXQFWLH
YDQGHPDQLHUZDDURSKHWLQVWUXPHQWEHVSHHOGZRUGW%LMYRRUEHHOGZDQQHHUHHQ
WURPSHWVFKHUSHQVWHYLJEHVSHHOGZRUGW]DOGHDDQ]HWVQHO]LMQHQGHNODQNVFKHUS
:DQHHUHFKWHUGHWURPSHWOLFKWHQ]DFKWEHVSHHOGZRUGW]DOGHDDQ]HW]DFKWHU]LMQ
2PGHDDQ]HWYDQHHQNODQNDDQWHSDVVHQNXQQHQZHGH$WWDFN7LPHDDQ]HWWLMG
YDQGHHQYHORSYHUDQGHUHQ'RRUGHZDDUGHQYDQGHHQYHORSHWHYHUDQGHUHQNDQ
PHQGHHLJHQVFKDSSHQYDQHHQJURWHKRHYHHOKHLGYHUVFKLOOHQGHLQVWUXPHQWHQ
VLPXOHUHQ
'HYRUPYDQGHHQYHORSHGLHZHRSGH]HPDQLHUFUHsUHQKHHIWRRNLQYORHGRSGH
PDQLHUZDDURSGHDIVQLMIUHTXHQWLHYHUDQGHUW$OVGHDIVQLMIUHTXHQWLHYHUODDJGZHUG
]DO]HVWLMJHQZDQQHHUGHHQYHORSHVWLMJWHQ]DO]HGDOHQZDQQHHUGHHQYHORSHGDDOW
ILJH
A: Attack-tijd
D: Decay-tijd
R: Release-tijd
Afsnijfrequentie
Envelope
Filter
Geluid eindigt
Tijd
Level
A
Note On
66
D
R
Note Off
%LMVRPPLJHNODQNHQ]XOOHQ
QHJDWLHYHLQVWHOOLQJHQ
YRRU5HVRQDQFHKHWJHOXLG
QLHWPHUNEDDUYHUDQGHUHQ
Een klank of drumset creëren
■Attack Time
²0²
'H]HSDUDPHWHUSDVWGHVFKHUSWHYDQKHWEHJLQYDQHHQNODQNDDQ
■Decay Time
²0²
'H]HSDUDPHWHUSDVWGHWLMGVSDQQHDDQZDDULQGHNODQNYDQKHWKRRJVWHSXQWYDQGH
DDQ]HWWHUXJYDOWWRWRSDDQKRXGQLYHDX)LJ
■Release Time
²0²
'H]HSDUDPHWHUSDVWGHWLMGVSDQQHDDQZDDULQGHNODQNXLWVWHUIWQDGDWGHQRRWZHUG
ORVJHODWHQWRW]HQLHWODQJHUJHKRRUGZRUGW'HDIVQLMIUHTXHQWLH]DOHYHQHHQVLQYHU
KRXGLQJGDOHQ
6RPPLJHNODQNHQKHEEHQ
HHQVXVWDLQOHYHOYDQ
)LJ3LDQRHQJLWDDU
NODQNHQEHKRUHQWRWGH]H
FDWHJRULH
ILJH
Fig. 1
9RRUVRPPLJHNODQNHQ
]XOOHQZLM]LJLQJHQLQGH
YHUVFKLOOHQGH7LPHLQVWHO
OLQJHQYDQGHHQYHORSH
JHHQPHUNEDDUHIIHFW
KHEEHQRSKHWJHOXLG
Volume
Geluid eindigt
Sustain Level
Tijd
A
D
R
Note Off
Note On
Fig. 2
A: Attack-tijd
D: Decay-tijd
R: Release-tijd
Volume
Geluid eindigt
Tijd
A
D
Note Off
Note On
■ Een klank creëren en bewaren (User-instrument)
ILJH
0HQNDQGHSDUDPHWHUVYDQGH6&QDDUXZVPDDNDDQSDVVHQHQXZQLHXZHLQ
VWHOOLQJHQEHZDUHQLQ9DULDWLRQQXPPHUVRIYDQGH6&PDSS(HQ
NODQNGLHRSGH]HPDQLHULVEHZDDUGZRUGWHHQUser-instrumentJHQRHPG2S
GH]HPDQLHUNDQXNODQNHQEHZDUHQ
0HQNDQGHYLEUDWRILOWHUHQHQYHORSHSDUDPHWHUVRSHHQLQVWUXPHQWLQVWHOOHQ
'H]HSDUDPHWHUVZRUGHQUser-instrumentparametersJHQRHPG=LHSYRRUGH
IXQFWLHYDQHONHSDUDPHWHU
'HNODQNYDQKHW8VHULQVWUXPHQWGLHPHQZHUNHOLMNKRRUW]DOGHFRPELQDWLHZHHU
VSLHJHOHQYDQGHLQVWHOOLQJHQYDQGHSDUWSDUDPHWHUHQGHLQVWHOOLQJHQYDQGH8VHU
LQVWUXPHQWSDUDPHWHU%LMYRRUEHHOGDOVGH9LEUDWR5DWHLVLQJHVWHOGRSGRRUGH
SDUWSDUDPHWHUVHQRSGRRUGH8VHULQVWUXPHQWSDUDPHWHUVGDQ]DOGHKRHYHHOKHLG
YLEUDWRYDQGHNODQNGDWPHQZHUNHOLMNKRRUW ]LMQ
'H]HOIGHLQKRXGLV
RSJHVODJHQLQGHPDSVYDQ
GH6&6&3URHQGH
6&
User Instrument
Part parameter-instellingen
Vibrato Rate
+20
+
User Instrument parameterinstellingen
Vibrato Rate
-5
=
Klank toegewezen
aan een Part
Vibrato Rate
+15
MIDI-boodschap
$OVYLEUDWRILOWHUHQHQYHORSHZDDUGHQYHUDQGHUG]LMQGRRU0,',FRPPDQGR·V]XO
OHQGHZDDUGHQYDQGH3DUWSDUDPHWHUVSRRNYHUDQGHUHQ,QGLWJHYDO]DOGH
ZDDUGHYDQGH8VHULQVWUXPHQWSDUDPHWHUVQLHWYHUDQGHUHQ
9RRUHHQYHUNODULQJYDQGH
ERRGVFKDSSHQGLHKHW
JHOXLGZLM]LJHQEY6\VWHP
([FOXVLYHPHVVDJHVHQ
1531ERRGVFKDSSHQ]LH
S
67
Een klank of drumset creëren
Een klank creëren
1
=RUJHUYRRUGDWKHWPart Basic-schermJHVHOHFWHHUGLV
2
'UXNPART>
3
'UXNVAR.>
@RI>
3DUW%DVLFVFKHUPS
@RPHHQSDUWWHVHOHFWHUHQ
@RIINST>
@RPGHFXUVRUQDDUVAR.>
@RIINST>
@
WHYHUSODDWVHQHQGUDDLGDQDDQGH>9$/8(@NQRSRIGUXN>'(&@RI>,1&@
RPGHNODQNWHVHOHFWHUHQ
8ZEHZHUNLQJHQ]XOOHQWRHJHSDVWZRUGHQRSGHNODQNGLHKLHUJHVHOHFWHHUGLV
4
5
'UXN>(',7@RPKHWDDQWH]HWWHQ
'UXNWZHHPDDO>→@>)@RPGRRUKHWVFKHUPWHORSHQHQGUXN>8,167@
>)@
ILJ
6
7
68
'UXNVAR.>
@RIINST>
@RPGHFXUVRURPKRRJRIRPODDJWHEHZHJHQ
HQVHOHFWHHUGHSDUDPHWHUGLHXZLOYHUDQGHUHQ
'UDDLDDQGH>9$/8(@NQRSRIGUXN>'(&@RI>,1&@RPGHZDDUGHYDQGH
SDUDPHWHULQWHVWHOOHQ
'HWDLOVRYHUHONHSDUDPHWHU
YLQGWXLQParameters
voor het bewerken van
een klankS
Een klank of drumset creëren
De klank bewaren
1DGDWXHHQNODQNKHEWJHPDDNWPRHWXGHYROJHQGHSURFHGXUHJHEUXLNHQRPGH
NODQNWHEHZDUHQ
1
'UXN>(17(5@
'HGLVSOD\YUDDJW´Write User Inst?µ
ILJH
U kan de klank opslaan onder de
Variatienummers 64 en 65.
Het Instrument-nummer kan gelijk
welk getal van 1 tot 128 zijn.
2
3
'UXNVAR.>
@RIINST>
@RPGHFXUVRUQDDUVAR WHYHUSODDWVHQ
'UDDLDDQGH>9$/8(@NQRSRIGUXN>'(&@RI>,1&@RPKHW9DULDWLRQ
QXPPHULQWHVWHOOHQ8NDQ9DULDWLRQQXPPHU64HQ65JHEUXLNHQYRRUGH
8VHULQVWUXPHQWHQ
ILJH
Native Map
065
064
User Tone
User Tone
User Tone
User Tone
User Tone
User Tone
User Tone
User Tone
User Tone
User Tone
008
Upright P w
Comp Clav.
Variatienummer
Variatieklanken
003
002
001
000
Atk Clav.2
Mild Piano
UprightPiano
Piano 1
001
Atk Clav.1
Clav. 2
Pop Celesta
Clav.
Celesta
008
009
Glockenspiel
004
003
002
001
000
010
Eruption
Explosion
Lasergun
Machine Gun
Gun Shot
Hoofdklanken
128
Instrumentnummer
User Instruments opslaan
4
5
6
'UXNVAR.>
@RIINST>
@RPGHFXUVRUQDDUINST WHYHUSODDWVHQ
'UDDLDDQGH>9$/8(@NQRSRIGUXN>'(&@RI>,1&@RPKHW,QVWUXPHQW
QXPPHULQWHVWHOOHQ
'UXN>(17(5@RPKHWXVHULQVWUXPHQWWHEHZDUHQ
'UXN>(;,7@RPWHVWRSSHQ]RQGHUKHW8VHULQVWUXPHQWWHEHZDUHQ
2PKHWEHZDDUGHXVHULQVWUXPHQWWHJHEUXLNHQPRHWXKHWYDULDWLRQQXPPHURI
VSHFLILsUHQ
,QVWHOOLQJVZDDUGHQYRRU
8VHU,QVWUXPHQWVNXQQHQ
RRNYHU]RQGHQZRUGHQDOV
0,',V\VWHPH[FOXVLYH
PHVVDJHVS$OVXHHQ
VHTXHQFHUSURJUDPPDRI
HHQKDUGZDUHVHTXHQFHU
JHEUXLNWRPGH]H
YHU]RQGHQGDWDRSWH
QHPHQHQ]HGDQRSQLHXZ
YHU]HQGWQDDUGH6&
NDQX8VHU,QVWUXPHQWV
RSVODDQHQUHSURGXFHUHQ
=RUJGDWKHWWRHVWHOEOLMIW
DDQVWDDQWHUZLMOGHLQVWHO
OLQJHQRSJHVODJHQZRUGHQ
69
Een klank of drumset creëren
Een drumset creëen en bewaren (User-drum)
$DQHHQGUXPSDUWLVHHQYHU]DPHOLQJNODQNHQYDQSHUFXVVLHLQVWUXPHQWHQ
WRHJHZH]HQGLHHHQGUXPVHWZRUGWJHQRHPG,QWHJHQVWHOOLQJWRWELMHHQQRUPDOH
SDUWKHHIWHHQGUXPSDUWHHQYHUVFKLOOHQGLQVWUXPHQWYRRUHONQRRWQXPPHU'LWLV
XLWHUVWJHPDNNHOLMNDDQJH]LHQHHQGUXPSDUWWHJHOLMNHUWLMGHHQJURWHKRHYHHOKHLG
NODQNHQPRHWSURGXFHUHQ]RDOVHHQEDVGUXPVQDUHWRPHQF\PEDOHQ(HQ
YHU]DPHOLQJYDQ]XONHNODQNHQGLHHONDI]RQGHUOLMNDDQHHQHLJHQQRRWQXPPHU]LMQ
WRHJZH]HQQRHPWPHQHHQdrumset(ONHNODQNLQHHQGUXPVHWZRUGWHHQ
druminstrumentJHQRHPG'UXP6HW/LVWS
,QGH6&NDQPHQYHUVFKLOOHQGHSDUDPHWHUVYDQGUXPLQVWUXPHQWYHUDQGHUHQ
RPGHGUXPNODQNHQWHFUHsUHQGLHKHWPHHVWDDQXZPX]LNDOHEHKRHIWHQYROGRHQ
(HQparameterLVLHWVGDWGHNODQNEHwQYORHGW+HWSURFHVZDDULQPHQSDUDPHWHU
ZDDUGHQYHUDQGHUWZRUGWediting (bewerken) JHQRHPG
0HQNDQGHZDDUGHQYDQHONLQVWUXPHQWGUXPLQVWUXPHQWYDQGHRSGLWPRPHQW
JHVHOHFWHHUGHGUXPVHWYHUDQGHUHQYRRUKHWYROXPHGHSDQVWHUHRSRVLWLHGHWRRQ
KRRJWHKHW5HYHUE6HQGQLYHDX&KRUXV6HQGQLYHDX'HOD\6HQGQLYHDXHQGH$V
VLJQJURHS'H]HSDUDPHWHUZDDUGHQZRUGHQDI]RQGHUOLMNLQJHVWHOGYRRUHON
GUXPLQVWUXPHQWGDWDDQHHQQRRWQXPPHULVWRHJHZH]HQ
+RHXGH'UXP6HWGLHX
KHEWDDQJHPDDNWRSVODDW
OHHVWXLQEen gecreëerde
drumset bewaren (userdrumset)S
■ Drum edit
1
=RUJHUYRRUGDWKHWPart Basic-schermJHVHOHFWHHUGLV
2
'UXNPART>
@RI>
3DUW%DVLFVFKHUPS
@RPHHQGUXPSDUWWHVHOHFWHUHQ
,QGHVWDQGDDUGLQVWHOOLQJHQLV3DUW$%&'LQJHVWHOGRS'UXPSDUWV
0HQNDQWRWWZHHGUXPVHWVDDQHONHSDUWJURHSWRHZLM]HQ
3
$OVGHFXUVRURSINSTVWDDWPRHWX>'(&@RI>,1&@GUXNNHQRPHHQGUXP
VHWWHVHOHFWHUHQ
8ZEHZHUNLQJZRUGWWRHJHSDVWRSGHGUXPVHWGLHXKLHUVHOHFWHHUW'LWNDQODWHUQRJ
YHUDQGHUGZRUGHQ
4
'UXN>'580@RPKHWDDQWH]HWWHQ
+HWGUXPVFKHUPYHUVFKLMQWHQKHWGUXPVHWQXPPHUGHWRRQKRRJWHQRRWQXPPHU
GHGUXPLQVWUXPHQWQDDPHQ]ZRUGHQJHWRRQG
ILJ
70
0HW>,1670$3@NDQXHHQ
DQGHUHVRXQGPDSNLH]HQ
YRRUGHJHVHOHFWHHUGHSDUW
8NDQNLH]HQWXVVHQGH6&
PDSGH6&3UR
PDSGH6&PDSHQGH
6&PDS>
@ZLMVWGH
PRPHQWHHOJHVHOHFWHHUGH
PDSDDQ
'HQRRWQDDPLVHHQQDDP
GLHWRHJHZH]HQLVDDQHON
YDQGHWRHWVHQQRWHQHQ
GLHRYHUHHQVWHPWPHWKHW
0,',QRRWQXPPHU$DQ
HONQRRWQXPPHULVHUHHQ
VODJLQVWUXPHQW
WRHJHZH]HQ
Een klank of drumset creëren
5
'UXNVAR.>
@RIINST>
@RPGHFXUVRUQDDUINST WHYHUSODDWVHQHQ
GUDDLDDQGH>9$/8(@NQRSHQGUXN>'(&@RI>,1&@RPKHW'UXPLQVWUX
PHQWGDWXZLOEHZHUNHQLQWHVWHOOHQ
3DUW0RGHS
6
=RUJHUYRRUGDW>(',7@>)@LQJHGUXNWLV
7
'UXNVAR.>
@RIINST>
@RPGHFXUVRURPKRRJRIRPODDJWHEHZHJHQ
HQVHOHFWHHUGHSDUDPHWHUGLHXZLOYHUDQGHUHQ
(ONHSDUDPHWHUGRHWKHWYROJHQGH
6HW
3LWFK&RDUVH
,QVW/HYHO
,QVW3DQ
5HYHUE6HQG
&KRUXV6HQG
'HOD\6HQG
$VVLJQ*URXS
5[1RWH2Q
5[1RWH2II
8
9
9HUDQGHUWGHQDDPYDQGHGUXPVHW'HQDDPGLHXKLHUYH
UDQGHUWNDQDOOHHQDOVHHQuser-drumsetEHZDDUGZRUGHQ=LH
Een volledige drumset opslaan (procedure 2)SYRRU
PHHUGHWDLOV
SDVWGHWRRQKRRJWHDDQYDQHONLQVWUXPHQWLQVWDSSHQYDQHHQ
KDOYHWRRQ
VWHOWKHWYROXPHYDQHONLQVWUXPHQWLQ
VWHOW
GHVWHUHRSRVLWLHYDQHONLQVWUXPHQWLQ
VWHOWKHW5HYHUE6HQGQLYHDXYDQHONLQVWUXPHQWLQ
VWHOWKHW&KRUXV6HQGQLYHDXYDQHONLQVWUXPHQWLQ
VWHOWKHW'HOD\6HQGQLYHDXYDQHONLQVWUXPHQWLQW
VWHOWGH$VVLJQJURHSLQS
PDDNWRQWYDQJVWPRJHOLMNYDQ1RWH2QFRPPDQGR·V
PDDNWRQWYDQJVWPRJHOLMNYDQ1RWH2IIFRPPDQGR·V
'HFXUVRUYHUVFKXLIWSHU
NDUDNWHURYHUGHQDDPYDQ
GH'UXP6HW$OVXGH
VAR.INSTWRHWV
LQJHGUXNWKRXGWWHUZLMOX
RSGHINSTVAR.WRHWV
GUXNWJDDWGHFXUVRU
VQHOOHU
9RRU'UXPLQVWUXPHQWHQ
NDQXFKRUXVHQGHOD\QLHW
WHJHOLMNHUWLMGJHEUXLNHQ
9RRUGHWDLOV]LHChorus
en Delay gebruikenS
'UXNVAR.>
@RIINST>
@RPGHFXUVRUWHYHUSODDWVHQQDDUGHSDUDPH
WHUGLHXZLOYHUDQGHUHQHQGUDDLDDQGH>9$/8(@NQRSRIGUXN>'(&@RI
>,1&@RPGHZDDUGHYDQGHSDUDPHWHULQWHVWHOOHQ
'UXN>'580@RI>(;,7@RPGHSURFHGXUHWHEHsLQGLJHQZDQQHHUXNODDU
EHQWPHWLQVWHOOLQJHQPDNHQ
71
Een klank of drumset creëren
Chorus en Delay gebruiken
0HWGUXPLQVWUXPHQWHQNDQPHQFKRUXVHQGHOD\QLHWWHJHOLMNHUWLMGJHEUXLNHQ
$OVLQKHWGUXPHGLWVFKHUPGHSDUDPHWHUVYDQRIZHOChorus SendRIDelay Send
PHWHHQDVWHULVN]LMQJHPHUNWGDQLVGH]HSDUDPHWHUQLHWJHOGLJ:DQQHHUXGH
ZDDUGHYDQGH]HSDUDPHWHUYHUDQGHUWZRUGWGH]HSDUDPHWHUHFKWHUDFWLHI0HWDQ
GHUHZRRUGHQRIZHOLVFKRUXVJHOGLJRIZHOGHOD\DIKDQNHOLMNYDQGHSDUDPHWHUGLH
KHWODDWVWLVLQJHVWHOG
ILJ
Assign-groep
0HQNDQHONLQVWUXPHQWHHQQXPPHUJHYHQHQLQVWUXPHQWHQPHWKHW]HOIGHQXPPHU
ZRUGHQEHKDQGHOGDOVHHQAssign-groep(U]XOOHQJHHQWZHHLQVWUXPHQWHQYDQGH
]HOIGH$VVLJQJURHSVDPHQNOLQNHQ$OVHUHHQ0,',FRPPDQGRZRUGWRQWYDQJHQ
RPHHQDQGHULQVWUXPHQWYDQGH]HOIGH$VVLJQJURHSWHVSHOHQWHUZLMOHUDOHHQLQ
VWUXPHQWNOLQNWGDQ]DOKHWHHUVWHLQVWUXPHQWHHUVWZRUGHQXLWJH]HW'LWLVHHQKDQ
GLJHPDQLHURPWHYRRUNRPHQGDWWZHHLQVWUXPHQWHQGLHQRUPDDOQRRLWVDPHQ
NOLQNHQWRFKVDPHQ]RXGHQVSHOHQ%LMYRRUEHHOGDDQJH]LHQKHWGXLGHOLMNRQ
PRJHOLMNLVRPWHJHOLMNHUWLMGHHQRSHQHQHHQJHVORWHQKLKDWNODQNYRRUWWHEUHQJHQ
NXQQHQGH]HWZHHNODQNHQLQGH]HOIGH$VVLJQJURHSKHW]HOIGHQXPPHUZRUGHQ
JHSODDWVW]RGDW]HQLHWVDPHQ]XOOHQNOLQNHQ
0HQNDQQXPPHUVVHOHFWHUHQYDQ1RQWRWPDDUGHLQVWUXPHQWHQZDDUYRRU
PHQ1RQKHHIWJHVHOHFWHHUG]XOOHQQLHWZRUGHQXLWJH]HWGRRUDQGHUHLQVWUXPHQWHQ
0HWDQGHUHZRRUGHQLQVWUXPHQWHQZDDUYDQGHLQVWHOOLQJ1RQLV]XOOHQQLHWZRUGHQ
EHKDQGHOGDOVHHQ$VVLJQJURHS
:DQQHHUXHHQDQGHUH
'UXP6HWNLHVWZRUGHQGH
SDUDPHWHUZDDUGHQJHwQLWL
DOLVHHUG+RXGDDU
UHNHQLQJPHH
Drumsets veranderen in het drumscherm
=HOIVZDQQHHUXLQKHWGUXPVFKHUPEHQWNDQXQRJVWHHGVGUXPVHWVHQ]YHUDQGHU
HQ
■'UXPPDSVVHOHFWHUHQ
*HEUXLNGH3$57>
@>
@NQRSSHQRPGHGUXPPDSWHVHOHFWHUHQ
,QGHIDEULHNVLQVWHOOLQJHQNDQXA1B1C1HQD1 VHOHFWHUHQ
$ 'UXPYDQ3DUWJURHS$
$ 'UXPYDQ3DUWJURHS$$OOHHQZDQQHHUHHQ'UXPSDUWDDQGHLQVWHOOLQJHQYDQ
GH3DUWPRGXVLVWRHJHYRHJG
% 'UXPYDQ3DUWJURHS%
% 'UXPYDQ3DUWJURHS%$OOHHQZDQQHHUHHQ'UXPSDUWDDQGHLQVWHOOLQJHQYDQ
GH3DUWPRGXVLVWRHJHYRHJG
& 'UXPYDQ3DUWJURHS&
& 'UXPYDQ3DUWJURHS&$OOHHQZDQQHHUHHQ'UXPSDUWDDQGHLQVWHOOLQJHQYDQ
GH3DUWPRGXVLVWRHJHYRHJG
' 'UXPYDQ3DUWJURHS'
' 'UXPYDQ3DUWJURHS'$OOHHQZDQQHHUHHQ'UXPSDUWDDQGHLQVWHOOLQJHQ
YDQGH3DUWPRGXVLVWRHJHYRHJG
72
'HWDLOVRYHU'UXP
'UXPHQ3DUW0RGHYLQGW
XRSS
Een klank of drumset creëren
■'UXPVHWVVHOHFWHUHQ
1 'UXNINST>
QXPPHU
@RPGHFXUVRUQDDUVARWHYHUSODDWVHQKHWGUXPVHW
ILJ
2 'UDDLDDQGH>9$/8(@RIGUXN>'(&@RI>,1&@RPHHQGUXPVHWWHVHOHF
WHUHQ
6HOHFWHHUGDDUQDKHWGUXPLQVWUXPHQW]RDOVLQVWDSYDQDrum Edit
S
:DQQHHUXHHQDQGHUH
'UXP6HWNLHVWZRUGHQGH
SDUDPHWHUZDDUGHQJHwQLWL
DOLVHHUG+RXGDDU
UHNHQLQJPHH
■ Een gecreëerde drumset bewaren (user-drumset)
0HQNDQGHGUXPLQVWUXPHQWSDUDPHWHUVQDDUEHOLHYHQYHUDQGHUHQHQGH]HJHJHY
HQVEHZDUHQDOVHHQGUXPVHW(HQGUXPVHWGLHRSGH]HPDQLHULVEHZDDUGQRHPW
PHQHHQuser-drumset0HQNDQWRWWZHHGUXPVHWVEHZDUHQHQDDQJH]LHQHONVWHO
LQVWUXPHQWDOHNODQNHQEHYDWPDDNWGLWLQWRWDDOLQVWUXPHQWDOHNODQNHQ
GUXPLQVWUXPHQWHQ0HQNDQHONHGUXPVHWRRNHHQQDDPQDDUNHX]HJHYHQ8VHU
GUXPVHWVZRUGHQRSJHVODJHQLQGUXPVHWQXPPHUVHQYDQGH6&PDS
S
'H]HOIGHLQKRXGLV
RSJHVODJHQLQGHPDSVYDQ
GH6&GH6&3URHQ
GH6&
(U]LMQWZHHPDQLHUHQZDDURSPHQHHQEHZHUNWLQVWUXPHQWNDQRSVODDQ7HQHHUVWH
NDQPHQHONGUXPLQVWUXPHQWDI]RQGHUOLMNRSVODDQSURFHGXUH7HQWZHHGHNDQ
PHQHHQYROOHGLJHVHWGUXPLQVWUXPHQWHQDOVHHQGUXPVHWRSVODDQSURFHGXUH
ILJH
Procedure 1
Procedure 2
SC-8850/SC-88Pro/
SC-88 Map
SC-8850/SC-88Pro/
SC-88 Map
C3 48
C3 48
49
52
53
51
52
53
54
57
58
58
59
59
C4 60
61
61
62
62
65
54
56
56
57
64
51
55
55
C4 60
49
50
50
63
64
65
66
63
66
67
67
68
68
69
69
70
70
71
B4 71
Nootnaam
Nootnummer
65
66
User Drum Set-nummer
65
66
User Drum Set-nummer
73
Een klank of drumset creëren
Een afzonderlijk druminstrument opslaan (procedure 1)
+LHURQGHUZRUGWEHVFKUHYHQKRHPHQHHQEHZHUNWGUXPLQVWUXPHQWYRRUHONHQRRW
NDQEHZDUHQ
1 0DDNHHQGUXPLQVWUXPHQWLQKHWGUXPVFKHUP
ILJ
9RRUKHWHGLWHQYDQ
GUXPNODQNHQ]LHDrum
editS
2 'UXN>:ULWH@>)@
'HGLVSOD\YUDDJW´Write User Drum?µ
ILJ
3 $OVXUser Drum No.RIInstZLOYHUDQGHUHQGDQPRHWXVAR.>
INST>
VHQ
@RI
@GUXNNHQRPGHFXUVRUQDDUUser Drum No.RIInstWHYHUSODDW
4 'UDDLDDQGH>9$/8(@NQRSRIGUXN>'(&@RI>,1&@RPKHWQXPPHU
YRRUUser Drum No.RIInstWHVHOHFWHUHQ8NDQ65RI66DOVUser Drum
No.NLH]HQ
5 'UXN>(17(5@RPGHLQVWHOOLQJHQDOVHHQ8VHUGUXPWHEHZDUHQ
'UXN>(;,7@RPWHVWRSSHQ]RQGHUGHLQVWHOOLQJHQWHEHZDUHQ
2PGHEHZDDUGHXVHUGUXPWHJHEUXLNHQPRHWPHQKHWGUXPQXPPHU
RIVSHFLILsUHQHQGDDUQDKHWLQVWUXPHQWEHSDOHQ
74
=RUJGDWKHWWRHVWHOEOLMIW
DDQVWDDQWHUZLMOGHLQVWHO
OLQJHQZRUGHQRSJHVODJHQ
Een klank of drumset creëren
Een volledige drumset opslaan (procedure 2)
'HYROJHQGHSURFHGXUHVODDWDOOHGUXPLQVWUXPHQWHQRSYRRUGHJHKHOHGUXPVHWGLH
RSGLWPRPHQWLVJHVHOHFWHHUG
8NDQRRNHHQQDDPJHYHQDDQGH8VHUGUXPVHWVLQGUXPVHWQXPPHUVHQ$OV
XJHHQQDDPZLOJHYHQOHHVGDQEen drumset bewaren.
Een User-drumset benoemen
1 'UXN>'580@LQKHWPart Basic-scherm
2 'UXNPART>
EHQRHPHQ
@RI>
3DUW%DVLFVFKHUPS
@RPGH8VHUGUXPVHWWHVHOHFWHUHQGLHXZLO
3 'UXNVAR.>
@RIINST>
@RPGHFXUVRUQDDUGHHHUVWHOHWWHUYDQGH
SetGUXPVHWQDDPWHYHUSODDWVHQ
ILJ
4 'UXNVAR.>
EHSDOHQ
@RIINST>
@RPGHSODDWVYDQKHWOHWWHUWHNHQWH
5 'UDDLDDQGH>9$/8(@NQRSRIGUXN>'(&@RI>,1&@RPKHWJHZHQVWH
WHNHQWHVHOHFWHUHQ7HONHQVXRSGH>9$/8(@NQRSGUXNWYHUDQGHUWKHW
WHNHQA → a → 0 → & → (
6 +HUKDDOGDDUQDVWDSHQRPKHWWHNHQLQWHYRHUHQ
1XLVGHQDDPYDQGHXVHUGUXPVHWLQJHYRHUGPDDUQRJQLHWEHZDDUG2PGHQDDP
WHEHZDUHQPRHWXGHSURFHGXUHYROJHQGLHRSGHYROJHQGHEODG]LMGHEHVFKUHYHQLV
$OVXKHW8VHU'UXP6HW
QXPPHUZLOZLM]LJHQGUXN
GDQRSINST>
@RPGH
FXUVRURSKHW'UXP6HW
QXPPHUWHSODDWVHQHQ
GUDDLDDQGH>9$/8(@GLDO
RIGUXNRS>'(&@RI>,1&@
RPKHWQXPPHWWH
ZLM]LJHQ+RXHUHFKWHU
UHNHQLQJPHHGDWVDPHQ
PHWKHWQXPPHURRNGH
SDUDPHWHULQVWHOOLQJHQ
]XOOHQYHUDQGHUHQ
75
Een klank of drumset creëren
Een drumset bewaren
1 0DDNHHQGUXPLQVWUXPHQWLQKHWGUXPVFKHUP
2 'UXN>:56(7@>)@
'HGLVSOD\YUDDJW´Write User Drum Set?µ
ILJ
3 =RUJHUYRRUGDWGHFXUVRURSUser Drum No. VWDDW
4 $OVXKHWUser Drum No.ZLOYHUDQGHUHQPRHWXDDQGH>9$/8(@NQRS
GUDDLHQRI>'(&@RI>,1&@GUXNNHQRPKHWQXPPHUWHVHOHFWHUHQ0HQ
NDQNLH]HQWXVVHQ65RI66DOVUser Drum No.
5 'UXN>(17(5@RPGHLQVWHOOLQJHQDOVHHQ8VHUGUXPVHWWHEHZDUHQ
'UXN>(;,7@RPWHVWRSSHQ]RQGHUGHLQVWHOOLQJHQWHEHZDUHQ
2PGHEHZDDUGHXVHUGUXPVHWWHJHEUXLNHQPRHWPHQKHWGUXPQXPPHURI
VSHFLILsUHQ
76
9RRUKHWHGLWHQYDQ
GUXPNODQNHQ]LHDrum
editS
Organisatie van effecten op de SC-8850
'HHIIHFWHQYDQGH6&NXQQHQZRUGHQRQGHUYHUGHHOGLQSysteemeffecten
SHQInvoegeffectenS
4XDV\VWHHPHIIHFWHQLVGH6&YRRU]LHQYDQVRRUWHQUHYHUEYRRUKHWWRHYRHJHQ
YDQZHHUJDOPDDQGHNODQNVRRUWHQFKRUXVYRRUKHWWRHYRHJHQYDQGLHSWH
VRRUWHQGHOD\RPHFKRDFKWLJHHIIHFWHQWRHWHYRHJHQHQHHQEDQGHTXDOL]HURPKHW
WRQDDONDUDNWHUWHYHUDQGHUHQGRRUKHWYHUJURWHQRIDIVQLMGHQYDQKHWIUHTXHQWLH
EHUHLNYDQGHNODQN
4XDLQYRHJHIIHFWHQLVGH6&YRRU]LHQYDQYHUVFKLOOHQGHVRRUWHQHIIHFWHQ
ZDDUPHHXGHNODQNNDQYHUYRUPHQRIPRGXOHUHQHQ]HOIVPHHUGHUHHIIHFWHQPHH
NDQFRPELQHUHQ
'HV\VWHHPHIIHFWHQHQGHLQYRHJHIIHFWHQYHUVFKLOOHQQLHWDOOHHQLQKXQVRRUWPDDU
RRNLQGHXLWJDQJVURXWHYDQGHHIIHFWNODQN
Systeemeffecten
9DQGHV\VWHHPHIIHFWHQQHPHQGHUHYHUEFKRUXVGHOD\HIIHFWHQHHQGHHOYDQGH
NODQNXLWHONHSDUWRPHHQQLHXZHHIIHFWNODQNWHFUHsUHQZHHUJDOPHQ]GLHGDDUQD
DDQGHRRUVSURQNHOLMNHNODQNZRUGWWRHJHYRHJG
9RRUGH]HHIIHFWHQNDQXGHKRHYHHOKHLGNODQNVSHFLILsUHQGLHYRRUHONHSDUWQDDUKHW
HIIHFWDSSDUDDWZRUGWJHVWXXUG6HQG/HYHO+RJHUHLQVWHOOLQJHQYHUKRJHQKHW
QLYHDXYDQKHWVLJQDDOGDWQDDUKHWHIIHFWDSSDUDDWZRUGWJHVWXXUGZDDUGRRUKHW
JHSURGXFHHUGHHIIHFWJHOXLGOXLGHUNOLQNW$OVUHVXOWDDWJDDWKHWHIIHFWGLHSHUNOLQNHQ
$QGHU]LMGVNDQPHQYRRUGHHTXDOL]HUYDQGHV\VWHHPHIIHFWHQVHOHFWHUHQRIGHNODQN
YDQGHSDUWDOGDQQLHWGRRUGHHTXDOL]HUZRUGWJHVWXXUGGZ]HHQDDQXLWLQVWHO
OLQJPDNHQRPGHNODQNWHZLM]LJHQ
77
Organisatie van effecten op de SC-8850
Invoegeffecten (EFX)
,QYRHJHIIHFWHQ]LMQHIIHFWHQGLHGHNODQN]HOIYHUDQGHUHQHQGLHGHNODQNHHQFRP
SOHHWDQGHUNDUDNWHUNXQQHQJHYHQ'H6&LVYRRU]LHQYDQVRRUWHQHIIHFWHQ
=RDOVZHHUJHJHYHQLQKHWRQGHUVWDDQGHGLDJUDPNDQPHQHHQLQYRHJHIIHFWVHOHFWHU
HQHQYRRUHONHSDUWEHSDOHQRIGHNODQNDOGDQQLHWGRRUKHWHIIHFW]DOZRUGHQJHVW
XXUGDDQXLW
$DQJH]LHQHUVOHFKWVppQVRRUWLQYRHJHIIHFWWHJHOLMNHUWLMGNDQZRUGHQWRHJHSDVW]DO
GHNODQNYDQGHSDUWVZRUGHQYHUPHQJGDOVKHWHIIHFWYRRUWZHHRIPHHUSDUWVZHUG
DDQJH]HW$OVHUHHQV\VWHHPHIIHFWZHUGWRHJHSDVWRSHHQSDUWZDDUYRRUKHWLQYRHJ
HIIHFWDDQVWDDW]DOKHW6HQG/HYHOYDQKHWLQYRHJHIIHFWJHEUXLNWZRUGHQLQSODDWV
YDQKHW6HQG/HYHOYDQGHSDUW]HOIS
ILJH
Reverb Send Level
Reverb Level
Reverb
x64
Reverb Send Level
Chorus Level
Chorus Send Level
Chorus
x64
Chorus Send Level
Chorus Send Level To Reverb
Delay Send Level To Reverb
Chorus Send Level To Delay
Part-groep A
Part A1 - A16
Delay Level
Delay Send Level
Delay
x64
Delay Send Level
Part-groep B
Part B1 - B16
Equalizer
Part-groep C
Part C1 - C16
Part-groep D
Part D1 - D16
78
Invoegeffect
(EFX)
Level On/Off
x64
x64
Equalizer On/Off
L
R
x64
Equalizer On/Off
Invoegeffect(EFX)
OUTPUT
Systeemeffecten gebruiken
Reverb/Chorus/Delay
'HV\VWHHPHIIHFWHQYDQGH6&EHYDWWHQVRRUWHQUHYHUEHQFKRUXVHQ
VRRUWHQGHOD\'DDUQDDVWNDQPHQYRRUHONYDQGH]HHIIHFWHQGHSDUDPHWHUZDDUGHQ
VSHFLILsUHQ]RDOVNDUDNWHUGLHSWHVQHOKHLGHQWLMG9RRUGH]HHIIHFWHQNDQPHQYRRU
DOOHSDUWVKHWDOJHPHQHQLYHDXLQVWHOOHQHQKHWLQGLYLGXHOHQLYHDXYRRUHONHSDUWDI
]RQGHUOLMN
9RRUGHLQVWHOOLQJHQYDQ
HONH3DUWLVGLWKHW6HQG
/HYHO
Reverb
5HYHUELVHHQHIIHFWGDWZHHUJDOPDDQGHNODQNWRHYRHJW]RDOVPHQLQHHQFRQ
FHUW]DDONDQKRUHQ
Chorus
&KRUXVYHUEUHHGWKHWUXLPWHOLMNEHHOGYDQGHNODQNHQYRHJWGLHSWHHQULMNGRPWRH
Delay
'HOD\PDDNWHFKR·V+HWLVRRNPRJHOLMNRPGLHSWHHQRPYDQJDDQGHNODQNWHJHYHQ
GRRUHHQNRUWHGHOD\DDQGHRULJLQHOHNODQNWRHWHYRHJHQ
■ Parameters instellen voor Reverb/Chorus/Delay
Soort en hoeveelheid (Level)
2PHHQV\VWHHPHIIHFWWHDFWLYHUHQPRHWXGRRUKHWSend LevelLQWHVWHOOHQYRRU
HONHSDUWVSHFLILsUHQKRHYHHOHUYDQGHNODQNGRRUGHHIIHFWHQPRHWZRUGHQJHVW
XXUG$OVGH6&QRJRSGHIDEULHNVLQVWHOOLQJHQVWDDWPRHWXKHW&KRUXV6HQG
/HYHOHQKHW'HOD\6HQG/HYHOYHUKRJHQ=LH3YRRUPHHUGHWDLOVRYHUKHWLQ
VWHOOHQYDQKHW6HQG/HYHO
1
2
'UXN>())(&76@RPGH]HDDQWH]HWWHQ
'UXN>5(9(5%@>)@>&+2586@>)@RI>'(/$<@>)@RPKHWVRRUW
HIIHFWWHVHOHFWHUHQGDWXZLOYHUDQGHUHQ
ILJ
3
4
'UXNVAR.>
@RIINST>
@RPGHFXUVRURPKRRJRIRPODDJWHEHZHJHQ
HQVHOHFWHHUGHSDUDPHWHUGLHXZLOYHUDQGHUHQ
'UDDLDDQGH>9$/8(@NQRSRIGUXN>'(&@RI>,1&@RPGHZDDUGHYDQGH
SDUDPHWHULQWHVWHOOHQ
%LMHHQSDUWZDDUYRRUHHQ
LQYRHJHIIHFWJHDFWLYHHUGLV
NDQXKHWVHQGOHYHOQDDU
GHV\VWHHPHIIHFWHQQLHW
RQDIKDQNHOLMNUHJHOHQ$OOH
SDUWVZDDUYRRUHUHHQ
LQYRHJHIIHFWLVJHDFWLYHHUG
SJHEUXLNHQHHQ
JHPHHQVFKDSSHOLMNOHYHO
'HWDLOVRYHUHONHSDUDPHWHU
YLQGWXRSS
79
Systeemeffecten gebruiken
Chorus en Delay gebruiken
9RRU3DUW&HQ'NDQPHQFKRUXVHQGHOD\QLHWWHJHOLMNHUWLMGJHEUXLNHQ
$OVX>())(&7@>)@GUXNWLQKHW(GLWVFKHUP]LMQGHSDUDPHWHUVYDQRIZHOChorus
SendRIDelay SendPHWHHQDVWHULVNJHPHUNWGH]HSDUDPHWHULVQLHWJHOGLJ
:DQQHHUXGHZDDUGHYDQGH]HSDUDPHWHUYHUDQGHUWZRUGWGH]HSDUDPHWHUHFKWHU
DFWLHI0HWDQGHUHZRRUGHQRIZHOLVFKRUXVJHOGLJRIZHOGHOD\DIKDQNHOLMNYDQGH
SDUDPHWHUGLHKHWODDWVWLVLQJHVWHOG
ILJ
■ Reverb-parameters en hun functies
■Rev Type (Reverb Type)
8NDQXLWVRRUWHQUHYHUENLH]HQ
5RRP
5RRP
5RRP
'H]HUHYHUEVVLPXOHUHQGHZHHUJDOPYDQHHQNDPHU=HYRRU]LHQLQHHQZHORP
VFKUHYHQUXLPWHOLMNHZHHUJDOP
+DOO
Hall2
'H]HUHYHUEVVLPXOHUHQGHZHHUJDOPYDQHHQFRQFHUW]DDO=HJHYHQHHQGLHSHUH
ZHHUJDOPGDQGH5RRP5HYHUEV
3ODWH
'LWVLPXOHHUWHHQSODDWUHYHUEHHQVWXGLRYRRUZHUSPHWHHQPHWDOHQSODDW
'HOD\
(HQFRQYHQWLRQHOHGHOD\GLHHFKRHIIHFWHQSURGXFHHUW
3DQQLQJ'HOD\
(HQVSHFLDOHGHOD\ZDDULQGHYHUWUDDJGHNODQNHQOLQNVHQUHFKWVEHZHJHQ,VJH
VFKLNWZDQQHHUPHQLQVWHUHROXLVWHUW
■Rev Level (Reverb Level)
²64²
'H]HSDUDPHWHUVWHOWGHKRHYHHOKHLGJDOPNODQNLQ+RJHUHZDDUGHQJHYHQHHQOXL
GHUHZHHUJDOP
■Rev Character (Reverb Character)
²4²
'H]HSDUDPHWHUVHOHFWHHUWKHWVRRUWJDOP²]LMQJDOPHIIHFWHQHQ]LMQGHOD\
HIIHFWHQ
■ Rev Pre-LPF (Reverb Pre-LPF)
0²
(HQORZSDVVILOWHUNDQRSGHNODQNLQGHUHYHUEZRUGHQWRHJHSDVWRPKHWKRJHIUH
TXHQWLHEHUHLNDIWHVQLMGHQ+RJHUHZDDUGHQVQLMGHQPHHUYDQGHKRJHIUHTXHQWLHV
ZHJHQJHYHQHHQ]DFKWHUHJDOP
■ Rev Time (Reverb Time)
²64²
'H]HSDUDPHWHUVWHOWGHWLMGVGXXULQZDDULQGHZHHUJDOP]DONOLQNHQ+RJHUH
ZDDUGHQJHYHQHHQODQJHUHJDOP
■ Rev Dly Fb (Reverb Delay Feedback)
0²
'H]HSDUDPHWHUZRUGWJHEUXLNWZDQQHHUGH5HYHUE&KDUDFWHURSRIVWDDWRIZDQ
QHHUKHW5HYHUE7\SHRS'HOD\RI3DQQLQJ'HOD\5HY&KDUDFLVLQJHVWHOG+HW
VWHOWGHPDQLHULQZDDURSGHGHOD\V]LFKKHUKDOHQ+RJHUHZDDUGHQJHYHQPHHUGH
OD\KHUKDOLQJHQ
■ Rev PreDlyTm (Reverb Pre-Delay Time)
0²PV
'H]HSDUDPHWHUVWHOWGHGHOD\WLMGLQYRRUGDWPHQGHJDOPKRRUW+RJHUHZDDUGHQ
JHYHQHHQODQJHUHSUHGHOD\WLMGHQERRWVHQ]RHHQJURWHUHJDOPUXLPWHQD
80
:DQQHHUXHHQDQGHU
5HYHUE7\SHNLHVWYHUDQ
GHUHQGHYROJHQGHSDUDPH
WHUZDDUGHQDXWRPDWLVFK
9RRUGHWDLOV]LHOver
Reverb TypeS
2PKHW5HYHUEHIIHFWWRHWH
SDVVHQRSHHQSDUWGLHQWX
KHWVHQGOHYHOYRRUGLHSDUW
LQWHVWHOOHQS
Systeemeffecten gebruiken
Over Reverb Type
:DQQHHUXKHW5HYHUE7\SHYHUDQGHUW]XOOHQGHUHYHUESDUDPHWHUVPHWLQEHJULSYDQ5H
YHUE&KDUDFWHUDXWRPDWLVFKDDQGHRSWLPDOHZDDUGHQZRUGHQDDQJHSDVW+HWLVJH
PDNNHOLMNHURPHHUVWKHW5HYHUE7\SHLQWHVWHOOHQEHVFKUHYHQLQGH0,',LPSOHPHQWDWLH
DOVREVERB MACROSHQGDDUQDDOOHHQGHSDUDPHWHUVWHYHUDQGHUHQGLHXZLOZLM]L
JHQGDQHONHUHYHUESDUDPHWHUDI]RQGHUOLMNDDQWHSDVVHQ9RRUDOZDQQHHUX0,',([FOX
VLYHFRPPDQGR·VJHEUXLNWEHSHUNWGH]HPDQLHUYDQLQVWHOOLQJHQPDNHQGHKRHYHHOKHLG
JHJHYHQV
5HYHUE5RRP5RRP5RRP+DOO+DOO3ODWH'HOD\3DQ'HOD\
5HY/HYHO
5HY&KDUDFWHU
5HY3UH/3)
5HY7LPH
5HY'O\)E
2PKHWVRRUWUHYHUEDDQWHSDVVHQPHWEHKXOSYDQ0,',FRPPDQGR·VPRHWXKHW
YROJHQGH6\VWHP([FOXVLYHFRPPDQGRYHUVWXUHQ
ILJHH
DELAY:
address
data checksum
=LHRRNMIDI Implementation(QJHOVWDOLJH
KDQGOHLGLQJS
F0 41 10 42 12 [ 40 01 30 ] [ ] [ ] F7
$GGUHVV
'DWD
5(9(5%0$&52
²
5RRP 5RRP 5RRP +DOO +DOO 3ODWH 'HOD\ 3DQQLQJ'HOD\
&KHFNVXP =LHHet controletotaal berekenenS
<Voorbeeld> Het soort reverb op Room 3 instellen
9HU]HQGKHWYROJHQGH6\VWHP([FOXVLYHFRPPDQGR
ILJKH
address
data checksum
F0 41 10 42 12 [ 40 01 30 ] [ 02 ] [ 0D ] F7
REVERB MACRO
checksum
Room3
81
Systeemeffecten gebruiken
■ Chorus-parameters en hun functies
■Cho Type (Chorus Type)
8NDQXLWVRRUWHQFKRUXVNLH]HQ
&KRUXV
&KRUXV
Chorus3
&KRUXV
'LW]LMQFRQYHQWLRQHOHFKRUXVHIIHFWHQGLHUXLPWHHQGLHSWHDDQGHNODQNWRHYRH
JHQ
)HHGEDFN&KRUXV
'LWLVHHQFKRUXVPHWHHQRSHHQIODQJHUOLMNHQGHIIHFWHQHHQ]DFKWHNODQN
)ODQJHU
'LWLVHHQHIIHFWGDWLHWZDWOLMNWRSHHQVWUDDOYOLHJWXLJGDWRSVWLMJWRIODQGW
6KRUW'HOD\
'LWLVHHQGHOD\PHWHHQNRUWHGHOD\WLMG
6KRUW'HOD\)%
'LWLVHHQNRUWHGHOD\PHWYHHOKHUKDOLQJHQ
■ Cho Level (Chorus Level)
'H]HSDUDPHWHUVWHOWGHKRHYHHOKHLGFKRUXVNODQNLQ
■ Cho Feedback (Chorus Feedback)
²8²
'H]HSDUDPHWHUVWHOWKHWQLYHDXLQZDDURSGHFKRUXVNODQNRSQLHXZLQJHYRHUG
ZRUGWLQGHFKRUXV:DQQHHUPHQIHHGEDFNJHEUXLNWNDQPHQHHQGLFKWHUHFKRUXV
NODQNEHNRPHQ+RJHUHZDDUGHQJHYHQHHQJURWHUIHHGEDFNQLYHDX
²80²
■ Cho Rate (Chorus Rate)
²3²
'H]HSDUDPHWHUVWHOWGHVQHOKHLGIUHTXHQWLHLQZDDUDDQGHFKRUXVNODQNZRUGWJH
PRGXOHHUG+RJHUHZDDUGHQJHYHQHHQVQHOOHUHPRGXODWLH
■ Cho Depth (Chorus Depth)
²19²
'H]HSDUDPHWHUVWHOWGHGLHSWHLQZDDURSGHFKRUXVNODQNZRUGWJHPRGXOHHUG
+RJHUHZDDUGHQJHYHQHHQGLHSHUHPRGXODWLH
■ Cho To Rev (Chorus Send Level To Reverb)
0²
'H]HSDUDPHWHUVWHOWGHKRHYHHOKHLGFKRUXVNODQNLQGLHQDDUGHUHYHUEZRUGWJH
VWXXUG+RJHUHZDDUGHQ]XOOHQPHHUNODQNVWXUHQ
■ Cho To Dly (Chorus Send Level To Delay)
0²
'H]HSDUDPHWHUVWHOWGHKRHYHHOKHLGFKRUXVNODQNLQGLHQDDUGHGHOD\ZRUGWJH
VWXXUG+RJHUHZDDUGHQ]XOOHQPHHUNODQNVWXUHQ
82
2PKHW&KRUXVHIIHFWWRHWH
SDVVHQRSHHQSDUWGLHQWX
KHWVHQGOHYHOYRRUGLHSDUW
LQWHVWHOOHQS
²64²
■ Cho Pre-LPF (Chorus Pre-LPF)
0²
(HQORZSDVVILOWHUNDQRSGHNODQNLQGHFKRUXVZRUGHQWRHJHSDVWRPKHWKRJHIUH
TXHQWLHEHUHLNDIWHVQLMGHQ+RJHUHZDDUGHQVQLMGHQPHHUYDQGHKRJHIUHTXHQWLHV
ZHJHQJHYHQHHQ]DFKWHUHFKRUXVNODQN
■ Cho Delay (Chorus Delay Time)
'H]HSDUDPHWHUVWHOWGHGHOD\WLMGYDQKHWFKRUXVHIIHFWLQ
:DQQHHUXHHQDQGHU
&KRUXV7\SHNLHVWYHUDQ
GHUHQGHYROJHQGHSDUDPH
WHUZDDUGHQDXWRPDWLVFK
PHH9RRUGHWDLOV]LHOver
Chorus TypeS
9RRU3DUW&HQ'NDQX
FKRUXVHQGHOD\QLHW
WHJHOLMNHUWLMGJHEUXLNHQ
9RRUGHWDLOV]LHChorus
en Delay gebruikenS
Systeemeffecten gebruiken
Over Chorus Type
:DQQHHUXKHW&KRUXV7\SHYHUDQGHUW]XOOHQGHFKRUXVSDUDPHWHUVDXWRPDWLVFKDDQGH
RSWLPDOHZDDUGHQZRUGHQDDQJHSDVW+HWLVJHPDNNHOLMNHURPHHUVWKHW&KRUXV7\SHLQWH
VWHOOHQEHVFKUHYHQLQGH0,',LPSOHPHQWDWLHDOVCHORUS MACROSHQGDDUQDDO
OHHQGHSDUDPHWHUVWHYHUDQGHUHQGLHXZLOZLM]LJHQGDQHONHFKRUXVSDUDPHWHUDI]RQGHUOLMN
DDQWHSDVVHQ9RRUDOZDQQHHUX0,',([FOXVLYHFRPPDQGR·VJHEUXLNWEHSHUNWGH]H
PDQLHUYDQLQVWHOOLQJHQPDNHQGHKRHYHHOKHLGJHJHYHQV
&KRUXV&KRUXV&KRUXV&KRUXV)E&KRUXV)ODQJHU6'HOD\6'HOD\)E
&KR/HYHO
&KR3UH/3)
&KR)HHGEDFN
&KR'HOD\
&KR5DWH
&KR'HSWK
&KR7R5HY
&KR7R'O\
2PKHWVRRUWFKRUXVDDQWHSDVVHQPHWEHKXOSYDQ0,',FRPPDQGR·VPRHWXKHW
YROJHQGH6\VWHP([FOXVLYHFRPPDQGRYHUVWXUHQ
ILJIH
DELAY:
address
data checksum
=LHRRNMIDI Implementation(QJHOVWDOLJH
KDQGOHLGLQJS
F0 41 10 42 12 [ 40 01 38 ] [ ] [ ] F7
$GGUHVV
'DWD
&+25860$&52
²
&KRUXV &KRUXV &KRUXV &KRUXV )HHG
EDFN&KRUXV )ODQJHU 6KRUW'HOD\ 6KRUW'HOD\)%
&KHFNVXP =LHHet controletotaal berekenenS
<Voorbeeld> Het chorus type op Chorus4 instellen
9HU]HQGKHWYROJHQGH6\VWHP([FOXVLYHFRPPDQGR
ILJNH
address
data
checksum
F0 41 10 42 12 [ 40 01 38 ] [ 03 ] [ 04 ] F7
CHORUS MACRO
checksum
Chorus 4
83
Systeemeffecten gebruiken
■ Delay-parameters en hun functies
■Delay Type
8NDQNLH]HQXLWVRRUWHQGHOD\
Delay1
'HOD\
'HOD\
'LW]LMQFRQYHQWLRQHOHGHOD\VHQKHEEHQSURJUHVVLHIODQJHUHGHOD\WLMGHQ
'HOD\
'LWLVHHQGHOD\PHWHHQQRJDONRUWHGHOD\WLMG
3DQ'HOD\ 3DQ'HOD\ 3DQ'HOD\
'HGHOD\NODQNEHZHHJWWXVVHQOLQNVHQUHFKWV'LWZHUNWJRHGZDQQHHUPHQLQ
VWHUHROXLVWHUWHQKHEEHQSURJUHVVLHIODQJHUHGHOD\WLMGHQ
3DQ'HOD\
'LWLVHHQQRJDONRUWHGHOD\ZDDUELMGHGHOD\NODQNWXVVHQOLQNVHQUHFKWV
EHZHHJW:HUNWJRHGZDQQHHUPHQLQVWHUHROXLVWHUW
'O\7R5HY
(UZRUGWUHYHUEWRHJHYRHJGDDQGHGHOD\NODQNGLHWXVVHQOLQNVHQUHFKWVEH
ZHHJW:HUNWJRHGZDQQHHUPHQLQVWHUHROXLVWHUW
3DQ5HSHDW
'HGHOD\NODQNEHZHHJWWXVVHQOLQNVHQUHFKWVPDDUGHSDQSRVLWLHYHUVFKLOWYDQ
GHKLHUERYHQEHVFKUHYHQHIIHFWHQ:HUNWJRHGZDQQHHUPHQLQVWHUHROXLVWHUW
■ Dly Level (Delay Level)
²64²
'H]HSDUDPHWHUVWHOWKHWDOJHPHHQYROXPHLQYDQGHGULHGHOD\VPLGGHQOLQNVHQ
UHFKWV+RJHUHZDDUGHQJHYHQHHQOXLGHUHDOJHPHQHGHOD\
■ Dly Pre-LPF (Delay Pre-LPF)
0²
(HQORZSDVVILOWHUNDQRSGHNODQNLQGHGHOD\ZRUGHQWRHJHSDVWRPKHWKRJHIUH
TXHQWLHEHUHLNDIWHVQLMGHQ+RJHUHZDDUGHQVQLMGHQPHHUYDQGHKRJHIUHTXHQWLHV
ZHJHQJHYHQHHQ]DFKWHUHGHOD\NODQN
■ Dly Time C (Delay Time Center)
PV²340ms²V
0HWKHWGHOD\HIIHFWYDQGH6&NDQXGULHGHOD\WLMGHQLQVWHOOHQPLGGHQOLQNV
HQUHFKWVDOVPHQLQVWHUHROXLVWHUW'HOD\7LPH&HQWHUSODDWVWGHGHOD\WLMGYDQGH
GHOD\LQKHWPLGGHQ
■ DlyTmRatioL (Delay Time Ratio Left)
4%²
'H]HSDUDPHWHUVWHOWGHGHOD\WLMGLQYDQGHGHOD\GLHOLQNVJHSODDWVWLVDOVHHQSHU
FHQWDJHYDQGH'HOD\7LPH&HQWHUWRWPD[V
■ DlyTmRatioR (Delay Time Ratio Right)
4%²
'H]HSDUDPHWHUVWHOWGHGHOD\WLMGLQYDQGHGHOD\GLHUHFKWVJHSODDWVWLVDOVHHQSHU
FHQWDJHYDQGH'HOD\7LPH&HQWHUWRWPD[V
■ Dly Level C (Delay Level Center)
²127
'H]HSDUDPHWHUVWHOWKHWYROXPHLQYDQGHFHQWUDOHGHOD\+RJHUHZDDUGHQJHYHQ
HHQOXLGHUHFHQWUDOHGHOD\
■ Dly Level L (Delay Level Left)
0²
'H]HSDUDPHWHUVWHOWKHWYROXPHLQYDQGHOLQNVHGHOD\+RJHUHZDDUGHQJHYHQHHQ
OXLGHUHOLQNVHGHOD\
■ Dly Level R (Delay Level Right)
0²
'H]HSDUDPHWHUVWHOWKHWYROXPHLQYDQGHUHFKWVHGHOD\+RJHUHZDDUGHQJHYHQHHQ
OXLGHUHUHFKWVHGHOD\
■ Dly Feedback (Delay Feedback)
²+16²
'H]HSDUDPHWHUEHSDDOWKHWDDQWDONHUHQGDWGHGHOD\]LFK]DOKHUKDOHQ%LMHHQ
ZDDUGHYDQ]DOGHGHOD\QLHWKHUKDDOGZRUGHQ+RJHUHZDDUGHQJHYHQPHHUKHU
KDOLQJHQ1HJDWLHYHYDOXHVVWXUHQGHFHQWUDOHGHOD\WHUXJPHWHHQRPJHNHHUGH
IDVH1HJDWLHYHZDDUGHQ]LMQHIILFLsQWPHWNRUWHGHOD\WLMGHQ
84
:DQQHHUXHHQDQGHU'HOD\
7\SHNLHVWYHUDQGHUHQGH
YROJHQGHSDUDPHWHU
ZDDUGHQDXWRPDWLVFKPHH
9RRUGHWDLOV]LHOver
Delay TypeS
2PKHWGHOD\HIIHFWWRHWH
SDVVHQRSHHQSDUWGLHQWX
KHWVHQGOHYHOYRRUGLHSDUW
LQWHVWHOOHQS
9RRU3DUW&HQ'NDQX
FKRUXVHQGHOD\QLHW
WHJHOLMNHUWLMGJHEUXLNHQ
9RRUGHWDLOV]LH Chorus
en Delay gebruikenS
Systeemeffecten gebruiken
■ Dly To Rev (Delay Send Level To Reverb)
0²
'H]HSDUDPHWHUVWHOWGHKRHYHHOKHLGGHOD\LQGLHQDDUGHUHYHUEZRUGWJHVWXXUG
+RJHUHZDDUGHQYHUVWXUHQPHHUNODQN
About Delay Type
:DQQHHUXKHW'HOD\7\SHYHUDQGHUWZRUGHQGHKLHUERYHQEHVFKUHYHQGHOD\SDUDPHWHUV
DXWRPDWLVFKDDQGHRSWLPDOHZDDUGHQDDQJHSDVW+HWLVJHPDNNHOLMNHURPHHUVWKHW'HOD\
7\SHLQWHVWHOOHQEHVFKUHYHQLQGH0,',LPSOHPHQWDWLHDOVDELAY MACROSHQ
GDDUQDDOOHHQGHSDUDPHWHUVWHYHUDQGHUHQGLHXZLOZLM]LJHQGDQHONHGHOD\SDUDPHWHUDI
]RQGHUOLMNDDQWHSDVVHQ9RRUDOZDQQHHUX0,',([FOXVLYHFRPPDQGR·VJHEUXLNWEHSHUNW
GH]HPDQLHUYDQLQVWHOOLQJHQPDNHQGHKRHYHHOKHLGJHJHYHQV
'HOD\
3DQ'HOD\
'O\7R
3DQ
5HY5HSHDW
'O\/HYHO
'O\3UH/3)
'O\7LPH&
PV PV VHF PV PV PV VHF PV PV PV
'O\7P5DWLR/
'O\7P5DWLR5
'O\/HYHO&
'O\/HYHO/
'O\/HYHO5
'O\)HHGEDFN
'O\7R5HY
2PKHWVRRUWGHOD\DDQWHSDVVHQPHWEHKXOSYDQ0,',FRPPDQGR·VPRHWXKHWYRO
JHQGH6\VWHP([FOXVLYHFRPPDQGRYHUVWXUHQ
ILJJH
DELAY:
address
data checksum
=LHRRNMIDI Implementation(QJHOVWDOLJH
KDQGOHLGLQJS
F0 41 10 42 12 [ 40 01 50 ] [ ] [ ] F7
$GGUHVV
'DWD
'(/$<0$&52
²
'HOD\ 'HOD\ 'HOD\ 'HOD\ 3DQ'HOD\
3DQ'HOD\ 3DQ'HOD\ 3DQ'HOD\ 'HOD\WR5H
YHUE 3DQ5HSHDW
&KHFNVXP =LHHet controletotaal berekenenS
<Voorbeeld> Het reverb type op Delay 3 instellen
9HU]HQGKHWYROJHQGH6\VWHP([FOXVLYHFRPPDQGR
ILJMH
address
data checksum
F0 41 10 42 12 [ 40 01 50 ] [ 02 ] [ 6D ] F7
DELAY MACRO
checksum
Delay3
85
Systeemeffecten gebruiken
Equalizer
'H6&LVYRRU]LHQYDQHHQWZREDQGHTXDOL]HUKRRJEHUHLNODDJEHUHLN0HW
HHQHTXDOL]HUNDQXVSHFLILHNHIUHTXHQWLHEHUHLNHQYDQHHQNODQNYHUJURWHQRIDIV
QLMGHQRPGHWRRQDDQWHSDVVHQ9RRUHONEHUHLNKRRJHQODDJNDQXGHIUHTXHQWLH
VSHFLILsUHQHQKRHYHHOHUPRHWZRUGHQYHUJURRWRIDIJHVQHGHQJDLQEHSDOHQ
■ Equalizer-instellingen maken
1
=HW>())(&76@RPKHW(TXDOL]HUVFKHUPWH]HWWHQ
2
'UXN>→@>)@RPGRRUKHWVFKHUPWHORSHQHQGUXN>(4@>)@
'H(TXDOL]HUDDQXLW
]HWWHQ]LHPart EQ (Part
Equalizer)S
ILJ
3
4
'UXNVAR.>
@RIINST>
@RPGHFXUVRURPKRRJRIRPODDJWHEHZHJHQ
HQVHOHFWHHUGHSDUDPHWHUGLHXZLOYHUDQGHUHQ'HSDUDPHWHUVYRRU(TXDO
L]HU]LMQEQ Low Freq(TXDOL]HU/RZ)UHTXHQF\EQ Low Gain(TXDOL]HU
/RZ*DLQEQ High Freq(TXDOL]HU+LJK)UHTXHQF\HQEQ Hi Gain(TXDO
L]HU+LJK*DLQ
'UUDDLDDQGH>9$/8(@NQRSRIGUXN>'(&@RI>,1&@RPGHZDDUGHYDQGH
SDUDPHWHULQWHVWHOOHQ
■ Equalizer-parameters
■(4/)UHT(TXDOL]HU/RZ)UHTXHQF\
200+]
■(4/*DLQ(TXDOL]HU/RZ*DLQ
²0²G%
■(4+)UHT(TXDOL]HU+LJK)UHTXHQF\
3N+]
'H]HSDUDPHWHUVVWHOOHQGHDIVQLMIUHTXHQWLHVLQYDQKHWEHUHLNGDWGRRUGHHTXDOL]HU
ZRUGWYHUJURRWRIDIJHVQHGHQ
■(4+*DLQ(TXDOL]HU+LJK*DLQ
²0²G%
%HSDDOWKRHYHHOHUZRUGWYHUJURRWRIDIJHVQHGHQJDLQYRRUGHKRJHIUHTXHQWLHHQ
GHODJHIUHTXHQWLHORZ3RVLWLHYHLQVWHOOLQJHQYHUJURWHQQHJDWLHYHLQVWHOOLQJHQ
VQLMGHQDI
86
'HLQVWHOOLQJHQYDQGH
(TXDOL]HU*DLQ]LMQ
JHPHHQVFKDSSHOLMNYRRU
DOOH3DUWV=LMNXQQHQQLHW
RQDIKDQNHOLMNLQJHVWHOG
ZRUGHQYRRULQGLYLGXHOH
3DUWV
0HWHHQJDLQLQVWHOOLQJYDQ
KHHIWGHHTXDOL]HUJHHQ
HIIHFW
Systeemeffecten gebruiken
2PKHWVRRUW(TXDOL]HU/RZ*DLQDDQWHSDVVHQPHWEHKXOSYDQ0,',FRPPDQGR·V
PRHWXKHWYROJHQGH6\VWHP([FOXVLYHFRPPDQGRYHUVWXUHQ
ILJDH
address
data checksum
=LHRRNMIDI Implementation(QJHOVWDOLJH
KDQGOHLGLQJS
F0 41 10 42 12 [ 40 02 01 ] [ ] [ ] F7
$GGUHVV
(4/2:*$,1
'DWD
+²40H²&+²“²G%
&KHFNVXP =LHHet controletotaal berekenenS
<Voorbeeld> De Equalizer Low Gain op +6 instellen
9HU]HQGKHWYROJHQGH6\VWHP([FOXVLYHFRPPDQGR
ILJEH
address
data checksum
F0 41 10 42 12 [ 40 02 01 ] [ 46 ] [ 77 ] F7
EQ LOW GAIN
checksum
±0=40 ➟ +6=46
87
Invoegeffecten gebruiken
Instellen van het soort van invoegeffect,
de diepte (level) en andere parameters
1
2
=RUJHUYRRUGDWKHWPart Basic-schermJHVHOHFWHHUGLVHQJHEUXLNPART
>
@RI>
@RPGHSDUWWHVHOHFWHUHQZDDURSXHHQLQYRHJHIIHFWZLOWRH
SDVVHQ
+RHZHOLQYRHJHIIHFWHQQLHWYRRUKHWLQVWUXPHQWZRUGHQEHSDDOGPDDUZHO
YRRUGHSDUWLVKHWQXWWLJRPWRFKHHUVWKHWLQVWUXPHQWWHVHOHFWHUHQ
@RIINST>
@
ZDDURSKHWHIIHFW]DOZRUGHQWRHJHSDVW'UXNVAR.>
RPGHFXUVRUQDDUVAR.RIINSTWHYHUSODDWVHQHQGUDDLGDDUQDDDQGH
>9$/8(@NQRSRIGUXN>'(&@RI>,1&@RPKHWLQVWUXPHQWWHVHOHFWHUHQ
ZDDUDDQXKHWHIIHFWZLOWRHYRHJHQ
3
'UXN>())(&76@RPGLWDDQWH]HWWHQ
4
'UXN>→@>)@RPGRRUKHWVFKHUPWHORSHQHQGUXN>();@>)@
'HHHUVWHOLMQPHWSDUDPHWHUVGXLGWKHWVRRUWLQYRHJHIIHFWDDQ$OVXGLWYHUDQGHUW
GDQ]XOOHQGHSDUDPHWHUVYDQGDWHIIHFWLQJHVWHOGZRUGHQRSGHPHHVWJHVFKLNWH
ZDDUHQ8NDQHONYDQGH]HSDUDPHWHUV]HOIYHUDQGHUHQ
5
6
3DUW%DVLFVFKHUPS
9RRUGHWDLOVRYHUHIIHFW
W\SHVHQHIIHFWSDUDPHWHUV
]LHS
'UDDLDDQGH>9$/8(@NQRSRIGUXN>'(&@RI>,1&@RPKHWVRRUWHIIHFWWH
VHOHFWHUHQ
'UXNVAR.>
@RIINST>
@RPGHFXUVRURPKRRJRIRPODDJWHEHZHJHQ
HQVHOHFWHHUGHSDUDPHWHUGLHXZLOYHUDQGHUHQ
ILJ
7
'UDDLDDQGH>9$/8(@NQRSRIGUXN>'(&@RI>,1&@RPGHZDDGHYDQGH
SDUDPHWHULQWHVWHOOHQ
1DDVWGHHIIHFWSDUDPHWHUV]LMQHUSDUDPHWHUVGLHKHWNODQNQLYHDXLQVWHOOHQGDWQDGH
LQYRHJHIIHFWHQELMHONV\VWHHPHIIHFWNRPW$OVXGH]HSDUDPHWHUVZLOLQVWHOOHQPRHW
XGH]HOIGHSURFHGXUHYROJHQGLHKLHUERYHQEHVFKUHYHQZHUG
8
88
'UXN>(;,7@RPGHSURFHGXUHWHEHsLQGLJHQDOVXNODDUEHQWPHWKHWPDNHQ
YDQLQVWHOOLQJHQ
+HWJHOXLGLVQLHWRQPLG
GHOOLMNKRRUEDDUQDGDWXKHW
LQYRHJHIIHFWKHEWWRHJH
SDVW:DQQHHUX00 : Thru
NLHVWZRUGWKHWLQYRHJ
HIIHFWQLHWWRHJHSDVW
Invoegeffecten gebruiken
■ Invoegeffect-parameters en hun functies
■EFX Type (Effect Type)
0²
.LHVKHWVRRUWLQYRHJHIIHFW
=LHSYRRUPHHUGHWDLOVRYHUGHVRRUWHQHIIHFWHQ
■EFX Parameter (Effect Parameter)
$OVXKHW();W\SHYHUDQGHUWZRUGHQGHSDUDPHWHUVYDQGDWHIIHFWJHWRRQG
=LHSYRRUPHHUGHWDLOVRYHUGHHIIHFWSDUDPHWHUV
■EFX To Rev
²40²
3DVWKHW]HQGQLYHDXDDQYDQGHNODQNGLHQDKHWLQYRHJHIIHFWELMGHUHYHUENRPW
■ EFX To Cho
0²
3DVWKHW]HQGQLYHDXDDQYDQGHNODQNGLHQDKHWLQYRHJHIIHFWELMGHFKRUXVNRPW
■ EFX To Dly
0²
3DVWKHW]HQGQLYHDXDDQYDQGHNODQNGLHQDKHWLQYRHJHIIHFWELMGHGHOD\NRPW
Invoegeffecten aan/uitzetten
1DGDWXGHLQVWHOOLQJHQYDQGHLQYRHJHIIHFWHQKHHIWJHPDDNWPRHWXHONHSDUWDFWL
YHUHQRPGHHIIHFWHQWHNXQQHQJHEUXLNHQ
1
2
=RUJHUYRRUGDWKHWPart Basic-schermJHVHOHFWHHUGLVHQJHEUXLNPART
>
@RI>
@RPGHSDUWWHVHOHFWHUHQ
3DUW%DVLFVFKHUPS
'UXN>(',7@WHVWDUWHQ
+HWHGLWLQJVFKHUPYHUVFKLMQW
ILJJ
3
'UXN>())(&7@>)@
4
'UXNVAR.>
5
@RIINST>
@RPGHFXUVRUQDDUEFXWHYHUSODDWVHQ
'UDDLDDQGH>9$/8(@NQRSRIGUXN>'(&@RI>,1&@RPGHLQYRHJHIIHFWHQ
$$18,7WH]HWWHQ
1DGDWXGHZDDUGHLQVWDS
KHEWLQJHVWHOGNDQX
WHJHOLMNHUWLMGRS>'(&@HQ
>,1&@GUXNNHQRPGH
PRPHQWHHOJHWRRQGH
SDUDPHWHUZDDUGHWH
YHU]HQGHQS
89
Invoegeffecten gebruiken
6
'UXN>(;,7@RPGHSURFHGXUHWHEHsLQGLJHQDOVXNODDUEHQWPHWKHWPDNHQ
YDQLQVWHOOLQJHQ
'HZLWWHFLUNHOQDDVWGHEFXLQGLFDWLHRSKHWSDQHHOZRUGW]ZDUWJHNOHXUG
ILJK
■ Shortcut-toetsen
0HQNDQGH>6+,)7@NQRSJHEUXLNHQRPHHQHIIHFWRSHHQYRXGLJHZLM]HDDQXLWWH
]HWWHQ
1
2
*HEUXLNPART>
HUHQ
@RI>
@LQKHWPart Basic-schermRPGHSDUWWHVHOHFW
'UXN>())(&76@WHUZLMOX>6+,)7@LQJHGUXNWKRXGW
Pan-instellingen wanneer men invoegeffecten gebruikt
2IGHSDQLQVWHOOLQJDOGDQQLHW]DOZRUGHQWRHJHSDVWLVDIKDQNHOLMNYDQKHWIHLWRI
KHWLQYRHJHIIHFWVWHUHRRIPRQRLV
$OVHHQPRQRLQYRHJHIIHFWZRUGWDDQJH]HWZRUGHQGHLQVWHOOLQJHQYDQ3DUW3DQ
SHQ0DVWHU3DQSJHQHJHHUG
9RRUEHHOGYDQPRQRLQYRHJHIIHFWHQ!
6SHFWUXP2' →&KRUXVHWF
,QKHWJHYDOYDQVWHUHRLQYRHJHIIHFWHQ]XOOHQGHLQVWHOOLQJHQYDQ3DUW3DQSHQ
0DVWHU3DQSHFKWHUZHOZHUNHQZDQQHHUKHWLQYRHJHIIHFWDDQVWDDW
9RRUEHHOGYDQVWHUHRLQYRHJHIIHFWHQ!
6WHUHR(4+H[D&KRUXVHWF
+HWGLDJUDPYDQHONHIIHFWWRRQWRIKHWLQYRHJHIIHFWPRQRRIVWHUHRLV(IIHFWHQGLH
DI]RQGHUOLMNHVLJQDDOSDGHQKHEEHQYDQLQJDQJQDDUXLWJDQJYDQOLQNVQDDUUHFKWV
]LMQVWHUHR'HJHQHGLHGDWQLHWKHEEHQ]LMQPRQR
Systeemeffectinstellingen wanneer men invoegeffecten gebruikt
$OVKHWLQYRHJHIIHFWYRRUPHHUGDQWZHHSDUWVDDQVWDDW]DOGHNODQNYDQHONHSDUW
ZRUGHQYHUPHQJGHQ]XOOHQGHJHZRQHLQVWHOOLQJHQRSGH]HSDUWVZRUGHQWRHJH
SDVW+HWLVQLHWPRJHOLMNRPUHYHUEFKRUXVGHOD\HTXDOL]HUYRRUGH]HSDUWVDI
]RQGHUOLMNLQWHVWHOOHQ]LHGHJHJHYHQVRSS
%LMSDUWVZDDUYDQKHWLQYRHJHIIHFWXLWVWDDWNDQPHQYRRUHONHSDUWDI]RQGHUOLMN
V\VWHHPHIIHFWLQVWHOOLQJHQPDNHQ
90
6\VWHHPHIIHFWLQVWHOOLQJHQ
NXQQHQQLHWRQDIKDQNHOLMN
JHPDDNWZRUGHQYRRUHHQ
SDUWGLHHHQLQYRHJHIIHFW
JHEUXLNW$OVHUHHQ
V\VWHHPHIIHFWWRHJHSDVW
ZRUGWGDQLVKHWOHYHO
JHPHHQVFKDSSHOLMNYRRU
DOOHSDUWVZDDUYRRUHUHHQ
LQYRHJHIIHFWLVJHDFWLYHHUG
HQNDQKHWQLHWRQDIKDQ
NHOLMNLQJHVWHOGZRUGHQ
YRRULQGLYLGXHOHSDUWV
Invoegeffecten gebruiken
Soorten invoegeffecten
(IIHFWVRRUWHQNXQQHQLQGHYROJHQGHUXLPHFDWHJRULHsQ
ZRUGHQRQGHUYHUGHHOG
(IIHFWHQGLHGHWRRQNOHXUYHUDQGHUHQ ILOWHUW\SH
²
(IIHFWHQGLHGHNODQNYHUYRUPHQ GLVWRUWLRQW\SH
²
(IIHFWHQGLHGHNODQNPRGXOHUHQ
PRGXODWLRQW\SH
²
(IIHFWHQGLHKHWQLYHDXEHwQYORHGHQFRPSUHVVRUW\SH²
(IIHFWHQGLHNODQNEUHGHUPDNHQ
FKRUXVW\SH
²
(IIHFWHQGLHNODQNZHHUJDOPHQ
GHOD\UHYHUEW\SH
²
(IIHFWHQGLHGHWRRQKRRJWHYHUDQGHUHQSLWFKVKLIWW\SH
²
$QGHUH
²
(IIHFWHQGLHWZHHVRRUWHQHIIHFWHQVHULHHOYHUELQGHQ
VHULHV
²
(IIHFWHQGLHPHHUGDQGULHVRRUWHQHIIHFWHQVHULHHOYHUELQGHQ
VHULHVVHULHVVHULHV
²
(IIHFWHQGLHWZHHVRRUWHQHIIHFWHQSDUDOOHOYHUELQGHQ
SDUDOOHO
²
,QGHKLHUQDYROJHQGHYHUGXLGHOLMNLQJZRUGHQGHKH[DGH
FLPDOHZDDUGHQGLHJHEUXLNWZHUGHQYRRUKHWPDNHQYDQGH
LQVWHOOLQJHQDDQKHWHLQGHYDQGHHIIHFWW\SHOLMQJHJHYHQ+HW
SDUDPHWHUQXPPHUZRUGWLQGHFLPDOHQJHJHYHQDDQKHW
HLQGHYDQGH(IIHFWSDUDPHWHUOLMQ+DQWHHUGH]HZDDUGHQ
ZDQQHHUX0,',FRPPDQGR·VJHEUXLNWRPSDUDPHWHUVLQWH
VWHOOHQ=LHSYRRUPHHUGHWDLOVRYHUKHWJHEUXLNYDQ
([FOXVLYHFRPPDQGR·V
%LMYRRUEHHOGLQGLHQXKHWHIIHFWW\SHRS6WHUHR(4VWHUHR
HTXDOL]HUZLOLQVWHOOHQHQGH/RZ)UHTODJHIUHTXHQWLHRS
ZLO]HWWHQPRHWXKHWYROJHQGH([FOXVLYHFRPPDQGR
YHUVWXUHQ
1. 6WHOKHWHIIHFWW\SHLQRS6WHUHR(4
fig.stereoEQ
F0 41 10 42 12 40 03 00 01 00 3C F7
adres
voor EFX
Waardeset voor
Stereo EQ
2. 6HOHFWHHUGH/RZ)UHT
fig.lowFreq
F0 41 10 42 12 40 03 03 01 39 F7
adres dat
overeenstemt met [1]
Te selecteren
waarde: +400
=LHGH(IIHFWHQOLMVWRSRQSDJLQDYRRUGHRYHUHHQNRPVWYDQGH
SDUDPHWHUHQGHZDDUGH
=LHSDJLQDYRRUGHRYHUHHQNRPVWYDQKHWSDUDPHWHUQXPPHUHQKHW
DGUHV
%LMSDUDPHWHUVPHW+RI#V\PEROHQLVKHWPRJHOLMNKXQZDDUGHQWH
YHUDQGHUHQPHWEHKXOSYDQHHQEHSDDOGHFRQWUROOHU]RDOVGHSLWFKEHQG
KHQGHOHQGHVFKXLYHQRIGRRUPLGGHOYDQFRQWUROFRPPDQGR·V'H
HIIHFWSDUDPHWHUVYHUDQGHUHQPHWFRQWUROOHUVS
9RRUEHHOG!
01: Stereo-EQ
[01H, 00H]
'LWEHWHNHQWGDWGHZDDUGHYDQ$GGUHVVGLHRYHUHHQNRPW
PHW();+++JHOLMNLVDDQ06%+/6%+
Low Freq
200/400 [1 (40 03 03)]
[1]EHVFKULMIWGDWGLWGHHHUVWHSDUDPHWHULV
(40 03 03)EHVFKULMIWGDWKHWKHWSDUDPHWHUDGUHVLVYRRU>@
91
Invoegeffecten gebruiken
00: Thru
[00H, 00H]
(UZRUGWJHHQHIIHFWWRHJHSDVW:DQQHHUHHQ*06\VWHP2Q
RI*65HVHWFRPPDQGRSRQWYDQJHQZRUGW]DO7KUX
DOVLQYRHJHIIHFWZRUGHQJHVHOHFWHHUG
Effecten die de toonkleur veranderen (filter type)
01: Stereo-EQ (Stereo Equalizer)
[01H, 00H]
'LWLVHHQYLHUEDQGVVWHUHRHTXDOL]HUODDJPLGGHQ[
KRRJ
fig.9-1
02: Spectrum
[01H, 01H]
6SHFWUXPLVHHQVRRUWILOWHUGLHKHWWLPEUHYHUDQGHUWGRRUKHW
QLYHDXRSVSHFLILHNHIUHTXHQWLHVWHYHUJURWHQRIDIWHVQLMGHQ
+HWZHUNWDOVHHQHTXDOL]HUPDDUKHHIWIUHTXHQWLHSXQWHQ
GLHYDVWOLJJHQRSSODDWVHQGLHKHWPHHVWJHVFKLNW]LMQRP
NDUDNWHUDDQHHQNODQNWRHWHYRHJHQ
fig.9-2
L
Spectrum
Pan
R
L
EQ
Band 1 (Band 1 Gain)
3DVWKHW+]QLYHDXDDQ
-12–+12 [1 (40 03 03)]
R
EQ
Band 2 (Band 2 Gain)
3DVWKHW+]QLYHDXDDQ
-12–+12 [2 (40 03 04)]
Low Freq (Low Frequency)
200/400 [1 (40 03 03)]
6HOHFWHHUWGHIUHTXHQWLHYDQKHWODJHEHUHLN+]+]
Band 3 (Band 3 Gain)
3DVWKHW+]QLYHDXDDQ
-12–+12 [3 (40 03 05)]
Low Gain
-12–+12 [2 (40 03 04)]
3DVWGHJDLQYDQGHODJHIUHTXHQWLHDDQ
Band 4 (Band 4 Gain)
3DVWKHW+]QLYHDXDDQ
-12–+12 [4 (40 03 06)]
Hi Freq (High Frequency)
4k/8k [3 (40 03 05)]
6HOHFWHHUWGHIUHTXHQWLHYDQKHWKRJHEHUHLNN+]N+]
Band 5 (Band 5 Gain)
3DVWKHW+]QLYHDXDDQ
-12–+12 [5 (40 03 07)]
Hi Gain
-12–+12 [4 (40 03 06)]
3DVWGHJDLQYDQGHKRJHIUHTXHQWLHDDQ
Band 6 (Band 6 Gain)
3DVWKHW+]QLYHDXDDQ
-12–+12 [6 (40 03 08)]
M1 Freq (Mid 1 Frequency)
200–6.3k [5 (40 03 07)]
3DVWGHIUHTXHQWLHYDQ0LGPLGEHUHLNDDQ
Band 7 (Band 7 Gain)
3DVWKHW+]QLYHDXDDQ
-12–+12 [7 (40 03 09)]
M1 Q (Mid 1 Q)
0.5/1.0/2.0/4.0/9.0 [6 (40 03 08)]
'H]HSDUDPHWHUSDVWGHEUHHGWHDDQYDQKHWJHELHGURQGGH
0)UHTSDUDPHWHUGDWGRRUGHLQVWHOOLQJYDQGHJDLQ
ZRUGWEHwQYORHG+RJHUH4ZDDUGHQPDNHQKHWEHwQYORHGH
JHELHGVPDOOHU
Band 8 (Band 8 Gain)
3DVWKHW+]QLYHDXDDQ
-12–+12 [8 (40 03 0A)]
Width (Band Width)
0.5/1.0/2.0/4.0/9.0 [9 (40 03 0B)]
3DVWGHEUHHGWHYDQGHIUHTXHQWLHEDQGHQDDQZDDUYDQGH
JDLQYHUDQGHUGZHUGJHOLMNYRRUDOOHEDQGHQ+RJHUH
LQVWHOOLQJHQPDNHQGHIUHTXHQWLHEDQGVPDOOHU
M1 Gain (Mid 1 Gain)
-12–+12 [7 (40 03 09)]
3DVWGHJDLQDDQYRRUKHWJHELHGGDWJHVSHFLILHHUGZRUGW
GRRUGH0)UHTSDUDPHWHUHQGHLQVWHOOLQJHQYDQGH04
SDUDPHWHU
+Pan (Output Pan)
L63–0–R63 [19 (40 03 15)]
3DVWGHVWHUHRSRVLWLHDDQYDQGHXLWJDDQGHNODQN/LV
XLWHUVWOLQNVLVKHWPLGGHQHQ5LVXLWHUVWUHFKWV
M2 Freq (Mid 2 Frequency)
200–6.3k [8 (40 03 0A)]
3DVWGHIUHTXHQWLHYDQ0LGPLGEHUHLN
#Level (Output Level)
3DVWKHWXLWJDQJVQLYHDXDDQ
M2 Q (Mid 2 Q)
0.5/1.0/2.0/4.0/9.0 [9 (40 03 0B)]
'H]HSDUDPHWHUSDVWGHEUHHGWHDDQYDQKHWJHELHGURQGGH
0)UHTSDUDPHWHUGDWGRRUGHLQVWHOOLQJYDQGHJDLQ
ZRUGWEHwQYORHG+RJHUH4ZDDUGHQPDNHQKHWEHwQYORHGH
JHELHGVPDOOHU
M2 Gain (Mid 2 Gain)
-12–+12 [10 (40 03 0C)]
3DVWGHJDLQDDQYRRUKHWJHELHGGDWJHVSHFLILHHUGZRUGW
GRRUGH0)UHTSDUDPHWHUHQGHLQVWHOOLQJHQYDQGH04
SDUDPHWHU
+Level (Output Level)
3DVWKHWXLWJDQJVQLYHDXDDQ
92
0–127 [20 (40 03 16)]
0–127 [20 (40 03 16)]
Invoegeffecten gebruiken
03: Enhancer
[01H, 02H]
'H(QKDQFHUFRQWUROHHUWGHRYHUWRRQVWUXFWXXUYDQGHKRJH
IUHTXHQWLHVHQPDDNWGHNODQNVSUDQNHOHQGHQGLFKW
fig.9-3
L
EQ
Enhancer
R
Effecten die de klank vervormen (distortion type)
05: Overdrive
[01H, 10H]
'LWHIIHFWFUHsHUWHHQ]DFKWHYHUYRUPLQJYHUJHOLMNEDDUPHW
KHWJHOXLGYDQEXLVYHUVWHUNHUV
fig.9-5
L
Mix
Over
drive
Enhancer
EQ
Amp
Simulator
EQ
Pan
R
+Sens (Sensitivity)
0–127 [1 (40 03 03)]
3DVWGHJHYRHOLJKHLGYDQGHHQKDQFHUDDQ
#Mix (Mix Level)
0–127 [2 (40 03 04)]
3DVWGHYHUKRXGLQJDDQZDDULQGHRYHUWRQHQGLHGRRUGH
HQKDQFHUJHJHQHUHHUGZRUGHQPHWGHGLUHFWHNODQNZRUGHQ
JHFRPELQHHUG
Low Gain
-12–+12 [17 (40 03 13)]
3DVWGHJDLQYDQGHODJHIUHTXHQWLHDDQ
Hi Gain (High Gain)
-12–+12 [18 (40 03 14)]
3DVWGHJDLQYDQGHKRJHIUHTXHQWLHDDQ
Level (Output Level)
3DVWKHWXLWJDQJVQLYHDXDDQ
0–127 [20 (40 03 16)]
04: Humanizer
[01H, 03H]
*HHIWGHNODQNHHQYRFDDONDUDNWHUZDDUGRRUGH]HRSHHQ
PHQVHOLMNHVWHPJDDWOLMNHQ
fig.9-4
L
Humanizer
EQ
Pan
R
Drive
0–127 [1 (40 03 03)]
3DVWGHGLHSWHYDQGHYHUYRUPLQJDDQ
Drive Sw (Drive Switch)
=HW'ULYHDDQXLW
+Vowel
6HOHFWHHUWGHVWHP
Off/On [2 (40 03 04)]
Amp Type (Amp Simulator Type)
Small/BltIn/2-Stk/3-Stk [2 (40 03 04)]
6HOHFWHHUKHWW\SHJLWDDUYHUVWHUNHU
6PDOO NOHLQHYHUVWHUNHU
%OW,Q YHUVWHUNHUYDQHHQHQNHOHHHQKHLG
6WN JURWHGXEEHOJHVWDSHOGHYHUVWHUNHU
6WN JURWHGULHGXEEHOJHVWDSHOGHYHUVWHUNHU
Amp Sw (Amp Switch)
=HWKHW$PS7\SHDDQXLW
Off/On [3 (40 03 05)]
Low Gain
-12–+12 [17 (40 03 13)]
3DVWGHJDLQYDQGHODJHIUHTXHQWLHDDQ
Hi Gain (High Gain)
-12–+12 [18 (40 03 14)]
3DVWGHJDLQYDQGHKRJHIUHTXHQWLHDDQ
#Pan (Output Pan)
L63–0–R63 [19 (40 03 15)]
3DVWGHVWHUHRSRVLWLHDDQYDQGHXLWJDDQGHNODQN/LV
XLWHUVWOLQNVLVKHWPLGGHQHQ5LVXLWHUVWUHFKWV
Level (Output Level)
3DVWKHWXLWJDQJVQLYHDXDDQ
0–127 [20 (40 03 16)]
06: Distortion
[01H, 11H]
'LWHIIHFWJHHIWHHQLQWHQVHUHYHUYRUPLQJGDQ2YHUGULYH
fig.9-6
a/i/u/e/o [3 (40 03 05)]
L
Distortion
Accel
0–15 [4 (40 03 06)]
3DVWGHWLMGDDQZDDULQGHNODQNQDDUGHJHVSHFLILHHUGH
9RZHOZRUGWYHUSODDWVW.OHLQHUHZDDUGHQKHEEHQPHHUWLMG
QRGLJ
Low Gain
-12–+12 [17 (40 03 13)]
3DVWGHJDLQYDQGHODJHIUHTXHQWLHDDQ
Hi Gain (High Gain)
-12–+12 [18 (40 03 14)]
3DVWGHJDLQYDQGHKRJHIUHTXHQWLH
Pan (Output Pan)
L63–0–R63 [19 (40 03 15)]
3DVWGHVWHUHRSRVLWLHDDQYDQGHXLWJDDQGHNODQN/LV
XLWHUVWOLQNVLVKHWPLGGHQHQ5LVXLWHUVWUHFKWV
#Level (Output Level)
3DVWKHWXLWJDQJVQLYHDXDDQ
+Drive
0–127 [1 (40 03 03)]
3DVWGHJUDDGYDQGHYHUYRUPLQJDDQ
Amp
Simulator
EQ
Pan
R
+Drive
0–127 [1 (40 03 03)]
3DVWGHGLHSWHYDQGHYHUYRUPLQJDDQ
Amp Type (Amp Simulator Type)
Small/BltIn/2-Stk/3-Stk [2 (40 03 04)]
6HOHFWHHUKHWW\SHYDQJLWDDUYHUVWHUNHU
6PDOO NOHLQHYHUVWHUNHU
%OW,Q YHUVWHUNHUYDQHHQHQNHOHHHQKHLG
6WN JURWHGXEEHOJHVWDSHOGHYHUVWHUNHU
6WN JURWHGULHGXEEHOJHVWDSHOGHYHUVWHUNHU
0–127 [20 (40 03 16)]
93
Invoegeffecten gebruiken
Amp Sw (Amp Switch)
=HWKHW$PS7\SHDDQXLW
Off/On [3 (40 03 05)]
Low Gain
-12–+12 [17 (40 03 13)]
3DVWGHJDLQYDQGHODJHIUHTXHQWLHDDQ
Hi Gain (High Gain)
-12–+12 [18 (40 03 14)]
3DVWGHJDLQYDQGHKRJHIUHTXHQWLHDDQ
#Pan (Output Pan)
L63–0–R63 [19 (40 03 15)]
3DVWGHVWHUHRSRVLWLHDDQYDQGHXLWJDDQGHNODQN/LV
XLWHUVWOLQNVLVKHWPLGGHQHQ5LVXLWHUVWUHFKWV
Level (Output Level)
3DVWKHWXLWJDQJVQLYHDXDDQ
0–127 [20 (40 03 16)]
Effecten die de klank moduleren (modulation type)
07: Phaser
[01H, 20H]
(HQSKDVHUYRHJWNODQNGLHLQIDVHQLVYHUVFKRYHQWRHDDQGH
RULJLQHOHNODQNZDDUGRRUHHQJHGUDDLGHPRGXODWLHZRUGW
JHSURGXFHHUGGLHUXLPWHOLMNKHLGHQGLHSWHFUHsHUW
fig.9-7
L
R
Phaser
Phaser
EQ
EQ
+Manual
100–8.0k [1 (40 03 03)]
3DVWGHEDVLVIUHTXHQWLHDDQYDQZDDUXLWGHNODQNJHPRGX
OHHUGZRUGW
#Rate
0.05–10.0 [2 (40 03 04)]
3DVWGHIUHTXHQWLHSHULRGHYDQGHPRGXODWLHDDQ
Depth
0–127 [3 (40 03 05)]
3DVWGHGLHSWHYDQGHPRGXODWLHDDQ
08: Auto Wah
[01H, 21H]
'H$XWR:DKFRQWUROHHUWRSF\FOLVFKHZLM]HHHQILOWHURP
F\FOLVFKHWLPEUHYHUDQGHULQJHQWHFUHsUHQ
fig.9-8
L
Wah
EQ
Pan
R
Fil Type (Filter Type)
LPF/BPF [1 (40 03 03)]
6HOHFWHHUWKHWVRRUWILOWHU
/3) +HWZDKHIIHFWZRUGWWRHJHSDVWRYHUHHQEUHHG
IUHTXHQWLHEHUHLN
%3) +HWZDKHIIHFWZRUGWWRHJHSDVWRYHUHHQVPDO
IUHTXHQWLHEHUHLN
Sens (Sensitivity)
0–127 [2 (40 03 04)]
3DVWGHJHYRHOLJHKLGDDQZDDUPHHGHILOWHUJHFRQWUROHHUG
ZRUGW$OVGH]HZDDUGHZRUGWYHUKRRJWGDQ]DOGHILOWHU
IUHTXHQWLHJHPDNNHOLMNHUYHUDQGHUHQDOVUHDFWLHRSKHW
LQJDQJVQLYHDX
+Manual
0–127 [3 (40 03 05)]
3DVWGHPLGGHQIUHTXHQWLHDDQYDQZDDUXLWKHWHIIHFWZRUGW
WRHJHSDVW
Peak
0–127 [4 (40 03 06)]
3DVWGHKRHYHHOKHLGZDKHIIHFWDDQGDWLQKHWJHELHGYDQGH
PLGGHQIUHTXHQWLH]DOYRRUNRPHQ0HWODJHUHLQVWHOOLQJHQ
ZRUGWKHWHIIHFWWRHJHSDVWLQHHQEUHHGJHELHGURQGGH
PLGGHQIUHTXHQWLH0HWKRJHUHLQVWHOOLQJHQZRUGWKHWHIIHFW
LQHHQVPDOOHUJHELHGWRHJHSDVW,QJHYDOYDQ/3)]DOKHW
ZDKHIIHFWPLQGHUYHUDQGHUHQZDQQHHUPHQGHZDDUGH
YHUODDJW
Reso (Resonance)
0–127 [4 (40 03 06)]
3DVWGHKRHYHHOKHLGNOHPWRRQDDQGLHDDQKHWIUHTXHQWLH
EHUHLNZRUGWWRHJHYRHJGGLHGHEDVLVIUHTXHQWLHRPULQJWHQ
GRRUGH0DQXDOSDUDPHWHULQVWHOOLQJLVEHSDDOG
#Rate
0.05–10.0 [5 (40 03 07)]
3DVWGHVQHOKHLGYDQGHPRGXODWLHDDQ
Mix (Mix Level)
0–127 [5 (40 03 07)]
3DVWGHYHUKRXGLQJDDQZDDULQGHLQIDVHQYHUVFKRYHQ
NODQNPHWGHGLUHFWHNODQNJHFRPELQHHUGZRUGW
Polarity
Down/Up [7 (40 03 09)]
6WHOWGHULFKWLQJLQZDDULQGHIUHTXHQWLH]DOYHUDQGHUHQ
ZDQQHHUGHILOWHUJHPRGXOHHUGZRUGW0HWHHQLQVWHOOLQJRS
8S]DOGHILOWHUQDDUGHKRJHUHIUHTXHQWLHYHUDQGHUHQ0HW
HHQLQVWHOOLQJRS'RZQ]DOGHILOWHUQDDUHHQODJHUH
IUHTXHQWLHYHUDQGHUHQ
Low Gain
-12–+12 [17 (40 03 13)]
3DVWGHJDLQYDQGHODJHIUHTXHQWLHDDQ
Hi Gain (High Gain)
-12–+12 [18 (40 03 14)]
3DVWGHJDLQYDQGHKRJHIUHTXHQWLHDDQ
Level (Output Level)
3DVWKHWXLWJDQJVQLYHDXDDQ
0–127 [20 (40 03 16)]
Depth
0–127 [6 (40 03 08)]
3DVWGHGLHSWHYDQGHPRGXODWLHDDQ
Low Gain
-12–+12 [17 (40 03 13)]
3DVWGHJDLQYDQGHODJHIUHTXHQWLHDDQYRRU(4
Hi Gain (High Gain)
-12–+12 [18 (40 03 14)]
3DVWGHJDLQYDQGHKRJHIUHTXHQWLHDDQYRRU(4
Pan (Output Pan)
L63–0–R63 [19 (40 03 15)]
3DVWGHVWHUHRSRVLWLHDDQYDQGHXLWJDDQGHNODQN/LV
XLWHUVWOLQNVLVKHWPLGGHQHQ5LVXLWHUVWUHFKWV
Level (Output Level)
3DVWKHWXLWJDQJVQLYHDXDDQ
94
0–127 [20 (40 03 16)]
Invoegeffecten gebruiken
09: Rotary
[01H, 22H]
+HW5RWDU\HIIHFWVLPXOHHUWGHNODQNYDQNODVVLHNHURWHUHQGH
OXLGVSUHNHUV$DQJH]LHQGHEHZHJLQJYDQGHKRJHHQODJH
EHUHLNURWRUVDI]RQGHUOLMNNDQZRUGHQLQJHVWHOGNXQQHQGH
XQLHNHPRGXODWLHHLJHQVFKDSSHQYDQGH]HOXLGVSUHNHUVHUJ
EHWURXZEDDUZRUGHQQDJHERRWVW'LWHIIHFWLVKHWPHHVW
JHVFKLNWYRRUHHQHOHNWULVFKRUJHO
fig.9-9
L
EQ
Rotary
R
EQ
Low Slow (Low Frequency Slow Rate)
0.05–10.0 [1 (40 03 03)]
3DVWGHODJHVQHOKHLGDDQYDQGHODJHIUHTXHQWLHURWRU
Low Fast (Low Frequency Fast Rate)
0.05–10.0 [2 (40 03 04)]
3DVWGHKRJHVQHOKHLGDDQYDQGHODJHIUHTXHQWLHURWRU
Low Accl (Low Frequency Acceleration)
0–15 [3 (40 03 05)]
3DVWGHWLMGDDQGLHGHODJHIUHTXHQWLHURWRUQRGLJKHHIWRP
GH]RSDVJHVHOHFWHHUGHVQHOKHLGWHEHUHLNHQZDQQHHUPHQ
YDQVQHOQDDUODQJ]DDPRIYDQODQJ]DDPQDDUVQHOJDDW
/DJHUHZDDUGHQYHUJHQPHHUWLMG
Hi Gain (High Gain)
-12–+12 [18 (40 03 14)]
3DVWGHJDLQYDQGHKRJHIUHTXHQWLHDDQYRRU(4
Level (Output Level)
3DVWKHWXLWJDQJVQLYHDXDDQ
0–127 [20 (40 03 16)]
10: Stereo Flanger
[01H, 23H]
'LWLVHHQVWHUHRIODQJHUHQSURGXFHHUWHHQPHWDDODFKWLJH
UHVRQDQWLHGLHVWLMJWHQGDDOWQHWDOVHHQVWUDDOYOLHJWXLJGDW
RSVWLMJWRIODQGW(ULVHHQILOWHUYRRU]LHQ]RGDWXKHWWLPEUH
YDQGHIODQJHNODQNNDQDDQSDVVHQ
fig.9-10
L
EQ
Flanger
Flanger
R
Balance
EQ
Pre Filter (Pre Filter Type)
Off/LPF/HPF [1 (40 03 03)]
6HOHFWHHUWKHWVRRUWYDQILOWHU
2II
HUZRUGWJHHQILOWHUJHEUXLNW
/3)
VQLMGWKHWIUHTXHQWLHEHUHLNDIERYHQGH&XWRII
SDUDPHWHU
+3)
VQLMGWKHWIUHTXHQWLHEHUHLNDIRQGHUGH&XWRII
SDUDPHWHU
Low Level (Low Frequency Level) 0–127 [4 (40 03 06)]
3DVWKHWYROXPHDDQYDQGHODJHIUHTXHQWLHURWRU
Cutoff (Cutoff Frequency)
250–8k [2 (40 03 04)]
3DVWGHEDVLVIUHTXHQWLHYDQGHILOWHUDDQ
Hi Slow (High Frequency Slow Rate)
0.05–10.0 [5 (40 03 07)]
3DVWGHODJHVQHOKHLGDDQYDQGHKRJHIUHTXHQWLHURWRU
Pre Dly (Pre Delay Time)
0–100ms [3 (40 03 05)]
3DVWGHWLMGVSDQQHDDQYDQKHWPRPHQWGDWGHGLUHFWHNODQN
EHJLQWWRWPHQGHEHZHUNWHNODQNKRRUW
Hi Fast (High Frequency Fast Rate)
0.05–10.0 [6 (40 03 08)]
3DVWGHKRJHVQHOKHLGDDQYDQGHKRJHIUHTXHQWLHURWRU
+Rate
3DVWGHPRGXODWLHVQHOKHLGDDQ
Depth
3DVWGHPRGXODWLHGLHSWHDDQ
0.05–10.0 [4 (40 03 06)]
0–127 [5 (40 03 07)]
Hi Accl (High Frequency Acceleration) 0–15 [7 (40 03 09)]
3DVWGHWLMGDDQGLHGHKRJHIUHTXHQWLHURWRUQRGLJKHHIWRP
GH]RSDVJHVHOHFWHHUGHVQHOKHLGWHEHUHLNHQZDQQHHUPHQ
YDQVQHOQDDUODQJ]DDPRIYDQODQJ]DDPQDDUVQHOJDDW
/DJHUHZDDUGHQYHUJHQPHHUWLMG
#Feedback (Feedback Level)
-98%–+98% [6 (40 03 08)]
3DVWGHYHUKRXGLQJDDQGHYHUZHUNWHNODQNGLHQDDUGH
LQJDQJZRUGWWHUXJJHVWXXUG1HJDWLHYHLQVWHOOLQJHQ
GUDDLHQGHIDVHRP
Hi Level (High Frequency Level)
0–127 [8 (40 03 0A)]
3DVWKHWYROXPHDDQYDQGHKRJHIUHTXHQWLHURWRU
Phase
0–180 [7 (40 03 09)]
3DVWGHUXLPWHOLMNHVSUHLGLQJYDQGHNODQNDDQ
Separate (Separation)
0–127 [9 (40 03 0B)]
3DVWGHUXLPWHOLMNHYHUVSUHLGLQJYDQGHNODQNDDQ
Balance (Effect Balance)
D>0E–D0<E [16 (40 03 12)]
3DVWGHYROXPHEDODQVDDQWXVVHQGHGLUHFWHHQGH
YHUZHUNWHNODQN
´'µRI´(µLQGHGLVSOD\EHWHNHQWUHVSHFWLHYHOLMN'GLUHFWH
NODQNRI(HIIHFWNODQNZDDUGHQYDQ
+Speed
Slow/Fast [11 (40 03 0D)]
:LVVHOWWHJHOLMNHUWLMGGHGUDDLVQHOKHLGYDQGHODJH
IUHTXHQWLHHQGHKRJHIUHTXHQWLHURWRU
/DQJ]DDP9HUWUDDJWGHURWDWLHYDQGHJHVSHFLILHHUGH
VQHOKHLGGH/RZ6ORZSDUDPHWHU+L6ORZ
SDUDPHWHUZDDUGHQ
6QHO
9HUVQHOWGHURWDWLHYDQGHJHVSHFLILHHUGH
VQHOKHLGGH/RZ)DVWSDUDPHWHU+L)DVW
SDUDPHWHUZDDUGHQ
Low Gain
-12–+12 [17 (40 03 13)]
3DVWGHJDLQYDQGHODJHIUHTXHQWLHDDQ
Hi Gain (High Gain)
-12–+12 [18 (40 03 14)]
3DVWGHJDLQYDQGHKRJHIUHTXHQWLHDDQ
Level (Output Level)
3DVWKHWXLWJDQJVQLYHDXDDQ
0–127 [20 (40 03 16)]
Low Gain
-12–+12 [17 (40 03 13)]
3DVWGHJDLQYDQGHKRJHIUHTXHQWLHDDQYRRU(4
95
Invoegeffecten gebruiken
11: Step Flanger
[01H, 24H]
12: Tremolo
[01H, 25H]
'H6WHS)ODQJHULVHHQHIIHFWZDDUELMGHWRRQKRRJWHYDQGH
IODQJHULQVWDSSHQYHUDQGHUW
7UHPRORPRGXOHHUWKHWYROXPHF\FOLVFKHQJHHIWHHQ
WUHPRORHIIHFWDDQGHNODQN
fig.9-11
fig.9-12
L
EQ
L
Tremolo
EQ
EQ
R
Tremolo
EQ
Flanger
Flanger
R
Balance
Pre Dly (Pre Delay Time)
0–100ms [1 (40 03 03)]
3DVWGHWLMGVSDQQHDDQYDQKHWPRPHQWGDWGHGLUHFWHNODQN
EHJLQWWRWPHQGHEHZHUNWHNODQNKRRUW
Rate
3DVWGHPRGXODWLHVQHOKHLGDDQ
Depth
3DVWGHPRGXODWLHGLHSWHDDQ
0.05–10.0 [2 (40 03 04)]
0–127 [3 (40 03 05)]
+Feedback (Feedback Level)
-98%–+98% [4 (40 03 06)]
3DVWGHYHUKRXGLQJDDQYDQGHYHUZHUNWHNODQNGLH
QDDUGHLQJDQJZRUGWWHUXJJHVWXXUG1HJDWLHYHLQVWHOO
LQJHQGUDDLHQGHIDVHRP
Phase
0–180 [5 (40 03 07)]
3DVWGHUXLPWHOLMNHVSUHLGLQJYDQGHNODQNDDQ
Mod Wave (Modulation Wave)
Tri/Sqr/Sin/Saw1/Saw2 [1 (40 03 03)]
6HOHFWHHUWGHVRRUWPRGXODWLH
7UL
'HNODQNZRUGWJHPRGXOHHUGDOVHHQ
GULHKRHNVJROI
6TU
'HNODQNZRUGWJHPRGXOHHUGDOVHHQ
YLHUNDQWHJROI
6LQ
'HNODQNZRUGWJHPRGXOHHUGDOVHHQ
VLQXVJROI
6DZ 'HNODQNZRUGWJHPRGXOHHUGDOVHHQ
]DDJWDQGJROI'HtandenLQ6DZHQ6DZ
ZLM]HQLQYHUVFKLOOHQGHULFKWLQJHQ
fig.9-13
Saw1
Saw2
#Step Rate
0.05–10.0 [6 (40 03 08)]
3DVWGHVQHOKHLGSHULRGHYDQGHWRRQKRRJWHYHUDQGHULQJ
DDQ
Balance (Effect Balance)
D>0E–D0<E [16 (40 03 12)]
3DVWGHYROXPHEDODQVDDQWXVVHQGHGLUHFWHHQGH
YHUZHUNWHNODQN
´'µRI´(µLQGHGLVSOD\EHWHNHQWUHVSHFWLHYHOLMN'GLUHFWH
NODQNRI(HIIHFWNODQNZDDUGHQYDQ
Low Gain
-12–+12 [17 (40 03 13)]
3DVWGHJDLQYDQGHODJHIUHTXHQWLHDDQ
Hi Gain (High Gain)
-12–+12 [18 (40 03 14)]
3DVWGHJDLQYDQGHKRJHIUHTXHQWLHDDQ
Level (Output Level)
3DVWKHWXLWJDQJVQLYHDXDDQ
96
0–127 [20 (40 03 16)]
+Mod Rate (Modulation Rate)
3DVWGHPRGXODWLHVQHOKHLGDDQ
#Mod Depth (Modulation Depth)
3DVWGHPRGXODWLHGLHSWHDDQ
0.05–10.0 [2 (40 03 04)]
0–127 [3 (40 03 05)]
Low Gain
-12–+12 [17 (40 03 13)]
3DVWGHJDLQYDQGHODJHIUHTXHQWLHDDQ
Hi Gain (High Gain)
-12–+12 [18 (40 03 14)]
3DVWGHJDLQYDQGHKRJHIUHTXHQWLHDDQ
Level (Output Level)
3DVWKHWXLWJDQJVQLYHDXDDQ
0–127 [20 (40 03 16)]
Invoegeffecten gebruiken
13: Auto Pan
[01H, 26H]
+HW$XWR3DQHIIHFWJHHIWHHQF\FOFLVFKHPRGXODWLHYDQGH
VWHUHRSRVLWLHYDQGHNODQN
fig.9-14
L
Auto Pan
EQ
R
Auto Pan
EQ
Post Gain
3DVWGHXLWJDDQGHJDLQDDQ
Mod Wave (Modulation Wave)
Tri/Sqr/Sin/Saw1/Saw2 [1 (40 03 03)]
6HOHFWHHUWGHVRRUWPRGXODWLH
7UL
'HNODQNZRUGWJHPRGXOHHUGDOVHHQ
GULHKRHNVJROI
6TU
'HNODQNZRUGWJHPRGXOHHUGDOVHHQ
YLHUNDQWHJROI
6LQ
'HNODQNZRUGWJHPRGXOHHUGDOVHHQ
VLQXVJROI
6DZ 'HNODQNZRUGWJHPRGXOHHUGDOVHHQ
]DDJWDQGJROI'HtandenLQ6DZHQ6DZ
ZLM]HQLQYHUVFKLOOHQGHULFKWLQJHQ
fig.9-14a
Saw1
Sustain
0–127 [2 (40 03 04)]
3DVWGHWLMGDDQZDDULQGHNODQNHQYDQKHWODJHQLYHDX
ZRUGHQRSJHWURNNHQWRW]HKHWJHVSHFLILHHUGHYROXPH
EHUHLNHQ
9HUNOHLQWPHQGHZDDUGHGDQYHUNRUWGHWLMG:DQQHHUGH
ZDDUGHYHUDQGHUGZRUGW]DOKHWQLYHDXHYHQHHQVYHUDQ
GHUHQ
Saw2
0/+6/+12/+18 [3 (40 03 05)]
Low Gain
-12–+12 [17 (40 03 13)]
3DVWGHJDLQYDQGHODJHIUHTXHQWLHDDQ
Hi Gain (High Gain)
-12–+12 [18 (40 03 14)]
3DVWGHJDLQYDQGHKRJHIUHTXHQWLHDDQ
+Pan (Output Pan)
L63–0–R63 [19 (40 03 15)]
3DVWGHVWHUHRSRVLWLHDDQYDQGHXLWJDDQGHNODQN/LV
XLWHUVWOLQNVLVKHWPLGGHQHQ5LVXLWHUVWUHFKWV
Level (Output Level)
3DVWKHWXLWJDQJVQLYHDXDDQ
0–127 [20 (40 03 16)]
15: Limiter
[01H, 31H]
'H/LPLWHUGUXNWVLJQDOHQVDPHQGLHERYHQHHQJHVSHFLILHHUG
YROXPHJDDQ]RGDWJHHQYHUYRUPLQJNDQRSWUHGHQ
fig.9-16
L
Limiter
+Mod Rate (Modulation Rate)
3DVWGHPRGXODWLHVQHOKHLGDDQ
0.05–10.0 [2 (40 03 04)]
EQ
Pan
R
0–127 [3 (40 03 05)]
Threshold (Threshold Level)
0–127 [1 (40 03 03)]
3DVWKHWYROXPHDDQZDDURSGHFRPSUHVVLHEHJLQW
Low Gain
-12–+12 [17 (40 03 13)]
3DVWGHJDLQYDQGHODJHIUHTXHQWLHDDQ
Ratio (Compression Ratio)
1/1.5,1/2,1/4,1/100 [2 (40 03 04)]
3DVWGHFRPSUHVVLHYHUKRXGLQJDDQYDQVLJQDOHQGLHOXLGHU
]LMQGDQKHW7KUHVKROG/HYHOLVGHKRRJVWHFRPSUHVV
LHYHUKRXGLQJHQKHWXLWJDQJVQLYHDX]DODIQHPHQ
#Mod Depth (Modulation Depth)
3DVWGHPRGXODWLHGLHSWHDDQ
Hi Gain (High Gain)
-12–+12 [18 (40 03 14)]
3DVWGHJDLQYDQGHKRJHIUHTXHQWLHDDQ
Level (Output Level)
3DVWKHWXLWJDQJVQLYHDXDDQ
0–127 [20 (40 03 16)]
Effecten die het niveau beïnvloeden (compressortype)
14: Compressor
[01H, 30H]
'H&RPSUHVVRUYODNWGHKRJHQLYHDX·VXLWHQWUHNWGHODJH
QLYHDX·VRSZDDUGRRURQJHOLMNKHGHQLQKHWYROXPHZRUGHQ
JHOLMNJHWURNNHQ
fig.9-15
Release (Release Time)
0–127 [3 (40 03 05)]
3DVWGHWLMGDDQZDDULQKHWYROXPHRQGHUKHW7KUHVKROG
QLYHDXYDOWWRWZDQQHHUHUQLHWODQJHUFRPSUHVVLHZRUGW
WRHJHSDVW
Post Gain
3DVWGHXLWJDDQGHJDLQDDQ
0/+6/+12/+18 [4 (40 03 06)]
Low Gain
-12–+12 [17 (40 03 13)]
3DVWGHJDLQYDQGHODJHIUHTXHQWLHDDQ
Hi Gain (High Gain)
-12–+12 [18 (40 03 14)]
3DVWGHJDLQYDQGHKRJHIUHTXHQWLHDDQ
L
Compressor
EQ
Pan
R
Attack
0–127 [1 (40 03 03)]
3DVWGHDDQVODJWLMGDDQYDQHHQLQJHYRHUGHNODQN
+Pan (Output Pan)
L63–0–R63 [19 (40 03 15)]
3DVWGHVWHUHRSRVLWLHDDQYDQGHXLWJDDQGHNODQN/LV
XLWHUVWOLQNVLVKHWPLGGHQHQ5LVXLWHUVWUHFKWV
Level (Output Level)
3DVWKHWXLWJDQJVQLYHDXDDQ
0–127 [20 (40 03 16)]
97
Invoegeffecten gebruiken
Effecten die de klank verbreden (chorus type)
16: Hexa Chorus
[01H, 40H]
+H[DFKRUXVJHEUXLNWHHQ]HVIDVLJHFKRUXV]HVODJHQFKRUXV
NODQNRPULMNGRPHQHHQUXLPWHOLMNHVSUHLGLQJDDQGHNODQN
WHJHYHQ
17: Tremolo Chorus
7UHPROR&KRUXVLVHHQFKRUXVHIIHFWPHWWRHJHYRHJGH
7UHPRORF\FOLVFKHYROXPHPRGXODWLH
fig.9-18
L
fig.9-17
L
EQ
Hexa
Chorus
R
EQ
Tremolo
Chorus
R
Balance
EQ
Balance
EQ
Pre Dly (Pre Delay Time)
0–100ms [1 (40 03 03)]
3DVWGHWLMGVSDQQHDDQYDQKHWPRPHQWGDWGHGLUHFWHNODQN
EHJLQWWRWPHQGHEHZHUNWHNODQNKRRUW
+Rate
3DVWGHPRGXODWLHVQHOKHLGDDQ
[01H, 41H]
Pre Dly (Pre Delay Time)
0–100ms [1 (40 03 03)]
3DVWGHWLMGVSDQQHDDQYDQKHWPRPHQWGDWGHGLUHFWHNODQN
EHJLQWWRWPHQGHEHZHUNWHNODQNKRRUW
Cho Rate (Chorus Rate)
0.05–10.0 [2 (40 03 04)]
3DVWGHPRGXODWLHVQHOKHLGDDQYDQKHWFKRUXVHIIHFW
0.05–10.0 [2 (40 03 04)]
Cho Depth (Chorus Depth)
0–127 [3 (40 03 05)]
3DVWGHPRGXODWLHVQHOKHLGDDQYDQKHWFKRUXVHIIHFW
0–127 [3 (40 03 05)]
Trem Phase (Tremolo Phase)
0–180 [4 (40 03 06)]
3DVWGHEUHHGWHYDQGHWUHPRORNODQNDDQ
Pre Dly Dev (Pre Delay Deviation)
0–20 [4 (40 03 06)]
'H3UH'HOD\LVGHWLMGWXVVHQKHWEHJLQYDQGHRULJLQHOH
NODQNWRWZDQQHHUGHFKRUXVNODQNJHKRRUGZRUGW+HW
SDVWKHWYHUVFKLOLQ3UH'HOD\DDQWXVVHQHONYDQGH]HV
IDVHQYDQGHFKRUXVNODQN
+Trem Rate (Tremolo Rate)
0.05–10.0 [5 (40 03 07)]
3DVWGHPRGXODWLHVQHOKHLGYDQKHWWUHPRORHIIHFWDDQ
Depth
3DVWGHPRGXODWLHGLHSWHDDQ
Depth Dev (Depth Deviation)
-20–+20 [5 (40 03 07)]
3DVWKHWPRGXODWLHYHUVFKLODDQWXVVHQHONYDQGH]HVIDVHQ
YDQGHFKRUXVNODQN
Pan Dev (Pan Deviation)
0–20 [6 (40 03 08)]
3DVWKHWYHUVFKLOLQVWHUHRSRVLWLHDDQWXVVHQHONYDQGH]HV
IDVHQYDQGHFKRUXVNODQN%LMHHQLQVWHOOLQJYDQ]XOOHQ
DOOHFKRUXVNODQNHQLQKHWPLGGHQJHSODDWVWZRUGHQ%LMHHQ
LQVWHOOLQJYDQZRUGWHONHFKRUXVNODQNLQLQWHUYDOVYDQ
JUDGHQWHQRS]LFKWHYDQKHWPLGGHQJHSODDWVW
Balance (Effect Balance)
D>0E–D0<E [16 (40 03 12)]
3DVWGHYROXPHEDODQVDDQWXVVHQGHGLUHFWHHQGH
YHUZHUNWHNODQN
´'µRI´(µLQGHGLVSOD\EHWHNHQWUHVSHFWLHYHOLMN'GLUHFWH
NODQNRI(HIIHFWNODQNZDDUGHQYDQ
Low Gain
-12–+12 [17 (40 03 13)]
3DVWGHJDLQYDQGHODJHIUHTXHQWLHDDQ
Hi Gain (High Gain)
-12–+12 [18 (40 03 14)]
3DVWGHJDLQYDQGHKRJHIUHTXHQWLHDDQ
Level (Output Level)
3DVWKHWXLWJDQJVYROXPHDDQ
98
0–127 [20 (40 03 16)]
Trem Sep (Tremolo Separation)
0–127 [6 (40 03 08)]
3DVWGHUXLPWHOLMNHVSUHLGLQJDDQYDQKHWWUHPRORHIIHFW
#Balance (Effect Balance)
D>0E–D0<E [16 (40 03 12)]
3DVWGHYROXPHEDODQVDDQWXVVHQGHGLUHFWHHQGH
YHUZHUNWHNODQN
´'µRI´(µLQGHGLVSOD\EHWHNHQWUHVSHFWLHYHOLMN'GLUHFWH
NODQNRI(HIIHFWNODQNZDDUGHQYDQ
Low Gain
-12–+12 [17 (40 03 13)]
3DVWGHJDLQYDQGHODJHIUHTXHQWLHDDQ
Hi Gain (High Gain)
-12–+12 [18 (40 03 14)]
3DVWGHJDLQYDQGHKRJHIUHTXHQWLHDDQ
Level (Output Level)
3DVWKHWXLWJDQJVYROXPHDDQ
0–127 [20 (40 03 16)]
Invoegeffecten gebruiken
18: Stereo Chorus
[01H, 42H]
'LWLVHHQVWHUHRFKRUXV(ULVHHQILOWHUYRRU]LHQ]RGDWXKHW
WLPEUHYDQGHFKRUXVNODQNNDQDDQSDVVHQ
fig.9-19
L
EQ
Chorus
Chorus
R
19: Space D
[01H, 43H]
6SDFH'LVHHQPHHUYRXGLJFKRUXVHIIHFWGDWWZHHIDVLJH
PRGXODWLHLQVWHUHRWRHSDVW+HWJHHIWQLHWGHLQGUXNHHQ
PRGXODWLHWH]LMQPDDUEUHQJWHHQGRRU]LFKWLJHFKRUXVNODQN
YRRUW
fig.9-20
Balance
L
EQ
EQ
Space D
Pre Filter (Pre Filter Type)
Off/LPF/HPF [1 (40 03 03)]
6HOHFWHHUWKHWVRRUWYDQILOWHU
2II
HUZRUGWJHHQILOWHUJHEUXLNW
/3)
VQLMGWKHWIUHTXHQWLHEHUHLNDIERYHQGH&XWRII
SDUDPHWHU
+3)
VQLMGWKHWIUHTXHQWLHEHUHLNDIRQGHUGH&XWRII
SDUDPHWHU
Cutoff (Cutoff Frequency)
250–8k [2 (40 03 04)]
3DVWGHPLGGHQIUHTXHQWLHDDQYDQGHILOWHUYRRUGHFKRUXV
NODQN
Pre Dly (Pre Delay Time)
0–100ms [3 (40 03 05)]
3DVWGHWLMGVSDQQHDDQYDQKHWPRPHQWGDWGHGLUHFWHNODQN
EHJLQWWRWPHQGHEHZHUNWHNODQNKRRUW
+Rate
3DVWGHPRGXODWLHVQHOKHLGDDQ
Depth
3DVWGHPRGXODWLHGLHSWHDDQ
0.05–10.0 [4 (40 03 06)]
Balance
R
EQ
Pre Dly (Pre Delay Time)
0–100ms [1 (40 03 03)]
3DVWGHWLMGVSDQQHDDQYDQKHWPRPHQWGDWGHGLUHFWHNODQN
EHJLQWWRWPHQGHEHZHUNWHNODQNKRRUW
+Rate
3DVWGHPRGXODWLHVQHOKHLGDDQ
Depth
3DVWGHPRGXODWLHGLHSWHDDQ
0.05–10.0 [2 (40 03 04)]
0–127 [3 (40 03 05)]
Phase
0–180 [4 (40 03 06)]
3DVWGHUXLPWHOLMNHVSUHLGLQJYDQGHNODQNDDQ
#Balance (Effect Balance)
D>0E–D0<E [16 (40 03 12)]
3DVWGHYROXPHEDODQVDDQWXVVHQGHGLUHFWHHQGH
YHUZHUNWHNODQN
´'µRI´(µLQGHGLVSOD\EHWHNHQWUHVSHFWLHYHOLMN'GLUHFWH
NODQNRI(HIIHFWNODQNZDDUGHQYDQ
0–127 [5 (40 03 07)]
Low Gain
-12–+12 [17 (40 03 13)]
3DVWGHJDLQYDQGHODJHIUHTXHQWLHDDQ
Phase
0–180 [7 (40 03 09)]
3DVWGHUXLPWHOLMNHVSUHLGLQJYDQGHNODQNDDQ
Hi Gain (High Gain)
-12–+12 [18 (40 03 14)]
3DVWGHJDLQYDQGHKRJHIUHTXHQWLHDDQ
#Balance (Effect Balance)
D>0E–D0<E [16 (40 03 12)]
3DVWGHYROXPHEDODQVDDQWXVVHQGHGLUHFWHHQGH
YHUZHUNWHNODQN
´'µRI´(µLQGHGLVSOD\EHWHNHQWUHVSHFWLHYHOLMN'GLUHFWH
NODQNRI(HIIHFWNODQNZDDUGHQYDQ
Low Gain
-12–+12 [17 (40 03 13)]
3DVWGHJDLQYDQGHODJHIUHTXHQWLHDDQ
Hi Gain (High Gain)
-12–+12 [18 (40 03 14)]
3DVWGHJDLQYDQGHKRJHIUHTXHQWLHDDQ
Level (Output Level)
3DVWKHWXLWJDQJVYROXPHDDQ
Level (Output Level)
3DVWKHWXLWJDQJVYROXPHDDQ
0–127 [20 (40 03 16)]
20: 3D Chorus
[01H, 44H]
3DVWHHQ'HIIHFWWRHRSGHFKRUXVNODQN'HFKRUXVNODQN
ZRUGWRSJUDGHQOLQNVHQJUDGHQUHFKWVJHSODDWVW
fig.9-21
L
EQ
3D Chorus
0–127 [20 (40 03 16)]
R
Balance
EQ
Pre Dly (Pre Delay Time)
0–100ms [1 (40 03 03)]
3DVWGHWLMGVSDQQHDDQYDQKHWPRPHQWGDWGHGLUHFWHNODQN
EHJLQWWRWPHQGHEHZHUNWHNODQNKRRUW
+Cho Rate (Chorus Rate)
0.05–10.0 [2 (40 03 04)]
3DVWGHPRGXODWLHVQHOKHLGYDQGHFKRUXVNODQNDDQ
Cho Depth (Chorus Depth)
0–127 [3 (40 03 05)]
3DVWGHPRGXODWLHVGLHSWHYDQGHFKRUXVNODQNDDQ
99
Invoegeffecten gebruiken
Out (Output Mode)
Speaker/Phones [15 (40 03 11)]
%HSDDOWGHPHWKRGHGLH]DOJHEUXLNWZRUGHQRPGHNODQNWH
KRUHQGLHQDDUGH287387ILFKHVZRUGWJHVWXXUG+HW
RSWLPDOH'HIIHFW]DOEHUHLNWZRUGHQDOVXGH6SHDNHU
VHOHFWHHUWWHUZLMOXGHOXLGSUHNHUVJHEUXLNWRIGH3KRQHV
VHOHFWHHUWWHUZLMOXGHKRRIGWHOHIRRQJHEUXLNWS
#Balance (Effect Balance)
D>0E–D0<E [16 (40 03 12)]
3DVWGHYROXPHEDODQVDDQWXVVHQGHGLUHFWHHQGH
YHUZHUNWHNODQN
´'µRI´(µLQGHGLVSOD\EHWHNHQWUHVSHFWLHYHOLMN'GLUHFWH
NODQNRI(HIIHFWNODQNZDDUGHQYDQ
Low Gain
-12–+12 [17 (40 03 13)]
3DVWGHJDLQYDQGHODJHIUHTXHQWLHDDQ
Hi Gain (High Gain)
-12–+12 [18 (40 03 14)]
3DVWGHJDLQYDQGHKRJHIUHTXHQWLHDDQ
Level (Output Level)
3DVWKHWXLWJDQJVYROXPHDDQ
0–127 [20 (40 03 16)]
Effecten die de klank weergalmen
(delay/reverb type)
21: Stereo Delay
[01H, 50H]
'LWLVHHQVWHUHRGHOD\
)E0RGHLV1RUP
fig.9-22
Delay
HF
EQ
Balance
Delay
HF
Balance
L
R
EQ
Phase L (Phase Left)
Norm/Invert [5 (40 03 07)]
6HOHFWHHUWGHIDVHYDQGHOLQNVHGHOD\NODQN
1RUP 'HIDVHZRUGWQLHWYHUDQGHUG
,QYHUW 'HIDVHZRUGWRPJHGUDDLG
Phase R (Phase Right)
Norm/Invert [6 (40 03 08)]
6HOHFWHHUWGHIDVHYDQGHUHFKWVHGHOD\NODQN
1RUP 'HIDVHZRUGWQLHWYHUDQGHUG
,QYHUW 'HIDVHZRUGWRPJHGUDDLG
HF Damp
315–8k/Bypass [8 (40 03 0A)]
3DVWGHIUHTXHQWLHDDQZDDUERYHQGHNODQNZRUGW
DIJHVQHGHQGLHQDDUKHWHIIHFWZRUGWWHUXJJHVWXXUG$OVX
GHKRJHIUHTXHQWLHVYDQGHIHHGEDFNQLHWZLODIVQLMGHQ
PRHWXGH]HSDUDPHWHURS%\SDVV]HWWHQ
#Balance (Effect Balance)
D>0E–D0<E [16 (40 03 12)]
3DVWGHYROXPHEDODQVDDQWXVVHQGHGLUHFWHHQGH
YHUZHUNWHNODQN
´'µRI´(µLQGHGLVSOD\EHWHNHQWUHVSHFWLHYHOLMN'GLUHFWH
NODQNRI(HIIHFWNODQNZDDUGHQYDQ
Low Gain
-12–+12 [17 (40 03 13)]
3DVWGHJDLQYDQGHODJHIUHTXHQWLHDDQ
Hi Gain (High Gain)
-12–+12 [18 (40 03 14)]
3DVWGHJDLQYDQGHKRJHIUHTXHQWLHDDQ
)E0RGHLV&URVV
fig.9-23
Delay
HF
EQ
Balance
Delay
HF
Balance
L
R
Fb Mode (Feedback Mode)
Norm/Cross [4 (40 03 06)]
6HOHFWHHUWGHPDQLHUZDDURSGHYHUZHUNWHNODQNQDDUKHW
HIIHFWZRUGWWHUXJJHVWXXUG
1RUP 'HOLQNVHGHOD\NODQNZRUGWQDDUGHOLQNVH
GHOD\WHUXJJHVWXXUGGHUHFKWVHGHOD\NODQN
QDDUGHUHFKWVHGHOD\
&URVV 'HOLQNVHGHOD\NODQNZRUGWQDDUGHUHFKWVH
GHOD\WHUXJJHVWXXUGGHUHFKWVHGHOD\NODQN
QDDUGHOLQNVHGHOD\
EQ
Dly Tm L (Delay Time Left)
0–500ms [1 (40 03 03)]
3DVWGHWLMGDDQGLHYHUORRSWYDQDIGHRULJLQHOHNODQNWRWKHW
ZHHUNOLQNHQYDQGHOLQNVHGHOD\NODQN
Level (Output Level)
3DVWKHWXLWJDQJVYROXPHDDQ
22: Mod Delay (Modulation Delay)
fig.9-24
Delay
HF
EQ
Balance
Delay
HF
Balance
L
R
EQ
)E0RGHLV&URVV
fig.9-25
Delay
HF
EQ
Balance
Delay
HF
Balance
L
R
100
[01H, 51H]
'LWHIIHFWYRHJWPRGXODWLHWRHDDQGHGHOD\NODQNHQKHHIW
HHQHIIHFWGDWYHUJHOLMNEDDULVPHWHHQIODQJHU
)E0RGHLV1RUP
Dly Tm R (Delay Time Right)
0–500ms [2 (40 03 04)]
3DVWGHWLMGDDQGLHYHUORRSWYDQDIGHRULJLQHOHNODQNWRWKHW
ZHHUNOLQNHQYDQGHUHFKWVHGHOD\NODQN
+Feedback (Feedback Level)
-98%–+98% [3 (40 03 05)]
3DVWGHYHUKRXGLQJDDQYDQYHUZHUNWHNODQNGLHQDDU
GHLQJDQJZRUGWWHUXJJHVWXXUG1HJDWLHYHLQVWHOOLQJHQ
GUDDLHQGHIDVHRP
0–127 [20 (40 03 16)]
EQ
Invoegeffecten gebruiken
Dly Tm L (Delay Time Left)
0–500ms [1 (40 03 03)]
3DVWGHWLMGDDQGLHYHUORRSWYDQDIGHRULJLQHOHNODQNWRWKHW
ZHHUNOLQNHQYDQGHOLQNVHGHOD\NODQN
Dly Tm R (Delay Time Right)
0–500ms [2 (40 03 04)]
3DVWGHWLMGDDQGLHYHUORRSWYDQDIGHRULJLQHOHNODQNWRWKHW
ZHHUNOLQNHQYDQGHUHFKWVHGHOD\NODQN
23: 3 Tap Delay (Triple Tap Delay)
'H7ULSOH7DS'HOD\SURGXFHHHUWGULHGHOD\NODQNHQ
PLGGHQOLQNVHQUHFKWV
fig.9-26
L
Delay Left
+Feedback (Feedback Level)
-98%–+98% [3 (40 03 05)]
3DVWGHYHUKRXGLQJDDQYDQYHUZHUNWHNODQNGLHQDDU
GHLQJDQJZRUGWWHUXJJHVWXXUG1HJDWLHYHLQVWHOOLQJHQ
GUDDLHQGHIDVHRP
Fb Mode (Feedback Mode)
Norm/Cross [4 (40 03 06)]
6HOHFWHHUWGHPDQLHUZDDURSGHYHUZHUNWHNODQNQDDUKHW
HIIHFWZRUGWWHUXJJHVWXXUG
1RUP 'HOLQNVHGHOD\NODQNZRUGWQDDUGHOLQNVH
GHOD\WHUXJJHVWXXUGGHUHFKWVHGHOD\NODQN
QDDUGHUHFKWVHGHOD\
&URVV 'HOLQNVHGHOD\NODQNZRUGWQDDUGHUHFKWVH
GHOD\WHUXJJHVWXXUGGHUHFKWVHGHOD\NODQN
QDDUGHOLQNVHGHOD\
+Mod Rate (Modulation Rate)
3DVWGHPRGXODWLHVQHOKHLGDDQ
Mod Depth (Modulation Depth)
3DVWGHPRGXODWLHGLHSWHDDQ
0.05–10.0 [5 (40 03 07)]
0–127 [6 (40 03 08)]
Mod Phase (Modulation Phase)
0–180 [7 (40 03 09)]
3DVWGHUXLPWHOLMNHVSUHLGLQJYDQGHNODQNDDQ
HF Damp
315–8k/Bypass [8 (40 03 0A)]
3DVWGHIUHTXHQWLHDDQZDDUERYHQGHNODQNZRUGW
DIJHVQHGHQGLHQDDUKHWHIIHFWZRUGWWHUXJJHVWXXUG$OVX
GHKRJHIUHTXHQWLHVYDQGHIHHGEDFNQLHWZLODIVQLMGHQ
PRHWXGH]HSDUDPHWHURS%\SDVV]HWWHQ
#Balance (Effect Balance)
D>0E–D0<E [16 (40 03 12)]
3DVWGHYROXPHEDODQVDDQWXVVHQGHGLUHFWHHQGH
YHUZHUNWHNODQN
´'µRI´(µLQGHGLVSOD\EHWHNHQWUHVSHFWLHYHOLMN'GLUHFWH
NODQNRI(HIIHFWNODQNZDDUGHQYDQ
Low Gain
-12–+12 [17 (40 03 13)]
3DVWGHJDLQYDQGHODJHIUHTXHQWLHDDQ
Hi Gain (High Gain)
-12–+12 [18 (40 03 14)]
3DVWGHJDLQYDQGHKRJHIUHTXHQWLHDDQ
Level (Output Level)
3DVWKHWXLWJDQJVYROXPHDDQ
0–127 [20 (40 03 16)]
[01H, 52H]
Level
Balance
Delay Center
HF
Delay Right
Balance
R
Dly Tm C (Delay Time Center)
200–990ms/1sec [1 (40 03 03)]
3DVWGHWLMGDDQGLHYHUORRSWYDQDIGHRULJLQHOHNODQNWRWKHW
ZHHUNOLQNHQYDQGHFHQWUDOHGHOD\NODQN
Dly Tm L (Delay Time Left) 200–990ms/1sec [2 (40 03 04)]
3DVWGHWLMGDDQGLHYHUORRSWYDQDIGHRULJLQHOHNODQNWRWKHW
ZHHUNOLQNHQYDQGHOLQNVHGHOD\NODQN
Dly Tm R (Delay Time Right)
200–990ms/1sec [3 (40 03 05)]
3DVWGHWLMGDDQGLHYHUORRSWYDQDIGHRULJLQHOHNODQNWRWKHW
ZHHUNOLQNHQYDQGHUHFKWVHGHOD\NODQN
+Feedback (Feedback Level)
-98%–+98% [4 (40 03 06)]
3DVWGHYHUKRXGLQJDDQYDQGHFHQWUDOHGHOD\GLHQDDU
GHLQJDQJZRUGWWHUXJJHVWXXUG1HJDWLHYHLQVWHOOLQJHQ
GUDDLHQGHIDVHRP
Dly Lev C (Delay Level Center)
0–127 [5 (40 03 07)]
3DVWKHWYROXPHDDQYDQGHFHQWUDOH'HOD\NODQN
Dly Lev L (Delay Level Left)
0–127 [6 (40 03 08)]
3DVWKHWYROXPHDDQYDQGHOLQNVH'HOD\NODQN
Dly Lev R (Delay Level Right)
0–127 [7 (40 03 09)]
3DVWKHWYROXPHDDQYDQGHUHFKWVH'HOD\NODQN
HF Damp
315–8k/Bypass [8 (40 03 0A)]
3DVWGHIUHTXHQWLHDDQZDDURSKHWKRJHEHUHLNZRUGW
DIJHVQHGHQZDQQHHUGHFHQWUDOH'HOD\NODQNQDDUGH
LQJDQJZRUGWWHUXJJHVWXXUG$OVXKHWKRJHEHUHLNQLHWZLO
DIVQLMGHQPRHWXGH]HSDUDPHWHURS%\SDVV]HWWHQ
#Balance (Effect Balance)
D>0E–D0<E [16 (40 03 12)]
3DVWGHYROXPHEDODQVDDQWXVVHQGHGLUHFWHHQGH
YHUZHUNWHNODQN
´'µRI´(µLQGHGLVSOD\EHWHNHQWUHVSHFWLHYHOLMN'GLUHFWH
NODQNRI(HIIHFWNODQNZDDUGHQYDQ
Low Gain
-12–+12 [17 (40 03 13)]
3DVWGHJDLQYDQGHODJHIUHTXHQWLHDDQ
Hi Gain (High Gain)
-12–+12 [18 (40 03 14)]
3DVWGHJDLQYDQGHKRJHIUHTXHQWLHDDQ
Level (Output Level)
3DVWKHWXLWJDQJVYROXPHDDQ
0–127 [20 (40 03 16)]
101
Invoegeffecten gebruiken
24: 4 Tap Delay (Quadruple Tap Delay)
[01H, 53H]
'H4XDGUXSOH7DS'HOD\KHHIWYLHUGHOD\V
fig.9-27
L
Delay 4
Level
Balance
Delay 3
25: Tm Ctrl Delay (Time Control Delay)
[01H, 54H]
0HWGLWHIIHFWNDQXHHQVSHFLILHNHFRQWUROOHUJHEUXLNHQGH
FRQWUROOHUGLHLQ();&6UFSJHVHOHFWHHUGLVRPGH
GHOD\WLMGHQGHWRRQKRRJWHLQUHsOHWLMGWHFRQWUROHUHQ$OV
PHQGHGHOD\WLMGYHUOHQJWZRUGWGHWRRQKRRJWHYHUODDJG
9HUNRUWPHQGHGHOD\WLMGGDQYHUKRRJWGHWRRQKRRJWH
fig.9-28
Delay 2
L
EQ
Delay 1
HF
Dly Tm 2 (Delay Time 2) 200–990ms/1sec [2 (40 03 04)]
3DVWGHWLPHGHOD\DDQGLHYHUORRSWYDQDIGHGLUHFWHNODQN
WRWKHWZHHUNOLQNHQYDQGH'HOD\NODQN
Dly Tm 3 (Delay Time 3) 200–990ms/1sec [3 (40 03 05)]
3DVWGHWLPHGHOD\DDQGLHYHUORRSWYDQDIGHGLUHFWHNODQN
WRWKHWZHHUNOLQNHQYDQGH'HOD\NODQN
Dly Tm 4 (Delay Time 4) 200–990ms/1sec [4 (40 03 06)]
3DVWGHWLPHGHOD\DDQGLHYHUORRSWYDQDIGHGLUHFWHNODQN
WRWKHWZHHUNOLQNHQYDQGH'HOD\NODQN
Dly Lev 1 (Delay Level 1)
0–127 [5 (40 03 07)]
3DVWKHWYROXPHDDQYDQGH'HOD\NODQN
Dly Lev 2 (Delay Level 2)
0–127 [6 (40 03 08)]
3DVWKHWYROXPHDDQYDQGH'HOD\NODQN
Dly Lev 3 (Delay Level 3)
0–127 [7 (40 03 09)]
3DVWKHWYROXPHDDQYDQGH'HOD\NODQN
Dly Lev 4 (Delay Level 4)
0–127 [8 (40 03 0A)]
3DVWKHWYROXPHDDQYDQGH'HOD\NODQN
+Feedback (Feedback Level) -98%–+98% [9 (40 03 0B)]
3DVWGHYHUKRXGLQJDDQYDQGH'HOD\NODQNGLHQDDU
GHLQJDQJZRUGWWHUXJJHVWXXUG1HJDWLHYHLQVWHOOLQJHQ
GUDDLHQGHIDVHRP
HF Damp
315–8k/Bypass [10 (40 03 0C)]
3DVWGHIUHTXHQWLHDDQZDDURSKHWKRJHEHUHLNZRUGW
DIJHVQHGHQZDQQHHUGH'HOD\NODQNQDDUGHLQJDQJ
ZRUGWWHUXJJHVWXXUG$OVXKHWKRJHEHUHLNQLHWZLO
DIVQLMGHQPRHWXGH]HSDUDPHWHURS%\SDVV]HWWHQ
#Balance (Effect Balance)
D>0E–D0<E [16 (40 03 12)]
3DVWGHYROXPHEDODQVDDQWXVVHQGHGLUHFWHHQGH
YHUZHUNWHNODQN
´'µRI´(µLQGHGLVSOD\EHWHNHQWUHVSHFWLHYHOLMN'GLUHFWH
NODQNRI(HIIHFWNODQNZDDUGHQYDQ
Low Gain
-12–+12 [17 (40 03 13)]
3DVWGHJDLQYDQGHODJHIUHTXHQWLHDDQ
Hi Gain (High Gain)
-12–+12 [18 (40 03 14)]
3DVWGHJDLQYDQGHKRJHIUHTXHQWLHDDQ
102
HF
R
Dly Tm 1 (Delay Time 1) 200–990ms/1sec [1 (40 03 03)]
3DVWGHWLPHGHOD\DDQGLHYHUORRSWYDQDIGHGLUHFWHNODQN
WRWKHWZHHUNOLQNHQYDQGH'HOD\NODQN
Level (Output Level)
3DVWKHWXLWJDQJVYROXPHDDQ
Delay
Balance
R
0–127 [20 (40 03 16)]
Pan Balance
EQ
+Dly Time (Delay Time)
200–990ms/1sec [1 (40 03 03)]
3DVWGHWLMGDDQGLHYHUORRSWYDQDIGHGLUHFWHNODQNWRWKHW
ZHHUNOLQNHQYDQHONHGHOD\NODQN
Accel (Acceleration)
0–15 [2 (40 03 04)]
'H]HSDUDPHWHUSDVWGHVQHOKHLGDDQZDDUDDQGHGHOD\WLMG
YDQGHKXLGLJHLQVWHOOLQJWRWHHQQLHXZJHVHOHFWHHUGH
LQVWHOOLQJ]DOYHUDQGHUHQ'HYHUDQGHULQJVVQHOKHLGYDQGH
'HOD\WLMGEHwQYORHGWGHVQHOKHLGYDQGHWRRQKRRJWHYHUDQ
GHULQJ
#Feedback (Feedback Level)
-98%–+98% [3 (40 03 05)]
3DVWGHYHUKRXGLQJDDQYDQGHEHZHUNWHNODQNGLHQDDU
KHWHIIHFWZRUGWWHUXJJHVWXXUG1HJDWLHYHLQVWHOOLQJHQ
GUDDLHQGHIDVHRP
HF Damp
315–8k/Bypass [4 (40 03 06)]
3DVWGHIUHTXHQWLHDDQZDDUERYHQHHQNODQNZRUGW
DIJHVQHGHQGLHQDDUKHWHIIHFWZRUGWWHUXJJHVWXXUG$OVX
GHKRJHIUHTXHQWLHVQLHWZLODIVQLMGHQPRHWXGH]H
SDUDPHWHURS%\SDVV]HWWHQ
EFX Pan (Effect Output Pan) L63–0–R63 [5 (40 03 07)]
3DVWGHVWHUHRSRVLWLHDDQYDQGHXLWJDDQGHNODQN/LV
XLWHUVWOLQNVLVKHWPLGGHQHQ5LVXLWHUVWUHFKWV
Balance (Effect Balance)
D>0E–D0<E [16 (40 03 12)]
3DVWGHYROXPHEDODQVDDQWXVVHQGHGLUHFWHHQGH
YHUZHUNWHNODQN
´'µRI´(µLQGHGLVSOD\EHWHNHQWUHVSHFWLHYHOLMN'GLUHFWH
NODQNRI(HIIHFWNODQNZDDUGHQYDQ
Low Gain
-12–+12 [17 (40 03 13)]
3DVWGHJDLQYDQGHODJHIUHTXHQWLHDDQ
Hi Gain (High Gain)
-12–+12 [18 (40 03 14)]
3DVWGHJDLQYDQGHKRJHIUHTXHQWLHDDQ
Level (Output Level)
3DVWKHWXLWJDQJVYROXPHDDQ
0–127 [20 (40 03 16)]
Invoegeffecten gebruiken
26: Reverb
[01H, 55H]
27: Gate Reverb
[01H, 56H]
+HW5HYHUEHIIHFWYRHJWJDOPWRHDDQHHQNODQNZDDUGRRU
HHQDNRHVWLVFKHUXLPWHZRUGWQDJHERRWVW
*DWH5HYHUELVHHQVSHFLDDOVRRUWUHYHUEZDDUELMGHZHHUJDO
PHQGHNODQNYRRU]LMQQDWXXUOLMNHOHQJWHZRUGWDIJHVQHGHQ
fig.9-29
fig.9-30
L
EQ
Reverb
R
L
Balance
EQ
EQ
Reverb
R
Balance
EQ
Type (ReverbType)
Room1/2/Stage1/2/Hall1/2 [1 (40 03 03)]
6HOHFWHHUWKHWVRRUWYDQ5HYHUEHIIHFW
5RRP GLFKWHUHYHUEPHWNRUWHXLWVWHUIWLMG
5RRP EUHGHUHYHUEPHWNRUWHXLWVWHUIWLMG
6WDJH UHYHUEPHWJURWHUHODWHZHHUJDOP
6WDJH UHYHUEPHWVWHUNHYURHJHUHIOHFWLHV
+DOO
UHYHUEPHWKHOHGHUHZHHUJDOP
+DOO
UHYHUEPHWULMNHZHHUJDOP
Type (Gate Reverb Type)
Norm/Reverse/Sweep1/2 [1 (40 03 03)]
6HOHFWHHUWKHWVRRUWUHYHUE
1RUP
FRQYHQWLRQHOHJDWHUHYHUE
5HYHUVH RPJHGUDDLGHUHYHUE
6ZHHS GHJDOPNODQNYHUSODDWVW]LFKYDQUHFKWV
QDDUOLQNV
6ZHHS GHJDOPNODQNYHUSODDWVW]LFKYDQOLQNVQDDU
UHFKWV
Pre Dly (Pre Delay Time)
0–100ms [2 (40 03 04)]
3DVWGHWLMGDDQGLHYHUORRSWYDQDIGHGLUHFWHNODQNWRWKHW
ZHHUNOLQNHQYDQGHUHYHUENODQN
Pre Dly (Pre Delay Time)
0–100ms [2 (40 03 04)]
3DVWGHWLMGDDQGLHYHUORRSWYDQDIGHGLUHFWHNODQNWRWKHW
ZHHUNOLQNHQYDQGHUHYHUENODQN
+Time (Reverb Time)
3DVWGHOHQJWHYDQGHZHHUJDOPDDQ
0–127 [3 (40 03 05)]
HF Damp
315–8k/Bypass [4 (40 03 06)]
3DVWGHIUHTXHQWLHDDQZDDUERYHQGHZHHUJDOPHQGHNODQN
ZRUGWDIJHVQHGHQ$OVXGHIUHTXHQWLHODJHULQVWHOWZRUGHQ
PHHUKRJHIUHTXHQWLHVDIJHVQHGHQGLWJHHIWHHQ]DFKWHUHHQ
VWLOOHUHZHHUJDOP$OVXGHKRJHIUHTXHQWLHVQLHWZLO
DIVQLMGHQPRHWXGH]HSDUDPHWHURS%\SDVV]HWWHQ
#Balance (Effect Balance)
D>0E–D0<E [16 (40 03 12)]
3DVWGHYROXPHEDODQVDDQWXVVHQGHGLUHFWHHQGH
YHUZHUNWHNODQN
´'µRI´(µLQGHGLVSOD\EHWHNHQWUHVSHFWLHYHOLMN'GLUHFWH
NODQNRI(HIIHFWNODQNZDDUGHQYDQ
Low Gain
-12–+12 [17 (40 03 13)]
3DVWGHJDLQYDQGHODJHIUHTXHQWLHDDQ
Gate Time
5–500ms [3 (40 03 05)]
3DVWGHWLMGDDQYDQDIKHWPRPHQWGDWGHUHYHUEJHKRRUG
ZRUGWWRWGH]HYHUGZLMQW
+Balance (Effect Balance)
D>0E–D0<E [16 (40 03 12)]
3DVWGHYROXPHEDODQVDDQWXVVHQGHGLUHFWHHQGH
YHUZHUNWHNODQN
´'µRI´(µLQGHGLVSOD\EHWHNHQWUHVSHFWLHYHOLMN'GLUHFWH
NODQNRI(HIIHFWNODQNZDDUGHQYDQ
Low Gain
-12–+12 [17 (40 03 13)]
3DVWGHJDLQYDQGHODJHIUHTXHQWLHDDQ
Hi Gain (High Gain)
-12–+12 [18 (40 03 14)]
3DVWGHJDLQYDQGHKRJHIUHTXHQWLHDDQ
Level (Output Level)
3DVWKHWXLWJDQJVYROXPHDDQ
0–127 [20 (40 03 16)]
Hi Gain (High Gain)
-12–+12 [18 (40 03 14)]
3DVWGHJDLQYDQGHKRJHIUHTXHQWLHDDQ
Level (Output Level)
3DVWKHWXLWJDQJVYROXPHDDQ
0–127 [20 (40 03 16)]
103
Invoegeffecten gebruiken
28: 3D Delay
[01H, 57H]
3DVWHHQ'HIIHFWWRHRSGHGHOD\NODQN'HGHOD\NODQN
ZRUGWRSJUDGHQOLQNVHQJUDGHQUHFKWVJHSODDWVW
fig.9-31
L
3D Delay L
Level
EQ
Effecten die de toonhoogte veranderen (pitch shift type)
29: 2 Pitch Shifter (2-Voice Pitch Shifter)
(HQ3LWFK6KLIWHUYHUDQGHUWGHWRRQKRRJWHYDQGHRULJLQHOH
NODQN'H]HWZHHVWHPPLJHSLWFKVKLIWHUKHHIWWZHHSLWFK
VKLIWHUVHQNDQWZHHPHWSLWFKVKLIWEHZHUNWHNODQNHQDDQGH
RULJLQHOHNODQNWRHYRHJHQ
fig.9-32
EQ
L
3D Delay C
HF
Pitch 1
Pan
Pitch 2
Pan
Balance
3D Delay R
R
[01H, 60H]
R
EQ
EQ
Dly Tm C (Delay Time Center)
0–500ms [1 (40 03 03)]
3DVWGHWLMGDDQGLHYHUORRSWYDQDIGHRULJLQHOHNODQNWRWKHW
ZHHUNOLQNHQYDQGHFHQWUDOHGHOD\NODQN
+Coarse 1 (Coarse Pitch 1)
-24–0–+12 [1 (40 03 03)]
3DVWGHWRRQKRRJWHDDQYDQ3LWFK6KLIWLQVWDSSHQYDQHHQ
KDOYHWRRQ²RFWDYHQ
Dly Tm L (Delay Time Left) 200–990ms/1sec [2 (40 03 04)]
3DVWGHWLMGDDQGLHYHUORRSWYDQDIGHRULJLQHOHNODQNWRWKHW
ZHHUNOLQNHQYDQGHOLQNVHGHOD\NODQN
Fine 1 (Fine Pitch 1)
-100–0–+100 [2 (40 03 04)]
3DVWGHWRRQKRRJWHYDQ3LWFK6KLIWQDXZNHXULJDDQLQ
VWDSSHQYDQKRQGHUGVWHQ²KRQGHUGVWHQ
Dly Tm R (Delay Time Right)
200–990ms/1sec [3 (40 03 05)]
3DVWGHWLMGDDQGLHYHUORRSWYDQDIGHRULJLQHOHNODQNWRWKHW
ZHHUNOLQNHQYDQGHUHFKWVHGHOD\NODQN
+Feedback (Feedback Level)
-98%–+98% [4 (40 03 06)]
3DVWGHYHUKRXGLQJDDQYDQGHFHQWUDOHGHOD\GLHQDDU
GHLQJDQJZRUGWWHUXJJHVWXXUG1HJDWLHYHLQVWHOOLQJHQ
GUDDLHQGHIDVHRP
Dly Lev C (Delay Level Center)
0–127 [5 (40 03 07)]
3DVWKHWYROXPHDDQYDQGHFHQWUDOH'HOD\NODQN
Dly Lev L (Delay Level Left)
0–127 [6 (40 03 08)]
3DVWKHWYROXPHDDQYDQGHOLQNVH'HOD\NODQN
Dly Lev R (Delay Level Right)
0–127 [7 (40 03 09)]
3DVWKHWYROXPHDDQYDQGHUHFKWVH'HOD\NODQN
HF Damp
315–8k/Bypass [8 (40 03 0A)]
3DVWGHIUHTXHQWLHDDQZDDURSKHWKRJHEHUHLNZRUGW
DIJHVQHGHQZDQQHHUGHFHQWUDOH'HOD\NODQNQDDUGH
LQJDQJZRUGWWHUXJJHVWXXUG$OVXKHWKRJHEHUHLNQLHWZLO
DIVQLMGHQPRHWXGH]HSDUDPHWHURS%\SDVV]HWWHQ
Pre Dly 1 (Pre Delay Time 1)
0–100ms [3 (40 03 05)]
3DVWGHWLMGDDQGLHYHUORRSWYDQDIGHRULJLQHOHNODQNWRWKHW
ZHHUNOLQNHQYDQGH3LWFK6KLIWNODQN
EFX Pan 1 (Effect Output Pan 1) L63–0–R63 [4 (40 03 06)]
3DVWGHVWHUHRSRVLWLHDDQYDQGH3LWFK6KLIWNODQN/LV
XLWHUVWOLQNVLVKHWPLGGHQHQ5LVXLWHUVWUHFKWV
#Coarse 2 (Coarse Pitch 2)
-24–0–+12 [5 (40 03 07)]
3DVWGHWRRQKRRJWHDDQYDQ3LWFK6KLIWLQVWDSSHQYDQHHQ
KDOYHWRRQ²RFWDYHQ
Fine 2 (Fine Pitch 2)
-100–0–+100 [6 (40 03 08)]
3DVWGHWRRQKRRJWHYDQ3LWFK6KLIWQDXZNHXULJDDQLQ
VWDSSHQYDQKRQGHUGVWHQ²KRQGHUGVWHQ²
KRQGHUGVWHQ
Pre Dly 2 (Pre Delay Time 2)
0–100ms [7 (40 03 09)]
3DVWGHWLMGDDQGLHYHUORRSWYDQDIGHRULJLQHOHNODQNWRWKHW
ZHHUNOLQNHQYDQGH3LWFK6KLIWNODQN
EFX Pan 2 (Effect Output Pan 2) L63–0–R63 [8 (40 03 0A)]
3DVWGHVWHUHRSRVLWLHDDQYDQGH3LWFK6KLIWNODQN/LV
XLWHUVWOLQNVLVKHWPLGGHQHQ5LVXLWHUVWUHFKWV
Out (Output Mode)
Speaker/Phones [15 (40 03 11)]
%HSDDOWGHPHWKRGHGLH]DOJHEUXLNWZRUGHQRPGHNODQNWH
KRUHQGLHQDDUGH287387ILFKHVZRUGWJHVWXXUG+HW
RSWLPDOH'HIIHFW]DOEHUHLNWZRUGHQDOVXGH6SHDNHU
VHOHFWHHUWWHUZLMOXGHOXLGSUHNHUVJHEUXLNWRIGH3KRQHV
VHOHFWHHUWWHUZLMOXGHKRRIGWHOHIRRQJHEUXLNWS
#Balance (Effect Balance)
D>0E–D0<E [16 (40 03 12)]
3DVWGHYROXPHEDODQVDDQWXVVHQGHGLUHFWHHQGH
YHUZHUNWHNODQN
´'µRI´(µLQGHGLVSOD\EHWHNHQWUHVSHFWLHYHOLMN'GLUHFWH
NODQNRI(HIIHFWNODQNZDDUGHQYDQ
Shift Mode (Pitch Shifter Mode)
1–5 [9 (40 03 0B)]
+HWYHUKRJHQYDQGHLQVWHOOLQJHQYDQGH]HSDUDPHWHU
YHUWUDDJWGHUHDFWLHPDDUJHHIWHHQYDVWHUHWRRQKRRJWH
Low Gain
-12–+12 [17 (40 03 13)]
3DVWGHJDLQYDQGHODJHIUHTXHQWLHDDQ
Low Gain
-12–+12 [17 (40 03 13)]
3DVWGHJDLQYDQGHODJHIUHTXHQWLHDDQ
Hi Gain (High Gain)
-12–+12 [18 (40 03 14)]
3DVWGHJDLQYDQGHKRJHIUHTXHQWLHDDQ
Hi Gain (High Gain)
-12–+12 [18 (40 03 14)]
3DVWGHJDLQYDQGHKRJHIUHTXHQWLHDDQ
Level (Output Level)
3DVWKHWXLWJDQJVYROXPHDDQ
Level (Output Level)
3DVWKHWXLWJDQJVYROXPHDDQ
104
0–127 [20 (40 03 16)]
L.Bal (Level Balance)
A> 0B–A0<B [10 (40 03 0C)]
3DVWGHYROXPHEDODQVDDQWXVVHQGHNODQNHQYDQ3LWFK6KLIW
HQ3LWFK6KLIW
Balance (Effect Balance)
D>0E–D0<E [16 (40 03 12)]
3DVWGHYROXPHEDODQVDDQWXVVHQGHGLUHFWHHQGH
YHUZHUNWHNODQN
´'µRI´(µLQGHGLVSOD\EHWHNHQWUHVSHFWLHYHOLMN'GLUHFWH
NODQNRI(HIIHFWNODQNZDDUGHQYDQ
0–127 [20 (40 03 16)]
Invoegeffecten gebruiken
30: Fb P.Shifter (Feedback Pitch Shifter)
[01H, 61H]
Andere
0HWGH]HSLWFKVKLIWHUNDQGHPHWSLWFKVKLIWEHZHUNWHNODQN
WHUXJQDDUKHWHIIHFWZRUGHQJHVWXXUG
31: 3D Auto
fig.9-33
fig.9-34
EQ
L
Pitch
R
+HW'$XWRHIIHFWURWHHUWGHSODDWVLQJYDQGHNODQN
L
3D Auto
Pan Balance
EQ
+P.Coarse (Coarse Pitch)
-24–0–+12 [1 (40 03 03)]
3DVWGHWRRQKRRJWHDDQYDQGH3LWFK6KLIWNODQNLQVWDSSHQ
YDQHHQKDOYHWRRQ²RFWDYHQ
P.Fine (Fine Pitch)
-100–0–+100 [2 (40 03 04)]
3DVWGHWRRQKRRJWHYDQGH3LWFK6KLIWNODQNQDXZNHXULJ
DDQLQVWDSSHQYDQKRQGHUGVWHQ²KRQGHUGVWHQ
#Feedback (Feedback Level)
-98%–+98% [3 (40 03 05)]
3DVWGHYHUKRXGLQJDDQYDQGHYHUZHUNWHNODQNGLH
QDDUKHWHIIHFWZRUGWWHUXJJHVWXXUG1HJDWLHYHLQVWHOO
LQJHQGUDDLHQGHIDVHRP
Pre Dly (Pre Delay Time)
0–100ms [4 (40 03 06)]
3DVWGHWLMGDDQGLHYHUORRSWYDQDIGHGLUHFWHNODQNWRWKHW
ZHHUNOLQNHQYDQGH3LWFK6KLIWNODQN
Mode (Pitch Shifter Mode)
1–5 [5 (40 03 07)]
+HWYHUKRJHQYDQGHLQVWHOOLQJHQYDQGH]HSDUDPHWHU
YHUWUDDJWGHUHDFWLHPDDUJHHIWHHQYDVWHUHWRRQKRRJWH
EFX Pan (Effect Output Pan) L63–0–R63 [6 (40 03 08)]
3DVWGHVWHUHRSRVLWLHDDQYDQGH3LWFK6KLIWNODQN/LV
XLWHUVWOLQNVLVKHWPLGGHQHQ5LVXLWHUVWUHFKWV
Balance (Effect Balance)
D>0E–D0<E [16 (40 03 12)]
3DVWGHYROXPHEDODQVDDQWXVVHQGHGLUHFWHHQGH
YHUZHUNWHNODQN
´'µRI´(µLQGHGLVSOD\EHWHNHQWUHVSHFWLHYHOLMN'GLUHFWH
NODQNRI(HIIHFWNODQNZDDUGHQYDQ
[01H, 70H]
R
Azimuth
180/L168–0–R168 [1 (40 03 03)]
6WHOWGHSODDWVLQZDDURSGHNODQN]DOVWRSSHQZDQQHHUGH
URWDWLHLVJHVWRSW
0HWHHQLQVWHOOLQJYDQZRUGWGHNODQNLQKHWPLGGHQ
JHSODDWVW
+Speed
6WHOWGHURWDWLHVQHOKHLGLQ
0.05–10.0 [2 (40 03 04)]
Clockwise
-/+ [3 (40 03 05)]
6WHOWGHURWDWLHULFKWLQJLQ(HQ-LQVWHOOLQJLVWHJHQGHNORN
HHQ+LQVWHOOLQJLVPHWGHNORNPHH
#Turn
Off/On [4 (40 03 06)]
6WRSWRIVWDUWGHURWDWLH:DQQHHUGLWDDQVWDDW]DOGHNODQN
URWHUHQ:DQQHHUKHWXLWVWDDW]DOGHURWDWLHVWRSSHQRSGH
GRRU$]LPXWKEHSDDOGHSODDWV
Out (Output Mode)
Speaker/Phones [15 (40 03 11)]
%HSDDOWGHPHWKRGHGLH]DOJHEUXLNWZRUGHQRPGHNODQNWH
KRUHQGLHQDDUGH287387ILFKHVZRUGWJHVWXXUG+HW
RSWLPDOH'HIIHFW]DOEHUHLNWZRUGHQDOVXGH6SHDNHU
VHOHFWHHUWWHUZLMOXGHOXLGSUHNHUVJHEUXLNWRIGH3KRQHV
VHOHFWHHUWWHUZLMOXGHKRRIGWHOHIRRQJHEUXLNWS
Level (Output Level)
3DVWKHWXLWJDQJVYROXPHDDQ
0–127 [20 (40 03 16)]
Low Gain
-12–+12 [17 (40 03 13)]
3DVWGHJDLQYDQGHODJHIUHTXHQWLHDDQ
Hi Gain (High Gain)
-12–+12 [18 (40 03 14)]
3DVWGHJDLQYDQGHKRJHIUHTXHQWLHDDQ
Level (Output Level)
3DVWKHWXLWJDQJVYROXPHDDQ
0–127 [20 (40 03 16)]
105
Invoegeffecten gebruiken
32: 3D Manual
[01H, 71H]
3ODDWVWKHW'HIIHFWRSGHJHZHQVWHORFDWLH
[01H, 73H]
/R)LLVHHQHIIHFWGDWGHNODQNNZDOLWHLWRS]HWWHOLMNQDDU
EHQHGHQKDDOWHQZDDUDDQHHQJURWHYHUVFKHLGHQKHLGUXLV
NDQZRUGHQWRHJHYRHJG
fig.9-35
L
3D Locate
$OVGHLQVWHOOLQJHQYDQ5'HWXQH5DGLR'HWXQH:3/HYHO:KLWH
3LQN1RLVH/HYHO'LVF1]/HY'LVF1RLVH/HYHORI+XP/HYHOKRJHU
R
ZRUGHQJH]HW]DOHU]HOIVDOVGHLQJDQJVWLOZDVUXLVRSWUHGHQ
+Azimuth
180/L168–0–R168 [1 (40 03 03)]
%HSDDOWGHSODDWV0HWHHQLQVWHOOLQJYDQZRUGWGHNODQN
LQKHWPLGGHQJHSODDWVW
Out (Output Mode)
Speaker/Phones [15 (40 03 11)]
%HSDDOWGHPHWKRGHGLH]DOJHEUXLNWZRUGHQRPGHNODQNWH
KRUHQGLHQDDUGH287387MDFNVZRUGWJHVWXXUG+HW
RSWLPDOH'HIIHFW]DOEHUHLNWZRUGHQDOVXGH6SHDNHU
VHOHFWHHUWWHUZLMOXGHOXLGSUHNHUVJHEUXLNWRIGH3KRQHV
VHOHFWHHUWWHUZLMOXGHKRRIGWHOHIRRQJHEUXLNWS
#Level (Output Level)
3DVWKHWXLWJDQJVYROXPHDDQ
0–127 [20 (40 03 16)]
33: Lo-Fi 1
[01H, 72H]
/R)LLVHHQHIIHFWGDWGHNODQNNZDOLWHLWRS]HWWHOLMNQDDU
EHQHGHQKDDOW
fig.9-36
L
Lo-Fi
EQ
Pan
R
Pre Filter (Pre Filter Type)
1–6 [1 (40 03 03)]
%HSDDOWKHWVRRUWILOWHUGDW]DOZRUGHQWRHJHSDVWYRRUDOHHU
GHNODQNGRRUKHW/R)LHIIHFWZRUGWJHVWXXUG
Lo-Fi Type
1–9 [2 (40 03 04)]
9HUPLQGHUWGHNODQNNZDOLWHLW'HNZDOLWHLWYDQGHNODQN
ZRUGWVOHFKWHUQDDUPDWHGH]HZDDUGHZRUGWYHUKRRJG
Post Filter (Post Filter Type)
1–6 [3 (40 03 05)]
%HSDDOWKHWVRRUWILOWHUGDW]DOZRUGHQWRHJHSDVWQDGDWGH
NODQNGRRUKHW/R)LHIIHFWZHUGJHVWXXUG
+Balance (Effect Balance)
D>0E–D0<E [16 (40 03 12)]
3DVWGHYROXPHEDODQVDDQWXVVHQGHGLUHFWHHQGH
YHUZHUNWHNODQN
´'µRI´(µLQGHGLVSOD\EHWHNHQWUHVSHFWLHYHOLMN'GLUHFWH
NODQNRI(HIIHFWNODQNZDDUGHQYDQ
Low Gain
-12–+12 [17 (40 03 13)]
3DVWGHJDLQYDQGHODJHIUHTXHQWLHDDQ
Hi Gain (High Gain)
-12–+12 [18 (40 03 14)]
3DVWGHJDLQYDQGHKRJHIUHTXHQWLHDDQ
#Pan (Output Pan)
L63–0–R63 [19 (40 03 15)]
3DVWGHVWHUHRSRVLWLHDDQYDQGHXLWJHVWXXUGHNODQN/LV
XLWHUVWOLQNVLVKHWPLGGHQHQ5LVXLWHUVWUHFKWV
Level (Output Level)
3DVWKHWXLWJDQJVQLYHDXDDQ
106
34: Lo-Fi 2
0–127 [20 (40 03 16)]
fig.9-37
Radio
L
EQ
Lo-Fi
Lo-Fi
R
Balance
EQ
Noise
Generator
Lo-Fi Type
1–6 [1 (40 03 03)]
9HUPLQGHUWGHNODQNNZDOLWHLW'HNZDOLWHLWYDQGHNODQN
ZRUGWVOHFKWHUQDDUPDWHGH]HZDDUGHZRUGWYHUKRRJG
Fil Type (Filter Type)
Off/LPF/HPF [2 (40 03 04)]
%HSDDOWKHWVRRUWILOWHUGDW]DOZRUGHQWRHJHSDVWQDGDWGH
NODQNGRRUKHW/R)LHIIHFWZHUGJHVWXXUG
Cutoff (Cutoff Frequency)
250–8 k [3 (40 03 05)]
%HSDDOWGHDIVQLMIUHTXHQWLHYDQGHILOWHUGLHZRUGWWRHJHSDVW
QDGDWGHNODQNGRRUKHW/R)LHIIHFWZHUGJHVWXXUG
+R.Detune (Radio Detune)
0–127 [4 (40 03 06)]
'LWVLPXOHHUWGHUXLVYDQKHWDIVWHPPHQYDQHHQUDGLR$OV
GHZDDUGHYHUKRRJGZRUGW]DOKHWDIVWHPPHQQRJYHUGHU
JDDQ
R.Nz Lev (Radio Noise Level)
0–127 [5 (40 03 07)]
3DVWKHWYROXPHDDQYDQGHUDGLRUXLV
W/P Sel (White/Pink Noise Select)
White/Pink [6 (40 03 08)]
6HOHFWHHUWRIZHOZLWWHUXLVRIUR]HUXLV
W/P LPF (White/Pink Noise LPF)
250–6.3 k/Bypass [7 (40 03 09)]
%HSDDOWGHDIVQLMIUHTXHQWLHYDQGHORZSDVVILOWHUGLHRSGH
ZLWWHRIUR]HUXLVZRUGWWRHJHSDVW
W/P Level (White/Pink Noise Level) 0–127 [8 (40 03 0A)]
%HSDDOWKHWYROXPHYDQGHZLWWHRIUR]HUXLV
Disc Type (Disc Noise Type)LP/EP/SP/RND [9 (40 03 0B)]
6HOHFWHHUWKHWVRRUWRSQDPHUXLV'HIUHTXHQWLHZDDURSGH
UXLVJHKRRUGZRUGWLVDIKDQNHOLMNYDKHWJHVOHFWHHUGHW\SH
Disc LPF (Disc Noise LPF)
250–6.3 k/Bypass [10 (40 03 0C)]
%HSDDOWGHDIVQLMIUHTXHQWLHYDQGHORZSDVVILOWHUGLHRSGH
RSQDPHUXLVZRUGWWRHJHSDVW
Disc Nz Lev (Disc Noise Level)
0–127 [11 (40 03 0D)]
%HSDDOWKHWYROXPHYDQGHRSQDPHUXLV
Hum Type (Hum Noise Type)
50/60 Hz [12 (40 03 0E)]
6HOHFWHHUWKHWVRRUWYDQEURPUXLV
Invoegeffecten gebruiken
Hum LPF (Hum Noise LPF)
250–6.3 k/Bypass [13 (40 03 0F)]
%HSDDOWGHDIVQLMIUHTXHQWLHYDQGHORZSDVVILOWHUGLHRSGH
EURPUXLVZRUGWWRHJHSDVW
Hum Level (Hum Noise Level)
%HSDDOWKHWYROXPHYDQGHEURP
0–127 [14 (40 03 10)]
2'→&KRUXV2YHUGULYH→&KRUXV>++@
'LWHIIHFWPDDNWHHQVHULsOHYHUELQGLQJWXVVHQHHQ
RYHUVWXULQJHQHHQFKRUXV
fig.9-38
M/S (Mono/Stereo Switch) Mono/Stereo [15 (40 03 11)]
6HOHFWHHUWRIKHWHIIHFWPRQRRIVWHUHR]DO]LMQ
#Balance (Effect Balance)
D>0E–D0<E [16 (40 03 12)]
3DVWGHYROXPHEDODQVDDQWXVVHQGHGLUHFWHHQGH
YHUZHUNWHNODQN
´'µRI´(µLQGHGLVSOD\EHWHNHQWUHVSHFWLHYHOLMN'GLUHFWH
NODQNRI(HIIHFWNODQNZDDUGHQYDQ
Low Gain
-12–+12 [17 (40 03 13)]
3DVWGHJDLQYDQGHODJHIUHTXHQWLHDDQ
Hi Gain (High Gain)
-12–+12 [18 (40 03 14)]
3DVWGHJDLQYDQGHKRJHIUHTXHQWLHDDQ
Pan (Mono) (Output Pan (Mono))
L63–0–R63 [19 (40 03 15)]
:DQQHHUXGH0RQRPRGXVJHEUXLNWPRHWXGHVWHUHR
SRVLWLHYDQGHXLWJHVWXXUGHNODQNDDQSDVVHQ/LVXLWHUVW
OLQNVLVKHWPLGGHQHQ5LVXLWHUVWUHFKWV
Level (Output Level)
3DVWKHWXLWJDQJVQLYHDXDDQ
Effecten die twee soorten effecten serieel
verbinden. (series 2)
0–127 [20 (40 03 16)]
EQ
L
Overdrive
R
Chorus
Balance
EQ
OD Drive (Overdrive Drive)
0–127 [1 (40 03 03)]
3DVWGHJUDDGDDQYDQGHRYHUVWXULQJVYHUYRUPLQJ+HW
YROXPH]DOVDPHQPHWGHYHUYRUPLQJVJUDDGYHUDQGHUHQ
+OD Pan (Overdrive Drive Output Pan)
L63–0–R63 [2 (40 03 04)]
3DVWGHVWHUHRSRVLWLHDDQYDQGHRYHUVWXXUGHNODQN/LV
XLWHUVWOLQNVLVKHWPLGGHQHQ5LVXLWHUVWUHFKWV
OD Amp (Overdrive Amp Simulator Type)
Small/BltIn/2-Stk/3-Stk [3 (40 03 05)]
6HOHFWHHUWKHWW\SHJLWDDUYHUVWHUNHU
6PDOO NOHLQHYHUVWHUNHU
%OW,Q YHUVWHUNHUYDQHHQHQNHOHHHQKHLG
6WN JURWHGXEEHOJHVWDSHOGHYHUVWHUNHU
6WN JURWHGULHGXEEHOJHVWDSHOGHYHUVWHUNHU
OD Amp Sw (Overdrive Amp Switch)
Off/On [4 (40 03 06)]
=HW2'$PSDDQXLW
Cho Dly (Chorus Pre Delay)
0–100ms [6 (40 03 08)]
3DVWGHWLMGDDQGLHYHUORRSWYDQDIKHWEHJLQYDQGHGLUHFWH
NODQNWRWKHWZHHUNOLQNHQYDQGHFKRUXVNODQN
Cho Rate (Chorus Rate)
0.05–10.0 [7 (40 03 09)]
3DVWGHPRGXODWLHVQHOKHLGDDQYDQKHWFKRUXVHIIHFW
Cho Depth (Chorus Depth)
0–127 [8 (40 03 0A)]
3DVWGHPRGXODWLHGLHSWHDDQYDQKHWFKRUXVHIIHFW
#Cho Bal (Chorus Balance) D>0E–D0<E [10 (40 03 0C)]
3DVWGHYROXPHEDODQVDDQYDQGHNODQNGLHGRRUGHFKRUXV
JDDWHQGHNODQNGLHQLHWGRRUGHFKRUXVJDDW%LMHHQ
LQVWHOOLQJYDQ'!(]DODOOHHQGHRYHUVWXXUGHNODQN
ZRUGHQXLWJHVWXXUGHQELMHHQLQVWHOOLQJYDQ'(ZRUGW
GHRYHUVWXXUGHNODQNXLWJHVWXXUGGLHGRRUGHFKRUXVJDDW
´'µRI´(µLQGHGLVSOD\EHWHNHQWUHVSHFWLHYHOLMN'GLUHFWH
NODQNRI(HIIHFWNODQNZDDUGHQYDQ
Low Gain
-12–+12 [17 (40 03 13)]
3DVWGHJDLQYDQGHODJHIUHTXHQWLHDDQ
Hi Gain (High Gain)
-12–+12 [18 (40 03 14)]
3DVWGHJDLQYDQGHKRJHIUHTXHQWLHDDQ
Level (Output Level)
0–127 [20 (40 03 16)]
3DVWKHWXLWJDQJVYROXPHDDQ
107
Invoegeffecten gebruiken
36: OD → Flanger (Overdrive → Flanger)
[02H, 01H]
37: OD → Delay (Overdrive → Delay)
[02H, 02H]
'LWHIIHFWPDDNWHHQVHULsOHYHUELQGLQJWXVVHQHHQ
RYHUVWXULQJHQHHQIODQJHU
'LWHIIHFWPDDNWHHQVHULsOHYHUELQGLQJWXVVHQHHQ
RYHUVWXULQJHQHHQGHOD\
fig.9-39
fig.9-40
EQ
L
Overdrive
R
Flanger
Overdrive
Balance
EQ
EQ
L
R
Delay
Balance
EQ
OD Drive (Overdrive Drive)
0–127 [1 (40 03 03)]
3DVWGHJUDDGDDQYDQGHRYHUVWXULQJVYHUYRUPLQJ+HW
YROXPH]DOVDPHQPHWGHYHUYRUPLQJVJUDDGYHUDQGHUHQ
OD Drive (Overdrive Drive)
0–127 [1 (40 03 03)]
3DVWGHJUDDGDDQYDQGHRYHUVWXULQJVYHUYRUPLQJ+HW
YROXPH]DOVDPHQPHWGHYHUYRUPLQJVJUDDGYHUDQGHUHQ
+OD Pan (Overdrive Drive Output Pan)
L63–0–R63 [2 (40 03 04)]
3DVWGHVWHUHRSRVLWLHDDQYDQGHRYHUVWXXUGHNODQN/LV
XLWHUVWOLQNVLVKHWPLGGHQHQ5LVXLWHUVWUHFKWV
+OD Pan (Overdrive Output Pan) L63–0–R63 [2 (40 03 04)]
3DVWGHVWHUHRSRVLWLHDDQYDQGHRYHUVWXXUGHNODQN/LV
XLWHUVWOLQNVLVKHWPLGGHQHQ5LVXLWHUVWUHFKWV
OD Amp (Overdrive Amp Simulator Type)
Small/BltIn/2-Stk/3-Stk [3 (40 03 05)]
6HOHFWHHUWKHWW\SHJLWDDUYHUVWHUNHU
6PDOO NOHLQHYHUVWHUNHU
%OW,Q YHUVWHUNHUYDQHHQHQNHOHHHQKHLG
6WN JURWHGXEEHOJHVWDSHOGHYHUVWHUNHU
6WN JURWHGULHGXEEHOJHVWDSHOGHYHUVWHUNHU
OD Amp Sw (Overdrive Amp Switch)
Off/On [4 (40 03 06)]
=HW2'$PSDDQXLW
FL Dly (Flanger Pre Delay)
0–100ms [6 (40 03 08)]
3DVWGHWLMGDDQGLHYHUORRSWYDQDIKHWEHJLQYDQGHGLUHFWH
NODQNWRWKHWZHHUNOLQNHQYDQGHIODQJHUNODQN
FL Rate (Flanger Rate)
0.05–10.0 [7 (40 03 09)]
3DVWGHPRGXODWLHVQHOKHLGDDQYDQKHWIODQJHUHIIHFW
FL Depth (Flanger Depth)
0–127 [8 (40 03 0A)]
3DVWGHPRGXODWLHGLHSWHDDQYDQKHWIODQJHUHIIHFW
FL Fb (Flanger Feedback Level) -98%–+98% [9 (40 03 0B)]
3DVWGHYHUKRXGLQJDDQYDQGHIODQJHUNODQNGLHQDDU
KHWHIIHFWZRUGWWHUXJJHVWXXUG1HJDWLHYHLQVWHOOLQJHQ
GUDDLHQGHIDVHRP
#FL Bal (Flanger Balance)
D>0E–D0<E [10 (40 03 0C)]
3DVWGHYROXPHEDODQVDDQYDQGHNODQNGLHGRRUGHIODQJHU
JDDWHQGHNODQNGLHQLHWGRRUGHIODQJHUJDDW%LMHHQ
LQVWHOOLQJYDQ'!(]DODOOHHQGHRYHUVWXXUGHNODQN
ZRUGHQXLWJHVWXXUGHQELMHHQLQVWHOOLQJYDQ'(ZRUGW
GHRYHUVWXXUGHNODQNXLWJHVWXXUGGLHGRRUGHIODQJHUJDDW
´'µRI´(µLQGHGLVSOD\EHWHNHQWUHVSHFWLHYHOLMN'GLUHFWH
NODQNRI(HIIHFWNODQNZDDUGHQYDQ
Low Gain
-12–+12 [17 (40 03 13)]
3DVWGHJDLQYDQGHODJHIUHTXHQWLHDDQ
Hi Gain (High Gain)
-12–+12 [18 (40 03 14)]
3DVWGHJDLQYDQGHKRJHIUHTXHQWLHDDQ
Level (Output Level)
3DVWKHWXLWJDQJVYROXPHDDQ
108
0–127 [20 (40 03 16)]
OD Amp (Overdrive Amp Simulator Type)
Small/BltIn/2-Stk/3-Stk [3 (40 03 05)]
6HOHFWHHUWKHWW\SHJLWDDUYHUVWHUNHU
6PDOO NOHLQHYHUVWHUNHU
%OW,Q YHUVWHUNHUYDQHHQHQNHOHHHQKHLG
6WN JURWHGXEEHOJHVWDSHOGHYHUVWHUNHU
6WN
JURWHGULHGXEEHOJHVWDSHOGHYHUVWHUNHU
OD Amp Sw (Overdrive Amp Switch)
Off/On [4 (40 03 06)]
=HW2'$PSDDQXLW
Dly Time (Delay Time)
0–500ms [6 (40 03 08)]
3DVWGHWLMGDDQGLHYHUORRSWYDQDIKHWEHJLQYDQGHGLUHFWH
NODQNWRWKHWZHHUNOLQNHQYDQGHGHOD\NODQN
Dly Fb (Delay Feedback Level) -98%–+98% [7 (40 03 09)]
3DVWGHYHUKRXGLQJDDQYDQGHGHOD\NODQNGLHQDDUKHW
HIIHFWZRUGWWHUXJJHVWXXUG1HJDWLHYHLQVWHOOLQJHQ
GUDDLHQGHIDVHRP
Dly HF (Delay HF Damp) 315–8k/Bypass [8 (40 03 0A)]
3DVWGHIUHTXHQWLHDDQZDDUERYHQHHQGHOD\NODQNZRUGW
DIJHVQHGHQGLHQDDUKHWHIIHFWZRUGWWHUXJJHVWXXUG$OVX
GHKRJHIUHTXHQWLHVQLHWZLODIVQLMGHQPRHWXGH]H
SDUDPHWHURS%\SDVV]HWWHQ
#Dly Bal (Delay Balance)
D>0E–D0<E [10 (40 03 0C)]
3DVWGHYROXPHEDODQVDDQYDQGHNODQNGLHGRRUGHGHOD\
JDDWHQGHNODQNGLHQLHWGRRUGHGHOD\JDDW%LMHHQ
LQVWHOOLQJYDQ'!(]DODOOHHQGHRYHUVWXXUGHNODQN
ZRUGHQXLWJHVWXXUGHQELMHHQLQVWHOOLQJYDQ'(ZRUGW
GHRYHUVWXXUGHNODQNXLWJHVWXXUGGLHGRRUGHGHOD\JDDW
´'µRI´(µLQGHGLVSOD\EHWHNHQWUHVSHFWLHYHOLMN'GLUHFWH
NODQNRI(HIIHFWNODQNZDDUGHQYDQ
Low Gain
-12–+12 [17 (40 03 13)]
3DVWGHJDLQYDQGHODJHIUHTXHQWLHDDQ
Hi Gain (High Gain)
-12–+12 [18 (40 03 14)]
3DVWGHJDLQYDQGHKRJHIUHTXHQWLHDDQ
Level (Output Level)
3DVWKHWXLWJDQJVYROXPHDDQ
0–127 [20 (40 03 16)]
Invoegeffecten gebruiken
38: DS → Chorus (Distortion → Chorus)
[02H, 03H]
39: DS → Flanger (Distortion → Flanger)
[02H, 04H]
'LWHIIHFWPDDNWHHQVHULsOHYHUELQGLQJWXVVHQHHQ
YHUYRUPLQJHQHHQFKRUXV
'LWHIIHFWPDDNWHHQVHULsOHYHUELQGLQJWXVVHQHHQGLVWRUWLRQ
HQHHQIODQJHU
fig.9-41
fig.9-42
EQ
L
Distortion
R
Chorus
Balance
EQ
EQ
L
Distortion
R
Flanger
Balance
EQ
DS Drive (Distortion Drive)
0–127 [1 (40 03 03)]
3DVWGHJUDDGDDQYDQGHYHUYRUPLQJ+HWYROXPH]DO
VDPHQPHWGHYHUYRUPLQJVJUDDGYHUDQGHUHQ
DS Drive (Distortion Drive)
0–127 [1 (40 03 03)]
3DVWGHJUDDGDDQYDQGHYHUYRUPLQJ+HWYROXPH]DO
VDPHQPHWGHYHUYRUPLQJVJUDDGYHUDQGHUHQ
+DS Pan (Distortion Output Pan) L63–0–R63 [2 (40 03 04)]
3DVWGHVWHUHRSRVLWLHDDQYDQGHYHUYRUPGHNODQN/LV
XLWHUVWOLQNVLVKHWPLGGHQHQ5LVXLWHUVWUHFKWV
+DS Pan (Distortion Output Pan) L63–0–R63 [2 (40 03 04)]
3DVWGHVWHUHRSRVLWLHDDQYDQGHYHUYRUPGHNODQN/LV
XLWHUVWOLQNVLVKHWPLGGHQHQ5LVXLWHUVWUHFKWV
DS Amp (Distortion Amp Simulator Type)
Small/BltIn/2-Stk/3-Stk [3 (40 03 05)]
6HOHFWHHUWKHWW\SHJLWDDUYHUVWHUNHU
6PDOO NOHLQHYHUVWHUNHU
%OW,Q YHUVWHUNHUYDQHHQHQNHOHHHQKHLG
6WN JURWHGXEEHOJHVWDSHOGHYHUVWHUNHU
6WN
JURWHGULHGXEEHOJHVWDSHOGHYHUVWHUNHU
DS Amp (Distortion Amp Simulator Type)
Small/BltIn/2-Stk/3-Stk [3 (40 03 05)]
6HOHFWHHUWKHWW\SHJLWDDUYHUVWHUNHU
6PDOO NOHLQHYHUVWHUNHU
%OW,Q YHUVWHUNHUYDQHHQHQNHOHHHQKHLG
6WN JURWHGXEEHOJHVWDSHOGHYHUVWHUNHU
6WN
JURWHGULHGXEEHOJHVWDSHOGHYHUVWHUNHU
DS Amp Sw (Distortion Amp Switch) Off/On [4 (40 03 06)]
=HW2'$PSDDQXLW
DS Amp Sw (Distortion Amp Switch) Off/On [4 (40 03 06)]
=HW2'$PSDDQXLW
Cho Dly (Chorus Pre Delay)
0–100ms [6 (40 03 08)]
3DVWGHWLMGDDQGLHYHUORRSWYDQDIKHWEHJLQYDQGHGLUHFWH
NODQNWRWKHWZHHUNOLQNHQYDQGHFKRUXVNODQN
FL Dly (Flanger Pre Delay)
0–100ms [6 (40 03 08)]
3DVWGHWLMGDDQGLHYHUORRSWYDQDIKHWEHJLQYDQGHGLUHFWH
NODQNWRWKHWZHHUNOLQNHQYDQGHIODQJHUNODQN
Cho Rate (Chorus Rate)
0.05–10.0 [7 (40 03 09)]
3DVWGHPRGXODWLHVQHOKHLGDDQYDQKHWFKRUXVHIIHFW
FL Rate (Flanger Rate)
0.05–10.0 [7 (40 03 09)]
3DVWGHPRGXODWLHVQHOKHLGDDQYDQKHWIODQJHUHIIHFW
Cho Depth (Chorus Depth)
0–127 [8 (40 03 0A)]
3DVWGHPRGXODWLHGLHSWHDDQYDQKHWFKRUXVHIIHFW
FL Depth (Flanger Depth)
0–127 [8 (40 03 0A)]
3DVWGHPRGXODWLHGLHSWHDDQYDQKHWIODQJHUHIIHFW
#Cho Bal (Chorus Balance) D>0E–D0<E [10 (40 03 0C)]
3DVWGHYROXPHEDODQVDDQYDQGHNODQNGLHGRRUGHFKRUXV
JDDWHQGHNODQNGLHQLHWGRRUGHFKRUXVJDDW%LMHHQ
LQVWHOOLQJYDQ'!(]DODOOHHQGHYHUYRUPGHNODQNZRUGHQ
XLWJHVWXXUGHQELMHHQLQVWHOOLQJYDQ'(ZRUGWGH
YHUYRUPGHNODQNXLWJHVWXXUGGLHGRRUGHFKRUXVJDDW
´'µRI´(µLQGHGLVSOD\EHWHNHQWUHVSHFWLHYHOLMN'GLUHFWH
NODQNRI(HIIHFWNODQNZDDUGHQYDQ
FL Fb (Flanger Feedback Level)
-98%–+98% [9 (40 03 0B)]
3DVWGHYHUKRXGLQJDDQYDQGHIODQJHUNODQNGLHQDDU
KHWHIIHFWZRUGWWHUXJJHVWXXUG1HJDWLHYHLQVWHOOLQJHQ
GUDDLHQGHIDVHRP
Low Gain
-12–+12 [17 (40 03 13)]
3DVWGHJDLQYDQGHODJHIUHTXHQWLHDDQ
Hi Gain (High Gain)
-12–+12 [18 (40 03 14)]
3DVWGHJDLQYDQGHKRJHIUHTXHQWLHDDQ
Level (Output Level)
3DVWKHWXLWJDQJVYROXPHDDQ
0–127 [20 (40 03 16)]
#FL Bal (Flanger Balance)
D>0E–D0<E [10 (40 03 0C)]
3DVWGHYROXPHEDODQVDDQYDQGHNODQNGLHGRRUGHIODQJHU
JDDWHQGHNODQNGLHQLHWGRRUGHIODQJHUJDDW%LMHHQ
LQVWHOOLQJYDQ'!(]DODOOHHQGHYHUYRUPGHNODQNZRUGHQ
XLWJHVWXXUGHQELMHHQLQVWHOOLQJYDQ'(ZRUGWGH
YHUYRUPGHNODQNXLWJHVWXXUGGLHGRRUGHIODQJHUJDDW
´'µRI´(µLQGHGLVSOD\EHWHNHQWUHVSHFWLHYHOLMN'GLUHFWH
NODQNRI(HIIHFWNODQNZDDUGHQYDQ
Low Gain
-12–+12 [17 (40 03 13)]
3DVWGHJDLQYDQGHODJHIUHTXHQWLHDDQ
Hi Gain (High Gain)
-12–+12 [18 (40 03 14)]
3DVWGHJDLQYDQGHKRJHIUHTXHQWLHDDQ
Level (Output Level)
3DVWKHWXLWJDQJVYROXPHDDQ
0–127 [20 (40 03 16)]
109
Invoegeffecten gebruiken
40: DS → Delay (Distortion → Delay )
[02H, 05H]
41: EH → Chorus (Enhancer → Chorus)
[02H, 06H]
'LWHIIHFWPDDNWHHQVHULsOHYHUELQGLQJWXVVHQHHQ
YHUYRUPLQJHQHHQGHOD\
'LWHIIHFWPDDNWHHQVHULsOHYHUELQGLQJWXVVHQHHQHQKDQFHU
HQHHQFKRUXV
fig.9-43
fig.9-44
EQ
L
Distortion
R
Delay
EQ
+DS Pan (Distortion Output Pan) L63–0–R63 [2 (40 03 04)]
3DVWGHVWHUHRSRVLWLHDDQYDQGHYHUYRUPGHNODQN/LV
XLWHUVWOLQNVLVKHWPLGGHQHQ5LVXLWHUVWUHFKWV
DS Amp (Distortion Amp Simulator Type)
Small/BltIn/2-Stk/3-Stk [3 (40 03 05)]
6HOHFWHHUWKHWW\SHJLWDDUYHUVWHUNHU
6PDOO NOHLQHYHUVWHUNHU
%OW,Q YHUVWHUNHUYDQHHQHQNHOHHHQKHLG
6WN JURWHGXEEHOJHVWDSHOGHYHUVWHUNHU
6WN
JURWHGULHGXEEHOJHVWDSHOGHYHUVWHUNHU
DS Amp Sw (Distortion Amp Switch) Off/On [4 (40 03 06)]
=HW2'$PSDDQXLW
Dly Time (Delay Time)
0–500ms [6 (40 03 08)]
3DVWGHWLMGDDQGLHYHUORRSWYDQDIKHWEHJLQYDQGHGLUHFWH
NODQNWRWKHWZHHUNOLQNHQYDQGHGHOD\NODQN
Dly Fb (Delay Feedback Level) -98%–+98% [7 (40 03 09)]
3DVWGHYHUKRXGLQJDDQYDQGHGHOD\NODQNGLHQDDUKHW
HIIHFWZRUGWWHUXJJHVWXXUG1HJDWLHYHLQVWHOOLQJHQ
GUDDLHQGHIDVHRP
Dly HF (Delay HF Damp) 315–8k/Bypass [8 (40 03 0A)]
3DVWGHIUHTXHQWLHDDQZDDUERYHQHHQGHOD\NODQNZRUGW
DIJHVQHGHQGLHQDDUKHWHIIHFWZRUGWWHUXJJHVWXXUG$OVX
GHKRJHIUHTXHQWLHVQLHWZLODIVQLMGHQPRHWXGH]H
SDUDPHWHURS%\SDVV]HWWHQ
#Dly Bal (Delay Balance)
D>0E–D0<E [10 (40 03 0C)]
3DVWGHYROXPHEDODQVDDQYDQGHNODQNGLHGRRUGHGHOD\
JDDWHQGHNODQNGLHQLHWGRRUGHGHOD\JDDW%LMHHQ
LQVWHOOLQJYDQ'!(]DODOOHHQGHYHUYRUPGHNODQNZRUGHQ
XLWJHVWXXUGHQELMHHQLQVWHOOLQJYDQ'(ZRUGWGH
YHUYRUPGHNODQNXLWJHVWXXUGGLHGRRUGHGHOD\JDDW
´'µRI´(µLQGHGLVSOD\EHWHNHQWUHVSHFWLHYHOLMN'GLUHFWH
NODQNRI(HIIHFWNODQNZDDUGHQYDQ
Low Gain
-12–+12 [17 (40 03 13)]
3DVWGHJDLQYDQGHODJHIUHTXHQWLHDDQ
Hi Gain (High Gain)
-12–+12 [18 (40 03 14)]
3DVWGHJDLQYDQGHKRJHIUHTXHQWLHDDQ
110
Enhancer
Balance
DS Drive (Distortion Drive)
0–127 [1 (40 03 03)]
3DVWGHJUDDGDDQYDQGHYHUYRUPLQJ+HWYROXPH]DO
VDPHQPHWGHYHUYRUPLQJVJUDDGYHUDQGHUHQ
Level (Output Level)
3DVWKHWXLWJDQJVYROXPHDDQ
L
0–127 [20 (40 03 16)]
EQ
Chorus
R
Enhancer
Balance
EQ
+EH Sens (Enhancer Sensitivity)
0–127 [1 (40 03 03)]
3DVWGHJHYRHOLJKHLGYDQGHHQKDQFHUDDQ
EH Mix (Enhancer Mix Level)
0–127 [2 (40 03 04)]
3DVWGHYHUKRXGLQJDDQZDDULQGHRYHUWRQHQGLHGRRUGH
HQKDQFHUZRUGHQJHJHQHUHHUGPHWGHGLUHFWHNODQNJHFRP
ELQHHUGZRUGHQ
Cho Dly (Chorus Pre Delay)
0–100ms [6 (40 03 08)]
3DVWGHWLMGDDQGLHYHUORRSWYDQDIKHWEHJLQYDQGHGLUHFWH
NODQNWRWKHWZHHUNOLQNHQYDQGHFKRUXVNODQN
Cho Rate (Chorus Rate)
0.05–10.0 [7 (40 03 09)]
3DVWGHPRGXODWLHVQHOKHLGDDQYDQKHWFKRUXVHIIHFW
Cho Depth (Chorus Depth)
0–127 [8 (40 03 0A)]
3DVWGHPRGXODWLHGLHSWHDDQYDQKHWFKRUXVHIIHFW
#Cho Bal (Chorus Balance)
D>0E–D0<E[10 (40 03 0C)]
3DVWGHYROXPHEDODQVDDQYDQGHNODQNGLHGRRUGHFKRUXV
JDDWHQGHNODQNGLHQLHWGRRUGHFKRUXVJDDW%LMHHQ
LQVWHOOLQJYDQ'!(]DODOOHHQGHHQKDQFHUNODQNZRUGHQ
XLWJHVWXXUGHQELMHHQLQVWHOOLQJYDQ'(ZRUGWGH
HQKDQFHUNODQNXLWJHVWXXUGGLHGRRUGHGHOD\JDDW
´'µRI´(µLQGHGLVSOD\EHWHNHQWUHVSHFWLHYHOLMN'GLUHFWH
NODQNRI(HIIHFWNODQNZDDUGHQYDQ
Low Gain
-12–+12 [17 (40 03 13)]
3DVWGHJDLQYDQGHODJHIUHTXHQWLHDDQ
Hi Gain (High Gain)
-12–+12 [18 (40 03 14)]
3DVWGHJDLQYDQGHKRJHIUHTXHQWLHDDQ
Level (Output Level)
3DVWKHWXLWJDQJVYROXPHDDQ
0–127 [20 (40 03 16)]
Invoegeffecten gebruiken
42: EH → Flanger (Enhancer → Flanger)
[02H, 07H]
43: EH → Delay (Enhancer → Delay)
[02H, 08H]
'LWHIIHFWPDDNWHHQVHULsOHYHUELQGLQJWXVVHQHHQHQKDQFHU
HQHHQIODQJHU
'LWHIIHFWPDDNWHHQVHULsOHYHUELQGLQJWXVVHQHHQHQKDQFHU
HQHHQGHOD\
fig.9-45
fig.9-46
L
Enhancer
EQ
Flanger
R
Enhancer
L
Enhancer
Delay
Balance
EQ
EQ
R
Enhancer
Balance
EQ
+EH Sens (Enhancer Sensitivity)
0–127 [1 (40 03 03)]
3DVWGHJHYRHOLJKHLGYDQGHHQKDQFHUDDQ
+EH Sens (Enhancer Sensitivity)
0–127 [1 (40 03 03)]
3DVWGHJHYRHOLJKHLGYDQGHHQKDQFHUDDQ
EH Mix (Enhancer Mix Level)
0–127 [2 (40 03 04)]
3DVWGHYHUKRXGLQJDDQZDDULQGHRYHUWRQHQGLHGRRUGH
HQKDQFHUZRUGHQJHJHQHUHHUGPHWGHGLUHFWHNODQNJHFRP
ELQHHUGZRUGHQ
EH Mix (Enhancer Mix Level)
0–127 [2 (40 03 04)]
3DVWGHYHUKRXGLQJDDQZDDULQGHRYHUWRQHQGLHGRRUGH
HQKDQFHUZRUGHQJHJHQHUHHUGPHWGHGLUHFWHNODQNJHFRP
ELQHHUGZRUGHQ
FL Dly (Flanger Pre Delay)
0–100ms [6 (40 03 08)]
3DVWGHWLMGDDQGLHYHUORRSWYDQDIKHWEHJLQYDQGHGLUHFWH
NODQNWRWKHWZHHUNOLQNHQYDQGHIODQJHUNODQN
Dly Time (Delay Time)
0–500ms [6 (40 03 08)]
3DVWGHWLMGDDQGLHYHUORRSWYDQDIKHWEHJLQYDQGHGLUHFWH
NODQNWRWKHWZHHUNOLQNHQYDQGHGHOD\NODQN
FL Rate (Flanger Rate)
0.05–10.0 [7 (40 03 09)]
3DVWGHPRGXODWLHVQHOKHLGDDQYDQKHWIODQJHUHIIHFW
FL Depth (Flanger Depth)
0–127 [8 (40 03 0A)]
3DVWGHPRGXODWLHGLHSWHDDQYDQKHWIODQJHUHIIHFW
Dly Fb (Delay Feedback Level) -98%–+98% [7 (40 03 09)]
3DVWGHYHUKRXGLQJDDQYDQGHGHOD\NODQNGLHQDDUKHW
HIIHFWZRUGWWHUXJJHVWXXUG1HJDWLHYHLQVWHOOLQJHQ
GUDDLHQGHIDVHRP
FL Fb (Flanger Feedback Level)
-98%–+98% [9 (40 03 0B)]
3DVWGHYHUKRXGLQJDDQYDQGHIODQJHUNODQNGLHQDDU
KHWHIIHFWZRUGWWHUXJJHVWXXUG1HJDWLHYHLQVWHOOLQJHQ
GUDDLHQGHIDVHRP
Dly HF (Delay HF Damp) 315–8k/Bypass [8 (40 03 0A)]
3DVWGHIUHTXHQWLHDDQZDDUERYHQHHQGHOD\NODQNZRUGW
DIJHVQHGHQGLHQDDUKHWHIIHFWZRUGWWHUXJJHVWXXUG$OVX
GHKRJHIUHTXHQWLHVQLHWZLODIVQLMGHQPRHWXGH]H
SDUDPHWHURS%\SDVV]HWWHQ
#FL Bal (Flanger Balance)
D>0E–D0<E [10 (40 03 0C)]
3DVWGHYROXPHEDODQVDDQYDQGHNODQNGLHGRRUGHIODQJHU
JDDWHQGHNODQNGLHQLHWGRRUGHIODQJHUJDDW%LMHHQ
LQVWHOOLQJYDQ'!(]DODOOHHQGHHQKDQFHUNODQNZRUGHQ
XLWJHVWXXUGHQELMHHQLQVWHOOLQJYDQ'(ZRUGWGH
HQKDQFHUNODQNXLWJHVWXXUGGLHGRRUGHGHOD\JDDW
´'µRI´(µLQGHGLVSOD\EHWHNHQWUHVSHFWLHYHOLMN'GLUHFWH
NODQNRI(HIIHFWNODQNZDDUGHQYDQ
#Dly Bal (Delay Balance)
D>0E–D0<E [10 (40 03 0C)]
3DVWGHYROXPHEDODQVDDQYDQGHNODQNGLHGRRUGHGHOD\
JDDWHQGHNODQNGLHQLHWGRRUGHGHOD\JDDW%LMHHQ
LQVWHOOLQJYDQ'!(]DODOOHHQGHHQKDQFHUNODQNZRUGHQ
XLWJHVWXXUGHQELMHHQLQVWHOOLQJYDQ'(ZRUGWGH
HQKDQFHUNODQNXLWJHVWXXUGGLHGRRUGHGHOD\JDDW
´'µRI´(µLQGHGLVSOD\EHWHNHQWUHVSHFWLHYHOLMN'GLUHFWH
NODQNRI(HIIHFWNODQNZDDUGHQYDQ
Low Gain
-12–+12 [17 (40 03 13)]
3DVWGHJDLQYDQGHODJHIUHTXHQWLHDDQ
Low Gain
-12–+12 [17 (40 03 13)]
3DVWGHJDLQYDQGHODJHIUHTXHQWLHDDQ
Hi Gain (High Gain)
-12–+12 [18 (40 03 14)]
3DVWGHJDLQYDQGHKRJHIUHTXHQWLHDDQ
Hi Gain (High Gain)
-12–+12 [18 (40 03 14)]
3DVWGHJDLQYDQGHKRJHIUHTXHQWLHDDQ
Level (Output Level)
3DVWKHWXLWJDQJVYROXPHDDQ
Level (Output Level)
3DVWKHWXLWJDQJVYROXPHDDQ
0–127 [20 (40 03 16)]
0–127 [20 (40 03 16)]
111
Invoegeffecten gebruiken
44: Cho → Delay (Chorus → Delay)
[02H, 09H]
45: FL → Delay (Flanger → Delay)
[02H, 0AH]
'LWHIIHFWPDDNWHHQVHULsOHYHUELQGLQJWXVVHQHHQFKRUXVHQ
HHQGHOD\
'LWHIIHFWPDDNWHHQVHULsOHYHUELQGLQJWXVVHQHHQIODQJHUHQ
HHQGHOD\
fig.9-47
fig.9-48
L
EQ
Chorus
R
L
Delay
EQ
Flanger
EQ
R
Delay
EQ
Cho Dly (Chorus Pre Delay)
0–100ms [1 (40 03 03)]
3DVWGHWLMGDDQGLHYHUORRSWYDQDIGHGLUHFWHNODQNWRWKHW
ZHHUNOLQNHQYDQGHFKRUXVNODQN
FL Dly (Flanger Pre Delay)
0–100ms [1 (40 03 03)]
3DVWGHWLPHGHOD\DDQGLHYHUORRSWYDQDIGHGLUHFWHNODQN
WRWKHWZHHUNOLQNHQYDQGHIODQJHUNODQN
Cho Rate (Chorus Rate)
0.05–10.0 [2 (40 03 04)]
3DVWGHPRGXODWLHVQHOKHLGYDQKHWFKRUXVHIIHFWDDQ
FL Rate (Flanger Rate)
0.05–10.0 [2 (40 03 04)]
3DVWGHPRGXODWLHVQHOKHLGYDQKHWIODQJHUHIIHFWDDQ
Cho Depth (Chorus Depth)
0–127 [3 (40 03 05)]
3DVWGHPRGXODWLHGLHSWHYDQKHWFKRUXVHIIHFWDDQ
FL Depth (Flanger Depth)
0–127 [3 (40 03 05)]
3DVWGHPRGXODWLHGLHSWHYDQKHWIODQJHUHIIHFWDDQ
+Cho Bal (Chorus Balance)
D>0E–D0<E [5 (40 03 07)]
3DVWGHYROXPHEDODQVDDQYDQGHGLUHFWHNODQNHQGH
FKRUXVNODQN%LMHHQLQVWHOOLQJYDQ'!(]DODOOHHQGH
GULHFWHNODQNZRUGHQXLWJHVWXXUGHQELMHHQLQVWHOOLQJYDQ
'(]DODOOHHQGHFKRUXVNODQNZRUGHQXLWJHVWXXUG
´'µRI´(µLQGHGLVSOD\EHWHNHQWUHVSHFWLHYHOLMN'GLUHFWH
NODQNRI(HIIHFWNODQNZDDUGHQYDQ
+FL Fb (Flanger Feedback Level) -98%–+98% [4 (40 03 06)]
3DVWGHYHUKRXGLQJDDQYDQGHIODQJHUNODQNGLHQDDU
KHWHIIHFWZRUGWWHUXJJHVWXXUG1HJDWLHYHLQVWHOOLQJHQ
GUDDLHQGHIDVHRP
Dly Time (Delay Time)
0–500ms [6 (40 03 08)]
3DVWGHGHOD\WLMGDDQGLHYHUORRSWYDQDIKHWEHJLQYDQGH
GLUHFWHNODQNWRWKHWZHHUNOLQNHQYDQGHGHOD\NODQN
Dly Fb (Delay Feedback Level) -98%–+98% [7 (40 03 09)]
3DVWGHYHUKRXGLQJDDQYDQGHGHOD\NODQNGLHQDDUGH
GHOD\LQJDQJZRUGWWHUXJJHVWXXUG1HJDWLHYHLQVWHOO
LQJHQGUDDLHQGHIDVHRP
Dly HF (Delay HF Damp) 315–8k/Bypass [8 (40 03 0A)]
3DVWGHIUHTXHQWLHDDQZDDUERYHQHHQGHOD\NODQNZRUGW
DIJHVQHGHQGLHQDDUGHGHOD\LQJDQJZRUGWWHUXJJHVWXXUG
$OVXGHKRJHIUHTXHQWLHVYDQGHIHHGEDFNQLHWZLO
DIVQLMGHQPRHWXGH]HSDUDPHWHURS%\SDVV]HWWHQ
#Dly Bal (Delay Balance)
D>0E–D0<E [10 (40 03 0C)]
3DVWGHYROXPHEDODQVDDQYDQGHNODQNGLHGRRUGHGHOD\
JDDWHQGHNODQNGLHQLHWGRRUGHGHOD\JDDW%LMHHQ
LQVWHOOLQJYDQ'!(]DODOOHHQGHFKRUXVNODQNZRUGHQ
XLWJHVWXXUGHQELMHHQLQVWHOOLQJYDQ'(ZRUGWGHFKRUXV
NODQNXLWJHVWXXUGGLHGRRUGHGHOD\JDDW
´'µRI´(µLQGHGLVSOD\EHWHNHQWUHVSHFWLHYHOLMN'GLUHFWH
NODQNRI(HIIHFWNODQNZDDUGHQYDQ
Low Gain
-12–+12 [17 (40 03 13)]
3DVWGHJDLQYDQGHODJHIUHTXHQWLHDDQ
Hi Gain (High Gain)
-12–+12 [18 (40 03 14)]
3DVWGHJDLQYDQGHKRJHIUHTXHQWLHDDQ
Level (Output Level)
3DVWKHWXLWJDQJVYROXPHDDQ
0–127 [20 (40 03 16)]
FL Bal (Flanger Balance)
D>0E–D0<E [5 (40 03 07)]
3DVWGHYROXPHEDODQVDDQYDQGHNODQNWXVVHQGHGLUHFWH
NODQNHQGHIODQJHUNODQN%LMHHQLQVWHOOLQJYDQ'!(]DO
DOOHHQGHGLUHFWHNODQNZRUGHQXLWJHVWXXUGHQELMHHQ
LQVWHOOLQJYDQ'(ZRUGWDOOHHQGHFKRUXVNODQNXLWJH
VWXXUG
´'µRI´(µLQGHGLVSOD\EHWHNHQWUHVSHFWLHYHOLMN'GLUHFWH
NODQNRI(HIIHFWNODQNZDDUGHQYDQ
Dly Time (Delay Time)
0–500ms [6 (40 03 08)]
3DVWGHGHOD\WLMGDDQGLHYHUORRSWYDQDIKHWEHJLQYDQGH
GLUHFWHNODQNWRWKHWZHHUNOLQNHQYDQGHGHOD\NODQN
Dly Fb (Delay Feedback Level) -98%–+98% [7 (40 03 09)]
3DVWGHYHUKRXGLQJDDQYDQGHGHOD\NODQNGLHQDDUGH
GHOD\LQJDQJZRUGWWHUXJJHVWXXUG1HJDWLHYHLQVWHOO
LQJHQGUDDLHQGHIDVHRP
Dly HF (Delay HF Damp) 315–8k/Bypass [8 (40 03 0A)]
3DVWGHIUHTXHQWLHDDQZDDUERYHQHHQGHOD\NODQNZRUGW
DIJHVQHGHQGLHQDDUGHGHOD\LQJDQJZRUGWWHUXJJHVWXXUG
$OVXGHKRJHIUHTXHQWLHVYDQGHIHHGEDFNQLHWZLO
DIVQLMGHQPRHWXGH]HSDUDPHWHURS%\SDVV]HWWHQ
#Dly Bal (Delay Balance)
D>0E–D0<E [10 (40 03 0C)]
3DVWGHYROXPHEDODQVDDQYDQGHNODQNGLHGRRUGHGHOD\
JDDWHQGHNODQNGLHQLHWGRRUGHGHOD\JDDW%LMHHQ
LQVWHOOLQJYDQ'!(]DODOOHHQGHIODQJHUNODQNZRUGHQ
XLWJHVWXXUGHQELMHHQLQVWHOOLQJYDQ'(ZRUGWGH
IODQJHUNODQNXLWJHVWXXUGGLHGRRUGHGHOD\JDDW
´'µRI´(µLQGHGLVSOD\EHWHNHQWUHVSHFWLHYHOLMN'GLUHFWH
NODQNRI(HIIHFWNODQNZDDUGHQYDQ
Low Gain
-12–+12 [17 (40 03 13)]
3DVWGHJDLQYDQGHODJHIUHTXHQWLHDDQ
Hi Gain (High Gain)
-12–+12 [18 (40 03 14)]
3DVWGHJDLQYDQGHKRJHIUHTXHQWLHDDQ
Level (Output Level)
3DVWKHWXLWJDQJVYROXPHDDQ
112
0–127 [20 (40 03 16)]
Invoegeffecten gebruiken
46: Cho → Flanger (Chorus → Flanger)
[02H, 0BH]
'LWHIIHFWPDDNWHHQVHULsOHYHUELQGLQJWXVVHQHHQFKRUXVHQ
HQIODQJHU
fig.9-49
L
EQ
Chorus
R
47: Rotary Multi
[03H, 00H]
'LWPDDNWHHQVHULsOHYHUELQGLQJWXVVHQGH2YHUGULYH2'
EDQGHTXDOL]HU(4HQ5RWDU\57HIIHFWHQ
fig.9-50
Flanger
L
EQ
Cho Dly (Chorus Pre Delay)
0–100ms [1 (40 03 03)]
3DVWGHWLMVDDQGLHYHUORRSWYDQDIGHGLUHFWHNODQNWRWKHW
ZHHUNOLQNHQYDQGHFKRUXVNODQN
Cho Rate (Chorus Rate)
0.05–10.0 [2 (40 03 04)]
3DVWGHPRGXODWLHVQHOKHLGYDQKHWFKRUXVHIIHFWDDQ
Cho Depth (Chorus Depth)
0–127 [3 (40 03 05)]
3DVWGHPRGXODWLHGLHSWHYDQKHWFKRUXVHIIHFWDDQ
+Cho Bal (Chorus Balance)
D>0E–D0<E [5 (40 03 07)]
3DVWGHYROXPHEDODQVDDQYDQGHGLUHFWHNODQNHQGH
FKRUXVNODQN%LMHHQLQVWHOOLQJYDQ'!(]DODOOHHQGH
GULHFWHNODQNZRUGHQXLWJHVWXXUGHQELMHHQLQVWHOOLQJYDQ
'(]DODOOHHQGHFKRUXVNODQNZRUGHQXLWJHVWXXUG
´'µRI´(µLQGHGLVSOD\EHWHNHQWUHVSHFWLHYHOLMN'GLUHFWH
NODQNRI(HIIHFWNODQNZDDUGHQYDQ
FL Dly (Flanger Pre Delay Time) 0–100ms [6 (40 03 08)]
3DVWGHWLPHGHOD\DDQGLHYHUORRSWYDQDIGHGLUHFWHNODQN
WRWKHWZHHUNOLQNHQYDQGHIODQJHUNODQN
FL Rate (Flanger Rate)
0.05–10.0 [7 (40 03 09)]
3DVWGHPRGXODWLHVQHOKHLGYDQKHWIODQJHUHIIHFWDDQ
FL Depth (Flanger Depth)
0–127 [8 (40 03 0A)]
3DVWGHPRGXODWLHVQHOKHLGYDQKHWIODQJHUHIIHFWDDQ
FL Fb (Flanger Feedback Level)
-98%–+98% [9 (40 03 0B)]
3DVWGHYHUKRXGLQJDDQYDQGHIODQJHUNODQNGLHQDDU
KHWHIIHFWZRUGWWHUXJJHVWXXUG1HJDWLHYHLQVWHOOLQJHQ
GUDDLHQGHIDVHRP
#FL Bal (Flanger Balance)
D>0E–D0<E [10 (40 03 0C)]
3DVWGHYROXPHEDODQVDDQYDQGHNODQNWXVVHQGHNODQNGLH
GRRUGHIODQJHUZRUGWJHVWXXUGHQGHNODQNGLHQLHWGRRU
GHIODQJHUZRUGWJHVWXXUG%LMHHQLQVWHOOLQJYDQ'!(]DO
DOOHHQGHFKRUXVNODQNZRUGHQXLWJHVWXXUGHQELMHHQ
LQVWHOOLQJYDQ'(ZRUGWDOOHHQGHFKRUXVNODQNXLWJH
VWXXUGGLHGRRUGHIODQJHUJDDW
´'µRI´(µLQGHGLVSOD\EHWHNHQWUHVSHFWLHYHOLMN'GLUHFWH
NODQNRI(HIIHFWNODQNZDDUGHQYDQ
Low Gain
-12–+12 [17 (40 03 13)]
3DVWGHJDLQYDQGHODJHIUHTXHQWLHDDQ
Hi Gain (High Gain)
-12–+12 [18 (40 03 14)]
3DVWGHJDLQYDQGHKRJHIUHTXHQWLHDDQ
Level (Output Level)
3DVWKHWXLWJDQJVYROXPHDDQ
Effecten die drie of meer soorten effecten
serieel verbinden (series 3/series 4/series 5)
0–127 [20 (40 03 16)]
Over
drive
EQ
Rotary
R
●OD (Overdrive)
+OD Drive
0–127 [1 (40 03 03)]
3DVWGHJUDDGDDQYDQGHRYHUVWXULQJVYHUYRUPLQJ+HW
YROXPH]DOVDPHQPHWGHYHUYRUPLQJVJUDDGYHUDQGHUHQ
OD Sw (Overdrive Switch)
=HWKHW2YHUGULYHHIIHFWDDQXLW
Off/On [2 (40 03 04)]
●EQ (Equalizer)
EQ L Gain (EQ Low Gain)
-12–+12 [3 (40 03 05)]
3DVWGHJDLQDDQYDQKHWODJHEHUHLNYDQGHHTXDOL]HU
EQ M Fq (EQ Mid Frequency)
200–6.3k [4 (40 03 06)]
6WHOWGHPLGGHQIUHTXHQWLHLQYDQKHWPLGGHQEHUHLNYDQGH
HTXDOL]HU
EQ M Q (EQ Mid Q)
0.5/1.0/2.0/4.0/9.0 [5 (40 03 07)]
3DVWGHEUHHGWHDDQYDQKHWEHUHLNGDW]LFKFRQFHQWUHHUW
URQGGH(40)TLQVWHOOLQJZDDULQGHJDLQ]DOZRUGHQ
EHwQYORHG+HWEHwQYORHGHEHUHLNZRUGWVPDOOHUZDQQHHU
GH]HZDDUGHZRUGWYHUKRRJG
EQ M Gain (EQ Mid Gain)
-12–+12 [6 (40 03 08)]
3DVWGHJDLQDDQYDQKHWEHUHLNGDWGRRUGH(40)T
SDUDPHWHUHQGH(404SDUDPHWHULVJHVSHFLILHHUG
EQ H Gain (EQ High Gain)
-12–+12 [7 (40 03 09)]
3DVWGHJDLQDDQYDQKHWKRJHEHUHLNYDQGHHTXDOL]HU
●RT (Rotary)
RT L Slow (RT Low Frequency Slow Rate)
0.05–10.0 [8 (40 03 0A)]
3DVWGHVQHOKHLGDDQYDQGHODJHEHUHLNURWRUYRRUGHODJH
VQHOKHLGLQVWHOOLQJ
RT L Fast (RT Low Frequency Fast Rate)
0.05–10.0 [9 (40 03 0B)]
3DVWGHVQHOKHLGDDQYDQGHODJHEHUHLNURWRUYRRUGHKRJH
VQHOKHLGLQVWHOOLQJ
RT Lo Accl (RT Low Frequency Acceleration)
0–15 [10 (40 03 0C)]
3DVWGHWLMGDDQZDDULQGHURWDWLHVQHOKHLGYDQGHODJH
EHUHLNURWRUYDQVQHOOHQDDUODQJ]DPHRIYDQODQJ]DPH
QDDUVQHOOHURWDWLH]DOYHUDQGHUHQ.OHLQHUHZDDUGHQ
KHEEHQHHQODQJHUHWLMGQRGLJRPGHQLHXZLQJHVWHOGH
URWDWLHVQHOKHLGWHEHUHLNHQ
RT Lo Lev (RT Low Frequency Level)
0–127 [11 (40 03 0D)]
3DVWKHWYROXPHDDQYDQGHODJHEHUHLNURWRU
113
Invoegeffecten gebruiken
RT H Slow (RT High Frequency Slow Rate)
0.05–10.0 [12 (40 03 0E)]
3DVWGHVQHOKHLGDDQYDQGHURWRUYDQKHWKRJHEHUHLNYRRU
GHODJHVQHOKHLGLQVWHOOLQJ
RT H Fast (RT High Frequency Fast Rate)
0.05–10.0 [13 (40 03 0F)]
3DVWGHVQHOKHLGDDQYDQGHURWRUYDQKHWKRJHEHUHLNYRRU
GHKRJHVQHOKHLGLQVWHOOLQJ
●OD (Overdrive/Distortion)
OD Sel (OD Select)
Odrv/Dist [5 (40 03 07)]
6HOHFWHHUW2YHUGULYHRYHUVWXULQJRI'LVWRUWLRQYHUYRUPLQJ
+OD Drive
0–127 [6 (40 03 08)]
3DVWGHGLHSWHDDQYDQGHYHUYRUPLQJ+HWYROXPH
YHUDQGHUWPHWGHGLHSWHYDQGHYHUYRUPLQJ
OD Amp (OD Amp Simulator Type)
Small/BltIn/2-Stk/3-Stk [7 (40 03 09)]
6HOHFWHHUWKHWW\SHJLWDDUYHUVWHUNHU
6PDOO NOHLQHYHUVWHUNHU
%OW,Q YHUVWHUNHUYDQHHQHQNHOHHHQKHLG
6WN JURWHGXEEHOJHVWDSHOGHYHUVWHUNHU
6WN
JURWHGULHGXEEHOJHVWDSHOGHYHUVWHUNHU
RT Hi Accl (RT High Frequency Acceleration)
0–15 [14 (40 03 10)]
3DVWGHWLMGDDQZDDULQGHURWDWLHVQHOKHLGYDQGHODJH
EHUHLNURWRUYDQVQHOOHQDDUODQJ]DPHRIYDQODQJ]DPH
QDDUVQHOOHURWDWLH]DOYHUDQGHUHQ.OHLQHUHZDDUGHQ
KHEEHQHHQODQJHUHWLMGQRGLJRPGHQLHXZLQJHVWHOGH
URWDWLHVQHOKHLGWHEHUHLNHQ
OD Amp Sw (OD Amp Switch)
=HW2'$PSDDQXLW
RT Hi Lev (RT High Frequency Level)
0–127 [15 (40 03 11)]
3DVWKHWYROXPHDDQYDQGHKRJHEHUHLNURWRU
OD L Gain (OD Low Gain)
-12–+12 [9 (40 03 0B)]
3DVWGHJDLQYDQKHWODJHEHUHLNDDQ
RT Sept (RT Separation)
0–127 [16 (40 03 12)]
3DVWGHUXLPWHOLMNHVSUHLGLQJDDQYDQGHURWDWLHNODQN
#RT Speed
Slow/Fast [17 (40 03 13)]
6FKDNHOWWHJHOLMNHUWLMGGHURWDWLHVQHOKHLGYDQ]RZHOGHODJH
EHUHLNDOVGHKRJHEHUHLNURWRUVDDQ
/DQJ]DDPYHUWUDDJWGHURWDWLHQDDUGHJHVSHFLILHHUGH
VQHOKHGHQ57/6ORZSDUDPHWHU57+
6ORZSDUDPHWHUZDDUGHQ
)DVW
YHUVQHOWGHURWDWLHQDDUGHJHVSHFLILHHUGH
VQHOKHGHQ57/)DVWSDUDPHWHU57+)DVW
SDUDPHWHUZDDUGHQ
Level (Output Level)
3DVWKHWXLWJDQJVYROXPHDDQ
L
CF
Delay
CF Sel (CF Select)
Chorus/Flangr [12 (40 03 0E)]
6HOHFWHHUW&KRUXVRI)ODQJHU
CF Rate
0.05–6.40 [13 (40 03 0F)]
3DVWGHPRGXODWLHVQHOKHLGDDQ
●Cmp (Compressor)
Cmp Atck (Compressor Attack)
0–127 [1 (40 03 03)]
3DVWGHWLMGDDQZDDULQGHNODQN]DOVWLMJHQQDGDWGH]HZHUG
LQJHYRHUG
Cmp Sus (Compressor Sustain)
0–127 [2 (40 03 04)]
3DVWGHWLMGDDQZDDULQNODQNHQPHWODDJYROXPHRSJHYRHUG
ZRUGHQWRW]HHHQJHVSHFLILHHUGYROXPHEHUHLNHQ
$OVGHZDDUGHYHUKRRJWZRUGWGHWLMGNRUWHU:DQQHHUGH
ZDDUGHDDQJHSDVWZRUGW]DOKHWQLYHDXHYHQHHQVYHUDQ
GHUHQ
Cmp Level (Compressor Level)
0–127 [3 (40 03 05)]
3DVWKHWYROXPHDDQYDQGHFRPSUHVVRUNODQN
Cmp Sw (Compressor Switch)
=HWGHFRPSUHVVRUDDQXLW
0–127 [14 (40 03 10)]
CF Fb (CF Feedback)
-98%–+98% [15 (40 03 11)]
3DVWGHYHUKRXGLQJDDQYDQGHIODQJHUNODQNGLHQDDU
KHWHIIHFWZRUGWWHUXJJHVWXXUG1HJDWLHYHLQVWHOOLQJHQ
GUDDLHQGHIDVHRP
'LWKHHIWJHHQHIIHFWDOV&KRUXVJHVHOHFWHHUGLV
CF Mix
0–127 [16 (40 03 12)]
3DVWKHWYROXPHYDQGHFKRUXVRIIODQJHUNODQNDDQ
●Dly (Delay)
R
114
●CF (Chorus/Flanger)
[04H, 00H]
fig.9-51
OD
OD Sw (OD Switch)
Off/On [11 (40 03 0D)]
=HW2YHUGULYHRI'LVWRUWLRQDDQXLW
CF Depth
3DVWGHPRGXODWLHGLHSWHDDQ
*XLWDU0XOWLPDNWHQVHULsOHYHUELQGLQJWXVVHQ&RPSUHVVRU
&PS2YHUGULYHRI'LVWRUWLRQ2'&KRUXVRI)ODQJHU&)
HQ'HOD\'O\HIIHFWHQ
Cmp
OD H Gain (OD High Gain)
-12–+12 [10 (40 03 0C)]
3DVWGHJDLQYDQKHWKRJHEHUHLNDDQ
0–127 [20 (40 03 16)]
48: GTR Multi 1 (Guitar Multi 1)
Off/On [8 (40 03 0A)]
Off/On [4 (40 03 06)]
Dly Time (Delay Time)
0–635ms [17 (40 03 13)]
3DVWGHWLMGDDQGLHYHUORRSWYDQDIGHRULJLQHOHNODQNWRWKHW
ZHHUNOLQNHQYDQGHGHOD\NODQN
Dly Fb (Delay Feedback Level)
0–127 [18 (40 03 14)]
3DVWGHYHUKRXGLQJDDQYDQGHGHOD\NODQNGLHQDDUGH
LQJDQJZRUGWWHUXJJHVWXXUG
#Dly Mix (Delay Mix)
0–127 [19 (40 03 15)]
3DVWKHWYROXPHYDQGHGHOD\NODQNDDQ
Level (Output Level)
3DVWKHWXLWJDQJVQLYHDXDDQ
0–127 [20 (40 03 16)]
Invoegeffecten gebruiken
49: GTR Multi 2 (Guitar Multi 2)
[04H, 01H]
●EQ (Equalizer)
EQ L Gain (EQ Low Gain)
-12–+12 [10 (40 03 0C)]
3DVWGHJDLQDDQYDQKHWODJHEHUHLNYDQGHHTXDOL]HU
*XLWDU0XOWLPDDNWHHQVHULsOHYHUELQGLQJWXVVHQ
&RPSUHVVRU&PS2YHUGULYHRI'LVWRUWLRQ2'(TXDOL]HU
(4HQ&KRUXVRI)ODQJHU&)HIIHFWHQ
EQ M Fq (EQ Mid Frequency) 200–6.3k [11 (40 03 0D)]
6WHOWGHPLGGHQIUHTXHQWLHLQYDQKHWPLGGHQEHUHLNYDQGH
HTXDOL]HU
fig.9-52
L
Cmp
OD
EQ
EQ M Q (EQ Mid Q)
0.5/1.0/2.0/4.0/9.0 [12 (40 03 0E)]
3DVWGHEUHHGWHDDQYDQKHWEHUHLNGDW]LFKFRQFHQWUHHUW
URQGGH(40)TLQVWHOOLQJZDDULQGHJDLQ]DOZRUGHQ
EHwQYORHG+HWEHwQYORHGHEHUHLNZRUGWVPDOOHUZDQQHHU
GH]HZDDUGHZRUGWYHUKRRJG
CF
R
●Cmp (Compressor)
Cmp Atck (Compressor Attack)
0–127 [1 (40 03 03)]
3DVWGHWLMGDDQZDDULQGHNODQN]DOVWLMJHQQDGDWGH]HZHUG
LQJHYRHUG
EQ M Gain (EQ Mid Gain)
-12–+12 [13 (40 03 0F)]
3DVWGHJDLQDDQYDQKHWEHUHLNGDWGRRUGH(40)T
SDUDPHWHUHQGH(404SDUDPHWHULVJHVSHFLILHHUG
Cmp Sus (Compressor Sustain)
0–127 [2 (40 03 04)]
3DVWGHWLMGDDQZDDULQNODQNHQPHWODDJYROXPHRSJHYRHUG
ZRUGHQWRW]HHHQJHVSHFLILHHUGYROXPHEHUHLNHQ
$OVGHZDDUGHYHUKRRJWZRUGWGHWLMGNRUWHU:DQQHHUGH
ZDDUGHDDQJHSDVWZRUGW]DOKHWQLYHDXHYHQHHQVYHUDQ
GHUHQ
EQ H Gain (EQ High Gain)
-12–+12 [14 (40 03 10)]
3DVWGHJDLQDDQYDQKHWKRJHEHUHLNYDQGHHTXDOL]HU
●CF (Chorus/Flanger)
CF Sel (CF Select)
Chorus/Flangr [15 (40 03 11)]
6HOHFWHHUW&KRUXVRI)ODQJHU
Cmp Level (Compressor Level)
0–127 [3 (40 03 05)]
3DVWKHWYROXPHDDQYDQGHFRPSUHVVRUNODQN
Cmp Sw (Compressor Switch)
=HWGHFRPSUHVVRUDDQXLW
CF Rate
0.05–6.40 [16 (40 03 12]
3DVWGHPRGXODWLHVQHOKHLGDDQYRRU&KRUXVRI)ODQJHU
Off/On [4 (40 03 06)]
CF Depth
0–127 [17 (40 03 13)]
3DVWGHPRGXODWLHGLHSWHDDQYRRU&KRUXVRI)ODQJHU
●OD (Overdrive/Distortion)
CF Fb (CF Feedback)
-98%–+98% [18 (40 03 14)
3DVWGHYHUKRXGLQJDDQYDQGHIODQJHUNODQNGLHQDDU
GHLQJDQJZRUGWWHUXJJHVWXXUG1HJDWLHYHLQVWHOOLQJHQ
GUDDLHQGHIDVHRP
OD Sel (OD Select)
Odrv/Dist [5 (40 03 07)]
6HOHFWHHUW2YHUGULYHRI'LVWRUWLRQ
+OD Drive (OD Drive)
0–127 [6 (40 03 08)]
3DVWGHYHUYRUPLQJVJUDDGDDQ+HWYROXPHYHUDQGHUWLQ
YHUKXGLQJPHWGHJUDDGYDQGHYHUYRUPLQJ
OD Amp (OD Amp Simulator Type)
Small/BltIn/2-Stk/3-Stk [7 (40 03 09)]
6HOHFWHHUWKHWW\SHJLWDDUYHUVWHUNHU
6PDOO NOHLQHYHUVWHUNHU
%OW,Q YHUVWHUNHUYDQHHQHQNHOHHHQKHLG
6WN JURWHGXEEHOJHVWDSHOGHYHUVWHUNHU
6WN
JURWHGULHGXEEHOJHVWDSHOGHYHUVWHUNHU
OD Amp Sw (OD Amp Switch)
=HW2'$PSDDQXLW
'LWKHHIWJHHQHIIHFWDOV&KRUXVJHVHOHFWHHUGLV
#CF Mix (CF Mix)
0–127 [19 (40 03 15)]]
3DVWKHWYROXPHYDQGHFKRUXVRIIODQJHUNODQNDDQ
Level (Output Level)
3DVWKHWXLWJDQJVYROXPHDDQ
0–127 [20 (40 03 16)]
Off/On [8 (40 03 0A)]
OD Sw (OD Switch)
Off/On [9 (40 03 0B)]
=HW2YHUGULYHRI'LVWRUWLRQDDQXLW
115
Invoegeffecten gebruiken
50: GTR Multi 3 (Guitar Multi 3)
[04H, 02H]
●CF (Chorus/Flanger)
CF Sel (CF Select)
Chorus/Flangr [12 (40 03 0E)]
6HOHFWHHUW&KRUXVRI)ODQJHU
*XLWDU0XOWLPDDNWHHQVHULsOHYHUELQGLQJWXVVHQ:DK
:DK2YHUGULYHRI'LVWRUWLRQ2'&KRUXVRI)ODQJHU&)
HQ'HOD\'O\HIIHFWHQ
CF Rate
0.05–6.40 [13 (40 03 0F)]
3DVWGHPRGXODWLHVQHOKHLGDDQYDQGHFKRUXVRIIODQJHU
fig.9-53
CF Depth
0–127 [14 (40 03 10)]
3DVWGHPRGXODWLHGLHSWHDDQYDQGHFKRUXVRIIODQJHU
L
Wah
OD
CF
Delay
CF Fb (CF Feedback)
-98%–+98% [15 (40 03 11)]
3DVWGHYHUKRXGLQJDDQYDQGHIODQJHUNODQNGLHQDDU
KHWHIIHFWZRUGWWHUXJJHVWXXUG1HJDWLHYHLQVWHOOLQJHQ
GUDDLHQGHIDVHRP
R
●Wah
Wah Fil (Wah Filter Type)
LPF/BPF [1 (40 03 03)]
6HOHFWHHUWKHWVRRUWILOWHU
/3)
+HWZDKHIIHFWZRUGWLQHHQEUHHGIUHTXHQ
WLHEHUHLNJHJHYHQ
%3)
+HWZDKHIIHFWZRUGWLQHHQVPDOIUHTXHQWLH
EHUHLNJHJHYHQ
'LWKHHIWJHHQHIIHFWDOV&KRUXVJHVHOHFWHHUGLV
CF Mix
0–127 [16 (40 03 12)]
3DVWKHWYROXPHYDQGHFKRUXVRIIODQJHUNODQNDDQ
●Dly (Delay)
+Wah Man (Wah Manual)
0–127 [2 (40 03 04)]
6WHOWGHPLGGHQIUHTXHQWLHLQZDDURSKHWHIIHFW]DOZRUGHQ
JHJHYHQ
Dly Time (Delay Time)
0–635ms [17 (40 03 13)]
3DVWGHWLMGDDQGLHYHUORRSWYDQDIGHRULJLQHOHNODQNWRWKHW
ZHHUNOLQNHQYDQGHGHOD\NODQN
Wah Peak
0–127 [3 (40 03 05)]
3DVWGHPDQLHUDDQZDDURSKHWZDKHIIHFWLQKHWJHELHGYDQ
GHPLGGHQIUHTXHQWLH]DOZRUGHQWRHJHSDVW/DJHLQVWHOO
LQJHQJHYHQHHQZDKHIIHFWLQHHQEUHHGJHELHGURQGGH
PLGGHQIUHTXHQWLHKRJHUHLQVWHOOLQJHQJHYHQHHQZDK
HIIHFWLQHHQVPDOOHUJHELHGURQGGHPLGGHQIUHTXHQWLH
Dly Fb (Delay Feedback Level)
0–127 [18 (40 03 14)]
3DVWGHYHUKRXGLQJDDQYDQGHGHOD\NODQNGLHQDDUGH
LQJDQJZRUGWWHUXJJHVWXXUG
Wah Sw (Wah Switch)
=HW:DKDDQXLW
Off/On [4 (40 03 06)]
●OD (Overdrive/Distortion)
OD Sel (OD Select)
Odrv/Dist [5 (40 03 07)]
6HOHFWHHUW2YHUGULYHRYHUVWXULQJRI'LVWRUWLRQYHUYRUPLQJ
#OD Drive (Overdrive Drive)
0–127 [6 (40 03 08)]
3DVWGHGLHSWHDDQYDQGHYHUYRUPLQJ+HWYROXPH
YHUDQGHUWPHWGHGLHSWHYDQGHYHUYRUPLQJ
OD Amp (OD Amp Simulator Type)
Small/BltIn/2-Stk/3-Stk [7 (40 03 09)]
6HOHFWHHUWKHWW\SHJLWDDUYHUVWHUNHU
6PDOO NOHLQHYHUVWHUNHU
%OW,Q YHUVWHUNHUYDQHHQHQNHOHHHQKHLG
6WN JURWHGXEEHOJHVWDSHOGHYHUVWHUNHU
6WN
JURWHGULHGXEEHOJHVWDSHOGHYHUVWHUNHU
OD Amp Sw (OD Amp Switch)
=HW2'$PSDDQXLW
Off/On [8 (40 03 0A)]
OD L Gain (OD Low Gain)
-12–+12 [9 (40 03 0B)]
3DVWGHJDLQDDQYDQKHWODJHEHUHLNYDQGHRYHUVWXULQJRI
YHUYRUPLQJ
OD H Gain (OD High Gain)
-12–+12 [10 (40 03 0C)]
3DVWGHJDLQDDQYDQKHWKRJHEHUHLNYDQGHRYHUVWXULQJRI
YHUYRUPLQJ
OD Sw (OD Switch)
Off/On [11 (40 03 0D)]
=HW2YHUGULYHRI'LVWRUWLRQDDQXLW
116
#Dly Mix (Delay Mix)
0–127 [19 (40 03 15)]
3DVWKHWYROXPHYDQGHGHOD\NODQNDDQ
Level (Output Level)
3DVWKHWXLWJDQJVQLYHDXDDQ
0–127 [20 (40 03 16)]
Invoegeffecten gebruiken
51: Clean Gt Multi1 (Clean Guitar Multi 1)
[04H, 03H]
&OHDQ*XLWDU0XOWLPDDNWHHQVHULsOHYHUELQGLQJWXVVHQ
&RPSUHVVRU&PS(TXDOL]HU(4&KRUXVRI)ODQJHU&)
HQ'HOD\'O\HIIHFWHQ
fig.9-54
L
Cmp
EQ
CF
Delay
R
●Cmp (Compressor)
Cmp Atck (Compressor Attack)
0–127 [1 (40 03 03)]
3DVWGHWLMGDDQZDDULQGHNODQN]DOVWLMJHQQDGDWGH]HZHUG
LQJHYRHUG
Cmp Sus (Compressor Sustain)
0–127 [2 (40 03 04)]
3DVWGHWLMGDDQZDDULQNODQNHQPHWODDJYROXPHRSJHYRHUG
ZRUGHQWRW]HHHQJHVSHFLILHHUGYROXPHEHUHLNHQ
$OVGHZDDUGHYHUKRRJWZRUGWGHWLMGNRUWHU:DQQHHUGH
ZDDUGHDDQJHSDVWZRUGW]DOKHWQLYHDXHYHQHHQVYHUDQ
GHUHQ
Cmp Level (Compressor Level)
0–127 [3 (40 03 05)]
3DVWKHWYROXPHDDQYDQGHFRPSUHVVRUNODQN
Cmp Sw (Compressor Switch)
=HWGHFRPSUHVVRUDDQXLW
Off/On [4 (40 03 06)]
●EQ (Equalizer)
EQ L Gain (EQ Low Gain)
-12–+12 [5 (40 03 07)]
3DVWGHJDLQDDQYDQKHWODJHEHUHLNYDQGHHTXDOL]HU
EQ M Fq (EQ Mid Frequency)
200–6.3k [6 (40 03 08)
6WHOWGHPLGGHQIUHTXHQWLHLQYDQKHWPLGGHQEHUHLNYDQGH
HTXDOL]HU
EQ M Q (EQ Mid Q)
0.5/1.0/2.0/4.0/9.0 [7 (40 03 09)]
3DVWGHEUHHGWHDDQYDQKHWEHUHLNGDW]LFKFRQFHQWUHHUW
URQGGH(40)TLQVWHOOLQJZDDULQGHJDLQ]DOZRUGHQ
EHwQYORHG+HWEHwQYORHGHEHUHLNZRUGWVPDOOHUZDQQHHU
GH]HZDDUGHZRUGWYHUKRRJG
EQ M Gain (EQ Mid Gain)
-12–+12 [8 (40 03 0A)]
3DVWGHJDLQDDQYDQKHWEHUHLNGDWGRRUGH(40)T
SDUDPHWHUHQGH(404SDUDPHWHULVJHVSHFLILHHUG
EQ H Gain (EQ High Gain)
-12–+12 [9 (40 03 0B)]
3DVWGHJDLQDDQYDQKHWKRJHEHUHLNYDQGHHTXDOL]HU
●CF (Chorus/Flanger)
CF Sel (CF Select)
Chorus/Flangr [10 (40 03 0C)]
6HOHFWHHUW&KRUXVRI)ODQJHU
CF Rate
0.05–6.40 [11 (40 03 0D]
3DVWGHPRGXODWLHVQHOKHLGDDQYDQGHFKRUXVRIIODQJHU
CF Depth
0–127 [12 (40 03 0E)]
3DVWGHPRGXODWLHGLHSWHDDQYDQGHFKRUXVRIIODQJHU
CF Fb (CF Feedback)
-98%–+98% [13 (40 03 0F)]
3DVWGHYHUKRXGLQJDDQYDQGHIODQJHUNODQNGLHQDDU
GHLQJDQJZRUGWWHUXJJHVWXXUG1HJDWLHYHLQVWHOOLQJHQ
GUDDLHQGHIDVHRP
●Dly (Delay)
Dly Time (Delay Time)
0–635ms [15 (40 03 11)]
3DVWGHWLMGDDQGLHYHUORRSWYDQDIGHRULJLQHOHNODQNWRWKHW
ZHHUNOLQNHQYDQGHGHOD\NODQN
Dly Fb (Delay Feedback Level)
0–127 [16 (40 03 12)]
3DVWGHYHUKRXGLQJDDQYDQGHGHOD\NODQNGLHQDDUGH
LQJDQJZRUGWWHUXJJHVWXXUG
Dly HF (Delay HF Damp) 315-8k/Bypass[17 (40 03 13)]
3DVWGHIUHTXHQWLHDDQZDDURSKHWKRJHEHUHLNGDWQDDUGH
LQJDQJZRUGWWHUXJJHVWXXUG]DOZRUGHQDIJHVQHGHQ$OVX
KHWKRJHEHUHLNYDQGHWHUXJJHVWXXUGHNODQNQLHWZLO
DIVQLMGHQPRHWX%\SDVVVHOHFWHUHQ
#Dly Mix (Delay Mix)
0–127 [18 (40 03 14)]
3DVWKHWYROXPHYDQGHGHOD\NODQNDDQ
Level (Output Level)
3DVWKHWXLWJDQJVQLYHDXDDQ
0–127 [20 (40 03 16)]
52: Clean Gt Multi2 (Clean Guitar Multi 2)
[04H, 04H]
&OHDQ*XLWDU0XOWLPDDNWHHQVHULsOHYHUELQGLQJWXVVHQ
$XWRZDK$:(TXDOL]HU(4&KRUXVRI)ODQJHU&)HQ
'HOD\'O\HIIHFWHQ
fig.9-55
L
AW
EQ
CF
Delay
R
●AW (Auto-wah)
AW Filter (Auto-wah Filter Type) LPF/BPF [1 (40 03 03)]
6HOHFWHHUWKHWVRRUWILOWHUYRRUGH$XWRZDK
/3)
+HWZDKHIIHFWZRUGWLQHHQEUHHGIUHTXHQ
WLHEHUHLNJHJHYHQ
%3)
+HWZDKHIIHFWZRUGWLQHHQVPDOIUHTXHQWLH
EHUHLNJHJHYHQ
+AW Man (Auto-wah Manual)
0–127 [2 (40 03 04)]
6WHOWGHPLGGHQIUHTXHQWLHLQZDDURSKHWDXWRZDKHIIHFW
]DOZRUGHQJHJHYHQ
AW Peak (Auto-wah Peak)
0–127 [3 (40 03 05)]
3DVWGHPDQLHUDDQZDDURSKHWZDKHIIHFWLQKHWJHELHGYDQ
GHPLGGHQIUHTXHQWLH]DOZRUGHQWRHJHSDVW/DJHLQVWHOO
LQJHQJHYHQHHQZDKHIIHFWLQHHQEUHHGJHELHGURQGGH
PLGGHQIUHTXHQWLHKRJHUHLQVWHOOLQJHQJHYHQHHQZDK
HIIHFWLQHHQVPDOOHUJHELHGURQGGHPLGGHQIUHTXHQWLH
AW Rate (Auto-wah Rate)
0.05–6.40 [4 (40 03 06)]
3DVWGHPRGXODWLHVQHOKHLGDDQYDQGH$XWRZDK
AW Depth (Auto-wah Depth)
0–127 [5 (40 03 07)]
3DVWGHPRGXODWLHGLHSWHDDQYDQGH$XWRZDK
AW Sw (Auto-wah Switch)
=HW$XWRZDKDDQXLW
Off/On [6 (40 03 08)]
'LWKHHIWJHHQHIIHFWDOV&KRUXVJHVHOHFWHHUGLV
+CF Mix (CF Mix)
0–127 [14 (40 03 10)]
3DVWKHWYROXPHYDQGHFKRUXVRIIODQJHUNODQNDDQ
117
Invoegeffecten gebruiken
●EQ (Equalizer)
53: Bass Multi
EQ M Fq (EQ Mid Frequency)
200–6.3k [8 (40 03 0A)]
3DVWGHJDLQDDQYDQKHWODJHEHUHLNYDQGHHTXDOL]HU
EQ M Q (EQ Mid Q)
0.5/1.0/2.0/4.0/9.0 [9 (40 03 0B)]
6WHOWGHPLGGHQIUHTXHQWLHLQYDQKHWPLGGHQEHUHLNYDQGH
HTXDOL]HU
EQ M Q (EQ Mid Q)
0.5/1.0/2.0/4.0/9.0 [7 (40 03 09)]
3DVWGHEUHHGWHDDQYDQKHWEHUHLNGDW]LFKFRQFHQWUHHUW
URQGGH(40)TLQVWHOOLQJZDDULQGHJDLQ]DOZRUGHQ
EHwQYORHG+HWEHwQYORHGHEHUHLNZRUGWVPDOOHUZDQQHHU
GH]HZDDUGHZRUGWYHUKRRJG
EQ M Gain (EQ Mid Gain)
-12–+12 [10 (40 03 0C)]
3DVWGHJDLQDDQYDQKHWEHUHLNGDWGRRUGH(40)T
SDUDPHWHUHQGH(404SDUDPHWHULVJHVSHFLILHHUG
%DVV0XOWLPDDNWHHQVHULsOHYHUELQGLQJWXVVHQ&RPSUHVVRU
&PS2YHUGULYHRI'LVWRUWLRQ2'(TXDOL]HU(4HQ
&KRUXVRI)ODQJHU&)HIIHFWHQ
fig.9-56
L
Cmp
OD
EQ
CF
R
●Cmp (Compressor)
Cmp Atck (Compressor Attack)
0–127 [1 (40 03 03)]
3DVWGHWLMGDDQZDDULQGHNODQN]DOVWLMJHQQDGDWGH]HZHUG
LQJHYRHUG
CF Sel (CF Select)
Chorus/Flangr [12 (40 03 0E)]
6HOHFWHHUW&KRUXVRI)ODQJHU
Cmp Sus (Compressor Sustain)
0–127 [2 (40 03 04)]
3DVWGHWLMGDDQZDDULQNODQNHQPHWODDJYROXPHRSJHYRHUG
ZRUGHQWRW]HHHQJHVSHFLILHHUGYROXPHEHUHLNHQ
$OVGHZDDUGHYHUKRRJWZRUGWGHWLMGNRUWHU:DQQHHUGH
ZDDUGHDDQJHSDVWZRUGW]DOKHWQLYHDXHYHQHHQVYHUDQ
GHUHQ
CF Rate
0.05–6.40 [13 (40 03 0F)]
3DVWGHPRGXODWLHVQHOKHLGDDQYDQGHFKRUXVRIIODQJHU
Cmp Level (Compressor Level)
0–127 [3 (40 03 05)]
3DVWKHWYROXPHDDQYDQGHFRPSUHVVRUNODQN
CF Depth
0–127 [14 (40 03 10)]
3DVWGHPRGXODWLHGLHSWHDDQYDQGHFKRUXVRIIODQJHU
Cmp Sw (Compressor Switch)
=HWGHFRPSUHVVRUDDQXLW
CF Fb (CF Feedback)
-98%–+98% [15 (40 03 11)]
3DVWGHYHUKRXGLQJDDQYDQGHIODQJHUNODQNGLHQDDU
GHLQJDQJZRUGWWHUXJJHVWXXUG1HJDWLHYHLQVWHOOLQJHQ
GUDDLHQGHIDVHRP
●OD (Overdrive/Distortion)
EQ H Gain (EQ High Gain)
-12–+12 [11 (40 03 0D)]
3DVWGHJDLQDDQYDQKHWKRJHEHUHLNYDQGHHTXDOL]HU
●CF (Chorus/Flanger)
[04H, 05H]
'LWKHHIWJHHQHIIHFWDOV&KRUXVJHVHOHFWHHUGLV
CF Mix
0–127 [16 (40 03 12)]
3DVWKHWYROXPHYDQGHFKRUXVRIIODQJHUNODQNDDQ
●Dly (Delay)
Dly Time (Delay Time)
0–635ms [17 (40 03 13)]
3DVWGHWLMGDDQGLHYHUORRSWYDQDIGHRULJLQHOHNODQNWRWKHW
ZHHUNOLQNHQYDQGHGHOD\NODQN
Dly Fb (Delay Feedback Level)
0–127 [18 (40 03 14)]
3DVWGHYHUKRXGLQJDDQYDQGHGHOD\NODQNGLHQDDUGH
LQJDQJZRUGWWHUXJJHVWXXUG
#Dly Mix (Delay Mix)
0–127 [19 (40 03 15)]
3DVWKHWYROXPHYDQGHGHOD\NODQNDDQ
Level (Output Level)
3DVWKHWXLWJDQJVQLYHDXDDQ
118
0–127 [20 (40 03 16)]
Off/On [4 (40 03 06)]
OD Sel (OD Select)
Odrv/Dist [5 (40 03 07)]
6HOHFWHHUWEDVJLWDDU2YHUGULYHRI'LVWRUWLRQ
#OD Drive (Overdrive Drive)
0–127 [6 (40 03 08)]
3DVWGHGLHSWHDDQYDQGHYHUYRUPLQJ+HWYROXPH
YHUDQGHUWPHWGHGLHSWHYDQGHYHUYRUPLQJ
OD Amp (OD Amp Simulator Type)
Small/BltIn/2-Stk/3-Stk [7 (40 03 09)]
6HOHFWHHUWKHWW\SHJLWDDUYHUVWHUNHU
6PDOO NOHLQHYHUVWHUNHU
%OW,Q YHUVWHUNHUYDQHHQHQNHOHHHQKHLG
6WN JURWHGXEEHOJHVWDSHOGHYHUVWHUNHU
6WN
JURWHGULHGXEEHOJHVWDSHOGHYHUVWHUNHU
OD Amp Sw (OD Amp Switch)
=HW2'$PSDDQXLW
Off/On [8 (40 03 0A)]
OD Sw (OD Switch)
Off/On [9 (40 03 0B)]
=HW2YHUGULYHRI'LVWRUWLRQDDQXLW
Invoegeffecten gebruiken
●EQ (Equalizer)
●PH (Phaser)
EQ L Gain (EQ Low Gain)
-12–+12 [10 (40 03 0C)]
3DVWGHJDLQDDQYDQKHWODJHEHUHLNYDQGHHTXDOL]HU
PH Man (Phaser Manual)
100–8.0k [3 (40 03 05)]
3DVWGHPLGGHQIUHTXHQWLHDDQZDDULQGHWRRQJHPRGXOHHUG
ZRUGW
EQ M Fq (EQ Mid Frequency) 200–6.3k [11 (40 03 0D)]
6WHOWGHPLGGHQIUHTXHQWLHLQYDQKHWPLGGHQEHUHLNYDQGH
HTXDOL]HU
PH Rate (Phaser Rate)
3DVWGHPRGXODWLHVQHOKHLGDDQ
PH Depth (Phaser Depth)
3DVWGHPRGXODWLHGLHSWHDDQ
EQ M Q (EQ Mid Q)
0.5/1.0/2.0/4.0/9.0 [12 (40 03 0E)]
3DVWGHEUHHGWHDDQYDQKHWEHUHLNGDW]LFKFRQFHQWUHHUW
URQGGH(40)TLQVWHOOLQJZDDULQGHJDLQ]DOZRUGHQ
EHwQYORHG+HWEHwQYORHGHEHUHLNZRUGWVPDOOHUZDQQHHU
GH]HZDDUGHZRUGWYHUKRRJG
EQ M Gain (EQ Mid Gain)
-12–+12 [13 (40 03 0F)]
3DVWGHJDLQDDQYDQKHWEHUHLNGDWGRRUGH(40)T
SDUDPHWHUHQGH(404SDUDPHWHULVJHVSHFLILHHUG
●CF (Chorus/Flanger)
CF Sel (CF Select)
Chorus/Flangr [8 (40 03 0A)]
6HOHFWHHUW&KRUXVRI)ODQJHU
CF LPF (CF Low Pass Filter)
250–6.3k/Bypass [9 (40 03 0B)]
6QLMGWKHWKRJHIUHTXHQWLHEHUHLNDIYDQGHIODQJHURI
FKRUXVNODQN
CF Dly (CF Pre Delay)
0–100ms [10 (40 03 0C)]
3DVWGHWLMGDDQYDQDIKHWPRPHQWGDWPHQGHGLUHFWHNODQN
KRRUWWRWZDQQHHUGHFKRUXVRIIODQJHUNODQNJHKRRUG
ZRUGW
CF Rate
0.05–6.40 [11 (40 03 0D)]
3DVWGHPRGXODWLHVQHOKHLGDDQ
●CF (Chorus/Flanger)
CF Sel (CF Select)
Chorus/Flangr [15 (40 03 11)]
6HOHFWHHUW&KRUXVRI)ODQJHU
CF Rate
0.05–6.40 [16 (40 03 12)]
3DVWGHPRGXODWLHVQHOKHLGDDQYDQGHFKRUXVRIIODQJHU
CF Depth
0–127 [17 (40 03 13)]
3DVWGHPRGXODWLHGLHSWHDDQYDQGHFKRUXVRIIODQJHU
CF Fb (CF Feedback Level) -98%–+98% [18 (40 03 14)]
3DVWGHYHUKRXGLQJDDQYDQGHIODQJHUNODQNGLHQDDU
GHLQJDQJZRUGWWHUXJJHVWXXUG1HJDWLHYHLQVWHOOLQJHQ
GUDDLHQGHIDVHRP
CF Depth
3DVWGHPRGXODWLHGLHSWHDDQ
Level (Output Level)
3DVWKHWXLWJDQJVQLYHDXDDQ
0–127 [20 (40 03 16)]
[04H, 06H]
5KRGHV0XOWLPDDNWHHQVHULsOHYHUELQGLQJWXVVHQ(QKDQFHU
(+3KDVHU3+&KRUXVRI)ODQJHU&)HQ7UHPRORRI
3DQ73HIIHFWHQ
fig.9-57
EH
TP
PH
R
EH
'LWKHHIWJHHQHIIHFWDOV&KRUXVJHVHOHFWHHUGLV
CF Mix
0–127 [14 (40 03 10)]
3DVWKHWYROXPHYDQGHFKRUXVRIIODQJHUNODQNDDQ
●Dly (Delay)
54: Rhodes Multi
L
0–127 [12 (40 03 0E)]
CF Fb (CF Feedback Level) -98%–+98% [13 (40 03 0F)]
3DVWGHYHUKRXGLQJDDQYDQGHIODQJHUNODQNGLHQDDU
GHLQJDQJZRUGWWHUXJJHVWXXUG1HJDWLHYHLQVWHOOLQJHQ
GUDDLHQGHIDVHRP
'LWKHHIWJHHQHIIHFWDOV&KRUXVJHVHOHFWHHUGLV
#CF Mix
0–127 [19 (40 03 15)]
3DVWKHWYROXPHYDQGHFKRUXVRIIODQJHUNODQNDDQ
0–127 [5 (40 03 07)]
PH Reso (Phaser Resonance)
0–127 [6 (40 03 08)]
3DVWGHNOHPWRRQDDQYDQKHWJHELHGURQGGHPLGGHQIUH
TXHQWLHJHVSHFLILHHUGGRRUGH3+0DQSDUDPHWHU
PH Mix (Phaser Mix)
0–127 [7 (40 03 09)]
3DVWGHYHUKRXGLQJDDQYDQGHSKDVHUNODQNGLHPHWGH
GLUHFWHNODQN]DOZRUGHQYHUPHQJG
EQ H Gain (EQ High Gain)
-12–+12 [14 (40 03 10)]
3DVWGHJDLQDDQYDQKHWKRJHEHUHLNYDQGHHTXDOL]HU
0.05–6.40 [4 (40 03 06)]
Dly Time (Delay Time)
0–635ms [17 (40 03 13)]
3DVWGHWLMGDDQGLHYHUORRSWYDQDIGHRULJLQHOHNODQNWRWKHW
ZHHUNOLQNHQYDQGHGHOD\NODQN
Dly Fb (Delay Feedback Level)
0–127 [18 (40 03 14)]
3DVWGHYHUKRXGLQJDDQYDQGHGHOD\NODQNGLHQDDUGH
LQJDQJZRUGWWHUXJJHVWXXUG
#Dly Mix (Delay Mix)
0–127 [19 (40 03 15)]
3DVWKHWYROXPHYDQGHGHOD\NODQNDDQ
●TP (Tremolo/Pan)
CF
TP
●EH (Enhancer)
EH Sens (Enhancer Sensitivity)
0–127 [1 (40 03 03)]
3DVWGHJHYRHOLJKHLGYDQGHHQKDQFHUDDQ
EH Mix (Enhancer Mix Level)
0–127 [2 (40 03 04)]
3DVWGHYHUKRXGLQJDDQZDDULQGHRYHUWRQHQGLHGRRUGH
HQKDQFHUZRUGHQJHJHQHUHHUGPHWGHGLUHFWHNODQNJHFRP
ELQHHUGZRUGHQ
TP Sel (TP Select)
6HOHFWHHUW7UHPRORRI3DQ
Trem/Pan [15 (40 03 11)]
TP Mod WV (TP Modulation Wave)
Tri/Sqr/Sin/Saw1/Saw2 [16 (40 03 12)]
6HOHFWHHUWGHPDQLHUZDDURSWUHPRORRISDQZRUGHQ
JHPRGXOHHUG
7UL
'HNODQNZRUGWJHPRGXOHHUGDOVHHQ
GULHKRHNVJROI
6TU
'HNODQNZRUGWJHPRGXOHHUGDOVHHQ
YLHUNDQWHJROI
6LQ
'HNODQNZRUGWJHPRGXOHHUGDOVHHQ
VLQXVRwGHJROI
6DZ 'HNODQNZRUGWJHPRGXOHHUGDOVHHQ
]DDJWDQGJROI
119
Invoegeffecten gebruiken
'HtandenLQ6DZHQ6DZZLM]HQLQWHJHQRYHUJHVWHOGH
ULFKWLQJHQ
fig.9-58
Saw1
Saw2
+TP Mod RT (TP Modulation Rate) 0.05–6.40 [17 (40 03 13)]
3DVWGHPRGXODWLHVQHOKHLGDDQ
#TP Mod Dep (TP Modulation Depth) 0–127 [18 (40 03 14)]
3DVWGHPRGXODWLHGLHSWHDDQ
TP Sw (TP Switch)
=HWWUHPRORRISDQDDQXLW
Off/On [19 (40 03 15)]
Level (Output Level)
3DVWKHWXLWJDQJVQLYHDXDDQ
0–127 [20 (40 03 16)]
55: Keyboard Multi
[05H, 00H]
.H\ERDUG0XOWLPDDNWHHQVHULsOHYHUELQGLQJWXVVHQ5LQJ
0RGXODWRU50(TXDOL]HU(43LWFK6KLIWHU363KDVHU
3+HQ'HOD\'O\HIIHFWHQ
5LQJ0RGXODWRULVHHQHIIHFWGDWDPSOLWXGHPRGXODWLH$0
RSKHWLQJDQJVVLJQDDOWRHSDVWHQEHOJHOXLGHQSURGXFHHUW
fig.9-59
L
RM
EQ
PS
R
RM
PH
Dly
EQ
●RM (Ring Modulator)
+RM Mod Freq (RM Modulation Frequency)
0–127 [1 (40 03 03)]
6WHOWGHIUHTXHQWLHLQZDDURSGHPRGXODWLHZRUGW
WRHJHSDVW
#RM Bal (RM Balance)
D>0E–D0<E [2 (40 03 04)]
3DVWGHEDODQVDDQWXVVHQGHGLUHFWHNODQNHQGHNODQNPHW
ULQJPRGXODWLH
´'µRI´(µLQGHGLVSOD\EHWHNHQHQUHVSHFWLHYHOLMN'
GLUHFWHNODQNRI(HIIHFWNODQNZDDUGHQYDQ
●EQ (Equalizer)
EQ L Gain (EQ Low Gain)
-12–+12 [3 (40 03 05)]
3DVWGHJDLQDDQYDQKHWODJHEHUHLNYDQGHHTXDOL]HU
EQ M Fq (EQ Mid Frequency)
200–6.3k [4 (40 03 06)]
6WHOWGHPLGGHQIUHTXHQWLHLQYDQKHWPLGGHQEHUHLNYDQGH
HTXDOL]HU
EQ M Q (EQ Mid Q)
0.5/1.0/2.0/4.0/9.0 [5 (40 03 07)]
3DVWGHEUHHGWHDDQYDQKHWEHUHLNGDW]LFKFRQFHQWUHHUW
URQGGH(40)TLQVWHOOLQJZDDULQGHJDLQ]DOZRUGHQ
EHwQYORHG+HWEHwQYORHGHEHUHLNZRUGWVPDOOHUZDQQHHU
GH]HZDDUGHZRUGWYHUKRRJG
EQ M Gain (EQ Mid Gain)
-12–+12 [6 (40 03 08)]
3DVWGHJDLQDDQYDQKHWEHUHLNGDWGRRUGH(40)T
SDUDPHWHUHQGH(404SDUDPHWHULVJHVSHFLILHHUG
EQ H Gain (EQ High Gain)
-12–+12 [7 (40 03 09)]
3DVWGHJDLQDDQYDQKHWKRJHEHUHLNYDQGHHTXDOL]HU
120
●PS (Pitch Shifter)
PS Coarse (PS Coarse Pitch) -24–0–+12 [8 (40 03 0A)]
3DVWGHKRHYHHOKHLGSLWFKVKLIWDDQLQVWDSSHQYDQHHQ
KDOYHWRRQWRWRFWDYHQ
PS Fine (PS Fine Pitch)
-100–0–+100 [9 (40 03 0B)]
0DDNWILMQHDDQSDVVLQJHQDDQGHSLWFKVKLIWLQVWDSSHQYDQ
KRQGHUVWHQWRKRQGHUVWHQ
PS Mode (PS Shifter Mode)
1–5 [10 (40 03 0C)]
$OVGH]HZDDUGHVWLMJWLVGHUHDFWLHWUDJHUPDDU]DOGHNODQN
VWDELHOHU]LMQ
PS Bal (PS Balance)
D>0E–D0<E [11 (40 03 0D)]
3DVWGHYROXPHEDODQVDDQWXVVHQGHGLUHFWHNODQNHQGH
SLWFKVKLIWNODQN
´'µRI´(µLQGHGLVSOD\EHWHNHQWUHVSHFWLHYHOLMN'GLUHFWH
NODQNRI(HIIHFWNODQNZDDUGHQYDQ
●PH (Phaser)
PH Man (Phaser Manual)
100–8.0k [12 (40 03 0E)]
3DVWGHPLGGHQIUHTXHQWLHDDQZDDULQGHWRRQJHPRGXOHHUG
ZRUGW
PH Rate (Phaser Rate)
0.05–6.40 [13 (40 03 0F)]
3DVWGHPRGXODWLHVQHOKHLGDDQYDQGHSKDVHU
PH Depth (Phaser Depth)
0–127 [14 (40 03 10)]
3DVWGHPRGXODWLHGLHSWHDDQYDQGHSKDVHU
PH Reso (Phaser Resonance)
0–127 [15 (40 03 11)]
3DVWGHNOHPWRRQDDQYDQKHWJHELHGURQGGHPLGGHQIUH
TXHQWLHJHVSHFLILHHUGGRRUGH3+0DQSDUDPHWHU
PH Mix (Phaser Mix)
0–127 [16 (40 03 12)]
3DVWGHYHUKRXGLQJDDQYDQGHSKDVHUNODQNGLHPHWGH
GLUHFWHNODQN]DOZRUGHQYHUPHQJG
●Dly (Delay)
Dly Time (Delay Time)
0–635ms [17 (40 03 13)]
3DVWGHWLMGDDQGLHYHUORRSWYDQDIGHRULJLQHOHNODQNWRWKHW
ZHHUNOLQNHQYDQGHGHOD\NODQN
Dly Fb (Delay Feedback Level)
0–127 [18 (40 03 14)]
3DVWGHKRHYHHOKHLGDDQYDQGHGHOD\NODQNGLHQDDUGH
LQJDQJZRUGWWHUXJJHVWXXUG
Dly Mix (Delay Mix Level)
0–127 [19 (40 03 15)]
3DVWGHKRHYHHOKHLGGHOD\NODQNDDQGLHPHWGHGLUHFWH
NODQNZRUGWJHPHQJG
Level (Output Level)
3DVWKHWXLWJDQJVQLYHDXDDQ
0–127 [20 (40 03 16)]
Invoegeffecten gebruiken
Effecten die twee soorten effecten parallel
verbinden (parallel 2)
0HWHIIHFWHQZDDULQWZHHYHUVFKLOOHQGHHIIHFWSDUDOOHO
YHUERQGHQ]LMQNDQXRS/HQ5DI]RQGHUOLMNYHUVFKLOOHQGH
HIIHFWHQWRHSDVVHQ$OVPHQSDUDOOHOOHHIIHFWHQJHEUXLNWYRRU
GHNODQNYDQWZHHSDUWVNDQPHQKHWHIIHFWEHUHLNHQDOVRI
WZHHYHUVFKLOOHQGHHIIHFWWRHVWHOOHQZHUGHQJHEUXLNW
%LMYRRUEHHOGXVHOHFWHHUWHHQJLWDDUNODQNYRRUSDUWHQHHQ
RUJHONODQNYRRUSDUW=HWGHSDQLQVWHOOLQJRS/XLWHUVW
OLQNVYRRUSDUWHQ5XLWHUVWUHFKWVYRRUSDUW3DVKHW
HIIHFW60: OD/RotaryWRHRS]RZHOSDUWDOVSDUW$OVX
GDQGHMXLVWHLQVWHOOLQJHQPDDNWYRRUGHOD PanHQRT Pan
HIIHFWSDUDPHWHUVNDQX2YHUGULYHRSGHJLWDDUNODQNHQ
5RWDU\RSGHRUJHONODQNWRHSDVVHQZDDUGRRUXZHUNHOLMN
WZHHYHUVFKLOOHQGHHIIHFWHQWHJHOLMNHUWLMGJHEUXLNW
fig.9-60
60 OD/Rotary
Part 01 L63
028 Clean Gt.
L
R
Dly Fb (Delay Feedback Level) -98%–+98% [7 (40 03 09)]
3DVWGHYHUKRXGLQJDDQYDQGHGHOD\NODQNGLHQDDUGH
GHOD\LQJDQJZRUGWWHUXJJHVWXXUG1HJDWLHYHLQVWHOO
LQJHQGUDDLHQGHIDVHRP
Dly HF (Delay HF Damp) 315–8k/Bypass [8 (40 03 0A)]
3DVWGHIUHTXHQWLHDDQZDDUERYHQHHQGHOD\NODQNZRUGW
DIJHVQHGHQGLHQDDUGHGHOD\LQJDQJZRUGWWHUXJJHVWXXUG
$OVXGHKRJHIUHTXHQWLHVYDQGHIHHGEDFNQLHWZLO
DIVQLMGHQPRHWXGH]HSDUDPHWHURS%\SDVV]HWWHQ
#Dly Bal (Delay Balance)
D>0E–D0<E [10 (40 03 0C)]
3DVWGHYROXPHEDODQVDDQYDQGHNODQNGLHGRRUGHGHOD\
JDDWHQGHNODQNGLHQLHWGRRUGHGHOD\JDDW´'µRI´(µLQ
GHGLVSOD\EHWHNHQWUHVSHFWLHYHOLMN'GLUHFWHNODQNRI(
HIIHFWNODQNZDDUGHQYDQ
Dly Pan (Delay Output Pan) L63–0–R63 [18 (40 03 14)]
3DVWGHVWHUHRSRVLWLHYDQGHGHOD\NODQNLQ/LVXLWHUVW
OLQNVLVKHWPLGGHQHQ5LVXLWHUVWUHFKWV
Pan
Part 02 R63
017 Organ 1
Dly Time (Delay Time)
0–500ms [6 (40 03 08)]
3DVWGHWLMGVSDQQHDDQGLHYHUORRSWYDQDIKHWEHJLQYDQGH
GLUHFWHNODQNWRWKHWZHHUNOLQNHQYDQGHGHOD\NODQN
Overdrive/
Distortion
Dly Level (Delay Level)
0–127 [19 (40 03 15)]
3DVWKHWYROXPHDDQYDQGHGHOD\NODQN
Rotary
Pan
56: Cho/Delay (Chorus/Delay)
[11H, 00H]
Level (Output Level)
3DVWKHWXLWJDQJVYROXPHDDQ
0–127 [20 (40 03 16)]
'LWHIIHFWPDDNWHHQSDUDOOHOHYHUELQGLQJWXVVHQFKRUXVHQ
GHOD\
fig.9-61
Pan
L
Chorus
Delay
Balance
R
Pan
Cho Dly (Chorus Pre Delay)
0–100ms [1 (40 03 03)]
3DVWGHWLMGVSDQQHDDQGLHYHUORRSWYDQDIGHGLUHFWHNODQN
WRWKHWZHHUNOLQNHQYDQGHFKRUXVNODQN
Cho Rate (Chorus Rate)
0.05–10.0 [2 (40 03 04)]
3DVWGHPRGXODWLHVQHOKHLGYDQKHWFKRUXVHIIHFWDDQ
Cho Depth (Chorus Depth)
0–127 [3 (40 03 05)]
3DVWGHPRGXODWLHGLHSWHYDQKHWFKRUXVHIIHFWDDQ
+Cho Bal (Chorus Balance)
D>0E–D0<E [5 (40 03 07)]
3DVWGHYROXPHEDODQVDDQYDQGHGLUHFWHNODQNHQGH
FKRUXVNODQN
´'µRI´(µLQGHGLVSOD\EHWHNHQWUHVSHFWLHYHOLMN'GLUHFWH
NODQNRI(HIIHFWNODQNZDDUGHQYDQ
Cho Pan (Chorus Output Pan)L63–0–R63 [16 (40 03 12)]
3DVWGHVWHUHRSRVLWLHYDQGHFKRUXVNODQNLQ/LVXLWHUVW
OLQNVLVKHWPLGGHQHQ5LVXLWHUVWUHFKWV
Cho Level (Chorus Level)
0–127 [17 (40 03 13)]
3DVWKHWYROXPHDDQYDQGHFKRUXVNODQN
121
Invoegeffecten gebruiken
57: FL/Delay (Flanger/Delay)
[11H, 01H]
58: Cho/Flanger (Chorus/Flanger)
[11H, 02H]
'LWHIIHFWPDDNWHHQSDUDOOHOHYHUELQGLQJWXVVHQHHQIODQJHU
HQHHQGHOD\
'LWHIIHFWPDDNWHHQSDUDOOHOHYHUELQGLQJWXVVHQHHQFKRUXV
HQHHQIODQJHU
fig.9-62
fig.9-63
Pan
L
Pan
L
Flanger
Delay
Chorus
Balance
Flanger
R
Balance
R
Pan
FL Dly (Flanger Pre Delay)
0–100ms [1 (40 03 03)]
3DVWGHWLMGVSDQQHDDQGLHYHUORRSWYDQDIGHGLUHFWHNODQN
WRWKHWZHHUNOLQNHQYDQGHIODQJHUNODQN
FL Rate (Flanger Rate)
0.05–10.0 [2 (40 03 04)]
3DVWGHPRGXODWLHVQHOKHLGYDQKHWIODQJHUHIIHFWDDQ
FL Depth (Flanger Depth)
0–127 [3 (40 03 05)]
3DVWGHPRGXODWLHGLHSWHYDQKHWIODQJHUHIIHFWDDQ
+FL Fb (Flanger Feedback Level) -98%–+98% [4 (40 03 06)]
3DVWGHYHUKRXGLQJDDQYDQGHIODQJHUNODQNGLHQDDU
KHWHIIHFWZRUGWWHUXJJHVWXXUG1HJDWLHYHLQVWHOOLQJHQ
GUDDLHQGHIDVHRP
+FL Bal (Flanger Balance)
D>0E–D0<E [5 (40 03 07)]
3DVWGHYROXPHEDODQVDDQYDQGHNODQNWXVVHQGHGLUHFWH
NODQNHQGHIODQJHUNODQN
´'µRI´(µLQGHGLVSOD\EHWHNHQWUHVSHFWLHYHOLMN'GLUHFWH
NODQNRI(HIIHFWNODQNZDDUGHQYDQ
FL Pan (Flanger Output Pan) L63–0–R63 [16 (40 03 12)]
3DVWGHVWHUHRSRVLWLHYDQGHIODQJHUNODQNLQ/LVXLWHUVW
OLQNVLVKHWPLGGHQHQ5LVXLWHUVWUHFKWV
FL Level (Flanger Level)
0–127 [17 (40 03 13)]
3DVWKHWYROXPHDDQYDQGHIODQJHUNODQN
Dly Time (Delay Time)
0–500ms [6 (40 03 08)]
3DVWGHWLMGDDQGLHYHUORRSWYDQDIKHWEHJLQYDQGHGLUHFWH
NODQNWRWKHWZHHUNOLQNHQYDQGHGHOD\NODQN
Dly Fb (Delay Feedback Level) -98%–+98% [7 (40 03 09)]
3DVWGHYHUKRXGLQJDDQYDQGHGHOD\NODQNGLHQDDUGH
GHOD\LQJDQJZRUGWWHUXJJHVWXXUG1HJDWLHYHLQVWHOO
LQJHQGUDDLHQGHIDVHRP
Dly HF (Delay HF Damp) 315–8k/Bypass [8 (40 03 0A)]
3DVWGHIUHTXHQWLHDDQZDDUERYHQHHQGHOD\NODQNZRUGW
DIJHVQHGHQGLHQDDUGHGHOD\LQJDQJZRUGWWHUXJJHVWXXUG
$OVXGHKRJHIUHTXHQWLHVYDQGHIHHGEDFNQLHWZLO
DIVQLMGHQPRHWXGH]HSDUDPHWHURS%\SDVV]HWWHQ
#Dly Bal (Delay Balance)
D>0E–D0<E [10 (40 03 0C)]
3DVWGHYROXPHEDODQVDDQYDQGHNODQNGLHGRRUGHGHOD\
JDDWHQGHNODQNGLHQLHWGRRUGHGHOD\JDDW´'µRI´(µLQ
GHGLVSOD\EHWHNHQWUHVSHFWLHYHOLMN'GLUHFWHNODQNRI(
HIIHFWNODQNZDDUGHQYDQ
Pan
Cho Dly (Chorus Pre Delay)
0–100ms [1 (40 03 03)]
3DVWGHWLMGVSDQQHDDQGLHYHUORRSWYDQDIGHGLUHFWHNODQN
WRWKHWZHHUNOLQNHQYDQGHFKRUXVNODQN
Cho Rate (Chorus Rate)
0.05–10.0 [2 (40 03 04)]
3DVWGHPRGXODWLHVQHOKHLGYDQKHWFKRUXVHIIHFWDDQ
Cho Depth (Chorus Depth)
0–127 [3 (40 03 05)]
3DVWGHPRGXODWLHGLHSWHYDQKHWFKRUXVHIIHFWDDQ
+Cho Bal (Chorus Balance)
D>0E–D0<E [5 (40 03 07)]
3DVWGHYROXPHEDODQVDDQYDQGHGLUHFWHNODQNHQGH
FKRUXVNODQN
´'µRI´(µLQGHGLVSOD\EHWHNHQWUHVSHFWLHYHOLMN'GLUHFWH
NODQNRI(HIIHFWNODQNZDDUGHQYDQ
Cho Pan (Chorus Output Pan)L63–0–R63 [16 (40 03 12)]
3DVWGHVWHUHRSRVLWLHYDQGHFKRUXVNODQNLQ/LVXLWHUVW
OLQNVLVKHWPLGGHQHQ5LVXLWHUVWUHFKWV
Cho Level (Chorus Level)
0–127 [17 (40 03 13)]
3DVWKHWYROXPHDDQYDQGHFKRUXVNODQN
FL Dly (Flanger Pre Delay)
0–100ms [6 (40 03 08)]
3DVWGHWLMGDDQGLHYHUORRSWYDQDIGHGLUHFWHNODQNWRWKHW
ZHHUNOLQNHQYDQGHIODQJHUNODQN
FL Rate (Flanger Rate)
0.05–10.0 [7 (40 03 09)]
3DVWGHPRGXODWLHVQHOKHLGYDQKHWIODQJHUHIIHFWDDQ
FL Depth (Flanger Depth)
0–127 [8 (40 03 0A)]
3DVWGHPRGXODWLHGLHSWHYDQKHWIODQJHUHIIHFWDDQ
FL Fb (Flanger Feedback Level)
-98%–+98% [9 (40 03
0B)]
3DVWGHYHUKRXGLQJDDQYDQGHIODQJHUNODQNGLHQDDU
KHWHIIHFWZRUGWWHUXJJHVWXXUG1HJDWLHYHLQVWHOOLQJHQ
GUDDLHQGHIDVHRP
#FL Bal (Flanger Balance)
D>0E–D0<E [10 (40 03 0C)]
3DVWGHYROXPHEDODQVDDQYDQGHNODQNWXVVHQGHGLUHFWH
NODQNHQGHIODQJHUNODQN
´'µRI´(µLQGHGLVSOD\EHWHNHQWUHVSHFWLHYHOLMN'GLUHFWH
NODQNRI(HIIHFWNODQNZDDUGHQYDQ
Dly Pan (Delay Output Pan) L63–0–R63 [18 (40 03 14)]
3DVWGHVWHUHRSRVLWLHYDQGHGHOD\NODQNLQ/LVXLWHUVW
OLQNVLVKHWPLGGHQHQ5LVXLWHUVWUHFKWV
FL Pan (Flanger Output Pan) L63–0–R63 [18 (40 03 14)]
3DVWGHVWHUHRSRVLWLHYDQGHIODQJHUNODQNLQ/LVXLWHUVW
OLQNVLVKHWPLGGHQHQ5LVXLWHUVWUHFKWV
Dly Level (Delay Level)
0–127 [19 (40 03 15)]
3DVWKHWYROXPHDDQYDQGHGHOD\NODQN
FL Level (Flanger Level)
0–127 [19 (40 03 15)]
3DVWKHWYROXPHDDQYDQGHIODQJHUNODQN
Level (Output Level)
3DVWKHWXLWJDQJVYROXPHDDQ
Level (Output Level)
3DVWKHWXLWJDQJVYROXPHDDQ
122
0–127 [20 (40 03 16)]
0–127 [20 (40 03 16)]
Invoegeffecten gebruiken
59: OD1/OD2 (Overdrive/Distortion 1, 2)
[11H, 03H]
0DDNWHHQSDUDOOHOHYHUELQGLQJWXVVHQWZHHHIIHFWWRHVWHOOHQ
2YHUGULYHRI'LVWRUWLRQNDQLQEHLGHJHVHOHFWHHUGZRUGHQ
60: OD/Rotary (Overdrive/Distortion, Rotary)
[11H, 04H]
9HUELQGW2YHUGULYHRI'LVWRUWLRQSDUDOOHOPHW5RWDU\
fig.9-65
fig.9-64
Pan
Pan
L
Overdrive/
Distortion 1
R
Overdrive/
Distortion 2
Overdrive/
Distortion
R
Rotary
Pan
Pan
●OD (Overdrive/Distortion)
●OD1 (Overdrive/Distortion 1)
OD1 Sel (OD1 Select)
Odrv/Dist [1 (40 03 03)]
6HOHFWHHUW2YHUGULYHRI'LVWRUWLRQYRRU6HW
+OD1 Drive (OD1 Drive)
0–127 [2 (40 03 04)]
3DVWGHYHUYRUPLQJVJUDDGDDQYRRUVHW+HWYROXPH]DO
VDPHQPHWGHYHUYRUPLQJVJUDDGYHUDQGHUHQ
OD Amp (Overdrive Amp Simulator Type)
Small/BltIn/2-Stk/3-Stk [3 (40 03 05)]
6HOHFWHHUWKHWW\SHJLWDDUYHUVWHUNHUYRRUVHW
6PDOO NOHLQHYHUVWHUNHU
%OW,Q YHUVWHUNHUYDQHHQHQNHOHHHQKHLG
6WN JURWHGXEEHOJHVWDSHOGHYHUVWHUNHU
6WN JURWHGULHGXEEHOJHVWDSHOGHYHUVWHUNHU
OD Amp Sw (Overdrive Amp Switch)
Off/On [4 (40 03 06)]
=HW2'$PSDDQXLW
OD1 Pan (OD1 Output Pan)
L
OD Sel (OD Select)
Odrv/Dist [1 (40 03 03)]
6HOHFWHHUW2YHUGULYHRI'LVWRUWLRQ
+OD Drive (OD Drive)
0–127 [2 (40 03 04)]
3DVWGHYHUYRUPLQJVGLHSWHDDQ+HWYROXPH]DOVDPHQPHW
GHYHUYRUPLQJVGLHSWHYHUDQGHUHQ
OD Amp (OD Amp Simulator Type)
Small/BltIn/2-Stk/3-Stk [3 (40 03 05)]
6HOHFWHHUWKHWW\SHJLWDDUYHUVWHUNHUYRRURYHUGULYHRI
GLVWRUWLRQ
6PDOO NOHLQHYHUVWHUNHU
%OW,Q YHUVWHUNHUYDQHHQHQNHOHHHQKHLG
6WN JURWHGXEEHOJHVWDSHOGHYHUVWHUNHU
6WN
JURWHGULHGXEEHOJHVWDSHOGHYHUVWHUNH
OD Amp Sw (OD Amp Switch)
Off/On [4 (40 03 06)]
=HW2'$PSSDUDPHWHUDDQXLW
L63–0–R63 [16 (40 03 12)]
3DVWGHVWHUHRSRVLWLHDDQYDQGHRYHUGULYHRIGLWRUWLRQ
NODQN/LVXLWHUVWOLQNVLVKHWPLGGHQHQ5LVXLWHUVW
UHFKWV
OD Pan (OD Output Pan)
L63–0–R63 [16 (40 03 12)]
3DVWGHVWHUHRSRVLWLHDDQYDQGHRYHUVWXXUGHRIYHUYRUPGH
NODQN/LVXLWHUVWOLQNVLVKHWPLGGHQHQ5LVXLWHUVW
UHFKWV
OD1 Level
0–127 [17 (40 03 13)]
3DVWKHWRYHUGULYHRIGLVWRUWLRQYROXPHDDQYRRUVHW
OD Level
0–127 [17 (40 03 13)]
3DVWKHWRYHUVWXULQJVRIYHUYRUPLQJVYROXPHDDQ
●OD2 (Overdrive/Distortion 2)
OD2 Sel (OD2 Select)
Odrv/Dist [6 (40 03 08)]
6HOHFWHHUW2YHUGULYHRI'LVWRUWLRQYRRUVHW
#OD2 Drive (OD2 Drive)
0–127 [7 (40 03 09)]
3DVWGHYHUYRUPLQJVJUDDGDDQYRRUVHW+HWYROXPH]DO
VDPHQPHWGHYHUYRUPLQJVJUDDGYHUDQGHUHQ
OD2 Amp (OD2 Amp Simulator Type)
Small/BltIn/2-Stk/3-Stk [8 (40 03 0A)]
6HOHFWHHUWKHWW\SHJLWDDUYHUVWHUNHUYRRUVHW
6PDOO NOHLQHYHUVWHUNHU
%OW,Q YHUVWHUNHUYDQHHQHQNHOHHHQKHLG
6WN JURWHGXEEHOJHVWDSHOGHYHUVWHUNHU
6WN
JURWHGULHGXEEHOJHVWDSHOGHYHUVWHUNHU
OD2 Amp Sw (OD2 Amp Switch)
=HW2'$PSDDQXLW
OD2 Pan (OD2 Output Pan)
Off/On [9 (40 03 0B)]
L63–0–R63 [18 (40 03 14)]
3DVWGHVWHUHRSRVLWLHDDQYDQGHRYHUGULYHRIGLWRUWLRQ
NODQN/LVXLWHUVWOLQNVLVKHWPLGGHQHQ5LVXLWHUVW
UHFKWV
●RT (Rotary)
RT L Slow (RT Low Frequency Slow Rate)
0.05–10.0 [6 (40 03 08)]
3DVWGHVQHOKHLGDDQYDQGHODJHEHUHLNURWRUYRRUGHODJH
VQHOKHLGLQVWHOOLQJ
RT L Fast (RT Low Frequency Fast Rate)
0.05–10.0 [7 (40 03 09)]
3DVWGHVQHOKHLGDDQYDQGHODJHEHUHLNURWRUYRRUGHKRJH
VQHOKHLGLQVWHOOLQJ
RT Lo Accl (RT Low Frequency Acceleration)
0–15 [8 (40 03 0A)
3DVWGHWLMGDDQZDDULQGHURWDWLHVQHOKHLGYDQGHODJH
EHUHLNURWRUYDQVQHOOHQDDUODQJ]DPHRIYDQODQJ]DPH
QDDUVQHOOHURWDWLH]DOYHUDQGHUHQ.OHLQHUHZDDUGHQ
KHEEHQHHQODQJHUHWLMGQRGLJRPGHQLHXZLQJHVWHOGH
URWDWLHVQHOKHLGWHEHUHLNHQ
RT Lo Lev (RT Low Frequency Level)0–127 [9 (40 03 0B)]
3DVWKHWYROXPHDDQYDQGHODJHEHUHLNURWRU
OD2 Level
0–127 [19 (40 03 15)]
3DVWKHWRYHUGULYHRIGLVWRUWLRQYROXPHDDQYRRUVHW
Level (Output Level)
3DVWKHWXLWJDQJVQLYHDXDDQ
0–127 [20 (40 03 16)]
123
Invoegeffecten gebruiken
RT H Slow (RT High Frequency Slow Rate)
0.05–10.0 [10 (40 03 0C)]
3DVWGHVQHOKHLGDDQYDQGHURWRUYDQKHWKRJHEHUHLNYRRU
GHODJHVQHOKHLGLQVWHOOLQJ
RT H Fast (RT High Frequency Fast Rate)
0.05–10.0 [11 (40 03 0D)]
3DVWGHVQHOKHLGDDQYDQGHURWRUYDQKHWKRJHEHUHLNYRRU
GHKRJHVQHOKHLGLQVWHOOLQJ
RT Hi Accl (RT High Frequency Acceleration)
0–15 [12 (40 03 0E)]
3DVWGHWLMGDDQZDDULQGHURWDWLHVQHOKHLGYDQGHODJH
EHUHLNURWRUYDQVQHOOHQDDUODQJ]DPHRIYDQODQJ]DPH
QDDUVQHOOHURWDWLH]DOYHUDQGHUHQ.OHLQHUHZDDUGHQ
KHEEHQHHQODQJHUHWLMGQRGLJRPGHQLHXZLQJHVWHOGH
URWDWLHVQHOKHLGWHEHUHLNHQ
RT Hi Lev (RT High Frequency Level)
0–127 [13 (40 03 0F)]
3DVWKHWYROXPHDDQYDQGHKRJHEHUHLNURWRU
RT Sept (RT Separation)
0–127 [14 (40 03 10)]
3DVWGHUXLPWHOLMNHVSUHLGLQJDDQYDQGHURWDWLHNODQN
#RT Speed
Slow/Fast [15 (40 03 11)]
6FKDNHOWWHJHOLMNHUWLMGGHURWDWLHVQHOKHLGYDQ]RZHOGHODJH
EHUHLNDOVGHKRJHEHUHLNURWRUVDDQ
/DQJ]DDPYHUWUDDJWGHURWDWLHQDDUGHJHVSHFLILHHUGH
VQHOKHGHQ57/6ORZSDUDPHWHU57+
6ORZSDUDPHWHUZDDUGHQ
)DVW
YHUVQHOWGHURWDWLHQDDUGHJHVSHFLILHHUGH
VQHOKHGHQ57/)DVWSDUDPHWHU57+)DVW
SDUDPHWHUZDDUGHQ
RT Pan (RT Output Pan)
L63–0–R63 [18 (40 03 14)]
3DVWGHVWHUHRSRVLWLHDDQYDQGHURWDU\NODQN/LVXLWHUVW
OLQNVLVKHWPLGGHQHQ5LVXLWHUVWUHFKWV
RT Level
0–127 [19 (40 03 15)]
3DVWKHWYROXPHDDQYDQGHURWDU\NODQN
Level (Output Level)
3DVWKHWXLWJDQJVYROXPHDDQ
0–127 [20 (40 03 16)]
61: OD/Phaser (Overdrive/Distortion, Phaser) [11H, 05H]
0DDNWHHQSDUDOOHOHYHUELQGLQJYDQHHQRYHUGULYHRI
GLVWRUWLRQPHWHHQSKDVHU
fig.9-66
Pan
L
Overdrive/
Distortion
R
Phaser
Pan
●OD (Overdrive/Distortion)
OD Sel (OD Select)
Odrv/Dist [1 (40 03 03)]
6HOHFWHHUW2YHUGULYHRI'LVWRUWLRQ
+OD Drive (OD Drive)
0–127 [2 (40 03 04)]
3DVWGHYHUYRUPLQJVJUDDGDDQ+HWYROXPH]DOVDPHQPHW
GHYHUYRUPLQJVJUDDGYHUDQGHUHQ
OD Amp (OD Amp Simulator Type)
Small/BltIn/2-Stk/3-Stk [3 (40 03 05)]
6HOHFWHHUWKHWW\SHJLWDDUYHUVWHUNHU
6PDOO NOHLQHYHUVWHUNHU
%OW,Q YHUVWHUNHUYDQHHQHQNHOHHHQKHLG
6WN JURWHGXEEHOJHVWDSHOGHYHUVWHUNHU
6WN
JURWHGULHGXEEHOJHVWDSHOGHYHUVWHUNH
OD Amp Sw (OD Amp Switch)
Off/On [4 (40 03 06)]
=HW2'$PSSDUDPHWHUDDQXLW
OD Pan (OD Output Pan)
L63–0–R63 [16 (40 03 12)]
3DVWGHVWHUHRSRVLWLHDDQYDQGHRYHUVWXXUGHRIYHUYRUPGH
NODQN/LVXLWHUVWOLQNVLVKHWPLGGHQHQ5LVXLWHUVW
UHFKWV
OD Level
0–127 [17 (40 03 13)]
3DVWKHWRYHUVWXULQJVRIYHUYRUPLQJVYROXPHDDQ
●PH (Phaser)
PH Man (Phaser Manual)
100–8.0k [6 (40 03 08)]
3DVWGHPLGGHQIUHTXHQWLHDDQZDDULQGHWRRQJHPRGXOHHUG
ZRUGW
#PH Rate (Phaser Rate)
0.05–10.0 [7 (40 03 09)]
3DVWGHPRGXODWLHVQHOKHLGDDQ
PH Depth (Phaser Depth)
3DVWGHPRGXODWLHGLHSWHDDQ
0–127 [8 (40 03 0A)]
PH Reso (Phaser Resonance)
0–127 [9 (40 03 0B)]
3DVWGHNOHPWRRQDDQYDQKHWJHELHGURQGGHPLGGHQIUH
TXHQWLHJHVSHFLILHHUGGRRUGH3+0DQSDUDPHWHU
PH Mix (Phaser Mix Level)
0–127 [10 (40 03 0C)]
3DVWGHYHUKRXGLQJDDQYDQGHSKDVHUNODQNGLHPHWGH
GLUHFWHNODQN]DOZRUGHQYHUPHQJG
PH Pan (Phaser Output Pan) L63–0–R63 [18 (40 03 14)]
3DVWGHVWHUHRSRVLWLHDDQYDQGHSKDVHUNODQN/LVXLWHUVW
OLQNVLVKHWPLGGHQHQ5LVXLWHUVWUHFKWV
124
PH Level
3DVWKHWSKDVHUYROXPHDDQ
0–127 [19 (40 03 15)]
Level (Output Level)
3DVWKHWXLWJDQJVYROXPHDDQ
0–127 [20 (40 03 16)]
Invoegeffecten gebruiken
62: OD/Auto Wah (Overdrive/Distortion, Auto-wah)[11H, 06H]
0DDNWHHQSDUDOOHOHYHUELQGLQJYDQHHQ2YHUGULYHRI
'LVWRUWLRQPHWHHQ$XWRZDK
fig.9-67
Pan
L
Overdrive/
Distortion
R
Auto Wah
AW Filter (Auto-wah Filter Type) LPF/BPF [6 (40 03 08)]
6HOHFWHHUWKHWVRRUWILOWHUYRRUGH$XWRZDK
/3)
+HWZDKHIIHFWZRUGWLQHHQEUHHGIUHTXHQ
WLHEHUHLNJHJHYHQ
%3)
+HWZDKHIIHFWZRUGWLQHHQVPDOIUHTXHQWLH
EHUHLNJHJHYHQ
AW Sens (Auto-wah Sensitivity)
0–127 [7 (40 03 09)]
3DVWGHJHYRHOLJKHLGDDQZDDUPHHGHDXWRZDKILOWHU
JHVWXXUGZRUGW
Pan
●OD (Overdrive/Distortion)
OD Sel (OD Select)
Odrv/Dist [1 (40 03 03)]
6HOHFWHHUW2YHUGULYHRI'LVWRUWLRQ
+OD Drive (OD Drive)
0–127 [2 (40 03 04)]
3DVWGHYHUYRUPLQJVJUDDGDDQ+HWYROXPH]DOVDPHQPHW
GHYHUYRUPLQJVJUDDGYHUDQGHUHQ
OD Amp (OD Amp Simulator Type)
Small/BltIn/2-Stk/3-Stk [3 (40 03 05)]
6HOHFWHHUWKHWW\SHJLWDDUYHUVWHUNHU
6PDOO NOHLQHYHUVWHUNHU
%OW,Q YHUVWHUNHUYDQHHQHQNHOHHHQKHLG
6WN JURWHGXEEHOJHVWDSHOGHYHUVWHUNHU
6WN
JURWHGULHGXEEHOJHVWDSHOGHYHUVWHUNH
OD Amp Sw (OD Amp Switch)
●AW (Auto-wah)
Off/On [4 (40 03 06)]
=HW2'$PSSDUDPHWHUDDQXLW
OD Pan (OD Output Pan)
L63–0–R63 [16 (40 03 12)]
3DVWGHVWHUHRSRVLWLHDDQYDQGHRYHUVWXXUGHRIYHUYRUPGH
NODQN/LVXLWHUVWOLQNVLVKHWPLGGHQHQ5LVXLWHUVW
UHFKWV
OD Level
0–127 [17 (40 03 13)]
3DVWKHWRYHUVWXULQJVRIYHUYRUPLQJVYROXPHDDQ
#AW Man (Auto-wah Manual)
0–127 [8 (40 03 0A)]
6WHOWGHPLGGHQIUHTXHQWLHLQZDDURSKHWDXWRZDKHIIHFW
]DOZRUGHQJHJHYHQ
AW Peak (Auto-wah Peak)
0–127 [9 (40 03 0B)]
3DVWGHPDQLHUDDQZDDURSKHWZDKHIIHFWLQKHWJHELHGYDQ
GHPLGGHQIUHTXHQWLH]DOZRUGHQWRHJHSDVW/DJHLQVWHOO
LQJHQJHYHQHHQZDKHIIHFWLQHHQEUHHGJHELHGURQGGH
PLGGHQIUHTXHQWLHKRJHUHLQVWHOOLQJHQJHYHQHHQZDK
HIIHFWLQHHQVPDOOHUJHELHGURQGGHPLGGHQIUHTXHQWLH
AW Rate (Auto-wah Rate)
0.05–10.0 [10 (40 03 0C)]
3DVWGHPRGXODWLHVQHOKHLGDDQYDQGH$XWRZDK
AW Depth (Auto-wah Depth)
0–127 [11 (40 03 0D)]
3DVWGHPRGXODWLHGLHSWHDDQYDQGH$XWRZDK
AW Pol (Auto-wah Polarity)
Down/Up [12 (40 03 0E)]
,QVWHOOHQYDQGHGHULFKWLQJZDDULQGHIUHTXHQWLH]DOYHUDQ
GHUHQZDQQHHUGHDXWRZDKILOWHUJHPRGXOHHUGZRUGW$OV
GHLQVWHOOLQJ8SLV]DOGHILOWHUQDDUHHQKRJHUHIUHTXHQWLH
YHUDQGHUHQ$OVGHLQVWHOOLQJ'RZQLV]DOGHILOWHUQDDUHHQ
ODJHUHIUHTXHQWLHYHUDQGHUHQ
AW Pan (Auto-wah Output Pan)
14)]
L63–0–R63 [18 (40 03
3DVWGHVWHUHRSRVLWLHDDQYDQGHDXWRZDKNODQN/LV
XLWHUVWOLQNVLVKHWPLGGHQHQ5LVXLWHUVWUHFKWV
AW Level (Auto-wah Level)
0–127 [19 (40 03 15)]
3DVWKHWYROXPHDDQYDQGHDXWRZDKNODQN
Level (Output Level)
3DVWKHWXLWJDQJVYROXPHDDQ
0–127 [20 (40 03 16)]
125
Invoegeffecten gebruiken
63: PH/Rotary (Phaser, Rotary)
[11H, 07H]
0DDNWHHQSDUHOOHOHYHUELQGLQJYDQHHQ3KDVHUHIIHFWPHW
HHQ5RWDU\HIIHFW
fig.9-68
RT Hi Accl (RT High Frequency Acceleration)
0–15 [12 (40 03 0E)]
3DVWGHWLMGDDQZDDULQGHURWDWLHVQHOKHLGYDQGHODJH
EHUHLNURWRUYDQVQHOOHQDDUODQJ]DPHRIYDQODQJ]DPH
QDDUVQHOOHURWDWLH]DOYHUDQGHUHQ.OHLQHUHZDDUGHQ
KHEEHQHHQODQJHUHWLMGQRGLJRPGHQLHXZLQJHVWHOGH
URWDWLHVQHOKHLGWHEHUHLNHQ
Pan
L
Phaser
R
Rotary
RT H Fast (RT High Frequency Fast Rate)
0.05–10.0 [11 (40 03 0D)]
3DVWGHVQHOKHLGDDQYDQGHURWRUYDQKHWKRJHEHUHLNYRRU
GHKRJHVQHOKHLGLQVWHOOLQJ
Pan
●PH (Phaser)
PH Man (Phaser Manual)
100–8.0k [1 (40 03 03)]
3DVWGHPLGGHQIUHTXHQWLHDDQZDDULQGHWRRQJHPRGXOHHUG
ZRUGW
+PH Rate (Phaser Rate)
0.05–10.0 [2 (40 03 04)]
3DVWGHPRGXODWLHVQHOKHLGYDQGHSKDVHUDDQ
RT Hi Lev (RT High Frequency Level)
0–127 [13 (40 03 0F)]
3DVWKHWYROXPHDDQYDQGHKRJHEHUHLNURWRU
PH Depth (Phaser Depth)
0–127 [3 (40 03 05)]
3DVWGHPRGXODWLHGLHSWHYDQGHSKDVHUDDQ
#RT Speed
Slow/Fast [15 (40 03 11)]
6FKDNHOWWHJHOLMNHUWLMGGHURWDWLHVQHOKHLGYDQ]RZHOGHODJH
EHUHLNDOVGHKRJHEHUHLNURWRUVDDQ
/DQJ]DDPYHUWUDDJWGHURWDWLHQDDUGHJHVSHFLILHHUGH
VQHOKHGHQ57/6ORZSDUDPHWHU57+
6ORZSDUDPHWHUZDDUGHQ
)DVW
YHUVQHOWGHURWDWLHQDDUGHJHVSHFLILHHUGH
VQHOKHGHQ57/)DVWSDUDPHWHU57+)DVW
SDUDPHWHUZDDUGHQ
PH Reso (Phaser Resonance)
0–127 [4 (40 03 06)]
3DVWGHNOHPWRRQDDQYDQKHWJHELHGURQGGHPLGGHQIUH
TXHQWLHJHVSHFLILHHUGGRRUGH3+0DQSDUDPHWHU
PH Mix (Phaser Mix Level)
0–127 [5 (40 03 07)]
3DVWGHYHUKRXGLQJDDQYDQGHSKDVHUNODQNGLHPHWGH
GLUHFWHNODQN]DOZRUGHQYHUPHQJG
PH Pan (Phaser Output Pan) L63–0–R63 [16 (40 03 12)]
3DVWGHVWHUHRSRVLWLHDDQYDQGHSKDVHUNODQN/LVXLWHUVW
OLQNVLVKHWPLGGHQHQ5LVXLWHUVWUHFKWV
PH Level (Phaser Level)
3DVWKHWSKDVHUYROXPHDDQ
0–127 [17 (40 03 13)]
●RT (Rotary)
RT L Slow (RT Low Frequency Slow Rate)
0.05–10.0 [6 (40 03 08)]
3DVWGHVQHOKHLGDDQYDQGHODJHEHUHLNURWRUYRRUGHODJH
VQHOKHLGLQVWHOOLQJ
RT L Fast (RT Low Frequency Fast Rate)
0.05–10.0 [7 (40 03 09)]
3DVWGHVQHOKHLGDDQYDQGHODJHEHUHLNURWRUYRRUGHKRJH
VQHOKHLGLQVWHOOLQJ
RT Lo Accl (RT Low Frequency Acceleration)
0–15 [8 (40 03 0A)
3DVWGHWLMGDDQZDDULQGHURWDWLHVQHOKHLGYDQGHODJH
EHUHLNURWRUYDQVQHOOHQDDUODQJ]DPHRIYDQODQJ]DPH
QDDUVQHOOHURWDWLH]DOYHUDQGHUHQ.OHLQHUHZDDUGHQ
KHEEHQHHQODQJHUHWLMGQRGLJRPGHQLHXZLQJHVWHOGH
URWDWLHVQHOKHLGWHEHUHLNHQ
RT Lo Lev (RT Low Frequency Level)0–127 [9 (40 03 0B)]
3DVWKHWYROXPHDDQYDQGHODJHEHUHLNURWRU
RT H Slow (RT High Frequency Slow Rate)
0.05–10.0 [10 (40 03 0C)]
3DVWGHVQHOKHLGDDQYDQGHURWRUYDQKHWKRJHEHUHLNYRRU
GHODJHVQHOKHLGLQVWHOOLQJ
126
RT Sept (RT Separation)
0–127 [14 (40 03 10)]
3DVWGHUXLPWHOLMNHVSUHLGLQJDDQYDQGHURWDWLHNODQN
RT Pan (RT Output Pan)
L63–0–R63 [18 (40 03 14)]
3DVWGHVWHUHRSRVLWLHDDQYDQGHURWDU\NODQN/LVXLWHUVW
OLQNVLVKHWPLGGHQHQ5LVXLWHUVWUHFKWV
RT Level
0–127 [19 (40 03 15)]
3DVWKHWYROXPHDDQYDQGHURWDU\NODQN
Level (Output Level)
3DVWKHWXLWJDQJVYROXPHDDQ
0–127 [20 (40 03 16)]
64: PH/Auto Wah (Phaser, Auto-wah)
[11H, 08H]
0DDNWHHQSDUDOOHOHYHUELQGLQJYDQHHQ3KDVHUHIIHFWHQHHQ
$XWRZDKHIIHFW
fig.9-69
Pan
L
Phaser
R
Auto Wah
Pan
●PH (Phaser)
PH Man (Phaser Manual)
100–8.0k [1 (40 03 03)]
3DVWGHPLGGHQIUHTXHQWLHDDQZDDULQGHWRRQJHPRGXOHHUG
ZRUGW
+PH Rate (Phaser Rate)
0.05–10.0 [2 (40 03 04)]
3DVWGHPRGXODWLHVQHOKHLGYDQGHSKDVHUDDQ
PH Depth (Phaser Depth)
0–127 [3 (40 03 05)]
3DVWGHPRGXODWLHGLHSWHYDQGHSKDVHUDDQ
Invoegeffecten gebruiken
PH Reso (Phaser Resonance)
0–127 [4 (40 03 06)]
3DVWGHNOHPWRRQDDQYDQKHWJHELHGURQGGHPLGGHQIUH
TXHQWLHJHVSHFLILHHUGGRRUGH3+0DQSDUDPHWHU
PH Mix (Phaser Mix Level)
0–127 [5 (40 03 07)]
3DVWGHYHUKRXGLQJDDQYDQGHSKDVHUNODQNGLHPHWGH
GLUHFWHNODQN]DOZRUGHQYHUPHQJG
PH Pan (Phaser Output Pan) L63–0–R63 [16 (40 03 12)]
3DVWGHVWHUHRSRVLWLHDDQYDQGHSKDVHUNODQN/LVXLWHUVW
OLQNVLVKHWPLGGHQHQ5LVXLWHUVWUHFKWV
PH Level (Phaser Level)
3DVWKHWSKDVHUYROXPHDDQ
0–127 [17 (40 03 13)]
●AW (Auto-wah)
AW Filter (Auto-wah Filter Type) LPF/BPF [6 (40 03 08)]
6HOHFWHHUWKHWVRRUWILOWHUYRRUGH$XWRZDK
/3)
+HWZDKHIIHFWZRUGWLQHHQEUHHGIUHTXHQ
WLHEHUHLNJHJHYHQ
%3)
+HWZDKHIIHFWZRUGWLQHHQVPDOIUHTXHQWLH
EHUHLNJHJHYHQ
●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●
3D-effecten gebruiken
'HYROJHQGHYLHU'HIIHFWHQJHEUXLNHQ5665RODQG6RXQG
6SDFHWHFKQRORJLHRPHHQUXLPWHOLMNKHLGWHFUHsUHQGLHQLHW
GRRUGHOD\UHYHUEFKRUXVHQ]NDQZRUGHQJHSURGXFHHUG
'&KRUXV
''HOD\
'$XWR
'0DQXDO
:DQQHHUXGH]HHIIHFWHQJHEUXLNWUDGHQZLMXDDQXZ
OXLGVSUHNHUVDOVYROJWRSWHVWHOOHQ]RUJHUHYHQHHQVYRRUGDW
GHOXLGVSUHNHUVDDQDONHNDQWYHUJHQRHJYDQGHPXUHQ
VWDDQ
fig.9-70
30˚
30˚
AW Sens (Auto-wah Sensitivity)
0–127 [7 (40 03 09)]
3DVWGHJHYRHOLJKHLGDDQZDDUPHHGHDXWRZDKILOWHU
JHVWXXUGZRUGW
#AW Man (Auto-wah Manual)
0–127 [8 (40 03 0A)]
6WHOWGHPLGGHQIUHTXHQWLHLQZDDURSKHWDXWRZDKHIIHFW
]DOZRUGHQJHJHYHQ
AW Peak (Auto-wah Peak)
0–127 [9 (40 03 0B)]
3DVWGHPDQLHUDDQZDDURSKHWZDKHIIHFWLQKHWJHELHGYDQ
GHPLGGHQIUHTXHQWLH]DOZRUGHQWRHJHSDVW/DJHLQVWHOO
LQJHQJHYHQHHQZDKHIIHFWLQHHQEUHHGJHELHGURQGGH
PLGGHQIUHTXHQWLHKRJHUHLQVWHOOLQJHQJHYHQHHQZDK
HIIHFWLQHHQVPDOOHUJHELHGURQGGHPLGGHQIUHTXHQWLH
AW Rate (Auto-wah Rate)
0.05–10.0 [10 (40 03 0C)]
3DVWGHPRGXODWLHVQHOKHLGDDQYDQGH$XWRZDK
AW Depth (Auto-wah Depth)
0–127 [11 (40 03 0D)]
3DVWGHPRGXODWLHGLHSWHDDQYDQGH$XWRZDK
AW Pol (Auto-wah Polarity)
Down/Up [12 (40 03 0E)]
$OVGHOLQNVHHQUHFKWVHOXLGVSUHNHUVWHYHUXLWHONDDUVWDDQ
RIDOVHUWHYHHOJDOPLVLVKHWPRJHOLMNGDWPHQQLHWKHW
YROOHGLJH'HIIHFWEHUHLNW
(ONYDQGH]HHIIHFWHQKHHIWHHQOut (Output Mode)
SDUDPHWHU$OVGHNODQNYDQGH287387ILFKHVGRRUGH
OXLGVSUHNHUVPRHWZRUGHQJHKRRUGPRHWXGH]HSDUDPHWHU
RS6SHDNHU]HWWHQ$OVXGHNODQNGRRUGHKRRIGWHOHIRRQZLO
KRUHQPRHWXGHSDUDPHWHURS3KRQHV]HWWHQ'LW]RUJWHU
YRRUGDWPHQKHWRSWLPDOH'HIIHFW]DOKRUHQ$OVGH]H
SDUDPHWHUQLHWMXLVWLVLQJHVWHOGLVKHWPRJHOLMNGDWPHQQLHW
KHWYROOHGLJH'HIIHFWEHUHLNW
●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●
,QVWHOOHQYDQGHGHULFKWLQJZDDULQGHIUHTXHQWLH]DOYHUDQ
GHUHQZDQQHHUGHDXWRZDKILOWHUJHPRGXOHHUGZRUGW$OV
GHLQVWHOOLQJ8SLV]DOGHILOWHUQDDUHHQKRJHUHIUHTXHQWLH
YHUDQGHUHQ$OVGHLQVWHOOLQJ'RZQLV]DOGHILOWHUQDDUHHQ
ODJHUHIUHTXHQWLHYHUDQGHUHQ
AW Pan (Auto-wah Output Pan)
14)]
L63–0–R63 [18 (40 03
3DVWGHVWHUHRSRVLWLHDDQYDQGHDXWRZDKNODQN/LV
XLWHUVWOLQNVLVKHWPLGGHQHQ5LVXLWHUVWUHFKWV
AW Level (Auto-wah Level)
0–127 [19 (40 03 15)]
3DVWKHWYROXPHDDQYDQGHDXWRZDKNODQN
Level (Output Level)
3DVWKHWXLWJDQJVYROXPHDDQ
0–127 [20 (40 03 16)]
127
Invoegeffecten gebruiken
2PHHQLQYRHJHIIHFWRSHHQEHSDDOGHSDUWWRHWHSDVVHQPHWEHKXOSYDQ0,',FRP
PDQGR·VPRHWXGHYROJHQGH6\VWHP([FOXVLYHFRPPDQGR·VLQYROJRUGHYHUVWXUHQ
ILJFH
address
data
checksum
1. F0 41 10 42 12 [ 40 03 00 ] [ . . ] [ . . ] F7
2. F0 41 10 42 12 [ 40 03 03 ] [ . . ] [ . . ] F7
|
[40 03 20 ]
3. F0 41 10 42 12 [ 40 4x 22 ] [ . . ] [ . . ] F7
$GGUHVV
'DWD
$GGUHVV
'DWD
&KHFNVXP
$GGUHVV
[
'DWD
();7<3(
*HEUXLNGHWZHHZDDUGHQ06%HQ/6%RPKHWVRRUWHIIHFWWHVSHFL
ILsUHQ=LHSoorten invoegeffectenSHQGHInvoegeffectenlijst
SYRRUPHHUGHWDLOVRYHUKHWVRRUWHIIHFW
();3$5$0(7(5²
=LHSoorten invoegeffectenSHQGHInvoegeffectenlijstS
YRRUPHHUGHWDLOVRYHUGHSDUDPHWHUV
%HSDDOGHSDUDPHWHUZDDUGHLQHHQEHUHLNYDQ²)²
=LHEen controletotaal berekenen S
3$57();$66,*1
3DUW1XPEHU,QGH0,',LPSOHPHQWDWLHZRUGWKHWSDUWQXPPHUEH
VFKUHYHQDOVKHWEORFNQXPPHU=LHSYRRUPHHUGHWDLOVEHWUHI
IHQGHKHWRYHUHHQVWHPPHQYDQSDUWQXPPHUVHQEORFNQXPPHUV
²
%<3$66(IIHFW2II ();(IIHFW2Q
<Voorbeeld> Invoegeffect 06 toepassen:Distortion op Part 1
9HU]HQGGHYROJHQGH6\VWHP([FOXVLYHFRPPDQGR·VLQYROJRUGH
=HWHHUVWGHHIIHFWVRRUWRS'LVWRUWLRQGRRU();7<3(WHYHUVWXUHQ
ILJHH
adres
data
checksum
F0 41 10 42 12 [ 40 03 00 ] [ 01 11 ] [ 2B ] F7
Effecttype
Distortion
=LHRRNMIDI Implementation(QJHOVWDOLJH
KDQGOHLGLQJS
'HWDLOVRYHUGHFLPDDOHQ
KH[DGHFLPDDOYLQGWXLQGH
Decimal and Hexadecimal
Table(QJHOVWDOLJH
KDQGOHLGLQJS
'HWDLOVRYHUGHHIIHFWW\SHV
YLQGWXLQSoorten
invoegeffectenSRI
LQGHInvoegeffectenlijst
S
checksum
=HWGDDUQDGHHIIHFWSDUDPHWHU'ULYHRSGRRU();3$5$0(7(5WHYHUVWXUHQ
ILJIH
adres
data checksum
F0 41 10 42 12 [ 40 03 03 ] [ 7F ] [ 3B ] F7
Drive
checksum
7F (=127)
=HWWHQVORWWHKHWHIIHFWYRRUSDUWDDQGRRU3$57();$66,*1WHYHUVWXUHQ
ILJGH
adres
data checksum
F0 41 10 42 12 [ 40 41 22 ] [ 01 ] [ 5C ] F7
Part 1
128
EFX on checksum
'HWDLOVRYHUFKHFNVXPHQ
RYHUGHFLPDDOHQKH[DGH
FLPDDOYLQGWXLQHow to
calculate the checksum
HQLQGHDecimal and
Hexadecimal Table
(QJHOVWDOLJHKDQGOHLGLQJ
S
Invoegeffecten gebruiken
De effectparameters veranderen met
controllers
'HZDDUGHYDQVRPPLJHLQYRHJHIIHFWSDUDPHWHUVNDQPHWEHKXOSYDQFRQWUROOHUV
DDQJHSDVWZRUGHQ'H]HSDUDPHWHUVZRUGHQDDQJHGXLGGRRUHHQ+RI#YRRUGHSD
UDPHWHUQDDPLQSoorten invoegeffectenS
,QGLHQPHQYRRUDOOHVWXULQJHQ([FOXVLYHFRPPDQGR·VJHEUXLNWZDQQHHUPHQGHHI
IHFWSDUDPHWHUVPHWEHKXOSYDQ0,',FRPPDQGR·VWLMGHQVHHQVRQJZLOYHUDQGHUHQ
GDQ]DOKHWDDQWDOJHJHYHQVRYHUPDWLJVWLMJHQ'DDURPNDQXRSGH6&JHEUXLN
PDNHQYDQFRQWUROOHUVRPHQNHOHYDQGHEHODQJULMNVWHSDUDPHWHUVYDQHONVRRUWHI
IHFWWHYHUDQGHUHQ$OVXKLHUYDQJHEUXLNPDDNWNDQXFRQWUROFKDQJHFRPPDQGR·V
JHEUXLNHQRPGHSDUDPHWHUZDDUGHQWLMGHQVHHQVRQJWHYHUDQGHUHQ]RQGHUKHWDDQ
WDOJHJHYHQVRYHUPDWLJWHGRHQVWLMJHQ
:DQQHHUXGH6&YDQXLWHHQNODYLHUHQ]EHVSHHOWNDQXHHQSHGDDORIHHQDQ
GHUHFRQWUROOHUJHEUXLNHQRPGHZDDUGHQLQUHDOWLPHWHYHUDQGHUHQ
1HHPELMYRRUEHHOGGHSDUDPHWHUVYDQKHWLQYRHJHIIHFW04: HumanizerS0HUN
RSGDWGH9RZHOSDUDPHWHUYRRU]LHQLVYDQHHQ+HQGDWKHW/HYHOYRRU]LHQLVYDQ
HHQ#,QGLWJHYDO]DOGHFRQWUROOHUGLHDDQ();&6UFLVWRHJHZH]HQ9RZHOVWXUHQ
HQ]DOGHFRQWUROOHUGLHDDQ();&6UFLVWRHJHZH]HQ/HYHOVWXUHQ
();&6UF
();&'HS
(IIHFW&RQWURO6RXUFH
(IIHFW&RQWURO'HSWK
■ Instelprocedure
1
'UXN>())(&76@RPGHIXQFWLHDDQWH]HWWHQ
2
'UXN>→@>)@RPGRRUKHWVFKHUPWHORSHQHQGUXN>&75/@>)@
ILJ
3
'UXNVAR.>
@RIINST>
@RPGHFXUVRURPKRRJRIRPODDJWHEHZHJHQ
HQVHOHFWHHUGHSDUDPHWHUGLHXZLOYHUDQGHUHQ
ILJ
129
Invoegeffecten gebruiken
4
'UDDLDDQGH>9$/8(@NQRSRIGUXN>'(&@RI>,1&@RPGHZDDUGHYDQGH
SDUDPHWHULQWHVWHOOHQ
5
'UXN>(;,7@RPGHSURFHGXUHWHEHsLQGLJHQZDQQHHUXNODDUEHQWPHWKHW
PDNHQYDQLQVWHOOLQJHQ
■ De functie van elke parameter
■EFX C.Src1, 2 (Effect Control Source)
Off&&²&$I%HQG
6SHFLILHHUGHFRQWUROOHUVGLHXZLOJHEUXLNHQ();&6UF]DOGHSDUDPHWHUVWXUHQGLH
OLQNVYDQGHSDUDPHWHUQDDPJHPHUNWLVPHWHHQ+();&6UF]DOGHSDUDPHWHU
VWXUHQGLHOLQNVYDQGHSDUDPHWHUQDDPJHPHUNWLVPHWHHQ #
&&²
&$I
%HQG
&RQWUROOHUQXPPHUV²
&KDQQHODIWHUWRXFK
3LWFKEHQG
■ EFX C.Depth 1, 2 (Effect Control Depth)
²±0²
%HSDDOWKHWSHUFHQWDJHYDQKHWYROOHGLJHSDUDPHWHUEHUHLNZDDULQGHYHUDQGHULQJ]DO
SODDWVYLQGHQZDQQHHUHHQFRQWUROOHUZRUGWJHEUXLNW+RJHUHZDDUGHQODWHQHHQ
JURWHUYHUDQGHULQJVEHUHLNWRH$OVGHZDDUGHRSVWDDW]DOGHFRQWUROOHUGHSDUDP
HWHUQLHWEHwQYORHGHQ1HJDWLHYHLQVWHOOLQJHQGUDDLHQGHYHUDQGHULQJRP'HFRQ
WUROOHU]DOGHZDDUGHYDQGHHIIHFWSDUDPHWHULQUHDOWLPHYHUKRJHQYHUODJHQWRWGH
ZDDUGHGLHZHUGLQJHVWHOG
$OV'HSWKHHQSRVLWLHYHLQVWHOOLQJKHHIW
,QVWHOOHQYDQZDDUGHZDDUGHYDQFRQWUROOHU[GHSWK
$OV'HSWKHHQQHJDWLHYHLQVWHOOLQJKHHIW
,QVWHOOHQYDQZDDUGHZDDUGHYDQFRQWUROOHU[GHSWK
9RRUEHHOG!
'H'ULYHSDUDPHWHUYDQOverdriveYHUDQGHUWJHZRRQOLMNELQQHQHHQEHUHLNYDQ
:DQQHHUGH]HSDUDPHWHUGRRUHHQFRQWUROOHUZRUGWJHZLM]LJG]DOKLMELQQHQHHQEH
UHLNYDQYHUDQGHUHQDOVGH(IIHFW&RQWURO'HSWKZDDUGHJHOLMNLVDDQ0HW
HHQZDDUGHYDQ]DOKLMELQQHQHHQEHUHLNYDQDI²LHRIYHUDQGHU
HQ
1RUPDDO
'HSWK 'HSWK 'HSWK 130
→ ²
→ ²
→ ²
→ ²
9RRU&&²PRHWX
HUYRRU]RUJHQGDWGH
LQVWHOOLQJRYHUHHQVWHPWPHW
KHWFRQWUROOHUQXPPHUYDQ
KHWWRHVWHOGDWGH0,',
ERRGVFKDSSHQYHU]HQGW
Invoegeffecten gebruiken
Voorbeelden van het gebruik van effectcontrollers
+LHURQGHUYROJHQHQNHOHYRRUEHHOGHQYDQGHPDQLHUZDDURSHIIHFWFRQWUROOHUVNXQQHQ
ZRUGHQJHEUXLNW
,QGH]HYRRUEHHOGHQZRUGHQGH0,',FRPPDQGR·VJHEUXLNWRPGHLQVWHOOLQJHQWHYH
UDQGHUHQPDDUGH]HLQVWHOOLQJHQNXQQHQHYHQHHQVYDQRSKHWYRRUSDQHHOZRUGHQ
JHZLM]LJGSS
+H[DGHFLPDOHZDDUGHQLQ6HWWLQJV!JHYHQ([FOXVLYHFRPPDQGR·VDDQHQKH[DGHF
LPDOHZDDUGHQLQGH0RGLI\LQJWKHYDOXH!JHYHQFRQWUROFKDQJHFRPPDQGR·VDDQ
'H([FOXVLYHFRPPDQGR·VZRUGHQJHJHYHQPHWWRHVWHO,'+GHIDEULHNVLQVWHO
OLQJ1DGDWGHLQVWHOOLQJHQLQ6HWWLQJV!JHPDDNW]LMQNXQQHQGHFRQWUROFKDQJHFRP
PDQGR·VGLHEHVFKUHYHQZRUGHQLQ0RGLI\LQJWKHYDOXH!YHUVWXXUGZRUGHQRPGHSD
UDPHWHUVQDDUGHJHZHQVWHZDDUGHWHYHUDQGHUHQ
=LHSYRRUGHRYHUHHQVWHPPLQJWXVVHQGHKH[DGHFLPDOHZDDUGHQHQGHSDUDPHWHU
ZDDUGHQ
■&RQWURO&KDQJHJHEUXLNHQRPGH'ULYHZDDUGH06: DistortionWHYHUDQGHUHQ
,QVWHOOLQJHQ!
1 =HW();DDQDGGUHVV+++YRRU3DUW
)&)
2 6WHOKHWVRRUWHIIHFWLQRS6: DistortionZDDUGH++
)%)
3 6WHO'ULYHLQDGGUHVV+++RS+
)$)
4 6WHO(IIHFW&RQWURO6RXUFHLQDGGUHVV++%+RS&&+
)%)
5 6WHO(IIHFW&RQWURO'HSWKLQDGGUHVV++&+RS)+
)&))
'HZDDUGHYHUDQGHUHQ!
&&
'ULYH → 'ULYH → 'ULYH → 'ULYH → ■&RQWURO&KDQJHJHEUXLNHQRPGH6SHHGZDDUGH9: Rotary WHYHUDQGHUHQ
,QVWHOOLQJHQ!
1 =HW();DDQDGGUHVV+++YRRU3DUW
)&)
2 6WHOKHWVRRUWHIIHFWLQRS9: RotaryZDDUGH++
)$)
3 6WHO6SHHGLQDGGUHVV++'+RS6ORZ+
)')
4 6WHO(IIHFW&RQWURO6RXUFHLQDGGUHVV++%+RS&&+
)%)
5 6WHO(IIHFW&RQWURO'HSWKLQDGGUHVV++&+RS)+
)&))
:DDUGHQYHUDQGHUHQ!
$DQJH]LHQGH6SHHGSDUDPHWHUVOHFKWVWZHHZDDUGHQ6ORZHQ)DVWKHHIW]DOGRRUGH
RQGHUVWHKHOIWYDQKHWEHUHLN6ORZHQGRRUGHERYHQVWHKHOIW)DVWJHVHOHFW
HHUGZRUGHQ
&&
6SHHG → 6ORZ
6SHHG → 6ORZ
6SHHG → )DVW
6SHHG → )DVW
131
Invoegeffecten gebruiken
■&RQWURO&KDQJHJHEUXLNHQRPGH:DK0DQZDDUGH50:GTR Multi3WHYHUDQGHUHQ
6HWWLQJV!
1 =HW();DDQYRRU3DUW
)&)
2 6WHOKHWVRRUWHIIHFWLQRS50: GTR Multi 3YDOXH++
))
3 6WHO:DK0DQLQDGGUHVV+++RS+
))
4 6WHO(IIHFW&RQWURO6RXUFHLQDGGUHVV++%+RS&&+
)%)
5 6WHO(IIHFW&RQWURO'HSWKLQDGGUHVV++&+RS)+
)&))
'HZDDUGHYHUDQGHUHQ!
&&
:DK0DQ
:DK0DQ
:DK0DQ
:DK0DQ
→
→
→ → ■&RQWURO&KDQJHJHEUXLNHQRPGH)HHGEDFNZDDUGH10: Stereo FlangerWH
YHUDQGHUHQ
9RRUEHHOG:DQQHHU(IIHFW&RQWURO'HSWKRSLVLQJHVWHOG
,QVWHOOLQJHQ!
1 =HW();DDQYRRU3DUW
)&)
2 6WHOKHWVRRUWHIIHFWLQRS10: Stereo FlangerYDOXH++
))
3 6WHO)HHGEDFNLQDGGUHVV+++RS+
))
4 6WHO(IIHFW&RQWURO6RXUFHLQDGGUHVV++'+RS&&+
)'))
5 6WHO(IIHFW&RQWURO'HSWKLQDGGUHVV++(+RS)+
)())
'HZDDUGHYHUDQGHUHQ!
'H)HHGEDFNSDUDPHWHUYHUDQGHUWLQVWDSSHQYDQZDDUELMKHWPLGGHQLV
&&
132
)HHGEDFN →
)HHGEDFN →
)HHGEDFN →
)HHGEDFN
)HHGEDFN
)HHGEDFN
)HHGEDFN
)HHGEDFN
→
→
→
→
→
)HHGEDFN →
)HHGEDFN →
)HHGEDFN →
9RRUGHWDLOVRYHUGH
KH[DGHFLPDOHZDDUGHQHQ
KXQRYHUHHQNRPVWLJH
SDUDPHWHUZDDUGHQ]LHGH
Effect Parameter Value
Conversion Table(QJHO
VWDOLJHKDQGOHLGLQJS
Invoegeffecten gebruiken
■&RQWURO&KDQJHJHEUXLNHQRPGH)HHGEDFNZDDUGH10: Stereo Flanger WHYHUDQ
GHUHQ
9RRUEHHOG:DQQHHU(IIHFW&RQWURO'HSWKRSLVLQJHVWHOG
,QVWHOOLQJHQ!
1 =HW();DDQYRRU3DUW
)&)
2 6WHOKHWVRRUWHIIHFWLQRS10: Stereo FlangerZDDUGH++
))
3 6WHO)HHGEDFNLQDGGUHVV+++RS)+
)))
4 6WHO(IIHFW&RQWURO6RXUFHLQDGGUHVV++'+RS&&+
)'))
5 6WHO(IIHFW&RQWURO'HSWKLQDGGUHVV++(+RS+
)())
'HZDDUGHYHUDQGHUHQ!
'H)HHGEDFNSDUDPHWHUYHUDQGHUWLQVWDSSHQYDQPHW+DOVPLGGHQ$DQJH]LHQ
(IIHFW&RQWURO'HSWKRSLVLQJHVWHOG]DOKHWYHUKRJHQYDQGHFRQWUROFKDQJH
ZDDUGHQGHZDDUGHYDQGH)HHGEDFNSDUDPHWHUGRHQYHUODJHQ
&&
)HHGEDFN → )HHGEDFN → )HHGEDFN → )HHGEDFN → )HHGEDFN → )HHGEDFN → )HHGEDFN →
)HHGEDFN →
)HHGEDFN → )HHGEDFN → )HHGEDFN → 133
SC-8850-instellingen bewaren en opladen
De instellingen van de SC-8850 naar
een computer sturen
'H6&NDQGHLQKRXGYDQKHWJHKHXJHQYDQ]LMQNODQNJHQHUDWRUDOV0,',JH
JHYHQVYHUVWXUHQ'HJHJHYHQVNXQQHQRSWZHHPDQLHUHQZRUGHQYHUVWXXUGPHW
Bulk DumpGDWPHHUYRXGLJHSDUDPHWHUVDOVHHQJURHSYHUVWXXUWHQPHWIndividual
DataZDDUGRRUGHSDUDPHWHUVDI]RQGHUOLMNZRUGHQYHUVWXXUG$OOHJHJHYHQV
ZRUGHQDOV6\VWHP([FOXVLYHFRPPDQGR·VYHUVWXXUG
*HEUXLN%XON'XPSZDQQHHUXGHLQVWHOOLQJHQYDQGH6&LQHHQVHTXHQFHURI
HHQFRPSXWHUZLOEHZDUHQ'RRUHHQ%XON'XPSFRPPDQGRWHYHUVWXUHQNDQPHQ
HYHQHHQVDOOHSDUDPHWHUVYDQGHWZHHWRHVWHOOHQRSGH]HOIGHLQVWHOOLQJHQ]HWWHQ
$OVPHQ,QGLYLGXDO'DWDYHUVWXXUWNDQPHQJHJHYHQVFUHsUHQ]RQGHUGDWPHQGH
DI]RQGHUOLMNH6\VWHP([FOXVLYHFRPPDQGR·VPRHWRS]RHNHQHQNDQXRSHHQHI
ILFLsQWHUHPDQLHUJHJHYHQVFUHsUHQ
■ Een Bulk Dump versturen
:DQQHHUPHQBulk DumpJHJHYHQVYHUVWXXUWRIRQWYDQJWPRHWXGHLQVWHOOLQJHQ
HQSURFHGXUHVRSXZVHTXHQFHSURJUDPPDRIXZVHTXHQFHUFRQWUROHUHQ
+LHURQGHUOHJJHQZHXLWKRHJHJHYHQVYDQXLWGH6&PRHWHQZRUGHQYHUVWXXUG
1
'UXNWHJHOLMNHUWLMGGH>(',7@HQPART>
@NQRSSHQLQUTIL
ILJ
2
3
'UXN>%8/.@>)@
'UXNVAR.>
YHU]HQGHQ
@RIINST>
@RPKHWVRRUWJHJHYHQVWHVHOHFWHUHQGDWXZLO
ILJ
'XPS$OO
'XPS$OO8VHU
'XPS8VHU,QVW
'XPS8VHU'UXP
'XPS3DUW$
'XPS3DUW%
'XPS3DUW&
'XPS3DUW'
134
9HUVWXXUWDOOHSDUDPHWHUVYDQGH6&8VHUSDUDPHWHUV
LQEHJUHSHQ
9HUVWXXUWDOOHSDUDPHWHUVEHKDOYHGHLQVWHOOLQJHQYDQGH8VHU
SDUDPHWHUV8VHU,QVWUXPHQW8VHU'UXPVHW
9HUVWXXUWGHLQVWHOOLQJHQYDQ8VHU,QVWUXPHQW
9HUVWXXUWGHLQVWHOOLQJHQYDQ8VHU'UXP
9HUVWXXUWSDUDPHWHUVYRRU3DUWJURXS$
9HUVWXXUWSDUDPHWHUVYRRU3DUWJURXS%
9HUVWXXUWSDUDPHWHUVYRRU3DUWJURXS&
9HUVWXXUWSDUDPHWHUVYRRU3DUWJURXS'
SC-8850-instellingen bewaren en opladen
4
6WDUWKHWRSQHPHQRSGHVHTXHQFHU
5
'UXN>(17(5@
'HGLVSOD\YUDDJW´Bulk Dump Sure?µ
6
'UXN>(17(5@RPGHJHJHYHQVWHYHUVWXUHQ
'UXN>(;,7@RPWHVWRSSHQ]RQGHUGHJHJHYHQVWHYHUVWXUHQ
+HWGUXNNHQRS>(17(5@VWDUWKHWYHUVWXUHQYDQJHJHYHQV
'HTransmittingGLVSOD\YHUVFKLMQWWHUZLMOGH6&GHJHJHYHQVYHUVWXXUW
7
:DQQHHUKHWYHU]HQGHQYDQJHJHYHQVYROWRRLGLVPRHWXKHWRSQHPHQ
VWRS]HWWHQ
■ Individuele gegevens versturen
,QGLYLGXHOHJHJHYHQVNXQQHQLQKHWHGLWVFKHPKHW(GLW$OOVFKHUPKHW'UXP
VFKHUPHQKHW(IIHFWVFKHUPZRUGHQYHUVWXXUG
$DQJH]LHQHUELMGH]H
KDQGHOLQJHHQJURWHKRH
YHHOKHLGGDWDYHU]RQGHQ
ZRUGWPRHWX]RUJHQGDW
KHWRQWYDQJHQGH0,',
WRHVWHOYROGRHQGH
JHKHXJHQKHHIW$OVKHW
RQWYDQJHQGHWRHVWHOWH
ZHLQLJJHKHXJHQKHHIW]DO
GHRSQDPHQLHWYROWRRLG
ZRUGHQ$OVXGDWDYRRU
DOOH3DUWVYHU]HQGWGDQ
EHGUDJHQGH%XON'XPS
GDWDGLHGH6&YHU
]HQGWRQJHYHHU.E\WHV
Parameters versturen voor een enkele part/ alle parts
1
2
6HOHFWHHUGHSDUDPHWHUGLHXZLOYHUVWXUHQLQKHW(GLWVFKHUP(GLW$OO
VFKHUP'UXPVFKHUPRI(IIHFWVFKHUPHQVWHO]LMQZDDUGHLQ
'RRUWHJHOLMNHUWLMGRSGH>'(&@HQ>,1&@NQRSSHQWHGUXNNHQZRUGHQGH
JHJHYHQVYHUVWXXUG
'HTransmittingGLVSOD\YHUVFKLMQWWHUZLMOGH6&GHJHJHYHQVYHUVWXXUW
135
SC-8850-instellingen bewaren en opladen
Parameters
8NDQLQHONVFKHUPGHYROJHQGHSDUDPHWHUZDDUGHQYHUVWXUHQ
■ Edit-scherm
❏())(&7S
5HYHUE6HQG
&KRUXV6HQG
'HOD\6HQG
3DUW(4
();
❏(',7S
3DUW/HYHO
3DUW3DQ
5[0,',&+
3DUW0RGH
030RGH
.H\6KLIW
)LQH7XQH
%HQG5DQJH
0RG'HSWK
9HOR'HSWK
9HOR2IIVHW
.H\5DQJH/
.H\5DQJH+
&&&1XPEHU
2XW$VJQ
❏02',)<S
9LE5DWH
9LE'HSWK
9LE'HOD\
&XWRII)UHT
5HVRQDQFH
$WWDFN7LPH
'HFD\7LPH
5HOHDVH7LPH
❏6781(S
6FDOH7XQH&
6FDOH7XQH&
6FDOH7XQH'
6FDOH7XQH'
6FDOH7XQH(
6FDOH7XQH)
6FDOH7XQH)
6FDOH7XQH*
6FDOH7XQH*
6FDOH7XQH$
6FDOH7XQH$
6FDOH7XQH%
❏02'S
0RG5DQJH
0RG&XIRII
0RG$PS
0RG/)25DWH
0RG/)23LWFK
0RG/)279)
0RG/)279$
136
❏%QGS
%QG5DQJH
%QG&XIRII
%QG$PS
%QG/)25DWH
%QG/)23LWFK
%QG/)279)
%QG/)279$
❏&$)S
&$I5DQJH
&$I&XIRII
&$I$PS
&$I/)25DWH
&$I/)23LWFK
&$I/)279)
&$I/)279$
❏&&S
&&5DQJH
&&&XIRII
&&$PS
&&/)25DWH
&&/)23LWFK
&&/)279)
&&/)279$
❏8,167S
9LE5DWH
9LE'HSWK
9LE'HOD\
&XWRII)UHT
5HVRQDQFH
$WWDFN7LPH
'HFD\7LPH
5HOHDVH7LPH
■Edit All-scherm
❏(',7S
0DVWHU/HYHO
0DVWHU3DQ
0.H\6KLIW
07XQH
+HW'HYLFH,'QXPPHUNDQQLHWYHUVWXXUG
ZRUGHQ
■ Drum-scherm (p.71)
'5806HW
3LWFK&RDUVH
,QVW/HYHO
,QVW3DQ
5HYHUE6HQG
&KRUXV6HQG
'HOD\6HQG
$VVLJQ*URXS
5[1RWH2Q
5[1RWH2II
■ Effect-scherm
❏5(9(5%S
5HY7\SH
5HY/HYHO
5HY&KDUDFWHU
5HY3UH/3)
5HY7LPH
5HY'O\)E
5HY3UH'O\7P
❏&+2586S
&KR7\SH
&KR/HYHO
&KR3UH/3)
&KR)HHGEDFN
&KR'HOD\
&KR5DWH
&KR'HSWK
&KR7R5HY
&KR7R'O\
❏'(/$<S
'O\7\SH
'O\/HYHO
'O\3UH/3)
'O\7LPH&
'O\7P5DWLR/
'O\7P5DWLR5
'O\/HYHO&
'O\/HYHO/
'O\/HYHO5
'O\)HHGEDFN
'O\7R5HY
❏(4S
(4/)UHT
(4/*DLQ
(4+)UHT
(4+*DLQ
❏();S
();7\SH,QVHUWLRQ(IIHFWW\SH
();3DUDPHWHU
,QVHUWLRQ(IIHFWSDUDPHWHU
();7R5HY
();7R&KR
();7R'O\
❏&75/S
();&6UF
();&'HS
();&6UF
();&'HS
SC-8850-instellingen bewaren en opladen
SC-8850 instellingen wegschrijven naar of
opladen uit de User Area (Edit All-scherm)
0HWGH6&NDQXDOOHLQVWHOOLQJHQYDQGHNODQNEURQEHZDUHQRSHHQSODDWVGLH
GHuser areaZRUGWJHQRHPG$OVPHQGH]HLQVWHOOLQJHQRSQLHXZRSODDGWNDQXGH
WRHVWDQGYDQGH6&UHSURGXFHUHQ]RDOVGLHZDVWRHQGHLQVWHOOLQJHQZHUGHQEH
ZDDUG8NDQGH6&RRNPHWGHEHZDDUGHLQVWHOOLQJHQRSVWDUWHQ
$OOHLQVWHOOLQJHQYDQGHNODQNEURQSDUDPHWHUVEHKDOYHGLHYDQGHXVHULQVWUXPHQW
HQHQGHXVHUGUXPVNXQQHQLQGHXVHUDUHDEHZDDUGZRUGHQ
+LHURQGHUOHJJHQZHXLWKRHGHLQVWHOOLQJHQYDQGH6&LQGHXVHUDUHDNXQQHQ
ZHJJHVFKUHYHQZRUGHQHQKRH]HYDQXLWGHXVHUDUHDNXQQHQZRUGHQRSJHODGHQ
■ SC-8850-instellingen in de User Area wegschrijven
1
'UXNWHJHOLMNHUWLMGPART>
@HQ>
@ALLRPKHWAll Part-schermWH
VHOHFWHUHQ'UXNGDDUQDRS>(',7@RPKHWEdit All-schermWHVHOHFWHUHQ
8NDQRRNRS>(',7@LQKHWPart Basic-schermGUXNNHQHQGDDUQDWHJHOLMNHUWLMGRS
PART>
@HQ>
@ALLGUXNNHQ
2
'UXN>:5,7(@>)@
:DQQHHUXGH6&DDQ
]HW]DOKLMYROJHQVGH
IDEULHNVLQVWHOOLQJHQ
RSVWDUWHQLQGH]HOIGH
WRHVWDQGDOVRIKLMQHWHHQ
*65HVHWERRGVFKDSKHHIW
RQWYDQJHQ$OVXGH6&
ZLOODWHQRSVWDUWHQ
PHWGHLQVWHOOLQJHQGLHLQ
GHXVHUDUHDRSJHVODJHQ
]LMQOHHVGDQGHXLWOHJYDQ
GHStartupSDUDPHWHU
SLQKHWKRRIGVWXN
Parameters instellen die
de SC-8850 zelf beïnvloeden (Utility-scherm)
3DUW%DVLFVFKHUPS
'HGLVSOD\YUDDJW´Write User Setting?µ
ILJ
%LMGH]HSURFHGXUHZRUGHQ
GHV\VWHHPSDUDPHWHUVYDQ
GH6&QLHWRSJH
VODJHQ$OVXGHV\VWHHP
SDUDPHWHUVZLORSVODDQ]LH
Parameters instellen die
de SC-8850 zelf beïnvloeden (Utility-scherm)
S
3
2PGHLQVWHOOLQJHQLQGH8VHUDUHDZHJWHVFKULMYHQPRHWX>(17(5@GUXN
NHQ'UXN>(;,7@RPWHVWRSSHQ
=RUJGDWKHWWRHVWHOEOLMIW
DDQVWDDQWHUZLMOGHLQVWHO
OLQJHQZRUGHQRSJHVODJHQ
137
SC-8850-instellingen bewaren en opladen
■ SC-8850-instellingen vanuit de User-area opladen
1
'UXNWHJHOLMNHUWLMGPART>
@HQ>
@ALLRPKHWAll Part-schermWH
VHOHFWHUHQ'UXNGDDUQDRS>(',7@RPKHWEdit All-schermWHVHOHFWHUHQ
8NDQRRNRS>(',7@LQKHWPart Basic-schermGUXNNHQHQGDDUQDWHJHOLMNHUWLMGRS
PART>
@HQ>
@ALLGUXNNHQ
2
'UXN>/2$'@>)@
'HGLVSOD\YUDDJW´Load User Setting?µ
ILJ
3
'UXN>(17(5@RPGHXVHULQVWHOOLQJHQRSWHODGHQ
'UXN>(;,7@RPWHVWRSSHQ]RQGHUGHXVHULQVWHOOLQJHQRSWHODGHQ
Shortcut-toetsen
8NDQGHLQVWHOOLQJHQYDQGH6&JHPDNNHOLMNRSODGHQPHWEHKXOSYDQGH
>6+,)7@NQRS
1
'UXN>'580@WHUZLMOX>6+,)7@LQJHGUXNWKRXGW
'HGLVSOD\YUDDJW´Load User Setting?µ
2
'UXN>(17(5@RPGHXVHULQVWHOOLQJHQRSWHODGHQ
'UXN>(;,7@RPWHVWRSSHQ]RQGHUGHXVHULQVWHOOLQJHQRSWHODGHQ
138
3DUW%DVLFVFKHUPS
Bijlagen
Problemen oplossen
$OVGH6&QLHWZHUNW]RDOVXYHUZDFKWPRHWXHHUVWGHYROJHQGHSXQWHQFRQ
WUROHUHQ$OVKHWSUREOHHPKLHUPHHQLHWRSJHORVWUDDNWPRHWXXZYHUGHOHURIKHW
GLFKWVWELM]LMQGH5RODQG6HUYLFH6WDWLRQDFKWHUDDQLQGLWKDQGERHNRSJHJHYHQFRQ
WDFWHUHQ
De stroom kan niet aangezet worden
● Is de stroomkabel op de juiste manier in een uitgang van de SC-8850 geprikt?
$OVHUHHQERRGVFKDS
YHUVFKLMQWUDDGSOHHJGDQ
KHWKRRIGVWXNAls er een
boodschap verschijnt
S
Het volumeniveau van het instrument dat verbonden is aan de Audio
output/input jacks is te laag.
● Gebrukt u misschien een aansluitingskabel die een resistor bevat?
*HEUXLNHHQDDQVOXLWLQJVNDEHOGLHJHHQUHVLVWRUEHYDW
De uitvoering is niet juist wanneer muziekbestanden met het
General MIDI/GS logo worden afgespeeld
● Is het Toestel-ID ingesteld op 17? S
Een bepaalde part wordt niet gehoord
● Is het laagste punt in de staaf-display uit?
3DUWVZDDUELMGLWSXQWXLWVWDDWZHUGHQXLWJH]HW=HW3DUW0XWHXLWS
● Werd het volume-niveau van de Part omlaag gedraaid? S
● Komt het MIDI-ontvangstkanaal van de Part overeen met het MIDI-verzendkanaal van het MIDI-toestel?S
Sommige parts klinken niet als u op de [VOLUME] knop drukt
● Probeer de GS-basisinstellingen opnieuw in te stellen.S
● Controleer de instelling van Prevw Velo.S
3UHYZ9HORLVGHSDUDPHWHUGLHKHWQLYHDXYDQGHNODQNVSHFLILHHUWGLHXKRRUWZDQ
QHHUXRSGH>92/80(@NQRSGUXNW
● Zorg er voor dat het niveau van de part niet omlaag gezet is. S
● Zorg er voor dat Part Mute niet aan staat.S
6RPVZRUGWGHSDUWPRGXVWLMGHQVGHZHUNLQJXLWJH]HW$OVXQLHWQDDUGHXLWJH]HWWH
SDUWZHQVWWH]RHNHQNDQXJHZRRQRSQLHXZLQLWLDOL]HUHQS
Een bepaald gebied op het klavier klinkt niet
● Is het klavierbereik ingesteld?S
Men hoort klank maar de staafindicator beweegt niet
● Verschilt de part die klinkt van de part-groep die in de display staat?
,VGLWKHWJHYDOGDQPRHWX>)@²>)@LQKHW3DUW%DVLFGUXNNHQRPGHSDUWJURHS
GLHLQGHGLVSOD\VWDDWWHVHOHFWHUHQ
3DUW%DVLFVFKHUPS
De gewenste klank kan niet geselecteerd worden
● Verzendt u een onjuist Program-nummer? S
● Stelt u de SC-8850 in op SC-55 Map, SC-88 Map of SC-88 Pro Map? S
139
Bijlagen
Geen klank
'HUHGHQHQZDDURPXJHHQNODQNKRRUWLVGLNZLMOVLQJHZLNNHOGHUHQNDQPHHU
PRJHOLMNHRRU]DNHQKHEEHQGDQGHPHHVWHDQGHUHSUREOHPHQ,QGHPHHVWHJHYDOOHQLV
KHWSUREOHHPHFKWHUWHZLMWHQDDQRQMXLVWHDDQVOXLWLQJHQYDQWRHVWHOOHQRIDDQRQMXLVWH
LQVWHOOLQJHQLQGHVWXULQJRIGHVRIWZDUH
Het schema lezen
/HHVLQYROJRUGHHQYROJGHLQVWUXFWLHV
%HDQWZRRUGGHYUDJHQ
ILJIORZ
Geen geluid
Staat uw SC-8850 aan?
U hoort geluid!
JA
Bewegen de balkindicators
in de display ? (p.21)
NEE
Is de laagste stip van
de balkindicator uit?
Parts waarvoor deze stip uit is, zijn uitgeschakeld.
Druk op [MUTE] om de uitschakeling op te heffen.
Als u met PART [ ] en [ ] (ALL) All Part selecteert en
dan op [64PART] ([F4]) drukt, kan u alle parts controleren.
JA
NEE
Controleer het volgende.
• Zijn de SC-8850 en uw computer correct aangesloten en staat de
Computer-schakelaar van de SC-8850 in de juiste stand?
Zie Aansluiten op een computer / MIDI-klavier, en controleer de
aansluitingen nogmaals. (p.12)
* De nieuwe instelling van de Computer-schakelaar wordt van kracht
wanneer het toestel wordt opgestart. Schakel het toestel uit alvorens
de stand van de Computer-schakelaar te verzetten.
Staat de Thru-functie van uw computer software aan? (p.18)
• Staat de volumeknop helemaal dicht?
• Zijn de instellingen voor de OUTPUT1, 2 jacks correct?
Met de fabrieksinstellingen sturen de Output 2 jacks geen geluid uit.
• Is het volume dichtgezet door een Expression-pedaal op een
aangesloten MIDI-toestel?
U hoort geluid!
U hoort geluid!
Het is ook mogelijk dat de parameterinstellingen van de SC-8850 niet meer correct zijn.
Initialiseer voor GM of GS reset. (p.24)
Hebt u bij het installeren van
de software ook de driver
geïnstalleerd?
JA
U hoort geluid!
Controleer de volgende punten in de software
die u gebruikt.
• Is het volume verlaagd?
• Is het geluid uitgeschakeld (mute)?
U hoort geluid!
Is de MIDI output-bestemming correct ingesteld?
• Raadpleeg de handleiding van de bijgeleverde CD-ROM,
en maak de nodige instellingen.
• Als de juiste MIDI driver niet geselecteerd is, zal de SC-8850 geen geluid
genereren. Controleer de MIDI output-instellingen van de software.
* Details over de MIDI output-instellingen vindt u in de handleiding van de
software die u gebruikt.
U hoort geluid!
140
NEE
Bijlagen
ILJIORZ
Sluit de hoofdtelefoon aan op de
headphone jack van de SC-8850.
Hoort u geluid door de
hoofdtelefoon?
JA
NEE
Controleer de volgende punten.
• Zijn de output jacks van de SC-8850 correct aangesloten op de input jacks van uw audiotoestel?
Controleer de volgende punten.
Als u geluid kan horen door de hoofdtelefoon, dan is het
probleem misschien dat de audiokabel die het geluid naar
de andere apparaten stuurt, defect is of niet correct is
aangesloten, of misschien is er een probleem met uw
mengtafel / versterker / luidsprekersysteem. Vervang de
kabel en de aangesloten apparatuur.
U hoort geluid!
Contacteer een Roland Service Center. (p.248)
Als de driver niet geïnstalleerd is, produceert de SC-8850
geen geluid. Raadpleeg de handleiding van de bijgeleverde
CD-ROM en installeer de USB driver of de seriële MIDI driver.
• Als u een computerkabel gebruikt voor de aansluitingen, wordt die
seriële poort (COM-poort) dan door een ander toestel gebruikt?
(Windows 95/98)
* Details over de instellingen van de seriële poort vindt u in de
handleiding van uw computer.
• Raadpleeg de handleiding van de bijgeleverde CD-ROM en maak
de juiste instellingen voor de driver.
Contacteer een Roland Service Center.
U hoort geluid!
141
Bijlagen
De SC-8850 USB-sturing (Windows 98) kan niet geïnstalleerd worden
● Staat USB aan?
=HW86%DDQRSXZFRPSXWHU
$OVHHQRQJHNHQGWRHVWHOQLHWJHGHWHFWHHUGZRUGWZDQQHHUXGH6&YRRUGHHHU
VWHNHHUPHWHHQ86%NDEHORSXZFRPSXWHUDDQVOXLWLVKHWPRJHOLMNGDWGH86%LQ
WHUIDFH]HOIXLWJHVFKDNHOGLV*HEUXLNGHYROJHQGHSURFHGXUHRPWHFRQWUROHUHQRI
GH86%LQWHUIDFHLQJHVFKDNHOGLV
1 .OLNRSGH:LQGRZV>6WDUW@NQRSHQNLHV>&RQWURO3DQHO@XLW>6HWWLQJV@'XEEHONOLN
RSKHW>6\VWHP@LFRRQLQ>&RQWURO3DQHO@
2 .OLNRSGH>'HYLFH0DQDJHU@WDEHQ]RUJHUYRRUGDWHUJHHQJHOH´µWHNHQVRI´[µ
WHNHQVJHWRRQGZRUGHQQDDVWRIRQGHU>8QLYHUVDOVHULDOEXVFRQWUROOHU@RI>86%5RRW
+XE@
$OVHUHHQJHHO´µRI´[µWHNHQZRUGWJHWRRQGGDQLVGH86%RSGLWPRPHQWXLWJH
VFKDNHOG
5DDGSOHHJGHKDQGOHLGLQJYDQXZFRPSXWHUHQ]HWGH86%DDQ
● Wordt een ongekend toestel geregistreerd?
$OVGHVWXULQJVLQVWDOODWLHYDQGH6&86%RQGHUEURNHQZRUGWGRRURPKHWHYHQ
ZHONHUHGHQELMYRRUEHHOGZDQQHHUHHQNDEHOXLWJHWURNNHQZHUGLVKHWPRJHOLMN
GDWHHQRQJHNHQGWRHVWHOLQGHFRPSXWHUZRUGWJHUHJLVWUHHUGHQ]RXKHWNXQQHQGDW
XGHVWXULQJQLHWRSQLHXZNDQLQVWDOOHUHQ$OVGLWJHEHXUWPRHWXGHYROJHQGHSUR
FHGXUHJHEUXLNHQRPKHWRQJHNHQGHWRHVWHOWHYHUZLMGHUHQHQGHVWXULQJRSQLHXZWH
LQVWDOOHUHQ
1 .OLNRSGH:LQGRZV>6WDUW@NQRSHQNLHV>&RQWURO3DQHO@XLW>6HWWLQJV@'XEEHONOLN
RSKHW>6\VWHP@LNRRQLQ>&RQWURO3DQHO@
2 .OLNRSGH>'HYLFH0DQDJHU@WDEHQ]RUJHUYRRUGDWHUJHHQ>2WKHUGHYLFHV@]LMQWHU
ZLMO>9LHZGHYLFHVE\W\SH@JHVHOHFWHHUGLV$OVGLWKHWJHYDOLVPRHWXHURSGXEEHO
NOLNNHQHQDOVHUQRJ>8QNQRZQGHYLFHV@RQGHUVWDDQNOLNWXKLHURSRPGH]HWHVH
OHFWHUHQ.OLNGDDUQDRSGH>5HPRYH@NQRSRP]HWHYHZLMGHUHQ
3 9HUZLMGHUGH86%NDEHOXLWGH6&HQVOXLWGHNDEHORSQLHXZDDQ$OVGHFRP
SXWHUGH6&KHUNHQWPRHWXGHLQVWDOODWLHYDQGHVWXULQJYDQLQKHWEHJLQXLW
YRHUHQ
USB-aansluitingen kunnen niet juist worden gemaakt (Windows 98)
● Werd de SC-8850 herkend?
9HUZLMGHUGH86%NDEHOHQVOXLWGH]HRSQLHXZDDQ
+HWLVPRJHOLMNGDWGHFRPSXWHUGH6&QLHWNRQKHUNHQQHQRILQLWLDOL]HUHQ
+RXGWGH86%NDEHODDQJHVORWHQRSGH6&HQKHUVWDUW:LQGRZV$OVXQRJ
VWHHGVJHHQYHUELQGLQJNULMJWPRHWX:LQGRZVYHUODWHQHQGHVWURRPYDQXZFRP
SXWHUXLW]HWWHQ
=HWGDDUQDGHVWURRPYDQXZFRPSXWHUDDQHQ]HW:LQGRZVDDQ
De klank is vervormd
● Wordt er een effect toegepast dat de klank vervormt? S
● Als een specifieke part of klank vervormd is, moet u het volume van deze part
omlaag draaien.S
● Als alle klanken vervormd zijn, moet u het algemene volume van alle parts omlaag draaien S, of de [VOLUME] knop S gebruiken om het volume te
verlagen.
De toonhoogte is niet juist
● Is de toonhoogte van een specifieke part of van alle parts incorrect?SS
● Werd de Fine Tune-instelling op een specifieke part ingesteld?S
● Werd er een MIDI Pitch Bend-commando ontvangen om de toonhoogte te veranderen?
142
Bijlagen
De klank blijft doorklinken - stopt niet
● Bij sommige sequence-programma’s blijft de klank doorgaan wanneer u de opnamesporen verandert terwijl u op het klavier speelt.
,QGDWJHYDOPRHWXRSGH>087(@NQRSYDQGH6&GUXNNHQRPGHNODQNWH
VWRSSHQHQGDDUQDRSQLHXZRSGH>087(@NQRSGUXNNHQRPGHYRULJHWRHVWDQGWH
KHUVWHOOHQS
De klank is fout
● Hebt u een andere klank geslecteerd nadat u de parameterinstellingen van de
klank hebt gewijzigd (filter, enz.)?
6WHODOOHNODQNSDUDPHWHUVRSQLHXZLQRSHHQZDDUGHYDQSS
● Soms is het mogelijk dat de parameters van de SC-8850 fout zijn.
2P]XONHVLWXDWLHVWHYHUKHOSHQPRHWXKHWWRHVWHOLQLWLDOL]HUHQYRRU*HQHUDO0,',
RI*6S
De klanken worden onderbroken
● Als u meer dan 128 stemmen tegelijkertijd speelt, worden de klanken onderbroken.S
● Worden dezelfde gegevens tegelijkertijd naar MIDI IN 1 en MIDI IN 2 verstuurd?
=HOIVDOVGH6&
JHwQLWLDOLVHHUGZRUGWYRRU
*HQHUDO0,',*6]XOOHQ
GHLQVWHOOLQJHQYDQGH
6\VWHHPSDUDPHWHUVQLHW
YHUDQGHUHQ
Er kunnen niet meer dan 32 parts worden afgespeeld
● De SC-8850 kan alleen meer dan 32 parts afspelen wanneer het toestel
aangesloten is met een USB-connector of met een seriële connector.
:DQQHHUGH6&PHWGH0,',FRQQHFWRUHQLVDDQJHVORWHQNDQPHQPD[LPDDO
SDUWVVSHOHQ
Er worden geen exclusive-commando’s ontvangen
● Komt het Device ID-nummer van het verstuurde Exclusive-commando overeen
met het Device ID-nummer van de SC-8850?S
De SC-8850 verstuurt geen MIDI-gegevens
● Als u met dit toestel gegevens wil versturen met de USB- of de seriële connector, moet u de computerschakelaar op USB, PC of Mac zetten, al naargelang
uw computer.SS
● Als de computerschakelaar van de SC-8850 op MIDI staat, zal de SC-8850 geen
gegevens versturen vanuit de USB-connector of de seriële connector.
De MIDI-klankgeneratoren die op de SC-8850 zijn aangesloten
spelen niet vanuit een computer of een sequencer
● Muziekgegegevens die door de USB-connector of de seriële connector van de
SC-8850 ontvangen worden, werden vanuit de MIDI OUT-connector verzonden.
0DDNGHMXLVWHLQVWHOOLQJHQRSXZVHTXHQFHUVRIWZDUHHQGHVWXULQJ
Wanneer een invoegeffect wordt gebruikt, heeft de panpot van een
part geen effect — de klank wordt in het midden geplaatst
● Afhankelijk van het algoritme is het mogelijk dat dit geen effect heeft.
'HLQYRHJHIIHFWHQ]LMQRQWZRUSHQRPQDGHSDUWSDQLQJHYRHJGWHZRUGHQ*HEUXLN
GHSDQYDQGHLQYRHJHIIHFWHQ
143
Bijlagen
Ik wil delay op een drumpart toepassen, maar dit lukt niet
● Het Delay Send Level van alle druminstruments staat in de oorspronkelijke instellingen op 0.
6WHOKHW'HOD\6HQG/HYHOLQYRRUHONLQVWUXPHQWS
$DQJH]LHQGHRRUVSURQNHOLMNHLQVWHOOLQJYDQKHW'HOD\/HYHOYRRUGHGUXPSDUWLV
PRHWXKHW'HOD\6HQG/HYHOYHUKRJHQS
Als ik een invoegeffect aanzet, zijn de eerder gemaakte instellingen
van de systeemeffecten (reverb enz.) geïnitializeerd
● Als u een invoegeffect aanzet, is het niet langer mogelijk om control changes
te gebruiken om het zendniveau van de systeemeffecten in te stellen.
'LWEHWHNHQWGDWZDQQHHUXHHQLQYRHJHIIHFWDDQ]HWXHHQDQGHUHURXWH]DOPRHWHQ
JHEUXLNHQRPKHWVLJQDDOQDDUGHV\VWHHPHIIHFWHQWHVWXUHQ
8NDQKHW]HQGQLYHDXRSKHWV\VWHHPHIIHFWLQVWHOOHQZDQQHHUGHEFX TO Rev (Cho,
Dly)SSZHUGJHEUXLNWRP();DDQWH]HWWHQ
Bestaat er een manier om telkens automatisch te initializeren?
● Met de fabrieksinstellingen, wordt de SC-8850 bij het aanzetten van de stroom
opgestart in een GS reset-toestand.
+HWLVRRNPRJHOLMNRPGH6&RSWHVWDUWHQPHWGHLQVWHOOLQJHQGLHLQGHXVHU
DUHDZHUGHQEHZDDUGS
● Als een exclusive-commando een GS-reset verstuurt die in het begin van een
song is opgenomen, zal de SC-8850 automatisch een reset ondergaan bij het
begin van een song.
Ik kan slechts 16 parts spelen met een computerkabelaansluiting
● De Windows MIDI Mapper ondersteunt gewoonlijk slechts 16 parts.
$OVXSDUWVRIPHHUZLOJHEUXLNHQPRHWXWRHSDVVLQJVVRIWZDUHJHEUXLNHQPHW
0,',XLWUXVWLQJHQYRRUWZHHSRRUWHQ
Is het mogelijk om alleen individuele parametergegevens naar de
computer (sequencer) te versturen (teveel gegevens in een bulk dump)
● Naast de dump bulk-functie die een groep parameters verstuurt, kan u met de
SC-8850 ook gegevens van individuele parameters versturen. U kan deze individuele gegevenstransmissie gebruiken om alleen de gewenste gegevens te
versturen.
%LMKHWYHUVWXUHQYDQLQGLYLGXHOHJHJHYHQVPRHWXKHWKXLGLJHV\VWHPH[FOXVLYHJH
JHYHQVIRUPDDWQLHWRS]RHNHQHQLVGDDUHQERYHQHHQHIILFLsQWHPDQLHUYRRUKHW
FUHsUHQYDQJHJHYHQV
Het volume van het aangesloten instrument dat aangesloten is op
een Audio Input jack is te laag
● Gebrukt u misschien een aansluitingskabel die een resistor bevat?
*HEUXLNHHQDDQVOXLWLQJVNDEHOGLHJHHQUHVLVWRUEHYDW
144
Bijlagen
Over MIDI
■ Wat is MIDI?
0,',VWDDWYRRU0XVLFDO,QVWUXPHQW'LJLWDO,QWHUIDFH0,',WRHVWHOOHQNXQQHQDDQ
PX]LHNYHUZDQWHJHJHYHQVYHUVWXUHQ]RDOVXLWYRHULQJVJHJHYHQVRIJHJHYHQVRP
NODQNHQWHVHOHFWHUHQ$DQJH]LHQ0,',HHQZHUHOGVWDQGDDUGLVNXQQHQPX]LHNJH
JHYHQVWXVVHQWRHVWHOOHQZRUGHQYHUVWXXUGHQRQWYDQJHQ]HOIVZDQQHHUGH]HWRHV
WHOOHQYDQHHQDQGHUW\SH]LMQRIZDQQHHU]HGRRUYHUVFKLOOHQGHILUPD·VZHUGHQ
JHIDEULFHHUG,QGH0,',VWDQGDDUGZRUGHQJHJHYHQVGLHHHQPX]LHNXLWYRHULQJEH
VFKULMYHQ]RDOV´VSHHOHHQQRRWµRI´GUXNRSKHWSHGDDOµDOV0,',FRPPDQGR·VYHU
VWXXUG
:DQQHHUXGH6&JHEUXLNWRPXLWVOXLWHQGFRPPHUFLsOHPX]LHNJHJHYHQVDIWH
VSHOHQRIRPXZVSHOVRIWZDUHYDQNODQNWHYRRU]LHQLVKHWQLHWQRGLJXLQ0,',WH
YHUGLHSHQ9ROJJHZRRQGHLQVWUXFWLHVLQKHWKDQGERHNYDQXZWRHVWHOGDWPX
]LHNJHJHYHQVDIVSHHOW0,',VSHOHURIYDQXZVRIWZDUH
'HKLHUQDYROJHQGHYHUGXLGHOLMNLQJKHOSWXRP0,',WHJHEUXLNHQHQRP]RPHWXZ
6&LQGHWDLOWHNXQQHQZHUNHQ
Versturen en ontvangen van MIDI-commando’s
(HUVWOHJJHQZHLQKHWNRUWXLWKRH0,',FRPPDQGR·VYHUVWXXUGHQRQWYDJHQ
ZRUGHQ
MIDI -connectoren
0,',FRPPDQGR·VZRUGHQYHUVWXXUGHQRQWYDQJHQPHWEHKXOSYDQWZHHVRRUWHQ
FRQQHFWRUHQRSGH6&6OXLWRSGH]HFRQQHFWRUHQ0,',NDEHOVDDQ]RDOVKHW
YRRUXZRSVWHOOLQJJHVFKLNWLV
ILJH
MIDI
OUT
IN
'H6&LVQLHWXLWJHUXVW
PHWHHQ0,',7+58
FRQQHFWRU
naar een ander MIDI-toestel van een ander MIDI-toestel
0,',,1
0,',287
'H]HFRQQHFWRURQWYDQJWFRPPDQGR·VYDQHHQDQGHU0,',WRHVWHO
'H]HFRQQHFWRUYHUVWXXUWFRPPDQGR·VYDQXLWGH6&
MIDI-kanalen en multitimbrale klankmodules
0,',YHUVWXXUWHHQJURRWJDPPDYDQXLWYRHULQJVJHJHYHQVGRRUHHQHQNHOH0,',
NDEHO'LWZRUGWPRJHOLMNJHPDDNWGRRU0,',NDQDOHQ'RRUGH0,',NDQDOHQNDQ
PHQEHSDDOGHJHJHYHQVXLWHHQJURRWDDQWDOJHJHYHQVVHOHFWHUHQ+HWFRQFHSWLV
JHOLMNDDUGLJDDQGDWYDQ79NDQDOHQ:DQQHHUXHHQNDQDDOYHUDQGHUWRSXZ79
RQWYDQJHUNDQXGHSURJUDPPD·VYDQGHYHUVFKLOOHQGHVWDWLRQV]LHQ'RRUKHWNDQDDO
YDQGHRQWYDQJHU]RLQWHVWHOOHQGDWKHWRYHUHHQNRPWPHWKHWNDQDDOYDQGH
YHU]HQGHULVKHWPRJHOLMNRPXLWVOXLWHQGKHWSURJUDPPDWHRQWYDQJHQGDWXZLO
EHNLMNHQ2SGH]HOIGHPDQLHUNDQXPHW0,',JHJHYHQVDOOHHQRQWYDQJHQZDQQHHU
KHWNDQDDOYDQGHRQWYDQJHURYHUHHQNRPWPHWKHWNDQDDOYDQGHYHU]HQGHU
ILJH
Station A
De TV staat ingesteld op het kanaal
van het station dat u wil bekijken.
Station B
Station C
De kabel van de antenne voert de TV-signalen van vele zendstations.
145
Bijlagen
0,',JHEUXLNW]HVWLHQNDQDOHQPHWQXPPHUV0X]LHNJHJHYHQVZRUGHQRQW
YDQJHQZDQQHHUKHWYHU]HQGNDQDDOYDQKHWYHU]HQGHQGHWRHVWHORYHUHHQVWHPWPHW
KHWRQWYDQJVWNDQDDOYDQKHWRQWYDQJHQGHWRHVWHO$OVXGHLQVWHOOLQJHQYDQGH0,',
NDQDOHQPDDNWGLHLQ)LJJHWRRQGZRUGHQ]DODOOHHQNODQNPRGXOH%VSHOHQZDQ
QHHUXRSKHWNODYLHUVSHHOWHQ]DONODQNPRGXOH$QLHWNOLQNHQ'HUHGHQKLHUYDQLV
GDWNODQNPRGXOH%RYHUHHQNRPWPHWKHWYHU]HQGNDQDDOYDQKHWNODYLHUHQGDWKHW
NDQDDOYDQNODQNPRGXOH$KLHUPHHQLHWRYHUHHQVWHPW
2PJHNHHUG]DONODQNPRGXOH$NOLQNHQZDQQHHUXKHWYHU]HQGNDQDDOYDQKHWNOD
YLHU]RLQVWHOWGDWKHWRYHUHHQVWHPWPHWNODQNPRGXOH$)LJ
ILJH
MIDI OUT
MIDI IN
MIDI THRU
Ontvangstkanaal: 2
Zendkanaal: 1
Klankmodule A
Fig. 1
MIDI-klavier
Ontvangstkanaal: 1
Klankmodule B
MIDI OUT
MIDI IN
MIDI IN
MIDI THRU
Ontvangstkanaal: 2
Zendkanaal: 2
Klankmodule A
Fig. 2
MIDI-klavier
Ontvangstkanaal: 1
MIDI IN
Klankmodule B
$DQJH]LHQGH6&WZHH0,',,1FRQQHFWRUHQKHHIWNDQKHWWRHVWHOLQWRWDDO
NDQDOHQWHJHOLMNHUWLMGRQWYDQJHQ$OVXNDQDOHQJHEUXLNWNDQXHQVHPEOHVVSHOHQ
GLHSDUWVJHEUXLNHQ.ODQNPRGXOHV]RDOVGH6&GLHWHJHOLMNHUWLMGHHQJURRW
DDQWDOSDUWVNXQQHQVSHOHQQRHPWPHQ´PXOWLWLPEUDOH·NODQNPRGXOHV7LPEUHLV
HHQDQGHUZRRUGYRRUNODQN
'LWWRHVWHOKHHIWWZHHVRRUWHQSDUWVQRUPDOHSDUWVHQGUXPSDUWVS1RUPDOH
SDUWVZRUHQJHEUXLNWRPPHORGLHHQEDVOLMQHQWHVSHOHQ2S*HQHUDO0,',*6
NODQNPRGXOHVJHEUXLNWGHGUXPSDUWNDQDDO
■ Wat is General MIDI 2?
*HQHUDO0,',LVHHQUHHNVDDQEHYROHQVSHFLILFDWLHVGLHLQJHGHWDLOOHHUGHGHILQLWLHV
YRRUIXQFWLRQDOLWHLWYRRU]LHQ]RDOVYRRUKHWEHZHUNHQYDQNODQNHQHQYRRUHIIHFWHQ
GLHQRJQLHWEHSDDOGZDUHQLQ*HQHUDO0,',HQGLHGHNODQNPDSHHQKRJHUH
JUDDGYDQXLWYRHULQJVH[SUHVVLHHQFRPSDWLELOLWHLWJHYHQ
*HQHUDO0,',ZHUGLQJHGHILQLHHUGDOVHHQDDQEHYROHQYHUVLHYDQGH0,',VSHFLILFDWLHRPGH
0,',IXQFWLRQDOLWHLWYDQNODQNPRGXOHVYDQHHQVWDQGDDUGWHYRRU]LHQGLHEHSDDOGHYRUPHQYDQFRPSDW
LELOLWHLWWRHODDWWXVVHQGHYHUVFKLOOHQGHIDEULNDQWHQ+HWGHILQLHHUWGHEDVLVVSHFLILFDWLHVYDQNODQNPRGXOHV
]RDOVKHWDDQWDOSDUWVSRO\IRQLHHQGHNODQNPDS
Voornaamste verschillen tussen General MIDI 2 en het GS Format (SC-8850)
‡,QLWLDOL]DWLHFRPPDQGRYRRUGHNODQNEURQSDUDPHWHUV
>*6@
*65HVHW
)))
>*HQHUDO0,',@ *06\VWHP2Q
)())
‡.ODQNVHOHFWLH
>*6@
146
*HEUXLNEDQNVHOHFW06%HQSURJUDPFKDQJH
%DQNVHOHFW/6%ZRUGWJHEUXLNWRPGHNODQNPDSWHYHUDQGHUHQ
+VSHFLI\,1670$3
+6&0DS
+6&0DS
+6&3UR0DS
+6&0DS
2PKHWGUXPSDUWRSHHQDQGHUHSDUWGDQSDUWLQWHVWHOOHQPRHW
XHHQV\VWHPH[FOXVLYHFRPPDQGRJHEUXLNHQS
Bijlagen
9RRUEHHOG! 3DUWLQVWHOOHQRSHHQGUXPSDUW5RRP6HW
)$))
0,',&+
&&
&&
3&
>*HQHUDO0,',@ *HEUXLNEDQNVHOHFW/6%HQSURJUDPFKDQJH
%DQNVHOHFW06%LV*HEUXLNRPDOVGUXPSDUWLQWHVWHOOHQ
9RRUEHHOG! 3DUWLQVWHOOHQRSHHQGUXPSDUW5RRP6HW
0,',&+
&&
&&
3&
'HNODQNPDSYDQ*HQHUDO0,',YHUVFKLOWYDQGLHYDQKHW*6IRUPDW'H6&ZHUNWJHZRRQLQ
KHW*6IRUPDWPDDUDOVHHQ*06\VWHP2QFRPPDQGRRQWYDQJHQZRUGW]DOGH6&LQ*HQHUDO
0,',PRGXVJDDQHQHHQVSHFLDOHNODQNPDSJHEUXLNHQ,QGH]HWRHVWDQGLVKHWQLHWPRJHOLMNRPGH
HLJHQNODQNHQYDQGH6&WHVHOHFWHUHQ
*HQHUDO0,',6RXQGPDS
S
Onderwerpen die zopas in General MIDI 2 werden gedefinieerd
‡3RO\IRQLH
*HQHUDO0,',LV
‡ $DQWDONODQNHQ
NODQNHQGUXPVHWV*HQHUDO0,',LVNODQNHQGUXPVHW
‡7HRQWYDQJHQFRPPDQGR·V GHLQ*HQHUDO0,',WRHJHYRHJGHFRPPDQGR·V
1RWH212))
3URJUDP&KDQJH
&RQWURO&KDQJH
%DQN6HOHFW
&RQWUROOHUV
0RGXODWLRQ'HSWK
&RQWUROOHU
3RUWDPHQWR7LPH
&RQWUROOHU
&KDQQHO9ROXPH
&RQWUROOHU
3DQ
&RQWUROOHU
([SUHVVLRQ
&RQWUROOHU
+ROG
&RQWUROOHU
3RUWDPHQWR212))
&RQWUROOHU
6RVWHQXWR
&RQWUROOHU
6RIW
&RQWUROOHU
+DUPRQLF&RQWHQW
&RQWUROOHU
5HOHDVH7LPH
&RQWUROOHU
$WWDFN7LPH
&RQWUROOHU
%ULJKWQHVV
&RQWUROOHU
'HFD\7LPH
&RQWUROOHU
9LEUDWR5DWH
&RQWUROOHU
9LEUDWR'HSWK
&RQWUROOHU
9LEUDWR'HOD\
&RQWUROOHU
5HYHUE6HQG/HYHO
&RQWUROOHU
&KRUXV6HQG/HYHO
&RQWUROOHU
'DWD(QWU\
&RQWUROOHUV
531/6%06%
&RQWUROOHU
531
3LWFK%HQG6HQVLWLYLW\
)LQH7XQH
&RDUVH7XQH
0RGXODWLRQ6HQVLWLYLW\
5311XOO
147
Bijlagen
&KDQQHO0RGH0HVVDJH
$OO6RXQG2II
5HVHW$OO&RQWUROOHUV
$OO1RWHV2))
0RQR0RGH21
3RO\0RGH21
3LWFK%HQG
&KDQQHO3UHVVXUH
*06\VWHP0HVVDJH
*06\VWHP21
*06\VWHP21
*06\VWHP2))
8QLYHUVDO6\VWHP([FOXVLYHFRPPDQGR
0DVWHU9ROXPH
0DVWHU)LQH7XQLQJ
0DVWHU&RDUVH7XQLQJ
5HYHUE3DUDPHWHUV
5HYHUE7\SH
5HYHUE7LPH
&KRUXV3DUDPHWHUV
&KRUXV7\SH
0RGXODWLRQ5DWH
0RGXODWLRQ'HSWK
)HHGEDFN
5HYHUE6HQG/HYHO
&RQWUROOHU6HWWLQJV
&KDQQHO3UHVVXUH
&RQWURO&KDQJH
6FDOH2FWDYH7XQLQJ
.H\EDVHG&RQWUROOHU
/HYHO
3DQ
5HYHUE6HQG/HYHO
&KRUXV6HQG/HYHO
$FWLYH6HQVLQJ
■ MIDI-commando’s die door de SC-8850 kunnen
ontvangen worden
0,',JHEUXLNWYHUVFKLOOHQGHVRRUWHQFRPPDQGR·VRPPX]LNDOHXLWYRHULQJVJHJHY
HQVWHYHUVWXUHQHQHU]LMQYHHOVRRUWHQ0,',FRPPDQGR·V%LMYRRUEHHOGGHLQIRU
PDWLHGLHDDQJHHIW´ZHONHWRHWVKRHVWHUNZHUGDDQJHVODJHQµZRUGWYHU]RQGHQDOV
HHQ1RWHFRPPDQGR
'HPDQLHUZDDURSHHQWRHVWHOUHDJHHUWZDQQHHUKHWRPKHWHYHQZHON0,',FRP
PDQGRRQWYDQJW]RDOVKRHKHWNODQNSURGXFHHUWLVDIKDQNHOLMNYDQGHVSHFLILFDWLHV
YDQGDWWRHVWHO'LWEHWHNHQWGDWDOVKHWRQWYDQJHQGHWRHVWHOGHGRRUKHWLQNRPHQGH
FRPPDQGRJHYUDDJGHIXQFWLHQLHWNDQXLWYRHUHQKHWPX]LNDOHUHVXOWDDWQLHWGDW
JHQH]DO]LMQZDWXYHUZDFKWKDG
'HEHODQJULMNVWHVRRUWHQ0,',FRPPDQGR·VGLHGRRUGH6&ZRUGHQRQWYDQJHQ
]LMQGHYROJHQGH
0,',FRPPDQGR·VZDDUYRRUGRRU*HQHUDO0,',RQWYDQJVWPRJHOLMNKHLGZRUGWYHUHLVW]LMQPHWHHQ✩
WHNHQJHPHUNW
148
Bijlagen
Note-commando’s ✩
'H]HFRPPDQGR·VYHUVWXUHQQRWHQGLHRSKHWNODYLHUZRUGHQJHVSHHOG=HEHYDWWHQ
GHYROJHQGHLQIRUPDWLH
1RWHQXPEHU QXPPHUGDWGHQRRWWRHWVDDQGXLGWGLHLQJHGUXNWRIORVJHODWHQZRUGW
1RWHRQ
JHJHYHQVGLHDDQGXLGHQRIHHQQRRWWRHWVLQJHGUXNWZHUG
1RWHRII
JHJHYHQVGLHDDQGXLGHQRIHHQQRRWWRHWVORVJHODWHQZHUG
9HORFLW\
QXPPHUGDWDDQGXLGWKRHVWHUNGHQRRWWRHWVLQJHGUXNWZHUG
1RWHQXPPHUVJDDQYDQWRWHQGXLGHQGHSRVLWLHYDQGHWRHWV
RSKHWNODYLHUDDQPHWPLGGHQ&DOVQRRWQXPPHU
Pitch Bend ✩
:RUGWJHEUXLNWRPFRPPDQGR·VWHYHUVWXUHQEHWUHIIHQGHGHZHUNLQJYDQGHSLWFK
EHQGVFKLMIRIKHQGHOGLHPHQPHHVWDORSV\QWKHVL]HUVYLQGW3LWFKEHQGHUVNXQQHQ
GHWRRQKRRJWHYDQHHQQRRWYRRUWGXUHQGLQHHQEUHHGEHUHLNYHUDQGHUHQ
Program Change ✩
'H]HFRPPDQGR·VZRUGHQJHEUXLNWRPNODQNHQWHVHOHFWHUHQ.ODQNHQZRUGHQJH
VHOHFWHHUGGRRU3URJUDPQXPPHUV²2SGH6&VHOHFWHUHQGH]HFRPPDQ
GR·VNODQNHQ,QVWUXPHQWHQ'RRU%DQN6HOHFWFRPPDQGR·VWHJHEUXLNHQGLHHHQ
VRRUWYDQ&RQWURO&KDQJHFRPPDQGR]LMQNDQHHQQRJJURWHUHYDULsWHLWNODQNHQ
ZRUGHQJHVHOHFWHHUGS
Control Change ✩
'H]HFRPPDQGR·VVWXUHQSDUDPHWHUV]RDOVPRGXODWLHHQSDQ'HIXQFWLHYDQKHW
FRPPDQGRZRUGWEHSDDOGGRRU]LMQ&RQWURO&KDQJHQXPPHU
Bank Select (control change-nummer 0/32)
'HWRRQZRUGWYHUDQGHUGZDQQHHUKLMJHEUXLNWZRUGWPHWHHQ3URJUDP&KDQJH
FRPPDQGR'HWRRQZRUGWJHVHOHFWHHUGPHWHHQ3URJUDP&KDQJHFRPPDQGRQDGDW
HHQ%DQN6HOHFWFRPPDQGRRQWYDQJHQZHUG
'HNODQN]DOQLHWYHUDQGHUHQZDQQHHUDOOHHQHHQ%DQN6HOHFWFRPPDQGRRQWYDQJHQ
ZRUGW
Modulation (control change-nummer 1) ✩
'LWFRPPDQGRVWXXUWYLEUDWR
Volume (control change-nummer 7) ✩
'LWFRPPDQGRVWXXUWKHWYROXPHYDQHHQSDUW:DQQHHUGLWFRPPDQGRRQWYDQJHQ
ZRUGW]DOKHWYROXPHYDQHHQSDUWYHUDQGHUHQ
Expression (control change-nummer 11) ✩
'LWFRPPDQGRYHUVWXXUWYROXPHYHUDQGHULQJHQ+HWNDQJHEUXLNWZRUGHQRPH[
SUHVVLHDDQHHQVRQJWRHWHYRHJHQ
Volume en Expression gebruiken
+HWLVJHPDNNHOLMNRP9ROXPHHQ([SUHVVLRQRSYHUVFKLOOHQGHPDQLHUHQDOVYROJWWH
JHEUXLNHQ
9ROXPH
3DVWGHYROXPHEDODQVWXVVHQGH3DUWVDDQ
([SUHVVLRQ 0DDNWYROXPHYHUDQGHULQJHQWLMGHQVHHQVRQJFUHVFHQGRGHFUHVFHQ
GRHQ]
'HUHGHQYRRUGH]HGLIIHUHQWLDWLHLVGDWZDQQHHUXDOOHHQ9ROXPHFRPPDQGR·VJH
EUXLNWRPYROXPHYHUDQGHULQJHQLQHHQVRQJWHFUHsUHQXDOOH9ROXPHJHJHYHQVLQ
GHVRQJPRHWYHUDQGHUHQLQGLHQXODWHU]RXEHVOXLWHQGHYROXPHEDODQVWXVVHQGH
SDUWVDDQWHSDVVHQ$OVXHFKWHUDOOHHQ9ROXPHJHEUXLNWLQKHWEHJLQYDQGHVRQJHQ
DOOHHQ([SUHVVLRQJHEUXLNWWLMGHQVGHVRQJ]DOKHWHHQYRXGLJ]LMQRPGHYROXPHEDO
DQVWXVVHQGHSDUWVYRRUGHYROOHGLJHVRQJDDQWHSDVVHQGRRUJHZRRQGH9ROXPHJH
JHYHQVLQKHWEHJLQYDQGHVRQJWHYHUDQGHUHQ]RGDWGHJHJHYHQVYRRU
G\QDPLHNYHUDQGHULQJHQNXQQHQEOLMYHQ]RDOV]HZDUHQ'LWLV]HHUKDQGLJZDQQHHU
XELMYRRUEHHOGEHVOXLWRPHHQOLFKWHEDODQVYHUDQGHULQJWHPDNHQWXVVHQGHSLDQRHQ
GHEDVZDQQHHUGHVRQJELMQDDILV
%LMVRPPLJH0,',
VHTXHQFHUVZRUGHQFRQWURO
FKDQJHGDWDYDQGH]HOIGH
VWDSWLPLQJYHU]RQGHQ
YROJHQVRSNOLPPHQGH
YROJRUGHYDQKXQ
FRQWUROOHUQXPPHU$OVX
GLWW\SHYDQ0,',
VHTXHQFHUJHEUXLNWPRHWX
GHWLPLQJYDQGHEDQN
VHOHFWGDWDDDQSDVVHQ]RGDW
GH]HDOWLMGLQGHMXLVWH
YROJRUGHYDQ%DQN6HOHFW→
3URJUDP&KDQJH
YHU]RQGHQZRUGW
+HWYROXPHYDQHHQ3DUW
ZRUGW]RZHOGRRU9ROXPH
ERRGVFKDSSHQFRQWURO
FKDQJHDOVGRRU
([SUHVVLRQERRGVFKDSSHQ
FRQWUROFKDQJHEHwQ
YORHG$OVHUHHQZDDUGH
RQWYDQJHQZRUGWYRRUHHQ
YDQGH]HERRGVFKDSSHQ
GDQLVKHWYROXPHYDQGH]H
3DUWJHOLMNDDQHQ]DOKHW
QLHWWRHQHPHQ]HOIVDO
ZRUGWGHDQGHUHERRG
VFKDSPHWHHQKRJHUH
ZDDUGHYHU]RQGHQ+RX
KLHUUHNHQLQJPHH
149
Bijlagen
Pan (control change-nummer 10) ✩
'LWFRPPDQGRVWXXUWGHVWHUHRSRVLWLHYDQHHQSDUWS
Hold (1) (control change-nummer 64) ✩
'LWFRPPDQGRVWXXUWGHRSZDDUWVHHQQHHUZDDUWVHEHZHJLQJHQYDQKHWUHFKWVH
SHGDDOZDDUGRRUGHQRWHQGLHNOLQNHQDDQJHKRXGHQZRUGHQ:DQQHHUHHQ+ROG
2QFRPPDQGRRQWYDQJHQZRUGW]XOOHQGHQRWHQZRUGHQDDQJHKRXGHQ,QKHWJHY
DOYDQLQVWUXPHQWHQPHWXLWVWHUIWLMG]RDOVHHQSLDQR]DOGHNODQNJHOHLGHOLMNXLWVWHU
YHQWRWHHQ+ROG2IIFRPPDQGRRQWYDQJHQZRUGW,QKHWJHYDOYDQLQVWUXPHQWHQ
GLHGRRUNOLQNHQ]RDOVHHQRUJHO]DOGHNODQNEOLMYHQGRRUNOLQNHQWRWHHQ+ROG2II
FRPPDQGRRQWYDQJHQZRUGW
Sostenuto (control change-nummer 66)
+HWVRVWHQXWRSHGDDORSHHQSLDQRODDWDOOHHQGLHQRWHQGRRUNOLQNHQGLHUHHGV
NORQNHQRSKHWPRPHQWGDWKHWSHGDDOZHUGLQJHGUXNW+HW6RVWHQXWRFRPPDQGR
VWXXUWGHEHZHJLQJYDQGH]HSHGDDO:DQQHHU6RVWHQXWR2QRQWYDQJHQZRUGW]X
OOHQDOOHHQGHQRWHQDDQJHKRXGHQZRUGHQGLHRSGDWPRPHQWUHHGVNORQNHQ,QKHW
JHYDOYDQLQVWUXPHQWHQPHWXLWVWHUIWLMG]RDOVHHQSLDQR]DOGHNODQNJHOHLGHOLMNXLW
VWHUYHQWRWHHQ+ROG2IIFRPPDQGRRQWYDQJHQZRUGW,QKHWJHYDOYDQLQVWUXPHQW
HQGLHGRRUNOLQNHQ]RDOVHHQRUJHO]DOGHNODQNEOLMYHQGRRUNOLQNHQWRWHHQ+ROG2II
FRPPDQGRRQWYDQJHQZRUGW
Soft (control change-nummer 67)
+HWOLQNVHSHGDDOYDQHHQSLDQRYHU]DFKWGHWRRQZDQQHHUKHWSHGDDOLQJHGUXNWLV
+HW6RIWFRPPDQGRVWXXUWGHEHZHJLQJYDQGH]HSHGDDO:DQQHHU6RIW2QRQWYDQ
JHQZRUGW]DOGHDIVQLMIUHTXHQWLHYHUODJHQZDDUGRRUPHQHHQ]DFKWHUHNODQNNULMJW
:DQQHHU6RIW2IIRQWYDQJHQZRUGW]DOGHYRULJHNODQNWHUXJNRPHQ
Reverb Send Level (control change-nummer 91)
'LWFRPPDQGRJHHIWHHQJDOPHIIHFWDDQGH3DUW5HYHUE/HYHOS
Chorus Send Level (control change-nummer 93)
'LWFRPPDQGRJHHIWHHQFKRUXVHIIHFWDDQGH3DUW&KRUXV/HYHOS
Delay Send Level (control change-nummer 94)
'LWFRPPDQGRJHHIWHHQHFKRHIIHFWDDQGH3DUW'HOD\/HYHOS
Portamento (control change-nummer 65)
Portamento Time (control change-nummer 5)
Portamento Control (control change-nummer 84)
3RUWDPHQWRLVHHQHIIHFWGDWHHQOLFKWHWRRQKRRJWHYHUDQGHULQJFUHsHUWWXVVHQGHQRRW
GLHHHUVWZHUGJHVSHHOGHQGHQRRWGLH]RSDVZHUGJHVSHHOG:DQQHHUHHQ3RUWD
PHQWRFRPPDQGRZRUGWRQWYDQJHQ]DOKHW3RUWDPHQWRHIIHFWDDQRIXLWJH]HW
ZRUGHQ3RUWDPHQWR7LPHVWXXUWGHVQHOKHLGYDQGHWRRQKRRJWHYHUDQGHULQJ3RUWD
PHQWR&RQWUROEHSDDOWKHW6RXUFH1RWHQXPPHUGHHHUVWJHVSHHOGHQRRW
150
Bijlagen
RPN LSB, MSB (control change-nummers 100 & 101) ✩
Data Entry (control change-nummers 6 & 38) ✩
$DQJH]LHQGHIXQFWLH5315HJLVWHUHG3DUDPHWHU1XPEHULQGH0,',VSHFLILFDWLH
EHSDDOGLVNDQGLWFRPPDQGRJHEUXLNWZRUGHQWXVVHQWRHVWHOOHQYDQHHQYHUVFKLO
OHQGPHUN'H53106%HQ/6%FRPPDQGR·VVSHFLILsUHQGHSDUDPHWHUGLH
JHZLM]LJGPRHWZRUGHQZDDUQD'DWD(QWU\FRPPDQGR·VZRUGHQJHEUXLNWRPGH
ZDDUGHYDQGLHSDUDPHWHUWHZLM]LJHQ531NDQJHEUXLNWZRUGHQRP3LWFK%HQG
6HQVLWLYLW\0DVWHU&RDUVH7XQHHQ0DVWHU)LQH7XQHDDQWHSDVVHQ
NRPN LSB, MSB (control change-nummers 98 & 99)
'HZDDUGHQGLHXZLM]LJW
YLD531ERRGVFKDSSHQ
ZRUGHQQLHWJHwQLWLDOL
VHHUG]HOIVDONRPHQHU
3URJUDP&KDQJH
FRPPDQGR·VHQ]ELQQHQ
RPDQGHUHNODQNHQWH
NLH]HQ
Data Entry (control change-nummers 6 & 38)
15311RQUHJLVWHUHG3DUDPHWHU1XPEHUFRPPDQGR·VNXQQHQJHEUXLNWZRUGHQ
RPGHZDDUGHQYDQNODQNSDUDPHWHUVDDQWHSDVVHQGLHHLJHQ]LMQDDQHHQEHSDDOG
WRHVWHO'H153106%HQ/6%FRPPDQGR·VVSHFLILsUHQGHSDUDPHWHUGLHYHUDQGHUG
PRHWZRUGHQZDDUQD'DWD(QWU\FRPPDQGR·VZRUGHQJHEUXLNWRPGHZDDUGHYDQ
GLHSDUDPHWHUWHZLM]LJHQ
$DQJH]LHQKHW*6IRUPDWGHIXQFWLHYDQYHUVFKHLGHQH1531FRPPDQGR·V
GHILQLHHUWNXQQHQPHW*6FRPSDWLEOHWRHSDVVLQJVSURJUDPPD·V1531FRPPDQ
GR·VJHEUXLNHQRPNODQNJHJHYHQVSDUDPHWHUVWHZLM]LJHQYRRU9LEUDWR&XWRII)UH
TXHQF\5HVRQDQFHHQ(QYHORSHZDDUGHQ
1DGDWHUHHQ*65HVHW
ERRGVFKDSRQWYDQJHQLV
ZRUGHQHU1531
ERRGVFKDSSHQRQWYDQJHQ
'HWDLOVRYHUKHWJHEUXLN
YDQ1531PHW*6NODQN
PRGXOHV]LHNRPNs
gebruiken met GS Sound
ModulesS
Aftertouch (Alleen kanaaldruk ✩)
$IWHUWRXFKLVHHQFRPPDQGRGDWGHGUXNVWXXUWGLHRSKHWNODYLHUZRUGWWRHJHSDVW
QDGDWHHQQRRWZHUGJHVSHHOG]RGDWGH]HLQIRUPDWLHJHEUXLNWNDQZRUGHQRPYHU
VFKLOOHQGHDVSHFWHQYDQGHNODQNWHFRQWUROHUHQ
(U]LMQWZHHVRRUWHQDIWHUWRXFKFRPPDQGR·V3RO\SKRQLF.H\3UHVVXUHGLHYRRUHONH
QRRWDI]RQGHUOLMNZRUGWYHUVWXXUGHQ&KDQQHO.H\3UHVVXUHGLHDOVppQZDDUGH
ZRUGWYHUVWXXUGGLHDOOHQRWHQYDQKHWJHVSHFLILHHUGH0,',NDQDDOEHwQYORHGW
Alle klanken uit
'LWFRPPDQGR]HWGHNODQNYDQDOOHQRWHQGLHRSKHWPRPHQWNOLQNHQYROOHGLJXLW
'HNODQNYDQKHWJHVSHFLILHHUGHNDQDDOZRUGWXLWJH]HW
0HWGHEHJLQLQVWHOOLQJHQ
]XOOHQ$IWHUWRXFK
ERRGVFKDSSHQJHHQHIIHFW
KHEEHQZDQQHHUGH6&
]HRQWYDQJW2SGDW
$IWHUWRXFKERRGVFKDSSHQ
HIIHFW]RXGHQKHEEHQPRHW
XGH$IWHUWRXFK
SDUDPHWHUVLQVWHOOHQS
Ale noten uit ✩
'RRUGLWFRPPDQGRZRUGWHHQ1RWH2IIFRPPDQGRYHUVWXXUGQDDUHONHQRRWYDQ
KHWJHVSHFLILHHUGHNDQDDOGDWRSGLWPRPHQWDDQVWDDW$OV+ROGRI6RVWHQXWR
HFKWHUDDQVWDDQ]DOGHNODQNGRRUNOLQNHQWRWGH]HZRUGHQXLWJH]HW
151
Bijlagen
Reset All Controllers ✩
'LWFRPPDQGREUHQJWFRQWUROOHUZDDUGHQWHUXJWRWKXQRRUSVURQNHOLMNHLQVWHOO
LQJHQ'HYROJHQGHFRQWUROOHUZDDUGHQYDQKHWJHVSHFLILHHUGNDQDDOZRUGHQWRWKXQ
RRUVSURQNHOLMNHZDDUGHQWHUXJJHEUDFKW
&RQWUROOHU
2RUVSURQNHOLMNHZDDUGH
3LWFK%HQG
3RO\SKRQLF.H\3UHVVXUH
&KDQQHO3UHVVXUH
0RGXODWLRQ
([SUHVVLRQ
+ROG
3RUWDPHQWR
6RIW
6RVWHQXWR
531
1531
PLGGHQ
PLQLPXP
PLQLPXP
PLQLPXP
PD[LPXP
RII
RII
RII
RII
JHHQQXPPHU
JHHQQXPPHU
Active Sensing
'LWFRPPDQGRZRUGWJHEUXLNWRPDIJHEURNHQ0,',YHUELQGLQJHQRSWHVSRUHQ
]RDOV0,',FRQQHFWRUHQGLHZHUGHQXLWJHWURNNHQRIJHEURNHQ0,',NDEHOV'H6&
YHUVWXXUW$FWLYH6HQVLQJFRPPDQGR·VYDQXLW0,',287LQVSHFLILHNHLQWHUYDO
OHQ(HQVGDWHHQ$FWLYH6HQVLQJFRPPDQGRLQ0,',,1ZRUGWRQWYDQJHQ]DOGH$F
WLYH6HQVLQJFRQWUROHEHJLQQHQHQDOVHHQ$FWLYH6HQVLQJFRPPDQGRQLHWDDQNRPW
ELQQHQGH>PVHF@ZRUGWHUYHURQGHUVWHOGGDWGHNDEHOORVJHNRSSHOGLV$OVGLW
JHEHXUW]XOOHQDOOHQRWHQGLHRSGLWPRPHQWNOLQNHQXLWJH]HWZRUGHQHQ]DOGH
]HOIGHSURFHGXUHZRUGHQXLWJHYRHUGDOVELMHHQ5HVHW$OO&RQWUROOHUFRPPDQGRHQ
]DOGHFRQWUROHYDQ$FWLYH6HQVLQJVWRSSHQ
System Exclusive-commando’s
([FOXVLYHFRPPDQGR·VZRUGHQJHEUXLNWRPIXQFWLHVWHFRQWUROHUHQGLHHLJHQ]LMQ
DDQEHSDDOGHWRHVWHOOHQ+RHZHO8QLYHUVDO6\VWHP([FOXVLYHFRPPDQGR·VNXQQHQ
ZRUGHQJHEUXLNWWXVVHQWRHVWHOOHQYDQYHUVFKLOOHQGHIDEULNDQWHQNXQQHQGHPHHVWH
([FOXVLYHFRPPDQGR·VQLHWJHEUXLNWZRUGHQWXVVHQWRHVWHOOHQYDQYHUVFKLOOHQGH
W\SHVRIYHUVFKLOOHQGHIDEULNDQWHQ
2PKHWWRHVWHOZDDUYRRUGHJHJHYHQVEHVWHPG]LMQWHKHUNHQQHQEHYDWWHQ5RODQG
([FOXVLYHFRPPDQGR·VHHQIDEULNDQWHQ,'HHQWRHVWHO,'HQHHQPRGHO,'
+HWIDEULNDQWHQ,'YDQGH6&LV++HWWRHVWHO,'LV++HWPRGHO,'LV
+
GM1 System On ✩
8QLYHUVDO6\VWHP([FOXVLYH
:DQQHHU*06\VWHP2QRQWYDQJHQZRUGW]DOGH6&RSQLHXZQDDUGHEDVL
VLQVWHOOLQJHQYDQ*HQHUDO0,',ZRUGHQLQJHVWHOG(U]XOOHQRRNJHHQ1531%DQN
6HOHFWFRPPDQGR·VRQWYDQJHQZRUGHQQDGDW*06\VWHP2QRQWYDQJHQLV+HWEH
JLQYDQGHVRQJJHJHYHQVGLHKHW*0ORJRGUDJHQEHYDWHHQ*06\VWHP2QFRP
PDQGR'LWEHWHNHQWGDWDOVPHQGHJHJHYHQVYDQDIKHWEHJLQDIVSHHOWGH
NODQNJHQHUDWRUDXWRPDWLVFKWHUXJQDDU]LMQEDVLVLQVWHOOLQJHQ]DOZRUGHQJHwQLWLDO
L]HHUG
GM2 System On
8QLYHUVDO6\VWHP([FOXVLYH
:DQQHHU*06\VWHP2QRQWYDQJHQZRUGW]DOGH6&RSQLHXZQDDUGHEDVL
VLQVWHOOLQJHQYDQ*HQHUDO0,',ZRUGHQLQJHVWHOG=LHS
152
3DUDPHWHUZDDUGHQGLH
JHZLM]LJGZHUGHQYLD531
RI1531YHUDQGHUHQQLHW
]HOIVDOZRUGWHUHHQ5HVHW
$OO&RQWUROOHUERRGVFKDS
RQWYDQJHQ
Bijlagen
GS Reset
*6)RUPDW6\VWHP([FOXVLYH
:DQQHHUHHQ*65HVHWRQWYDQJHQZRUGW]DOGH6&RSQLHXZQDDUGHEDVLVLQ
VWHOOLQJHQYDQ*6ZRUGHQLQJHVWHOG'H153FRPPDQGR·VGLHEHSDDOGZRUGHQGRRU
KHW*6IRUPDW]XOOHQRRNKHUNHQGZRUGHQQDGDWHHQ*65HVHWZHUGRQWYDQJHQ(HQ
*66\VWHP5HVHWFRPPDQGREHYLQGW]LFKLQKHWEHJLQYDQGHVRQJJHJHYHQVGLHKHW
*6ORJRGUDJHQ'LWEHWHNHQWGDWDOVPHQGHJHJHYHQVYDQDIKHWEHJLQDIVSHHOWGH
NODQNJHQHUDWRUDXWRPDWLVFKWHUXJQDDU]LMQEDVLVLQVWHOOLQJHQ]DOZRUGHQJHwQLWLDO
L]HHUG
Master Volume
8QLYHUVDO6\VWHP([FOXVLYH
'LWLVHHQ([FOXVLYHFRPPDQGRGLHYRRUDOOH0,',WRHVWHOOHQGH]HOIGHLVHQGLHKHW
KRRIGYROXPHYDQDOOHSDUWVVWXXUW
Andere Exclusive-commando’s
'H6&NDQ*6IRUPDW([FOXVLYHFRPPDQGR·VPRGHO,'+RQWYDQJHQGLH
YRRUDOOH*6NODQNJHQHUDWRUHQGH]HOIGH]LMQ([FOXVLYHFRPPDQGR·VNXQQHQ
ZRUGHQJHEUXLNWRPGHLQVWHOOLQJHQYDQGH6&RSWHVODDQRIRPQDXZNHXULJH
DDQSDVVLQJHQWHPDNHQDDQSDUDPHWHUV
=LHGHYHUGXLGHOLMNLQJRSSHQYROJHQGHYRRUPHHUGHWDLOVRYHUGH([FOXVLYH
FRPPDQGR·VGLHGRRUGH6&YHUVWXXUGHQRQWYDQJHQZRUGHQ
Over MIDI-implementatiekaarten
0HW0,',ZHUGKHWPRJHOLMNRPLQIRUPDWLHXLWWHZLVVHOHQWXVVHQHHQEUHGHZDDLHUYDQ
WRHVWHOOHQPDDUKHWLVQLHWDOWLMGZDDUGDWDOOHVRRUWHQ0,',FRPPDQGR·VWXVVHQDOOH
VRRUWHQWRHVWHOOHQNXQQHQZRUGHQXLWJHZLVVHOG$OVXELMYRRUEHHOGHHQV\QWKHVL]HUDOV
KRRIGWRHVWHOJHEUXLNWRPHHQGLJLWDOHSLDQRWHVWXUHQGDQ]DOGHSLWFKEHQGHUGHKHQ
GHORIGHVFKLMIGLHGHWRRQKRRJWHZLM]LJWYDQGHV\QWKHVL]HUJHHQLQYORHGKHEEHQRS
GHNODQNYDQGHSLDQR
:DQQHHUPHQ0,',JHEUXLNWLVKHWEHODQJULMNWHZHWHQGDWKHWVODDIWRHVWHOLQVWDDWPRHW
]LMQWHEHJULMSHQZDWKHWPHHVWHUWRHVWHO]HJW0HWDQGHUHZRRUGHQGH0,',FRPPDQ
GR·VPRHWHQYRRUPHHVWHUHQVODDIGH]HOIGH]LMQ
2PXWHKHOSHQVQHOWHEHSDOHQZHONHVRRUWHQ0,',FRPPDQGR·VWXVVHQPHHVWHUHQVODDI
NXQQHQZRUGHQXLWJHZLVVHOGZRUGWHUELMKHWKDQGERHNYDQHON0,',WRHVWHOHHQMIDIimplementatiekaart SJHYHRJG$OVXGH]HNDDUWEHNLMNWNDQXVQHOXLWPDNHQ
ZHONHFRPPDQGR·VKHWWRHVWHONDQYHUVWXUHQHQRQWYDQJHQ'HOLQNHU]LMGHYDQGHNDDUW
JHHIWGHQDPHQYDQYHUVFKLOOHQGH0,',FRPPDQGR·VHQGHNRORPPHQ7UDQVPLWWHGHQ
5HFRJQL]HGJHEUXLNHQ´RµHQ´[µWHNHQVRPDDQWHJHYHQRIGHFRPPDQGR·VNXQQHQ
YHUVWXXUGRIRQWYDQJHQZRUGHQ'LWEHWHNHQWGDWHHQVSHFLILHN0,',FRPPDQGRDOOHHQ
NDQZRUGHQXLWJHZLVVHOGDOVHUHHQ´RµVWDDWLQ]RZHOGH7UDQVPLWWHGNRORPYDQKHW
PHHVWHUWRHVWHODOVLQGH5HFRJQL]HGNRORPYDQKHWVODDIWRHVWHO0,',LPSOHPHQWDWLH
NDDUWHQ]LMQJHVWDQGDUGL]HHUG]RGDWXGHNDDUWHQYDQWZHHKDQGERHNHQVDPHQNDQ
SORRLHQHQ]RLQppQRJHQEOLNNDQ]LHQKRHGHWZHHWRHVWHOOHQ]XOOHQFRPPXQLFHUHQ
(HQJHGHWDLOOHHUGHYHUNODULQJRYHUKHWJHJHYHQVIRUPDDWGDWYRRU([FOXVLYHFRPPDQ
GR·VZRUGWJHEUXLNWHQGHLPSOHPHQWDWLHYDQ0,',RS6&YLQGWXYDQDIS
153
Bijlagen
NRPNs gebruiken met GS Sound Modules
,QGHYHUVFKLOOHQGHVRRUWHQ&RQWURO&KDQJHVYDDNDIJHNRUWDOVCCLVHHQXLWJHEUHLGHUHHNVLQEH
JUHSHQGLH1531VQLHWJHUHJVLWUHHUGHSDUDPHWHUQXPPHUVJHQRHPGZRUGW'H1531VNXQQHQPHW
*6NODQNPRGXOHVJHEUXLNWZRUGHQRPGHYHUVFKHLGHQHSDUDPHWHUVWHUYHUDQGHUHQ]RDOVGHSDUDPH
WHUVYRRUYLEUDWRYRRUGHILOWHUVHQGHHQYHORSHV+HWJHEUXLNYDQ&RQWURO&KDQJHVELHGWYHHO
YRRUGHOHQWHQRS]LFKWHYDQGH([FOXVLYHFRPPDQGR·VZDQQHHUXNODQNHQZLOYHUDQGHUHQ=H]LMQQLHW
]RLQJHZLNNHOG]LMQJHPDNNHOLMNHUWHKDQWHUHQHQYHUHLVHQQLHW]R·QJURRWDDQWDOJHJHYHQVS
S=XONH&RQWURO&KDQJHFRPPDQGR·VEHYDWWHQHHQQXPPHUKHW&RQWUROQXPPHUGLHKHWVRRUW
IXQFWLHVSHFLILHHUWGLHPRHWZRUGHQJHVWXXUG
'H0,',VSHFLILFDWLHVEHSDOHQJHHQVSHFLILHNHIXQFWLHVGLHNXQQHQZRUGHQLQJHVWHOGDOVPHQ1531V
JHEUXLNW'LWRPGDWGH1531VPRHWHQGLHQHQDOVHHQVRHSHOHUHHNVYDQVWXULQJHQZDDUDDQRPKHW
HYHQZHONHSDUDPHWHUNDQZRUGHQWRHJHZH]HQGLHYRRUHHQVSHFLILHNWRHVWHOQRGLJ]LMQRPGHJHZHQ
VWHYHUDQGHULQJHQLQ]LMQNODQNHQWHYHUNULMJHQRI]LMQH[SUHVVLHPRJHOLMNKHGHQWHYHUEHWHUHQ'DDUWHJ
HQRYHUEHVWDDWHUHHQDQGHUVRRUWYDQXLWJHEUHLGHVWXULQJGLH531JHUHJLVWUHHUGSDUDPHWHUQXPPHU
JHQRHPGZRUGW=RDOVKXQQDDPVXJJHUHHUW]LMQGH531IXQFWLHVELQQHQGH0,',VSHFLILFDWLHVDO
OHPDDOJRHGJHGHILQLHHUGJHUHJLVWUHHUGS
:DQQHHUPHQHHQ1531JHEUXLNWPRHWGHIXQFWLHNODQNSDUDPHWHUGLHEHKDQGHOGZRUGWJHVSHFL
ILHHUGZRUGHQGRRUQXPHULVFKHZDDUGHQGLHYRRUGH153106%&RQWUROOHU1RHQ1531/6%
&RQWUROOHU1RZRUGHQYRRU]LHQ'RRUGHJHVFKLNWHZDDUGHYRRU'DWD(QWU\&RQWUROOHU1RWH
YHUVWXUHQEHUHLNWPHQGHYHUDQGHULQJLQGHJHVSHFLILHHUGHNODQNSDUDPHWHU
0HUNRSGDWLQSODDWVYDQGHKH[DGHFLPDOHQRWDWLHGLHLQMIDI-implementatieSJHEUXLNW
ZRUGWGHQXPPHUVYRRUGHFRPELQDWLHVYDQZDDUGHQYRRU1531VLQRQGHUVWDDQGHNDDUWDOOHPDDO
QDDUGHFLPDOHQZHUGHQRPJH]HW
1531
06%
1531
/6%
UU
%HUHLN
)XQFWLH
²²
²²
²²
²²
²²
²²
²²
²²
²²
9LEUDWR5DWHS
9LEUDWR'HSWKS
9LEUDWR'HOD\S
79)&XWRII)UHTXHQF\S
79)5HVRQDQFHS
79)79$(QYHORSH$WWDFN7LPHS
79)79$(QYHORSH'HFD\7LPHS
79)79$(QYHORSH5HOHDVH7LPHS
'UXP,QVWUXPHQW3LWFK&RDUVH
9HUDQGHUWGHWRRQKRRJWHYDQLQGLYLGXHOHSHUFXVVLHLQVWUXPHQWHQ
LQGHGUXPSDUW
UU
²
'UXP,QVWUXPHQW79$/HYHO
9HUDQGHUWKHWYROXPHYDQLQGLYLGXHOHSHUFXVVLHLQVWUXPHQWHQLQ
GHGUXPSDUW
UU
²²
'UXP,QVWUXPHQW3DQ
9HUDQGHUWGHVWHUHRSRVLWLHYDQLQGLYLGXHOHSHUFXVVLHLQVWUXPHQW
HQLQGHGUXPSDUW(HQLQVWHOOLQJYDQ0JHHIWHHQZLOOHNHXULJHVWH
UHRSRVLWLH1LVXLWHUVWOLQNV64LVKHWPLGGHQHQ127LVXLWHUVW
UHFKWV
UU
²
'UXP,QVWUXPHQW5HYHUE6HQG/HYHO
6WHOWGHUHYHUEGLHSWHLQYDQLQGLYLGXHOHSHUFXVVLHLQVWUXPHQWHQ
LQGHGUXPSDUW
UU
²
'UXP,QVWUXPHQW&KRUXV6HQG/HYHO
6WHOWGHFKRUXVGLHSWHLQYDQLQGLYLGXHOHSHUFXVVLHLQVWUXPHQWHQ
LQGHGUXPSDUW
UU
²
'UXP,QVWUXPHQW'HOD\6HQG/HYHO
%HSDDOWGHKRHYHHOKHLGGHOD\YDQLQGLYLGXHOHSHUFXVVLHLQVWUX
PHQWHQLQGHGUXPSDUWDOOHHQ6&6&3UR6&
6WHOGDWXELMYRRUEHHOGGH79)&XWRII)UHTXHQF\ZLOYHUDQGHUHQ(HUVWPRHWXEHYHVWLJHQGDWXGH79)
&XWRII)UHTXHQF\ZLOVWXUHQGRRUKHW]HQGHQYDQGHJHVFKLNWH153106%HQ1531/6FRPELQDWLH
'HZDDUGHYDQ&RQWUROOHU1RLVGH153106%HQGLHYDQ&RQWUROOHU1RLVGH1531/6%'XV
PRHWXGH]HZDDUGHQYHUVWXUHQ
&RQWUROOHU1R
&RQWUROOHU1R
1XZHHWGH6&GDWXGH79)&XWRII)UHTXHQF\JDDWYHUDQGHUHQ2PYHUGHUWHJDDQHQGHHFKWH
ZLM]LJLQJGRRUWHYRHUHQPRHWXKHW'DWD(QWU\&RQWURO&KDQJHFRPPDQGRJHEUXLNHQRPGHQLHXZH
ZDDUGH[[WHVSHFLILsUHQYRRUGH79)&XWRII)UHTXHQF\
'XVPRHWXKHWYROJHQGHYHUVWXUHQ
&RQWUROOHU1R[[
+HWUHVXOWDDWYDQKHWYHUVWXUHQYDQGHERYHQVWDDQGHGULHFRQWUROOHUZDDUGHQLVKHWYHUDQGHUHQYDQGH
79)&XWRII)UHTXHQF\HQKHWWLPEUHYDQKHWLQVWUXPHQWGDWYRRUGLHSDUWJHVHOHFWHHUGLVGDWDQGHUV
PRHWNOLQNHQ
154
Bijlagen
1DGDWXNODQNSDUDPHWHUVKHEWJHZLM]LJGPHWEHKXOSYDQHHQ1531UDGHQZLMXDDQRP
VWHHGVPHWHHQnulWHEHYHVWLJHQGRRUGHKLHURQGHUJHWRRQGHZDDUGHQWHYHUVWXUHQ+LHU
GRRUZHHWGH6&GDWXNODDUEHQWPHWGHSDUDPHWHUGLHZHUGJHVSHFLILHHUGHQGDWKLM
QLHWODQJHURSQLHXZHZDDUGHQYRRUGH]HSDUDPHWHUPRHWZDFKWHQ$QQXOHHUWGHKXLGLJH
YUDDJRPYHUDQGHULQJLQHHQEHSDDOGH1531RI531=RYRRUNRPWXRQYHUZDFKWHYHUDQ
GHULQJHQGLHJHPDDNWNXQQHQZRUGHQDOVPHQQDGHUKDQGSHURQJHOXN'DWD(QWU\ZDDUGHQ
YHUVWXXUW
&RQWUROOHU1R &RQWUROOHU1R 9RRUGHNRPN LSB rrZDDUGHPRHWXGHZDDUGHRSJHYHQGLHRYHUHHQNRPWPHWKHWQRRW
QXPPHUYDQKHWSHUFXVVLHLQVWUXPHQWGDWXZLOJHEUXLNHQGH]HQXPPHUVYLQGWPHQLQGH
'UXP6HW/LMVWRSS
6WHOELMYRRUEHHOGGDWXGH+LJK%RQJR]RZLOLQVWHOOHQGDWHUJHHQJDOPRSZRUGWWRHJHSDVW
'LWLQVWUXPHQWKHHIWQRRWQXPPHUPLGGHQ&HQLVRSJHQRPHQLQGHVWDQGDDUG6HW
'UXP6HW
8PRHWGH]HZDDUGHQYHUVWXUHQRPKHWERYHQVWDDQGHWHEHUHLNHQ
&RQWUROOHU1R &RQWUROOHU1R &RQWUROOHU1R
0HUNRSGDWGH]H0,',FRPPDQGR·VLQGHKLHUERYHQRSJHJHYHQYROJRUGHPRHWHQYHU
VWXXUGZRUGHQ
3DUDPHWHUVGLHLQGHNDDUWDDQGHOLQNHU]LMGHPHW]LMQJHPHUNWNXQQHQLQYHUKRXGLQJ
PHWGHVWDQGDDUGZDDUGHZRUGHQYHUDQGHUG$IKDQNHOLMNYDQGHEHSDDOGHNODQNZDDUPHH
XZHUNW]DOKHWVRRUWYHUDQGHULQJYHUVFKLOOHQLQVRPPLJHJHYDOOHQ]DOX]HOIVJHHQYHUDQ
GHULQJRSPHUNHQ+HWEHUHLNYDQGHYHUDQGHULQJ]DOHYHQHHQVYHUVFKLOOHQ
9RRUPHHUGHWDLOVRYHUKHWMXLVWLQYRHUHQHQYHUVWXUHQYDQ&RQWURO&KDQJHFRPPDQGR·VLV
KHWPRJHOLMNGDWXKHWKDQGERHNYDQXZXLWUXVWLQJRIYDQXZVRIWZDUHPRHWUDDGSOHJHQ
0HUNHFKWHURSGDWXPHWVRPPLJHWRHVWHOOHQVOHFKWVPHWHHQEHSHUNWDDQWDOFRQWUROOHUQXP
PHUVNDQZHUNHQ
=RUJHUYRRUGDWXVWHHGVGHKLHUERYHQJHJHYHQYROJRUGHJHEUXLNWELMKHWYHU]HQGHQYDQ
5311531HQ'DWD(QWU\JHJHYHQV/HWJRHGRSZDQWDOVXPHHUGHUH0,',FRPPDQGR·V
RSKHW]HOIGHPRPHQWRI]HHUNRUWQDHONDDUYHUVWXXUWWHUZLMOXHHQEHSDDOGHVRRUWPX]LHN
VRIWZDUHJHEUXLNWLVKHWPRJHOLMNGDWGHFRPPDQGR·VLQHHQDQGHUHYROJRUGHZRUGHQYHU
VWXXUGGDQGHRRUVSURQNHOLMNJHSODQGH2PSUREOHPHQWHYHUPLMGHQPRHWXVWHHGV
YROGRHQGHSODDWVODWHQWXVVHQQDHONDDUNRPHQGHFRPPDQGR·VWHQPLQVWHWHOELM7341
HQWHOOHQELM7341
'HZDDUGHYDQGHDIVQLMIUHTXHQWLHYDQHHQSDUWYHUDQGHUHQ
<Voorbeeld>De afsnijfrequentie van Part 3 op -25 zetten
0,',&+ &&
DIVQLMIUHTXHQWLH
&&
DIVQLMIUHTXHQWLH
&&
DDQJH]LHQJHOLMNLVDDQNULMJHQZH *HOLMNZHONHZDDUGHGLH
LQJHVWHOGLVGRRUPLGGHO
YDQHHQ1531ZRUGWQLHW
JHwQLWLDOLVHHUG]HOIVDO
ZRUGWHUHHQDQGHUNODQN
JHNR]HQLQRYHUHHQVWHP
PLQJPHWHHQRQWYDQJHQ
3URJUDP&KDQJH,QVWHOO
LQJHQGLHJHPDDNW]LMQPHW
1531·VNXQQHQHQNHO
JHwQLWLDOLVHHUGZRUGHQ
GRRUHHQ*65HVHWWH
YHU]HQGHQ
73417LFNV3HU4XDUWHU
1RWH
1DGDWHUHHQ*65HVHW
ERRGVFKDSRQWYDQJHQLV
ZRUGHQHU1531
ERRGVFKDSSHQRQWYDQJHQ
'HWRRQKRRJWHYDQHHQGUXPLQVWUXPHQWYHUDQGHUHQ
<Voorbeeld>De toonhoogte van nootnummer 48 van de Part 10 Drum Set +5 hoger
zetten dan de originele toonhoogte
0,',&+ &&
WRRQKRRJWHYDQKHWGUXPLQVWUXPHQW
&&
QRRWQXPPHU
DDQJH]LHQGHRULJLQHOHWRRQKRRJWHLVNULMJHQZH &&
155
Bijlagen
Als er een boodschap verschijnt
$OVHUHHQIRXWHKDQGHOLQJJHGDDQZRUGWRIDOVGHJHJHYHQVQLHWRSHHQFRUUHFWH
PDQLHUNXQQHQZRUGHQYHUZHUNW]DOHULQGHGLVSOD\HHQIRXWPHOGLQJYHUVFKLMQHQ
5DDGSOHHJGHYROJHQGHOLMVWHQWUHIGHJHVFKLNWHPDDWUHJHO
Checksum Error
2RU]DDN+HWFRQWUROHWRWDDOYDQKHWRQWYDQJHQ([FOXVLYHFRPPDQGRLVQLHWMXLVW
$FWLH
&RQWUROHHUGHJHJHYHQVGLHQDDUGH6&ZHUGHQYHUVWXXUGHQYHU]HQG
GH]HRSQLHXZ=RUJHUYRRUGDWXZ0,',NDEHOVQLHWVWXN]LMQ
MIDI Buff. Full
2RU]DDN'H6&RQWYLQJWHU]HOIGHUWLMGWHYHHO0,',JHJHYHQVHQNRQGH]HQLHW
FRUUHFWYHUZHUNHQ
$FWLH
9HUVWXXUEXLWHQVSRULJHKRHYHHOKHGHQ0,',JHJHYHQVQLHWDOOHPDDOWHJH
OLMNHUWLMG
MIDI Off Line
2RU]DDN+HWLVPRJHOLMNGDWGHVWURRPYDQKHW0,',WRHVWHOZHUGXLWJH]HWGDWRS
0,',,1LVDDQJHVORWHQ
$FWLH +HWSUREOHHPOLJWQLHWELMGH6&&RQWUROHHUGHVWURRPYDQKHW
DDQJHVORWHQ0,',WRHVWHO
2RU]DDN+HWLVPRJHOLMNGDWHHQ0,',NDEHOLVXLWJHWURNNHQRINRUWJHVORWHQLV
$FWLH &RQWUROHHUGH0,',NDEHOV
USB Off Line
2RU]DDN,+HWLVPRJHOLMNGDWGHVWURRPYDQGHFRPSXWHUZHUGXLWJH]HWGDWRS
0,',,1LVDDQJHVORWHQ
$FWLH +HWSUREOHHPOLJWQLHWELMGH6&&RQWUROHHUGHVWURRPYDQGH
DDQJHVORWHQFRPSXWHU
2RU]DDN,+HWLVPRJHOLMNGDWHHQ86%NDEHOLVXLWJHWURNNHQRINRUWJHVORWHQLV
$FWLH &RQWUROHHUGH86%NDEHOV
No Instrument
------------2RU]DDN(UZHUGHHQNODQNLQVWUXPHQWJHVHOHFWHHUGZDDURYHUGH6&QLHWEH
VFKLNW
$FWLH
'HHHUGHUJHVHOHFWHHUGHNODQNQDDPYHUVFKLMQWLQGHGLVSOD\HQGH]HNODQN
ZRUGWJHVSHHOG5DDGSOHHJ]RUJYXOGLJGHWDEHOOHQLQGHInstrumentenlijst
SHQEHSDDOKHWMXLVWH%DQNQXPPHUHQ3URJUDPQXPPHU
No Drum Set
2RU]DDN(UZHUGHHQGUXPVHWJHVHOHFWHHUGZDDURYHUGH6&QLHWEHVFKLNW
$FWLH
'HHHUGHUJHVHOHFWHHUGHGUXPVHWQDDPYHUVFKLMQWLQGHGLVSOD\HQGH]HVHW
ZRUGWJHVSHHOG5DDGSOHHJ]RUJYXOGLJGHWDEHOOHQLQGHDrumsetlijst
SHQEHSDDOKHWMXLVWHHQ3URJUDPQXPPHU
156
Bijlagen
Bekabelingsdiagrammen van de computer
ILJH
Voor Apple Macintosh (Apart verkocht: RSC-15APL)
mini DIN, 8-pin, mannelijk
6 78
mini DIN, 8-pin, mannelijk
mini DIN, 8-pin, mannelijk
HSKo
HSKi
TXDGND
RXDTXD+
GPi
RXD+
3 4 5
1 2
mini DIN, 8-pin, mannelijk
1
2
3
4
5
6
7
8
1
2
3
4
5
6
7
8
67 8
HSKo
HSKi
TXDGND
RXDTXD+
GPi
RXD+
3 4 5
1 2
Voor PC (9-pin) (Apart verkocht: RSC-15AT)
mini DIN, 8-pin, mannelijk
6 78
mini DIN, 8-pin, mannelijk
3 4 5
HSKo
HSKi
TXDGND
RXD-
1
2
3
4
5
D-sub, 9-pin, vrouwelijk
7
8
3
5
2
RTS
CTS
TXD
GND
RXD
D-sub, 9-pin, vrouwelijk
5
9
1 2
1
6
Voor PC (25-pin)
mini DIN, 8-pin, mannelijk
6 78
mini DIN, 8-pin, mannelijk
3 4 5
1 2
HSKo
HSKi
TXDGND
RXD-
1
2
3
4
5
D-sub, 25-pin, vrouwelijk
4
5
2
7
3
RTS
CTS
TXD
GND
RXD
D-sub, 25-pin, vrouwelijk
13
1
25
14
157
Bijlagen
Werkingsprocedurelijst
■ De zeven display schermen van de SC-8850
'HYHUVFKLOOHQGHGLVSOD\VFKHUPHQGLHRSGH6&YHUVFKLMQHQNXQQHQLQ]HYHQGLVSOD\VZRUGHQRQGHUYHUGHHOGDIKDQNHOLMN
YDQGHGRRUXRSJHYUDDJGHSDUDPHWHUVRIYDQGHJHWRRQGHLQKRXG
158
6FKHUP
+RHNRPWXLQKHWVFKHUP
,QKRXG
Part Basic-scherm
=HWGHVWURRPDDQRIGUXNEXITYDQXLWHHQ
DQGHUVFKHUP]RQGHUGDWXCANCELEHGRHOW
'LWLVKHWEDVLVVFKHUPGDWYHUVFKLMQWZDQQHHU
GHVWURRPZRUGWDDQJH]HW$OVXLQHHQDQGHU
VFKHUPDDQKHWZHUNHQZDV]DOXQDDUGLW
VFKHUPWHUXJNHUHQZDQQHHUXRSGHEXIT
NQRSGUXNW+LHUNDQXGHNODQNYRRUHONHSDUW
VHOHFWHUHQKHWYROXPHYDQHONHSDUWFRQWURO
UHQHQ]
All Part-scherm
'UXNWHJHOLMNHUWLMGRSPART>
ALLLQKHW3DUW%DVLFVFKHUP
+LHUNDQXDOOHSDUWVXLW]HWWHQRIGHNODQNPDS
YDQDOOHSDUWVYHUDQGHUHQ
Edit-scherm
'UXN>(',7@LQKHW3DUW%DVLFVFKHUP
+LHUNDQXYRRUHONHSDUWSDUDPHWHUVLQVWHOOHQ
]RDOVHIIHFWVHQGQLYHDXHQ]
Edit All-scherm
'UXN>(',7@LQKHW3DUW$OOVFKHUP2IGUXN
WHJHOLMNHUWLMGRSPART>
@HQ>
@ALLLQ
KHW3DUW$OOVFKHUP
+LHUNDQXSDUDPHWHUVLQVWHOOHQGLHDOOHSDUWV
EHwQYORHGHQ]RDOVKHWDOJHPHQHYROXPHHQ]
Drum-scherm
'UXN>'580@
+LHUNDQXKHWQLYHDXGHSDQHQ]LQVWHOOHQ
YRRUHONGUXPLQVWUXPHQW+LHUNDQXRRN
XVHUGUXPVRIXVHUGUXPVHWVFUHsUHQ
Effect-scherm
'UXN>())(&76@
+LHUNDQXLQVWHOOLQJHQPDNHQYRRUGH
V\VWHHPHIIHFWHQHQGHLQYRHJHIIHFWHQ
Utility-scherm
'UXNWHJHOLMNHUWLMGRS>(',7@HQPART>
UTIL
@HQ>
@
@
+LHUNDQXV\VWHHPLQVWHOOLQJHQPDNHQYRRUGH
6&]HOIJHJHYHQVQDDUHHQH[WHUQWRHVWHO
YHUVWXUHQYHUVFKLOOHQGHLQVWHOOLQJHQLQLWLOLD]
HUHQGHPRVRQJVDIVSHOHQHQ]
Bijlagen
Part Basic-scherm (bij het aanzetten van de stroom): Instellingen voor elke part
fig.11-6
PART VAR. INST
SC-8850
SC-88Pro
SC-88
SC-55
F1
F2
F3
.QRS
@
F4
INST
MAP
+DQGHOLQJ
:DDUGHEHUHLNYHW VWDQGDDUGZDDUGH
6HOHFWHHUWHHQSDUW
A01'
3$57>
@>
9$5>
@
9HUSODDWVWGHFXUVRUQDDUVAR.
,167>
@
9HUSODDWVWGHFXUVRUQDDU INST
>(;,7@
>(17(5@
>(',7@
5RHSWKHW(GLWVFKHUPRS
>'580@
5RHSWKHW'UXPVFKHUPRS
>())(&76@
5RHSWKHW(IIHFWVFKHUPRS
>6+,)7@
>62/2@
6SHHOWDOOHHQGHJHVHOHFWHHUGHSDUW
Uit$DQ
>087(@
=HWGHJHVHOHFWHHUGHSDUWXLW
Uit$DQ
>'(&@
9HUPLQGHUWGHZDDUGHYDQGHJHVHOHFWHHUGHSDUDPHWHUPHW
>,1&@
9HUPHHUGHUWGHZDDUGHYDQGHJHVHOHFWHHUGHSDUDPHWHUPHW
>,1670$3@
9HUDQGHUWGHNODQNPDSYDQGHJHVHOHFWHHUGHSDUW
>)@3$57$
*DDWQDDU3$57$RQJHZLM]LJGSDUWQXPPHU
>)@3$57%
*DDWQDDU3$57%RQJHZLM]LJGSDUWQXPPHU
>)@3$57&
*DDWQDDU3$57&RQJHZLM]LJGSDUWQXPPHU
>)@3$57'
*DDWQDDU3$57'RQJHZLM]LJGSDUWQXPPHU
SC-88506&6&6&3UR
159
Bijlagen
All Part-scherm (PART display staat op ALL): Instellingen voor alle parts
fig.11-7
PART VAR. INST
SC-8850
SC-88Pro
SC-88
SC-55
F1
F2
.QRS
160
F4
F3
INST
MAP
+DQGHOLQJ
3$57>
@>
@
9$5>
@
,167>
@
:DDUGHEHUHLNYHW VWDQGDDUGZDDUGH
>(;,7@
5RHSWKHW3DUW%DVLFVFKHUPRS
>(17(5@
>(',7@
5RHSWKHW(GLW$OOVFKHUPRS
>'580@
5RHSWKHW'UXPVFKHUPRS
>())(&76@
5RHSWKHW(IIHFWVFKHUPRS
>6+,)7@
>62/2@
>087(@
=HWDOOHSDUWVXLW
>'(&@
>,1&@
>,1670$3@
9HUDQGHUWGHNODQNPDSYDQDOOHSDUWV
>)@$
6WDDIGLVSOD\YDQSDUWJURHS$
>)@$%
6WDDIGLVSOD\YDQSDUWJURHS$HQ%
>)@&'
6WDDIGLVSOD\YDQSDUWJURHS&HQ'
>)@3$57
6WDDIGLVSOD\YDQDOOHSDUWJURHSHQ
UitDDQ
Geen aanduiding. (De Inst Map wordt
niet veranderd.)6&6&3UR
6&6&
Bijlagen
Edit-scherm ([EDIT] brandt): Instelling van de klankbronparameters voor elke part
fig.11-8
PART VAR. INST
SC-8850
SC-88Pro
SC-88
SC-55
F1
F2
F3
.QRS
@
F4
INST
MAP
+DQGHOLQJ
:DDUGHEHUHLNYHW VWDQGDDUGZDDUGH
6HOHFWHHUWHHQSDUW
$'
3$57>
@>
9$5>
@
9HUSODDWVWGHFXUVRURPODDJ
,167>
@
9HUSODDWVWGHFXUVRURPKRRJ
>(;,7@
5RHSWKHW3DUW%DVLFVFKHUPRS
>(17(5@
>(',7@
5RHSWKHW3DUW%DVLFVFKHUPRS
>'580@
5RHSWKHW'UXPVFKHUPRS
>())(&76@
5RHSWKHW(IIHFWVFKHUPRS
>6+,)7@
>62/2@
6SHHOWDOOHHQGHJHVHOHFWHHUGHSDUW
Off2Q
Off2Q
>087(@
=HWGHJHVHOHFWHHUGHSDUWXLW
>'(&@
9HUPLQGHUWGHZDDUGHYDQGHJHVHOHFWHHUGHSDUDPHWHUPHW
>,1&@
9HUPHHUGHUWGHZDDUGHYDQGHJHVHOHFWHHUGHSDUDPHWHUPHW
>'(&@>,1&@
9HU]HQGWGHZDDUGHYDQGHJHVHOHFWHHUGHSDUDPHWHU
>,1670$3@
9HUDQGHUWGHNODQNPDSYDQGHJHVHOHFWHHUGHSDUW
>)@
>)@
>)@
>)@
())(&7
(',7
02',)<
→
6781(
02'
%(1'
→
&$)
&&
8,167
→
SC-88506&6&6&3UR
>)@())(&7
6WHOWGH())(&7SDUDPHWHUVLQ5HYHUE6HQG&KRUXV6HQG'HOD\6HQG3DUW(4();
>)@(',7
6WHOWGH(',7SDUDPHWHUVLQ3DUW/HYHO3DUW3DQ5[0,',&+3DUW0RGH030RGH.H\6KLIW)LQH7XQH
%HQG5DQJH0RG'HSWK9HOR'HSWK9HOR2IIVHW.H\5DQJH/.H\5DQJH+&&&1XPEHU2XW$VJQ
>)@02',)<
6WHOWGH02',)<SDUDPHWHUVLQ9LE5DWH9LE'HSWK9LE'HOD\&XWRII)UHT5HVRQDQFH$WWDFN
7LPH'HFD\7LPH5HOHDVH7LPH
>)@→
/RRSWGRRUKHWVFKHUP
>)@6781(
6WHOWGH6781(SDUDPHWHUVLQ6FDOH7XQH&6FDOH7XQH&6FDOH7XQH'6FDOH7XQH'6FDOH7XQH(6FDOH
7XQH)6FDOH7XQH)6FDOH7XQH*6FDOH7XQH*6FDOH7XQH$6FDOH7XQH$6FDOH7XQH%
>)@02'
6WHOWGH02'SDUDPHWHUVLQ0RG5DQJH0RG&XWRII0RG$PS0RG/)25DWH0RG/)23LWFK
0RG/)279)0RG/)279$
>)@%(1'
6WHOWGH%(1'SDUDPHWHUVLQ%QG5DQJH%QG&XWRII%QG$PS%QG/)25DWH%QG/)23LWFK
%QG/)279)%QG/)279$
>)@→
/RRSWGRRUKHWVFKHUP
>)@&$)
6WHOW&$)SDUDPHWHUVLQ&$I5DQJH&$I&XWRII&$I$PS&$I/)25DWH&$I/)23LWFK
&$I/)279)&$I/)279$
>)@&&
6WHOWGH&&SDUDPHWHUVLQ&&5DQJH&&&XWRII&&$PS&&/)25DWH&&/)23LWFK
&&/)279)&&/)279$
>)@8,167
6WHOWGH8,167SDUDPHWHUVLQ9LE5DWH9LE'HSWK9LE'HOD\&XWRII)UHT5HVRQDQFH$WWDFN
7LPH'HFD\7LPH5HOHDVH7LPHGUXN>(17(5@RPGHLQVWHOOLQJHQWHVFKULMYHQ
>)@→
/RRSWGRRUKHWVFKHUP
161
Bijlagen
Edit All-scherm ([EDIT] brandt, PART display staat op ALL):
Instelling van de klankbronparameters voor alle parts
fig.11-9
PART VAR. INST
SC-8850
SC-88Pro
SC-88
SC-55
F1
F2
.QRS
162
F4
F3
INST
MAP
+DQGHOLQJ
3$57>
@>
@
9$5>
@
9HUSODDWVWGHFXUVRURPODDJ
,167>
@
9HUSODDWVWGHFXUVRURPKRRJ
:DDUGHEHUHLNYHW VWDQGDDUGZDDUGH
>(;,7@
5RHSWKHW3DUW%DVLFVFKHUPRS
>(17(5@
>(',7@
5RHSWKHW$OO3DUWVFKHUPRS
>'580@
5RHSWKHW'UXPVFKHUPRS
>())(&76@
5RHSWKHW(IIHFWVFKHUPRS
>6+,)7@
>62/2@
>087(@
=HWDOOHSDUWVXLW
>'(&@
9HUPLQGHUWGHZDDUGHYDQGHJHVHOHFWHHUGHSDUDPHWHUPHW
>,1&@
9HUPHHUGHUWGHZDDUGHYDQGHJHVHOHFWHHUGHSDUDPHWHUPHW
>'(&@>,1&@
9HU]HQGWGHZDDUGHYDQGHJHVHOHFWHHUGHSDUDPHWHU
>,1670$3@
9HUDQGHUWGHNODQNPDSYDQDOOHSDUWV
>)@(',7
6WHOW(',7SDUDPHWHUVLQ0DVWHU/HYHO0DVWHU
3DQ0.H\6KLIW07XQH'HYLFH,'
>)@:5,7(
6FKULMIW8VHULQVWHOOLQJHQ
>)@/2$'
/DDGW8VHULQVWHOOLQJHQ
>)@
Geen aanduiding. (De Inst Map wordt
niet veranderd.)6&6&3UR
6&6&
Bijlagen
Drum-scherm ([DRUM] brandt): Instelling van de parameters die betrekking hebben op de
drum
fig.11-10
PART VAR. INST
SC-8850
SC-88Pro
SC-88
SC-55
F1
F2
F3
.QRS
@
F4
INST
MAP
+DQGHOLQJ
:DDUGHEHUHLNYHW VWDQGDDUGZDDUGH
6HOHFWHHUWHHQGUXPSDUW
'UXPA1'
3$57>
@>
9$5>
@
9HUSODDWVWGHFXUVRURPODDJRIOLQNV
,167>
@
9HUSODDWVWGHFXUVRURPKRRJRIUHFKWV
>(;,7@
5RHSWKHW3DUW%DVLFVFKHUPRS
>(17(5@
>(',7@
5RHSWKHW(GLWVFKHUPRS
>'580@
5RHSWKHW'UXPVFKHUPRS
>())(&76@
5RHSWKHW(IIHFWVFKHUPRS
>6+,)7@
>62/2@
>087(@
>'(&@
9HUPLQGHUWGHZDDUGHYDQGHJHVHOHFWHHUGHSDUDPHWHUPHW
>,1&@
9HUPHHUGHUWGHZDDUGHYDQGHJHVHOHFWHHUGHSDUDPHWHUPHW
>'(&@>,1&@
9HU]HQGWGHZDDUGHYDQGHJHVHOHFWHHUGHSDUDPHWHU
>,1670$3@
9HUDQGHUWGHNODQNPDSYDQGHJHVHOHFWHHUGHSDUW
>)@(',7
6WHOW'580SDUDPHWHUVLQ6HW3LWFK&RDUVH,QVW
/HYHO,QVW3DQ5HYHUE6HQG&KRUXV6HQG'HOD\
6HQG$VVLJQ*URXS5[1RWH2Q5[1RWH2II
>)@:5,7(
6FKULMIWQDDU8VHU'UXP
>)@:56(7
6FKULMIWQDDU8VHU'UXP6HW
163
Bijlagen
Effect-scherm ([EFFECTS brandt]): Instelling der parameters die betrekking hebben op de effecten
fig.11-11
PART VAR. INST
SC-8850
SC-88Pro
SC-88
SC-55
F1
F2
F3
.QRS
INST
MAP
F4
+DQGHOLQJ
@
:DDUGHEHUHLNYHW VWDQGDDUGZDDUGH
3$57>
@>
9$5>
@
9HUSODDWVWGHFXUVRURPODDJ
,167>
@
9HUSODDWVWGHFXUVRURPKRRJ
>(;,7@
5RHSWKHW3DUW%DVLFVFKHUPRS
>(17(5@
>(',7@
5RHSWKHW(GLWVFKHUPRS
>'580@
5RHSWKHW'UXPVFKHUPRS
>())(&76@
5RHSWKHW(IIHFWVFKHUPRS
>6+,)7@
>62/2@
164
>087(@
=HWDOOHSDUWVXLW
>'(&@
9HUPLQGHUWGHZDDUGHYDQGHJHVHOHFWHHUGHSDUDPHWHUPHW
>,1&@
9HUPHHUGHUWGHZDDUGHYDQGHJHVHOHFWHHUGHSDUDPHWHUPHW
>'(&@>,1&@
9HU]HQGWGHZDDUGHYDQGHJHVHOHFWHHUGHSDUDPHWHU
>,1670$3@
9HUDQGHUWGHNODQNPDSYDQDOOHSDUWV
Off2Q
Geen aanduiding. (De Inst Map
wordt niet veranderd.)6&
6&3UR6&6&
>)@
>)@
>)@
>)@
5(9(5%
&+2586
'(/$<
→
(4
();
&75/
→
>)@5(9(5%
6WHOW5(9(5%SDUDPHWHUVLQ5HY7\SH5HY/HYHO5HY&KDUDFWHU5HY3UH/3)5HY7LPH5HY'O\
)E5HY3UH'O\7P
>)@&+2586
6WHOW&+2586SDUDPHWHUVLQ&KR7\SH&KR/HYHO&KR3UH/3)&KR)HHGEDFN&KR'HOD\&KR
5DWH&KR'HSWK&KR7R5HY&KR7R'O\
>)@'(/$<
6WHOW'(/$<SDUDPHWHUVLQ'O\7\SH'O\/HYHO'O\3UH/3)'O\7LPH&'O\7P5DWLR/
'O\7P5DWLR5'O\/HYHO&'O\/HYHO/'O\/HYHO5'O\)HHGEDFN'O\7R5HY
>)@→
/RRSWGRRUKHWVFKHUP
>)@(4
6WHOW(4SDUDPHWHUVLQ(4/)UHT(4/*DLQ(4+)UHT(4+*DLQ
>)@();
6WHOW();SDUDPHWHUVLQHIIHFWW\SHHIIHFWSDUDPHWHUV();7R5HY();7R&KR();7R'O\
>)@&75/
6WHOW&75/SDUDPHWHUVLQ();&6UF();&'HS();&6UF();&'HS
>)@→
/RRSWGRRUKHWVFKHUP
Bijlagen
Utility-scherm:Instellingen voor alle Parts
fig.11-12
PART VAR. INST
SC-8850
SC-88Pro
SC-88
SC-55
F1
F2
F3
.QRS
F4
INST
MAP
+DQGHOLQJ
3$57>
@>
@
9$5>
@
9HUSODDWVWGHFXUVRURPODDJ
,167>
@
9HUSODDWVWGHFXUVRURPKRRJ
:DDUGHEHUHLNYHW VWDQGDDUGZDDUGH
>(;,7@
5RHSWKHW3DUW%DVLFVFKHUPRS
>(17(5@
9RHUWYHUVFKLOOHQGHFRPPDQGR·VXLW]RDOVELMKHWEH
ZDUHQYDQGHV\VWHHPSDUDPHWHUVKHWXLWYRHUHQYDQ
HHQ%XON'XPSLQLWLDOL]HUHQRI'HPR3OD\
>(',7@
5RHSWKHW(GLWVFKHUPRS
>'580@
5RHSWKHW'UXPVFKHUPRS
>())(&76@
5RHSWKHW(IIHFWVFKHUPRS
>6+,)7@
>62/2@
>087(@
=HWDOOHSDUWVXLW
>'(&@
9HUPLQGHUWGHZDDUGHYDQGHJHVHOHFWHHUGHSDUDPHWHUPHW
>,1&@
9HUPHHUGHUWGHZDDUGHYDQGHJHVHOHFWHHUGHSDUDPHWHUPHW
>,1670$3@
9HUDQGHUWGHNODQNPDSYDQDOOHSDUWV
>)@6<67(0
6WHOW6<67(0SDUDPHWHUVLQ3UHYZ0RGH3UHYZ
1RWH3UHYZ9HOR/&'&RQWUDVW6WDUWXS+HWGUXN
NHQYDQ>(17(5@QDKHWLQVWHOOHQYDQGHSDUDPHWHU
EHZDDUWGHLQVWHOOLQJYDQGHV\VWHHPSDUDPHWHU
>)@%8/.
6WHOW%8/.SDUDPHWHUVLQ'XPS$OO'XPS$OO8V
HU'XPS8VHU,QVW'XPS8VHU'UXP'XPS3DUW
$'XPS3DUW%'XPS3DUW&'XPS3DUW'JH
EUXLN>,1&@>'(&@RI>9$/8(@RPGHSDUDPHWHUWHVHOHFWHUHQ
HQGUXN>(17(5@RPGRRUWHJDDQRI>(;,7@RPWHDQQXOHUHQ
>)@,1,7
6WHOW,1,7,$/,=(SDUDPHWHUVLQ,QLWLDOL]H$OO,QLWLDO
L]H*6,QLWLDOL]H*0,QLWLDOL]H*0JHEUXLN>,1&@
>'(&@RI>9$/8(@RPGHSDUDPHWHUWHVHOHFWHUHQHQGUXN>(1
7(5@RPGRRUWHJDDQRI>(;,7@RPWHDQQXOHUHQ
>)@'(02
6HOHFWHHUWGH'(02VRQJ7+(6(&5(73/$&(
:$//),9(0,;%OXH;$OO6RQJJHEUXLN>,1&@
>'(&@RI>9$/8(@RPGHSDUDPHWHUWHVHOHFWHUHQHQGUXN
>(17(5@RPGRRUWHJDDQRI>(;,7@RPWHDQQXOHUHQ'UXN
>(;,7@RI>6723@>)@RPKHWDIVSHOHQWHVWRSSHQ
Uit$DQ
Geen aanduiding. (De Inst Map
wordt niet veranderd.)6&6&
3UR6&6&
165
Bijlagen
■ Handelingen wanneer men de [SHIFT] knop ingedrukt houdt
.QRS
166
+DQGHOLQJ
=LHSDJLQD
>6KLIW@3$57>
@
,QLWLDOL]HHUW$OO)DFWRU\3UHVHW
S
>6KLIW@3$57>
@
,QLWLDOL]HHUW*6*65HVHW
S
>6KLIW@9$5>
@
,QLWLDOL]HHUW*0*06\VWHP2Q
S
>6KLIW@,167>
@
,QLWLDOL]HHUW*0*06\VWHP2Q
S
6KLIW>(',7@
5RHSWKHW'(02VFKHUPRS
S
6KLIW>'580@
5RHSWKHW/RDG8VHU6HWWLQJVFKHUPRS
S
6KLIW>())(&76@
=HW3$57();$DQ8LW
S
Bijlagen
Instrumentenlijst
Piano
CC00
PC
SC-8850 Map
000
001
002
008
009
016
024
025
026
027
001
Piano 1
Buffetpiano
Mild Piano
Buffetpiano w
Mild Piano w
European Pf
Piano + Str.
Piano + Str2
Piano+Choir1
Piano+Choir2
Stemmen
2
1
1
1
1
1
3
4
3
4
000
001
002
008
009
016
002
Piano 2
Pop Piano
Rock Piano
Pop Piano w
Rock Piano w
Dance Piano
4
2
2
2
2
2
[Pro]
Piano 2
--------Piano 2w
----Dance Piano
2
Piano 2
--------Piano 2w
---------
000
001
002
008
003
Piano 3
EG+Rhodes 1
EG+Rhodes 2
Piano 3w
2
2
2
2
[Pro]
[Pro]
[Pro]
[Pro]
Piano 3
EG+Rhodes 1
EG+Rhodes 2
Piano 3w
2
2
2
2
Piano 3
EG+Rhodes 1
EG+Rhodes 2
Piano 3w
1
2
2
1
Piano 3
--------Piano 3w
1
000
008
004
Honky-tonk
Honky-tonk 2
2
2
Honky-tonk
Honky-tonk 2
2
2
Honky-tonk
Old Upright
2
2
Honky-tonk
HonkyTonk w
2
2
000
008
009
010
016
017
024
025
026
005
E.Piano 1
St.Soft EP
Cho. E.Piano
SilentRhodes
FM+SA EP
Dist E.Piano
Wurly
Hard Rhodes
MellowRhodes
1
2
2
2
2
2
2
2
2
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
E.Piano 1
St.Soft EP
Cho. E.Piano
SilentRhodes
FM+SA EP
Dist E.Piano
Wurly
Hard Rhodes
MellowRhodes
1
2
2
2
2
2
2
2
2
2
2
E.Piano 1
Detuned EP1
--------E.Piano 1v
----60s E.Piano
---------
1
2
[88]
[88]
E.Piano 1
St.Soft EP
--------FM+SA EP
----60'sE.Piano
Hard Rhodes
MellwRhodes
000
001
008
009
010
016
024
032
006
E.Piano 2
E.Piano 3
Detuned EP 2
Detuned EP 3
EP Legend
St.FM EP
Hard FM EP
EP Phase
2
2
2
4
2
2
2
2
[Pro]
E.Piano 2
----Detuned EP 2
--------St.FM EP
Hard FM EP
-----
2
[88]
2
[88]
2
2
[88]
[88]
000
001
002
008
016
024
032
007
Harpsichord
Harpsichord2
Harpsichord3
Coupled Hps.
Harpsi.w
Harpsi.o
Synth Harpsi
1
2
2
2
1
2
2
Harpsichord
Harpsichord2
----Coupled Hps.
Harpsi.w
Harpsi.o
Synth Harpsi
1
2
[88]
2
1
2
2
[88]
[88]
[88]
000
001
002
003
008
016
017
024
032
033
035
036
037
038
039
008
Clav.
Clav. 2
Atk Clav.1
Atk Clav.2
Comp Clav.
Reso Clav.
Phase Clav
Clav.o
Analog Clav.
JP8 Clav. 1
JP8 Clav. 2
SynRingClav.
SynDistClav.
JP8000 Clav.
Pulse Clav
1
2
2
2
1
1
1
2
2
1
1
2
1
1
1
Clav.
------------Comp Clav.
Reso Clav.
----Clav.o
Analog Clav.
JP8 Clav. 1
JP8 Clav. 2
-----------------
1
[88]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
SC-88Pro Map
Piano 1
--------Piano 1w
----European Pf
Piano + Str.
-------------
Stemmen
1
Piano 1
--------Piano 1w
----Piano 1d
-----------------
1
1
2
2
2
1
1
2
2
1
1
SC-88 Map
[88]
[88]
[88]
E.Piano 2
----Detuned EP2
--------St.FM EP
Hard FM EP
----Harpsichord
--------Coupled Hps
Harpsi.w
Harpsi.o
----Clav.
---------------------------------------------------------
Stemmen
1
Piano 1
--------Piano 1w
----Piano 1d
-----------------
1
1
1
Piano 2
--------Piano 2w
---------
1
2
1
2
2
2
E.Piano 2
----Detuned EP2
--------E.Piano 2v
---------
2
2
2
1
2
1
2
1
SC-55 Map
[55]
Harpsichord
--------Coupled Hps
Harpsi.w
Harpsi.o
----Clav.
---------------------------------------------------------
Stemmen
1
1
1
1
1
1
2
1
1
2
2
1
2
1
2
1
167
3&
&&
SURJUDPQXPPHU,QVWUXPHQWQXPPHU
ZDDUGHYDQFRQWUROHQXPPHU
%DQNQXPPHU9DULDWLRQQXPPHU
OHJDWRNODQNHQV
6WHPPHQ
DDQWDOVWHPPHQGLHKHW,QVWUXPHQWJHEUXLNW
2SPHUNLQJ>3UR@]HOIGHNODQNDOV6&3URPDS
2SPHUNLQJ>@]HOIGHNODQNDOV6&PDS
2SPHUNLQJ>@]HOIGHNODQNDOV6&PDS
2SPHUNLQJ HHQSHUFXVVLHNODQNGLHQLHWPHORGLVFKHJHVSHHOGNDQ
ZRUGHQ*HEUXLN&QRRWQXPPHU
Bijlagen
Chromatische percussie
CC00
PC
SC-8850 Map
000
001
009
Celesta
Pop Celesta
Stemmen
1
2
[Pro]
[Pro]
Celesta
Pop Celesta
1
2
[88]
Celesta
-----
1
000
010
Glockenspiel
1
[Pro]
Glockenspiel
1
[88]
Glocknspiel
000
001
008
011
Music Box
Music Box 2
St.Music Box
1
2
2
Music Box
---------
1
[88]
Music Box
---------
000
001
008
009
012
Vibrafoon
Pop Vibe.
Vibraphone w
Vibraphones
1
2
1
2
[Pro]
[Pro]
[Pro]
[Pro]
Vibrafoon
Pop Vibe.
Vibraphone w
Vibraphones
1
2
1
2
000
008
016
017
024
013
Marimba
Marimba w
Barafon
Barafon 2
Log drum
1
1
1
1
1
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
Marimba
Marimba w
Barafon
Barafon 2
Log drum
1
1
1
1
1
000
008
014
Xylophone
Xylophone w
1
1
[Pro]
Xylophone
-----
000
008
009
010
016
015
Tubular-bell
Church Bell
Carillon
Church Bell2
Tubularbellw
1
1
1
1
1
000
001
002
008
016
017
024
016
Santur
Santur 2
Santur 3
Cimbalom
Zither 1
Zither 2
Dulcimer
1
2
2
2
1
2
2
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
SC-88Pro Map
Stemmen
SC-88 Map
Stemmen
SC-55 Map
Stemmen
Celesta
-----
1
1
Glockenspl
1
1
Music Box
---------
1
Vibrafoon
Hard Vibe
Vib.w
-----
1
2
1
Vibrafoon
----Vib.w
-----
1
[88]
[88]
[88]
[88]
[88]
Marimba
Marimba w
Barafon
Barafon 2
Log drum
1
1
1
1
1
Marimba
Marimba w
-------------
1
1
1
[88]
Xylophone
-----
1
Xylophone
-----
1
Tubular-bell
Church Bell
Carillon
---------
1
1
1
[88]
[88]
[88]
Tubularbell
Church Bell
Carillon
---------
1
1
1
[55]
[55]
[55]
Tubularbell
Church Bell
Carillon
---------
1
1
1
Santur
Santur 2
----Cimbalom
Zither 1
Zither 2
Dulcimer
1
2
[88]
[88]
1
2
[55]
[88]
Santur
-------------------------
1
2
1
2
2
Santur
Santur 2
----Cimbalom
-------------
2
[55]
[55]
1
&&HQ]LMQEHVWHPGYRRU8VHULQVWUXPHQWHQ
168
Bijlagen
Orgel
CC00
PC
SC-8850 Map
000
001
002
003
004
005
006
007
008
009
010
011
012
016
017
018
019
024
025
026
027
028
029
030
031
032
033
040
048
017
Organ 1
Organ 101
Ful Organ 1
Ful Organ 2
Ful Organ 3
Ful Organ 4
Ful Organ 5
Ful Organ 6
Trem. Organ
Organ o
Ful Organ 7
Ful Organ 8
Ful Organ 9
60's Organ 1
60's Organ 2
60's Organ 3
Farf Organ
Cheese Organ
D-50 Organ
JUNO Organ
Hybrid Organ
VS Organ
Digi Church
JX-8P Organ
FM Organ
70's E.Organ
Even Bar
Organ Bass
5th Organ
Stemmen
2
2
4
4
4
4
4
4
2
2
4
4
4
1
1
1
1
1
2
2
2
2
2
2
1
2
2
1
2
000
001
002
003
004
005
006
007
008
009
032
033
034
035
018
Organ 2
Jazz Organ
E.Organ 16+2
Jazz Organ 2
Jazz Organ 3
Jazz Organ 4
Jazz Organ 5
Jazz Organ 6
Chorus Or.2
Octave Organ
Perc. Organ
Perc.Organ 2
Perc.Organ 3
Perc.Organ 4
2
2
2
4
4
4
4
4
2
2
2
4
4
4
[Pro]
[Pro]
[Pro]
000
008
016
017
018
024
019
Organ 3
Rotary Org.
Rotary Org.S
Rock Organ 1
Rock Organ 2
Rotary Org.F
2
1
1
2
2
1
000
008
016
024
032
033
020
Church Org.1
Church Org.2
Church Org.3
Organ Flute
Trem.Flute
Theater Org.
000
008
016
021
000
008
009
016
024
025
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
SC-88Pro Map
Organ 1
Organ 101
------------------------Trem. Organ
Organ. o
------------60's Organ 1
60's Organ 2
60's Organ 3
Farf Organ
Cheese Organ
D-50 Organ
JUNO Organ
Hybrid Organ
VS Organ
Digi Church
--------70's E.Organ
Even Bar
Organ Bass
5th Organ
Stemmen
2
2
2
2
1
1
1
1
1
2
2
2
2
2
2
2
1
2
[88]
[88]
[88]
Organ 2
Jazz Organ
E.Organ 16+2
--------------------Chorus Or.2
Octave Organ
Perc. Organ
-------------
2
2
2
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
Organ 3
Rotary Org.
Rotary Org.S
Rock Organ 1
Rock Organ 2
Rotary Org.F
2
1
1
2
2
1
[88]
[88]
[88]
1
2
2
1
2
2
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
Church Org.1
Church Org.2
Church Org.3
Organ Flute
Trem.Flute
Theater Org.
1
2
2
1
2
2
Reed Organ
Wind Organ
Puff Organ
1
2
2
[Pro]
[Pro]
Reed Organ
Wind Organ
-----
1
2
022
Accordion Fr
Accordion It
Dist. Accord
Cho. Accord
Hard Accord
Soft Accord
1
1
2
2
2
2
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
Accordion Fr
Accordion It
Dist. Accord
Cho. Accord
Hard Accord
Soft Accord
000
001
008
009
023
Harmonica
Harmonica 2
B.Harp Basic
B.Harp Suppl
4
1
3
1
000
008
016
024
Bandoneon
Bandoneon 2
Bandoneon 3
2
2
2
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
SC-88 Map
Organ 1
Organ 101
------------------------DetunedOr.1
Organ 109
------------60'sOrgan 1
60'sOrgan 2
60'sOrgan 3
----CheeseOrgan
----------------------------Organ 4
Even Bar
Organ Bass
-----
Stemmen
1
2
1
1
1
1
1
2
1
1
2
Organ 3
Rotary Org.
RotaryOrg.S
--------RotaryOrg.F
2
1
1
[88]
[88]
[88]
[88]
[88]
ChurchOrg.1
ChurchOrg.2
ChurchOrg.3
Organ Flute
Trem.Flute
-----
1
2
2
1
2
[88]
Reed Organ
---------
1
1
1
2
2
2
2
AccordionFr
AccordionIt
-----------------
Harmonica
Harmonica 2
---------
1
1
Bandoneon
Bandoneon 2
Bandoneon 3
2
2
2
2
2
2
[88]
Organ 1
----------------------------Detuned Or1
----------------60's Organ1
--------------------------------------------Organ 4
-------------
2
2
Organ 2
Organ 201
------------------------DetunedOr.2
----Organ 5
-------------
SC-55 Map
Organ 2
----------------------------Detuned Or2
----Organ 5
-------------
2
2
[55]
Stemmen
1
2
1
2
1
2
2
Organ 3
---------------------
2
Church Org1
Church Org2
Church Org3
-------------
1
2
2
Reed Organ
---------
1
1
2
Accordion F
Accordion I
-----------------
2
2
Harmonica
Harmonica 2
---------
1
2
Harmonica
-------------
1
Bandoneon
---------
1
Bandoneon
---------
2
1
[55]
169
3&
&&
SURJUDPQXPPHU,QVWUXPHQWQXPPHU
ZDDUGHYDQFRQWUROHQXPPHU
%DQNQXPPHU9DULDWLRQQXPPHU
OHJDWRNODQNHQV
6WHPPHQ
DDQWDOVWHPPHQGLHKHW,QVWUXPHQWJHEUXLNW
2SPHUNLQJ>3UR@]HOIGHNODQNDOV6&3URPDS
2SPHUNLQJ>@]HOIGHNODQNDOV6&PDS
2SPHUNLQJ>@]HOIGHNODQNDOV6&PDS
2SPHUNLQJ HHQSHUFXVVLHNODQNGLHQLHWPHORGLVFKHJHVSHHOGNDQ
ZRUGHQ*HEUXLN&QRRWQXPPHU
Bijlagen
Gitaar
CC00
PC
SC-8850 Map
000
008
016
024
032
040
025
Nylon-str.Gt
Ukulele
Nylon Gt.o
Velo Harmnix
Nylon Gt.2
Lequint Gt.
Stemmen
2
1
2
1
1
1
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
Nylon-str.Gt
Ukulele
Nylon Gt.o
Velo Harmnix
Nylon Gt 2
Lequint Gt.
2
1
2
1
1
1
000
008
009
010
016
017
018
032
033
026
Steel-str.Gt
12-str.Gt
Nylon+Steel
Atk Steel Gt
Mandolin
Mandolin 2
MandolinTrem
Steel Gt.2
Steel + Body
1
2
2
2
2
2
2
1
2
[Pro]
[Pro]
[Pro]
Steel-str.Gt
12-str.Gt
Nylon+Steel
----Mandolin
Mandolin 2
MandolinTrem
Steel Gt.2
-----
1
2
2
000
001
008
027
Jazz Gt.
Mellow Gt.
Pedal Steel
1
2
1
[Pro]
[Pro]
[Pro]
Jazz Gt.
Mellow Gt.
Pedal Steel
1
2
1
000
001
002
003
004
005
008
009
016
017
018
019
020
021
022
023
024
025
028
Clean Gt.
Clean Half
Open Hard 1
Open Hard 2
JC Clean Gt.
Atk CleanGt.
Chorus Gt.
JC Chorus Gt
TC FrontPick
TC Rear Pick
TC Clean ff
TC Clean 2:
LP Rear Pick
LP Rear 2
LP RearAtack
Mid Tone GTR
Chung Ruan
Chung Ruan 2
1
1
2
1
1
2
2
2
1
1
2
2
1
2
2
1
1
2
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
Clean Gt.
Clean Half
Open Hard 1
Open Hard 2
JC Clean Gt.
----Chorus Gt.
JC Chorus Gt
TC FrontPick
TC Rear Pick
TC Clean ff
TC Clean 2:
-------------------------
1
1
2
1
1
000
001
002
008
016
024
029
Muted Gt.
Muted Dis.Gt
TC Muted Gt.
Funk Pop
Funk Gt.2
Jazz Man
1
1
2
1
1
2
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
Muted Gt.
Muted Dis.Gt
TC Muted Gt.
Funk Pop
Funk Gt.2
-----
1
1
2
1
1
000
001
002
003
004
005
008
009
010
011
012
030
Overdrive Gt
Overdrive 2
Overdrive 3
More Drive
Guitar Pinch
Attack Drive
LP OverDrvGt
LP OverDrv:
LP Half Drv
LP Half Drv2
LP Chorus
2
2
2
2
1
3
2
2
2
2
2
[Pro]
[Pro]
[Pro]
[Pro]
OverdriveGt
Overdrive 2
Overdrive 3
More Drive
--------LP OverDrvGt
LP OverDrv:
-------------
2
2
2
2
000
001
002
003
004
005
008
009
016
017
018
024
025
026
031
DistortionGt
Dist. Gt2 :
Dazed Guitar
Distortion:
Dist.Fast :
Attack Dist
Feedback Gt.
Feedback Gt2
Power Guitar
Power Gt.2
5th Dist.
Rock Rhythm
Rock Rhythm2
Dist Rtm GTR
2
2
2
2
2
3
2
2
2
2
2
2
2
1
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
DistortionGt
Dist. Gt2:
Dazed Guitar
Distortion:
Dist.Fast:
----Feedback Gt.
Feedback Gt2
Power Guitar
Power Gt.2
5th Dist.
Rock Rhythm
Rock Rhythm2
-----
2
2
2
2
2
000
008
009
016
024
032
Gt.Harmonics
Gt. Feedback
Gt.Feedback2
Ac.Gt.Harmnx
E.Bass Harm.
1
1
2
1
1
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
SC-88Pro Map
Gt.Harmonics
Gt. Feedback
Gt. Feedback2
Ac.Gt.Harmnx
E.Bass Harm.
Stemmen
2
2
2
1
[88]
[88]
[88]
[88]
[88]
[88]
[88]
2
2
1
1
2
2
[88]
[88]
[88]
2
2
2
2
2
2
2
2
2
1
1
2
1
1
[88]
[88]
[88]
[88]
[88]
[88]
[88]
[88]
[88]
[88]
SC-88 Map
Stemmen
SC-55 Map
Stemmen
Nylonstr.Gt
Ukulele
Nylon Gt.o
VeloHarmnix
Nylon Gt.2
Lequint Gt.
1
1
2
1
1
1
Nylon Gt.
Ukulele
Nylon Gt.o
----Nylon Gt.2
-----
1
1
2
Steelstr.Gt
12-str.Gt
Nylon+Steel
----Mandolin
--------Steel Gt.2
-----
1
2
2
Steel Gt.
12-str.Gt
--------Mandolin
-----------------
1
2
Jazz Gt.
Mellow Gt.
Pedal Steel
1
2
1
Clean Gt.
--------------------Chorus Gt.
---------------------------------------------
1
2
1
[55]
Clean Gt.
--------------------Chorus Gt.
---------------------------------------------
2
Muted Gt.
MutedDis.Gt
----Funk Pop
Funk Gt.2
-----
Jazz Gt.
----Hawaiian Gt
1
1
Muted Gt.
--------Funk Gt.
Funk Gt.2
-----
1
1
1
1
1
1
1
2
1
1
1
OverdriveGt
-----------------------------------------
1
OverdriveGt
-----------------------------------------
1
DistortionGt
Dist. Gt2
DazedGuitar
------------FeedbackGt.
FeedbackGt2
PowerGuitar
Power Gt.2
5th Dist.
Rock Rhythm
RockRhythm2
-----
1
2
2
Dist.Gt.
--------------------Feedback Gt
-----------------------------
1
Gt.Harmonix
Gt.Feedback
----Ac.Gt.Harm.
-----
2
2
2
2
2
2
2
1
1
1
[55]
[55]
Gt.Harmonix
Gt.Feedback
-------------
2
1
1
&&HQ]LMQEHVWHPGYRRU8VHULQVWUXPHQWHQ
170
Bijlagen
Bass
CC00
PC
SC-8850 Map
000
001
008
009
016
033
Acoustic Bs.
Rockabilly
Wild A.Bass
Atk A.Bass
Bass + OHH
Stemmen
1
2
2
2
2
000
001
002
003
004
005
006
007
008
016
034
Fingered Bs.
Fingered Bs2
Jazz Bass
Jazz Bass 2
Rock Bass
Heart Bass
AttackFinger
Finger Slap
ChorusJazzBs
F.Bass/Harm.
1
2
1
2
2
1
2
2
2
1
000
001
002
003
004
008
016
035
Picked Bass
Picked Bass2
Picked Bass3
Picked Bass4
Double Pick
Muted PickBs
P.Bass/Harm.
1
2
2
2
4
1
1
[Pro]
[Pro]
[Pro]
[Pro]
000
001
002
003
004
005
008
036
Fretless Bs.
Fretless Bs2
Fretless Bs3
Fretless Bs4
Syn Fretless
Mr.Smooth
Wood+FlessBs
000
001
008
009
037
000
001
008
000
001
002
003
004
005
006
008
009
010
011
012
013
014
015
016
017
018
019
020
021
022
023
024
032
033
034
035
036
040
041
042
043
044
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
SC-88Pro Map
Stemmen
Acoustic Bs.
Rockabilly
Wild A.Bass
----Bass + OHH
1
2
2
Fingered Bs.
Fingered Bs2
Jazz Bass
Jazz Bass 2
Rock Bass
------------ChorusJazzBs
F.Bass/Harm.
1
2
1
2
2
2
[88]
2
1
1
2
2
2
[Pro]
[Pro]
Picked Bass
Picked Bass2
Picked Bass3
Picked Bass4
----Muted PickBs
P.Bass/Harm.
1
2
2
2
2
2
2
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
Fretless Bs.
Fretless Bs2
Fretless Bs3
Fretless Bs4
Syn Fretless
Mr.Smooth
Wood+FlessBs
1
2
2
2
2
2
2
[88]
Slap Bass 1
Slap Pop
Reso Slap
Unison Slap
1
1
1
2
[Pro]
[Pro]
[Pro]
[Pro]
Slap Bass 1
Slap Pop
Reso Slap
Unison Slap
1
1
1
2
[88]
038
Slap Bass 2
Slap Bass 3
FM Slap
2
3
2
[Pro]
Slap Bass 2
----FM Slap
2
039
Synth Bass 1
SynthBass101
CS Bass
JP-4 Bass
JP-8 Bass
P5 Bass
JPMG Bass
Acid Bass
TB303 Bass
Tekno Bass
TB303 Bass 2
Kicked TB303
TB303 Saw Bs
Rubber303 Bs
Reso 303 Bs
Reso SH Bass
TB303 Sqr Bs
TB303 DistBs
Clavi Bass
Hammer
Jungle Bass
Square Bass
Square Bass2
Arpeggio Bs
Hit&Saw Bass
Ring Bass
AtkSineBass
OB sine Bass
Auxiliary Bs
303SqDistBs
303SqDistBs2
303SqDistBs3
303Sqr.Rev
TeeBee
2
1
2
1
2
1
2
1
1
2
1
2
1
1
1
1
1
1
2
2
1
2
2
1
2
2
2
2
2
1
2
1
1
1
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
Synth Bass 1
SynthBass101
CS Bass
JP-4 Bass
JP-8 Bass
P5 Bass
JPMG Bass
Acid Bass
TB303 Bass
Tekno Bass
TB303 Bass 2
Kicked TB303
TB303 Saw Bs
Rubber303 Bs
Reso 303 Bs
Reso SH Bass
303 Sqr Bs
TB303 DistBs
--------------------Arpeggio Bs
-----------------------------------------
2
1
2
1
2
1
2
1
1
2
1
2
1
1
1
1
1
1
[Pro]
[Pro]
1
1
[88]
[88]
[88]
[88]
[88]
Stemmen
Acoustic Bs
-----------------
1
FingeredBs.
FingeredBs2
Jazz Bass
-----------------------------
1
2
1
Fingered Bs
-------------------------------------
1
Picked Bass
----------------MutePickBs.
-----
1
Picked Bass
-------------------------
1
1
FretlessBs.
FretlessBs2
FretlessBs3
FretlessBs4
SynFretless
Mr.Smooth
-----
1
2
2
2
2
2
Fretless Bs
-------------------------
1
Slap Bass 1
----Reso Slap
-----
1
Slap Bass 1
-------------
1
Slap Bass 2
---------
1
Syn.Bass 1
Syn.Bass101
--------------------Syn.Bass 3
---------------------------------------------------------------------------------------------------------
1
1
1
2
[88]
[88]
SynthBass 1
Syn.Bass101
--------------------Acid Bass
TB303 Bass
Tekno Bass
--------------------Reso SHBass
-------------------------------------------------------------------------
2
1
[88]
Stemmen
2
Slap Bass 2
---------
[88]
[88]
[88]
SC-55 Map
AcousticBs.
-----------------
[88]
2
1
SC-88 Map
1
1
2
1
[55]
1
171
3&
&&
SURJUDPQXPPHU,QVWUXPHQWQXPPHU
ZDDUGHYDQFRQWUROHQXPPHU
%DQNQXPPHU9DULDWLRQQXPPHU
OHJDWRNODQNHQV
6WHPPHQ
DDQWDOVWHPPHQGLHKHW,QVWUXPHQWJHEUXLNW
2SPHUNLQJ>3UR@]HOIGHNODQNDOV6&3URPDS
2SPHUNLQJ>@]HOIGHNODQNDOV6&PDS
2SPHUNLQJ>@]HOIGHNODQNDOV6&PDS
2SPHUNLQJ HHQSHUFXVVLHNODQNGLHQLHWPHORGLVFKHJHVSHHOGNDQ
ZRUGHQ*HEUXLN&QRRWQXPPHU
Bijlagen
CC00
PC
SC-8850 Map
000
001
002
003
004
005
006
007
008
009
010
011
012
013
014
015
016
017
018
019
020
021
022
023
024
025
026
027
028
029
030
031
032
033
034
035
036
037
038
039
040
041
042
040
Synth Bass 2
SynthBass201
Modular Bass
Seq Bass
MG Bass
Mg Oct Bass1
MG Oct Bass2
MG Blip Bs:
Beef FM Bass
Dly Bass
X Wire Bass
WireStr Bass
Blip Bass :
RubberBass 1
Syn Bell Bs
Odd Bass
RubberBass 2
SH101 Bass 1
SH101 Bass 2
Smooth Bass
SH101 Bass 3
Spike Bass
House Bass:
KG Bass
Sync Bass
MG 5th Bass
RND Bass
WowMG Bass
Bubble Bass
Attack Pulse
Sync Bass 2
Pulse Mix Bs
MG Dist Bass
Seq Bass 2
3rd Bass
MG Oct Bass
SlowEnvBass
Mild Bass
DistEnvBass
MG LightBass
DistSynBass
Rise Bass
Cyber Bass
Stemmen
2
2
2
2
1
2
2
2
2
2
2
2
2
2
2
2
2
1
1
2
1
1
2
2
2
2
2
2
2
1
2
2
2
2
2
2
2
2
2
2
2
2
2
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
SC-88Pro Map
Synth Bass 2
SynthBass201
Modular Bass
Seq Bass
MG Bass
Mg Oct Bass1
MG Oct Bass2
MG Blip Bs:
Beef FM Bass
Dly Bass
X Wire Bass
WireStr Bass
Blip Bass:
RubberBass 1
--------RubberBass 2
SH101 Bass 1
SH101 Bass 2
Smooth Bass
SH101 Bass 3
Spike Bass
House Bass:
KG Bass
Sync Bass
MG 5th Bass
RND Bass
WowMG Bass
Bubble Bass
---------------------------------------------------------
Stemmen
2
2
2
2
1
2
2
2
2
2
2
2
2
2
2
1
1
2
1
1
2
2
2
2
2
2
2
[88]
[88]
[88]
[88]
[88]
[88]
[88]
[88]
[88]
SC-88 Map
Stemmen
SynthBass 2
Syn.Bass201
ModularBass
Seq Bass
----------------Beef FMBass
X Wire Bass
------------------------Rubber Bass
SH101Bass 1
SH101Bass 2
Smooth Bass
---------------------------------------------------------------------------------------------
2
2
2
2
2
2
2
1
1
2
[55]
SC-55 Map
Syn.Bass 2
----------------------------Syn.Bass 4
----------------------------Rubber Bass
---------------------------------------------------------------------------------------------------------
Stemmen
2
2
2
Strings/orchestra
CC00
PC
SC-8850 Map
000
001
008
041
Violin :
Violin Atk:
Slow Violin
Stemmen
2
2
1
[Pro]
[Pro]
[Pro]
Violin :
Violin Atk:
Slow Violin
2
2
1
Violin
----Slow Violin
000
001
042
Viola :
Viola Atk.:
2
2
[Pro]
[Pro]
Viola :
Viola Atk.:
2
2
Viola
-----
1
Viola
-----
1
000
001
043
Cello :
Cello Atk.:
2
2
Cello :
Cello Atk.:
2
2
Cello
-----
1
Cello
-----
1
000
044
Contrabass
1
Contrabass
1
Contrabass
1
Contrabass
1
000
002
008
009
010
045
Tremolo Str
Trem Str.St.
Slow Tremolo
Suspense Str
SuspenseStr2
1
2
1
2
4
Tremolo Str
----Slow Tremolo
Suspense Str
-----
1
[88]
1
[88]
[88]
Tremolo Str
-----------------
1
1
2
Tremolo Str
----SlowTremolo
SuspenseStr
-----
000
001
002
003
008
016
017
046
PizzicatoStr
Vcs&Cbs Pizz
Chamber Pizz
St.Pizzicato
Solo Pizz.
Solo Spic.
StringsSpic.
1
2
2
2
1
1
2
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
PizzicatoStr
Vcs&Cbs Pizz
Chamber Pizz
St. Pizzicato
Solo Pizz.
Solo Spic.
-----
1
2
2
2
1
1
[88]
Pizz. Str.
-------------------------
1
Pizzicato
-------------------------
1
000
001
002
008
016
024
025
026
047
Harp
Harp&Strings
Harp St.
Uillean Harp
Synth Harp
Yang Qin
Yang Qin 2
SynthYangQin
1
3
2
1
1
1
2
2
[Pro]
Harp
------------Synth Harp
-------------
1
[88]
Harp
-----------------------------
1
Harp
-----------------------------
1
000
048
Timpani
1
Timpani
1
[88]
Timpani
1
Timpani
1
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
SC-88Pro Map
Stemmen
1
SC-88 Map
Stemmen
1
1
1
2
SC-55 Map
Violin
----Slow Violin
Stemmen
1
1
&&HQ]LMQEHVWHPGYRRU8VHULQVWUXPHQWHQ
172
Bijlagen
Ensemble
CC00
PC
SC-8850 Map
000
001
002
003
004
005
006
007
008
009
010
011
012
013
014
015
016
017
018
019
020
024
032
033
034
040
049
Strings
Bright Str:
ChamberStr
Cello sect.
Bright Str.2
Bright Str.3
Quad Strings
Mild Strings
Orchestra
Orchestra 2
Tremolo Orch
Choir Str.
Strings+Horn
Str.+Flute
Choir Str.2
Choir Str.3
St. Strings
St.Strings 2
St.Strings 3
Orchestra 3
Orchestra 4
Velo Strings
Oct Strings1
Oct Strings2
ContraBsSect
60s Strings
Stemmen
4
1
4
1
2
2
4
2
2
2
2
2
2
3
4
4
2
2
2
4
4
4
4
4
4
2
000
001
002
008
009
010
011
012
013
050
Slow Strings
SlowStrings2
SlowStrings3
Legato Str.
Warm Strings
St.Slow Str.
St.Slow Str2
S.Str+Choir
S.Str+Choir2
2
2
2
2
2
2
2
4
4
000
001
002
003
004
008
009
010
011
012
016
017
024
025
051
Syn.Strings1
OB Strings
StackStrings
JP Strings
Chorus Str.
Syn.Strings3
Syn.Strings4
Syn.Strings6
Syn.Strings7
LoFi Strings
High Strings
Hybrid Str.
Tron Strings
Noiz Strings
2
2
2
2
2
2
2
2
2
4
2
2
2
2
000
001
002
003
004
005
006
007
008
009
010
052
Syn.Strings2
Syn.Strings5
JUNO Strings
FilteredOrch
JP Saw Str.
Hybrid Str.2
DistStrings
JUNOFullStr.
Air Strings
Atk Syn Str.
StraightStr.
2
2
2
2
2
2
4
2
2
2
2
[Pro]
[Pro]
[Pro]
000
008
009
010
011
012
013
014
016
024
032
033
053
Choir Aahs
St.ChoirAahs
Melted Choir
Church Choir
Boys Choir 1
Boys Choir 2
St.BoysChoir
Rich Choir
Choir Hahs
Chorus Lahs
Chorus Aahs
Male Aah+Str
1
2
2
2
1
2
2
4
1
1
2
2
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
SC-88Pro Map
Strings :
Bright Str:
ChamberStr:
Cello sect.
----------------Orchestra
Orchestra 2
Tremolo Orch
Choir Str.
Strings+Horn
------------St. Strings
----------------Velo Strings
Oct Strings1
Oct Strings2
---------
Stemmen
2
1
2
1
2
2
2
2
2
[88]
2
2
2
2
SlowStrings
SlowStrings2
----Legato Str.
Warm Strings
St.Slow Str.
-------------
1
1
Syn.Strings1
OB Strings
StackStrings
JP Strings
----Syn.Strings3
Syn.Strings4
------------High Strings
Hybrid Str.
Tron Strings
Noiz Strings
2
2
2
2
2
2
2
2
2
[88]
[88]
[88]
[88]
2
2
2
2
Syn.Strings2
Syn.Strings5
JUNO Strings
--------------------Air Strings
---------
2
2
2
Choir Aahs
St.ChoirAahs
Melted Choir
Church Choir
----------------Choir Hahs
Chorus Lahs
Chorus Aahs
Male Aah+Str
1
2
2
2
2
1
1
2
2
[88]
SC-88 Map
Strings
Strings 2
------------------------Orchestra
Orchestra 2
TremoloOrch
Choir Str.
----------------St.Strings
----------------VeloStrings
-----------------
Stemmen
1
1
Strings
----------------------------Orchestra
---------------------------------------------------------------------
2
2
2
2
2
2
SlowStrings
Slow Str. 2
----Legato Str.
WarmStrings
St.SlowStr.
-------------
1
1
SynStrings1
OB Strings
------------SynStrings3
---------------------------------
2
2
2
[55]
SynStrings2
-----------------------------------------
2
[55]
Choir Aahs
St.Choir
Mello Choir
----------------------------ChoirAahs 2
-----
1
2
2
2
2
2
1
SC-55 Map
[55]
Stemmen
1
2
SlowStrings
---------------------------------
1
SynStrings1
----------------SynStrings3
---------------------------------
1
2
SynStrings2
-----------------------------------------
2
Choir Aahs
------------------------------------Choir Aahs2
-----
1
1
173
3&
&&
SURJUDPQXPPHU,QVWUXPHQWQXPPHU
ZDDUGHYDQFRQWUROHQXPPHU
%DQNQXPPHU9DULDWLRQQXPPHU
OHJDWRNODQNHQV
6WHPPHQ
DDQWDOVWHPPHQGLHKHW,QVWUXPHQWJHEUXLNW
2SPHUNLQJ>3UR@]HOIGHNODQNDOV6&3URPDS
2SPHUNLQJ>@]HOIGHNODQNDOV6&PDS
2SPHUNLQJ>@]HOIGHNODQNDOV6&PDS
2SPHUNLQJ HHQSHUFXVVLHNODQNGLHQLHWPHORGLVFKHJHVSHHOGNDQ
ZRUGHQ*HEUXLN&QRRWQXPPHU
Bijlagen
CC00
PC
SC-8850 Map
000
001
002
003
004
005
006
008
009
010
011
012
016
017
018
019
020
021
022
023
024
032
033
034
035
036
037
040
054
Voice Oohs
Chorus Oohs
Voice Oohs 2
Chorus Oohs2
OohsCodeMaj7
OohsCodeSus4
Jazz Scat
Voice Dahs
JzVoice Dat
JzVoice Bap
JzVoice Dow
JzVoice Thum
VoiceLah Fem
ChorusLahFem
VoiceLuh Fem
ChorusLuhFem
VoiceLan Fem
ChorusLanFem
VoiceAah Fem
VoiceUuh Fem
Fem Lah&Lan
VoiceWah Mal
ChorusWahMal
VoiceWoh Mal
ChorusWohMal
VoiceAah Mal
VoiceOoh Mal
Humming
Stemmen
1
2
1
2
1
1
1
1
1
1
1
1
1
2
1
2
1
2
1
1
1
1
2
1
2
1
1
2
000
001
002
008
009
010
016
017
018
019
055
SynVox
SynVox 2
SynVox 3
Syn.Voice
Silent Night
Syn.Voice 2
VP330 Choir
Vinyl Choir
JX8P Vox
Analog Voice
1
1
2
2
2
2
1
2
2
1
000
001
002
003
008
009
010
011
012
013
014
015
016
017
018
019
020
021
022
023
024
025
026
027
056
OrchestraHit
Bass Hit
6th Hit
Euro Hit
Impact Hit
Philly Hit
Double Hit
Perc. Hit
Shock Wave
Bounce Hit
Drill Hit
Thrill Hit
Lo Fi Rave
Techno Hit
Dist. Hit
Bam Hit
Bit Hit
Bim Hit
Technorg Hit
Rave Hit
Strings Hit
Stack Hit
Industry Hit
Clap Hit
2
2
2
2
2
2
2
1
2
1
1
1
2
1
1
1
1
1
1
2
2
2
1
1
[Pro]
[Pro]
[Pro]
[Pro]
SC-88Pro Map
Voice Oohs
------------------------Voice Dahs
--------------------------------------------------------------------------------SynVox
--------Syn.Voice
Silent Night
Stemmen
1
SC-55 Map
Stemmen
1
[55]
Voice Oohs
-------------------------------------------------------------------------------------------------------------
1
1
[88]
1
[55]
[88]
SynVox
-------------------------------------
1
2
2
SynVox
--------Syn.Voice
-------------------------
Orchest.Hit
---------------------------------------------------------------------------------------------
2
1
VP330 Choir
Vinyl Choir
---------
1
2
[Pro]
OrchestraHit
------------Impact Hit
Philly Hit
Double Hit
Perc. Hit
Shock Wave
------------Lo Fi Rave
Techno Hit
Dist. Hit
Bam Hit
Bit Hit
Bim Hit
Technorg Hit
Rave Hit
Strings Hit
Stack Hit
---------
2
[88]
2
2
2
1
2
[88]
[88]
[88]
2
1
1
1
1
1
1
2
2
2
[88]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
Stemmen
Voice Oohs
-------------------------------------------------------------------------------------------------------------
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
SC-88 Map
[88]
Orch. Hit
------------Impact Hit
Philly Hit
Double Hit
--------------------Lo Fi Rave
---------------------------------------------
2
2
2
2
2
2
&&HQ]LMQEHVWHPGYRRU8VHULQVWUXPHQWHQ
174
Bijlagen
Brass
CC00
PC
SC-8850 Map
000
001
002
003
004
008
016
024
025
026
027
032
057
Trumpet
Trumpet 2
Trumpet :
Dark Trumpet
Trumpet & Nz
Flugel Horn
4th Trumpets
Bright Tp.
Warm Tp.
Warm Tp.2
Twin Tp.
Syn. Trumpet
Stemmen
1
1
1
1
2
1
2
2
2
3
3
1
000
001
002
003
004
008
016
058
Trombone
Trombone 2
Twin bones
Bones & Tuba
Bright Tb
Bs. Trombone
Euphonium
1
1
2
4
1
1
2
000
001
008
059
Tuba
Tuba 2
Tuba + Horn
1
1
2
000
001
002
003
008
060
MutedTrumpet
Cup Mute Tp
MuteTrumpet2
MuteTrumpet3
Muted Horns
1
1
1
2
1
000
001
002
003
008
009
016
024
061
French Horns
Fr.Horn 2
Horn + Orche
Wide FreHrns
F.Hrn Slow:
Dual Horns
Synth Horn
F.Horn Rip
1
2
2
2
1
2
2
1
000
001
002
003
004
005
008
009
010
012
014
016
017
024
025
026
032
033
035
036
037
038
062
Brass 1
Brass ff
Bones Sect.
St. Brass ff
Quad Brass1
Quad Brass2
Brass 2
Brass 3
Brass sfz
Brass sfz 2
FatPop Brass
Brass Fall
Trumpet Fall
Octave Brass
Brass + Reed
Fat + Reed
Orch Brass
Orch Brass 2
St.FatPopBrs
St.Orch Brs
St.Orch Brs2
St.Orch Brs3
2
1
1
2
4
4
2
2
2
2
2
1
1
2
2
4
1
2
2
2
4
4
000
001
002
003
004
005
008
009
010
016
017
018
019
063
Synth Brass1
JUNO Brass
Stack Brass
SH-5 Brass
MKS Brass
Jump Brass
Pro Brass
P5 Brass
OrchSynBrass
Oct SynBrass
Hybrid Brass
OctSynBrass2
BPF Brass
2
2
2
2
2
1
2
2
2
2
2
4
2
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
SC-88Pro Map
Trumpet
Trumpet 2
Trumpet :
--------Flugel Horn
4th Trumpets
Bright Tp.
Warm Tp.
--------Syn. Trumpet
Stemmen
1
1
1
1
2
2
2
1
1
2
Tuba
Tuba 2
-----
1
1
1
[Pro]
MutedTrumpet
------------Muted Horns
1
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
French Horns
Fr.Horn 2
Horn + Orche
Wide FreHrns
F.Hrn Slow:
Dual Horns
Synth Horn
F.Horn Rip
1
2
2
2
1
2
2
1
[Pro]
[Pro]
[Pro]
Brass 1
Brass ff
Bones Sect.
------------Brass 2
Brass 3
Brass sfz
--------Brass Fall
Trumpet Fall
Octave Brass
Brass + Reed
-----------------------------
2
1
1
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
SynthBrass1
JUNO Brass
StackBrass
SH-5 Brass
MKS Brass
----Pro Brass
P5 Brass
----Oct SynBrass
Hybrid Brass
---------
[88]
[88]
1
Trombone
Trombone 2
Twin bones
--------Bs. Trombone
-----
[Pro]
[Pro]
[88]
2
2
2
2
Stemmen
1
1
1
2
2
SC-55 Map
Stemmen
Trumpet
---------------------------------------------
1
Trombone
Trombone 2
---------------------
1
2
1
2
[88]
[88]
Tuba
Tuba 2
-----
1
1
Tuba
---------
1
[88]
Muted Tp.
-----------------
1
MuteTrumpet
-----------------
1
[88]
[88]
FrenchHorns
Fr.Horn 2
--------Fr.HornSolo
----Horn Orch
-----
1
2
French Horn
Fr.Horn 2
-------------------------
2
2
Brass 1
--------------------Brass 2
-------------------------------------------------------------
1
Syn.Brass 1
--------------------Syn.Brass 3
--------Analog Brs1
-------------
2
2
2
2
2
2
2
2
2
Trumpet
Trumpet 2
------------Flugel Horn
----Bright Tp.
Warm Tp.
------------Trombone
Trombone 2
---------------------
1
1
1
2
2
SC-88 Map
[88]
[55]
[55]
1
2
Brass 1
--------------------Brass 2
----------------Brass Fall
-----------------------------------------
1
SynthBrass1
Poly Brass
----------------Syn.Brass 3
Quack Brass
----OctaveBrass
-------------
2
2
[55]
2
1
2
2
2
[55]
2
2
2
175
3&
&&
SURJUDPQXPPHU,QVWUXPHQWQXPPHU
ZDDUGHYDQFRQWUROHQXPPHU
%DQNQXPPHU9DULDWLRQQXPPHU
OHJDWRNODQNHQV
6WHPPHQ
DDQWDOVWHPPHQGLHKHW,QVWUXPHQWJHEUXLNW
2SPHUNLQJ>3UR@]HOIGHNODQNDOV6&3URPDS
2SPHUNLQJ>@]HOIGHNODQNDOV6&PDS
2SPHUNLQJ>@]HOIGHNODQNDOV6&PDS
2SPHUNLQJ HHQSHUFXVVLHNODQNGLHQLHWPHORGLVFKHJHVSHHOGNDQ
ZRUGHQ*HEUXLN&QRRWQXPPHU
Bijlagen
CC00
PC
SC-8850 Map
000
001
002
003
004
005
006
008
009
010
011
012
016
017
064
Synth Brass2
Soft Brass
Warm Brass
Synth Brass3
Sync Brass
Fat SynBrass
DeepSynBrass
SynBrass sfz
OB Brass
Reso Brass
DistSqrBrass
JP8000SawBrs
Velo Brass 1
Transbrass
Stemmen
2
2
2
2
2
2
2
1
2
2
2
2
2
2
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
SC-88Pro Map
Synth Brass 2
Soft Brass
Warm Brass
----------------SynBrass sfz
OB Brass
Reso Brass
--------Velo Brass 1
Transbrass
Stemmen
2
2
2
1
2
2
2
2
[88]
SC-88 Map
Stemmen
Syn.Brass 2
Soft Brass
--------------------Syn.Brass 4
----------------VeloBrass 1
VeloBrass 2
2
2
[55]
1
[55]
2
2
SC-55 Map
Syn.Brass 2
------------------------Syn.Brass 4
----------------Analog Brs2
-----
Stemmen
2
1
2
Reed
CC00
PC
SC-8850 Map
000
008
065
Soprano Sax
Soprano Exp.
Stemmen
1
1
[Pro]
[Pro]
SC-88Pro Map
Soprano Sax
Soprano Exp.
Stemmen
1
1
SC-88 Map
Soprano Sax
-----
Stemmen
1
Soprano Sax
-----
1
000
008
009
016
017
066
Alto Sax
AltoSax Exp.
Grow Sax
AltoSax + Tp
Sax Section
1
1
1
2
4
[Pro]
[Pro]
[Pro]
[Pro]
Alto Sax
AltoSax Exp.
Grow Sax
AltoSax + Tp
-----
1
1
1
2
Alto Sax
Hyper Alto
-------------
1
1
Alto Sax
-----------------
1
000
001
008
009
067
Tenor Sax
Tenor Sax :
BreathyTn.:
St.Tenor Sax
2
2
1
2
[Pro]
[Pro]
[Pro]
[Pro]
Tenor Sax
Tenor Sax :
BreathyTn.:
St. Tenor Sax
2
2
1
2
Tenor Sax
----BreathyTnr.
-----
2
Tenor Sax
-------------
1
000
001
008
068
Baritone Sax
Bari. Sax :
Bari & Tenor
2
2
2
[Pro]
[Pro]
Baritone Sax
Bari. Sax :
-----
2
2
BaritoneSax
---------
1
BaritoneSax
---------
1
000
008
016
069
Oboe
Oboe Exp.
Multi Reed
1
1
1
[Pro]
1
1
1
Oboe
---------
1
Oboe
---------
1
[Pro]
Oboe
Oboe Exp.
Multi Reed
000
070
English Horn
1
[Pro]
English Horn
1
[88]
EnglishHorn
1
EnglishHorn
1
000
071
Bassoon
1
[Pro]
Bassoon
1
[88]
Bassoon
1
Bassoon
1
000
008
016
017
072
Clarinet
Bs Clarinet
Multi Wind
Quad Wind
1
1
1
4
Clarinet
Bs Clarinet
Multi Wind
-----
1
1
1
[88]
Clarinet
Bs Clarinet
---------
1
1
Clarinet
-------------
1
[Pro]
[Pro]
1
SC-55 Map
Stemmen
&&HQ]LMQEHVWHPGYRRU8VHULQVWUXPHQWHQ
176
Bijlagen
Pipe
CC00
PC
SC-8850 Map
000
001
008
009
016
073
Piccolo
Piccolo :
Nay
Nay Tremolo
Di
Stemmen
1
1
2
2
2
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
Piccolo
Piccolo :
Nay
Nay Tremolo
Di
1
1
2
2
2
[88]
Piccolo
-----------------
1
Piccolo
-----------------
1
000
001
002
003
008
009
016
017
074
Flute
Flute 2 :
Flute Exp.
Flt Travelso
Flute + Vln
Pipe & Reed
Tron Flute
Indian Flute
1
1
1
2
2
4
1
1
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
Flute
Flute 2 :
Flute Exp.
Flt Travelso
Flute + Vln
----Tron Flute
-----
1
1
1
2
2
[88]
Flute
-----------------------------
1
Flute
-----------------------------
1
000
075
Recorder
1
[Pro]
Recorder
1
[88]
Recorder
1
Recorder
1
000
008
016
017
024
025
026
076
Pan Flute
Kawala
Zampona
Zampona Atk
Tin Whistle
TinWhtsle Nm
TinWhtsle Or
2
2
2
1
1
1
1
[Pro]
[Pro]
[Pro]
[Pro]
Pan Flute
Kawala
Zampona
Zampona Atk
-------------
2
2
2
1
[88]
[88]
Pan Flute
Kawala
---------------------
2
2
Pan Flute
-------------------------
1
000
077
Bottle Blow
2
[Pro]
Bottle Blow
2
[88]
Bottle Blow
2
Bottle Blow
2
000
001
078
Shakuhachi
Shakuhachi:
2
2
[Pro]
[Pro]
Shakuhachi
Shakuhachi:
2
2
[88]
Shakuhachi
-----
2
[55]
Shakuhachi
-----
2
000
001
079
Whistle
Whistle 2
1
2
[Pro]
[Pro]
Whistle
Whistle 2
1
2
[88]
Whistle
-----
1
[55]
Whistle
-----
1
000
080
Ocarina
1
[Pro]
Ocarina
1
[88]
Ocarina
1
[55]
Ocarina
1
[Pro]
SC-88Pro Map
Stemmen
1
SC-88 Map
Stemmen
[55]
SC-55 Map
Stemmen
Synth lead
CC00
PC
SC-8850 Map
000
001
002
003
004
005
006
007
008
009
010
011
016
017
018
019
020
021
022
023
024
025
026
027
028
029
030
031
032
033
034
035
081
Square Wave
MG Square
Hollow Mini
Mellow FM
CC Solo
Shmoog
LM Square
JP8000 TWM
2600 Sine
Sine Lead
KG Lead
Twin Sine
P5 Square
OB Square
JP-8 Square
Dist Square
303SquarDst1
303SquarDst2
303 Mix Sqr
Dual Sqr&Saw
Pulse Lead
JP8 PulseLd1
JP8 PulseLd2
MG Reso. Pls
JP8 PulseLd3
260RingLead
303DistLead
JP8000DistLd
HipHop SinLd
HipHop SqrLd
HipHop PlsLd
Flux Pulse
Stemmen
2
1
1
2
2
2
2
2
1
1
1
2
1
1
1
1
1
1
2
4
2
2
1
1
2
2
2
2
1
1
1
2
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
SC-88Pro Map
Square Wave
MG Square
Hollow Mini
Mellow FM
CC Solo
Shmoog
LM Square
----2600 Sine
Sine Lead
KG Lead
----P5 Square
OB Square
JP-8 Square
--------------------Pulse Lead
JP8 PulseLd1
JP8 PulseLd2
MG Reso. Pls
---------------------------------
Stemmen
2
1
1
2
2
2
2
1
1
1
1
1
1
2
2
1
1
[88]
[88]
[88]
[88]
[88]
SC-88 Map
Square Wave
Square
Hollow Mini
Mellow FM
CC Solo
Shmoog
LM Square
----Sine Wave
---------------------------------------------------------------------------------------------
Stemmen
2
1
1
2
2
2
2
[55]
[55]
1
[55]
SC-55 Map
Square Wave
Square
------------------------Sine Wave
---------------------------------------------------------------------------------------------
Stemmen
2
1
1
177
3&
&&
SURJUDPQXPPHU,QVWUXPHQWQXPPHU
ZDDUGHYDQFRQWUROHQXPPHU
%DQNQXPPHU9DULDWLRQQXPPHU
OHJDWRNODQNHQV
6WHPPHQ
DDQWDOVWHPPHQGLHKHW,QVWUXPHQWJHEUXLNW
2SPHUNLQJ>3UR@]HOIGHNODQNDOV6&3URPDS
2SPHUNLQJ>@]HOIGHNODQNDOV6&PDS
2SPHUNLQJ>@]HOIGHNODQNDOV6&PDS
2SPHUNLQJ HHQSHUFXVVLHNODQNGLHQLHWPHORGLVFKHJHVSHHOGNDQ
ZRUGHQ*HEUXLN&QRRWQXPPHU
Bijlagen
CC00
PC
SC-8850 Map
000
001
002
003
004
005
006
007
008
009
010
011
012
013
014
015
016
017
018
024
025
026
027
028
029
030
031
032
033
034
035
036
040
041
042
043
044
045
046
047
082
Saw Wave
OB2 Saw
Pulse Saw
Feline GR
Big Lead
Velo Lead
GR-300
LA Saw
Doctor Solo
Fat Saw Lead
JP8000 Saw
D-50 Fat Saw
OB DoubleSaw
JP DoubleSaw
FatSawLead 2
JP SuperSaw
Waspy Synth
PM Lead
CS Saw Lead
MG Saw 1
MG Saw 2
OB Saw 1
OB Saw 2
D-50 Saw
SH-101 Saw
CS Saw
MG Saw Lead
OB Saw Lead
P5 Saw Lead
MG unison
Oct Saw Lead
Natural Lead
SequenceSaw1
SequenceSaw2
Reso Saw
Cheese Saw 1
Cheese Saw 2
Rhythmic Saw
SequencedSaw
Techno Saw
Stemmen
2
1
2
2
2
2
2
1
2
2
1
2
2
2
2
4
2
1
1
1
1
1
1
1
1
1
1
1
2
2
2
2
2
1
1
1
1
2
2
2
000
001
002
008
009
083
Syn.Calliope
Vent Synth
Pure PanLead
LM Pure Lead
LM Blow Lead
2
2
2
4
4
[Pro]
[Pro]
[Pro]
Syn.Calliope
Vent Synth
Pure PanLead
---------
2
2
2
000
001
002
003
004
005
006
007
008
009
010
084
Chiffer Lead
TB Lead
Hybrid Lead
Unison SqrLd
FatSolo Lead
ForcefulLead
Oct.UnisonLd
Unison SawLd
Mad Lead
CrowdingLead
Double Sqr.
2
2
4
4
4
4
4
4
2
4
2
[Pro]
[Pro]
Chiffer Lead
TB Lead
------------------------Mad Lead
---------
2
2
000
001
002
003
004
005
006
008
009
010
011
012
016
017
018
019
020
021
022
024
025
026
085
Charang
Wire Lead
FB.Charang
Fat GR Lead
Windy GR Ld
Mellow GR Ld
GR & Pulse
Dist.Lead
Acid Guitar1
Acid Guitar2
Dance Dst.Gt
DanceDst.Gt2
P5 Sync Lead
Fat SyncLead
Rock Lead
5th DecaSync
Dirty Sync
DualSyncLead
LA Brass Ld
JUNO Sub Osc
2600 Sub Osc
JP8000Fd Osc
2
2
4
4
2
2
3
2
2
2
1
1
1
2
2
2
1
4
4
1
1
1
[Pro]
Charang
------------------------Dist.Lead
Acid Guitar1
Acid Guitar2
--------P5 Sync Lead
Fat Sync Lead
Rock Lead
5th DecaSync
Dirty Sync
--------JUNO Sub Osc
---------
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
SC-88Pro Map
Saw Wave
OB2 Saw
Pulse Saw
Feline GR
Big Lead
Velo Lead
GR-300
LA Saw
Doctor Solo
Fat Saw Lead
----D-50 Fat Saw
----------------Waspy Synth
PM Lead
CS Saw Lead
MG Saw 1
MG Saw 2
OB Saw 1
OB Saw 2
D-50 Saw
SH-101 Saw
CS Saw
MG Saw Lead
OB Saw Lead
P5 Saw Lead
MG unison
Oct Saw Lead
----SequenceSaw1
SequenceSaw2
Reso Saw
Cheese Saw 1
Cheese Saw 2
Rhythmic Saw
---------
Stemmen
2
1
2
2
2
2
2
1
2
2
SC-88 Map
Stemmen
Saw Wave
Saw
Pulse Saw
Feline GR
Big Lead
Velo Lead
GR-300
LA Saw
Doctor Solo
----------------------------Waspy Synth
---------------------------------------------------------------------------------------------
2
1
2
2
2
2
2
1
2
[88]
[88]
[88]
SynCalliope
Vent Synth
PurePanLead
---------
2
2
2
[88]
ChifferLead
-----------------------------------------
2
[88]
2
2
2
[88]
Charang
------------------------Dist.Lead
---------------------------------------------------------
[88]
[88]
[88]
[88]
[88]
[88]
[88]
2
2
1
1
1
1
1
1
1
1
1
1
1
2
2
2
[88]
2
1
1
1
1
2
2
1
2
2
2
1
1
[55]
[55]
SC-55 Map
Stemmen
Saw Wave
Saw
------------------------Doctor Solo
-----------------------------------------------------------------------------------------------------------------------------
2
1
[55]
SynCalliope
-----------------
2
2
[55]
ChifferLead
-----------------------------------------
2
2
[55]
Charang
-------------------------------------------------------------------------------------
2
[55]
2
2
2
&&HQ]LMQEHVWHPGYRRU8VHULQVWUXPHQWHQ
178
Bijlagen
CC00
PC
SC-8850 Map
000
001
008
009
010
086
Solo Vox
Solo Vox 2
Vox Lead
LFO Vox
Vox Lead 2
Stemmen
2
4
2
2
2
000
001
002
003
004
005
006
008
087
5th Saw Wave
Big Fives
5th Lead
5th Ana.Clav
5th Pulse
JP 5th Saw
JP8000 5thFB
4th Lead
2
2
2
2
2
2
2
2
[Pro]
[Pro]
[Pro]
[Pro]
000
001
002
003
004
005
006
007
088
Bass & Lead
Big & Raw
Fat & Perky
JUNO Rave
JP8 BsLead 1
JP8 BsLead 2
SH-5 Bs.Lead
Delayed Lead
2
2
2
1
1
2
2
2
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
SC-88Pro Map
Solo Vox
----Vox Lead
LFO Vox
-----
Stemmen
2
2
2
2
2
Bass & Lead
Big & Raw
Fat & Perky
JUNO Rave
JP8 BsLead 1
JP8 BsLead 2
SH-5 Bs.Lead
-----
2
2
2
1
1
2
2
Stemmen
SC-55 Map
Stemmen
Solo Vox
-----------------
2
[55]
Solo Vox
-----------------
2
[88]
[88]
5th Saw
Big Fives
-------------------------
2
2
[55]
5th Saw
-----------------------------
2
[88]
[88]
[88]
Bass & Lead
Big & Raw
Fat & Perky
---------------------
2
2
2
[55]
Bass & Lead
-----------------------------
2
2
2
5th Saw Wave
Big Fives
5th Lead
5th Ana.Clav
------------4th Lead
SC-88 Map
[88]
2
Synth pad, etc
CC00
PC
SC-8850 Map
000
001
002
003
004
005
006
007
089
Fantasia
Fantasia 2
New Age Pad
Bell Heaven
Fantasia 3
Fantasia 4
After D !
260HarmPad
Stemmen
2
2
2
2
4
4
4
4
[Pro]
[Pro]
[Pro]
[Pro]
Fantasia
Fantasia 2
New Age Pad
Bell Heaven
-----------------
2
2
2
2
[88]
[88]
Fantasia
Fantasia 2
-------------------------
2
2
[55]
Fantasia
-----------------------------
2
000
001
002
003
004
005
006
008
009
010
011
012
013
090
Warm Pad
Thick Matrix
Horn Pad
Rotary Strng
OB Soft Pad
Sine Pad
OB Soft Pad2
Octave Pad
Stack Pad
Human Pad
Sync Brs.Pad
Oct.PWM Pad
JP Soft Pad
1
2
2
2
2
2
2
2
2
4
4
2
2
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
Warm Pad
Thick Matrix
Horn Pad
Rotary Strng
OB Soft Pad
--------Octave Pad
Stack Pad
-----------------
1
2
2
2
2
[88]
Warm Pad
Thick Pad
Horn Pad
RotaryStrng
Soft Pad
---------------------------------
1
2
2
2
2
[55]
Warm Pad
-------------------------------------------------
1
000
001
002
003
004
008
009
010
011
012
013
014
015
016
017
024
091
Polysynth
80's PolySyn
Polysynth 2
Poly King
Super Poly
Power Stack
Octave Stack
Reso Stack
Techno Stack
Pulse Stack
TwinOct.Rave
Oct.Rave
Happy Synth
ForwardSweep
ReverseSweep
Minor Rave
2
2
2
2
4
2
2
1
2
2
4
4
2
2
2
4
[Pro]
[Pro]
[Pro]
[Pro]
[88]
[88]
Polysynth
80'sPolySyn
---------------------------------------------------------
2
2
[55]
Polysynth
-------------------------------------------------------------
2
000
001
002
003
004
005
006
007
008
009
010
011
012
092
Space Voice
Heaven II
SC Heaven
Itopia
Water Space
Cold Space
Noise Peaker
Bamboo Hit
Cosmic Voice
Auh Vox
AuhAuh
Vocorderman
Holy Voices
1
2
2
2
2
4
1
1
2
1
2
2
4
[Pro]
[Pro]
[Pro]
[88]
[88]
Space Voice
Heaven II
-----------------------------------------
1
2
[55]
Space Voice
---------------------------------------------
1
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
SC-88Pro Map
Stemmen
[88]
[88]
2
2
Polysynth
80's PolySyn
Polysynth 2
Poly King
----Power Stack
Octave Stack
Reso Stack
Techno Stack
-----------------------------
2
2
2
2
Space Voice
Heaven II
SC Heaven
--------------------Cosmic Voice
Auh Vox
AuhAuh
Vocorderman
-----
1
2
2
2
2
1
2
2
1
2
2
SC-88 Map
Stemmen
SC-55 Map
Stemmen
179
3&
&&
SURJUDPQXPPHU,QVWUXPHQWQXPPHU
ZDDUGHYDQFRQWUROHQXPPHU
%DQNQXPPHU9DULDWLRQQXPPHU
OHJDWRNODQNHQV
6WHPPHQ
DDQWDOVWHPPHQGLHKHW,QVWUXPHQWJHEUXLNW
2SPHUNLQJ>3UR@]HOIGHNODQNDOV6&3URPDS
2SPHUNLQJ>@]HOIGHNODQNDOV6&PDS
2SPHUNLQJ>@]HOIGHNODQNDOV6&PDS
2SPHUNLQJ HHQSHUFXVVLHNODQNGLHQLHWPHORGLVFKHJHVSHHOGNDQ
ZRUGHQ*HEUXLN&QRRWQXPPHU
Bijlagen
CC00
PC
SC-8850 Map
000
001
002
003
004
005
093
Bowed Glass
SoftBellPad
JP8 Sqr Pad
7thBelPad
Steel Glass
Bottle Stack
Stemmen
2
2
2
2
4
4
[Pro]
[Pro]
[Pro]
[Pro]
Bowed Glass
SoftBellPad
JP8 Sqr Pad
7thBelPad
---------
2
2
2
2
[88]
Bowed Glass
---------------------
2
[55]
Bowed Glass
---------------------
2
000
001
002
003
004
005
094
Metal Pad
Tine Pad
Panner Pad
Steel Pad
Special Rave
Metal Pad 2
2
2
2
2
4
4
[Pro]
[Pro]
[Pro]
Metal Pad
Tine Pad
Panner Pad
-------------
2
2
2
[88]
[88]
[88]
Metal Pad
Tine Pad
Panner Pad
-------------
2
2
2
[55]
Metal Pad
---------------------
2
000
001
002
008
009
010
011
012
095
Halo Pad
Vox Pad
Vox Sweep
Horror Pad
SynVox Pad
SynVox Pad 2
Breath&Rise
Tears Voices
2
2
2
2
4
4
4
4
[Pro]
[Pro]
[Pro]
[Pro]
Halo Pad
Vox Pad
Vox Sweep
Horror Pad
-----------------
2
2
2
2
[88]
Halo Pad
-----------------------------
2
[55]
Halo Pad
-----------------------------
2
000
001
002
003
004
008
009
010
011
012
013
014
015
096
Sweep Pad
Polar Pad
Ambient BPF
Sync Pad
Warriors
Converge
Shwimmer
Celestial Pd
Bag Sweep
Sweep Pipe
Sweep Stack
Deep Sweep
Stray Pad
1
1
4
2
4
1
2
2
2
2
4
2
2
[Pro]
[Pro]
Sweep Pad
Polar Pad
------------Converge
Shwimmer
Celestial Pd
Bag Sweep
-----------------
1
1
[88]
[88]
1
1
[55]
[88]
[88]
[88]
Sweep Pad
-------------------------------------------------
1
1
2
2
2
Sweep Pad
Polar Pad
------------Converge
Shwimmer
CelestialPd
---------------------
[Pro]
[Pro]
[Pro]
[Pro]
SC-88Pro Map
Stemmen
SC-88 Map
Stemmen
1
2
2
SC-55 Map
Stemmen
Synth SFX
CC00
PC
SC-8850 Map
000
001
002
003
004
005
006
007
008
009
010
011
097
Ice Rain
Harmo Rain
African wood
Anklung Pad
Rattle Pad
Saw Impulse
Strange Str.
FastFWD Pad
Clavi Pad
EP Pad
Tambra Pad
CP Pad
Stemmen
2
2
2
2
2
3
2
2
2
2
2
2
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
000
001
002
003
004
005
008
098
Soundtrack
Ancestral
Prologue
Prologue 2
Hols Strings
HistoryWave
Rave
2
2
2
2
2
2
2
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
000
001
002
003
004
005
006
007
008
009
010
011
012
013
016
017
018
019
020
021
022
023
099
Crystal
Syn Mallet
Soft Crystal
Round Glock
Loud Glock
GlockenChime
Clear Bells
ChristmasBel
Vibra Bells
Digi Bells
Music Bell
Analog Bell
Blow Bell
Hyper Bell
Choral Bells
Air Bells
Bell Harp
Gamelimba
JUNO Bell
JP Bell
Pizz Bell
Bottom Bell
2
1
2
2
2
2
2
2
2
2
2
1
2
2
2
2
2
2
2
2
2
2
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
SC-88Pro Map
Stemmen
Ice Rain
Harmo Rain
African wood
Anklung Pad
Rattle Pad
------------Clavi Pad
-------------
2
2
2
2
2
[88]
[88]
[88]
2
[88]
Soundtrack
Ancestral
Prologue
Prologue 2
Hols Strings
----Rave
2
2
2
2
2
[88]
[88]
[88]
2
[88]
Crystal
Syn Mallet
Soft Crystal
Round Glock
Loud Glock
GlockenChime
Clear Bells
ChristmasBel
Vibra Bells
Digi Bells
Music Bell
Analog Bell
--------Choral Bells
Air Bells
Bell Harp
Gamelimba
JUNO Bell
-------------
2
1
2
2
2
2
2
2
2
2
2
1
[88]
[88]
[88]
[88]
[88]
[88]
[88]
[88]
[88]
[88]
2
2
2
2
2
[88]
[88]
[88]
[88]
SC-88 Map
Stemmen
Ice Rain
Harmo Rain
AfricanWood
--------------------Clavi Pad
-------------
2
2
2
2
2
2
Crystal
Syn Mallet
SoftCrystal
Round Glock
Loud Glock
GlocknChime
Clear Bells
X'mas Bell
Vibra Bells
Digi Bells
----------------ChoralBells
Air Bells
Bell Harp
Gamelimba
-----------------
2
1
2
2
2
2
2
2
2
2
2
[55]
Soundtrack
-------------------------
2
[55]
[55]
Crystal
Syn Mallet
---------------------------------------------------------------------------------
2
1
2
2
2
2
2
Stemmen
Ice Rain
---------------------------------------------
2
Soundtrack
Ancestral
Prologue
------------Rave
SC-55 Map
[55]
&&HQ]LMQEHVWHPGYRRU8VHULQVWUXPHQWHQ
180
Bijlagen
CC00
PC
SC-8850 Map
000
001
002
003
004
005
006
007
008
009
010
011
100
Atmosphere
Warm Atmos
Nylon Harp
Harpvox
HollowReleas
Nylon+Rhodes
Ambient Pad
Invisible
Pulsey Key
Noise Piano
Heaven Atmos
Tambra Atmos
Stemmen
2
2
2
2
2
2
2
2
2
2
2
2
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
Atmosphere
Warm Atmos
Nylon Harp
Harpvox
HollowReleas
Nylon+Rhodes
Ambient Pad
Invisible
Pulsey Key
Noise Piano
---------
2
2
2
2
2
2
2
2
2
2
[88]
[88]
[88]
[88]
[88]
[88]
[88]
Atmosphere
Warm Atmos
Nylon Harp
Harpvox
HollowRels.
NylonRhodes
Ambient Pad
---------------------
2
2
2
2
2
2
2
[55]
Atmosphere
---------------------------------------------
2
000
001
002
003
004
005
006
007
008
101
Brightness
Shining Star
OB Stab
Brass Star
Choir Stab
D-50 Retour
SouthernWind
SymbolicBell
Org Bell
2
2
1
2
4
4
4
2
2
[Pro]
[Pro]
[Pro]
Brightness
Shining Star
OB Stab
--------------------Org Bell
2
2
1
[88]
Brightness
---------------------------------
2
[55]
Brightness
---------------------------------
2
000
001
002
003
004
005
006
007
008
009
010
011
012
013
014
015
016
017
018
019
020
021
022
023
024
025
026
027
028
029
030
031
032
102
Goblin
Goblinson
50's Sci-Fi
Abduction
Auhbient
LFO Pad
Random Str
Random Pad
LowBirds Pad
Falling Down
LFO RAVE
LFO Horror
LFO Techno
Alternative
UFO FX
Gargle Man
Sweep FX
LM Has Come
FallinInsect
LFO Oct.Rave
Just Before
RND Fl.Chord
RandomEnding
Random Sine
EatingFilter
Noise&SawHit
Pour Magic
DancingDrill
Dirty Stack
Big Blue
Static Hit
Atl.Mod.FX
Acid Copter
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
1
1
2
4
2
4
4
2
2
2
2
2
2
2
2
4
4
2
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
Goblin
Goblinson
50's Sci-Fi
Abduction
Auhbient
LFO Pad
Random Str
Random Pad
LowBirds Pad
Falling Down
LFO RAVE
LFO Horror
LFO Techno
Alternative
UFO FX
Gargle Man
Sweep FX
-----------------------------------------------------------------
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
1
1
[88]
[88]
[88]
Goblin
Goblinson
50's Sci-Fi
-------------------------------------------------------------------------------------------------------------------------
2
2
2
[55]
Goblin
---------------------------------------------------------------------------------------------------------------------------------
2
000
001
002
003
004
005
006
007
008
009
010
011
103
Echo Drops
Echo Bell
Echo Pan
Echo Pan 2
Big Panner
Reso Panner
Water Piano
Echo SynBass
Pan Sequence
Aqua
Panning Lead
PanningBrass
1
2
2
2
2
2
2
2
2
2
2
2
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
Echo Drops
Echo Bell
Echo Pan
Echo Pan 2
Big Panner
Reso Panner
Water Piano
----Pan Sequence
Aqua
---------
1
2
2
2
2
2
2
[88]
[88]
[88]
[88]
[88]
[88]
[88]
Echo Drops
Echo Bell
Echo Pan
Echo Pan 2
Big Panner
Reso Panner
Water Piano
---------------------
1
2
2
2
2
2
2
[55]
[55]
[55]
Echo Drops
Echo Bell
Echo Pan
-------------------------------------
1
2
2
000
001
002
003
004
005
006
008
009
010
011
016
017
018
019
104
Star Theme
Star Theme 2
Star Mind
Star Dust
Rep.Trance
Etherality
Mystic Pad
Dream Pad
Silky Pad
Dream Pad 2
Silky Pad 2
New Century
7th Atmos.
Galaxy Way
Rising OSC.
2
2
4
4
4
4
4
2
2
2
2
1
2
2
2
[88]
[88]
Star Theme
StarTheme 2
-----------------------------------------------------
2
2
[55]
Star Theme
---------------------------------------------------------
2
[Pro]
[Pro]
[Pro]
SC-88Pro Map
Stemmen
2
2
2
[Pro]
[Pro]
Star Theme
Star Theme 2
-----------------
2
2
[Pro]
[Pro]
Dream Pad
Silky Pad
--------New Century
7th Atmos.
Galaxy Way
-----
2
2
[Pro]
[Pro]
[Pro]
1
2
2
SC-88 Map
Stemmen
SC-55 Map
Stemmen
181
3&
&&
SURJUDPQXPPHU,QVWUXPHQWQXPPHU
ZDDUGHYDQFRQWUROHQXPPHU
%DQNQXPPHU9DULDWLRQQXPPHU
OHJDWRNODQNHQV
6WHPPHQ
DDQWDOVWHPPHQGLHKHW,QVWUXPHQWJHEUXLNW
2SPHUNLQJ>3UR@]HOIGHNODQNDOV6&3URPDS
2SPHUNLQJ>@]HOIGHNODQNDOV6&PDS
2SPHUNLQJ>@]HOIGHNODQNDOV6&PDS
2SPHUNLQJ HHQSHUFXVVLHNODQNGLHQLHWPHORGLVFKHJHVSHHOGNDQ
ZRUGHQ*HEUXLN&QRRWQXPPHU
Bijlagen
Ethnisch, etc
CC00
PC
SC-8850 Map
000
001
002
003
004
005
008
016
105
Sitar
Sitar 2
Detune Sitar
Sitar 3
Sitar/Drone
Sitar 4
Tambra
Tamboura
Stemmen
1
2
2
2
1
2
1
2
000
001
008
009
016
024
028
032
106
Banjo
Muted Banjo
Rabab
San Xian
Gopichant
Oud
Oud+Strings
Pi Pa
000
001
008
107
000
001
008
016
019
024
108
000
008
009
010
SC-88Pro Map
Stemmen
1
2
2
2
[88]
[88]
[88]
[Pro]
[Pro]
Sitar
Sitar 2
Detune Sitar
Sitar 3
--------Tambra
Tamboura
1
2
[88]
[88]
1
1
2
2
2
2
2
1
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
Banjo
Muted Banjo
Rabab
San Xian
Gopichant
Oud
Oud+Strings
Pi Pa
1
1
2
2
2
2
2
1
[88]
[88]
[88]
Shamisen
Tsugaru
Syn Shamisen
1
2
2
[Pro]
[Pro]
[Pro]
Shamisen
Tsugaru
Syn Shamisen
1
2
2
Koto
Gu Zheng
Taisho Koto
Kanoon
Kanoon+Choir
Oct Harp
2
2
1
2
2
1
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
Koto
Gu Zheng
Taisho Koto
Kanoon
Kanoon+Choir
Oct Harp
2
2
1
2
2
1
109
Kalimba
Sanza
Bodhran
Bodhran Mute
1
2
1
1
[Pro]
[Pro]
Kalimba
Sanza
---------
1
2
000
008
009
010
011
110
Bagpipe
Didgeridoo
Uillean Pipe
UillnPipe Nm
UillnPipe Or
1
1
1
1
1
[Pro]
[Pro]
Bagpipe
Didgeridoo
-------------
1
1
[88]
000
008
009
111
Fiddle
Er Hu
Gao Hu
1
1
1
[Pro]
[Pro]
[Pro]
Fiddle
Er Hu
Gao Hu
1
1
1
000
001
008
016
024
032
033
112
Shanai
Shanai 2
Pungi
Hichiriki
Mizmar
Suona 1
Suona 2
1
1
1
2
1
1
1
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
Shanai
Shanai 2
Pungi
Hichiriki
Mizmar
Suona 1
Suona 2
1
1
1
2
1
1
1
[Pro]
[Pro]
[Pro]
SC-88 Map
[88]
[88]
[88]
[88]
[88]
[88]
Stemmen
Sitar
Sitar 2
DetuneSitar
------------Tambra
Tamboura
1
2
2
Banjo
Muted Banjo
Rabab
----Gopichant
Oud
---------
1
1
2
[55]
[55]
1
2
2
2
SC-55 Map
Stemmen
Sitar
Sitar 2
-------------------------
1
2
Banjo
-----------------------------
1
Shamisen
Tsugaru
-----
1
2
[55]
Shamisen
---------
1
Koto
----Taisho Koto
Kanoon
---------
1
[55]
Koto
----Taisho Koto
-------------
1
1
2
2
Kalimba
-------------
1
Kalimba
-------------
1
Bagpipe
-----------------
1
Bagpipe
-----------------
1
[88]
Fiddle
---------
1
[55]
Fiddle
---------
1
[88]
[88]
[88]
[88]
Shanai
Shanai 2
Pungi
Hichiriki
-------------
1
1
1
2
[55]
Shanai
-------------------------
1
+
Percussie
CC00
PC
SC-8850 Map
000
008
009
010
011
012
013
014
015
016
017
018
019
020
021
022
023
024
025
032
040
041
042
113
Tinkle Bell
Bonang
Gender
Gamelan Gong
St.Gamelan
Jang Gu
Jegogan
Jublag
Pemade
RAMA Cymbal
Kajar
Kelontuk
Kelontuk Mt
Kelontuk Sid
Kopyak Op
Kopyak Mt
Ceng Ceng
Reyoung
Kempur
Jngl Crash
Crash Menu
RideCym Menu
RideBellMenu
Stemmen
1
1
1
1
2
2
2
1
1
1
1
1
1
1
1
1
2
2
2
1
1
1
1
SC-88Pro Map
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
+
+
+
+
Tinkle Bell
Bonang
Gender
Gamelan Gong
St.Gamelan
Jang-Gu
------------RAMA Cymbal
-----------------------------------------------------
Stemmen
1
1
1
1
2
2
[88]
[88]
[88]
[88]
[88]
1
[88]
SC-88 Map
Stemmen
Tinkle Bell
Bonang
Gender
GamelanGong
St.Gamelan
----------------RAMA Cymbal
-----------------------------------------------------
1
1
1
1
2
1
[55]
SC-55 Map
Tinkle Bell
-----------------------------------------------------------------------------------------
Stemmen
1
&&HQ]LMQEHVWHPGYRRU8VHULQVWUXPHQWHQ
182
Bijlagen
CC00
PC
SC-8850 Map
000
008
016
114
Agogo
Atarigane
Tambourine
Stemmen
1
1
1
[Pro]
[Pro]
[Pro] +
SC-88Pro Map
Agogo
Atarigane
Tambourine
1
1
1
[88]
[88]
000
001
115
Steel Drums
Island Mlt
1
2
[Pro]
[Pro]
Steel Drums
Island Mlt
1
2
000
008
016
017
024
032
040
116
Woodblock
Castanets
Angklung
Angkl Rhythm
Finger Snaps
909 HandClap
HandClapMenu
1
1
1
2
1
1
1
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
Woodblock
Castanets
Angklung
Angkl Rhythm
Finger Snaps
909 HandClap
-----
000
001
008
009
016
017
018
024
025
026
027
028
032
040
041
042
043
117
Taiko
Small Taiko
Concert BD
ConcertBD Mt
Jungle BD
Techno BD
Bounce
KendangWadon
Bebarongan
Pelegongan
Dholak 1
Dholak 2
Jngl BD Roll
Kick Menu 1
Kick Menu 2
Kick Menu 3
Kick Menu 4
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
[Pro] +
[Pro] +
[Pro] +
+
[Pro] +
[Pro] +
[Pro] +
+
+
+
+
+
+
Taiko
Small Taiko
Concert BD
----Jungle BD
Techno BD
Bounce
-----------------------------------------
000
001
002
003
004
008
009
016
017
018
019
024
040
041
042
043
044
118
Melo. Tom 1
Real Tom
Real Tom 2
Jazz Tom
Brush Tom
Melo. Tom 2
Rock Tom
Rash SD
House SD
Jungle SD
909 SD
Jngl SD Roll
SD Menu 1
SD Menu 2
SD Menu 3
SD Menu 4
SD Menu 5
1
2
1
1
1
1
2
1
1
1
1
1
1
1
1
1
1
[Pro] +
[Pro] +
+
+
+
[Pro] +
[Pro] +
[Pro] +
[Pro] +
[Pro] +
[Pro] +
+
Melo. Tom 1
Real Tom
------------Melo. Tom 2
Rock Tom
Rash SD
House SD
Jungle SD
909 SD
-------------------------
000
008
009
010
011
012
013
119
Synth Drum
808 Tom
Elec Perc
Sine Perc.
606 Tom
909 Tom
606 Dist.Tom
1
2
1
1
1
1
1
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
000
001
002
003
008
009
016
017
024
025
026
027
040
041
042
043
044
045
046
120
Reverse Cym.
Reverse Cym2
Reverse Cym3
Reverse Cym4
Rev.Snare 1
Rev.Snare 2
Rev.Kick 1
Rev.ConBD
Rev.Tom 1
Rev.Tom 2
Rev.Tom 3
Rev.Tom 4
Rev.SD Menu1
Rev.SD Menu2
Rev.SD Menu3
Rev.BD Menu1
Rev.BD Menu2
Rev.BD Menu3
Rev.ClapMenu
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
[Pro] +
[Pro] +
[Pro] +
+
[Pro] +
[Pro] +
[Pro] +
[Pro] +
[Pro] +
[Pro] +
+
+
+
+
+
+
+
+
+
+
+
+
Stemmen
SC-88 Map
Stemmen
Agogo
Atarigane
-----
1
1
[88]
Steel Drums
-----
1
1
1
1
2
1
1
[88] +
[88] +
Woodblock
Castanets
---------------------
1
1
1
[88] +
+
[88] +
1
1
1
+
+
+
1
2
[88] +
[88] +
1
2
1
1
1
1
[88] +
[88] +
+
+
+
+
Synth Drum
808 Tom
Elec Perc
Sine Perc.
606 Tom
909 Tom
-----
1
2
1
1
1
1
[88] +
[88] +
[88] +
Reverse Cym.
Reverse Cym2
Reverse Cym3
----Rev.Snare 1
Rev.Snare 2
Rev.Kick 1
Rev.ConBD
Rev.Tom 1
Rev.Tom 2
-------------------------------------
1
1
1
[88] +
[88] +
+
1
1
1
1
1
1
[88]
[88]
[88]
[88]
[88]
[88]
+
+
+
+
+
+
+
+
+
+
+
SC-55 Map
Stemmen
Agogo
---------
1
[55]
Steel Drums
-----
1
1
1
[55] +
[55] +
Woodblock
Castanets
---------------------
1
1
+
+
Taiko
----Concert BD
---------------------------------------------------------
1
[55] +
1
+
1
[55] +
Taiko
----Concert BD
---------------------------------------------------------
1
+
Melo. Tom 1
Real Tom
------------Melo. Tom 2
Rock Tom
-----------------------------------------
1
2
[55] +
+
1
+
1
2
[55] +
+
Melo. Tom 1
----------------Melo. Tom 2
---------------------------------------------
1
+
Synth Drum
808 Tom
Elec Perc
-----------------
1
2
1
[55] +
+
[55] +
Synth Drum
808 Tom
Elec Perc
-----------------
1
1
1
+
+
+
Reverse Cym
ReverseCym2
--------Rev.Snare 1
Rev.Snare 2
Rev.Kick 1
Rev.ConBD
Rev.Tom 1
Rev.Tom 2
-------------------------------------
1
1
[55] +
+
1
+
1
1
1
1
1
1
+
+
+
+
+
+
Reverse Cym
-------------------------------------------------------------------------
183
3&
&&
SURJUDPQXPPHU,QVWUXPHQWQXPPHU
ZDDUGHYDQFRQWUROHQXPPHU
%DQNQXPPHU9DULDWLRQQXPPHU
OHJDWRNODQNHQV
6WHPPHQ
DDQWDOVWHPPHQGLHKHW,QVWUXPHQWJHEUXLNW
2SPHUNLQJ>3UR@]HOIGHNODQNDOV6&3URPDS
2SPHUNLQJ>@]HOIGHNODQNDOV6&PDS
2SPHUNLQJ>@]HOIGHNODQNDOV6&PDS
2SPHUNLQJ HHQSHUFXVVLHNODQNGLHQLHWPHORGLVFKHJHVSHHOGNDQ
ZRUGHQ*HEUXLN&QRRWQXPPHU
Bijlagen
SFX
CC00
PC
SC-8850 Map
000
001
002
003
004
005
006
008
009
010
011
012
013
016
017
018
019
020
021
022
023
024
025
026
027
028
029
030
031
032
034
035
036
037
038
039
040
041
042
121
Gt.FretNoise
Gt.Cut Noise
String Slap
Gt.CutNoise2
Dist.CutNoiz
Bass Slide
Pick Scrape
Gt. FX Menu
Bartok Pizz.
Guitar Slap
Chord Stroke
Biwa Stroke
Biwa Tremolo
A.Bs.Nz Menu
D.Gt.Nz Menu
E.Gt.NzMenu1
E.Gt.NzMenu2
G.StrokeMenu
Gt.SlideMenu
A.Bs.Mute Nz
A.Bs.TouchNz
A.Bs.AtackNz
TC Up Nz
TC DownMt.Nz
TC UpMt.Nz
TC Down Nz
DstGT.Up Nz
DstGT.DwnNz1
DstGT.DwnNz2
DstGT.MuteNz
Gt.StrokeNz5
StlGt.SldNz1
StlGt.SldNz2
StlGt.SldNz3
StlGt.SldNz4
Gt.StrokeNz1
Gt.StrokeNz2
Gt.StrokeNz3
Gt.StrokeNz4
Stemmen
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
SC-88Pro Map
000
001
002
003
004
005
006
007
008
009
122
Breath Noise
Fl.Key Click
Brth Nz Menu
Fl.Breath 1
Fl.Breath 2
Fl.Breath 3
Vox Breath 1
Vox Breath 2
Trombone Nz
Trumpet Nz
1
1
1
1
1
1
1
1
1
1
[Pro]
[Pro] +
000
001
002
003
004
005
006
007
016
017
123
Seashore
Rain
Thunder
Wind
Stream
Bubble
Wind 2
Cricket
Pink Noise
White Noise
1
1
1
1
2
2
1
1
1
1
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
000
001
002
003
004
005
006
007
008
124
Bird
Dog
Horse-Gallop
Bird 2
Kitty
Growl
Growl 2
Fancy Animal
Seal
2
1
1
1
1
1
1
1
1
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
+
+
+
+
+
+
+
+
+
Stemmen
Gt.FretNoise
Gt.Cut Noise
String Slap
Gt.CutNoise2
Dist.CutNoiz
Bass Slide
Pick Scrape
Gt. FX Menu
Bartok Pizz.
Guitar Slap
Chord Stroke
Biwa Stroke
Biwa Tremolo
---------------------------------------------------------------------------------------------------------
1
1
1
1
1
1
1
1
1
1
1
1
1
[88]
[88]
[88]
[88]
[88]
[88]
[88]
Breath Noise
Fl.Key Click
---------------------------------
1
1
Seashore
Rain
Thunder
Wind
Stream
Bubble
Wind 2
----Pink Noise
White Noise
1
1
1
1
2
2
1
Bird
Dog
Horse-Gallop
Bird 2
Kitty
Growl
-------------
SC-88 Map
SC-55 Map
Stemmen
1
1
1
1
1
1
1
[55]
[55] +
[55] +
+
+
+
+
Gt.FretNoiz
Gt.CutNoise
String Slap
-------------------------------------------------------------------------------------------------------------------------------------------------
1
1
1
+
+
[88]
[88] +
BreathNoise
Fl.KeyClick
---------------------------------
1
1
[55]
[55] +
BreathNoise
Fl.KeyClick
---------------------------------
1
1
+
[88]
[88]
[88]
[88]
[88]
[88]
+
+
+
+
+
+
+
Seashore
Rain
Thunder
Wind
Stream
Bubble
-----------------
1
1
1
1
2
2
[55]
[55]
[55]
[55]
[55]
[55]
+
+
+
+
+
+
Seashore
Rain
Thunder
Wind
Stream
Bubble
-----------------
1
1
1
1
2
2
+
+
+
+
+
+
[88]
[88]
[88]
[88]
[88]
[88]
+
+
+
+
+
+
Bird
Dog
HorseGallop
Bird 2
Kitty
Growl
-------------
2
1
1
1
1
1
[55]
[55]
[55]
[55]
+
+
+
+
+
+
Bird
Dog
HorseGallop
Bird 2
---------------------
2
1
1
1
+
+
+
+
+
+
+
+
+
+
+
+
+
1
1
2
1
1
1
1
1
Stemmen
Gt.FretNoiz
Gt.CutNoise
String Slap
Gt.CutNz. 2
Dist.CutNz.
Bass Slide
Pick Scrape
---------------------------------------------------------------------------------------------------------------------------------
&&HQ]LMQEHVWHPGYRRU8VHULQVWUXPHQWHQ
184
Bijlagen
CC00
PC
SC-8850 Map
000
001
002
003
004
005
007
008
009
010
011
012
013
014
015
016
125
Telephone 1
Telephone 2
DoorCreaking
Door
Scratch
Wind Chimes
Scratch 2
ScratchKey
TapeRewind
Phono Noise
MC-500 Beep
Scratch 3
Scratch 4
Scratch 5
Scratch 6
Scratch 7
Stemmen
1
1
1
1
1
2
1
2
1
1
1
1
1
1
1
1
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
000
001
002
003
004
005
006
007
008
009
010
011
012
013
014
015
016
017
018
019
020
021
022
023
024
025
026
027
028
029
030
031
032
126
Helicopter
Car-Engine
Car-Stop
Car-Pass
Car-Crash
Siren
Train
Jetplane
Starship
Burst Noise
Calculating
Perc. Bang
Burner
Glass & Glam
Ice Ring
Over Blow
Crack Bottle
Pour Bottle
Soda
Open CD Tray
Audio Switch
Key Typing
SL 1
SL 2
Car Engine 2
Car Horn
Boeeeen
R.Crossing
Compresser
Sword Boom!
Sword Cross
Stab! 1
Stab! 2
1
1
1
1
2
1
1
2
2
2
2
2
2
1
1
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
000
001
002
003
004
005
006
007
008
009
016
017
018
019
020
022
023
024
025
026
127
Applause
Laughing
Screaming
Punch
Heart Beat
Footsteps
Applause 2
Small Club
ApplauseWave
BabyLaughing
Voice One
Voice Two
Voice Three
Voice Tah
Voice Whey
Voice Kikit
Voice ComeOn
Voice Aou
Voice Oou
Voice Hie
2
1
1
1
1
1
2
2
2
1
1
1
1
1
1
1
1
1
1
1
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
000
001
002
003
004
005
006
128
Gun Shot
Machine Gun
Lasergun
Explosion
Eruption
Big Shot
Explosion 2
1
1
1
2
1
2
2
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
SC-88Pro Map
+
+
+
+
+
+
+
+
+
+
SC-88 Map
Stemmen
SC-55 Map
Stemmen
1
1
1
1
1
2
1
2
1
1
1
[88]
[88]
[88]
[88]
[88]
[88]
[88]
+
+
+
+
+
+
+
+
+
+
Telephone 1
Telephone 2
Creaking
Door
Scratch
Wind Chimes
Scratch 2
-------------------------------------
1
1
1
1
1
2
1
[55]
[55]
[55]
[55]
[55]
[55]
+
+
+
+
+
+
+
Telephone 1
Telephone 2
Creaking
Door
Scratch
Wind Chimes
-----------------------------------------
1
1
1
1
1
2
+
+
+
+
+
+
Helicopter
Car-Engine
Car-Stop
Car-Pass
Car-Crash
Siren
Train
Jetplane
Starship
Burst Noise
Calculating
Perc. Bang
-------------------------------------------------------------------------------------
1
1
1
1
2
1
1
2
2
2
2
2
[88]
[88]
[88]
[88]
[88]
[88]
[88]
[88]
[88]
[88]
+
+
+
+
+
+
+
+
+
+
+
+
Helicopter
Car-Engine
Car-Stop
Car-Pass
Car-Crash
Siren
Train
Jetplane
Starship
Burst Noise
---------------------------------------------------------------------------------------------
1
1
1
1
2
1
1
2
2
2
[55]
[55]
[55]
[55]
[55]
[55]
[55]
[55]
[55]
[55]
+
+
+
+
+
+
+
+
+
+
Helicopter
Car-Engine
Car-Stop
Car-Pass
Car-Crash
Siren
Train
Jetplane
Starship
Burst Noise
---------------------------------------------------------------------------------------------
1
1
1
1
2
1
1
2
2
2
+
+
+
+
+
+
+
+
+
+
2
1
1
1
1
1
2
2
2
[88]
[88]
[88]
[88]
[88]
[88]
[88]
+
+
+
+
Applause
Laughing
Screaming
Punch
Heart Beat
Footsteps
Applause 2
-----------------------------------------------------
2
1
1
1
1
1
2
[55]
[55]
[55]
[55]
[55]
[55]
+
+
+
+
Applause
Laughing
Screaming
Punch
Heart Beat
Footsteps
---------------------------------------------------------
2
1
1
1
1
1
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
Applause
Laughing
Screaming
Punch
Heart Beat
Footsteps
Applause 2
Small Club
ApplauseWave
----Voice One
Voice Two
Voice Three
Voice Tah
Voice Whey
---------------------
+
+
+
+
+
+
+
Gun Shot
Machine Gun
Lasergun
Explosion
Eruption
Big Shot
-----
1
1
1
2
1
2
Gun Shot
Machine Gun
Lasergun
Explosion
-------------
1
1
1
2
[55]
[55]
[55]
[55]
+
+
+
+
Gun Shot
Machine Gun
Lasergun
Explosion
-------------
1
1
1
2
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
[Pro]
[Pro]
[Pro]
[Pro]
[Pro]
Stemmen
Telephone 1
Telephone 2
DoorCreaking
Door
Scratch
Wind Chimes
Scratch 2
ScratchKey
TapeRewind
Phono Noise
MC-500 Beep
---------------------
+
+
+
+
1
1
1
1
1
+
+
+
+
+
+
+
+
+
[88]
[88]
[88]
[88]
+
+
+
+
+
+
+
+
+
185
3&
&&
SURJUDPQXPPHU,QVWUXPHQWQXPPHU
ZDDUGHYDQFRQWUROHQXPPHU
%DQNQXPPHU9DULDWLRQQXPPHU
OHJDWRNODQNHQV
6WHPPHQ
DDQWDOVWHPPHQGLHKHW,QVWUXPHQWJHEUXLNW
2SPHUNLQJ>@]HOIGHNODQNDOV6&PDS
2SPHUNLQJ>@]HOIGHNODQNDOV6&PDS
2SPHUNLQJHHQSHUFXVVLHNODQNGLHQLHWPHORGLVFKHJHVSHHOGNDQ
ZRUGHQ*HEUXLN&QRRWQXPPHU
Bijlagen
SC-55 Map (CM-64 Klankmap)
CM-64 (PCM)
PC
CC00 Instrument
001
002
003
004
005
006
007
008
009
010
011
012
013
014
015
016
017
018
019
020
021
022
023
024
025
026
027
028
029
030
031
032
033
034
035
036
037
038
039
040
041
042
043
044
045
046
047
048
049
050
051
052
053
054
055
056
057
058
059
060
061
062
063
064
126
126
126
126
126
126
126
126
126
126
126
126
126
126
126
126
126
126
126
126
126
126
126
126
126
126
126
126
126
126
126
126
126
126
126
126
126
126
126
126
126
126
126
126
126
126
126
126
126
126
126
126
126
126
126
126
126
126
126
126
126
126
126
126
186
Piano 2
Piano 2
Piano 2
Honky-tonk
Piano 1
Piano 2
Piano 2
E.Piano 1
Detuned EP1
E.Piano 2
Steel Gt.
Steel Gt.
12-str.Gt
Funk Gt.
Muted Gt.
Slap Bass 1
Slap Bass 1
Slap Bass 1
Slap Bass 1
Slap Bass 2
Slap Bass 2
Slap Bass 2
Slap Bass 2
Fingered Bs
Fingered Bs
Picked Bass
Picked Bass
Fretless Bs
Acoustic Bs
Choir Aahs
Choir Aahs
Choir Aahs
Choir Aahs
SlowStrings
Strings
SynStrings3
SynStrings3
Organ 1
Organ 1
Organ 1
Organ 2
Organ 1
Organ 1
Organ 2
Organ 2
Organ 2
Trumpet
Trumpet
Trombone
Trombone
Trombone
Trombone
Trombone
Trombone
Alto Sax
Tenor Sax
BaritoneSax
Alto Sax
Brass 1
Brass 1
Brass 2
Brass 2
Brass 1
Orchest.Hit
CM-64 (LA)
Stemmen
PC
CC00 Instrument
1
1
1
2
1
1
1
1
2
1
1
1
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
2
2
1
2
001
002
003
004
005
006
007
008
009
010
011
012
013
014
015
016
017
018
019
020
021
022
023
024
025
026
027
028
029
030
031
032
033
034
035
036
037
038
039
040
041
042
043
044
045
046
047
048
049
050
051
052
053
054
055
056
057
058
059
060
061
062
063
064
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
Acou Piano1
Acou Piano2
Acou Piano3
Elec Piano1
Elec Piano2
Elec Piano3
Elec Piano4
Honkytonk
Elec Org 1
Elec Org 2
Elec Org 3
Elec Org 4
Pipe Org 1
Pipe Org 2
Pipe Org 3
Accordion
Harpsi 1
Harpsi 2
Harpsi 3
Clavi 1
Clavi 2
Clavi 3
Celesta 1
Celesta 2
Syn Brass 1
Syn Brass 2
Syn Brass 3
Syn Brass 4
Syn Bass 1
Syn Bass 2
Syn Bass 3
Syn Bass 4
Fantasy
Harmo Pan
Chorale
Glasses
Soundtrack
Atmosphere
Warm Bell
Funny Vox
Echo Bell
Ice Rain
Oboe 2001
Echo Pan
Doctor Solo
School Daze
Bellsinger
Square Wave
Str Sect 1
Str Sect 2
Str Sect 3
Pizzicato
Violin 1
Violin 2
Cello 1
Cello 2
Contrabass
Harp 1
Harp 2
Guitar 1
Guitar 2
Elec Gtr 1
Elec Gtr 2
Sitar
Stemmen
PC
CC00 Instrument
1
1
1
1
1
1
1
2
1
2
1
1
2
2
2
2
1
2
1
1
1
1
1
1
2
2
2
2
1
2
2
1
2
2
1
2
2
2
2
1
2
2
2
2
2
1
1
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
2
065
066
067
068
069
070
071
072
073
074
075
076
077
078
079
080
081
082
083
084
085
086
087
088
089
090
091
092
093
094
095
096
097
098
099
100
101
102
103
104
105
106
107
108
109
110
111
112
113
114
115
116
117
118
119
120
121
122
123
124
125
126
127
128
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
127
Acou Bass 1
Acou Bass 2
Elec Bass 1
Elec Bass 2
Slap Bass 1
Slap Bass 2
Fretless 1
Fretless 2
Flute 1
Flute 2
Piccolo 1
Piccolo 2
Recorder
Pan Pipes
Sax 1
Sax 2
Sax 3
Sax 4
Clarinet 1
Clarinet 2
Oboe
Engl Horn
Bassoon
Harmonica
Trumpet 1
Trumpet 2
Trombone 1
Trombone 2
Fr Horn 1
Fr Horn 2
Tuba
Brs Sect 1
Brs Sect 2
Vibe 1
Vibe 2
Syn Mallet
Windbell
Glock
Tube Bell
Xylophone
Marimba
Koto
Sho
Shakuhachi
Whistle 1
Whistle 2
Bottleblow
Breathpipe
Timpani
Melodic Tom
Deep Snare
Elec Perc 1
Elec Perc 2
Taiko
Taiko Rim
Cymbal
Castanets
Triangle
Orche Hit
Telephone
Bird Tweet
OneNote Jam
Water Bell
Jungle Tune
Stemmen
1
1
1
1
1
1
1
1
1
1
1
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
2
2
2
2
1
1
2
1
1
1
2
1
1
1
1
1
2
2
2
1
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
2
2
+
+
+
+
+
+
+
+
+
Bijlagen
Drumsetlijst
'HGUXPVHWVYDQGLWWRHVWHO]LMQDOVYROJWJHRUJDQLVHHUG
'H6&PDSKHHIWVRRUWHQGH6&3URPDSGH6&PDSHQGH6&PDSKHHIWVRRUWHQ
3&
6&PDS
6&3URPDS
6&PDS
67$1'$5'
67$1'$5'
67$1'$5'/5
67$1'$5'
5220
5220
+,3+23
-81*/(
7(&+12
7(&+12
5220/5
+286(
32:(5
>3UR@
32:(5
32:(5
32:(5
(/(&7521,&
>3UR@
(/(&7521,&
(/(&7521,&
(/(&7521,&
75
>3UR@
75
75
75
'$1&(
'$1&(
'$1&(
&5
>3UR@
&5
75
>3UR@
75
75
>3UR@
75
75
>3UR@
75
-$==
-$==
-$==
-$==
-$==/5
%586+
%586+
%586+
%586+
%586+
%586+/5
25&+(675$
>3UR@
25&+(675$
>@
25&+(675$
25&+(675$
(7+1,&
>3UR@
(7+1,&
>@
(7+1,&
.,&.61$5(
>3UR@
.,&.61$5(
>@
.,&.61$5(
.,&.61$5(
$6,$
$6,$
&<0%$/&/$36
*$0(/$1
*$0(/$1
6);
>3UR@
6);
6);
6);
5+<7+0);
>3UR@
5+<7+0);
5+<7+0);
5+<7+0);
>3UR@
5+<7+0);
5+<7+0);
6);
92,&(
&<0&/$36
&0/
67$1'$5'
>3UR@
>3UR@
>3UR@
6&PDS
67$1'$5'
67$1'$5'
>@
67$1'$5'
>@
5220
5220
+,3+23
-81*/(
67$1'$5'
>@
&<0%$/&/$36
>@
3&
3URJUDPQXPPHU'UXPVHWQXPPHU
>@ =HOIGHDOVGH6&PDSGUXPVHWV
>3UR@ =HOIGHDOVGH6&3URPDSGUXPVHWV
.ODQNHQLQGHGUXPVHWV67$1'$5'/5HQ67$1'$5'HQJHOLMNDDUGLJHGLHLQGHOLMVWRSGHYROJHQGHSDJLQDKHWDFKWHUYRHJVHO´51'µDFKWHU
KXQQDDPKHEEHQ]RDOV.LFN6QDUHHQ+L+DW]LMQNODQNHQGLHZLOOHNHXULJ]XOOHQYHUDQGHUHQDOVHUHHQQRRWZRUGWJHVSHHOGGH]HYHUDQGHULQJHQ
EHwQYORHGHQKHWWLPEUHHQGHWLPLQJ'LWKHHIWDOVGRHORPHHQQDWXXUOLMNHUNOLQNHQGHXLWYRHULQJWHYHUNULMJHQ]HOIVZDQQHHUDOOHQRRWFRPPDQGR·V
YRRUSHUFXVVLHLQVWUXPHQWHQPHWHHQDEVROXWHSUHFLVLHZRUGHQYHUVWXXUGZRUGHQHUVXEWLHOHVFKRPPHOLQJHQWRHJHSDVW]RGDWGHXLWYRHULQJPLQGHU
PHFKDQLVFKNOLQNW0HUNHFKWHURSGDWKHWDOQDDUJHODQJGHRPVWDQGLJKHGHQQLHWDOWLMGPRJHOLMNLVRPKHWJHZHQVWHHIIHFWWHEHUHLNHQ
187
>3UR@
>@
>@
>(;&@
Bijlagen
=HOIGHDOVGHSHUFXVVLHNODQNYDQ6&
=HOIGHDOVGHSHUFXVVLHNODQNYDQ6&
=HOIGHDOVGHSHUFXVVLHNODQNYDQ6&
3HUFXVVLHNODQNPHWKHW]HOIGHQXPPHU
NDQQLHWWHJHOLMNHUWLMGJHKRRUGZRUGHQ
3& 3URJUDPQXPPHU'UXPVHWQXPPHU
² =HOIGHDOVGHSHUFXVVLHNODQNYDQ
67$1'$5'3&
*HHQNODQN
7RQHQGLHPHWWZHHVWHPPHQ]LMQJHPDDNW
SC-8850 Drum Set (1)
=LHSYRRUGHWDLOVRYHU²HQ²
22
23
C1 24
25
26
28
29
27
30
31
32
33
34
35
C2 36
37
38
40
41
39
42
43
44
45
46
47
C3 48
49
50
52
53
51
54
55
56
57
58
59
C4 60
61
62
64
65
63
66
67
68
69
70
71
C5 72
73
74
76
77
75
78
79
80
81
82
83
C6 84
85
86
88
89
87
90
91
92
93
94
95
C7 96
188
PC1
STANDARD 1
MC-500 Beep 1
MC-500 Beep 2
Concert SD
Snare Roll
Finger Snap 2
High Q
Slap
Scratch Push
Scratch Pull
Sticks
Square Click
Metronome Click
Metronome Bell
Standard 1 Kick 2
Standard 1 Kick 1
Side Stick
Standard 1 Snare 1
TR-909 Hand Clap
Standard 1 Snare 2
Low Tom 2
Closed Hi-Hat 1
Low Tom 1
Pedal Hi-Hat
Mid Tom 2
Open Hi-Hat 1
Mid Tom 1
High Tom 2
Crash Cymbal 1
High Tom 1
Ride Cymbal 1
Chinese Cymbal
Ride Bell
Tambourine
Splash Cymbal
Cowbell
Crash Cymbal 2
Vibra-slap
Ride Cymbal 2
High Bongo
Low Bongo
Mute High Conga
Open High Conga
Low Conga
High Timbale
Low Timbale
High Agogo
Low Agogo
Cabasa
Maracas
Short High Whistle
Long Low Whistle
Short Guiro
Long Guiro
Claves
High Wood Block
Low Wood Block
Mute Cuica
Open Cuica
Mute Triangle
Open Triangle
Shaker
Jingle Bell
Bell Tree
Castanets
Mute Surdo
Open Surdo
Applause 2
------------Room Snare 1
Room Snare 2
[EXC7]
[EXC7]
*
*
*
[EXC1]
[EXC1]
[EXC1]
*
[EXC2]
[EXC2]
[EXC3]
[EXC3]
[EXC4]
[EXC4]
[EXC5]
[EXC5]
[EXC6]
[EXC6]
*
PC2
STANDARD 2
<–
<–
<–
<–
Finger Snap
<–
<–
<–
<–
<–
<–
<–
<–
Standard 2 Kick 2
Standard 2 Kick 1
<–
Standard 2 Snare 1
Hand Clap
Standard 2 Snare 2
<–
Closed Hi-Hat
<–
Pedal Hi-Hat
<–
Open Hi-Hat
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
Bar Chimes
<–
<–
<–
<–
-----------------
[ Pro ]
[EXC1]
[EXC1]
[EXC1]
PC3
STANDARD L/R
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
[RND] Standard Kick 2
[RND] Standard Kick 1
<–
[RND] Standard Snare 1
<–
[RND] Standard Snare 2
[RND] Low Tom 2
[RND] Closed Hi-Hat
[RND] Low Tom 1
<–
[RND] Mid Tom 2
[RND] Open Hi-Hat
[RND] Mid Tom 1
[RND] High Tom 2
[RND] Crash Cymbal
[RND] High Tom 1
[RND] Ride Cymbal 1
<–
[RND] Ride Bell 1
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
------------[L] Standard Kick 2
[L] Standard Kick 1
[EXC1]
[EXC1]
[EXC1]
*
*
PC9
ROOM
<–
<–
<–
<–
Finger Snap
<–
<–
<–
<–
<–
<–
<–
<–
Room Kick 2
Room Kick 1
<–
Room Snare 1
Hand Clap
Room Snare 2
Room Low Tom 2
Room Closed Hi-Hat 3
Room Low Tom 1
Pedal Hi-Hat
Room Mid Tom 2
Room Open Hi-Hat 3
Room Mid Tom 1
Room High Tom 2
Room Crash Cymbal
Room High Tom 1
Room Ride Cymbal
<–
Room Ride Bell
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
------------Standard 1 Snare 1
Standard 1 Snare 2
*
*
[EXC1]
*
[EXC1]
*
[EXC1]
*
*
*
*
PC10
HIP HOP
<–
<–
<–
<–
<–
<–
<–
Scratch Push 2
Scratch Pull 2
<–
<–
<–
<–
Hip-Hop Kick 2
Hip-Hop Kick 1
TR-808 Rim Shot
LoFi Snare 1
TR-707 Claps
LoFi Snare 2
Jazz Low Tom 2
Room Closed Hi-Hat
Jazz Low Tom 1
Pedal Hi-Hat
Jazz Mid Tom 2
Room Open Hi-Hat
Jazz Mid Tom 1
Jazz High Tom 2
TR-909 Crash Cymbal
Jazz High Tom 1
<–
Reverse Cymbal
Ride Bell
Shake Tambourine
<–
TR-808 Cowbell
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
TR-808 Maracas
<–
<–
<–
CR-78 Guiro
TR-808 Claves
<–
<–
High Hoo
Low Hoo
Electric Mute Triangle
Electric Open Triangle
Shaker 2
<–
<–
<–
<–
<–
Small Club 1
Hip-Hop Snare 2
LoFi Snare Rim
Hip-Hop Claps
Stantard 1 Snare 1
Standard 1 Snare 2
Room Snare 1
Room Snare 2
Dance Snare
[EXC7]
[EXC7]
[EXC1]
[EXC1]
[EXC1]
[EXC3]
[EXC4]
[EXC4]
[EXC5]
[EXC5]
[EXC6]
[EXC6]
*
Bijlagen
SC-8850 Drum Set (2)
=LHSYRRUGHWDLOVRYHU²HQ²
22
23
C1 24
25
26
28
29
27
30
31
32
33
34
35
C2 36
37
38
40
41
39
42
43
44
45
46
47
C3 48
49
50
52
53
51
54
55
56
57
58
59
C4 60
61
62
64
65
63
66
67
68
69
70
71
C5 72
73
74
76
77
75
78
79
80
81
82
83
C6 84
85
86
88
89
87
90
91
92
93
94
95
C7 96
PC 11
JUNGLE
<–
<–
<–
<–
<–
<–
<–
Scratch Push 2
Scratch Pull 2
<–
<–
<–
<–
Jungle Kick 2
Jungle Kick 1
Jungle Snare Rim
HipHop Snare 1
R&B Claps
Jungle Snare
TR-909 Low Tom 2
TR-606 Closed Hi-Hat
TR-909 Low Tom 1
Jungle Hi-Hat
TR-909 Mid Tom 2
TR-606 Open Hi-Hat
TR-909 Mid Tom 1
TR-909 High Tom 2
Jungle Crash
TR-909 High Tom 1
Ride Cymbal 1
Reverse Cymbal
Ride Bell
Shake Tambourine
<–
TR-808 Cowbell
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
TR-808 Maracas
<–
<–
<–
CR-78 Guiro
TR-808 Claves
<–
<–
High Hoo
Low Hoo
Electric Mute Triangle
Electric Open Triangle
Jungle Shaker
<–
<–
<–
<–
<–
Small Club 1
Jungle Kick Roll
Jungle Snare Roll
TR-606 Snare 2
Dance Snare
Techno Snare
House Snare
Rock Snare Dry
LoFi Snare 1
[EXC7]
[EXC7]
[EXC1]
[EXC1]
[EXC1]
[EXC3]
[EXC4]
[EXC4]
[EXC5]
[EXC5]
*
PC 12
TECHNO
<–
<–
<–
<–
<–
<–
<–
Scratch Push 2
Scratch Pull 2
<–
<–
<–
<–
TR-808 Kick
TR-909 Kick 1
TR-909 Snare Rim
TR-606 Snare 2
TR-909 Claps
Techno Snare
TR-606 Low Tom 2
TR-707 Closed Hi-Hat
TR-606 Low Tom 1
CR-78 Closed Hi-Hat
TR-606 Mid Tom 2
TR-909 Open Hi-Hat
TR-606 Mid Tom 1
TR-606 High Tom 2
TR-909 Crash Cymbal
TR-606 High Tom 1
Ride Cymbal 1
Reverse Cymbal
Ride Bell
Shake Tambourine
<–
TR-808 Cowbell
TR-909 Crash Cymbal
<–
<–
CR-78 High Bongo
CR-78 Low Bongo
TR-808 High Conga
TR-808 Mute Conga
TR-808 Low Conga
<–
<–
<–
<–
<–
TR-808 Maracas
<–
<–
<–
CR-78 Guiro
TR-808 Claves
<–
<–
High Hoo
Low Hoo
Electric Mute Triangle
Electric Open Triangle
TR-626 Shaker
<–
<–
<–
<–
<–
<–
Dance Snare
House Snare
Rock Snare Dry
Jungle Snare
LoFi Snare 1
LoFi Snare 2
HipHop Snare 1
HipHop Snare 2
[EXC7]
[EXC7]
[EXC1]
[EXC1]
[EXC1]
[EXC3]
[EXC4]
[EXC4]
[EXC5]
[EXC5]
PC 13
ROOM L/R
<–
<–
<–
<–
Finger Snap
<–
<–
<–
<–
<–
<–
<–
<–
[RND] Room Kick 2
[RND] Room Kick 1
<–
[RND] Room Snare 1
Hand Clap
[RND] Room Snare 2
Room Low Tom 2
[RND] Room Closed Hi-Hat
Room Low Tom 1
Pedal Hi-Hat
Room Mid Tom 2
[RND] Room Open Hi-Hat
Room Mid Tom 1
Room High Tom 2
[RND] Room Crash Cymbal
Room High Tom 1
[RND] Room Ride Cymbal
<–
[RND] Room Ride Bell
<–
Splash Cymbal
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
------------[L] Room Kick 2
[L] Room Kick 1
[EXC7]
[EXC7]
[EXC1]
[EXC1]
[EXC1]
*
PC 14
HOUSE
<–
<–
<–
<–
<–
<–
<–
Scratch Push 2
Scratch Pull 2
<–
<–
<–
<–
TR-909 Kick 2
TR-909 Kick 1
House Snare Rim
House Snare 1
TR-909 Claps
House Snare 2
TR-909 Low Tom 2
Room Closed Hi-Hat
TR-909 Low Tom 1
Pedal Hi-Hat
TR-909 Mid Tom 2
Room Open Hi-Hat
TR-909 Mid Tom 1
TR-909 High Tom 2
TR-909 Crash Cymbal
TR-909 High Tom 1
TR-909 Ride Cymbal
Reverse Cymbal
Ride Bell
Shake Tambourine
<–
TR-808 Cowbell
TR-909 Crash Cymbal
<–
<–
CR-78 High Bongo
CR-78 Low Bongo
TR-808 High Conga
TR-808 Mute Conga
TR-808 Low Conga
<–
<–
<–
<–
<–
TR-808 Maracas
<–
<–
<–
CR-78 Guiro
TR-808 Claves
<–
<–
High Hoo
Low Hoo
Electric Mute Triangle
Electric Open Triangle
TR-626 Shaker
<–
<–
<–
<–
<–
Small Club 1
TR-606 Snare 2
Dance Snare
Techno Snare
Rock Snare Dry
Hip-Hop Snare 1
LoFi Snare 1
LoFi Snare 2
Jungle Snare
[EXC7]
[EXC7]
[EXC1]
[EXC1]
[EXC1]
[EXC3]
[EXC4]
[EXC4]
[EXC5]
[EXC5]
PC 17
POWER
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
Power Kick 2
Power Kick 1
<–
Power Snare 1
Hand Clap
Power Snare 2
Power Low Tom 2
<–
Power Low Tom 1
<–
Power Mid Tom 2
<–
Power Mid Tom 1
Power High Tom 2
<–
Power High Tom 1
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
-----------------
[ Pro ]
[EXC7]
[EXC7]
*
*
*
*
*
*
189
>3UR@
>@
>@
>(;&@
Bijlagen
=HOIGHDOVGHSHUFXVVLHNODQNYDQ6&
=HOIGHDOVGHSHUFXVVLHNODQNYDQ6&
=HOIGHDOVGHSHUFXVVLHNODQNYDQ6&
3HUFXVVLHNODQNPHWKHW]HOIGHQXPPHU
NDQQLHWWHJHOLMNHUWLMGJHKRRUGZRUGHQ
3& 3URJUDPQXPPHU'UXPVHWQXPPHU
² =HOIGHDOVGHSHUFXVVLHNODQNYDQ
67$1'$5'3&
*HHQNODQN
7RQHQGLHPHWWZHHVWHPPHQ]LMQJHPDDNW
SC-8850 Drum Set (3)
=LHSHQSYRRUGHWDLOVRYHU²HQ²
22
23
C1 24
25
26
28
29
27
30
31
32
33
34
35
C2 36
37
38
40
41
39
42
43
44
45
46
47
C3 48
49
50
52
53
51
54
55
56
57
58
59
C4 60
61
62
64
65
63
66
67
68
69
70
71
C5 72
73
74
76
77
75
78
79
80
81
82
83
C6 84
85
86
88
89
87
90
91
92
93
94
95
C7 96
190
PC 25
ELECTRONIC
<–
<–
<–
<–
Finger Snap 2
<–
<–
Scratch Push 2
Scratch Pull 2
<–
<–
<–
<–
Electric Kick 2
Electric Kick 1
<–
Electric Snare 1
Hand Clap
Electric Snare 2
Electric Low Tom 2
Closed Hi-Hat 2
Electric Low Tom 1
Pedal Hi-Hat
Electric Mid Tom 2
Open Hi-Hat 2
Electric Mid Tom 1
Electric High Tom 2
<–
Electric High Tom 1
<–
Reverse Cymbal
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
Small Club 1
-----------------
PC 26
[ Pro ] TR-808
<–
<–
<–
<–
<–
<–
<–
[EXC7] Scratch Push 2
[EXC7] Scratch Pull 2
<–
<–
<–
<–
TR-808 Kick 2
*
TR-808 Kick 1
TR-808 Rim Shot
TR-808 Snare 1
Hand Clap
TR-808 Snare 2
*
TR-808 Low Tom 2
[EXC1] TR-808 Closed Hi-Hat 2
*
TR-808 Low Tom 1
[EXC1] TR-808 Closed Hi-Hat
*
TR-808 Mid Tom 2
[EXC1] TR-808 Open Hi-Hat
*
TR-808 Mid Tom 1
*
TR-808 High Tom 2
TR-808 Crash Cymbal
*
TR-808 High Tom 1
TR-606 Ride Cymbal
<–
<–
CR-78 Tambourine
<–
TR-808 Cowbell
TR-909 Crash Cymbal
<–
Ride Cymbal 2
CR-78 High Bongo
CR-78 Low Bongo
TR-808 High Conga
TR-808 Mute Conga
TR-808 Low Conga
<–
<–
<–
<–
<–
TR-808 Maracas
<–
<–
<–
CR-78 Guiro
TR-808 Claves
<–
<–
High Hoo
Low Hoo
Electric Mute Triangle
Electric Open Triangle
TR-626 Shaker
<–
<–
<–
<–
<–
*
Small Club 1
-----------------
PC 27
[ Pro ] DANCE
<–
<–
<–
<–
Finger Snap 2
<–
<–
[EXC7] Scratch Push 2
[EXC7] Scratch Pull 2
<–
<–
<–
<–
Fat Kick
Dance Kick
Dance Rim Shot
Dance Snare
Comp Claps 2
Rock SD Dry
*
Electric Low Tom 2
[EXC1] CR-78 Closed Hi-Hat
*
Electric Low Tom 1
[EXC1] TR-808 Closed Hi-Hat 2
*
Electric Mid Tom 2
[EXC1] CR-78 Open Hi-Hat
*
Electric Mid Tom 1
*
Electric High Tom 2
TR-808 Crash Cymbal
*
Electric High Tom 1
TR-606 Ride Cymbal
Reverse Cymbal
Ride Bell
Shake Tambourine
<–
TR-808 Cowbell
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
[EXC3] <–
<–
<–
<–
[EXC4] High Hoo
[EXC4] Low Hoo
Electric Mute Triangle
Electric Open Triangle
TR-626 Shaker
<–
<–
<–
<–
<–
*
Small Club 1
TR-606 Snare 2
Techno Snare
House Snare
Jungle Snare
LoFi Snare 1
LoFi Snare 2
HipHop Snare 1
Hip-Hop Snare 2
[EXC7]
[EXC7]
*
[EXC1]
*
[EXC1]
*
[EXC1]
*
*
*
[EXC4]
[EXC4]
[EXC5]
[EXC5]
*
PC 28
CR-78
<–
<–
<–
<–
<–
<–
<–
Scratch Push 2
Scratch Pull 2
<–
<–
<–
<–
CR-78 Kick 2
CR-78 Kick 1
CR-78 Rim Shot
CR-78 Snare 1
TR-707 Hand Clap
CR-78 Snare 2
CR-78 Low Tom 2
CR-78 Closed Hi-Hat
CR-78 Low Tom 1
TR-606 Closed Hi-Hat
CR-78 Mid Tom 2
CR-78 Open Hi-Hat
CR-78 Mid Tom 1
CR-78 High Tom 2
TR-808 Crash Cymbal
CR-78 High Tom 1
TR-606 Ride Cymbal
<–
<–
CR-78 Tambourine
<–
CR-78 Cowbell
TR-909 Crash Cymbal
<–
Ride Cymbal Edge
CR-78 High Bongo
CR-78 Low Bongo
TR-808 High Conga
TR-808 Mute Conga
TR-808 Low Conga
<–
<–
<–
<–
<–
CR-78 Maracas
<–
<–
<–
CR-78 Guiro
CR-78 Claves
<–
<–
High Hoo
Low Hoo
CR-78 Metalic Beat 1
CR-78 Metalic Beat 2
TR-626 Shaker
<–
<–
<–
<–
<–
Small Club 1
-----------------
[ Pro ]
[EXC7]
[EXC7]
*
[EXC1]
*
[EXC1]
*
[EXC1]
*
*
*
[EXC3]
[EXC4]
[EXC4]
[EXC5]
[EXC5]
*
PC 29
TR-606
<–
<–
<–
<–
<–
<–
<–
Scratch Push 2
Scratch Pull 2
<–
<–
<–
<–
CR-78 Kick 2
TR-606 Kick 1
CR-78 Rim Shot
TR-606 Snare 1
TR-707 Hand Clap
TR-606 Snare 2
TR-606 Low Tom 2
TR-606 Closed Hi-Hat
TR-606 Low Tom 1
TR-606 Closed Hi-Hat
TR-606 Mid Tom 2
TR-606 Open Hi-Hat
TR-606 Mid Tom 1
TR-606 High Tom 2
TR-808 Crash Cymbal
TR-606 High Tom 1
TR-606 Ride Cymbal
<–
<–
CR-78 Tambourine
<–
CR-78 Cowbell
TR-909 Crash Cymbal
<–
Ride Cymbal Edge
CR-78 High Bongo
CR-78 Low Bongo
TR-808 High Conga
TR-808 Mute Conga
TR-808 Low Conga
<–
<–
<–
<–
<–
CR-78 Maracas
<–
<–
<–
CR-78 Guiro
CR-78 Claves
<–
<–
High Hoo
Low Hoo
CR-78 Metalic Beat 1
CR-78 Metalic Beat 2
TR-626 Shaker
<–
<–
<–
<–
<–
Small Club 1
-----------------
[ Pro]
[EXC7]
[EXC7]
[EXC1]
[EXC1]
[EXC1]
[EXC3]
[EXC4]
[EXC4]
[EXC5]
[EXC5]
*
Bijlagen
SC-8850 Drum Set (4)
=LHSYRRUGHWDLOVRYHU²HQ²
22
23
C1 24
25
26
28
29
27
30
31
32
33
34
35
C2 36
37
38
40
41
39
42
43
44
45
46
47
C3 48
49
50
52
53
51
54
55
56
57
58
59
C4 60
61
62
64
65
63
66
67
68
69
70
71
C5 72
73
74
76
77
75
78
79
80
81
82
83
C6 84
85
86
88
89
87
90
91
92
93
94
95
C7 96
PC 30
TR-707
<–
<–
<–
<–
<–
<–
<–
Scratch Push 2
Scratch Pull 2
<–
<–
<–
<–
TR-707 Kick 2
TR-707 Kick 1
TR-707 Rim Shot
TR-707 Snare 1
TR-707 Hand Clap
TR-707 Snare 2
TR-707 Low Tom 2
TR-707 Closed Hi-Hat
TR-707 Low Tom 1
TR-707 Closed Hi-Hat
TR-707 Mid Tom 2
TR-707 Open Hi-Hat
TR-707 Mid Tom 1
TR-707 High Tom 2
TR-909 Crash Cymbal
TR-707 High Tom 1
TR-909 Ride Cymbal
<–
<–
Tambourine 2
<–
TR-808 Cowbell
<–
<–
Ride Cymbal Edge
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
TR-808 Maracas
<–
<–
<–
<–
<–
<–
<–
High Hoo
Low Hoo
Electric Mute Triangle
Electric Open Triangle
TR-626 Shaker
<–
<–
<–
<–
<–
Small Club 1
-----------------
[ Pro ]
[EXC7]
[EXC7]
*
[EXC1]
*
[EXC1]
*
[EXC1]
*
*
*
*
[EXC4]
[EXC4]
*
PC 31
TR-909
<–
<–
<–
<–
<–
<–
<–
Scratch Push 2
Scratch Pull 2
<–
<–
<–
<–
TR-909 Kick 2
TR-909 Kick 1
TR-909 Rim
TR-909 Snare 1
<–
TR-909 Snare2
TR-909 Low Tom 2
TR-707 Closed Hi-Hat
TR-909 Low Tom 1
TR-707 Closed Hi-Hat
TR-909 Mid Tom 2
TR-909 Open Hi-Hat
TR-909 Mid Tom 1
TR-909 High Tom 2
TR-909 Crash Cymbal
TR-909 High Tom 1
TR-909 Ride Cymbal
<–
<–
Tambourine 2
<–
TR-808 Cowbell
<–
<–
Ride Cymbal Edge
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
TR-808 Maracas
<–
<–
<–
CR-78 Guiro
TR-808 Claves
<–
<–
High Hoo
Low Hoo
Electric Mute Triangle
Electric Open Triangle
TR-626 Shaker
<–
<–
<–
<–
<–
<–
-----------------
[ Pro ]
[EXC7]
[EXC7]
*
[EXC1]
[EXC1]
[EXC1]
*
[EXC3]
[EXC4]
[EXC4]
PC 33
JAZZ
<–
<–
<–
<–
Finger Snap 2
<–
<–
<–
<–
<–
<–
<–
<–
Jazz Kick 2
Jazz Kick 1
<–
Jazz Snare 1
Hand Clap 2
Jazz Snare 2
Jazz Low Tom 2
Closed Hi-Hat 2
Jazz Low Tom 1
Pedal Hi-Hat
Jazz Mid Tom 2
Open Hi-Hat 2
Jazz Mid Tom 1
Jazz High Tom 2
Jazz Crash Cymbal
Jazz High Tom 1
Jazz Ride Cymbal
<–
Jazz Ride Bell
<–
<–
<–
<–
<–
Ride Cymbal Edge
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
Applause
-----------------
[EXC1]
[EXC1]
[EXC1]
*
PC 34
JAZZ L/R
<–
<–
<–
<–
Finger Snap 2
<–
<–
<–
<–
<–
<–
<–
<–
[RND] Jazz Kick 2
[RND] Jazz Kick 1
<–
[RND] Jazz Snare 1
Hand Clap 2
[RND] Jazz Snare 2
[RND] Jazz Low Tom 2
[RND] Jazz Closed Hi-Hat [EXC1]
[RND] Jazz Low Tom 1
Pedal Hi-Hat
[EXC1]
[RND] Jazz Mid Tom 2
[RND] Jazz Open Hi-Hat [EXC1]
[RND] Jazz Mid Tom 1
[RND] Jazz High Tom 2
[RND] Jazz Crash Cymbal
[RND] Jazz High Tom 1
[RND] JAZZ Ride Cymbal
<–
[RND] Jazz Ride Bell
<–
<–
<–
<–
<–
Ride Cymbal Edge
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
Applause
------------[L] Jazz Kick 2
[L] Jazz Kick 1
PC 41
BRUSH
<–
<–
<–
<–
Finger Snap 2
<–
<–
<–
<–
<–
<–
<–
<–
Jazz Kick 2
Jazz Kick 1
<–
Brush Tap 1
Brush Slap 1
Brush Swirl 1
Brush Low Tom 2
Brush Closed Hi-Hat
Brush Low Tom 1
Pedal Hi-Hat
Brush Mid Tom 2
Brush Open Hi-Hat
Brush Mid Tom 1
Brush High Tom 2
Brush Crash Cymbal
Brush High Tom 1
Ride Cymbal Inner
<–
Brush Ride Bell
<–
<–
<–
<–
<–
Ride Cymbal Edge
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
Applause
-----------------
[ Pro ]
*
[EXC1]
*
[EXC1]
*
[EXC1]
*
*
*
*
191
>3UR@
>@
>@
>(;&@
Bijlagen
=HOIGHDOVGHSHUFXVVLHNODQNYDQ6&
=HOIGHDOVGHSHUFXVVLHNODQNYDQ6&
=HOIGHDOVGHSHUFXVVLHNODQNYDQ6&
3HUFXVVLHNODQNPHWKHW]HOIGHQXPPHU
NDQQLHWWHJHOLMNHUWLMGJHKRRUGZRUGHQ
3& 3URJUDPQXPPHU'UXPVHWQXPPHU
² =HOIGHDOVGHSHUFXVVLHNODQNYDQ
67$1'$5'3&
*HHQNODQN
7RQHQGLHPHWWZHHVWHPPHQ]LMQJHPDDNW
SC-8850 Drum Set (5)
=LHSYRRUGHWDLOVRYHU²HQ²
22
23
C1 24
25
26
28
29
27
30
31
32
33
34
35
C2 36
37
38
40
41
39
42
43
44
45
46
47
C3 48
49
50
52
53
51
54
55
56
57
58
59
C4 60
61
62
64
65
63
66
67
68
69
70
71
C5 72
73
74
76
77
75
78
79
80
81
82
83
C6 84
85
86
88
89
87
90
91
92
93
94
95
C7 96
192
PC 42
BRUSH 2
<–
<–
<–
<–
Finger Snap 2
<–
<–
<–
<–
<–
<–
<–
<–
Brush Kick 2
Brush Kick 1
<–
Brush Tap 2
Brush Slap 2
Brush Swirl 1
Brush Low Tom 2
Brush Closed Hi-Hat
Brush Low Tom 1
Pedal Hi-Hat
Brush Mid Tom 2
Brush Open Hi-Hat
Brush Mid Tom 1
Brush High Tom 2
Brush Crash Cymbal
Brush High Tom 1
Brush Ride Cymbal
<–
Brush Ride Bell
<–
<–
<–
<–
<–
Ride Cymbal Edge
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
Applause
-----------------
*
[EXC1]
[EXC1]
[EXC1]
PC 43
BRUSH 2 L/R
<–
<–
<–
<–
Finger Snap 2
<–
<–
<–
<–
<–
<–
<–
<–
[RND] Brush Kick 2
[RND] Brush Kick 1
<–
[RND] Brush Tap 2
[RND] Brush Slap 2
Brush Swirl 1
[RND] Brush Low Tom 2
[RND] Brush Closed Hi-Hat
[RND] Brush Low Tom 1
Pedal Hi-Hat
[RND] Brush Mid Tom 2
[RND] Brush Open Hi-Hat
[RND] Brush Mid Tom 1
[RND] Brush High Tom 2
[RND] Brush Crash Cymbal
[RND] Brush High Tom 1
[RND] Brush Ride Cymbal
<–
[RND] Brush Ride Bell
<–
<–
<–
<–
<–
Ride Cymbal Edge
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
Applause
------------[L] Brush Kick 2
[L] Brush Kick 1
[EXC1]
[EXC1]
[EXC1]
PC 49
ORCHESTRA
<–
<–
<–
<–
Finger Snap
Closed Hi-Hat 2
Pedal Hi-Hat
Open Hi-Hat 2
Ride Cymbal 1
<–
<–
<–
<–
Jazz Kick 1
Concert BD 1
<–
Concert SD
Castanets
Concert SD
Timpani F
Timpani F#
Timpani G
Timpani G#
Timpani A
Timpani A#
Timpani B
Timpani c
Timpani c#
Timpani d
Timpani d#
Timpani e
Timpani f
<–
<–
<–
Concert Cymbal 2
<–
Concert Cymbal 1
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
Applause
-----------------
[ Pro ]
[EXC1]
[EXC1]
[EXC1]
PC 50
ETHNIC
------Finger Snap
Tambourine
Castanets
Crash Cymbal 1
Snare Roll
Concert SD
Concert Cymbal
Concert BD 1
Jingle Bell
Bell Tree
Bar Chimes
Wadaiko
Wadaiko Rim
Shime Taiko
Atarigane
Hyoushigi
Ohkawa
High Kotsuzumi
Low Kotsuzumi
Ban Gu
Big Gong
Small Gong
Bend Gong
Thai Gong
Rama Cymbal
Gamelan Gong
Udo Short
Udo Long
Udo Slap
Bendir
Req Dum
Req Tik
Tabla Te
Tabla Na
Tabla Tun
Tabla Ge
Tabla Ge Hi
Talking Drum
Bend Talking Drum
Caxixi
Djembe
Djembe Rim
Timbales Low
Timbales Paila
Timbales High
Cowbell
High Bongo
Low Bongo
Mute High Conga
Open High Conga
Mute Low Conga
Conga Slap
Open Low Conga
Conga Slide
Mute Pandiero
Open Pandiero
Open Surdo
Mute Surdo
Tamborim
High Agogo
Low Agogo
Shaker
High Whistle
Low Whistle
Mute Cuica
Open Cuica
Mute Triangle
Open Triangle
Short Guiro
Long Guiro
Cabasa Up
Cabasa Down
[ Pro ]
*
*
[EXC1]
[EXC1]
*
*
*
[EXC2]
[EXC2]
[EXC3]
[EXC3]
[EXC4]
[EXC4]
[EXC5]
[EXC5]
[EXC6]
[EXC6]
PC 51
KICK & SNARE
------CR-78 Kick 1
CR-78 Kick 2
TR-606 Kick
TR-707 Kick
TR-808 Kick 1
TR-909 Kick 1
TR-909 Kick 2
Hip-Hop Kick 2
Hip-Hop Kick 1
Jungle Kick 2
Jungle Kick 1
Techno Kick 2
Techno KicK 1
Standard 1 Kick 2
Standard 1 Kick 1
[88] Standard 1 Kick 1
[88] Standard 1 Kick 2
[88] Standard 2 Kick 1
[88] Standard 2 Kick 2
[55] Kick Drum1
[55] Kick Drum 2
[88] Soft Kick
[88] Jazz Kick 1
[88] Jazz Kick 2
[55] Concert BD 1
[88] Room Kick 1
[88] Room Kick 2
[88] Power Kick1
[88] Power Kick2
[88] Electric Kick 2
[88] Electric Kick 1
[55] Electric Kick
[88] TR-808 Kick
[88] TR-909 Kick
[88] Dance Kick
[88] Standard 1 Snare 1
[88] Standard 1 Snare 2
[88] Standard 2 Snare 1
[88] Standard 2 Snare 2
[55] Tight Snare
[55] Concert Snare
[88] Jazz Snare 1
[88] Jazz Snare 2
[88] Room Snare 1
[88] Room Snare 2
[88] Power Snare 1
[88] Power Snare 2
[55] Gated Snare
[88] Dance Snare 1
[88] Dance Snare 2
[88] Disco Snare
[88] Electric Snare 2
[88] House Snare
[55] Electric Snare 1
[88] Electric Snare 3
[88] TR-808 Snare 1
[88] TR-808 Snare 2
[88] TR-909 Snare 1
[88] TR-909 Snare 2
[88] Brush Tap 1
[88] Brush Tap 2
[88] Brush Slap 1
[88] Brush Slap 2
[88] Brush Slap 3
[88] Brush Swirl 1
[88] Brush Swirl 2
[88] Brush Long Swirl
Standard 1 Snare 1
Standard 1 Snare 2
Standard 1 Snare 3
Rap Snare
Hip-Hop Snare 2
[ Pro ]
*
*
*
*
*
Bijlagen
SC-8850 Drum Set (6)
=LHSYRRUGHWDLOVRYHU²HQ²
22
23
C1 24
25
26
28
29
27
30
31
32
33
34
35
C2 36
37
38
40
41
39
42
43
44
45
46
47
C3 48
49
50
52
53
51
54
55
56
57
58
59
C4 60
61
62
64
65
63
66
67
68
69
70
71
C5 72
73
74
76
77
75
78
79
80
81
82
83
C6 84
85
86
88
89
87
90
91
92
93
94
95
C7 96
PC 52
KICK & SNARE 2
------[Pro] CR-78 Kick 1
[Pro] CR-78 Kick 2
[Pro] TR-606 Kick
[Pro] TR-707 Kick
[Pro] TR-808 Kick 1
[Pro] TR-909 Kick 1
[Pro] TR-909 Kick 2
[Pro] Hip-Hop Kick 2
[Pro] Hip-Hop Kick 1
[Pro] Jungle Kick 2
[Pro] Jungle Kick 1
[Pro] Techno Kick 2
[Pro] Techno Kick 1
[Pro] Standard 1 Kick 2
[Pro] Standard 1 Kick 1
Standard 1 Kick 2
Standard 1 Kick 1
Brush Kick 2
Brush Kick 1
Jazz Kick 2
Jazz Kick 1
Hip-Hop Kick 2
Hip-Hop Kick 1
Concert BD 1 Mute
[55] Concert BD 1
Room Kick 2
Room Kick 1
Jungle Kick 2
Jungle Kick 1
Jungle Kick Roll
Fat Kick
Dance Kick
TR-808 Kick
TR-909 Kick 2
TR-909 Kick 1
Standard 1 Snare 1
Standard 1 Snare 2
[88] Standard 2 Snare 1
[88] Standard 2 Snare 2
[55] Tight Snare
[55] Concert Snare
Jazz Snare 1
Jazz Snare 2
Room Snare 1
Room Snare 2
LoFi Snare 1
LoFi Snare 2
[55] Gated Snare
LoFi Snare Rim
[88] Dance Snare 2
HipHop Snare 1
HipHop Snare 2
Dance Snare
TR-606 Snare 2
Techno Snare
House Snare
Rock Snare Dry
Jungle Snare
Jungle Snare Roll
[88] Brush Tap 1
[88] Brush Tap 2
Brush Tap 2
Brush Slap 2
[88] Brush Slap 3
[88] Brush Swirl 1
[88] Brush Swirl 2
[88] Brush Long Swirl
[Pro] Standard 1 Snare 1
[Pro] Standard 1 Snare 2
[Pro] Standard 1 Snare 3
[Pro] Rap Snare
[Pro] Hip-Hop Snare 2
*
*
*
[EXC1]
[EXC1]
*
*
PC 53
ASIA
------Gamelan Gong 1
Gamelan Gong 2
Gamelan Gong 3
Gamelan Gong 4
Gamelan Gong 5
Gamelan Gong 6
Gamelan Gong 7
Gamelan Gong 8
Gamelan Gong 9
Gamelan Gong 10
Gender 1
Gender 2
Gender 3
Gender 4
Gender 5
Bonang 1
Bonang 2
Bonang 3
Bonang 4
Bonang 5
Rama Cymbal Low
Rama Cymbal High
Sagat Open
Sagat Closed
Jaws Harp
Wadaiko
Wadaiko Rim
Small Taiko
Shimetaiko
Atarigane
Hyoushigi
Ohkawa
High Kotsuzumi
Low Kotsuzumi
Yyoo Dude
Buk
Buk Rim
Gengari p
Gengari Mute Low
Gengari f
Gengari Mute High
Gengari Samll
Jang-Gu Che
Jang-Gu Kun
Jang-Gu Rim
Jing p
Jing f
Jing Mute
Asian Gong
Big Gong
Small Gong
Pai Ban
Ban Gu
Tang Gu
Tang Gu Mute
Shou Luo
Bend Gong
Hu Yin Luo Low
Hu Yin Luo Mid
Hu Yin Luo Mid 2
Hu Yin Luo High
Hu Yin Luo High 2
Nao Bo
Xiao Bo
Dholak 1
Dholak 2
-------------
[EXC7]
[EXC7]
*
*
[EXC1]
[EXC1]
[EXC2]
[EXC2]
[EXC3]
[EXC3] *
[EXC3]
[EXC4]
[EXC4]
*
*
[EXC5]
[EXC5]
[EXC6]
[EXC6]
PC 54
CYMBAL&CLAPS
--------------------Reverse Open Hi-Hat
Reverse Closed Hi-Hat 1
Reverse Closed Hi-Hat 2
Jungle Hi-Hat
[55] Closed Hi-Hat
[88] Closed Hi-Hat 2
[88] Closed Hi-Hat 3
Closed Hi-Hat 4
Closed Hi-Hat
TR-707 Closed Hi-Hat
TR-606 Closed Hi-Hat
[88] TR-808 Closed Hi-Hat
TR-808 Closed Hi-Hat
CR-78 Closed Hi-Hat
[55] Pedal Hi-Hat
[88] Pedal Hi-Hat
Pedal Hi-Hat
Half-Open Hi-Hat 1
Half-Open Hi-Hat 2
[55] Open Hi Hat
[88] Open Hi-Hat 2
[88] Open Hi-Hat 3
Open Hi-Hat 2
TR-909 Open Hi-Hat
TR-707 Open Hi-Hat
TR-606 Open Hi-Hat
[88] TR-808 Open Hi-Hat
TR-808 Open Hi-Hat
CR-78 Open Hi-Hat
Crash Cymbal 1
Crash Cymbal 2
Crash Cymbal 3
Brush Crash Cymbal
Hard Crash Cymbal
TR-909 Crash Cymbal
TR-808 Crash Cymbal
Mute Crash Cymbal 1
Mute Crash Cymbal 2
Reverse Crash Cymbal 1
Reverse Crash Cymbal 2
Reverse Crash Cymbal 3
Reverse TR-909 Crash Cymbal
[55] Splash Cymbal
Splash Cymbal
[88] Ride Bell
[88] Brush Ride Bell
[88] Ride Cymbal 1
[88] Ride Cymbal 2
[88] Brush Ride Cymbal
Ride Cymbal Low Inner
Ride Cymbal Mid Inner
Ride Cymbal High Inner
Ride Cymbal Low Edge
Ride Cymbal Mid Edge
Ride Cymbal High Edge
TR-606 Ride Cymbal
TR-808 Ride Cymbal
Chinese Cymbal
Chinese Cymbal 2
[55] Hand Clap
[88] Hand Clap 2
[88] Hand Clap
Hand Clap
Hand Clap 2
TR-707 Hand Clap
[ Pro ]
[EXC1]
[EXC1]
[EXC1]
[EXC1]
[EXC1]
[EXC1]
[EXC1]
[EXC1]
[EXC1]
[EXC1]
[EXC1]
[EXC1]
[EXC1]
[EXC1]
[EXC1]
[EXC1]
[EXC1]
[EXC1]
[EXC1]
[EXC1]
[EXC1]
[EXC1]
[EXC1]
[EXC1]
[EXC1]
[EXC1]
[EXC3]
[EXC4]
*
[EXC3]
[EXC4]
PC55
GAMELAN 1
----------------------------Kendang Wadon
Kendang Lanang
Bebarongan
Pelegongan
Kelontuk
Kelontuk Mute
Kelontuk Side
Gamelan Gong Wadon
Gamelan Gong Lanang
Ceng-Ceng
Kopyak Open
Kopyak Mute
Kajar
Kempur
Jegogan
Jegogan
Jegogan
Jegogan
Jegogan
Jublag
Jublag
Jublag
Jublag
Jublag
Penyacah
Penyacah
Penyacah
Penyacah
Penyacah
Penyacah
Penyacah
Pemade
Pemade
Pemade
Pemade
Pemade
Pemade
Pemade
Pemade
Pemade
Pemade
Reyong
Reyong
Reyong
Reyong
Reyong
Reyong
Reyong
Reyong
Reyong
Reyong
Reyong
Reyong
-----------------
[EXC1]
[EXC1]
[EXC1]
*
[EXC2]
[EXC2]
*
*
*
*
*
*
PC56
GAMELAN 2
----------------------------Kendang Wadon
Kendang Lanang
Bebarongan
Pelegongan
Kelontuk
Kelontuk Mute
Kelontuk Side
Gamelan Gong Wadon
Gamelan Gong Lanang
Ceng-Ceng
Kopyak Open
Kopyak Mute
Kajar
Kempur
Jegogan
Jegogan
Jegogan
Jegogan
Jegogan
Jublag
Jublag
Jublag
Jublag
Jublag
Penyacah
Penyacah
Penyacah
Penyacah
Penyacah
Penyacah
Penyacah
Pemade
Pemade
Pemade
Pemade
Pemade
Pemade
Pemade
Pemade
Pemade
Pemade
Reyong
Reyong
Reyong
Reyong
Reyong
Reyong
Reyong
Reyong
Reyong
Reyong
Reyong
Reyong
-----------------
[EXC1]
[EXC1]
[EXC1]
*
[EXC2]
[EXC2]
*
*
*
*
*
*
193
>3UR@
>@
>@
>(;&@
Bijlagen
=HOIGHDOVGHSHUFXVVLHNODQNYDQ6&
=HOIGHDOVGHSHUFXVVLHNODQNYDQ6&
=HOIGHDOVGHSHUFXVVLHNODQNYDQ6&
3HUFXVVLHNODQNPHWKHW]HOIGHQXPPHU
NDQQLHWWHJHOLMNHUWLMGJHKRRUGZRUGHQ
3& 3URJUDPQXPPHU'UXPVHWQXPPHU
² =HOIGHDOVGHSHUFXVVLHNODQNYDQ
67$1'$5'3&
*HHQNODQN
7RQHQGLHPHWWZHHVWHPPHQ]LMQJHPDDNW
SC-8850 Drum Set (7)
=LHSYRRUGHWDLOVRYHU²HQ²
22
23
C1 24
25
26
28
29
27
30
31
32
33
34
35
C2 36
37
38
40
41
39
42
43
44
45
46
47
C3 48
49
50
52
53
51
54
55
56
57
58
59
C4 60
61
62
64
65
63
66
67
68
69
70
71
C5 72
73
74
76
77
75
78
79
80
81
82
83
C6 84
85
86
88
89
87
90
91
92
93
94
95
C7 96
194
PC 57
SFX
MC-500 Beep 2
Guitar Slide
Guitar Wah
Guitar Slap
Chord Stroke Down
Chord Stroke Up
Biwa FX
Phonograph Noise
Tape Rewind
Scratch Push 2
Scratch Pull 2
Cutting Noise 2 Up
Cutting Noise 2 Down
Distortion Guitar Cutting Noise Up
Distortion Guitar Cutting Noise Down
Bass Slide
Pick Scrape
High Q
Slap
Scratch Push
Scratch Pull
Sticks
Square Click
Metronome Click
Metronome Bell
Guitar Fret Noise
Guitar Cutting Noise Up
Guitar Cutting Noise Down
String Slap of Double Bass
Flute Key Click Noise
Laughing
Screaming
Punch
Heart Beat
Footsteps 1
Footsteps 2
Applause
Door Creaking
Door
Scratch
Wind Chimes
Car - Engine
Car - Stop
Car - Passing
Car - Crash
Siren
Train
Jetplane
Helicopter
Starship
Gun Shot
Machine Gun
Laser Gun
Explosion
Dog
Horse-Gallop
Birds
Rain
Thunder
Wind
Seashore
Stream
Bubble
Kitty
Bird 2
Growl
<–
Telephone 1
Telephone 2
Small Club 1
Small Club 2
Applause Wave
Eruption
Big Shot
Percussion Bang
[ Pro ]
*
[EXC1]
[EXC1]
[EXC7]
[EXC7]
*
*
*
*
*
*
*
*
*
*
*
*
*
PC 58
RHYTHM FX
----------------------------Reverse Kick 1
Reverse Concert Bass Drum
Reverse Power Kick1
Reverse Electric Kick 1
Reverse Snare 1
Reverse Snare 2
Reverse Standard 1 Snare 1
Reverse Tight Snare
Reverse Dance Snare
Reverse 808 Snare
Reverse Tom 1
Reverse Tom 2
Reverse Sticks
Reverse Slap
Reverse Cymbal 1
Reverse Cymbal 2
Reverse Open Hi-Hat
Reverse Ride Cymbal
Reverse CR-78 Open Hi-Hat
Reverse Closed Hi-Hat
Reverse Gong
Reverse Bell Tree
Reverse Guiro
Reverse Bendir
Reverse Gun Shot
Reverse Scratch
Reverse Laser Gun
Key Click
Techno Thip
Pop Drop
Woody Slap
Distortion Kick
Syn. Drops
Reverse Hi Q
Pipe
Ice Block
Digital Tambourine
Alias
Modulated Bell
Spark
Metallic Percussion
Velocity Noise FX
Stereo Noise Clap
Swish
Slappy
Voice Ou
Voice Au
Hoo
Tape Stop 1
Tape Stop 2
Missile
Space Birds
Flying Monster
-----------------
[ Pro ]
*
*
*
*
*
*
*
PC 59
RHYTHM FX 2
----------------------------Reverse TR-707 Kick 1
Reverse TR-909 Kick 1
Reverse Hip-Hop Kick 1
Reverse Jungle Kick 2
Reverse Techno Kick 2
Reverse TR-606 Snare 2
Reverse CR-78 Snare 1
Reverse CR-78 Snare 2
Reverse Jungle Snare 2
Reverse Techno Snare 2
Reverse TR-707 Snare
Reverse TR-606 Snare 1
Reverse TR-909 Snare 1
Reverse Hip-Hop Snare 2
Reverse Jungle Snare 1
Reverse House Snare
Reverse Closed Hi-Hat
Reverse TR-606 Closed Hi-Hat
Reverse TR-707 Closed Hi-Hat
Reverse TR-808 Closed Hi-Hat
Reverse Jungle Hi-Hat
Reverse Tambourine 2
Reverse Shake Tambourine
Reverse TR-808 Open Hi-Hat
Reverse TR-707 Open Hi-Hat
Reverse Open Hi-Hat
Reverse TR-606 Open Hi-Hat
Reverse Hu Yin Luo
Reverse TR-707 Crash Cymbal
Voice One
Reverse Voice One
Voice Two
Reverse Voice Two
Voice Three
Reverse Voice Three
Voice Tah
Reverse Voice Tah
Voice Ou
Voice Au
Voice Whey
Frog Vpoce
Reverse Yyoo Dude
Douby
Reverse Douby
Baert High
Baert Low
Bounce
Reverse bounce
Distortion Knock
Guitar Slide
Sub Marine
Noise Attack
Space Worms
Emergency !
Calculating...
Saw LFO Saw
-----------
[ Pro ]
PC 60
RHYTHM FX 3
Reverse Clean Guitar Mute Up
Reverse Clean Guitar Mute Down
Reverse Distortion Guitar Cut Noise Up
Reverse Distortion Guitar Cut Noise Down
Reverse Distortion Guitar Stroke Noise
Reverse Distortion Guitar Mute Noise
Reverse Steel Guitar Slide Noise 1
Reverse Steel Guitar Slide Noise 2
Reverse Steel Guitar Slide Noise 3
Reverse Steel Guitar Slide Noise 4
Reverse Steel Guitar Stroke Noise
Reverse Steel Guitar Stroke Noise Up 1
Reverse Steel Guitar Stroke Noise Down 1
Reverse Steel Guitar Stroke Noise Up 2
Reverse Steel Guitar Stroke Noise Down 2
Reverse Trombone Noise
Reverse Trumpet Noise
Reverse Standard Kick 2
Reverse Standard Kick 1
Reverse Room Kick 2
Reverse Room Kick 1
Reverse Jazz Kick 2
Reverse Jazz Kick 1
Reverse Brush Kick 2
Reverse Brush Kick 1
Reverse HipHop Kick 2
Reverse HipHop Kick 1
Reverse Jungle Kick 2
Reverse Jungle Kick 1
Reverse TR-808 Kick
Reverse TR-909 Kick 2
Reverse TR-909 Kick 1
Reverse Fat Kick
Reverse Dance Kick
Reverse Standard Snare 1
Reverse Standard Snare 2
Reverse Room Snare 1
Reverse Room Snare 2
Reverse Jazz Snare 1
Reverse Jazz Snare 2
Reverse Brush Snare 1
Reverse Brush Snare 2
Reverse Lo-Fi Snare 1
Reverse Lo-Fi Snare 2
Reverse HipHop Snare 1
Reverse HipHop Snare 2
Reverse House Snare 1
Reverse Jungle Snare
Reverse 606 Snare 2
Reverse Techno Snare
Reverse Dance Snare
Reverse Rock Snare Dry
Reverse Lo-Fi Snare Rim
Reverse 909 Snare Rim
Reverse Jungle Snare Rim
Reverse Dance Snare Rim
Reverse House Snare Rim
Reverse Brush Tom 1
Reverse Brush Tom 2
Reverse Brush Tom 3
Reverse 606 Tom
Reverse Jungle Crash Cymbal
Reverse Standard Closed Hi-Hat
Reverse Room Closed Hi-Hat
Reverse Jazz Closed Hi-Hat
Reverse Brush Closed Hi-Hat
Reverse 707 Claps
Reverse 909 Claps
Reverse R&B Claps 1
Reverse HipHop Claps
Reverse Comp Claps 2
Reverse Shaker 2
Reverse Jungle Shaker
Reverse Clap Hit
Reverse Boeeeen
Bijlagen
SC-8850 Drum Set (8)
22
23
C1 24
25
26
28
29
27
30
31
32
33
34
35
C2 36
37
38
40
41
39
42
43
44
45
46
47
C3 48
49
50
52
53
51
54
55
56
57
58
59
C4 60
61
62
64
65
63
66
67
68
69
70
71
C5 72
73
74
76
77
75
78
79
80
81
82
83
C6 84
85
86
88
89
87
90
91
92
93
94
95
C7 96
PC 61
SFX 2
------------------Acoustic Bass Mute Noise
Acoustic Bass Touch Noise
Acoustic Bass Attack Noise
Distortion Guitar Mute Noise
Steel Guitar Slide Noise 1
Steel Guitar Slide Noise 2
Steel Guitar Slide Noise 3
Steel Guitar Slide Noise 4
Guitar Stroke Noise 1
Guitar Stroke Noise 2
Guitar Stroke Noise 3
Guitar Stroke Noise 4
Guitar Stroke Noise 5
Open CD Tray
Audio Switch
Keyboard Typing 1
Keyboard Typing 2
Keyboard Typing 3
Keyboard Typing 4
Keyboard Typing 5
Keyboard Typing 6
Baby Laughing
Clap Hit
Stab! 1
Stab! 2
Bounce Hit
Boeeeen
Glass Stir
Ice Ring
Crack Bottle
Pour Bottle
Soda
Car Engine 2
Car - Horn
Railroad Crossing
SL 1
SL 2
Over Blow
Sword Boom!
Sword Cross
Industry Hit
Drill Hit
Compresser
Thrill Hit
Explosion 2
Seal
Fancy Animal
Cricket
Bear
Frog Vpoce
Wind 2
Scratch 3
Scratch 4
Scratch 5
Scratch 6
Scratch 7
Noise Attack
Bounce
Dist Knock
Bound
-------------
PC 62
VOICE
----------------------------Reverse Breath Slow
Reverse Breath Short
Reverse Breath Strong
Reverse Woman's Breath
Reverse Man's Breath
Reverse Voice One
Reverse Voice Two
Reverse Voice Three
Reverse Voice Tah
Reverse Voice Come On
Reverse Voice Kikit
Reverse Voice Aou
Reverse Voice Oou
Reverse Voice Hie 2
Reverse Baby Laughing
Reverse Yyooh
Reverse Japanese Female Voice Lan
Reverse Ooue!
Flute Breath 1
Flute Breath 2
Flute Breath 3
Voice Breath 1
Voice Breath 2
Voice One
Voice Two
Voice Three
Voice Tah
Voice ComeOn
Voice Kikit
Voice Aou
Voice Oou
Punch
Screaming
Laughing
Voice Hie
Baby Laughing
Frog Vpoce
Yyooh Dude
Voice Ou
Voice Au
Jazz Voice Thum
Jazz Voice Bap
Jazz Voice Dat
Jazz Voice Dow
Voice Oohs 2
Voice Oohs Chord Maj7 A
Voice Oohs Chord Maj7 B
Voice Oohs Chord Sus4 A
Voice Oohs Chord Sus4 B
Japanese Female Voice Lah
Japanese Female Voice Lan
Japanese Male Voice Wah
Japanese Male Voice Woh
-----------------
PC 63
CYM&CLAPS 2
--------------------Reverse Standard Closed Hi-Hat
Reverse Room Closed Hi-Hat
Reverse Jazz Closed Hi-Hat
Reverse Brush Closed Hi-Hat
Standard 1 Closed Hi-Hat
Room Closed Hi-Hat
Jazz Closed Hi-Hat
Brush Closed Hi-Hat
TR-707 Closed Hi-Hat
TR-606 Closed Hi-Hat
TR-808 Closed Hi-Hat
CR-78 Closed Hi-Hat
Pedal Hi-Hat
Pedal Hi-Hat
Pedal Hi-Hat
Half-Open Hi-Hat 1
Half-Open Hi-Hat 2
Standard 1 Open Hi-Hat
Room Open Hi-Hat
Jazz Open Hi-Hat
Brush Open Hi-Hat
TR-909 Open Hi-Hat
TR-707 Open Hi-Hat
TR-606 Open Hi-Hat
TR-808 Open Hi-Hat
CR-78 Open Hi-Hat
Standard 1 Crash Cymbal
Room Crash Cymbal
Jazz Crash Cymbal
Brush Crash Cymbal
Hard Crash Cymbal
TR-909 Crash Cymbal
Jungle Crash Cymbal
TR-808 Crash Cymbal
Standard 1 Mute Crash Cymbal
Room Mute Crash Cymbal
Jazz Mute Crash Cymbal
Brush Mute Crash Cymbal
Mute Crash Cymbal 1
Mute Crash Cymbal 2
Reverse Standard 1 Crash Cymbal
Reverse Room Crash Cymbal
Reverse Jazz Crash Cymbal
Reverse Brush Crash Cymbal
Splash Cymbal
Standard Ride Bell
Room Ride Bell
Jazz Ride Bell
Brush Ride Bell
Standard Ride Cymbal
Room Ride Cymbal
Jazz Ride Cymbal
Brush Ride Cymbal
TR-606 Ride Cymbal
TR-808 Ride Cymbal
Chinese Cymbal
Chinese Cymbal 2
TR-707 Claps
Hip-Hop Claps
R&B Claps
TR-909 Claps
Comp Claps 2
Hand Clap
[Pro] Hand Clap 2
[Pro] TR-707 Hand Clap
195
>3UR@
>@
>@
>(;&@
Bijlagen
=HOIGHDOVGHSHUFXVVLHNODQNYDQ6&
=HOIGHDOVGHSHUFXVVLHNODQNYDQ6&
=HOIGHDOVGHSHUFXVVLHNODQNYDQ6&
3HUFXVVLHNODQNPHWKHW]HOIGHQXPPHU
NDQQLHWWHJHOLMNHUWLMGJHKRRUGZRUGHQ
3& 3URJUDPQXPPHU'UXPVHWQXPPHU
² =HOIGHDOVGHSHUFXVVLHNODQNYDQ
67$1'$5'3&
*HHQNODQN
7RQHQGLHPHWWZHHVWHPPHQ]LMQJHPDDNW
SC-8850 Drum Set (9)
1RWHQ²HQ²]LMQGHYROJHQGH
C-1 0
1
2
4
5
3
6
7
8
9
10
11
C0 12
13
14
16
17
15
18
19
20
21
95
96
97
98
99
100
101
102
103
104
105
106
107
C8 108
109
110
111
112
113
114
115
116
117
118
119
C9 120
121
122
123
124
125
126
127
196
PC1
STANDARD 1
[88] Standard 1 Kick 1
[88] Standard 1 Kick 2
[88] Standard 2 Kick 1
[88] Standard 2 Kick 2
[55] Kick Drum 1
[55] Kick Drum 2
[88] Jazz Kick 1
[88] Jazz Kick 2
[88] Room Kick 1
[88] Room Kick 2
[88] Power Kick 1
[88] Power Kick 2
[88] Electric Kick 2
[88] Electric Kick 1
[88] TR-808 Kick
[88] TR-909 Kick
[88] Dance Kick
[Pro] Voice One
[Pro] Voice Two
[Pro] Voice Three
Room Kick 2
Room Kick 1
:
:
:
Room Snare 1
Room Snare 2
[88] Standard 1 Snare1
[88] Standard 1 Snare 2
[88] Standard 2 Snare 1
[88] Standard 2 Snare 2
[55] Snare Drum 2
[Pro] Standard 1 Snare 1
[Pro] Standard 1 Snare 2
[Pro] Standard 1 Snare 3
[88] Jazz Snare 1
[88] Jazz Snare 2
[88] Room Snare 1
[88] Room Snare 2
[88] Power Snare 1
[88] Power Snare 2
[55] Gated Snare
[88] Dance Snare 1
[88] Dance Snare 2
[88] Disco Snare
[88] Electric Snare 2
[55] Electric Snare
[88] Electric Snare 3
[Pro] TR-707 Snare 1
[88] TR-808 Snare 1
[88] TR-808 Snare 2
[88] TR-909 Snare 1
[88] TR-909 Snare 2
[Pro] Rap Snare
[Pro] Jungle Snare 1
[Pro] House Snare 1
[88] House Snare
[Pro] House Snare 2
*
*
*
*
*
*
PC2
STANDARD 2
PC17
POWER
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
----:
:
:
----<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
[ Pro ]
[ Pro ]
PC3
STANDARD L/R
----------------------------------<–
<–
<–
----:
:
:
[L] Standard Kick 2
[L] Standard Kick 1
[L] Standard Crash Cymbal
[L] Standard Snare 1
[L] Standard Ride Cymbal
[L] Standard Snare 2
[L] Standard Low Tom
[L] Standard Closed Hi-Hat
[L] Standard Mid Tom
[L] Standard Ride Bell
[L] Standard High Tom
[L] Standard Open Hi-Hat
[R] Standard Kick 2
[R] Standard Kick 1
[R] Standard Crash Cymbal
[R] Standard Snare 1
[R] Standard Ride Cymbal
[R] Standard Snare 2
[R] Standard Low Tom
[R] Standard Closed Hi-Hat
[R] Standard Mid Tom
[R] Standard Ride Bell
[R] Standard High Tom
[R] Standard Open Hi-Hat
-------------------
*
*
*
*
[EXC8]
[EXC8]
[EXC9]
[EXC9]
PC9
ROOM
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
Standard 1 Kick 2
Standard 1 Kick 1
:
:
:
Standard 1 Snare 1
Standard 1 Snare 2
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
*
*
*
PC10
HIP HOP
[88] Electric Kick 2
[88] Electric Kick 1
[Pro] CR-78 Kick 1
[Pro] CR-78 Kick 2
[Pro] TR-606 Kick1
[Pro] TR-707 Kick 1
[55] TR-808 Kick
[88] TR-808 Kick
[Pro] TR-808 Kick 2
[88] TR-909 Kick
[88] Dance Kick
[Pro] Hip-Hop Kick 2
[Pro] TR-909 Kick 1
[Pro] Hip-Hop Kick 3
[Pro] Jungle Kick 1
[Pro] Techno Kick 1
[Pro] Bounce Kick
<–
<–
<–
Jungle Kick 2
Jungle Kick 1
:
:
:
Room Snare 2
Dance Snare
[Pro] Techno Hit
[Pro] Philly Hit
[Pro] Impact Hit
[Pro] Lo-Fi Rave
[Pro] Bam Hit
[Pro] Bim Hit
[Pro] Tape Rewind
[Pro] Phonograph Noise
[88] Power Snare 1
[88] Dance Snare 1
[88] Dance Snare 2
[88] Disco Snare
[88] Electric Snare 2
[55] Electric Snare
[88] Electric Snare 3
[Pro] TR-606 Snare 2
[Pro] TR-707 Snare 1
[88] TR-808 Snare 2
[88] TR-808 Snare 1
[Pro] TR-808 Snare 2
[88] TR-909 Snare 1
[88] TR-909 Snare 2
[Pro] TR-909 Snare 1
[Pro] TR-909 Snare 2
[Pro] Rap Snare
[Pro] Jungle Snare
[Pro] House Snare 1
[88] House Snare
[Pro] House Snare 2
[Pro] Voice Tah
[88] Slappy
*
*
*
*
*
*
*
*
*
*
Bijlagen
SC-8850 Drum Set (10)
1RWHQ²HQ²]LMQGHYROJHQGH
C-1 0
1
2
4
5
3
6
7
8
9
10
11
C0 12
13
14
16
17
15
18
19
20
21
95
96
97
98
99
100
101
102
103
104
105
106
107
C8 108
109
110
111
112
113
114
115
116
117
118
119
C9 120
121
122
123
124
125
126
127
PC 11
JUNGLE
[88] Electric Kick 2
[88] Electric Kick 1
[Pro] CR-78 Kick 1
[Pro] CR-78 Kick 2
[Pro] TR-606 Kick1
[Pro] TR-707 Kick 1
[55] TR-808 Kick
[88] TR-808 Kick
[Pro] TR-808 Kick 2
[88] TR-909 Kick
[88] Dance Kick
[Pro] Hip-Hop Kick 2
[Pro] TR-909 Kick 1
[Pro] Hip-Hop Kick 3
[Pro] Jungle Kick 1
[Pro] Techno Kick 1
[Pro] Bounce Kick
<–
<–
<–
HipHop Kick 2
HipHop Kick 1
:
:
:
Rock Snare Dry
LoFi Snare 1
[Pro] Techno Hit
[Pro] Philly Hit
[Pro] Impact Hit
[Pro] Lo-Fi Rave
[Pro] Bam Hit
[Pro] Bim Hit
[Pro] Tape Rewind
[Pro] Phonograph Noise
[88] Power Snare 1
[88] Dance Snare 1
[88] Dance Snare 2
[88] Disco Snare
[88] Electric Snare 2
[55] Electric Snare
[88] Electric Snare 3
[Pro] TR-606 Snare 2
[Pro] TR-707 Snare 1
[88] TR-808 Snare 2
[88] TR-808 Snare 1
[Pro] TR-808 Snare 2
[88] TR-909 Snare 1
[88] TR-909 Snare 2
[Pro] TR-909 Snare 1
[Pro] TR-909 Snare 2
[Pro] Rap Snare
[Pro] Jungle Snare
[Pro] House Snare 1
[88] House Snare
[Pro] House Snare 2
[Pro] Voice Tah
[88] Slappy
*
*
*
*
*
*
*
*
*
*
PC 12
TECHNO
[88] Electric Kick 2
[88] Electric Kick 1
[Pro] CR-78 Kick 1
[Pro] CR-78 Kick 2
[Pro] TR-606 Kick1
[Pro] TR-707 Kick 1
[55] TR-808 Kick
[88] TR-808 Kick
[Pro] TR-808 Kick 2
[88] TR-909 Kick
[88] Dance Kick
[Pro] Hip-Hop Kick 2
[Pro] TR-909 Kick 1
[Pro] Hip-Hop Kick 3
[Pro] Jungle Kick 1
[Pro] Techno Kick 1
[Pro] Bounce Kick
<–
<–
<–
TR-909 Kick 2
Fat Kick
:
:
:
HipHop Snare 1
HipHop Snare 2
[Pro] Techno Hit
[Pro] Philly Hit
[Pro] Impact Hit
[Pro] Lo-Fi Rave
[Pro] Bam Hit
[Pro] Bim Hit
[Pro] Tape Rewind
[Pro] Phonograph Noise
[88] Power Snare 1
[88] Dance Snare 1
[88] Dance Snare 2
[88] Disco Snare
[88] Electric Snare 2
[55] Electric Snare
[88] Electric Snare 3
[Pro] TR-606 Snare 2
[Pro] TR-707 Snare 1
[88] TR-808 Snare 2
[88] TR-808 Snare 1
[Pro] TR-808 Snare 2
[88] TR-909 Snare 1
[88] TR-909 Snare 2
[Pro] TR-909 Snare 1
[Pro] TR-909 Snare 2
[Pro] Rap Snare
[Pro] Jungle Snare
[Pro] House Snare 1
[88] House Snare
[Pro] House Snare 2
[Pro] Voice Tah
[88] Slappy
*
*
*
*
*
*
*
*
*
*
PC 13
ROOM L/R
----------------------------------<–
<–
<–
----:
:
:
[L] Room Kick 2
[L] Room Kick 1
[L] Room Crash Cymbal
[L] Room Snare 1
[L] Room Ride Cymbal
[L] Room Snare 2
[L] Room Low Tom
[L] Room Closed Hi-Hat
[L] Room Mid Tom
[L] Room Ride Bell
[L] Room High Tom
[L] Room Open Hi-Hat
[R] Room Kick 2
[R] Room Kick 1
[R] Room Crash Cymbal
[R] Room Snare 1
[R] Room Ride Cymbal
[R] Room Snare 2
[R] Room Low Tom
[R] Room Closed Hi-Hat
[R] Room Mid Tom
[R] Room Ride Bell
[R] Room High Tom
[R] Room Open Hi-Hat
-------------------
*
[EXC8]
[EXC8]
*
[EXC9]
*
[EXC9]
PC 14
HOUSE
[88] Electric Kick 2
[88] Electric Kick 1
[Pro] CR-78 Kick 1
[Pro] CR-78 Kick 2
[Pro] TR-606 Kick1
[Pro] TR-707 Kick 1
[55] TR-808 Kick
[88] TR-808 Kick
[Pro] TR-808 Kick 2
[88] TR-909 Kick
[88] Dance Kick
[Pro] Hip-Hop Kick 2
[Pro] TR-909 Kick 1
[Pro] Hip-Hop Kick 3
[Pro] Jungle Kick 1
[Pro] Techno Kick 1
[Pro] Bounce Kick
<–
<–
<–
Fat Kick
Dance Kick
:
:
:
LoFi Snare 2
Jungle Snare
[Pro] Techno Hit
[Pro] Philly Hit
[Pro] Impact Hit
[Pro] Lo-Fi Rave
[Pro] Bam Hit
[Pro] Bim Hit
[Pro] Tape Rewind
[Pro] Phonograph Noise
[88] Power Snare 1
[88] Dance Snare 1
[88] Dance Snare 2
[88] Disco Snare
[88] Electric Snare 2
[55] Electric Snare
[88] Electric Snare 3
[Pro] TR-606 Snare 2
[Pro] TR-707 Snare 1
[88] TR-808 Snare 2
[88] TR-808 Snare 1
[Pro] TR-808 Snare 2
[88] TR-909 Snare 1
[88] TR-909 Snare 2
[Pro] TR-909 Snare 1
[Pro] TR-909 Snare 2
[Pro] Rap Snare
[Pro] Jungle Snare
[Pro] House Snare 1
[88] House Snare
[Pro] House Snare 2
[Pro] Voice Tah
[88] Slappy
*
*
PC 25
ELECTRONIC
PC 26
TR-808
[88] Electric Kick 2
[88] Electric Kick 1
CR-78 Kick 1
CR-78 Kick 2
TR-606 Kick1
TR-707 Kick 1
[55] TR-808 Kick
[88] TR-808 Kick
TR-808 Kick 2
[88] TR-909 Kick
[88] Dance Kick
Hip-Hop Kick 2
TR-909 Kick 1
Hip-Hop Kick 3
Jungle Kick 1
Techno Kick 1
Bounce Kick
<–
<–
<–
----:
:
:
----Techno Hit
Philly Hit
Impact Hit
Lo-Fi Rave
Bam Hit
Bim Hit
Tape Rewind
Phonograph Noise
[88] Power Snare 1
[88] Dance Snare 1
[88] Dance Snare 2
[88] Disco Snare
[88] Electric Snare 2
[55] Electric Snare
[88] Electric Snare 3
TR-606 Snare 2
TR-707 Snare 1
[88] TR-808 Snare 2
[88] TR-808 Snare 1
TR-808 Snare 2
[88] TR-909 Snare 1
[88] TR-909 Snare 2
TR-909 Snare 1
TR-909 Snare 2
Rap Snare
Jungle Snare
House Snare 1
[88] House Snare
House Snare 2
Voice Tah
[88] Slappy
[ Pro ]
[ Pro ]
*
*
*
*
*
*
*
*
*
*
197
>3UR@
>@
>@
>(;&@
Bijlagen
=HOIGHDOVGHSHUFXVVLHNODQNYDQ6&
=HOIGHDOVGHSHUFXVVLHNODQNYDQ6&
=HOIGHDOVGHSHUFXVVLHNODQNYDQ6&
3HUFXVVLHNODQNPHWKHW]HOIGHQXPPHU
NDQQLHWWHJHOLMNHUWLMGJHKRRUGZRUGHQ
3& 3URJUDPQXPPHU'UXPVHWQXPPHU
² =HOIGHDOVGHSHUFXVVLHNODQNYDQ
67$1'$5'3&
*HHQNODQN
7RQHQGLHPHWWZHHVWHPPHQ]LMQJHPDDNW
SC-8850 Drum Set (11)
1RWHQ²HQ²]LMQGHYROJHQGH
C-1 0
1
2
4
5
3
6
7
8
9
10
11
C0 12
13
14
16
17
15
18
19
20
21
95
96
97
98
99
100
101
102
103
104
105
106
107
C8 108
109
110
111
112
113
114
115
116
117
118
119
C9 120
121
122
123
124
125
126
127
198
PC 27
DANCE
[88] Electric Kick 2
[88] Electric Kick 1
[Pro] CR-78 Kick 1
[Pro] CR-78 Kick 2
[Pro] TR-606 Kick1
TR-707 Kick 1
[55] TR-808 Kick
[88] TR-808 Kick
TR-808 Kick 2
[88] TR-909 Kick
[88] Dance Kick
[Pro] Hip-Hop Kick 2
[Pro] TR-909 Kick 1
[Pro] Hip-Hop Kick 3
[Pro] Jungle Kick 1
[Pro] Techno Kick 1
[Pro] Bounce Kick
<–
<–
<–
TR-909 Kick 2
TR-909 Kick 1
:
:
:
HipHop Snare 1
Hip-Hop Snare 2
[Pro] Techno Hit
[Pro] Philly Hit
[Pro] Impact Hit
[Pro] Lo-Fi Rave
[Pro] Bam Hit
[Pro] Bim Hit
[Pro] Tape Rewind
[Pro] Phonograph Noise
[88] Power Snare 1
[88] Dance Snare 1
[88] Dance Snare 2
[88] Disco Snare
[88] Electric Snare 2
[55] Electric Snare
[88] Electric Snare 3
[Pro] TR-606 Snare 2
[Pro] TR-707 Snare 1
[88] TR-808 Snare 2
[88] TR-808 Snare 1
[Pro] TR-808 Snare 2
[88] TR-909 Snare 1
[88] TR-909 Snare 2
[Pro] TR-909 Snare 1
[Pro] TR-909 Snare 2
[Pro] Rap Snare
[Pro] Jungle Snare
[Pro] House Snare 1
[88] House Snare
[Pro] House Snare 2
[Pro] Voice Tah
[88] Slappy
*
*
*
*
*
*
*
*
*
*
PC 28
CR-78
PC 29
TR-606
PC 30
TR-707
PC 31
TR-909
[88] Electric Kick 2
[88] Electric Kick 1
CR-78 Kick 1
CR-78 Kick 2
TR-606 Kick1
TR-707 Kick 1
[55] TR-808 Kick
[88] TR-808 Kick
TR-808 Kick 2
[88] TR-909 Kick
[88] Dance Kick
Hip-Hop Kick 2
TR-909 Kick 1
Hip-Hop Kick 3
Jungle Kick 1
Techno Kick 1
Bounce Kick
<–
<–
<–
----:
:
:
----Techno Hit
Philly Hit
Impact Hit
Lo-Fi Rave
Bam Hit
Bim Hit
Tape Rewind
Phonograph Noise
[88] Power Snare 1
[88] Dance Snare 1
[88] Dance Snare 2
[88] Disco Snare
[88] Electric Snare 2
[55] Electric Snare
[88] Electric Snare 3
TR-606 Snare 2
TR-707 Snare 1
[88] TR-808 Snare 2
[88] TR-808 Snare 1
TR-808 Snare 2
[88] TR-909 Snare 1
[88] TR-909 Snare 2
TR-909 Snare 1
TR-909 Snare 2
Rap Snare
Jungle Snare
House Snare 1
[88] House Snare
House Snare 2
Voice Tah
[88] Slappy
[ Pro ]
[ Pro ]
[ Pro ]
[ Pro ]
*
*
*
*
*
*
*
*
*
*
PC 33
JAZZ
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
Brush Kick 2
Brush Kick 1
*
:
:
:
------Brush Tap 2
Brush Slap 2
[88] Brush Tap 1
[88] Brush Tap 2
[88] Brush Slap 1
[88] Brush Slap 2
[88] Brush Slap 3
[88] Brush Swirl 1
[88] Brush Swirl 2
[88] Brush Long Swirl
[88] Jazz Snare 1
[88] Jazz Snare 2
[88] Standard 1 Snare1
[88] Standard 1 Snare2
[88] Standard 2 Snare1
[88] Standard 2 Snare2
[55] Snare Drum 2
[Pro] Standard 1 Snare 1
[Pro] Standard 1 Snare 2
[Pro] Standard 1 Snare 3
[88] Room Snare 1
[88] Room Snare 2
[88] Power Snare 1
[88] Power Snare 2
[88] Gated Snare
[88] Dance Snare 1
[88] Dance Snare 2
[88] Disco Snare
[88] Electric Snare 2
[88] Electric Snare 3
*
PC 34
JAZZ L/R
----------------------------------<–
<–
<–
----:
:
:
[L] Jazz Kick 2
[L] Jazz Kick 1
[L] Jazz Crash Cymbal
[L] Jazz Snare 1
[L] Jazz Ride Cymbal
[L] Jazz Snare 2
[L] Jazz Low Tom
[L] Jazz Closed Hi-Hat
[L] Jazz Mid Tom
[L] Jazz Ride Bell
[L] Jazz High Tom
[L] Jazz Open Hi-Hat
[R] Jazz Kick 2
[R] Jazz Kick 1
[R] Jazz Crash Cymbal
[R] Jazz Snare 1
[R] Jazz Ride Cymbal
[R] Jazz Snare 2
[R] Jazz Low Tom
[R] Jazz Closed Hi-Hat
[R] Jazz Mid Tom
[R] Jazz Ride Bell
[R] Jazz High Tom
[R] Jazz Open Hi-Hat
-------------------
[EXC8]
[EXC8]
[EXC9]
[EXC9]
PC 41
BRUSH
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
----:
:
:
----------[88] Brush Tap 1
[88] Brush Tap 2
[88] Brush Slap 1
[88] Brush Slap 2
[88] Brush Slap 3
[88] Brush Swirl 1
[88] Brush Swirl 2
[88] Brush Long Swirl
[88] Jazz Snare 1
[88] Jazz Snare 2
[88] Standard 1 Snare1
[88] Standard 1 Snare2
[88] Standard 2 Snare1
[88] Standard 2 Snare2
[55] Snare Drum 2
Standard 1 Snare 1
Standard 1 Snare 2
Standard 1 Snare 3
[88] Room Snare 1
[88] Room Snare 2
[88] Power Snare 1
[88] Power Snare 2
[88] Gated Snare
[88] Dance Snare 1
[88] Dance Snare 2
[88] Disco Snare
[88] Electric Snare 2
[88] Electric Snare 3
[ Pro ]
*
Bijlagen
SC-8850 Drum Set (12)
1RWHQ²HQ²]LMQGHYROJHQGH
C-1 0
1
2
4
5
3
6
7
8
9
10
11
C0 12
13
14
16
17
15
18
19
20
21
95
96
97
98
99
100
101
102
103
104
105
106
107
C8 108
109
110
111
112
113
114
115
116
117
118
119
C9 120
121
122
123
124
125
126
127
PC 42
BRUSH 2
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
Jazz Kick 2
Jazz Kick 1
:
:
:
------Jazz Snare 1
Jazz Snare 2
[88] Brush Tap 1
[88] Brush Tap 2
[88] Brush Slap 1
[88] Brush Slap 2
[88] Brush Slap 3
[88] Brush Swirl 1
[88] Brush Swirl 2
[88] Brush Long Swirl
[88] Jazz Snare 1
[88] Jazz Snare 2
[88] Standard 1 Snare1
[88] Standard 1 Snare2
[88] Standard 2 Snare1
[88] Standard 2 Snare2
[55] Snare Drum 2
[Pro] Standard 1 Snare 1
[Pro] Standard 1 Snare 2
[Pro] Standard 1 Snare 3
[88] Room Snare 1
[88] Room Snare 2
[88] Power Snare 1
[88] Power Snare 2
[88] Gated Snare
[88] Dance Snare 1
[88] Dance Snare 2
[88] Disco Snare
[88] Electric Snare 2
[88] Electric Snare 3
*
PC 43
BRUSH 2 L/R
----------------------------------<–
<–
<–
----:
:
:
[L] Brush Kick 2
[L] Brush Kick 1
[L] Brush Crash Cymbal
[L] Brush Tap 2
[L] Brush Ride Cymbal
[L] Brush Slap 2
[L] Brush Low Tom
[L] Brush Closed Hi-Hat
[L] Brush Mid Tom
[L] Brush Ride Bell
[L] Brush High Tom
[L] Brush Open Hi-Hat
[R] Brush Kick 2
[R] Brush Kick 1
[R] Brush Crash Cymbal
[R] Brush Tap 2
[R] Brush Ride Cymbal
[R] Brush Slap 2
[R] Brush Low Tom
[R] Brush Closed Hi-Hat
[R] Brush Mid Tom
[R] Brush Ride Bell
[R] Brush High Tom
[R] Brush Open Hi-Hat
-------------------
*
[EXC8]
[EXC8]
[EXC9]
[EXC9]
PC 49
ORCHESTRA
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
----:
:
:
----Applause 2
Small Club 1
[55] Timpani D#
[55] Timpani E
[55] Timpani F
[55] Timpani F#
[55] Timpani G
[55] Timpani G#
[55] Timpani A
[55] Timpani A#
[55] Timpani B
[55] Timpani c
[55] Timpani c#
[55] Timpani d
[55] Timpani d#
[55] Timpani e
[55] Timpani f
-----------------------------
[ Pro ]
*
*
PC 50
ETHNIC
--------------------------------------------:
:
:
Cabasa Up
Cabasa Down
Claves
High Wood Block
Low Wood Block
---------------------------------------------------------
[ Pro ]
PC 51
KICK & SNARE
PC 52
KICK & SNARE 2
--------------------------------------------:
:
:
[Pro] Rap Snare
[Pro] Hip-Hop Snare 2
[Pro] Jungle Snare 1
[Pro] Jungle Snare 2
[Pro] Techno Snare 1
[Pro] Techno Snare 2
[Pro] House Snare 2
[Pro] CR-78 Snare 1
[Pro] CR-78 Snare 2
[Pro] TR-606 Snare 1
[Pro] TR-606 Snare 2
[Pro] TR-707 Snare 1
[Pro] TR-707 Snare 2
[Pro] Standard 3 Snare 2
[Pro] TR-808 Snare 2
[Pro] TR-909 Snare 1
[Pro] TR-909 Snare 2
---------------------------------
[ Pro ]
199
>3UR@
>@
>@
>(;&@
Bijlagen
SC-8850 Drum Set (13)
1RWHQ²HQ²]LMQGHYROJHQGH
C-1 0
1
2
4
5
3
6
7
8
9
10
11
C0 12
13
14
16
17
15
18
19
20
21
95
96
97
98
99
100
101
102
103
104
105
106
107
C8 108
109
110
111
112
113
114
115
116
117
118
119
C9 120
121
122
123
124
125
126
127
200
PC 57
SFX
------------------------------------------MC-500 Beep 1
:
:
:
Big Shot
Percussion Bang
---------------------------------------------------------------
[ Pro ]
*
*
PC 60
RHYTHM FX 3
----------------------------------Reverse Bass Mute Noise
Reverse Bass Touch Noise
Reverse Bass Attack Noise
Reverse Clean Guitar Cut Noise Up
Reverse Clean Guitar Cut Noise Down
:
:
:
Reverse Clap Hit
Reverse Boeeeen
Reverse Bounce
Reverse CD Tray
Reverse Drill
Reverse Glass Stir
Reverse Ice Ring
Reverse Industry Hit
Reverse Scratch 4
Reverse Scratch 5
Reverse Scratch 6
Reverse Scratch 7
Reverse Seal
Reverse Stab! 1
Reverse Stab! 2
Reverse Sword Boom
Reverse Sword Cross
Reverse Thrill Hit
Reverse Audio Switch
Reverse Keyboard Typing 1
Reverse Keyboard Typing 2
Reverse Keyboard Typing 3
Reverse Keyboard Typing 4
Reverse Keyboard Typing 5
Reverse Keyboard Typing 6
-----------------
=HOIGHDOVGHSHUFXVVLHNODQNYDQ6&
=HOIGHDOVGHSHUFXVVLHNODQNYDQ6&
=HOIGHDOVGHSHUFXVVLHNODQNYDQ6&
3HUFXVVLHNODQNPHWKHW]HOIGHQXPPHU
NDQQLHWWHJHOLMNHUWLMGJHKRRUGZRUGHQ
3& 3URJUDPQXPPHU'UXPVHWQXPPHU
² =HOIGHDOVGHSHUFXVVLHNODQNYDQ
67$1'$5'3&
*HHQNODQN
7RQHQGLHPHWWZHHVWHPPHQ]LMQJHPDDNW
Bijlagen
SC-88Pro Drum Set (1)
=LHSYRRUGHWDLOVRYHU²HQ²
21
22
23
C1 24
25
26
28
29
27
30
31
32
33
34
35
C2 36
37
38
40
41
39
42
43
44
45
46
47
C3 48
49
50
52
53
51
54
55
56
57
58
59
C4 60
61
62
64
65
63
66
67
68
69
70
71
C5 72
73
74
76
77
75
78
79
80
81
82
83
C6 84
85
86
88
89
87
90
91
92
93
94
95
PC1
STANDARD 1
MC-500 Beep 1
MC-500 Beep 2
Concert SD
Snare Roll
Finger Snap 2
High Q
Slap
Scratch Push
Scratch Pull
Sticks
Square Click
Metronome Click
Metronome Bell
Standard 1 Kick 2
Standard 1 Kick 1
Side Stick
Standard 1 Snare 1
TR-909 Hand Clap
Standard 1 Snare 2
Low Tom 2
Closed Hi-Hat
Low Tom 1
Pedal Hi-Hat
Mid Tom 2
Open Hi-Hat
Mid Tom 1
High Tom 2
Crash Cymbal1
High Tom 1
Ride Cymbal 1
Chinese Cymbal
Ride Bell
Tambourine
Splash Cymbal
Cowbell
Crash Cymbal 2
Vibra-slap
Ride Cymbal 2
High Bongo
Low Bongo
Mute High Conga
Open High Conga
Low Conga
High Timbale
Low Timbale
High Agogo
Low Agogo
Cabasa
Maracas
Short High Whistle
Long Low Whistle
Short Guiro
Long Guiro
Claves
High Wood Block
Low Wood Block
Mute Cuica
Open Cuica
Mute Triangle
Open Triangle
Shaker
Jingle Bell
Bell Tree
Castanets
Mute Surdo
Open Surdo
Applause 2
-----------------
[EXC7]
[EXC7]
*
[EXC1]
*
[EXC1]
*
[EXC1]
*
*
*
[EXC2]
[EXC2]
[EXC3]
[EXC3]
[EXC4]
[EXC4]
[EXC5]
[EXC5]
[EXC6]
[EXC6]
*
PC2
STANDARD 2
<–
<–
<–
<–
Finger Snap
<–
<–
<–
<–
<–
<–
<–
<–
Standard 2 Kick 2
Standard 2 Kick 1
<–
Standard 2 Snare 1
Hand Clap
Standard 2 Snare 2
<–
Closed Hi-Hat
<–
Pedal Hi-Hat
<–
Open Hi-Hat
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
Bar Chimes
<–
<–
<–
<–
-----------------
[88]
[EXC1]
[EXC1]
[EXC1]
PC3
STANDARD 3
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
Standard 3 Kick 2
[RND] Kick
<–
[RND] Snare
[RND] Hand Clap
Standard 3 Snare 2
<–
[RND] Closed Hi-Hat
<–
[RND] Pedal Hi-Hat
<–
[RND] Open Hi-Hat
<–
<–
[RND] Crash Cymbal
<–
[RND] Ride Cymbal 1
<–
[RND] Ride Bell 1
<–
<–
<–
<–
<–
[RND] Ride Cymbal 2
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
-----------------
*
[EXC1]
[EXC1]
[EXC1]
*
*
PC9
ROOM
<–
<–
<–
<–
Finger Snap
<–
<–
<–
<–
<–
<–
<–
<–
Room Kick 2
Room Kick 1
<–
Room Snare 1
Hand Clap
Room Snare 2
Room Low Tom 2
Closed Hi-Hat 3
Room Low Tom 1
Pedal Hi-Hat
Room Mid Tom 2
Open Hi-Hat 3
Room Mid Tom 1
Room High Tom 2
<–
Room High Tom 1
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
-----------------
[88]
*
[EXC1]
*
[EXC1]
*
[EXC1]
*
*
*
PC10
Hip-Hop
<–
<–
<–
<–
<–
<–
<–
Scratch Push 2
Scratch Pull 2
<–
<–
<–
<–
Hip-Hop Kick 2
Hip-Hop Kick 1
TR-808 Rim Shot
Rap Snare
<–
Hip-Hop Snare 2
TR-909 Low Tom 2
Room Closed Hi-Hat
TR-909 Low Tom 1
Pedal Hi-Hat
TR-909 Mid Tom 2
Room Open Hi-Hat
TR-909 Mid Tom 1
TR-909 High Tom 2
TR-909 Crash Cymbal
TR-909 High Tom 1
<–
Reverse Cymbal
<–
Shake Tambourine
<–
TR-808 Cowbell
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
TR-808 Maracas
<–
<–
<–
CR-78 Guiro
TR-808 Claves
<–
<–
High Hoo
Low Hoo
Mute Triangle
Open Triangle
TR-626 Shaker
<–
<–
<–
<–
<–
Small Club 1
-----------------
[EXC7]
[EXC7]
[EXC1]
[EXC1]
[EXC1]
[EXC3]
[EXC4]
[EXC4]
*
C7 96
201
>3UR@
>@
>@
>(;&@
Bijlagen
=HOIGHDOVGHSHUFXVVLHNODQNYDQ6&
=HOIGHDOVGHSHUFXVVLHNODQNYDQ6&
=HOIGHDOVGHSHUFXVVLHNODQNYDQ6&
3HUFXVVLHNODQNPHWKHW]HOIGHQXPPHU
NDQQLHWWHJHOLMNHUWLMGJHKRRUGZRUGHQ
3& 3URJUDPQXPPHU'UXPVHWQXPPHU
² =HOIGHDOVGHSHUFXVVLHNODQNYDQ
67$1'$5'3&
*HHQNODQN
7RQHQGLHPHWWZHHVWHPPHQ]LMQJHPDDNW
SC-88Pro Drum Set (2)
=LHSYRRUGHWDLOVRYHU²HQ²
22
23
C1 24
25
26
28
29
27
30
31
32
33
34
35
C2 36
37
38
40
41
39
42
43
44
45
46
47
C3 48
49
50
52
53
51
54
55
56
57
58
59
C4 60
61
62
64
65
63
66
67
68
69
70
71
C5 72
73
74
76
77
75
78
79
80
81
82
83
C6 84
85
86
88
89
87
90
91
92
93
94
95
C7 96
202
PC 11
JUNGLE
<–
<–
<–
<–
<–
<–
<–
Scratch Push 2
Scratch Pull 2
<–
<–
<–
<–
Jungle Kick 2
Jungle Kick 1
<–
Jungle Snare 1
Hand Clap 2
Jungle Snare 2
TR-909 Low Tom 2
TR-606 Closed Hi-Hat
TR-909 Low Tom 1
Jungle Hi-Hat
TR-909 Mid Tom 2
TR-606 Open Hi-Hat
TR-909 Mid Tom 1
TR-909 High Tom 2
TR-808 Crash Cymbal
TR-909 High Tom 1
<–
Reverse Cymbal
<–
Shake Tambourine
<–
TR-808 Cowbell
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
TR-808 Maracas
<–
<–
<–
CR-78 Guiro
TR-808 Claves
<–
<–
High Hoo
Low Hoo
Mute Triangle
Open Triangle
TR-626 Shaker
<–
<–
<–
<–
<–
Small Club 1
------------------
[EXC7]
[EXC7]
[EXC1]
[EXC1]
[EXC1]
[EXC3]
[EXC4]
[EXC4]
*
PC 12
TECHNO
<–
<–
<–
<–
<–
<–
<–
Scratch Push 2
Scratch Pull 2
<–
<–
<–
<–
Techno Kick 2
Techno Kick 1
TR-808 Rim Shot
Techno Snare 1
TR-707 Hand Clap
Techno Snare 2
TR-808 Low Tom 2
TR-707 Closed Hi-Hat
TR-808 Low Tom 1
CR-78 Closed Hi-Hat
TR-808 Mid Tom 2
TR-909 Open Hi-Hat
TR-808 Mid Tom 1
TR-808 High Tom 2
TR-909 Crash Cymbal
TR-808 High Tom 1
<–
Reverse Cymbal
<–
Shake Tambourine
<–
TR-808 Cowbell
TR-909 Crash Cymbal
<–
<–
CR-78 High Bongo
CR-78 Low Bongo
TR-808 High Conga
TR-808 Mute Conga
TR-808 Low Conga
<–
<–
<–
<–
<–
TR-808 Maracas
<–
<–
<–
CR-78 Guiro
TR-808 Claves
<–
<–
High Hoo
Low Hoo
Mute Triangle
Open Triangle
TR-626 Shaker
<–
<–
<–
<–
<–
<–
-----------------
[EXC7]
[EXC7]
*
[EXC1]
*
[EXC1]
*
[EXC1]
*
*
*
[EXC3]
[EXC4]
[EXC4]
PC 17
POWER
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
Power Kick 2
Power Kick 1
<–
Power Snare 1
Hand Clap
Power Snare 2
Power Low Tom 2
<–
Power Low Tom 1
<–
Power Mid Tom 2
<–
Power Mid Tom 1
Power High Tom 2
<–
Power High Tom 1
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
-----------------
[EXC7]
[EXC7]
*
*
*
*
*
*
PC 25
ELECTRONIC
<–
<–
<–
<–
Finger Snap 2
<–
<–
Scratch Push 2
Scratch Pull 2
<–
<–
<–
<–
Electric Kick 2
Electric Kick 1
<–
Electric Snare 1
Hand Clap
Electric Snare 2
Electric Low Tom 2
Closed Hi-Hat 2
Electric Low Tom 1
Pedal Hi-Hat
Electric Mid Tom 2
Open Hi-Hat 2
Electric Mid Tom 1
Electric High Tom 2
<–
Electric High Tom 1
<–
Reverse Cymbal
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
Small Club 1
-----------------
[88]
[EXC7]
[EXC7]
*
*
[EXC1]
*
[EXC1]
*
[EXC1]
*
*
*
*
PC 26
TR-808
<–
<–
<–
<–
<–
<–
<–
Scratch Push 2
[EXC7]
Scratch Pull 2
[EXC7]
<–
<–
<–
<–
TR-808 Kick 2
TR-808 Kick 1
TR-808 Rim Shot
TR-808 Snare 1
Hand Clap
TR-808 Snare 2
TR-808 Low Tom 2
*
TR-808 Closed Hi-Hat 2 [EXC1]
TR-808 Low Tom 1
*
TR-808 Closed Hi-Hat
[EXC1]
TR-808 Mid Tom 2
*
TR-808 Open Hi-Hat
[EXC1]
TR-808 Mid Tom 1
*
TR-808 High Tom 2
*
TR-808 Crash Cymbal
TR-808 High Tom 1
*
TR-606 Ride Cymbal
<–
<–
CR-78 Tambourine
<–
TR-808 Cowbell
TR-909 Crash Cymbal
<–
Ride Cymbal 2
CR-78 High Bongo
CR-78 Low Bongo
TR-808 High Conga
TR-808 Mute Conga
TR-808 Low Conga
<–
<–
<–
<–
<–
TR-808 Maracas
<–
<–
<–
CR-78 Guiro
[EXC3]
TR-808 Claves
<–
<–
High Hoo
[EXC4]
Low Hoo
[EXC4]
Mute Triangle
Open Triangle
TR-626 Shaker
<–
<–
<–
<–
<–
Small Club 1
*
-----------------
Bijlagen
SC-88Pro Drum Set (3)
=LHSYRRUGHWDLOVRYHU²HQ²
22
23
C1 24
25
26
28
29
27
30
31
32
33
34
35
C2 36
37
38
40
41
39
42
43
44
45
46
47
C3 48
49
50
52
53
51
54
55
56
57
58
59
C4 60
61
62
64
65
63
66
67
68
69
70
71
C5 72
73
74
76
77
75
78
79
80
81
82
83
C6 84
85
86
88
89
87
90
91
92
93
94
95
C7 96
PC 27
DANCE
<–
<–
<–
<–
Finger Snap 2
<–
<–
Scratch Push 2
Scratch Pull 2
<–
<–
<–
<–
TR-909 Comp Kick
Electric Kick 2
<–
House Snare
<–
Dance Snare 2
Electric Low Tom 2
CR-78 Closed Hi-Hat
Electric Low Tom 1
TR-808 Closed Hi-Hat 2
Electric Mid Tom 2
CR-78 Open Hi-Hat
Electric Mid Tom 1
Electric High Tom 2
TR-808 Crash Cymbal
Electric High Tom 1
TR-606 Ride Cymbal
Reverse Cymbal
<–
Shake Tambourine
<–
TR-808 Cowbell
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
High Hoo
Low Hoo
Mute Triangle
Open Triangle
TR-626 Shaker
<–
<–
<–
<–
<–
Small Club 1
-----------------
[EXC7]
[EXC7]
*
[EXC1]
*
[EXC1]
*
[EXC1]
*
*
*
[EXC4]
[EXC4]
*
PC 28
CR-78
<–
<–
<–
<–
<–
<–
<–
Scratch Push 2
Scratch Pull 2
<–
<–
<–
<–
CR-78 Kick 2
CR-78 Kick 1
CR-78 Rim Shot
CR-78 Snare 1
TR-707 Hand Clap
CR-78 Snare 2
CR-78 Low Tom 2
CR-78 Closed Hi-Hat
CR-78 Low Tom 1
TR-606 Closed Hi-Hat
CR-78 Mid Tom 2
CR-78 Open Hi-Hat
CR-78 Mid Tom 1
CR-78 High Tom 2
TR-808 Crash Cymbal
CR-78 High Tom 1
TR-606 Ride Cymbal
<–
<–
CR-78 Tambourine
<–
CR-78 Cowbell
TR-909 Crash Cymbal
<–
Ride Cymbal Edge
CR-78 High Bongo
CR-78 Low Bongo
TR-808 High Conga
TR-808 Mute Conga
TR-808 Low Conga
<–
<–
<–
<–
<–
CR-78 Maracas
<–
<–
<–
CR-78 Guiro
CR-78 Claves
<–
<–
High Hoo
Low Hoo
CR-78 Metalic Beat 1
CR-78 Metalic Beat 2
TR-626 Shaker
<–
<–
<–
<–
<–
Small Club 1
-----------------
[EXC7]
[EXC7]
*
[EXC1]
*
[EXC1]
*
[EXC1]
*
*
*
[EXC3]
[EXC4]
[EXC4]
[EXC5]
[EXC5]
*
PC 29
TR-606
<–
<–
<–
<–
<–
<–
<–
Scratch Push 2
Scratch Pull 2
<–
<–
<–
<–
CR-78 Kick 2
TR-606 Kick 1
CR-78 Rim Shot
TR-606 Snare 1
TR-707 Hand Clap
TR-606 Snare 2
TR-606 Low Tom 2
TR-606 Closed Hi-Hat
TR-606 Low Tom 1
TR-606 Closed Hi-Hat
TR-606 Mid Tom 2
TR-606 Open Hi-Hat
TR-606 Mid Tom 1
TR-606 High Tom 2
TR-808 Crash Cymbal
TR-606 High Tom 1
TR-606 Ride Cymbal
<–
<–
CR-78 Tambourine
<–
CR-78 Cowbell
TR-909 Crash Cymbal
<–
Ride Cymbal Edge
CR-78 High Bongo
CR-78 Low Bongo
TR-808 High Conga
TR-808 Mute Conga
TR-808 Low Conga
<–
<–
<–
<–
<–
CR-78 Maracas
<–
<–
<–
CR-78 Guiro
CR-78 Claves
<–
<–
High Hoo
Low Hoo
CR-78 Metalic Beat 1
CR-78 Metalic Beat 2
TR-626 Shaker
<–
<–
<–
<–
<–
Small Club 1
-----------------
[EXC7]
[EXC7]
[EXC1]
[EXC1]
[EXC1]
[EXC3]
[EXC4]
[EXC4]
[EXC5]
[EXC5]
*
PC 30
TR-707
<–
<–
<–
<–
<–
<–
<–
Scratch Push 2
Scratch Pull 2
<–
<–
<–
<–
TR-707 Kick 2
TR-707 Kick 1
TR-707 Rim Shot
TR-707 Snare 1
TR-707 Hand Clap
TR-707 Snare 2
TR-707 Low Tom 2
TR-707 Closed Hi-Hat
TR-707 Low Tom 1
TR-707 Closed Hi-Hat
TR-707 Mid Tom 2
TR-707 Open Hi-Hat
TR-707 Mid Tom 1
TR-707 High Tom 2
TR-909 Crash Cymbal
TR-707 High Tom 1
TR-909 Ride Cymbal
<–
<–
Tambourine 2
<–
TR-808 Cowbell
<–
<–
Ride Cymbal Edge
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
TR-808 Maracas
<–
<–
<–
<–
<–
<–
<–
High Hoo
Low Hoo
Mute Triangle
Open Triangle
TR-626 Shaker
<–
<–
<–
<–
<–
Small Club 1
-----------------
[EXC7]
[EXC7]
*
[EXC1]
*
[EXC1]
*
[EXC1]
*
*
*
*
[EXC4]
[EXC4]
*
203
>3UR@
>@
>@
>(;&@
Bijlagen
3& 3URJUDPQXPPHU'UXPVHWQXPPHU
² =HOIGHDOVGHSHUFXVVLHNODQNYDQ
67$1'$5'3&
*HHQNODQN
7RQHQGLHPHWWZHHVWHPPHQ]LMQJHPDDNW
=HOIGHDOVGHSHUFXVVLHNODQNYDQ6&
=HOIGHDOVGHSHUFXVVLHNODQNYDQ6&
=HOIGHDOVGHSHUFXVVLHNODQNYDQ6&
3HUFXVVLHNODQNPHWKHW]HOIGHQXPPHU
NDQQLHWWHJHOLMNHUWLMGJHKRRUGZRUGHQ
SC-88Pro Drum Set (4)
=LHSYRRUGHWDLOVRYHU²HQ²
22
23
C1 24
25
26
28
29
27
30
31
32
33
34
35
C2 36
37
38
40
41
39
42
43
44
45
46
47
C3 48
49
50
52
53
51
54
55
56
57
58
59
C4 60
61
62
64
65
63
66
67
68
69
70
71
C5 72
73
74
76
77
75
78
79
80
81
82
83
C6 84
85
86
88
89
87
90
91
92
93
94
95
C7 96
204
PC 31
TR-909
<–
<–
<–
<–
<–
<–
<–
Scratch Push 2
Scratch Pull 2
<–
<–
<–
<–
TR-909 Kick 2
TR-909 Kick 1
TR-909 Rim
TR-909 Snare 1
<–
TR-909 Snare2
TR-909 Low Tom 2
TR-707 Closed Hi-Hat
TR-909 Low Tom 1
TR-707 Closed Hi-Hat
TR-909 Mid Tom 2
TR-909 Open Hi-Hat
TR-909 Mid Tom 1
TR-909 High Tom 2
TR-909 Crash Cymbal
TR-909 High Tom 1
TR-909 Ride Cymbal
<–
<–
Tambourine 2
<–
TR-808 Cowbell
<–
<–
Ride Cymbal Edge
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
TR-808 Maracas
<–
<–
<–
CR-78 Guiro
TR-808 Claves
<–
<–
High Hoo
Low Hoo
Mute Triangle
Open Triangle
TR-626 Shaker
<–
<–
<–
<–
<–
<–
-----------------
[EXC7]
[EXC7]
*
[EXC1]
[EXC1]
[EXC1]
*
[EXC3]
[EXC4]
[EXC4]
PC 33
JAZZ
<–
<–
<–
<–
Finger Snap 2
<–
<–
<–
<–
<–
<–
<–
<–
Jazz Kick 2
Jazz Kick 1
<–
Jazz Snare 1
Hand Clap 2
Jazz Snare 2
<–
Closed Hi-Hat 2
<–
Pedal Hi-Hat
<–
Open Hi-Hat 2
<–
<–
<–
<–
Ride Cymbal Inner
<–
<–
<–
<–
<–
<–
<–
Ride Cymbal Edge
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
Applause
-----------------
[EXC1]
[EXC1]
[EXC1]
*
PC 41
BRUSH
<–
<–
<–
<–
Finger Snap 2
<–
<–
<–
<–
<–
<–
<–
<–
Jazz Kick 2
Jazz Kick 1
<–
Brush Tap 1
Brush Slap 1
Brush Swirl 1
Brush Low Tom 2
Brush Closed Hi-Hat
Brush Low Tom 1
Pedal Hi-Hat
Brush Mid Tom 2
Brush Open Hi-Hat
Brush Mid Tom 1
Brush High Tom 2
Brush Crash Cymbal
Brush High Tom 1
Ride Cymbal Inner
<–
Brush Ride Bell
<–
<–
<–
<–
<–
Ride Cymbal Edge
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
Applause
-----------------
*
[EXC1]
*
[EXC1]
*
[EXC1]
*
*
*
*
PC 49
ORCHESTRA
<–
<–
<–
<–
Finger Snap
Closed Hi-Hat 2
Pedal Hi-Hat
Open Hi-Hat 2
Ride Cymbal 1
<–
<–
<–
<–
Jazz Kick 1
Concert BD 1
<–
Concert SD
Castanets
Concert SD
Timpani F
Timpani F#
Timpani G
Timpani G#
Timpani A
Timpani A#
Timpani B
Timpani c
Timpani c#
Timpani d
Timpani d#
Timpani e
Timpani f
<–
<–
<–
Concert Cymbal 2
<–
Concert Cymbal 1
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
Applause
-----------------
[88]
[EXC1]
[EXC1]
[EXC1]
*
Bijlagen
SC-88Pro Drum Set (5)
=LHSYRRUGHWDLOVRYHU²HQ²
25
26
28
29
27
30
31
32
33
34
35
C2 36
37
38
40
41
39
42
43
44
45
46
47
C3 48
49
50
52
53
51
54
55
56
57
58
59
C4 60
61
62
64
65
63
66
67
68
69
70
71
C5 72
73
74
76
77
75
78
79
80
81
82
83
C6 84
85
86
88
89
87
90
91
92
93
94
95
C7 96
97
98
99
PC 50
ETHNIC
Finger Snap
Tambourine
Castanets
Crash Cymbal 1
Snare Roll
Concert SD
Concert Cymbal
Concert BD 1
Jingle Bell
Bell Tree
Bar Chimes
Wadaiko
Wadaiko Rim
Shime Taiko
Atarigane
Hyoushigi
Ohkawa
High Kotsuzumi
Low Kotsuzumi
Ban Gu
Big Gong
Small Gong
Bend Gong
Thai Gong
Rama Cymbal
Gamelan Gong
Udo Short
Udo Long
Udo Slap
Bendir
Req Dum
Req Tik
Tabla Te
Tabla Na
Tabla Tun
Tabla Ge
Tabla Ge Hi
Talking Drum
Bend Talking Drum
Caxixi
Djembe
Djembe Rim
Timbales Low
Timbales Paila
Timbales High
Cowbell
High Bongo
Low Bongo
Mute High Conga
Open High Conga
Mute Low Conga
Conga Slap
Open Low Conga
Conga Slide
Mute Pandiero
Open Pandiero
Open Surdo
Mute Surdo
Tamborim
High Agogo
Low Agogo
Shaker
High Whistle
Low Whistle
Mute Cuica
Open Cuica
Mute Triangle
Open Triangle
Short Guiro
Long Guiro
Cabasa Up
Cabasa Down
Claves
High Wood Block
Low Wood Block
[88]
*
*
[EXC1]
[EXC1]
*
*
*
[EXC2]
[EXC2]
[EXC3]
[EXC3]
[EXC4]
[EXC4]
[EXC5]
[EXC5]
[EXC6]
[EXC6]
PC 51
KICK & SNARE
CR-78 Kick 1
CR-78 Kick 2
TR-606 Kick
TR-707 Kick
TR-808 Kick 1
TR-909 Kick 1
TR-909 Kick 2
Hip-Hop Kick 2
Hip-Hop Kick 1
Jungle Kick 2
Jungle Kick 1
Techno Kick 2
Techno KicK 1
Standard 1 Kick 2
Standard 1 Kick 1
[88] Standard 1 Kick 1
[88] Standard 1 Kick 2
[88] Standard 2 Kick 1
[88] Standard 2 Kick 2
[55] Kick Drum1
[55] Kick Drum 2
[88] Soft Kick
[88] Jazz Kick 1
[88] Jazz Kick 2
[55] Concert BD 1
[88] Room Kick 1
[88] Room Kick 2
[88] Power Kick1
[88] Power Kick2
[88] Electric Kick 2
[88] Electric Kick 1
[55] Electric Kick
[88] TR-808 Kick
[88] TR-909 Kick
[88] Dance Kick
[88] Standard 1 Snare 1
[88] Standard 1 Snare 2
[88] Standard 2 Snare 1
[88] Standard 2 Snare 2
[55] Tight Snare
[55] Concert Snare
[88] Jazz Snare 1
[88] Jazz Snare 2
[88] Room Snare 1
[88] Room Snare 2
[88] Power Snare 1
[88] Power Snare 2
[55] Gated Snare
[88] Dance Snare 1
[88] Dance Snare 2
[88] Disco Snare
[88] Electric Snare 2
[88] House Snare
[55] Electric Snare 1
[88] Electric Snare 3
[88] TR-808 Snare 1
[88] TR-808 Snare 2
[88] TR-909 Snare 1
[88] TR-909 Snare 2
[88] Brush Tap 1
[88] Brush Tap 2
[88] Brush Slap 1
[88] Brush Slap 2
[88] Brush Slap 3
[88] Brush Swirl 1
[88] Brush Swirl 2
[88] Brush Long Swirl
Standard 1 Snare 1
Standard 1 Snare 2
Standard 1 Snare 3
Rap Snare
Hip-Hop Snare 2
Jungle Snare 1
Jungle Snare 2
Techno Snare 1
[88]
*
*
*
*
*
*
PC 53
ASIA
Gamelan Gong 1
Gamelan Gong 2
Gamelan Gong 3
Gamelan Gong 4
Gamelan Gong 5
Gamelan Gong 6
Gamelan Gong 7
Gamelan Gong 8
Gamelan Gong 9
Gamelan Gong 10
Gender 1
Gender 2
Gender 3
Gender 4
Gender 5
Bonang 1
Bonang 2
Bonang 3
Bonang 4
Bonang 5
Rama Cymbal Low
Rama Cymbal High
Sagat Open
Sagat Closed
Jaws Harp
Wadaiko
Wadaiko Rim
Small Taiko
Shimedaiko
Atarigane
Hyoushigi
Ohkawa
High Kotsuzumi
Low Kotsuzumi
Yyoo Dude
Buk
Buk Rim
Gengari p
Gengari Mute Low
Gengari f
Gengari Mute High
Gengari Samll
Jang-Gu Che
Jang-Gu Kun
Jang-Gu Rim
Jing p
Jing f
Jing Mute
Asian Gong
Big Gong
Small Gong
Pai Ban
Ban Gu
Tang Gu
Tang Gu Mute
Shou Luo
Bend Gong
Hu Yin Luo Low
Hu Yin Luo Mid
Hu Yin Luo Mid 2
Hu Yin Luo High
Hu Yin Luo High 2
Nao Bo
Xiao Bo
-----------------------
[EXC7]
[EXC7]
*
*
[EXC1]
[EXC1]
[EXC2]
[EXC2]
*
[EXC3]
[EXC3]
[EXC3]
[EXC4]
[EXC4]
*
*
[EXC5]
[EXC5]
[EXC6]
[EXC6]
PC 54
CYMBAL&CLAPS
--------------Reverse Open Hi-Hat
Reverse Closed Hi-Hat 1
Reverse Closed Hi-Hat 2
Jungle Hi-Hat
[55] Closed Hi-Hat
[88] Closed Hi-Hat 2
[88] Closed Hi-Hat 3
Closed Hi-Hat 4
Closed Hi-Hat
TR-707 Closed Hi-Hat
TR-606 Closed Hi-Hat
[88] TR-808 Closed Hi-Hat
TR-808 Closed Hi-Hat
CR-78 Closed Hi-Hat
[55] Pedal Hi-Hat
[88] Pedal Hi-Hat
Pedal Hi-Hat
Half-Open Hi-Hat 1
Half-Open Hi-Hat 2
[55] Open Hi Hat
[88] Open Hi-Hat 2
[88] Open Hi-Hat 3
Open Hi-Hat 2
TR-909 Open Hi-Hat
TR-707 Open Hi-Hat
TR-606 Open Hi-Hat
[88] TR-808 Open Hi-Hat
TR-808 Open Hi-Hat
CR-78 Open Hi-Hat
Crash Cymbal 1
Crash Cymbal 2
Crash Cymbal 3
Brush Crash Cymbal
Hard Crash Cymbal
TR-909 Crash Cymbal
TR-808 Crash Cymbal
Mute Crash Cymbal 1
Mute Crash Cymbal 2
Reverse Crash Cymbal 1
Reverse Crash Cymbal 2
Reverse Crash Cymbal 3
Reverse TR-909 Crash Cymbal
[55] Splash Cymbal
Splash Cymbal
[88] Ride Bell
[88] Brush Ride Bell
[88] Ride Cymbal 1
[88] Ride Cymbal 2
[88] Brush Ride Cymbal
Ride Cymbal Low Inner
Ride Cymbal Mid Inner
Ride Cymbal High Inner
Ride Cymbal Low Edge
Ride Cymbal Mid Edge
Ride Cymbal High Edge
TR-606 Ride Cymbal
TR-808 Ride Cymbal
Chinese Cymbal
Chinese Cymbal 2
[55] Hand Clap
[88] Hand Clap 2
[88] Hand Clap
Hand Clap
Hand Clap 2
TR-707 Hand Clap
-------
[EXC1]
[EXC1]
[EXC1]
[EXC1]
[EXC1]
[EXC1]
[EXC1]
[EXC1]
[EXC1]
[EXC1]
[EXC1]
[EXC1]
[EXC1]
[EXC1]
[EXC1]
[EXC1]
[EXC1]
[EXC1]
[EXC1]
[EXC1]
[EXC1]
[EXC1]
[EXC1]
[EXC1]
[EXC1]
[EXC1]
[EXC3]
[EXC4]
*
[EXC3]
[EXC4]
205
>3UR@
>@
>@
>(;&@
Bijlagen
=HOIGHDOVGHSHUFXVVLHNODQNYDQ6&
=HOIGHDOVGHSHUFXVVLHNODQNYDQ6&
=HOIGHDOVGHSHUFXVVLHNODQNYDQ6&
3HUFXVVLHNODQNPHWKHW]HOIGHQXPPHU
NDQQLHWWHJHOLMNHUWLMGJHKRRUGZRUGHQ
SC-88Pro Drum Set (6)
21
22
23
C1 24
25
26
28
29
27
30
31
32
33
34
35
C2 36
37
38
40
41
39
42
43
44
45
46
47
C3 48
49
50
52
53
51
54
55
56
57
58
59
C4 60
61
62
64
65
63
66
67
68
69
70
71
C5 72
73
74
76
77
75
78
79
80
81
82
83
C6 84
85
86
88
89
87
90
91
92
93
94
95
C7 96
206
PC 57
SFX
MC-500 Beep 1
MC-500 Beep 2
Guitar Slide
Guitar Wah
Guitar Slap
Chord Stroke Down
Chord Stroke Up
Biwa FX
Phonograph Noise
Tape Rewind
Scratch Push 2
Scratch Pull 2
Cutting Noise 2 Up
Cutting Noise 2 Down
Distortion Guitar Cutting Noise Up
Distortion Guitar Cutting Noise Down
Bass Slide
Pick Scrape
High Q
Slap
Scratch Push
Scratch Pull
Sticks
Square Click
Metronome Click
Metronome Bell
Guitar Fret Noise
Guitar Cutting Noise Up
Guitar Cutting Noise Down
String Slap of Double Bass
Flute Key Click Noise
Laughing
Screaming
Punch
Heart Beat
Footsteps 1
Footsteps 2
Applause
Door Creaking
Door
Scratch
Wind Chimes
Car - Engine
Car - Stop
Car - Passing
Car - Crash
Siren
Train
Jetplane
Helicopter
Starship
Gun Shot
Machine Gun
Laser Gun
Explosion
Dog
Horse-Gallop
Birds
Rain
Thunder
Wind
Seashore
Stream
Bubble
Kitty
Bird 2
Growl
<–
Telephone 1
Telephone 2
Small Club 1
Small Club 2
Applause Wave
Eruption
Big Shot
Percussion Bang
*
[EXC1]
[EXC1]
[EXC7]
[EXC7]
*
*
*
*
*
*
*
*
*
*
*
*
*
*
PC 58
RHYTHM FX
------------------------------Reverse Kick 1
Reverse Concert Bass Drum
Reverse Power Kick1
Reverse Electric Kick 1
Reverse Snare 1
Reverse Snare 2
Reverse Standard 1 Snare 1
Reverse Tight Snare
Reverse Dance Snare
Reverse 808 Snare
Reverse Tom 1
Reverse Tom 2
Reverse Sticks
Reverse Slap
Reverse Cymbal 1
Reverse Cymbal 2
Reverse Open Hi-Hat
Reverse Ride Cymbal
Reverse CR-78 Open Hi-Hat
Reverse Closed Hi-Hat
Reverse Gong
Reverse Bell Tree
Reverse Guiro
Reverse Bendir
Reverse Gun Shot
Reverse Scratch
Reverse Laser Gun
Key Click
Techno Thip
Pop Drop
Woody Slap
Distortion Kick
Syn. Drops
Reverse Hi Q
Pipe
Ice Block
Digital Tambourine
Alias
Modulated Bell
Spark
Metallic Percussion
Velocity Noise FX
Stereo Noise Clap
Swish
Slappy
Voice Ou
Voice Au
Hoo
Tape Stop 1
Tape Stop 2
Missile
Space Birds
Flying Monster
-----------------
[88]
*
*
*
*
*
*
*
PC 59
RHYTHM FX 2
------------------------------Reverse TR-707 Kick 1
Reverse TR-909 Kick 1
Reverse Hip-Hop Kick 1
Reverse Jungle Kick 2
Reverse Techno Kick 2
Reverse TR-606 Snare 2
Reverse CR-78 Snare 1
Reverse CR-78 Snare 2
Reverse Jungle Snare 2
Reverse Techno Snare 2
Reverse TR-707 Snare
Reverse TR-606 Snare 1
Reverse TR-909 Snare 1
Reverse Hip-Hop Snare 2
Reverse Jungle Snare 1
Reverse House Snare
Reverse Closed Hi-Hat
Reverse TR-606 Closed Hi-Hat
Reverse TR-707 Closed Hi-Hat
Reverse TR-808 Closed Hi-Hat
Reverse Jungle Hi-Hat
Reverse Tambourine 2
Reverse Shake Tambourine
Reverse TR-808 Open Hi-Hat
Reverse TR-707 Open Hi-Hat
Reverse Open Hi-Hat
Reverse TR-606 Open Hi-Hat
Reverse Hu Yin Luo
Reverse TR-707 Crash Cymbal
Voice One
Reverse Voice One
Voice Two
Reverse Voice Two
Voice Three
Reverse Voice Three
Voice Tah
Reverse Voice Tah
Voice Ou
Voice Au
Voice Whey
Frog Vpoce
Reverse Yyoo Dude
Douby
Reverse Douby
Baert High
Baert Low
Bounce
Reverse bounce
Distortion Knock
Guitar Slide
Sub Marine
Noise Attack
Space Worms
Emergency !
Calculating...
Saw LFO
-----------
*
*
*
*
3& 3URJUDPQXPPHU'UXPVHWQXPPHU
² =HOIGHDOVGHSHUFXVVLHNODQNYDQ
67$1'$5'3&
*HHQNODQN
7RQHQGLHPHWWZHHVWHPPHQ]LMQJHPDDNW
Bijlagen
SC-88Pro Drum Set (7)
1RWHQ²HQ²]LMQDOVYROJW
C-1 0
1
2
4
5
3
6
7
8
9
10
11
C0 12
13
14
16
17
15
18
19
97
98
99
100
101
102
103
104
105
106
107
C8 108
109
110
111
112
113
114
115
116
117
118
119
C9 120
121
122
123
124
125
126
127
PC 1 STANDARD 1
PC 2 STANDARD 2
PC 3 STANDARD 3
PC 9 ROOM
PC 17 POWER
[88] Standard 1 Kick 1
[88] Standard 1 Kick 2
[88] Standard 2 Kick 1
[88] Standard 2 Kick 2
[55] Kick Drum 1
[55] Kick Drum 2
[88] Jazz Kick 1
[88] Jazz Kick 2
[88] Room Kick 1
[88] Room Kick 2
[88] Power Kick 1
[88] Power Kick 2
[88] Electric Kick 2
[88] Electric Kick 1
[88] TR-808 Kick
[88] TR-909 Kick
[88] Dance Kick
Voice One
Voice Two
Voice Three
:
:
:
[88] Standard 1 Snare1
[88] Standard 1 Snare 2
[88] Standard 2 Snare 1
[88] Standard 2 Snare 2
[55] Snare Drum 2
Standard 1 Snare 1
Standard 1 Snare 2
Standard 1 Snare 3
[88] Jazz Snare 1
[88] Jazz Snare 2
[88] Room Snare 1
[88] Room Snare 2
[88] Power Snare 1
[88] Power Snare 2
[55] Gated Snare
[88] Dance Snare 1
[88] Dance Snare 2
[88] Disco Snare
[88] Electric Snare 2
[55] Electric Snare
[88] Electric Snare 3
TR-707 Snare 1
[88] TR-808 Snare 1
[88] TR-808 Snare 2
[88] TR-909 Snare 1
[88] TR-909 Snare 2
Rap Snare
Jungle Snare 1
House Snare 1
[88] House Snare
House Snare 2
*
*
*
*
*
PC 10 Hip-Hop
PC 11 JUNGLE
PC 12 TECHNO
PC 25 ELECTRONIC
PC 26 TR-808
PC 27 DANCE
PC 28 CR-78
PC 29 TR-606
PC 30 TR-707
PC 31 TR-909
[88] Electric Kick 2
[88] Electric Kick 1
CR-78 Kick 1
CR-78 Kick 2
TR-606 Kick1
TR-707 Kick 1
[55] TR-808 Kick
[88] TR-808 Kick
TR-808 Kick 2
[88] TR-909 Kick
[88] Dance Kick
Hip-Hop Kick 2
TR-909 Kick 1
Hip-Hop Kick 3
Jungle Kick 1
Techno Kick 1
Bounce Kick
<–
<–
<–
:
:
:
Techno Hit
Philly Hit
Impact Hit
Lo-Fi Rave
Bam Hit
Bim Hit
Tape Rewind
Phonograph Noise
[88] Power Snare 1
[88] Dance Snare 1
[88] Dance Snare 2
[88] Disco Snare
[88] Electric Snare 2
[55] Electric Snare
[88] Electric Snare 3
TR-606 Snare 2
TR-707 Snare 1
[88] TR-808 Snare 2
[88] TR-808 Snare 1
TR-808 Snare 2
[88] TR-909 Snare 1
[88] TR-909 Snare 2
TR-909 Snare 1
TR-909 Snare 2
Rap Snare
Jungle Snare
House Snare 1
[88] House Snare
House Snare 2
Voice Tah
[88] Slappy
*
*
*
*
*
*
*
*
*
*
PC 33 JAZZ
PC 41 BRUSH
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
:
:
:
------[88] Brush Tap 1
[88] Brush Tap 2
[88] Brush Slap 1
[88] Brush Slap 2
[88] Brush Slap 3
[88] Brush Swirl 1
[88] Brush Swirl 2
[88] Brush Long Swirl
[88] Jazz Snare 1
[88] Jazz Snare 2
[88] Standard 1 Snare1
[88] Standard 1 Snare2
[88] Standard 2 Snare1
[88] Standard 2 Snare2
[55] Snare Drum 2
Standard 1 Snare 1
Standard 1 Snare 2
Standard 1 Snare 3
[88] Room Snare 1
[88] Room Snare 2
[88] Power Snare 1
[88] Power Snare 2
[88] Gated Snare
[88] Dance Snare 1
[88] Dance Snare 2
[88] Disco Snare
[88] Electric Snare 2
[88] Electric Snare 3
*
PC 49 ORCHESTRA
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
:
:
:
Applause 2
Small Club 1
[55] Timpani D#
[55] Timpani E
[55] Timpani F
[55] Timpani F#
[55] Timpani G
[55] Timpani G#
[55] Timpani A
[55] Timpani A#
[55] Timpani B
[55] Timpani c
[55] Timpani c#
[55] Timpani d
[55] Timpani d#
[55] Timpani e
[55] Timpani f
-----------------------------
*
*
PC 51 KICK & SNARE
----------------------------------------:
:
:
Jungle Snare 1
Jungle Snare 2
Techno Snare 1
Techno Snare 2
House Snare 2
CR-78 Snare 1
CR-78 Snare 2
TR-606 Snare 1
TR-606 Snare 2
TR-707 Snare 1
TR-707 Snare 2
Standard 3 Snare 2
TR-808 Snare 2
TR-909 Snare 1
TR-909 Snare 2
---------------------------------
207
>3UR@
>@
>@
>(;&@
Bijlagen
=HOIGHDOVGHSHUFXVVLHNODQNYDQ6&
=HOIGHDOVGHSHUFXVVLHNODQNYDQ6&
=HOIGHDOVGHSHUFXVVLHNODQNYDQ6&
3HUFXVVLHNODQNPHWKHW]HOIGHQXPPHU
NDQQLHWWHJHOLMNHUWLMGJHKRRUGZRUGHQ
3& 3URJUDPQXPPHU'UXPVHWQXPPHU
² =HOIGHDOVGHSHUFXVVLHNODQNYDQ
67$1'$5'3&
*HHQNODQN
7RQHQGLHPHWWZHHVWHPPHQ]LMQJHPDDNW
SC-88 Drum Set (1)
25
26
28
29
27
30
31
32
33
34
35
C2 36
37
38
40
41
39
42
43
44
45
46
47
C3 48
49
50
52
53
51
54
55
56
57
58
59
C4 60
61
62
64
65
63
66
67
68
69
70
71
C5 72
73
74
76
77
75
78
79
80
81
82
83
C6 84
85
86
88
89
87
90
91
92
93
94
95
C7 96
97
98
99
208
PC 1
STANDARD 1
Snare Roll
Finger Snap
High Q
Slap
Scratch Push
Scratch Pull
Sticks
Square Click
Metronome Click
Metronome Bell
Standard 1 Kick 2
Standard 1 Kick 1
Side Stick
Standard 1 Snare 1
Hand Clap
Standard 1 Snare 2
Low Tom2
Closed Hi-hat1
Low Tom1
Pedal Hi-hat
Mid Tom2
Open Hi-hat1
Mid Tom1
High Tom2
Crash Cymbal1
High Tom1
Ride Cymbal1
Chinese Cymbal
Ride Bell
Tambourine
Splash Cymbal
Cowbell
Crash Cymbal2
Vibra-slap
Ride Cymbal2
High Bongo
Low Bongo
Mute High Conga
Open High Conga
Low Conga
High Timbale
Low Timbale
High Agogo
Low Agogo
Cabasa
Maracas
Short Hi Whistle
Long Low Whistle
Short Guiro
Long Guiro
Claves
High Wood Block
Low Wood Block
Mute Cuica
Open Cuica
Mute Triangle
Open Triangle
Shaker
Jingle Bell
Bell Tree
Castanets
Mute Surdo
Open Surdo
-------------------------------------
[EXC7]
[EXC7]
*
[EXC1]
*
[EXC1]
*
[EXC1]
*
*
*
[EXC2]
[EXC2]
[EXC3]
[EXC3]
[EXC4]
[EXC4]
[EXC5]
[EXC5]
[EXC6]
[EXC6]
PC 2
STANDARD 2
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
Standard 2 Kick 2
Standard 2 Kick 1
<–
Standard 2 Snare 1
<–
Standard 2 Snare 2
<–
Closed Hi-hat2
<–
<–
<–
Open Hi-hat2
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
Bar Chimes
<–
<–
<–
-------------------------------------
[EXC1]
[EXC1]
PC 9
ROOM
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
Room Kick 2
Room Kick 1
<–
Room Snare 1
<–
Room Snare 2
Room Low Tom2
Closed Hi-hat3
Room Low Tom1
<–
Room Mid Tom2
Open Hi-hat3
Room Mid Tom1
Room Hi Tom2
<–
Room Hi Tom1
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
-------------------------------------
*
[EXC1]
*
*
[EXC1]
*
*
*
PC 17
POWER
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
Power Kick 2
Power Kick 1
<–
Power Snare 1
<–
Power Snare 2
Power Low Tom2
Closed Hi-hat3
Power Low Tom1
<–
Power Mid Tom2
Open Hi-hat3
Power Mid Tom1
Power Hi Tom2
<–
Power Hi Tom1
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
-------------------------------------
*
[EXC1]
*
*
[EXC1]
*
*
*
PC 25
ELECTRONIC
<–
<–
<–
<–
Scratch Push2
Scratch Pull2
<–
<–
<–
<–
Electric Kick 2
Electric Kick 1
<–
Electric Snare 1
<–
Electric Snare 2
Electric Low Tom2
Closed Hi-hat2
Electric Low Tom1
<–
Electric Mid Tom2
Open Hi-hat2
Electric Mid Tom1
Electric Hi Tom2
<–
Electric Hi Tom1
<–
Reverse Cymbal
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
-------------------------------------
[EXC7]
[EXC7]
*
[EXC1]
*
*
[EXC1]
*
*
*
Bijlagen
SC-88 Drum Set (2)
25
26
28
29
27
30
31
32
33
34
35
C2 36
37
38
40
41
39
42
43
44
45
46
47
C3 48
49
50
52
53
51
54
55
56
57
58
59
C4 60
61
62
64
65
63
66
67
68
69
70
71
C5 72
73
74
76
77
75
78
79
80
81
82
83
C6 84
85
86
88
89
87
90
91
92
93
94
95
C7 96
97
98
99
PC 26
TR-808/909
<–
<–
<–
<–
Scratch Push2
Scratch Pull2
<–
<–
<–
<–
909 Bass Drum
808 Bass Drum
808 Rim Shot
808 Snare 1
<–
909 Snare 1
808 Low Tom2
808 CHH
808 Low Tom1
808 CHH
808 Mid Tom2
808 OHH
808 Mid Tom1
808 Hi Tom2
808 Cymbal
808 Hi Tom1
<–
<–
<–
<–
<–
808 Cowbell
<–
<–
<–
<–
<–
808 High Conga
808 Mid Conga
808 Low Conga
<–
<–
<–
<–
<–
808 Maracas
<–
<–
<–
<–
808 Claves
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
-------------------------------------
[EXC7]
[EXC7]
*
[EXC1]
*
[EXC1]
*
[EXC1]
*
*
PC 27
DANCE
<–
<–
<–
<–
Scratch Push2
Scratch Pull2
<–
<–
<–
<–
Dance Kick
Electric Kick 2
<–
Dance Snare 1
<–
Dance Snare 2
Electric Low Tom2
CR-78 CHH
Electric Low Tom1
808 CHH
Electric Mid Tom2
CR-78 OHH
Electric Mid Tom1
Electric High Tom2
<–
Electric High Tom1
<–
Reverse Cymbal
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
High Hoo
Low Hoo
Electric Mute Triangle
Electric Open Triangle
<–
<–
<–
<–
<–
<–
-------------------------------------
[EXC7]
[EXC7]
*
[EXC1]
*
[EXC1]
*
[EXC1]
*
*
*
[EXC4]
[EXC4]
[EXC5]
[EXC5]
PC 33
JAZZ
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
Jazz Kick 2
Jazz Kick 1
<–
Jazz Snare 1
Hand Clap2
Jazz Snare 2
<–
Closed Hi-hat2
<–
<–
<–
Open Hi-hat2
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
-------------------------------------
[EXC1]
[EXC1]
PC 41
BRUSH
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
Jazz Kick 2
Jazz Kick 1
<–
Brush Tap1
Brush Slap1
Brush Swirl1
Brush Low Tom2
Brush Closed Hi-hat
Brush Low Tom1
<–
Brush Mid Tom2
Brush Open Hi-hat
Brush Mid Tom1
Brush Hi Tom2
Brush Crash Cymbal
Brush Hi Tom1
Brush Ride Cymbal
<–
Brush Ride Bell
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
-------------------------------------
*
[EXC1]
*
*
[EXC1]
*
*
*
PC 49
ORCHESTRA
<–
<–
Closed Hi-hat2
Pedal Hi-hat
Open Hi-hat2
Ride Cymbal1
<–
<–
<–
<–
Jazz Kick 1
Concert BD1
<–
Concert SD
Castanets
Concert SD
Timpani F
Timpani F#
Timpani G
Timpani G#
Timpani A
Timpani A#
Timpani B
Timpani c
Timpani c#
Timpani d
Timpani d#
Timpani e
Timpani f
<–
<–
<–
Concert Cymbal2
<–
Concert Cymbal1
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
Applause
----------------------------------
[EXC1]
[EXC1]
[EXC1]
*
209
>3UR@
>@
>@
>(;&@
Bijlagen
=HOIGHDOVGHSHUFXVVLHNODQNYDQ6&
=HOIGHDOVGHSHUFXVVLHNODQNYDQ6&
=HOIGHDOVGHSHUFXVVLHNODQNYDQ6&
3HUFXVVLHNODQNPHWKHW]HOIGHQXPPHU
NDQQLHWWHJHOLMNHUWLMGJHKRRUGZRUGHQ
3& 3URJUDPQXPPHU'UXPVHWQXPPHU
² =HOIGHDOVGHSHUFXVVLHNODQNYDQ
67$1'$5'3&
*HHQNODQN
7RQHQGLHPHWWZHHVWHPPHQ]LMQJHPDDNW
SC-88 Drum Set (3)
25
26
28
29
27
30
31
32
33
34
35
C2 36
37
38
40
41
39
42
43
44
45
46
47
C3 48
49
50
52
53
51
54
55
56
57
58
59
C4 60
61
62
64
65
63
66
67
68
69
70
71
C5 72
73
74
76
77
75
78
79
80
81
82
83
C6 84
85
86
88
89
87
90
91
92
93
94
95
C7 96
97
98
99
210
PC 50
ETHNIC
Finger Snap
Tambourine
Castanets
Crash Cymbal1
Snare Roll
Concert Snare Drum
Concert Cymbal
Concert BD1
Jingle Bell
Bell Tree
Bar Chimes
Wadaiko
Wadaiko Rim
Shime Taiko
Atarigane
Hyoushigi
Ohkawa
High Kotsuzumi
Low Kotsuzumi
Ban Gu
Big Gong
Small Gong
Bend Gong
Thai Gong
Rama Cymbal
Gamelan Gong
Udo Short
Udo Long
Udo Slap
Bendir
Req Dum
Req Tik
Tabla Te
Tabla Na
Tabla Tun
Tabla Ge
Tabla Ge Hi
Talking Drum
Bend Talking Drum
Caxixi
Djembe
Djembe Rim
Timbales Low
Timbales Paila
Timbales High
Cowbell
Hi Bongo
Low Bongo
Mute Hi Conga
Open Hi Conga
Mute Low Conga
Conga Slap
Open Low Conga
Conga Slide
Mute Pandiero
Open Pandiero
Open Surdo
Mute Surdo
Tamborim
High Agogo
Low Agogo
Shaker
High Whistle
Low Whistle
Mute Cuica
Open Cuica
Mute Triangle
Open Triangle
Short Guiro
Long Guiro
Cabasa Up
Cabasa Down
Claves
High Wood Block
Low Wood Block
*
*
[EXC1]
[EXC1]
*
*
*
[EXC2]
[EXC2]
[EXC3]
[EXC3]
[EXC4]
[EXC4]
[EXC5]
[EXC5]
[EXC6]
[EXC6]
PC 51
KICK&SNARE
---------------------------------------------Standard 1 Kick 1
Standard 1 Kick 2
Standard 2 Kick 1
Standard 2 Kick 2
Kick 1
Kick 2
Soft Kick
Jazz Kick 1
Jazz Kick 2
Concert BD
Room Kick 1
Room Kick 2
Power Kick 1
Power Kick 2
Electric Kick 2
Electric Kick 1
Electric Kick
808 Bass Drum
909 Bass Drum
Dance Kick
Standard 1 Snare 1
Standard 1 Snare 2
Standard 2 Snare 1
Standard 2 Snare 2
Tight Snare
Concert Snare
Jazz Snare 1
Jazz Snare 2
Room Snare 1
Room Snare 2
Power Snare 1
Power Snare 2
Gated Snare
Dance Snare 1
Dance Snare 2
Disco Snare
Electric Snare2
House Snare
Electric Snare 1
Electric Snare 3
808 Snare 1
808 Snare 2
909 Snare 1
909 Snare 2
Brush Tap1
Brush Tap2
Brush Slap1
Brush Slap2
Brush Slap3
Brush Swirl1
Brush Swirl2
Brush Long Swirl
-------------------------
*
*
*
*
*
PC 57
SFX
------------------Scratch Push2
Scratch Pull2
Cutting Noise 2 Up
Cutting Noise 2 Down
Distortion Guitar Cutting Noise Up
Distortion Guitar Cutting Noise Down
Bass Slide
Pick Scrape
High Q
Slap
Scratch Push
Scratch Pull
Sticks
Square Click
Metronome Click
Metronome Bell
Guitar Fret Noise
Guitar Cutting Noise Up
Guitar Cutting Noise Down
String Slap of Double Bass
Fl.Key Click
Laughing
Scream
Punch
Heart Beat
Footsteps1
Footsteps2
Applause
Door Creaking
Door
Scratch
Wind Chimes
Car-Engine
Car-Stop
Car-Pass
Car-Crash
Siren
Train
Jetplane
Helicopter
Starship
Gun Shot
Machine Gun
Lasergun
Explosion
Dog
Horse-Gallop
Birds
Rain
Thunder
Wind
Seashore
Stream
Bubble
Kitty
Bird2
Growl
Applause2
Telephone1
Telephone2
----------------------------
[EXC1]
[EXC1]
[EXC7]
[EXC7]
*
*
*
*
*
*
*
*
*
*
PC 58
RHYTHM FX
---------------------------------Reverse Kick 1
Reverse Concert BD 1
Reverse Power Kick 1
Reverse Electric Kick 1
Reverse Snare 1
Reverse Snare 2
Reverse Standard set1 Snare 1
Reverse Tight Snare
Reverse Dance Snare
Reverse 808 Snare
Reverse Tom1
Reverse Tom2
Reverse Sticks
Reverse Slap
Reverse Cymbal1
Reverse Cymbal2
Reverse Open Hi-hat
Reverse Ride Cymbal
Reverse CR-78 OHH
Reverse Closed Hi-hat
Reverse Gong
Reverse Bell Tree
Reverse Guiro
Reverse Bendir
Reverse Gun Shot
Reverse Scratch
Reverse Laser
Key Click
Tekno Thip
Pop Drop
Woody Slap
Distortion Kick
Syn.Drop
Reverse High Q
Pipe
Ice Block
Digital Tambourine
Alias
Modulated Bell
Spark
Metalic Percussion
Velocity Noise FX
Stereo Noise Clap
Swish
Slappy
Voice Ou
Voice Au
Hoo
Tape Stop1
Tape Stop2
Missile
Space Bird
Flying Monster
----------------------------------
*
*
*
*
*
*
*
Bijlagen
SC-55 Drum Set (1)
25
26
28
29
27
30
31
32
33
34
35
C2 36
37
38
40
41
39
42
43
44
45
46
47
C3 48
49
50
52
53
51
54
55
56
57
58
59
C4 60
61
62
64
65
63
66
67
68
69
70
71
C5 72
73
74
76
77
75
78
79
80
81
82
83
C6 84
85
86
88
89
87
90
91
92
93
94
95
C7 96
97
98
99
PC 1 / PC 33
STANDARD / JAZZ
------High Q
Slap
Scratch Push
Scratch Pull
Sticks
Square Click
Metronome Click
Metronome Bell
Kick Drum2 / Jazz BD2
Kick Drum1 / Jazz BD1
Side Stick
Snare Drum1
Hand Clap
Snare Drum2
Low Tom2
Closed Hi-hat
Low Tom1
Pedal Hi-hat
Mid Tom2
Open Hi-hat
Mid Tom1
High Tom2
Crash Cymbal1
High Tom1
Ride Cymbal1
Chinese Cymbal
Ride Bell
Tambourine
Splash Cymbal
Cowbell
Crash Cymbal2
Vibra-slap
Ride Cymbal2
High Bongo
Low Bongo
Mute High Conga
Open High Conga
Low Conga
High Timbale
Low Timbale
High Agogo
Low Agogo
Cabasa
Maracas
Short Hi Whistle
Long Low Whistle
Short Guiro
Long Guiro
Claves
High Wood Block
Low Wood Block
Mute Cuica
Open Cuica
Mute Triangle
Open Triangle
Shaker
Jingle Bell
Bell Tree
Castanets
Mute Surdo
Open Surdo
-------------------------------------
[EXC1]
[EXC1]
[EXC1]
[EXC2]
[EXC2]
[EXC4]
[EXC4]
[EXC5]
[EXC5]
[EXC6]
[EXC6]
PC 9
ROOM
------<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
Room Low Tom2
<–
Room Low Tom1
<–
Room Mid Tom2
<–
Room Mid Tom1
Room Hi Tom2
<–
Room Hi Tom1
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
-------------------------------------
PC 17
POWER
------<–
<–
<–
<–
<–
<–
<–
<–
<–
MONDO Kick
<–
Gated SD
<–
<–
Room Low Tom2
<–
Room Low Tom1
<–
Room Mid Tom2
<–
Room Mid Tom1
Room Hi Tom2
<–
Room Hi Tom1
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
-------------------------------------
PC 25
ELECTRONIC
------<–
<–
<–
<–
<–
<–
<–
<–
<–
Elec BD
<–
Elec SD
<–
Gated SD
Elec Low Tom2
<–
Elec Low Tom1
<–
Elec Mid Tom2
<–
Elec Mid Tom1
Elec Hi Tom2
<–
Elec Hi Tom1
<–
Reverse Cymbal
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
-------------------------------------
PC 26
TR-808
------<–
<–
<–
<–
<–
<–
<–
<–
<–
808 Bass Drum
808 Rim Shot
808 Snare Drum
<–
<–
808 Low Tom2
808 CHH
808 Low Tom1
808 CHH
808 Mid Tom2
808 OHH
808 Mid Tom1
808 Hi Tom2
808 Cymbal
808 Hi Tom1
<–
<–
<–
<–
<–
808 Cowbell
<–
<–
<–
<–
<–
808 High Conga
808 Mid Conga
808 Low Conga
<–
<–
<–
<–
<–
808 Maracas
<–
<–
<–
<–
808 Claves
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
-------------------------------------
[EXC1]
[EXC1]
[EXC1]
PC 41
BRUSH
------<–
<–
<–
<–
<–
<–
<–
<–
Jazz BD2
Jazz BD1
<–
Brush Tap
Brush Slap
Brash Swirl
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
-------------------------------------
PC 49
ORCHESTRA
------Closed Hi-hat
Pedal Hi-hat
Open Hi-hat
Ride Cymbal1
<–
<–
<–
<–
Concert BD2
Concert BD1
<–
Concert SD
Castanets
Concert SD
Timpani F
Timpani F#
Timpani G
Timpani G#
Timpani A
Timpani A#
Timpani B
Timpani c
Timpani c#
Timpani d
Timpani d#
Timpani e
Timpani f
<–
<–
<–
Concert Cymbal2
<–
Concert Cymbal1
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
<–
Applause
----------------------------------
[EXC1]
[EXC1]
[EXC1]
*
211
>3UR@
>@
>@
>(;&@
Bijlagen
SC-55 Drum Set (2)
35
C2 36
37
38
40
41
39
42
43
44
45
46
47
C3 48
49
50
52
53
51
54
55
56
57
58
59
C4 60
61
62
64
65
63
66
67
68
69
70
71
C5 72
73
74
76
77
75
78
79
80
81
82
83
C6 84
85
86
88
89
87
90
91
92
93
94
95
C7 96
97
98
99
100
101
102
103
104
105
106
107
C8 108
212
PC 57
SFX
------------High Q
Slap
Scratch Push
Scratch Pull
Sticks
Square Click
Metronome Click
Metronome Bell
Guitar Fret Noise
Guitar cutting noise/up
Guitar cutting noise/down
String slap of double bass
Fl.Key Click
Laughing
Scream
Punch
Heart Beat
Footsteps1
Footsteps2
Applause
Door Creaking
Door
Scratch
Wind Chimes
Car-Engine
Car-Stop
Car-Pass
Car-Crash
Siren
Train
Jetplane
Helicopter
Starship
Gun Shot
Machine Gun
Lasergun
Explosion
Dog
Horse-Gallop
Birds
Rain
Thunder
Wind
Seashore
Stream
Bubble
-------------------------------------------------------------------------
[EXC7]
[EXC7]
*
*
*
*
*
*
*
*
*
*
PC 128
CM-64/32L
CM Kick Drum
CM Kick Drum
CM Rim Shot
CM Snare Drum
CM Hand Clap
CM Electronic Snare Drum
CM Acoustic Low Tom
CM Closed High Hat
CM Acoustic Low Tom
CM Open Hi-Hat2
CM Acoustic Middle Tom
CM Open Hi-Hat1
CM M.TomAcoustic Middle Tom
CM Acoustic High Tom
CM Crash Cymbal
CM Acoustic High Tom
CM Ride Cymbal
------CM Tambourine
---CM Cowbell
---------CM High Bongo
CM Low Bongo
CM Mute High Conga
CM High Conga
CM Low Conga
CM High Timbale
CM Low Timbale
CM High Agogo
CM Low Agogo
CM Cabasa
CM Maracas
CM Short Whistle
CM Long Whistle
CM Vibrato Slap
---CM Claves
Laughing
Scream
Punch
Heart Beat
Footsteps1
Footsteps2
Applause
Creaking
Door
Scratch
Wind Chimes
Car-Engine
Car-Stop
Car-Pass
Car-Crash
Siren
Train
Jetplane
Helicopter
Starship
Gun Shot
Machine Gun
Lasergun
Explosion
Dog
Horse-Gallop
Birds
Rain
Thunder
Wind
SeaShore
Stream
Bubble
[EXC1]
[EXC1]
*
*
*
*
*
*
*
*
*
*
=HOIGHDOVGHSHUFXVVLHNODQNYDQ6&
=HOIGHDOVGHSHUFXVVLHNODQNYDQ6&
=HOIGHDOVGHSHUFXVVLHNODQNYDQ6&
3HUFXVVLHNODQNPHWKHW]HOIGHQXPPHU
NDQQLHWWHJHOLMNHUWLMGJHKRRUGZRUGHQ
3& 3URJUDPQXPPHU'UXPVHWQXPPHU
² =HOIGHDOVGHSHUFXVVLHNODQNYDQ
67$1'$5'3&
*HHQNODQN
7RQHQGLHPHWWZHHVWHPPHQ]LMQJHPDDNW
Bijlagen
GM 2 Instrumentenlijst
'H6&JHEUXLNWGH*HQHUDO0,',NODQNVHWZDQQHHUKHWWRHVWHOJHwQLWLDOL]HHUGZRUGWQDDU0,',LQVWHOOLQJHQRIHHQ
,QLWLDOL]HFRPPDQGRYRRU*HQHUDO0,',*06\VWHP2QRQWYDQJW
PC#
CC32
Toonnaam
Stemmen
Piano
3LDQR
3LDQRZ
(XURSHDQ3I
3LDQR
3LDQRZ
3LDQR
3LDQRZ
+RQN\WRQN
+RQN\WRQN
(3LDQR
6W6RIW(3
)06$(3
:XUO\
(3LDQR
'HWXQHG(3
6W)0(3
(3/HJHQG
(33KDVH
+DUSVLFKRUG
&RXSOHG+SV
+DUSVLZ
+DUSVLR
&ODY
3XOVH&ODY
Toonnaam
Stemmen
1\ORQVWU*W
8NXOHOH
1\ORQ*WR
1\ORQ*W
6WHHOVWU*W
VWU*W
0DQGROLQ
6WHHO%RG\
-D]]*W
3HGDO6WHHO
&OHDQ*W
&KRUXV*W
0LG7RQH*75
0XWHG*W
)XQN3RS
)XQN*W
-D]]0DQ
2YHUGULYH*W
*XLWDU3LQFK
'LVWRUWLRQ*W
)HHGEDFN*W
'LVW5WP*75
*W+DUPRQLFV
*W)HHGEDFN
$FRXVWLF%V
)LQJHUHG%V
)LQJHU6ODS
3LFNHG%DVV
)UHWOHVV%V
6ODS%DVV
6ODS%DVV
6\QWK%DVV
6\QWK%DVV
$FLG%DVV
&ODYL%DVV
+DPPHU
6\QWK%DVV
%HHI)0%DVV
5XEEHU%DVV
$WWDFN3XOVH
9LROLQ
6ORZ9LROLQ
9LROD
&HOOR
&RQWUDEDVV
7UHPROR6WU
3L]]LFDWR6WU
+DUS
<DQJ4LQ
7LPSDQL
Bass
&HOHVWD
*ORFNHQVSLHO
0XVLF%R[
9LEUDSKRQH
9LEUDSKRQHZ
0DULPED
0DULPEDZ
;\ORSKRQH
7XEXODUEHOO
&KXUFK%HOO
&DULOORQ
6DQWXU
2UJDQ
7UHP2UJDQ
V2UJDQ
V(2UJDQ
2UJDQ
&KRUXV2U
3HUF2UJDQ
2UJDQ
&KXUFK2UJ
&KXUFK2UJ
&KXUFK2UJ
5HHG2UJDQ
3XII2UJDQ
$FFRUGLRQ)U
$FFRUGLRQ,W
+DUPRQLFD
%DQGRQHRQ
Orgel
CC32
Gitaar
Chromatische percussie
PC#
Orchestra
213
Bijlagen
PC#
CC32
Toonnaam
Stemmen
Ensemble
6WULQJV
2UFKHVWUD
V6WULQJV
6ORZ6WULQJV
6\Q6WULQJV
6\Q6WULQJV
6\Q6WULQJV
&KRLU$DKV
&KRUXV$DKV
9RLFH2RKV
+XPPLQJ
6\Q9R[
$QDORJ9RLFH
2UFKHVWUD+LW
%DVV+LW
WK+LW
(XUR+LW
7UXPSHW
'DUN7UXPSHW
7URPERQH
7URPERQH
%ULJKW7E
7XED
0XWHG7UXPSHW
0XWH7UXPSHW
)UHQFK+RUQV
)U+RUQ
%UDVV
%UDVV
6\QWK%UDVV
3UR%UDVV
2FW6\Q%UDVV
-XPS%UDVV
6\QWK%UDVV
6\Q%UDVVVI]
9HOR%UDVV
Reed
6RSUDQR6D[
$OWR6D[
7HQRU6D[
%DULWRQH6D[
2ERH
(QJOLVK+RUQ
%DVVRRQ
&ODULQHW
3LFFROR
)OXWH
5HFRUGHU
3DQ)OXWH
%RWWOH%ORZ
6KDNXKDFKL
:KLVWOH
2FDULQD
6TXDUH:DYH
0*6TXDUH
6LQH
6DZ:DYH
2%6DZ
'RFWRU6ROR
1DWXUDO/HDG
6HTXHQFHG6DZ
6\Q&DOOLRSH
&KLIIHU/HDG
&KDUDQJ
:LUH/HDG
6ROR9R[
WK6DZ:DYH
%DVV/HDG
'HOD\HG/HDG
Synth Lead
214
CC32
Toonnaam
Stemmen
Synth Pad
Brass
PC#
)DQWDVLD
:DUP3DG
6LQH3DG
3RO\V\QWK
6SDFH9RLFH
,WRSLD
%RZHG*ODVV
0HWDO3DG
+DOR3DG
6ZHHS3DG
,FH5DLQ
6RXQGWUDFN
&U\VWDO
6\Q0DOOHW
$WPRVSKHUH
%ULJKWQHVV
*REOLQ
(FKR'URSV
(FKR%HOO
(FKR3DQ
6WDU7KHPH
6LWDU
6LWDU
%DQMR
6KDPLVHQ
.RWR
7DLVKR.RWR
.DOLPED
%DJSLSH
)LGGOH
6KDQDL
7LQNOH%HOO
$JRJR
6WHHO'UXPV
:RRGEORFN
&DVWDQHWV
7DLNR
&RQFHUW%'
0HOR7RP
0HOR7RP
6\QWK'UXP
7RP
(OHF3HUF
5HYHUVH&\P
Synth SFX
Ethnisch varia
Percussie
Bijlagen
PC#
CC32
Toonnaam
Stemmen
GM 2 Drumsetlijst
SFX
*W)UHW1RLVH
*W&XW1RLVH
6WULQJ6ODS
%UHDWK1RLVH
)O.H\&OLFN
6HDVKRUH
5DLQ
7KXQGHU
:LQG
6WUHDP
%XEEOH
%LUG
'RJ
+RUVH*DOORS
%LUG
7HOHSKRQH
7HOHSKRQH
'RRU&UHDNLQJ
'RRU
6FUDWFK
:LQG&KLPHV
+HOLFRSWHU
&DU(QJLQH
&DU6WRS
&DU3DVV
&DU&UDVK
6LUHQ
7UDLQ
-HWSODQH
6WDUVKLS
%XUVW1RLVH
$SSODXVH
/DXJKLQJ
6FUHDPLQJ
3XQFK
+HDUW%HDW
)RRWVWHSV
*XQ6KRW
0DFKLQH*XQ
/DVHUJXQ
([SORVLRQ
'H*0'UXPVHWNRPWDOVYROJWRYHUHHQPHWGLHYDQGH6&
PC
GM2 Naam
SC-8850 Naaam
67$1'$5'
5220
32:(5
(/(&7521,&
$1$/2*
-$==
%586+
25&+(675$
6);
67$1'$5'
5220
32:(5
(/(&7521,&
75
-$==
%586+
25&+(675$
6);
215
Bijlagen
Invoegeffectenlijst
●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●
9RRUEHHOGYDQVRRUWHQHIIHFWHQHQHIIHFWSDUDPHWHUV!
Parameter
Instelwaarde
Waarde (Hex.)
MSB/LSB (H)
01 : Stereo-EQ
01 00
/RZ)UHT
400
‡ 'HMSB/LSBNRORPWRRQWKHWYROJHQGHGHHOYDQKHW([FOXVLYH
FRPPDQGR+H[DGHFLPDOHQRWHULQJS
9RRUVRRUWHIIHFW'DWDVHFWLRQ
)GHYVXP)
9RRU(IIHFWSDUDPHWHU/6%GHHOYDQDGGUHVV
)GHYGDWDVXP)
GHYWRHVWHO,'VXPFRQWUROHWRWDDO
‡3DUDPHWHUVPHWHHQ+YRRUKXQQDDPNXQQHQYHUDQGHUGZRUGHQGRRU(IIHFW
&RQWURO();&6UFS
‡3DUDPHWHUVPHWHHQ# YRRUKXQQDDPNXQQHQYHUDQGHUGZRUGHQGRRU(IIHFW
&RQWURO();&6UFS
‡,QKHWYHWJHGUXNWHZDDUGHQLQGHNRORPYDQSetting Value]LMQGH
VWDQGDDUGZDDUGHQYDQGHSDUDPHWHU
‡'HRYHUHHQNRPVWWXVVHQGHLQVWHOZDDUGHQHQGHKH[DGHFLPDOHZDDUGHQ
YRRUZDDUGHQLQGH9DOXHNRORPGLHDDQJHGXLG]LMQPHW*ZRUGWJHWRRQGLQ
GHOmzettingstabel voor effectparameterwaardenS
3UH'HOD\7LPH
5DWH
/3)
'HOD\7LPH
5DWH
0DQXDO
'HOD\7LPH
+)'DPS
$]LPXWK
'HOD\7LPH
&XWRII)UHT
$FFO
'HOD\7LPH
(4)UHT
●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●
❍ Effecten die de toon veranderen (filter type)
Parameter
Instelwaarde
Waarde (Hex.)
MSB/LSB (H)
00 : Thru
00
00
01 : Stereo-EQ
/RZ)UHT
/RZ*DLQ
+L)UHT
+L*DLQ
0)UHT
04
0*DLQ
0)UHT
04
0*DLQ
/HYHO
400
²+5²
N8k
-12²
²1.6k²N
0.5
²+8²
²1k²N
0.5
²-8²
²127
²&
²&
²&
²&
²)
01
00
$
%
&
02 : Spectrum
%DQG
%DQG
%DQG
%DQG
%DQG
%DQG
%DQG
%DQG
:LGWK
3DQ
/HYHO
²-4²
²+1²
²+3²
²+6²
²+2²
²-1²
²-4²
²-5²
2.0
/²0²5
²127
²&
²&
²&
²&
²&
²&
²&
²&
²)
²)
216
01
01
$
%
Parameter
03 : Enhancer
6HQV
0L[
/RZ*DLQ
+L*DLQ
/HYHO
Instelwaarde
²64²
²127
²+3²
²0²
²127
04 : Humanizer
'ULYH
²48²
'ULYH6Z
2IIOn
9RZHO
aLXHR
$FFHO
²15
/RZ*DLQ
²0²
+L*DLQ
²0²
3DQ
/²0²5
/HYHO
²127
Waarde (Hex.)
²)
²)
²&
²&
²)
MSB/LSB (H)
01
02
²)
²&
²&
²)
²)
01
03
❍ Effecten die de klank vervormen (distortion type)
05 : Overdrive
'ULYH
$PS7\SH
$PS6Z
/RZ*DLQ
+L*DLQ
3DQ
/HYHO
²48²
6PDOOBltIn6WN6WN
2IIOn
²0²
²0²
/²0²5
²96²
²)
²&
²&
²)
²)
06 : Distortion
'ULYH
$PS7\SH
$PS6Z
/RZ*DLQ
+L*DLQ
3DQ
/HYHO
²76²
6PDOO%OW,Q6WN3-Stk
2IIOn
²0²
²-8²
/²0²5
²84²
²)
²&
²&
²)
²)
01
10
01
11
01
20
01
21
❍ Effects die de klank moduleren
(modulation type)
07 : Phaser
0DQXDO
5DWH
'HSWK
5HVR
0L[
/RZ*DLQ
+L*DLQ
/HYHO
²620²N
²0.85²
²64²
²16²
²127
²0²
²0²
²104²
²)
²)
²)
²&
²&
²)
08 : Auto Wah
)LO7\SH
6HQV
0DQXDO
3HDN
5DWH
'HSWK
3RODULW\
/RZ*DLQ
+L*DLQ
3DQ
/HYHO
/3)BPF
0²
²68²
²62²
²2.05²
²72²
'RZQUp
²0²
²0²
/²0²5
²96²
²)
²)
²)
²)
²&
²&
²)
²)
Bijlagen
Parameter
09 : Rotary
/RZ6ORZ
/RZ)DVW
/RZ$FFO
/RZ/HYHO
+L6ORZ
+L)DVW
+L$FFO
+L/HYHO
6HSDUDWH
6SHHG
/RZ*DLQ
+L*DLQ
/HYHO
Instelwaarde
²0.35²
²6.40²
²3²
²127
²0.90²
²7.50²
²11²
²64²
²96²
Slow)DVW
²0²
²0²
²127
Waarde (Hex.)
MSB/LSB (H)
²)
²)
²)
)
²&
²&
²)
10 : Stereo Flanger
3UH)LOWHU
Off/3)+3)
&XWRII
250²N
3UH'O\
²1.6ms²PV
5DWH
²0.60²
'HSWK
²24²
)HHGEDFN
²+80%²
3KDVH
²180
%DODQFH
'!(²D=E²'(
/RZ*DLQ
²0²
+L*DLQ
²0²
/HYHO
²104²
²)
)²
²$
²)
²&
²&
²)
11 : Step Flanger
3UH'O\
²1.0ms²PV
5DWH
²0.30²
'HSWK
²95²
)HHGEDFN
²+30%²
3KDVH
²180
6WHS5DWH
²2.75²
%DODQFH
'!(²D=E²'(
/RZ*DLQ
²0²
+L*DLQ
²0²
/HYHO
²96²
²)
)²
²$
²)
²&
²&
²)
12 : Tremolo
0RG:DYH
0RG5DWH
0RG'HSWK
/RZ*DLQ
+L*DLQ
/HYHO
7ULSqr6LQ6DZ6DZ
²3.05²
²96²
²0²
²0²
²127
²)
²&
²&
²)
13 : Auto Pan
0RG:DYH
0RG5DWH
0RG'HSWK
/RZ*DLQ
+L*DLQ
/HYHO
7ULSqr6LQ6DZ6DZ
²3.05²
²96²
²0²
²0²
²127
²)
²&
²&
²)
01
01
01
22
$
%
'
23
24
01
25
01
26
❍ Effecten die het volume beïnvloeden (compressor type)
14 : Compressor
$WWDFN
²72²
6XVWDLQ
²100²
3RVW*DLQ
0
/RZ*DLQ
²0²
+L*DLQ
²0²
3DQ
/²0²5
/HYHO
²104²
²)
²)
²&
²&
²)
²)
01
30
Parameter
15 : Limiter
7KUHVKROG
5DWLR
5HOHDVH
3RVW*DLQ
/RZ*DLQ
+L*DLQ
3DQ
/HYHO
Instelwaarde
²85²
1/100
²16²
0
²0²
²0²
/²0²5
²127
Waarde (Hex.)
²)
²)
²&
²&
²)
²)
MSB/LSB (H)
01
31
❍ Effecten die de klank verbreden (chorus type)
16 : Hexa Chorus
3UH'O\
²2.4ms²PV
5DWH
²0.45²
'HSWK
²127
3UH'O\'HY ²5²
'HSWK'HY
²+2²
3DQ'HY
²16²
%DODQFH
'!(²D=E²'(
/RZ*DLQ
²0²
+L*DLQ
²0²
/HYHO
²112²
²)
²
&²
²
²)
²&
²&
²)
17 : Tremolo Chorus
3UH'O\
²1.6ms²PV
&KR5DWH
²0.45²
&KR'HSWK
²40²
7UHP3KDVH
²80²
7UHP5DWH
²3.05²
7UHP6HS
²96²
%DODQFH
'!(²D 0<E
/RZ*DLQ
²0–
+L*DLQ
²0²
/HYHO
²127
²)
²$
²)
²)
²&
²&
²)
18 : Stereo Chorus
3UH)LOWHU
Off/3)+3)
&XWRII
250²N
3UH'O\
²1.0ms²PV
5DWH
²0.45²
'HSWK
²111²
3KDVH
²180
%DODQFH
'!(²D=E²'(
/RZ*DLQ
²0²
+L*DLQ
²0²
/HYHO
²104²
²)
²$
²)
²&
²&
²)
19 : Space D
3UH'O\
5DWH
'HSWK
3KDVH
%DODQFH
/RZ*DLQ
+L*DLQ
/HYHO
²3.2ms²PV
²0.45²
²127
²180
'!(²D=E²'(
²0²
²0²
²96²
²)
²$
²)
²&
²&
²)
20 : 3D Chorus
3UH'O\
²1.0ms²PV
&KR5DWH
²0.45²
&KR'HSWK
²72²
2XW
Speaker3KRQHV
%DODQFH
'!(²D=E²'(
/RZ*DLQ
²0²
+L*DLQ
²0²
/HYHO
²80²
²)
²)
²&
²&
²)
01
40
01
41
01
42
01
43
01
44
217
Bijlagen
❍ Effecten die de klank weergalmen
(delay/reverb type)
Parameter
Instelwaarde
Waarde (Hex.)
21 : Stereo Delay
'O\7P/
²150ms²PV
'O\7P5
²300ms²PV
)HHGEDFN
²+48%²
)E0RGH
1RUPCross
3KDVH/
Norm,QYHUW
3KDVH5
Norm,QYHUW
+)'DPS
²NBypass
%DODQFH
'!(²D>74E²'(
/RZ*DLQ
²0²
+L*DLQ
²0²
/HYHO
²127
)²
²)
²&
²&
²)
22 : Mod Delay
'O\7P/
²40ms²PV
'O\7P5
²220ms²PV
)HHGEDFN
²+48%²
)E0RGH
1RUPCross
0RG5DWH
²0.65–
0RG'HSWK
²21²
0RG3KDVH
²180
+)'DPS
²NBypass
%DODQFH
'!(²D>61E²'(
/RZ*DLQ
²0²
+L*DLQ
²0²
/HYHO
²127
)²
²)
²$
²)
²&
²&
²)
23 : 3 Tap Delay
'O\7P&
PV²300mV²PVVHF
'O\7P/
PV²200mV²PVVHF
'O\7P5
PV²235ms²PVVHF
)HHGEDFN
²+32%²
'O\/HY&
²127
'O\/HY/
²127
'O\/HY5
²127
+)'DPS
²NBypass
%DODQFH
'!(²D>74E²'(
/RZ*DLQ
²0²
+L*DLQ
²0²
/HYHO
²127
)²
²)
²)
²)
²)
²&
²&
²)
24 : 4 Tap Delay
'O\7P
PV²500mV²PVVHF
'O\7P
PV²300mV²PVVHF
'O\7P
PV²400mV²PVVHF
'O\7P
PV²200ms²PVVHF
'O\/HY
²127
'O\/HY
²127
'O\/HY
²127
'O\/HY
²127
)HHGEDFN
²+32%²
+)'DPS
²NBypass
%DODQFH
'!(²D>74E²'(
/RZ*DLQ
²0²
+L*DLQ
²0²
/HYHO
²127
²)
²)
²)
²)
)²
²)
²&
²&
²)
25 : Tm Ctrl Delay
'O\7LPH
PV²500ms²PVVHF
$FFHO
²10²
)HHGEDFN
²+32%²
+)'DPS
²NBypass
();3DQ
/²0²5
%DODQFH
'!(²D>74E²'(
/RZ*DLQ
²0²
+L*DLQ
²0²
/HYHO
²127
)²
²)
²)
²&
²&
²)
218
Parameter
MSB/LSB (H)
01
01
01
01
01
50
$
51
$
52
$
53
$
%
&
54
26 : Reverb
7\SH
3UH'O\
7LPH
+)'DPS
%DODQFH
/RZ*DLQ
+L*DLQ
/HYHO
Instelwaarde
Waarde (Hex.)
MSB/LSB (H)
01
5RRPStage2+DOO
²74ms²PV
²120²
²)
²6.3k²N%\SDVV
'!(²D=E²'(
²)
²0²
²&
²0²
²&
²127
²)
27 : Gate Reverb
7\SH
Norm5HYHUVH6ZHHS
3UH'O\
²0.5ms²PV
*DWH7LPH
²65ms²PV
%DODQFH
'!(²D>65E²'(
/RZ*DLQ
²0²
+L*DLQ
²-3²
/HYHO
²112²
²
²)
²&
²&
²)
28 : 3D Delay
'O\7P&
'O\7P/
'O\7P5
)HHGEDFN
'O\/HY&
'O\/HY/
'O\/HY5
+)'DPS
2XW
%DODQFH
/RZ*DLQ
+L*DLQ
/HYHO
)²
²)
²)
²)
²)
²&
²&
²)
²300ms²PV
²200ms²PV
²240ms²PV
²+32%²
²40²
²64²
²64²
²NBypass
Speaker3KRQHV
'!(²D>74E²'(
²0²
²0²
²127
55
01
56
01
57
$
❍ Effecten die de toonhoogte veranderen (pitch/shift type)
29 : 2 Pitch Shifter
&RDUVH
²+7²
)LQH
²-4²
3UH'O\
0²PV
();3DQ
/²²R63
&RDUVH
²-5²
)LQH
²+4²
3UH'O\
0²PV
();3DQ
L63²²5
6KLIW0RGH
²3²
/%DO
$!%²A=B²$%
%DODQFH
'!(²D>74E²'(
/RZ*DLQ
²0²
+L*DLQ
²0²
/HYHO
²95²
²&
(²
²)
²&
(²
²)
²
²)
²)
²&
²&
²)
30 : Fb P.Shifter
3&RDUVH
²+7²
3)LQH
²0²
)HHGEDFN
²+40%²
3UH'O\
²45ms²PV
0RGH
²3²
();3DQ
/²0²5
%DODQFH
'!(²D=E²'(
/RZ*DLQ
²0²
+L*DLQ
²-6²
/HYHO
²127
²&
(²
)²
²
²)
²)
²&
²&
²)
01
60
$
%
&
01
61
Bijlagen
❍ Andere
Parameter
31 : 3D Auto
$]LPXWK
6SHHG
&ORFNZLVH
7XUQ
2XW
/HYHO
Parameter
Instelwaarde
Waarde (Hex.)
/²0²5
²1.30²
+
2IIOn
Speaker3KRQHV
²127
²)
32 : 3D Manual
$]LPXWK
/²0²5
2XW
Speaker3KRQHV
/HYHO
²127
²)
33 : Lo-Fi 1
3UH)LOWHU
/R)L7\SH
3RVW)LOWHU
%DODQFH
/RZ*DLQ
+L*DLQ
3DQ
/HYHO
²2²
²6²
²2²
'!(²D 0<E
²0²
²0²
/²0²5
²127
²
²
²
²)
²&
²&
²)
²)
34 : Lo-Fi 2
/R)L7\SH
)LO7\SH
&XWRII
5'HWXQH
51]/HY
:36HO
:3/3)
:3/HYHO
'LVF7\SH
'LVF/3)
'LVF1]/HY
+XP7\SH
+XP/3)
+XP/HYHO
06
%DODQFH
/RZ*DLQ
+L*DLQ
3DQ0RQR
/HYHO
²2²
2IILPF+3)
²630²N
0²
²64²
:KLWHPink
²NBypass
0²
LP(36351'
²NBypass
0²
50Hz+]
²NBypass
0²
0RQRStereo
'!(²D 0<E
²0²
²0²
/²0²5
²127
²
²)
²)
²)
²)
²)
²
²)
²&
²&
²)
²)
MSB/LSB (H)
01
70
01
71
01
72
01
73
$
%
&
'
(
)
❍ Effecten die twee soorten effecten serieel
verbinden (series 2)
35 : OD → Chorus
2''ULYH
²48²
2'3DQ
/²0²5
2'$PS
6PDOOBltIn6WN6WN
2'$PS6Z Off2Q
&KR'O\
²1.0ms²PV
&KR5DWH
²0.45²
&KR'HSWK
²72²
&KR%DO
'!(²D=E²'(
/RZ*DLQ
²0²
+L*DLQ
²0²
/HYHO
²80²
²)
²)
²)
²)
²&
²&
²)
02
00
$
&
Instelwaarde
Waarde (Hex.))
36 : OD→ Flanger
2''ULYH
²48²
2'3DQ
/²0²5
2'$PS
6PDOOBltIn6WN6WN
2'$PS6Z Off2Q
)/'O\
²1.6ms²PV
)/5DWH
²0.60²
)/'HSWK
²40²
)/)E
²+80%²
)/%DO
'!(²D>49E²'(
/RZ*DLQ
²0²
+L*DLQ
²0²
/HYHO
²80²
²)
²)
²)
)²
²)
²&
²&
²)
37 : OD → Delay
2''ULYH
²48²
2'3DQ
/²0²5
2'$PS
6PDOOBltIn6WN6WN
2'$PS6Z Off2Q
'O\7LPH
²250ms²PV
'O\)E
²+32%²
'O\+)
²NBypass
'O\%DO
'!(²D>74E²'(
/RZ*DLQ
²0²
+L*DLQ
²0²
/HYHO
²80²
²)
²)
)²
²)
²&
²&
²)
38 : DS → Chorus
'6'ULYH
²48²
'63DQ
/²0²5
'6$PS
6PDOOBltIn6WN6WN
'6$PS6Z Off2Q
&KR'O\
²1.0ms²PV
&KR5DWH
²0.45²
&KR'HSWK
²72²
&KR%DO
'!(²D=E²'(
/RZ*DLQ
²0²
+L*DLQ
²0²
/HYHO
²72²
²)
²)
²)
²)
²&
²&
²)
39 : DS → Flanger
'6'ULYH
²48²
'63DQ
/²0²5
'6$PS
6PDOOBltIn6WN6WN
'6$PS6Z Off2Q
)/'O\
²1.1ms²PV
)/5DWH
²0.60²
)/'HSWK
²24²
)/)E
²+80%²
)/%DO
'!(²D>49E²'(
/RZ*DLQ
²0²
+L*DLQ
²0²
/HYHO
²72²
²)
²)
²)
)²
²)
²&
²&
²)
40 : DS → Delay
'6'ULYH
²48²
'63DQ
/²0²5
'6$PS
6PDOOBltIn6WN6WN
'6$PS6Z Off2Q
'O\7LPH
²250ms²PV
'O\)E
²+32%²
'O\+)
²NBypass
'O\%DO
'!(²D>74E²'(
/RZ*DLQ
²0²
+L*DLQ
²0²
/HYHO
²72²
²)
²)
)²
²)
²&
²&
²)
MSB/LSB (H)
02
01
$
%
&
02
02
$
&
02
03
$
&
02
04
$
%
&
02
05
$
&
219
Bijlagen
Parameter
Instelwaarde
Waarde (Hex.)
41 : EH → Chorus
(+6HQV
²64²
(+0L[
²127
&KR'O\
²14ms²PV
&KR5DWH
²0.45²
&KR'HSWK
²101²
&KR%DO
'!(²D=E²'(
/RZ*DLQ
²0²
+L*DLQ
²0²
/HYHO
²80²
²)
²)
²)
²)
²&
²&
²)
42 : EH → Flanger
(+6HQV
²64²
(+0L[
²127
)/'O\
²1.6ms²PV
)/5DWH
²0.60²
)/'HSWK
²24²
)/)E
²+80%²
)/%DO
'!(²D>74E²'(
/RZ*DLQ
²0²
+L*DLQ
²0²
/HYHO
²96²
²)
²)
²)
)²
²)
²&
²&
²)
43 : EH → Delay
(+6HQV
²64²
(+0L[
²127
'O\7LPH
²250ms²PV
'O\)E
²+32%²
'O\+)
²NBypass
'O\%DO
'!(²D>74E²'(
/RZ*DLQ
²0²
+L*DLQ
²0²
/HYHO
²88²
²)
²)
)²
²)
²&
²&
²)
44 : Cho → Delay
&KR'O\
²1.0ms²PV
&KR5DWH
²0.50²
&KR'HSWK
²120²
&KR%DO
'!(²D=E²'(
'O\7LPH
²250ms²PV
'O\)E
²+32%²
'O\+)
²NBypass
'O\%DO
'!(²D>74E²'(
/RZ*DLQ
²0²
+L*DLQ
²0²
/HYHO
²127
²)
²)
)²
²)
²&
²&
²)
45 : FL → Delay
)/'O\
²1.6ms²PV
)/5DWH
²0.60²
)/'HSWK
²24²
)/)E
²+80%²
)/%DO
'!(²D=E²'(
'O\7LPH
²250ms²PV
'O\)E
²+32%²
'O\+)
²NBypass
'O\%DO
'!(²D>74E²'(
/RZ*DLQ
²0²
+L*DLQ
²0²
/HYHO
²127
²)
)²
²)
)²
²)
²&
²&
²)
220
MSB/LSB (H)
02
06
$
&
02
07
$
%
&
02
08
$
&
02
09
$
&
02
0A
$
&
Parameter
Instelwaarde
46 : Cho→ Flanger
&KR'O\
²1.0ms²PV
&KR5DWH
²0.45²
&KR'HSWK
²120²
&KR%DO
'!(²D=E²'(
)/'O\
²1.6ms²PV
)/5DWH
²0.60²
)/'HSWK
²24²
)/)E
²+80%²
)/%DO
'!(²D=E²'(
/RZ*DLQ
²0²
+L*DLQ
²0²
/HYHO
²112²
Waarde (Hex.)
MSB/LSB (H)
²)
²)
²)
)²
²)
²&
²&
²)
02
0B
$
%
&
❍ Effecten die drie of meer soorten effecten
serieel verbinden (series 3/4/5)
47 : Rotary Multi
2''ULYH
²13²
2'6Z
2IIOn
(4/*DLQ
²0²
(40)T
²1.6k²N
(404
0.5
(40*DLQ
²0²
(4+*DLQ
²0²
57/6ORZ
²0.35²
57/)DVW
²6.40²
57/R$FFO
²3²
57/R/HY
²127
57+6ORZ
²0.90²
57+)DVW
²7.50²
57+L$FFO
²11²
57+L/HY
²64²
576HSW
²96²
576SHHG
Slow)DVW
/HYHO
²96²
²)
²&
²&
²&
²)
²)
²)
)
²)
48 : GTR Multi 1
&PS$WFN
²100²
&PS6XV
²80²
&PS/HYHO
²100²
&PS6Z
2IIOn
2'6HO
Odrv'LVW
2''ULYH
²80²
2'$PS
Small%OW,Q6WN6WN
2'$PS6Z 2IIOn
2'/*DLQ
²+5²
2'+*DLQ
²+10²
2'6Z
2IIOn
&)6HO
Chorus)ODQJU
&)5DWH
²0.45²
&)'HSWK
²30²
&))E
²+76%²
&)0L[
²40²
'O\7LPH
²300ms²PV
'O\)E
²34²
'O\0L[
²15²
/HYHO
²110²
²)
²)
²)
²)
²&
²&
²)
)²
²)
²)
²)
²)
03
00
$
%
&
'
(
)
04
00
$
%
&
'
(
)
Bijlagen
Parameter
Instelwaarde
Waarde (Hex.)
MSB/LSB (H)
49 : GTR Multi 2
&PS$WFN
²70²
&PS6XV
²127
&PS/HYHO
²90²
&PS6Z
2IIOn
2'6HO
Odrv'LVW
2''ULYH
²80²
2'$PS
6PDOO%OW,Q2-Stk6WN
2'$PS6Z 2IIOn
2'6Z
2IIOn
(4/*DLQ
²+12
(40)T
²1k²N
(404
2.0
(40*DLQ
²+5²
(4+*DLQ
²-10²
&)6HO
Chorus)ODQJU
&)5DWH
²0.45²
&)'HSWK
²96²
&))E
²+76%²
&)0L[
0²
/HYHO
²80²
²)
²)
²)
²)
²&
²&
²&
²)
)²
²)
²)
50 : GTR Multi 3
:DK)LO
/3)BPF
:DK0DQ
²60²
:DK3HDN
²10²
:DK6Z
2IIOn
2'6HO
2GUYDist
2''ULYH
²80²
2'$PS
6PDOO%OW,Q2-Stk6WN
2'$PS6Z 2IIOn
2'/*DLQ
²0²
2'+*DLQ
²0²
2'6Z
2IIOn
&)6HO
Chorus)ODQJU
&)5DWH
²0.45²
&)'HSWK
0²
&))E
²+50%²
&)0L[
²50²
'O\7LPH
²160ms²PV
'O\)E
²64²
'O\0L[
²30²
/HYHO
²88²
²)
²)
²)
²&
²&
²)
)²
²)
²)
²)
²)
51 : Clean Gt Multi 1
&PS$WFN
²50²
&PS6XV
²127
&PS/HYHO
²75²
&PS6Z
2IIOn
(4/*DLQ
²+12
(40)T
200²N
(404
2.0
(40*DLQ
²+5²
(4+*DLQ
-12²
&)6HO
Chorus)ODQJU
&)5DWH
²0.45²
&)'HSWK
²40²
&))E
²+30%²
&)0L[
²100²
'O\7LPH
²120ms²PV
'O\)E
²40²
'O\+)
²NBypass
'O\0L[
²30²
/HYHO
²95²
²)
²)
²)
²&
²&
²&
²)
)²
²)
²)
²)
²)
Parameter
Instelwaarde
Waarde (Hex.)
MSB/LSB (H)
04
01
$
%
&
'
(
)
52 : Clean Gt Multi2
$:)LOWHU
/3)BPF
$:0DQ
²55²
$:3HDN
²40²
$:5DWH
²1.50²
$:'HSWK
²80²
$:6Z
2IIOn
(4/*DLQ
²+12
(40)T
²1.6k²N
(404
0.5
(40*DLQ
²0²
(4+*DLQ
²0²
&)6HO
Chorus)ODQJU
&)5DWH
²0.45²
&)'HSWK
²20²
&))E
²+76%²
&)0L[
²100²
'O\7LPH
²30ms²PV
'O\)E
²15²
'O\0L[
²80²
/HYHO
²76²
²)
²)
²)
²&
²&
²&
²)
)²
²)
²)
²)
²)
04
02
$
%
&
'
(
)
53 : Bass Multi
&PS$WFN
²72²
&PS6XV
²100²
&PS/HYHO
²75²
&PS6Z
2IIOn
2'6HO
Odrv'LVW
2''ULYH
²48²
2'$PS
Small%OW,Q6WN
2'$PS6Z Off2Q
2'6Z
2IIOn
(4/*DLQ
²+2²
(40)T
²1.6k²N
(404
1.0
(40*DLQ
²+4²
(4+*DLQ
²0²
&)6HO
Chorus)ODQJU
&)5DWH
²0.30²
&)'HSWK
²20²
&))E
²+76%²
&)0L[
²64²
/HYHO
²76²
²)
²)
²)
²)
²&
²&
²&
²)
)²
²)
²)
04
03
$
%
&
'
(
)
54 : Rhodes Multi
(+6HQV
²64²
(+0L[
²64²
3+0DQ
²620²N
3+5DWH
²0.85²
3+'HSWK
²32²
3+5HVR
²16²
3+0L[
²64²
&)6HO
Chorus)ODQJU
&)/3)
²NBypass
&)'O\
²1.0ms²PV
&)5DWH
²0.45²
&)'HSWK
²64²
&))E
²+80%²
&)0L[
²127
736HO
7UHPPan
730RG:9 7UL6TUSin6DZ6DZ
730RG57
²3.05²
730RG'HS ²64²
736Z
2IIOn
/HYHO
²127
²)
²)
²)
²)
²)
²)
)²
²)
²)
²)
04
04
$
%
&
'
(
)
04
05
$
%
&
'
(
)
04
06
$
%
&
'
(
)
221
Bijlagen
Parameter
Instelwaarde
55 : Keyboard Multi
500RG)UHT ²50²
50%DO
'!(²D>30E²'(
(4/*DLQ
²+3²
(40)T
200²N
(404
2.0
(40*DLQ
²+5²
(4+*DLQ
²-3²
36&RDUVH
²+7²
36)LQH
²0²
360RGH
1²
36%DO
'!(²D>60E²'(
3+0DQ
²620²N
3+5DWH
²0.45²
3+'HSWK
²90²
3+5HVR
²80²
3+0L[
²75²
'O\7LPH
²100ms²PV
'O\)E
²64²
'O\0L[
²40²
/HYHO
²96²
Waarde (Hex.)
MSB/LSB (H)
²)
²)
²&
²&
²&
²&
(²
²
²)
²)
²)
²)
²)
²)
²)
05
00
$
%
&
'
(
)
❍ Effecten die twee soorten effecten parallel
verbinden (parallel 2)
56 : Cho / Delay
&KR'O\
²1.0ms²PV
&KR5DWH
²0.45²
&KR'HSWK
²120²
&KR%DO
'!(²D=E²'(
&KR3DQ
L63²²5
&KR/HYHO
²127
'O\7LPH
²250ms²PV
'O\)E
²+32%²
'O\+)
²NBypass
'O\%DO
'!(²D>61E²'(
'O\3DQ
/²²R63
'O\/HYHO
²127
/HYHO
²96²
²)
²)
²)
²)
)²
²)
²)
²)
²)
57 : FL / Delay
)/'O\
)/5DWH
)/'HSWK
)/)E
)/%DO
)/3DQ
)//HYHO
'O\7LPH
'O\)E
'O\+)
'O\%DO
'O\3DQ
'O\/HYHO
/HYHO
²)
)²
²)
²)
²)
)²
²)
²)
²)
²)
²1.6ms²PV
²0.60²
²24²
²+80%²
'!(²D=E²'(
L63²²5
²127
²250ms²PV
²+32%²
²NBypass
'!(²D>74E²'(
/²²R63
²127
²96²
58 : Cho / Flanger
&KR'O\
²1.6ms²PV
&KR5DWH
²0.45²
&KR'HSWK
²120²
&KR%DO
'!(²D=E²'(
&KR3DQ
L63²²5
&KR/HYHO
²127
)/'O\
²1.6ms²PV
)/5DWH
²0.60²
)/'HSWK
²24²
)/)E
²+80%²
)/%DO
'!(²D=E²'(
)/3DQ
/²²R63
)//HYHO
²127
/HYHO
²88
222
²)
²)
²)
²)
²)
)²
²)
²)
²)
²)
11
11
11
00
$
&
01
$
&
02
$
%
&
Parameter
59 : OD1 / OD2
2'6HO
2''ULYH
2'$PS
2'$PS6Z
2'3DQ
2'/HYHO
2'6HO
2''ULYH
2'$PS
2'$PS6Z
2'3DQ
2'/HYHO
/HYHO
Instelwaarde
Waarde (Hex.)
Odrv'LVW
²48²
6PDOOBltIn6WN6WN
2IIOn
L63²²5
²96²
2GUYDist
²76²
6PDOO%OW,Q6WN3-Stk
2IIOn
/²²R63
²84²
²127
²)
²)
²)
²)
²)
²)
²)
60 : OD / Rotary
2'6HO
Odrv'LVW
2''ULYH
²48²
2'$PS
6PDOOBltIn6WN6WN
2'$PS6Z 2IIOn
2'3DQ
L63²²5
2'/HYHO
²96²
57/6ORZ
²0.35²
57/)DVW
²6.40
57/R$FFO
²3²
57/R/HY
²127
57+6ORZ
²0.90²
57+)DVW
²7.50²
57+L$FFO
²11²
57+L/HY
²64²
576HSW
²96²
576SHHG
Slow)DVW
573DQ
/²²R63
57/HYHO
²127
/HYHO
²127
²)
²)
²)
²)
²)
²)
)
²)
²)
²)
61 : OD / Phaser
2'6HO
Odrv'LVW
2''ULYH
²48²
2'$PS
6PDOBltIn6WN6WN
2'$PS6Z 2IIOn
2'3DQ
L63²²5
2'/HYHO
²96²
3+0DQ
²620²N
3+5DWH
²0.85²
3+'HSWK
²64²
3+5HVR
²16²
3+0L[
²127
3+3DQ
/²²R63
3+/HYHO
²127
/HYHO
²127
²)
²)
²)
²)
²)
²)
²)
²)
²)
62 : OD / AutoWah
2'6HO
Odrv'LVW
2''ULYH
²48²
2'$PS
6PDOOBltIn6WN6WN
2'$PS6Z 2IIOn
2'3DQ
L63²²5
2'/HYHO
²96²
$:)LOWHU
/3)BPF
$:6HQV
0²
$:0DQ
²68²
$:3HDN
²62²
$:5DWH
²2.05²
$:'HSWK
²72²
$:3RO
'RZQUp
$:3DQ
/²²R63
$:/HYHO
²127
/HYHO
²127
²)
²)
²)
²)
²)
²)
²)
²)
²)
²)
MSB/LSB (H)
11
03
$
%
11
04
$
%
&
'
(
)
11
05
$
%
&
11
06
$
%
&
'
(
Bijlagen
Parameter
Instelwaarde
Waarde (Hex.)
63 : PH / Rotary
3+0DQ
²620²N
3+5DWH
²0.85²
3+'HSWK
²64²
3+5HVR
²16²
3+0L[
²127
3+3DQ
L63²²5
3+/HYHO
²127
57/6ORZ
²0.35²
57/)DVW
²6.40²
57/R$FFO
²3²
57/R/HY
²127
57+6ORZ
²0.90²
57+)DVW
²7.50²
57+L$FFO
²11²
57+L/HY
²64²
576HSW
²96²
576SHHG
Slow)DVW
573DQ
/²²R63
57/HYHO
²127
/HYHO
²127
²)
²)
²)
²)
²)
²)
²)
²)
)
²)
²)
²)
64 : PH / AutoWah
3+0DQ
²620²N
3+5DWH
²0.85²
3+'HSWK
²64²
3+5HVR
²16²
3+0L[
²127
3+3DQ
L63²²5
3+/HYHO
²127
$:)LOWHU
/3)BPF
$:6HQV
0²
$:0DQ
²68²
$:3HDN
²62²
$:5DWH
²2.05²
$:'HSWK
²72²
$:3RO
'RZQUp
$:3DQ
/²²R63
$:/HYHO
²127
/HYHO
²127
²)
²)
²)
²)
²)
²)
²)
²)
²)
²)
²)
²)
MSB/LSB (H)
11
07
$
%
&
'
(
)
11
08
$
%
&
'
(
223
Bijlagen
Omzettingstabel voor effectparameterwaarden
+LHURQGHUYROJWHHQWDEHOYRRUKHWRP]HWWHQYDQGHKH[DGHFLPDOHZDDUGHQDDUGHZHUNHOLMNHLQVWHOOLQJYDQHONHSDUDPHWHU'H]H
SDUDPHWHUVZRUGHQJHEUXLNWLQGHYROJHQGHVRRUWHQHIIHFWHQ
Value
(Hex.)
00
01
02
03
04
05
06
07
08
09
0A
0B
0C
0D
0E
0F
10
11
12
13
14
15
16
17
18
19
1A
1B
1C
1D
1E
1F
20
21
22
23
24
25
26
27
28
29
2A
2B
2C
2D
2E
224
1. Pre Delay Time
10: Stereo Flanger
11: Step Flanger
16: Hexa Chorus
17: Tremolo Chorus
18: Stereo Chorus
19: Space-D
20: 3D Chorus
26: Reverb
27: Gate Reverb
29: 2 Pitch Shifter
30: Fb P.Shifter
35: OD → Chorus
36: OD → Flanger
38: DS → Chorus
39: DS → Flanger
41: EH → Chorus
42: EH → Flanger
44: Cho → Delay
45: FL → Delay
46: Cho → Flanger
54: Rhodes Multi
56: Cho/Delay
57: FL/Delay
58: Cho/Flanger
2.Delay Time1
23: 3 Tap Delay
24: 4 Tap Delay
1
Pre Delay
Time
(ms)
0.0
0.1
0.2
0.3
0.4
0.5
0.6
0.7
0.8
0.9
1.0
1.1
1.2
1.3
1.4
1.5
1.6
1.7
1.8
1.9
2.0
2.1
2.2
2.3
2.4
2.5
2.6
2.7
2.8
2.9
3.0
3.1
3.2
3.3
3.4
3.5
3.6
3.7
3.8
3.9
4.0
4.1
4.2
4.3
4.4
4.5
4.6
3
Delay
Time 2
(ms)
200
205
210
215
220
225
230
235
240
245
250
255
260
265
270
275
280
285
290
295
300
305
310
315
320
325
330
335
340
345
350
355
360
365
370
375
380
385
390
395
400
405
410
415
420
425
430
Value
(Dec.)
0
1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
21
22
23
24
25
26
27
28
29
30
31
32
33
34
35
36
37
38
39
40
41
42
43
44
45
46
3.Delay Time2
25: Tm Ctrl Delay
4.Delay Time3
21: Stereo Delay
22: Mod Delay
28: 3D Delay
37: OD → Delay
40: DS → Delay
43: EH → Delay
44: Cho → Delay
45: FL → Delay
56: Cho/Delay
57: FL/Delay
5.Delay Time4
48: GTR Multi 1
50: GTR Multi 3
51: Clean Gt Multi 1
52: Clean Gt Multi 2
55: Keyboard Multi
2
Delay
Time 1
(ms)
200
205
210
215
220
225
230
235
240
245
250
255
260
265
270
275
280
285
290
295
300
305
310
315
320
325
330
335
340
345
350
355
360
365
370
375
380
385
390
395
400
405
410
415
420
425
430
4
Delay
Time 3
(ms)
0.0
0.1
0.2
0.3
0.4
0.5
0.6
0.7
0.8
0.9
1.0
1.1
1.2
1.3
1.4
1.5
1.6
1.7
1.8
1.9
2.0
2.1
2.2
2.3
2.4
2.5
2.6
2.7
2.8
2.9
3.0
3.1
3.2
3.3
3.4
3.5
3.6
3.7
3.8
3.9
4.0
4.1
4.2
4.3
4.4
4.5
4.6
6.Rate1
07: Phaser
08: Auto Wah
09: Rotary
10: Stereo Flanger
11: Step Flanger
12: Tremolo
13: Auto Pan
16: Hexa Chorus
17: Tremolo Chorus
18: Stereo Chorus
19: Space-D
20: 3D Chorus
22: Mod Delay
31: 3D Auto
35: OD → Chorus
36: OD → Flanger
38: DS → Chorus
39: DS → Flanger
41: EH → Chorus
42: EH → Flanger
44: Cho → Delay
45: FL → Delay
46: Cho → Flanger
47: Rotary Multi
5
Delay
Time 4
(ms)
0
5
10
15
20
25
30
35
40
45
50
55
60
65
70
75
80
85
90
95
100
105
110
115
120
125
130
135
140
145
150
155
160
165
170
175
180
185
190
195
200
205
210
215
220
225
230
56: Cho/Delay
57: FL/Delay
58: Cho/Flanger
60: OD/Rotary
61: OD/Phaser
62: OD/Auto Wah
63: PH/Rotary
64: PH/Auto Wah
7.Rate 2
48: GTR Multi 1
49: GTR Multi 2
50: GTR Multi 3
51: Clean Gt Multi 1
52: Clean Gt Multi 2
53: Bass Multi
54: Rhodes Multi
55: Keyboard Multi
8.HF Damp
21: Stereo Delay
22: Mod Delay
23: 3 Tap Delay
24: 4 Tap Delay
25: Tm Ctrl Delay
6
7
Rate1
(Hz)
0.05
0.10
0.15
0.20
0.25
0.30
0.35
0.40
0.45
0.50
0.55
0.60
0.65
0.70
0.75
0.80
0.85
0.90
0.95
1.00
1.05
1.10
1.15
1.20
1.25
1.30
1.35
1.40
1.45
1.50
1.55
1.60
1.65
1.70
1.75
1.80
1.85
1.90
1.95
2.00
2.05
2.10
2.15
2.20
2.25
2.30
2.35
Rate2
(Hz)
0.05
0.10
0.15
0.20
0.25
0.30
0.35
0.40
0.45
0.50
0.55
0.60
0.65
0.70
0.75
0.80
0.85
0.90
0.95
1.00
1.05
1.10
1.15
1.20
1.25
1.30
1.35
1.40
1.45
1.50
1.55
1.60
1.65
1.70
1.75
1.80
1.85
1.90
1.95
2.00
2.05
2.10
2.15
2.20
2.25
2.30
2.35
8
HF
Damp
(Hz)
315
“
“
“
“
“
“
“
400
“
“
“
“
“
“
“
500
“
“
“
“
“
“
“
630
“
“
“
“
“
“
“
800
“
“
“
“
“
“
“
1000
“
“
“
“
“
“
9
Cutoff
Freq
(Hz)
250
“
“
“
“
“
“
“
315
“
“
“
“
“
“
“
400
“
“
“
“
“
“
“
500
“
“
“
“
“
“
“
630
“
“
“
“
“
“
“
800
“
“
“
“
“
“
26: Reverb
28: 3D Delay
37: OD → Delay
40: DS → Delay
43: EH → Delay
44: Cho → Delay
45: FL → Delay
51: Clean Gt Multi 1
56: Cho/Delay
57: FL/Delay
9.Cutoff Freq
10: Stereo Flanger
18: Stereo Chorus
34: Lo-Fi 2
10.EQ Freq
01: Stereo-EQ
47: Rotary Multi
49: GTR Multi 2
51: Clean Gt Multi 1
52: Clean Gt Multi 2
53: Bass Multi
55: Keyboard Multi
10
EQ
Freq
(Hz)
200
“
“
“
“
“
“
“
250
“
“
“
“
“
“
“
315
“
“
“
“
“
“
“
400
“
“
“
“
“
“
“
500
“
“
“
“
“
“
“
630
“
“
“
“
“
“
11.LPF
34: Lo-Fi 2
54: Rhodes Multi
12.Manual
07: Phaser
54: Rhodes Multi
55: Keyboard Multi
61: OD/Phaser
63: PH/Rotary
64: PH/Auto Wah
13.Azimuth
31: 3D Auto
32: 3D Locate
14.Accl
04: Humanizer
09: Rotary
60: OD/Rotary
63: PH/Rotary
11
12
LPF
(Hz)
250
“
“
“
“
“
“
“
315
“
“
“
“
“
“
“
400
“
“
“
“
“
“
“
500
“
“
“
“
“
“
“
630
“
“
“
“
“
“
“
800
“
“
“
“
“
“
Manual
(Hz)
100
110
120
130
140
150
160
170
180
190
200
210
220
230
240
250
260
270
280
290
300
320
340
360
380
400
420
440
460
480
500
520
540
560
580
600
620
640
660
680
700
720
740
760
780
800
820
13
Azimuth
(deg)
L180(=R180)
“
“
“
“
“
L168
“
“
“
L156
“
“
“
L144
“
“
“
L132
“
“
“
L120
“
“
“
L108
“
“
“
L96
“
“
“
L84
“
“
“
L72
“
“
“
L60
“
“
“
L48
14
Accl
0
“
“
“
“
“
“
“
1
“
“
“
“
“
“
“
2
“
“
“
“
“
“
“
3
“
“
“
“
“
“
“
4
“
“
“
“
“
“
“
5
“
“
“
“
“
“
Bijlagen
Value
(Hex.)
2F
30
31
32
33
34
35
36
37
38
39
3A
3B
3C
3D
3E
3F
40
41
42
43
44
45
46
47
48
49
4A
4B
4C
4D
4E
4F
50
51
52
53
54
55
56
57
58
59
5A
5B
5C
5D
5E
5F
60
61
62
63
64
65
66
67
68
69
6A
6B
6C
6D
6E
6F
70
71
72
73
74
75
76
77
78
79
7A
7B
7C
7D
7E
7F
Value
(Dec.)
47
48
49
50
51
52
53
54
55
56
57
58
59
60
61
62
63
64
65
66
67
68
69
70
71
72
73
74
75
76
77
78
79
80
81
82
83
84
85
86
87
88
89
90
91
92
93
94
95
96
97
98
99
100
101
102
103
104
105
106
107
108
109
110
111
112
113
114
115
116
117
118
119
120
121
122
123
124
125
126
127
1
Pre Delay
Time
(ms)
4.7
4.8
4.9
5.0
5.5
6.0
6.5
7.0
7.5
8.0
8.5
9.0
9.5
10
11
12
13
14
15
16
17
18
19
20
21
22
23
24
25
26
27
28
29
30
31
32
33
34
35
36
37
38
39
40
41
42
43
44
45
46
47
48
49
50
52
54
56
58
60
62
64
66
68
70
72
74
76
78
80
82
84
86
88
90
92
94
96
98
100
100
100
2
Delay
Time 1
(ms)
435
440
445
450
455
460
465
470
475
480
485
490
495
500
505
510
515
520
525
530
535
540
545
550
560
570
580
590
600
610
620
630
640
650
660
670
680
690
700
710
720
730
740
750
760
770
780
790
800
810
820
830
840
850
860
870
880
890
900
910
920
930
940
950
960
970
980
990
1000
–
–
–
–
–
–
–
–
–
–
–
–
3
Delay
Time 2
(ms)
435
440
445
450
455
460
465
470
475
480
485
490
495
500
505
510
515
520
525
530
535
540
545
550
555
560
565
570
575
580
585
590
595
600
610
620
630
640
650
660
670
680
690
700
710
720
730
740
750
760
770
780
790
800
810
820
830
840
850
860
870
880
890
900
910
920
930
940
950
960
970
980
990
1000
1000
1000
1000
1000
1000
1000
1000
4
Delay
Time 3
(ms)
4.7
4.8
4.9
5.0
5.5
6.0
6.5
7.0
7.5
8.0
8.5
9.0
9.5
10
11
12
13
14
15
16
17
18
19
20
21
22
23
24
25
26
27
28
29
30
31
32
33
34
35
36
37
38
39
40
50
60
70
80
90
100
110
120
130
140
150
160
170
180
190
200
210
220
230
240
250
260
270
280
290
300
320
340
360
380
400
420
440
460
480
500
500
5
Delay
Time 4
(ms)
235
240
245
250
255
260
265
270
275
280
285
290
295
300
305
310
315
320
325
330
335
340
345
350
355
360
365
370
375
380
385
390
395
400
405
410
415
420
425
430
435
440
445
450
455
460
465
470
475
480
485
490
495
500
505
510
515
520
525
530
535
540
545
550
555
560
565
570
575
580
585
590
595
600
605
610
615
620
625
630
635
6
7
Rate1
(Hz)
2.40
2.45
2.50
2.55
2.60
2.65
2.70
2.75
2.80
2.85
2.90
2.95
3.00
3.05
3.10
3.15
3.20
3.25
3.30
3.35
3.40
3.45
3.50
3.55
3.60
3.65
3.70
3.75
3.80
3.85
3.90
3.95
4.00
4.05
4.10
4.15
4.20
4.25
4.30
4.35
4.40
4.45
4.50
4.55
4.60
4.65
4.70
4.75
4.80
4.85
4.90
4.95
5.00
5.10
5.20
5.30
5.40
5.50
5.60
5.70
5.80
5.90
6.00
6.10
6.20
6.30
6.40
6.50
6.60
6.70
6.80
6.90
7.00
7.50
8.00
8.50
9.00
9.50
10.00
10.00
10.00
Rate2
(Hz)
2.40
2.45
2.50
2.55
2.60
2.65
2.70
2.75
2.80
2.85
2.90
2.95
3.00
3.05
3.10
3.15
3.20
3.25
3.30
3.35
3.40
3.45
3.50
3.55
3.60
3.65
3.70
3.75
3.80
3.85
3.90
3.95
4.00
4.05
4.10
4.15
4.20
4.25
4.30
4.35
4.40
4.45
4.50
4.55
4.60
4.65
4.70
4.75
4.80
4.85
4.90
4.95
5.00
5.05
5.10
5.15
5.20
5.25
5.30
5.35
5.40
5.45
5.50
5.55
5.60
5.65
5.70
5.75
5.80
5.85
5.90
5.95
6.00
6.05
6.10
6.15
6.20
6.25
6.30
6.35
6.40
8
HF
Damp
(Hz)
“
1250
“
“
“
“
“
“
“
1600
“
“
“
“
“
“
“
2000
“
“
“
“
“
“
“
2500
“
“
“
“
“
“
“
3150
“
“
“
“
“
“
“
4000
“
“
“
“
“
“
“
5000
“
“
“
“
“
“
“
6300
“
“
“
“
“
“
“
8000
“
“
“
“
“
“
“
Bypass
“
“
“
“
“
“
“
9
Cutoff
Freq
(Hz)
“
1000
“
“
“
“
“
“
“
1250
“
“
“
“
“
“
“
1600
“
“
“
“
“
“
“
2000
“
“
“
“
“
“
“
2500
“
“
“
“
“
“
“
3150
“
“
“
“
“
“
“
4000
“
“
“
“
“
“
“
5000
“
“
“
“
“
“
“
6300
“
“
“
“
“
“
“
8000
“
“
“
“
“
“
“
10
EQ
Freq
(Hz)
“
800
“
“
“
“
“
“
“
1000
“
“
“
“
“
“
“
1250
“
“
“
“
“
“
“
1600
“
“
“
“
“
“
“
2000
“
“
“
“
“
“
“
2500
“
“
“
“
“
“
“
3150
“
“
“
“
“
“
“
4000
“
“
“
“
“
“
“
5000
“
“
“
“
“
“
“
6300
“
“
“
“
“
“
“
11
12
13
14
LPF
(Hz)
“
1000
“
“
“
“
“
“
“
1250
“
“
“
“
“
“
“
1600
“
“
“
“
“
“
“
2000
“
“
“
“
“
“
“
2500
“
“
“
“
“
“
“
3150
“
“
“
“
“
“
“
4000
“
“
“
“
“
“
“
5000
“
“
“
“
“
“
“
6300
“
“
“
“
“
“
“
Bypass
“
“
“
“
“
“
“
Manual
(Hz)
840
860
880
900
920
940
960
980
1000
1100
1200
1300
1400
1500
1600
1700
1800
1900
2000
2100
2200
2300
2400
2500
2600
2700
2800
2900
3000
3100
3200
3300
3400
3500
3600
3700
3800
3900
4000
4100
4200
4300
4400
4500
4600
4700
4800
4900
5000
5100
5200
5300
5400
5500
5600
5700
5800
5900
6000
6100
6200
6300
6400
6500
6600
6700
6800
6900
7000
7100
7200
7300
7400
7500
7600
7700
7800
7900
8000
8000
8000
Azimuth
(deg)
“
“
“
L36
“
“
“
L24
“
“
“
L12
“
“
“
0
“
0
“
R12
“
“
“
R24
“
“
“
R36
“
“
“
R48
“
“
“
R60
“
“
“
R72
“
“
“
R84
“
“
“
R96
“
“
“
R108
“
“
“
R120
“
“
“
R132
“
“
“
R144
“
“
“
R156
“
“
“
R168
“
“
“
R180(=L180)
“
“
“
“
“
Accl
“
6
“
“
“
“
“
“
“
7
“
“
“
“
“
“
“
8
“
“
“
“
“
“
“
9
“
“
“
“
“
“
“
10
“
“
“
“
“
“
“
11
“
“
“
“
“
“
“
12
“
“
“
“
“
“
“
13
“
“
“
“
“
“
“
14
“
“
“
“
“
“
“
15
“
“
“
“
“
“
“
225
Bijlagen
MIDI-implementatie
❍ Voor dit hoofdstuk verwijzen we u naar de Engelstalige handleiding
p. 226 - 246.
226
Model SC-8850 Versie 1.00 '99.5
Specificaties
Model: Sound Canvas SC-8850
*HQHUDO0,',*HQHUDO0,',*6IRUPDW
●Aantal parts
●Maximum Polyfonie
VWHPPHQ
●Intern geheugen
.ODQNPDSSHQ
6&6&3UR6&6&
3UHVHWNODQNHQ
'UXPNODQNHQVHWV
8VHUNODQNHQ
8VHU'UXPNODQNHQVHWV
●Afmetingen
:['[+PP
:['[+LQFK
●Gewicht
NJ
OEVR]
●Bijlagen
*HEUXLNHUVKDQGOHLGLQJ
6WURRPVQRHU
,QKHWEHODQJYDQGHSURGXFWRQWZLNNHOLQJNXQQHQGHVSHFLILFDWLHVHQRI
KHWXLW]LFKWYDQGLWWRHVWHO]RQGHUYRRUDIJDDQGHOLMNHYHUZLWWLJLQJ
JHZLM]LJGZRUGHQ
●Effecten
5HYHUEVRRUWHQ
&KRUXVVRRUWHQ
'HOD\VRRUWHQ
7ZHHEDQGV(TXDOL]HU
,QYRHJHIIHFWHQVRRUWHQ
●Indicatoren
[SXQWVJUDILVFKH/&'EDFNOLW/&'
●Connectoren
86%FRQQHFWRU
6HULsOHFRQQHFWRU
0,',FRQQHFWRUHQ,1,1287287
$XGLR,QSXWDDQVOXLWLQJVWHUHR
$XGLR2XWSXWDDQVOXLWLQJVWHUHR
$XGLR2XWSXWDDQVOXLWLQJVWHUHR
$DQVOXLWLQJYRRUKRRIGWHOHIRRQ
●Stroomtoevoer
RI9$&
●Stroomverbruik
:
227
fig.Service’99/02/17
Informatie
:DQQHHUXHHQKHUVWHOOLQJVGLHQVWQRGLJKHEWFRQWDFWHHUGDQKHWGLFKWVWELM]LMQGH5RODQG(',52/6HUYLFH&HQWHURIHHQ
HUNHQGH5RODQG(',52/YHUGHOHULQXZODQG
AFRICA
EGYPT
$O)DQQ\7UDGLQJ2IILFH
32%R[
(O+RUULHK+HOLRSRORV&DLUR
(*<37
7(/
REUNION
0DLVRQ)2<$00DUFHO
5XH-XOHV0HUPDQ=/
&KDXGURQ%3
6WH&ORWLOGH5(81,21
7(/
SOUTH AFRICA
7KDW2WKHU0XVLF6KRS
37</WG
0HOOH6WUHHW&QU0HOOHDQG
-XWD6WUHHW
%UDDPIRQWHLQ
5HSXEOLFRI6287+$)5,&$
7(/
3DXO%RWKQHU37</WG
:HUGPXOOHU&HQWUH&ODUHPRQW
5HSXEOLFRI6287+$)5,&$
32%R[
&ODUHPRQW&DSH7RZQ
6287+$)5,&$
7(/
SINGAPORE
&5,672)25,086,&37(
/7'
%ON%HGRN,QGXVWULDO3DUN(
6,1*$325(
7(/
TAIWAN
52/$1'7$,:$1
(17(535,6(&2/7'
5RRPIO1R&KXQJ6KDQ
15RDG6HF7DLSHL7$,:$1
52&
7(/
THAILAND
7KHHUD0XVLF&R/WG
+XDQJPXFKDQJ&KDR<DQJ
'LVWULFW%HLMLQJ&+,1$
7(/
HONG KONG
7RP/HH0XVLF&R/WG
6HUYLFH'LYLVLRQ
3XQ6KDQ6WUHHW7VXHQ
:DQ1HZ7HUULWRULHV
+21*.21*
7(/
INDIA
5LYHUD'LJLWHF,QGLD3YW/WG
1LUPDQ.HQGUD0DKDOD[PL
)ODWV&RPSRXQG2II'U(GZLQ
0RVHV5RDG0XPEDL
,1',$
7(/
INDONESIA
37&LWUD,QWL5DPD
-&LGHQJ7LPXU1R-
-DNDUWD3XVDW
,1'21(6,$
7(/
KOREA
&RVPRV&RUSRUDWLRQ
6HUYLFH6WDWLRQ
QG)ORRU1DN:RQ$UFDGH
-RQJ5RNX6HRXO.25($
7(/
MALAYSIA
%HQWOH\0XVLF6'1%+'
BELGIUM/HOLLAND/
LUXEMBOURG
5RODQG%HQHOX[19
+RXWVWUDDW%2HYHO
:HVWHUOR%(/*,80
7(/
1RUGKDYQVYHM3RVWER[
'.&RSHQKDJHQ
'(10$5.
7(/
7UDQ4XDQJ.KDL6W
'LVWULFW
+R&KL0LQK&LW\
9,(71$0
7(/
AUSTRALIA/
NEW ZEALAND
NEW ZEALAND
0W(GHQ5RDG0W(GHQ
$XFNODQG1(:=($/$1'
7(/
CENTRAL/LATIN
AMERICA
5RODQG6FDQGLQDYLD$6
FRANCE
5RODQG)UDQFH6$
5XH3DXO+HQUL63$$.
3DUFGHO
(VSODQDGH)6W
7KLEDXOW/DJQ\&HGH[)5$1&(
7(/
5&RURQHO2FWDYLDQRGD6LOYHLUD
6DR3DXOR%5$=,/
7(/
MEXICO
&DVD9HHUNDPSVDGHFY
$Y7ROXFD1R&RO2OLYDUGH
ORV3DGUHV0H[LFR')
0(;,&2
7(/
GERMANY
5RODQG(OHNWURQLVFKH
0XVLNLQVWUXPHQWH
+DQGHOVJHVHOOVFKDIWPE+
672//$66$
0XVLF6RXQG/LJKW
1HZ1DWLRQDO5RDG
3DWUDV*5((&(
7(/
HUNGARY
,QWHUPXVLFD/WG
:DUHKRXVH$UHD¶'(32·3I
+7RURNEDOLQW+81*$5<
7(/
PHILIPPINES
*$<XSDQJFR&R,QF
&XDUHLP0RQWHYLGHR
858*8$<
7(/
VENEZUELA
0XVLFODQG'LJLWDO&$
$Y)UDQFLVFRGH0LUDQGD
&HQWUR3DUTXHGH&ULVWDO1LYHO
&/RFDO&DUDFDV
9(1(=8(/$
7(/
5RODQG6FDQGLQDYLD$6
6:(',6+6$/(62)),&(
'DQYLN&HQWHUWU
61DFND6:('(1
7(/
SWITZERLAND
5RODQG6ZLW]HUODQG$*
0XVLWURQLF$*
7,&7$&
0LUD6WU
32%R[
0XQNDFKHYR8.5$,1(
7(/
UNITED KINGDOM
5RODQG8./WG
$WODQWLF&ORVH6ZDQVHD
(QWHUSULVH3DUN6:$16($
6$)-
81,7('.,1*'20
7(/
BAHRAIN
0RRQ6WRUHV
%DE$O%DKUDLQ5RDG
32%R[
6WDWHRI%$+5$,1
7(/
'LDJRURX6W32%R[
1LFRVLD&<3586
7(/
5RODQG,WDO\6S$
NORWAY
5RODQG6FDQGLQDYLD$YG
.RQWRU1RUJH
/LOOHDNHUYHLHQ3RVWERNV
/LOOHDNHU12VOR
125:$<
7(/
POLAND
33+%U]RVWRZLF]
8/*LEUDOWDUVND
3/:DUV]DZD32/$1'
7(/
PORTUGAL
7HFQRORJLDV0XVLFDH$XGLR
5RODQG3RUWXJDO6$
58$6$17$&$7$5,1$
3RUWR32578*$/
7(/
32%R[0XVFDW
6XOWDQDWHRI20$1
7(/
QATAR
%DGLH6WXGLR6WRUHV
32%R[
'2+$4$7$5
7(/
SAUDI ARABIA
D'DZOLDK8QLYHUVDO
(OHFWURQLFV$3/
32%R[$/.+2%$5
6$8',$5$%,$
7(/
SYRIA
7HFKQLFDO/LJKW6RXQG
&HQWHU
.KDOHG,EQ$O:DOLG6W
32%R[
'DPDVFXV6<5,$
7(/
TURKEY
%DUNDW0X]LNDOHWOHULLWKDODW
YHLKUDFDWOLPLWHGLUHNHWL
6LUDVHOYLOHU&DG%LOOXUFX6RN
0XFDGHOOH&LNPH]H1R
7DNVLP,VWDQEXO785.(<
7(/
U.A.E.
=DN(OHFWURQLFV0XVLFDO
,QVWUXPHQWV&R
=DEHHO5RDG$O6KHURRT%OGJ
1R*UDQG)ORRU'8%$,
8$(
32%R['8%$,8$(
7(/
MIDDLE EAST
$XGLR+RXVH%HOPRQW&RXUW
'RQQ\EURRN'XEOLQ
5HSXEOLFRI,5(/$1'
7(/
9LDOHGHOOH,QGXVWULH
$UHVH0LODQR,7$/<
7(/
7RGR0XVLFD
SWEDEN
5DGH[6RXQG(TXLSPHQW/WG
$Y&RURQD1R6-
*XDGDODMDUD-DOLVFR0H[LFR
&30(;,&2
7(/
URUGUAY
&DOOH%ROLYLD%DUFHORQD
63$,1
7(/
CYPRUS
ITALY
$SDUWDGR3DQDPD
5(3'(3$1$0$
7(/
5RODQG(OHFWURQLFV
GH(VSDxD6$
5RODQG,UHODQG
3URGXFWRV6XSHULRUHV6$
SPAIN
IRELAND
/D&DVD:DJQHUGH
*XDGDODMDUDVDGHFY
PANAMA
6ODPL0XVLF&RPSDQ\
6DGRMDYD7ULXPIDOQDMDVW
0RVFRZ5866,$
7(/
UKRAINE
/DXWWDVDDUHQWLH%
)LQ+HOVLQNL),1/$1'
7(/
GREECE
5RODQG%UDVLO/WGD
RUSSIA
5RODQG6FDQGLQDYLD$V
)LOLDO)LQODQG
,QVWUXPHQWRV0XVLFDOHV6$
BRAZIL
2+,(OHFWURQLFV7UDGLQJ
&R//&
3ODWD/LEHUWDWLL
52&KHRUJKHQL
7(/
FINLAND
ARGENTINA
)ORULGDQG)ORRU
2IILFH1XPEHU$
%XHQRV$LUHV
$5*(17,1$&3
7(/
OMAN
)%6/,1(6
*HUEHUVWUDVVH&+/LHVWDO
6:,7=(5/$1'
7(/
2VWVWUDVVH1RUGHUVWHGW
*(50$1<
7(/
-DODQ%XNLW%LQWDQJ
.XDOD/XPSXU0$/$<6,$
7(/
*LO-3X\DW$YHQXH
0DNDWL0HWUR0DQLOD
3+,/,33,1(6
7(/
6LHPHQVVWUDVVH32%R[
$580$8675,$
7(/
VIETNAM
6DLJRQ0XVLF
ROMANIA
5RODQG$XVWULD*(60%+
DENMARK
CHINA
%HLMLQJ;LQJKDL0XVLFDO
,QVWUXPHQWV&R/WG
AUSTRIA
9HUQJ1DNRUQ.DVHP6RL
%DQJNRN7+$,/$1'
7(/
5RODQG&RUSRUDWLRQ1=/WG
ASIA
EUROPE
ISRAEL
+DOLOLW3*UHHQVSRRQ
6RQV/WG
5HW]LI)D
DOL\D+DVKQ\D6W
7HO$YLY<DKR,65$(/
7(/
JORDAN
$00$17UDGLQJ$JHQF\
AUSTRALIA
(',52/$XVWUDOLD3W\/WG
&HQWUDO$YHQXH
2DN)ODWV16:
$8675$/,$
7(/
U. S. A. / CANADA
(',52/&RUSRUDWLRQ1RUWK
$PHULFD
+DUULVRQ$YH6XLWH
32%R[
%ODLQH:$
86$
7(/
EUROPE
(',52/(XURSH/WG
&KLVZLFN+LJK5RDG
/RQGRQ:5*
8.
7(/
3ULQFH0RKDPPHG6W32%R[
$PPDQ-25'$1
7(/
KUWAIT
(DVD+XVDLQ$O<RXVLIL
32%R[6DIDW
.8:$,7
7(/
LEBANON
$&KDKLQH)LOV
32%R[*HUJL=HLGDQ6W
&KDKLQH%XLOGLQJ$FKUDILHK
%HLUXW/(%$121
7(/
MXQL(',52/
228
Index
Symbolen
Numeriek
3LWFKVKLIWHU
7DSGHOD\ 'DXWR 'FKRUXV 'GHOD\ 'HIIHFWHQ
'PDQXDO 7DS'HOD\ A
$&,1FRQQHFWRU $FWLYH6HQVLQJ $IVQLMIUHTXHQWLH
$IWHUWRXFK $OOPXWH
$OOQRWHVRII $OOSDUWVFKHUP
$OO6RXQGV2II
$PS $PSOLWXGH $QGHUH0,',NODQNEURQ
$UDELVFKHWRRQODGGHU $VVLJQJURHS ²
$WWDFNWLMG
$XGLRLQSXWDDQVOXLWILFKHV $XGLRLQSXWYROXPHNQRS
$XWRSDQ
$XWRZDK
B
%DQNVHOHFW
%DVVPXOWL EDXGVQHOKHLG %HJUHQ]HU
%HQG %HQGDPSOLWXGH %HQGDIVQLMIUHTXHQWLH %HQG/)2WRRQKRRJWH %HQG/)2VQHOKHLG
%HQG/)279)
%HQGEHUHLN EHUHLN
%QG %QGDPS %QGFXWRII %QG/)2WRRQKRRJWH
%QG/)2VQHOKHLG
%QG/)279) %QGEHUHLN %8/.
%XONGXPS
%XONGXPSYHU]RHN
C
&$) &$I &$IDPS &$IFXWRII
&$I/)2WRRQKRRJWH
&$I/)2VQHOKHLG
&$I/)279$
&$I/)279)
&$I5DQJH && &&
&&$PS
&&$PSOLWXGH &&&1XPEHU &&&RQWUROOHUQXPPHU
&&&XWRII
&&&XWRII)UHTXHQF\ &&/)23LWFK &&/)25DWH &&/)279$ &&/)279) &&5DQJH &KDQQHODIWHUWRXFK &KDQQHO$IWHUWRXFK$PSOLWXGH
&KDQQHO$IWHUWRXFKDIVQLMIUHTXHQWLH &KDQQHO$IWHUWRXFK/)23LWFK &KDQQHO$IWHUWRXFK/)2VQHOKHLG
&KDQQHO$IWHUWRXFK/)279$
&KDQQHO$IWHUWRXFK/)279)
&KDQQHO$IWHUWRXFKEHUHLN &KDQQHO3UHVVXUH
&KHFNVXP(UURU
&KR→'HOD\ &KR→)ODQJHU &KR'HOD\ &KR'HSWK &KR)HHGEDFN &KR1LYHDX &KR3UH/3) &KR5DWH &KR1DDU'O\
&KR1DDU5HY &KR'HOD\
&KR)ODQJHU
&KRUXV ²
&KRUXV'HOD\WLMG
&KRUXV'HSWK &KRUXV)HHGEDFN &KRUXV1LYHDX &+25860$&52 &KRUXVSDUDPHWHUV &KRUXV3UH/3) &KRUXV5DWH &KRUXV6HQG &KRUXV6HQG1LYHDX
&KRUXV6HQG1LYHDXQDDU'HOD\ &KRUXV6HQG1LYHDX1DDU5HYHUE &KRUXVVRRUW ²
&KRUXV &KRUXV &KRUXV &KRUXV &OHDQ*W0XOWL &OHDQ*W0XOWL &RPSUHVVRU &RPSXWHU &RPSXWHUNDEHO
&20387(5VFKDNHODDU ²
229
Index
FRQWUDVW
&RQWURO&KDQJH &RQWUROOHUV
&XUVRU
&XWRII &XWRII)UHT &XWRII)UHTXHQF\
D
'DWD(QWU\ 'HFDWLMG 'HFLPDO '(&5(0(17NQRS 'HOD\ ²
'HOD\)HHGEDFN 'HOD\1LYHDX
'HOD\1LYHDX0LGGHQ 'HOD\1LYHDX/LQNV
'HOD\1LYHDX5HFKWV '(/$<0$&52 'HOD\SDUDPHWHUV 'HOD\3UH/3) 'HOD\6HQG 'HOD\6HQG1LYHDX
'HOD\6HQG1LYHDX1DDU5HYHUE
'HOD\WLMG0LGGHQ
'HOD\WLMG5DWLR/LQNV
'HOD\WLMG5DWLR5HFKWV 'HOD\VRRUW ²
GHOD\UHYHUE 'HOD\ 'HOD\ 'HOD\ 'HOD\ 'HO\ 'HPRVRQJV
'HYLFH,'
'HYLFH,'QXPPHU GLVSOD\
'LVWRUWLRQ 'O\)HHGEDFN
'O\1LYHDX 'O\1LYHDX&
'O\1LYHDX/ 'O\1LYHDX5
'O\3UH/3) 'O\WLMG&
'O\1DDU5HY²
'O\7P5DWLR/
'O\7P5DWLR5
'580EXWWRQ
'UXP,QVWUXPHQW 'UXP,QVWUXPHQW&KRUXV6HQG1LYHDX 'UXP,QVWUXPHQW'HOD\6HQG1LYHDX
'UXP,QVWUXPHQW3DQ 'UXP,QVWUXPHQW3LWFK&RDUVH
'UXP,QVWUXPHQW5HYHUE6HQG1LYHDX
'UXP,QVWUXPHQW79$1LYHDX 'UXP3DUW
'UXP3DUWV 'UXP6FUHHQ
'UXP6HW ²
'UXPVHWOLMVW 'UXPVHWV 230
'6→FKRUXV
'6→GHOD\
'6→IODQJHU 'XPS ²
'XPSDOO
'XPSDOOXVHU
'XPSSDUW$ 'XPSSDUW%
'XPSSDUW& 'XPSSDUW' 'XPSXVHUGUXP
'XPSXVHULQVW
E
(',7 (GLWDOOVFKHUP
(',7NQRS (GLWVFKHUP
(GLWVFKHUP
())(&7
(IIHFWFRQWUROGLHSWH (IIHFWFRQWUROEURQ
(IIHFWSDUDPHWHU (IIHFWVFKHUP (IIHFWVRRUWHQ HIIHFWHQ ²
())(&7NQRS (); ();&GLHSWH ();&6UF
();2Q2II ();3$5$0(7(5
();3DUDPHWHU(IIHFWSDUDPHWHU ();1DDU&KR
();1DDU'O\
();1DDU5HY ();62257 ();VRRUW (+→FKRUXV (+→GHOD\ (+→IODQJHU (QKDQFHU
(17(5NRS (QYHORSH
(4+)UHT
(4+*DLQ (4/)UHT
(4/*DLQ (TXDOWHPSHUDPHQW (TXDOL]HU
(TXDOL]HUKRJHIUHTXHQWLH
(TXDOL]HUKRJHJDLQ (TXDOL]HUODJH (TXDOL]HUODJHJDLQ (TXDOL]HUSDUDPHWHUV ([FOXVLYHFRPPDQGR·V
(;,7NQRS ([SUHVVLH
Index
F
)NQRS )NQRS )NQRS )NQRS )DEULHNVLQVWHOOLQJHQ )DEULHN
IDEULHNVLQVWHOOLQJHQ )E36KLIWHU )HHGEDFN&KRUXV )LOWHU )LQHWXQH
IRXWPHOGLQJ
)/·GHOD\
)/GHOD\ )ODQJHU
G
*DWHUHYHUE *HQHUDO0,',
*HQHUDO0,',
*0LQVWUXPHQWHQOLMVW *06\VWHP2Q *06\VWHP2Q *6IRUPDDW *6UHVHW *750XOWL
*750XOWL
*750XOWL
H
+DOO +DOO +H[DFKRUXV
+H[DGHFLPDOHQ
+ROG +RRIGNODQNHQ
+RRIGWHOHIRRQ +XPDQL]HU I
,1&5(0(17NQRS ,QGLYLGXHOHJHJHYHQV ,QLWLDOL]HUHQ ,1387DDQVOXLWLQJVILFKH ,138792/80(NQRS
,QVW1LYHDX ,1670$3 ,QVW3DQ
,QVWUXPHQW
,QVWUXPHQWGLVSOD\DUHD
,QVWUXPHQWHQOLMVW ,167580(170$3NQRS
,QVWUXPHQWQXPPHU ²
,1678580(17NQRS LQWHUIDFH
LQWHUIDFHERUG ,QYRHJHIIHFWHQ ,QYRHJHIIHFWHQOLMVW
,QYRHJHIIHFWHQ2Q2II ,QYRHJHIIHFWSDUDPHWHUV J
-XVW,QWRQDWLRQ7RRQDDUG& K
.DQDDO
.H\VKLIW .H\ERDUGPXOWL
.H\ERDUGEHUHLNKRRJ .H\ERDUGEHUHLNODDJ .RUWHGHOD\ .RUWHGHOD\)%
L
/&'FRQWUDVW /HJDWRNODQNHQ /)23LWFK
/)25DWH
/)279$ /)279) /LPLWHU /R)L
/R)L
/6% ²
M
0.H\6KLIW
07XQH 030RGH
0DVWHU.H\6KLIW 0DVWHU1LYHDX 0DVWHU3DQ
0DVWHU7XQH
0DVWHU9ROXPH 0,', 0,',%DQNQXPPHUV
0,',%XII)XOO 0,',NDQDOHQ 0,',FRQQHFWRUHQ
0,',LPSOHPHQWDWLH
0,',LPSOHPHQWDWLHNDDUW
0,',,1FRQQHFWRU
0,',,1FRQQHFWRU
0,',,1FRQQHFWRU 0,',NODYLHU
0,',2II/LQH 0,',287FRQQHFWRU
0,',287FRQQHFWRU
0,',7KUX 0RG 0RG$PS 0RG&XWRII 0RG'HOD\ 0RG'HSWK 0RG/)23LWFK 0RG/)26QHOKHLG
0RG/)279$
0RG/)279)
0RG%HUHLN 02',)< 0RGXODWLH 0RGXODWLHDPSOLWXGH
0RGXODWLHDIVQLMIUHTXHQWLH 0RGXODWLHGLHSWH 231
Index
0RGXODWLH/)23LWFK 0RGXODWLH/)2VQHOKHLG
0RGXODWLH/)279$
0RGXODWLH/)279) 0RGXODWLHEHUHLN 0RQR 0RQRPRGXV 0RQR3RO\PRGXV
06% 0XOWLWLPEUDOHNODQNJHQHUDWRU 0XOWLWLPEUDOHNODQNPRGXOHV
087( 087(NQRS
N
1DXZNHXULJHDIVWHOOLQJ 1LYHDX
1R'UXPVHW
1R,QVWUXPHQW 1RQ5HJLVWHUHG3DUDPHWHUQXPPHU 1RUPDO3DUWV 1RRWFRPPDQGR·V 1RRWQXPPHU 1RWHRII
1RWHRQ
1RWHQ
1531 1531/6%06%
QXO O
RFWDDI 2'→&KRUXV 2'→'HOD\
2'→)ODQJHU 2'$XWR:DK 2'3KDVHU 2'5RWDU\ 2'2'
2SPHUNLQJ 2SVWDUWHQ
2XW$VJQ 287387DDQVOXLWLQJ 287387DDQVOXLWLQJ 2XWSXWDVVLJQ 2YHUGULYH 2YHUVWXULQJ P
3DQ
3DQGHOD\ 3DQGHOD\ 3DQGHOD\ 3DQGHOD\ 3DQQLQJGHOD\
3DQ5HSHDW
SDUDPHWHU 3DUW 3DUW%DVLFVFKHUP 3$57NQRS
3DUW(4 3DUWHTXDOL]HU 3DUWQLYHDX 232
3DUWPRGXV 3DUW0XWH
3DUWQXPPHU 3DUWSDQ 3DUWV
3+$XWR:DK 3+5RWDU\
3KDVHU 3+21(6DDQVOXLWLQJ 3+5$6(35(9,(: SLWFK
3LWFK%HQG
SLWFKEHQG
3LWFK&RDUVH
SLWFKVKLIW
3ODWH
3RO\
3RO\PRGXV 3RUWDPHQWR 3RUWDPHQWRFRQWUROH 3RUWDPHQWRWLMG
3UHYLHZIXQFWLH 3UHYLHZPRGXV 3UHYLHZQRRWQDDP 3UHYLHZVQHOKHLG 3UHYZPRGXV 3UHYZQRRW 3UHYZ9HOR 3UREOHPHQRSORVVHQ
3URJUDP&KDQJH
R
5DQGRP 5HJLVWHUHG3DUDPHWHUQXPPHU
5HOHDVHWLMG 5HVHW$OOFRQWUROOHUV 5HVRQDQWLH 5HYDDUG 5HY'O\)E 5HYQLYHDX
5HY3UH'O\7P 5HY3UH/3)
5HYWLMG 5HYVRRUW 5HYHUE 5HYHUEDDUG 5HYHUEGHOD\IHHGEDFN 5HYHUEQLYHDX 5(9(5%0$&52
5HYHUESDUDPHWHUV 5HYHUE3UH'HOD\WLMG 5HYHUE3UH/3)
5HYHUEVHQG 5HYHUEVHQGQLYHDX 5HYHUEWLMG 5HYHUEVRRUW ²
5KRGHV0XOWL 5RODQG6XSHU038,, 5RRP 5RRP 5RRP 5RWDU\ 5RWDU\0XOWL 531 Index
531/6%06%
5[0,',&+ 5[1RWH2II 5[1RWH2Q
S
6781(
6781(&²% 6&PDS 6&PDS 6&PDS
6&3URPDS
6FDOH7XQLQJ 6&52//EDU 6HOHFWHUHQYDQHHQ3DUW
6HULsOHFRQQHFWRU
6HULsOHFRQQHFWRU
6HULsOH0,',VWXULQJ
6HW
6+,)7NQRS
6LPXOWDQHQRWHQ
6QHOKHLG
6RIW 62/2
62/2NQRS 6RVWHQXWR 6SDFH'
6SHFWUXP 6WDUWXS
6WHPPHQ
6WHSIODQJHU 6WHUHRFKRUXV 6WHUHRGHOD\ 6WHUHRIODQJHU
6WHUHRSRVLWLH 6WHUHR(4 675220 6WURRPDDQ 6WURRPXLW
675220NQRS
6XSHU038,,
6\VWHHPHIIHFWHQ 6\VWHP([FOXVLYHFRPPDQGR
6\VWHHPSDUDPHWHUV U
8,167
86%
86%FRQQHFWRU ²
86%VWXULQJ 86%RII/LQH
8VHUDUHD 8VHUGUXP 8VHUGUXPVHW²
8VHULQVWUXPHQW
8VHU,QVWUXPHQWSDUDPHWHUV
8VHUSDUDPHWHUV 8WLOLW\VFKHUP
V
9$/8(VFKLMI
9$5NQRS
9DULDWLRQ
9$5,$7,21NQRS 9DULDWLRQQXPPHU²
9DULDWLRQNODQNHQ
9HORGLHSWH 9HORRIIVHW
9HORFLW\
9HORFLW\6HQVLWLYLW\GLHSWH
9HORFLW\6HQVLWLYLW\2IIVHW 9HUELQGW²
9HUZLVVHOHQWXVVHQ*URHS$%&HQ'
9HU]HQGHQ 9LEGHOD\ 9LEGLHSWH 9LEVQHOKHLG 9LEUDWR
9LEUDWRGHOD\
9LEUDWRGLHSWH
9LEUDWRVQHOKHLG 9RLFHV 9ROXPH 92/80(NQRS T
7KUX
7KUXIXQFWLH
7P&WUOGHOD\ 7RHWVHQEHUHLN+ 7RHWVHQEHUHLN/ 7RRQKRRJWH 7341 7UDQVSRQHUHQ 7UHPROR 7UHPROR&KRUXV 7XQH 79)DIVQLMIUHTXHQWLH
79)UHVRQDQWLH 79)79$(QYHORSHDDQ]HWWLMG
79)79$(QYHORSHXLWVWHUIWLMG
79)79$(QYHORSHORVODDWWLMG
233
Index
Werking via MIDI
&KRUXVYHUDQGHUHQ 'HOD\YHUDQGHUHQ 'UXPVHWYDQHHQSDUWYHUDQGHUHQ
(HQQRUPDOHSDUWLQHHQGUXPSDUWYHUDQGHUHQ (TXDOL]HU/RZ*DLQYHUDQGHUHQ
(TXDOL]HUYDQHHQ3DUWXLW]HWWHQ
,QVWHOOLQJHQYHUDQGHUHQRPNODQNWHNULMJHQYDQXLW287387 ,QYRHJHIIHFWHQWRHSDVVHQRSHHQEHSDDOGHSDUW .ODQNYDQHHQSDUWYHUDQGHUHQ 0DSHQYDULDWLHNODQNYDQHHQSDUWYHUDQGHUHQ
3DQYDQHHQSDUWYHUDQGHUHQ 3DQYDQHHQSDUWYHUDQGHUHQQDDUUDQGRP 3DUWQLYHDXYHUDQGHUHQ 3LWFKYDQHHQGUXLQVWUXPHQWYHUDQGHUHQ 5HYHUEYHUDQGHUHQ :DDUGHYDQGHDIVQLMIUHTXHQWLHYDQHHQSDUWYHUDQGHUHQ
9DULDWLHNODQNYDQHHQSDUWYHUDQGHUHQ 234