Woods 42C-6 Owner`s manual

Owner’s Manual
Operation and Care
INSTALLER: Leave this manual with party responsible for use and operation.
OWNER: Retain this manual for future reference.
Contact your dealer with questions on installation, operation, or service.
NOTICE: DO NOT discard this manual!
Model(s):
A36C, A36CH
A42C, A42CH
WARNING: If the information in these
instructions is not followed exactly, a fire
or explosion may result causing property
damage, personal injury, or death.
• DO NOTstoreorusegasolineorotherflammablevaporsandliquidsinthevicinityofthis
oranyotherappliance.
• DO NOT overfire. Overfiring will void your
warranty.
• Complywithallminimumclearancestocombustiblesasspecified.Failuretocomplymay
causehousefire.
WARNING
HOT SURFACES!
Glassandothersurfacesarehotduring
operationANDcooldown.
Hot glass will cause burns.
• DO NOTtouchglassuntilitiscooled
• NEVERallowchildrentotouchglass
• Keepchildrenaway
• CAREFULLY SUPERVISE children in same room as
fireplace.
• Alertchildrenandadultstohazardsofhightemperatures.
WOODBURNING FIREPLACE
Installationandserviceofthisfireplaceshouldbe
performedbyqualifiedpersonnel.Hearth&Home
TechnologiesrecommendsNFIcertifiedprofessionals,ortechnicianssupervisedbyan
NFIcertifiedprofessional.
High temperatures may ignite clothing or other flammable
materials.
• Keep clothing, furniture, draperies and other flammable
materialsaway.
WARNING
Fire Risk.
For use with solid wood fuel only.
Other fuels may overfire and generate poisonous
gases (i.e. carbon monoxide).
Heatilator•A36/42C,A36/42CHOwnersManual•4017-263•RevD•05/01/14
1
Safety Alert Key:
DANGER! Indicates a hazardous situation which, if not avoided will result in death or serious injury.
WARNING! Indicates a hazardous situation which, if not avoided could result in death or serious injury.
CAUTION! Indicates a hazardous situation which, if not avoided, could result in minor or moderate injury.
NOTICE: Indicates practices which may cause damage to the fireplace or to property.
•
•
•
•
Table of Contents
4 Maintenance and Service
1Welcome
A. Congratulations
B. LIMITED LIFETIME WARRANTY
3
4
2 Product Specific and General Information
A. Appliance Certification
6
B. Vented Gas Log Sets, Gas or Wood Inserts and Gas Log
Lighters
6
3 Important Safety and Operating Information
A. Fireplace Safety
1. Clear Space
2. Grate
3. Refractory
4. Firescreen
5. Flue Damper
6. Glass Doors
7. Over-Firing Your Fireplace
8. Chimney Fire
B. General Operating Parts
1. Flue Damper
2. Outside Air (Optional)
3. Glass Doors
4. Fan Kit
C.Fuel
1. Hardwood vs. Softwood
2. Moisture content
3. Seasoning
4. Storing Wood
5. Burning Process
6. Creosote Formation
7. Processed Solid Fuel Firelogs
D.First Fire
E. Lighting Instructions
2
7
7
8
8
8
8
8
8
8
9
10
10
10
10
11
11
11
12
12
12
12
12
12
13
A. Chimney Inspection
B. Creosote (Chimney) Cleaning
C.Grate
D.Glass Cleaning
E. Ash Removal
F. Refractory
5Troubleshooting
A. FAQs
6 Reference Materials
► A. Service Parts
B. Accessories
C.Contact Information
Heatilator • A36/42C, A36/42CH Owners Manual • 4017-263 • Rev D • 05/01/14
14
14
15
15
15
15
17
19
23
24
1
Welcome
A.Congratulations
Read this manual before installing or operating this fireplace.
Please retain this owner’s manual for future references.
Congratulations on selecting a Heatilator wood burning
fireplace. The Heatilator fireplace you have selected is
designed to provide the utmost in safety and reliability.
This Owner's Manual should be retained for future reference. We suggest that you keep it with your other important documents and product manuals.
As the owner of a new fireplace, you'll want to read and
carefully follow all of the instructions contained in this
Owner's Manual. Pay special attention to all Cautions and
Warnings.
Your new Heatilator wood burning fireplace will give you
years of durable use and trouble-free enjoyment. Welcome to the Heatilator family of fireplace products!
Heatilator is a registered trademark of Hearth & Home
Technologies.
Local Dealer Information
Dealer: Fill in
your name, address,
phone and e-mail
information here and
fireplace information
below.
Dealer Name: ________________________________________________________
Address: ____________________________________________________________
____________________________________________________________
Phone: _____________________________________________________________
E-mail: _____________________________________________________________
Fireplace Information:
Brand:_________________________________________________ Model Name:____________________________
Serial Number:___________________________________________ Date Installed:___________________________
Listing Label Information/Location
The model information regarding your specific fireplace can be found on
the rating plate usually located in the control area of the fireplace.
Serial
Number
Fireplace
Model
Grate
FIREPLACE NO.
WARNING: RISK OF
FIRE DAMAGE. REPLACE
GRATE WITH HEARTH & HOME
TECHNOLOGIES
MODEL NO.
MODEL NO.
MFG. DATE
FIRECHAMBER INTENDED FOR USE WITH HEARTH & HOME TECHNOLOGIES LISTED FIREPLACE PARTS. SEE INSTALLATION AND
OPERATING INSTRUCTIONS FOR THIS MODEL. ONLY HEARTH & HOME TECHNOLOGIES GLASS DOOR KITS CAN BE INSTALLED ON THIS UNIT.
FIREPLACE ALSO FOR USE
IN MANUFACTURED HOMES
FAN KIT
MODEL NO.
YES
CLEARANCE TO
COMBUSTIBLES:
NO
&
DO NOT OVERFIRE. USE ONLY: SOLID WOOD FUEL OR
LISTED DECORATIVE GAS APPLIANCE. DO NOT USE A
FIREPLACE INSERT OR OTHER PRODUCTS NOT
SPECIFIED FOR USE WITH THIS PRODUCT. IF DOORS
ARE USED OPERATE FIREPLACE WITH DOORS FULLY
OPEN OR CLOSED ONLY. WHEN BURNING A
DECORATIVE GAS APPLIANCE IN THE FIREPLACE,
ADJUST DAMPER TO THE FULLY OPEN POSITION.
CHIMNEY
2 IN. MIN.
RATED AT
115 VOLTS, 50/60 Hz.,
IN.
MIN.
FIREBOX
AMP.
WARNING! THIS FIREPLACE HAS NOT BEEN TESTED WITH AN UNVENTED
GAS LOG SET. TO REDUCE THE RISK OF FIRE OR INJURY, DO NOT
INSTALL AN UNVENTED GAS LOG SET INTO FIREPLACE.
WARNING! THIS APPLIANCE IS NOT FOR USE AS COOKING EQUIPMENT.
IF INSTALLATION OR OPERATING INSTRUCTIONS ARE MISSING
CONTACT: HEARTH & HOME TECHNOLOGIES,
7571 215th Street West, Lakeville, MN 55044
Heatilator • A36/42C, A36/42CH Owners Manual • 4017-263 • Rev D • 05/01/14
3
B.LIMITED LIFETIME WARRANTY
Hearth & Home Technologies
LIMITED LIFETIME WARRANTY
Hearth&HomeTechnologies,onbehalfofitshearthbrands(”HHT”),extendsthefollowingwarrantyforHHT
gas,wood,pellet,coalandelectrichearthappliancesthatarepurchasedfromanHHTauthorizeddealer.
WARRANTY COVERAGE:
HHTwarrantstotheoriginalowneroftheHHTapplianceatthesiteofinstallation,andtoanytransfereetakingownership
oftheapplianceatthesiteofinstallationwithintwoyearsfollowingthedateoforiginalpurchase,thattheHHTappliance
willbefreefromdefectsinmaterialsandworkmanshipatthetimeofmanufacture.Afterinstallation,ifcoveredcomponentsmanufacturedbyHHTarefoundtobedefectiveinmaterialsorworkmanshipduringtheapplicablewarrantyperiod,
HHTwill,atitsoption,repairorreplacethecoveredcomponents.HHT,atitsowndiscretion,mayfullydischargeallofits
obligationsundersuchwarrantiesbyreplacingtheproductitselforrefundingtheverifiedpurchasepriceoftheproduct
itself.Themaximumamountrecoverableunderthiswarrantyislimitedtothepurchasepriceoftheproduct.Thiswarranty
issubjecttoconditions,exclusionsandlimitationsasdescribedbelow.
WARRANTY PERIOD:
Warrantycoveragebeginsonthedateoforiginalpurchase.Inthecaseofnewhomeconstruction,warrantycoverage
beginsonthedateoffirstoccupancyofthedwellingorsixmonthsafterthesaleoftheproductbyanindependent,
authorizedHHTdealer/distributor,whicheveroccursearlier.Thewarrantyshallcommencenolaterthan24months
followingthedateofproductshipmentfromHHT,regardlessoftheinstallationoroccupancydate.Thewarrantyperiodfor
partsandlaborforcoveredcomponentsisproducedinthefollowingtable.
Theterm“LimitedLifetime”inthetablebelowisdefinedas:20yearsfromthebeginningdateofwarrantycoveragefor
gasappliances,and10yearsfromthebeginningdateofwarrantycoverageforwood,pellet,andcoalappliances.These
timeperiodsreflecttheminimumexpectedusefullivesofthedesignatedcomponentsundernormaloperatingconditions.
WarrantyPeriod
Parts
Labor
1Year
2years
HHTManufacturedAppliancesandVenting
Gas
X
X
Wood
X
X
X
3years
Pellet
EPA
Wood
Coal
X
X
X
X
X
X
X
X
X
ComponentsCovered
Electric Venting
X
X
Allpartsandmaterialexceptas
coveredbyConditions,
Exclusions,andLimitations
listed
Igniters,electroniccomponents,
and glass
Factory-installedblowers
Moldedrefractorypanels
X
Firepotsandburnpots
5years
1year
7years
3years
10
years
1year
X
Limited
3years
Lifetime
X
X
X
X
X
90Days
X
X
X
X
X
X
X
X
Castingsandbaffles
X
X
Manifoldtubes,
HHTchimneyandtermination
Burners,logsandrefractory
Fireboxandheatexchanger
X
X
Allreplacementparts
beyondwarrantyperiod
Seeconditions,exclusions,andlimitationsonnextpage.
4021-645F02-18-13
4
Page1of2
Heatilator • A36/42C, A36/42CH Owners Manual • 4017-263 • Rev D • 05/01/14
WARRANTY CONDITIONS:
•
ThiswarrantyonlycoversHHTappliancesthatarepurchasedthroughanHHTauthorizeddealerordistributor.Alistof
HHTauthorizeddealersisavailableontheHHTbrandedwebsites.
• ThiswarrantyisonlyvalidwhiletheHHTapplianceremainsatthesiteoforiginalinstallation.
•ThiswarrantyisonlyvalidinthecountryinwhichtheHHTauthorizeddealerordistributorthatsoldtheappliance
resides.
• Contactyourinstallingdealerforwarrantyservice.Iftheinstallingdealerisunabletoprovidenecessaryparts,contact
thenearestHHTauthorizeddealerorsupplier.Additionalservicefeesmayapplyifyouareseekingwarrantyservice
fromadealerotherthanthedealerfromwhomyouoriginallypurchasedtheproduct.
• Checkwithyourdealerinadvanceforanycoststoyouwhenarrangingawarrantycall.Travelandshippingcharges
forpartsarenotcoveredbythiswarranty.
WARRANTY EXCLUSIONS:
Thiswarrantydoesnotcoverthefollowing:
• Changesinsurfacefinishesasaresultofnormaluse.Asaheatingappliance,somechangesincolorofinteriorand
exteriorsurfacefinishesmayoccur.Thisisnotaflawandisnotcoveredunderwarranty.
• Damagetoprinted,plated,orenameledsurfacescausedbyfingerprints,accidents,misuse,scratches,melteditems,
orotherexternalsourcesandresiduesleftontheplatedsurfacesfromtheuseofabrasivecleanersorpolishes.
• Repairorreplacementofpartsthataresubjecttonormalwearandtearduringthewarrantyperiod.Theseparts
include:paint,wood,pelletandcoalgaskets,firebricks,grates,flameguides,batteriesandthediscolorationofglass.
• Minorexpansion,contraction,ormovementofcertainpartscausingnoise.Theseconditionsarenormalandcomplaintsrelatedtothisnoisearenotcoveredbythiswarranty.
• Damagesresultingfrom:(1)failuretoinstall,operate,ormaintaintheapplianceinaccordancewiththeinstallation
instructions,operatinginstructions,andlistingagentidentificationlabelfurnishedwiththeappliance;(2)failureto
installtheapplianceinaccordancewithlocalbuildingcodes;(3)shippingorimproperhandling;(4)improperoperation,abuse,misuse,continuedoperationwithdamaged,corrodedorfailedcomponents,accident,orimproperly/
incorrectlyperformedrepairs;(5)environmentalconditions,inadequateventilation,negativepressure,ordrafting
causedbytightlysealedconstructions,insufficientmake-upairsupply,orhandlingdevicessuchasexhaustfansor
forcedairfurnacesorothersuchcauses;(6)useoffuelsotherthanthosespecifiedintheoperatinginstructions;(7)
installationoruseofcomponentsnotsuppliedwiththeapplianceoranyothercomponentsnotexpresslyauthorized
andapprovedbyHHT;(8)modificationoftheappliancenotexpresslyauthorizedandapprovedbyHHTinwriting;
and/or(9)interruptionsorfluctuationsofelectricalpowersupplytotheappliance.
• Non-HHTventingcomponents,hearthcomponentsorotheraccessoriesusedinconjunctionwiththeappliance.
• Anypartofapre-existingfireplacesysteminwhichaninsertoradecorativegasapplianceisinstalled.
• HHT’sobligationunderthiswarrantydoesnotextendtotheappliance’scapabilitytoheatthedesiredspace.Informationisprovidedtoassisttheconsumerandthedealerinselectingtheproperappliancefortheapplication.Considerationmustbegiventoappliancelocationandconfiguration,environmentalconditions,insulationandairtightnessof
thestructure.
This warranty is void if:
•
•
•
Theappliancehasbeenover-firedoroperatedinatmospherescontaminatedbychlorine,fluorine,orotherdamaging
chemicals.Over-firingcanbeidentifiedby,butnotlimitedto,warpedplatesortubes,rustcoloredcastiron,bubbling,
crackinganddiscolorationofsteelorenamelfinishes.
Theapplianceissubjectedtoprolongedperiodsofdampnessorcondensation.
Thereisanydamagetotheapplianceorothercomponentsduetowaterorweatherdamagewhichistheresultof,but
notlimitedto,improperchimneyorventinginstallation.
LIMITATIONS OF LIABILITY:
•
Theowner’sexclusiveremedyandHHT’ssoleobligationunderthiswarranty,underanyotherwarranty,expressor
implied,orincontract,tortorotherwise,shallbelimitedtoreplacement,repair,orrefund,asspecifiedabove.Inno
eventwillHHTbeliableforanyincidentalorconsequentialdamagescausedbydefectsintheappliance.Somestates
donotallowexclusionsorlimitationofincidentalorconsequentialdamages,sotheselimitationsmaynotapplytoyou.
Thiswarrantygivesyouspecificrights;youmayalsohaveotherrights,whichvaryfromstatetostate.EXCEPTTO
THEEXTENTPROVIDEDBYLAW,HHTMAKESNOEXPRESSWARRANTIESOTHERTHANTHEWARRANTY
SPECIFIEDHEREIN.THEDURATIONOFANYIMPLIEDWARRANTYISLIMITEDTODURATIONOFTHE
EXPRESSEDWARRANTYSPECIFIEDABOVE.
4021-645F02-18-13
Page2of2
Heatilator • A36/42C, A36/42CH Owners Manual • 4017-263 • Rev D • 05/01/14
5
2
Product Specific and General Information
A.Appliance Certification
This fireplace system has been tested and listed in accordance with UL 127 and ULC-S610 standards by Underwriters Laboratories Inc. for installation and operation in
the United States and Canada.
This fireplace may be installed in sleeping rooms EXCEPT in manufactured homes. If installed with a gas log
set, provisions for the National Fuel Gas Code must be
met.
This fireplace has been tested and listed for use with
the optional components specified in this manual. These
optional components may be purchased separately and
installed at a later date. An outside air kit, gas log set, gas
insert or gas log-lighter should be installed at the time of
fireplace installation.
B.Vented Gas Log Sets, Gas or Wood Inserts and Gas Log Lighters
• Optional
• Vented gas log sets, gas or wood inserts, or gas loglighters can be installed in this fireplace. Follow the
instructions provided with the accessory for operation.
Warning! Risk of Fire or Asphyxiation!
• DO NOT install unvented gas logs.
• Damper must be locked open.
• Gas flame may generate fumes.
Heatilator is a registered trademark of Hearth & Home
Technologies.
Warning! Risk of Fire!
For use with solid wood fuel only.
Other fuels may overfire and generate poisonous gases
(i.e. carbon monoxide).
6
Heatilator • A36/42C, A36/42CH Owners Manual • 4017-263 • Rev D • 05/01/14
3
Important Safety and Operating Information
A. Fireplace Safety
Mostproblemsarecausedbyimproperinstallationandoperationofthefireplace.Toprovidereasonablefiresafety,
thefollowingshouldbegivenseriousconsideration:
• Thefireshouldbesupervisedwheneverthefireplaceis
inuse.
• An annual inspection should be performed on the
fireplacesystem.
• Installatleastonesmokedetectoroneachfloorofyour
hometoensureyoursafety.
• InstallaconvenientlylocatedClassAfireextinguisher
nearthefireplace.
• Deviseapracticedevacuationplan,consistingofatleast
twoescaperoutes.
• Deviseaplantodealwithachimneyfire:
- Evacuate.
- Notifythefiredepartment.
WARNING! Risk of Fire! Hearth & Home Technologies
disclaims any responsibility for, and the warranty and
agencylistingwillbevoidedbythefollowingactions.
DO NOT:
• operatedamagedfireplace
• modifyfireplace
• overfire
• installanyunventedgaslogset
• installanycomponentnotapprovedbyHearth&Home
Technologies
• installpartsorcomponentsnotListedorapproved
• operate the fireplace without fully assembling all
components
1. Clear Space
Combustiblematerialsmustnotbestoredonthehearth
extension.Roomfurnishingssuchasdrapes,curtains,
chairs or other combustibles must be at least 4ft
(1219mm)fromthefrontofthefireplace.
Combustible materials are materials made of or surfacedwithanyofthefollowingmaterials:
-
-
-
-
Wood
- Compressedpaper
Plantfibers
- Plastic
Plywood/OSB - Drywall
Anymaterialthatcanigniteandburn,flameproofed
ornot,plasteredorun-plastered.
Non-combustiblematerialsarematerialswhichwillnot
igniteandburn,composedofanycombinationofthe
following:
-
-
-
-
Steel
Brick
Concrete
Glass
-
-
-
-
Iron
Tile
Slate
Plasters
WARNING! Risk of Fire! Keep combustible materials,
gasolineandotherflammablevaporsandliquidsclearof
thefireplace.
DO NOT:
• storeflammablematerialsclosetothefireplace
• use gasoline, lantern fuel, kerosene, charcoal lighter
fluidorsimilarliquidstostartor“freshenup”afireinthis
fireplace.
Improper installation, adjustment, alteration, service or
maintenancecancauseinjuryorpropertydamage.
43-1/2 in. (1105mm)
Clear Space
Bottom of Fireplace
to Lower Edge of
Mantel or Trim
48 in. (1219 mm)
Clear Space
Front of Fireplace
Figure 3.1
12 in. (305 mm)
Clear Space
Sides of Fireplace
(from the FP
opening)
Clear Space
Heatilator•A36/42C,A36/42CHOwnersManual•4017-263•RevD•05/01/14
7
2.Grate
7. Over-Firing Your Fireplace
This fireplace is designed to be used with the supplied
grate or one approved by HHT.
Warning! Risk of Fire! Use only the factory-supplied integral grate.
• Keeps logs in place.
• Allows proper air circulation around the fire.
3.Refractory
The refractory is supplied to contain heat and provide
an attractive interior.
It will break down over time and will need occasional
replacement. Small hairline cracks and discoloration
are normal and do not affect its safety.
Warning! Risk of Fire! Do not burn fireplace without refractory. Use only refractory supplied by Hearth &
Home Technologies.
4.Firescreen
The firescreen is provided to control sparks. Keep it
closed when the fireplace in use.
Warning! Risk of Fire or Burns!
• Screen will not prevent burning materials from falling
out.
• Screen pulls or handles may be hot.
5. Flue Damper
The flue damper must be in the fully opened position
during operation of the fireplace.
Warning! Risk of Fire and Asphyxiation! Open
damper prior to operating fireplace. A closed damper
overfires the fireplace and spills smoke and flames
into the room.
WARNING! Risk of Fire! Do not over-fire.
Over-firing may ignite creosote or will damage the
fireplace and chimney.
To prevent over-firing your fireplace. DO NOT:
• use flammable liquids
• overload with wood
• burn trash or large amounts of scrap lumber
• permit too much air to the fire
Symptoms of over-firing may include one or more of the
following:
•
•
•
•
•
chimney connector or fireplace glowing
roaring, rumbling noises
loud cracking or banging sounds
metal warping
chimney fire
8. Chimney Fire
In the event of a chimney fire
• Have the chimney and adjacent structure inspected by
qualified professionals. Hearth & Home Technologies
recommends that NFI or CSIA certified professionals,
or technicians under the direction of certified
professionals, conduct a minimum of an NFPA 211
Level 2 inspection of the chimney.
• Replace components of the chimney and fireplace
as specified by the professionals.
• Ensure all joints are properly engaged and the
chimney is properly secured.
Warning! Risk of Fire! A chimney fire can permanently damage your chimney system. Failure to replace damaged components and make proper repairs
can cause a structure fire.
6. Glass Doors
Glass doors are optional.
Warning! Risk of Fire! Install ONLY doors approved
by Hearth & Home Technologies.
Warning! Risk of Fire and Smoke! Fireplace
equipped with doors should be operated only with
doors fully open or doors fully closed. If doors are left
partly open, gas and flame may be drawn out of the
fireplace opening.
8
Heatilator • A36/42C, A36/42CH Owners Manual • 4017-263 • Rev D • 05/01/14
WARNING
HOT SURFACES!
GlassandothersurfacesarehotduringoperationANDcooldown.
Hot glass will cause burns.
• DO NOTtouchglassuntilitiscooled
• NEVERallowchildrentotouchglass
• Keepchildrenaway
• CAREFULLYSUPERVISEchildreninsameroomasfireplace.
• Alertchildrenandadultstohazardsofhightemperatures.
High temperatures may ignite clothing or other flammable materials.
• Keepclothing,furniture,draperiesandotherflammablematerialsaway.
CAUTION! Ifyouexpectthatchildrenmaycomeintocontactwiththisfireplace,werecommendabarriersuchasadecorative
screen.Seeyourdealerforsuggestions.
B. General Operating Parts
WARNING! DO NOT operatefireplacebeforereadingandunderstandingoperatinginstructions.Failuretooperatefireplaceaccordingtooperatinginstructionscouldcausefireorinjury.
Flue Damper
Control
Section 2.F.
Close
Open
Open
Close
Outside Air Kit
Control
Section 2.I.
Figure 3.2
General Operating Parts
Heatilator•A36/42C,A36/42CHOwnersManual•4017-263•RevD•05/01/14
9
1. Flue Damper
3. Glass Doors
Thefluedampermustbeinthefullyopenedposition
(handleallthewaytotheright)duringoperationofthe
fireplace.
• Glassdoorsareoptional.
• RefertoFigure3.3forhowtoproperlyusethem.
Beforelightingthefireplace,verifyfullyopenposition
bylookingupfromtheinsideofthefireplace.
FULLY OPEN
CORRECT
PARTLY OPEN
INCORRECT
FULLY CLOSED
CORRECT
PARTLY CLOSED
INCORRECT
2. Outside Air (Optional)
RefertoFigure3.2forlocationandoperationofcontrol.
The outside air kit supplies some combustion air for
yourfireplace.Itmayhelpreducetheeffectsofnegativeairpressure.
Closetheinlettopreventcolddraftswhenthefireplace
isnotbeingused
CAUTION! Outside air control handle may be warm.
Adjustbeforelightingfire.
Figure 3.3
Operating Positions of Bi-fold Doors
4. Fan Kit
• Fankitisoptional.
• Refertoinstructionsincludedwithfankit.
10
Heatilator•A36/42C,A36/42CHOwnersManual•4017-263•RevD•05/01/14
C.Fuel
Warning! For use with solid wood fuel only.
Other fuels may overfire and generate poisonous gases (i.e.
carbon monoxide).
1. Hardwood vs. Softwood
Your fireplace’s performance depends on the quality of
the firewood you use. One species of wood varies very
little to the other in terms of energy content. All seasoned wood contains about 8,000 BTU’s per pound.
Hardwoods have a greater density than softwoods; a
piece of hardwood will contain about 60% more BTU’s
than an equal size piece of softwood. A cord of seasoned oak (hardwood) would contain about 60% more
potential energy than a cord of seasoned pine (softwood).
Most softwoods are coniferous. These are trees with
needle-like leaves that stay green all year and carry
their seeds exposed in a cone. Examples of coniferous trees are Douglas fir, pine, spruce and cedar. Softwoods, being more porous, require less time to dry,
burn faster and are easier to ignite than hardwoods.
Hardwoods are deciduous trees, broadleaf trees that
lose their leaves in the fall. Their seeds are usually
found within a protective pod or enclosure. Some examples of deciduous trees are oak, maple, apple, and
birch. However, it should be noted that there are some
deciduous trees that are definitely not considered hardwoods such as poplar, aspen and alder. Hardwoods
require more time to season, burn slower and are usually harder to ignite than softwoods. Obviously, you will
use the type of wood that is most readily available in
your area. However, if at all possible the best arrangement is to have a mix of softwood and hardwood. This
way you can use the softwood for starting the fire, giving off quick heat to bring the fireplace up to operating
temperature. Add the hardwood for slow, even heat and
longer burn time.
Soft woods
Hard woods
•
•
•
•
•
•
•
•
•
•
•
Douglas Fir
Pine
Spruce
Cedar
Poplar
Aspen
Alder
Warning! Risk of Fire!
• Do NOT burn wet or green wood.
• Wet, unseasoned wood can cause accumulation of
creosote.
2. Moisture content
The majority of the problems fireplace owners experience are caused by trying to burn wet, unseasoned
wood. Freshly cut wood can be as much water as it is
wood, having a moisture content of around 50%. Imagine a wooden bucket that weighs about 8 pounds. Fill it
with a gallon of water, put it in the firebox and try to burn
it. This sounds ridiculous but that is exactly what you
are doing if you burn unseasoned wood. Dead wood
lying on the forest floor should be considered wet, and
requires full seasoning time. Standing dead wood can
be considered to be about two-thirds seasoned, if cut at
the dry time of the year.
Burning wet, unseasoned wood will produce less heat
output because it requires energy in the form of heat
to evaporate the water trapped inside. This is wasted
energy that should be used for heating your home. This
moisture evaporates in the form of steam which has
a cooling effect in your firebox and chimney system.
When combined with tar and other organic vapors from
burning wood it will form creosote which condenses in
the relatively cool firebox and chimney.
Even dry wood contains at least 15% moisture by
weight, and should be burned hot enough to keep the
chimney hot for as long as it takes to dry the wood out
- about one hour. To tell if wood is dry enough to burn,
check the ends of the logs. If there are cracks radiating
in all directions from the center, it is dry. If your wood
sizzles in the fire, even though the surface is dry, it may
not be fully cured.
Oak
Maple
Apple
Birch
Heatilator • A36/42C, A36/42CH Owners Manual • 4017-263 • Rev D • 05/01/14
11
5. Burning Process
3.Seasoning
Seasoned firewood is nothing more than wood that is
cut to size, split and air dried to a moisture content of
around 20%. The time it takes to season wood varies
from around nine months for soft woods to as long as
eighteen months for hardwoods. The key to seasoning
wood is to be sure it has been split, exposing the wet
interior and increasing the surface area of each piece.
A tree that was cut down a year ago and not split is
likely to have almost as high a moisture content now as
it did when it was cut.
To season wood:
•
•
•
Cut logs to size
Split to 6 in. (152 mm) or less
Air dry to a moisture content of around 20%
- Soft wood - about nine months
- Hard wood - about eighteen months
Notice: Seasoning time may vary depending on drying
conditions.
6. Creosote Formation
When wood is burned slowly, it produces tar and other
organic vapors which combine with expelled moisture
to form creosote. The creosote vapors condense in
the relatively cool chimney flue of a newly-started or
a slow-burning fire. As a result, creosote residue accumulates on the flue lining.
When ignited, creosote creates an extremely hot fire
which may damage the chimney or even destroy the
house.
The chimney shall be inspected at least annually before lighting, or once every two months during heating
season.
When creosote has accumulated it shall be removed to
reduce the risk of a chimney fire.
4. Storing Wood
Splitting wood before it is stored reduces drying time.
The following guideline will ensure properly seasoned
wood:
• Stack the wood to allow air to circulate freely around
and through the woodpile.
• Elevate the woodpile off the ground to allow air
circulation underneath.
• The smaller the pieces, the faster the drying process.
Any piece over 6 in. (152 mm) in diameter should be
split.
• Wood should be stacked so that both ends of each
piece are exposed to air, since more drying occurs
through the cut ends than the sides. This is true even
with wood that has been split.
• Store wood under cover, such as in a shed, or covered
with a tarp, plastic, tar paper, sheets of scrap plywood,
etc., as uncovered wood can absorb water from rain
or snow, delaying the seasoning process. Avoid
covering the sides and ends completely. Doing so
may trap moisture from the ground and impede air
circulation.
12
Fire requires fuel, air and heat. If heat is robbed from
the fireplace during the drying stage, the new load of
wood has reduced the chances for a good clean burn.
Always burn dry, seasoned firewood.
7. Processed Solid Fuel Firelogs
Manufactured firelogs may be used with this fireplace.
Hearth & Home Technologies recommends the use of
UL Classified processed fuel firelogs. Follow the manufacturer’s lighting and safety instructions.
Using firelogs may require more frequent chimney inspections and cleaning.
Do not poke or stir the logs while they are burning. Use
only firelogs that have been evaluated for the application in manufactured fireplaces and refer to firelog
warnings and caution markings on packaging prior to
use.
D.First Fire
Before lighting your first fire in the fireplace, make certain
that:
• refractory is in place
• all labels have been removed.
Heatilator • A36/42C, A36/42CH Owners Manual • 4017-263 • Rev D • 05/01/14
E. Lighting Instructions
Notice: You must establish a good draft to prevent smoke
spillage into the room.
The first three or four fires should be of moderate size to
allow the oils and binders to be burned from the fireplace
and the refractory and paint to cure. You may notice an industrial odor the first few fires. This is considered normal.
Use well-seasoned wood.
• Open the flue damper to a fully open position.
• Place crumpled or twisted paper under the fireplace
grate.
• Loosely arrange kindling or small pieces of wood to form
a ‘tent’ on the fireplace grate.
• Pre-warm the flue to establish a draft to help reduce
smoke spillage during start-up. Hold a rolled up piece
of burning newspaper under the flue damper for a few
moments.
• Light the crumpled paper to ignite the kindling.
• Add small pieces of wood until a hot bed of embers has
been established.
• Add a minimum of three average size pieces of split
firewood, placed to allow combustion air and flames
between them.
Warning! Risk of Fire! Keep combustible materials,
gasoline and other flammable vapors and liquids clear of
the fireplace.
Do NOT:
• store flammable materials close to the fireplace
• use gasoline, lantern fuel, kerosene, charcoal lighter
fluid or similar liquids to start or “freshen up” a fire in this
fireplace.
Heatilator • A36/42C, A36/42CH Owners Manual • 4017-263 • Rev D • 05/01/14
13
4
Maintenance and Service
Warning! Hot Surfaces!
Glass and other surfaces are hot during operation AND cool
down. DO NOT clean fireplace until it is cooled.
Installation and repair should be done by a qualified
service technician only. The fireplace should be inspected
before use and at least annually by a professional service
person.
The following tasks may be performed annually by the
homeowner. If you are uncomfortable performing any of
the listed tasks, please contact your dealer for a service appointment.
WARNING! Risk of Asphyxiation and Fire! Annual
inspection by qualified technician recommended.
Check:
• condition of doors, surrounds and fronts
• condition of glass and glass assembly
• obstructions of combustion and ventilation air
• obstructions of termination cap
Clean:
• glass
• air passageways, grilles
A.Chimney Inspection
Frequency: As necessary; at least annually before
lighting fireplace, or once every two months during
heating season.
By: Homeowner/Chimney Sweep
• Confirm that termination cap remains clear and
unobstructed.
• Inspect for blockages such as bird nests, leaves, etc.
• Inspect for corrosion or separation.
• Inspect for creosote and remove as needed, at least
every two months during the heating season.
• Inspect the system at the fireplace connection and
at the chimney top.
B.Creosote (Chimney) Cleaning
Frequency: As needed; at least annually before lighting, or once every two months during heating season.
When creosote has accumulated it shall be removed
to reduce the risk of a chimney fire.
By: Chimney Sweep
Tools Needed: Brush, allen wrench, Phillips screwdriver
• When wood is burned slowly, it produces tar and
other organic vapors, which combine with expelled
moisture to form creosote. The creosote vapors
condense in the relatively cool chimney flue of a
slow-burning fire. As a result, creosote residue
accumulates on the flue lining. When ignited, this
creosote makes an extremely hot fire.
• Remove all ash from the firebox and extinguish all
hot embers before disposal. Allow the fireplace to
cool completely.
• Close the door tightly.
• Remove the top of the termination cap as shown in
Figure 4.1 to clean the cap and chimney.
• The creosote or soot should be removed from the
chimney with a brush specifically designed for the
size of chimney in use.
• Reinstall termination cap.
• Clean out fallen debris from the firebox.
Warning! Risk of Fire! Ignited creosote is extremely
HOT. Prevent creosote buildup.
In the event of a chimney fire, Hearth & Home Technologies recommends replacement of the chimney and
inspection of the adjacent structure to the provisions of
NFPA Level III inspection criteria.
14
Heatilator • A36/42C, A36/42CH Owners Manual • 4017-263 • Rev D • 05/01/14
Remove screws,
lift top cover.
1. Remove the 4 screws.
2. Remove the screen.
3. Remove the baffle.
Remove 4 screws
and lift top pan off.
Top Cover
Cap
Remove 8 screws
and lift top.
Remove 2 screws from
the front and back and
lift the top off.
Top
Top
Cap
Cap
Chimney
Slip
Section
Chase
ST375
Square
Termination Cap
TR344/TR342
Round
Termination Cap
Screw
Screw
TS345/TS345P
Square
Termination Caps
TCT375
Terra Cotta
Termination Cap
DTO/DTS Series
Termination Cap
Figure 4.1 Chimney & Termination Cap Cleaning
C.Grate
E. Ash Removal
Frequency: After each ash removal
By: Homeowner
Inspect grate for:
• Warping or sagging 1-1/2 in. (38 mm) or more
• Broken welds
• Burn-through of grate bars
For safe operation, replace only with the approved grate
from Hearth & Homes Technologies.
Frequency: As necessary
By: Homeowner
Tools Needed: Covered metal container, metal
shovel, fireplace broom
D.Glass Cleaning
Frequency: As necessary
By: Homeowner
Tools Needed: Vinegar or glass cleaner, soft towel
• Clean glass with a non-abrasive glass cleaner. Use a
damp cloth dipped in wood ashes or a commercially
available oven cleaner. Remove any oven cleaner
residue with a glass cleaner or soap and water.
Warning! Risk of Fire! Do not remove ashes until
the fire is out and the fireplace is cold.
• Ashes should be placed in metal container with tight
fitting lid.
• The closed container of ashes should be placed
on a noncombustible floor or on the ground, well
away from all combustible materials, pending final
disposal.
• If the ashes are disposed of by burial in soil or
otherwise locally dispersed, they should be retained
in the closed container until all cinders have
thoroughly cooled.
F.Refractory
Frequency: After each ash removal
By: Homeowner
• Inspect condition of refractory. Replace if crumbly
or otherwise deteriorated, or if cracks exceed 1/4 in.
(6 mm).
Heatilator • A36/42C, A36/42CH Owners Manual • 4017-263 • Rev D • 05/01/14
15
5
Troubleshooting
Start Fire Problems
Possible Cause
Solution
Can’t get fire started
Excessive smoke or spillage
Burns too slowly
Smolders, sizzles
Not enough kindling/paper or no
kindling/paper
Use dry kindling, more paper. Arrange kindling &
wood for air movement.
Damper closed/not fully open
Open damper.
Not enough air for fire to ignite
Check for restricted cap/shroud.
Open air kit (if installed).
Check for flue blockage.
Pre-warm flue before starting fire (refer to starting
fire section).
Check for adequate vent height (refer to chimney
assembly section).
Open window below the fireplace towards the
wind.
Fire burns too fast
Wood condition is too wet, too
large
Use dry, seasoned wood (refer to wood fuel
section).
Bed of coals not established
before adding wood
Start with paper & kindling to establish bed of
coals (refer to starting fire section).
Flue blockage such as birds’
nests or leaves in termination
cap
Have chimney inspected for creosote and cleaned
by a certified chimney sweep.
Down draft or negative pressure
Competition with exhaust
devices
Do not use exhaust fans during start-up (refer to
negative pressure section).
Extremely dry or soft wood
Mix in hardwood.
Open window below the fireplace towards the
wind.
Mix in less seasoned wood after fire is established
(refer to wood fuel section).
No glass doors
Add glass doors to slow down air flow.
Overdrafting
Check for correct vent height; too much vertical
height creates overdrafting.
Check location of vent termination (refer to
chimney assembly section).
16
Heatilator • A36/42C, A36/42CH Owners Manual • 4017-263 • Rev D • 05/01/14
A.FAQs
Hearth & Home Technologies assumes no responsibility for the improper performance of the fireplace system caused by inadequate draft due to environmental
conditions, down drafts, tight sealing construction of
the structure, or mechanical exhausting devices which
will create a negative air pressure within the structure
where the fireplace is located.
If smoke spillage occurs from a fireplace opening when
the door is open, there is either a leakage in the flue, a
blockage in the flue, or some condition is affecting draft
Understanding and differentiating the conditions which
can cause each of these kinds of spillage problems is
essential to their solution.
• Flue Leakage
Check for improperly connected flue joints or a
damaged flue joint in the chimney system. Such
leakage would reduce draft (air would be drawn in
through the leaks rather than through the fireplace).
The result might be difficult start-up and smoky
fires that might spill if other adverse draft conditions
accompany this problem.
• Flue Blockage
The damper should be open.
Check for objects that may have fallen down the
chimney.
Flue draft is measured as negative pressure in the
chimney. The amount of negative pressure determines
how strong the draft is. The draft is important because
it draws the combustion air into the fireplace and pulls
the smoke out of the chimney.
There are three basic criteria essential in establishing
and maintaining flue draft:
• availability of combustion air
• heat generated from the fire
• diameter and height of the flue system
These three factors work together as a system to create
the flue draft. Increasing or decreasing any one of them
will affect the other two and thus change the amount of
draft in the entire system.
If the fire is hard to start and smoke spills out of the fireplace, or you find it difficult to establish and maintain a
moderately high burn rate, then the flue draft is too low
and corrective measures must be taken.
Be sure you have air available for combustion and that
your firewood is dry and well seasoned. Build your fires
properly and according to the instructions given in op-
erating instructions, “Starting a Fire”. Be sure your flue
system is installed correctly and that it is the proper diameter and height. Check for the following:
• All chimney sections are properly installed.
• The chimney is clean and free of creosote or soot
buildup.
• Make sure overhanging trees and branches are cut
back within ten feet of the top of the chimney and the
chimney is free of debris from animals.
• Ensure the chimney cap is clean and free of any
buildup of soot or creosote if cap is equipped with a
spark arrestor screen.
• The wood being used in dry and well seasoned.
If you still suspect you have a low draft problem it may
be necessary to increase the volume of air in your
flue system. Since the diameter of your flue system is
matched with the size of the flue collar and should not
be changed, then the height of the system must be increased. Add chimney sections one at a time until the
draft improves.
In some cases, regardless of what you do, it can still be
difficult to establish the proper flue draft. This is especially evident when using an exterior factory-built chimney or exterior masonry chimney. Try holding a burning
rolled up newspaper as close to the flue outlet as possible for a few minutes, then light the paper under the
kindling. The heat generated from the burning rolled up
newspaper should help get the draft established.
Still other factors can affect how well your flue system
performs. Neighboring structures, high winds, tall trees,
even hillsides can affect air currents around the chimney. Well designed chimney caps are available that can
help. Your fireplace dealer is the local expert in your
area. He can usually make suggestions or discover
problems that can be easily corrected allowing your
fireplace to operate correctly as it has been designed,
providing safe and economical heat for your home.
Contact your dealer for additional information regarding operation and troubleshooting. Visit www.heatilator.com to find a
dealer.
Heatilator • A36/42C, A36/42CH Owners Manual • 4017-263 • Rev D • 05/01/14
17
nd
ina
y term
chimne
n?
tio
Bird's nest
or leaves in
termination
cap?
ds
ar
ou
Overhanging
tree?
in
gw
Stron
Structural
changes in
chimney area?
Another appliance in
home also exhausting
air (furnace, fan,
Unsealed
dryer, etc.)?
can lights?
Overhead fan
operating?
Creosote buildup
in flue?
Air register from
furnace near
fireplace?
Doors opening
and closing?
Window closed
for start-up?
Figure 5.1
18
Combustion
air control
Outside air
closed?
Factory-built Fireplaces: Troubleshooting
Heatilator•A36/42C,A36/42CHOwnersManual•4017-263•RevD•05/01/14
6
Reference Materials
► A.Service Parts
A36C, A36CH
Service Parts
Beginning Manufacturing Date: June 1998
Ending Manufacturing Date: Active
Accelerator
36”Woodburning Fireplace
2
1
3
4
5
6
7
IMPORTANT: THIS IS DATED INFORMATION. Parts must be ordered from a dealer or
distributor.Hearth and Home Technologies does not sell directly to consumers.Provide
modelnumberandserialnumberwhenrequestingservicepartsfromyourdealerordistributor.
ITEM
DESCRIPTION
COMMENTS
PART NUMBER
22069B
1
StarterSection
2
TopStandoff
3
UpperGrilleAssembly
29727
4
SmokeShield
31191
5
HearthFiller
30331
6
LowerGrilleAssembly
7
Grate
Qty4req.
PreAL959348
29248
PostAL959348
31679
Qty2req.
DamperAssembly
19785A
DamperBlade
FirescreenAssembly
FirescreenHandle
FirescreenRod
30558
Qty2req.
26053
10002
Qty2req.
12052
Y
21878
Y
JK9
Y
Qty4req.
OutsideAirKit
31190
AK22
RefractoryRetainer
11847
Pkgof40
SmokeDiverter
StripProtector
Y
Qty2req.
JunctionBoxKit
RetainerScrews
31527
Qty2req.
JunctionBox
NailingFlange
Y
28062
30528
DamperWeight
DoorPivotClip
Y
4044-111
GR18
GrateClip
Stocked
at Depot
12460/40
Y
30559
Qty2req.
18320
UpperDoorTrack
15425
InstallationManual
4017-262
Owner’sManual
4017-263
Additionalservicepartsonfollowingpage.
Heatilator • A36/42C, A36/42CH Owners Manual • 4017-263 • Rev D • 05/01/14
4/14
19
A36C, A36CH
Service Parts
Beginning Manufacturing Date: June 1998
Ending Manufacturing Date: Active
IMPORTANT: THIS IS DATED INFORMATION. Parts must be ordered from a dealer or
distributor.Hearth and Home Technologies does not sell directly to consumers.Provide
Stocked
at Depot
modelnumberandserialnumberwhenrequestingservicepartsfromyourdealerordistributor.
ITEM
DESCRIPTION
COMMENTS
#8 Traditional Refractory
PART NUMBER
8.2
8.3
8.3
8.1
Traditional Refractory
PreWeek34/98
8.1
8.2
8.3
HearthRefractory
29244
Week34/98thruSn#AK652474
BackRefractory
PostSN#AK652474
4010-017
PreWeek34/98
29245
Week34/98thruSn#AK652474
SideRefractory(Left/right)
#9 Herringbone Refractory
29993
29992
PostSN#AK652474
4010-059
PreSN#AK652474
28393
PostSN#AK652474
4010-058
9.2
9.4
9.3
9.1
Herringbone Refractory
20
9.1
HearthRefractory
9.2
BackRefractory
9.3
LeftHandRefractory
9.4
RightHandRefractory
4010-017
PreSN##AK652474
4010-012
PostSN##AK652474
4010-063
PreSN##AK652474
4010-010
PostSN##AK652474
4010-061
PreSN##AK652474
4010-009
PostSN##AK652474
4010-062
Heatilator • A36/42C, A36/42CH Owners Manual • 4017-263 • Rev D • 05/01/14
A42C, A42CH
Service Parts
Accelerator
42” Woodburning Fireplaces
Beginning Manufacturing Date: June 1998
Ending Manufacturing Date: Active
2
1
3
4
5
6
7
IMPORTANT: THIS IS DATED INFORMATION. Parts must be ordered from a dealer or
distributor.Hearth and Home Technologies does not sell directly to consumers.Provide
modelnumberandserialnumberwhenrequestingservicepartsfromyourdealerordistributor.
ITEM
DESCRIPTION
COMMENTS
PART NUMBER
22069B
1
StarterSection
2
TopStandoff
3
UpperGrilleAssembly
29564
4
SmokeShield
35221
5
HearthFiller
6
LowerGrilleAssembly
7
Grate
Qty4req
Y
4044-111
30332
PreAL656348
29248
PostAL656348
31680
GR19
GrateClip
Stocked
at Depot
Qty2req.
DamperAssembly
Y
28062
30528
DamperWeight
19785A
DamperBlade
30558
DoorPivotClip
Qty2req.
FirescreenAssembly
Qty2req.
29246
Qty2req.
10002
Qty2req.
28404
Y
JunctionBox
21878
Y
JunctionBoxKit
JK9
Y
FirescreenHandle
FirescreenRod
NailingFlange
Qty4req.
OutsideAirKit
RefractoryRetainer
RetainerScrews
31527
31190
AK22
Qty3req.
11847
Pkgof40
12460/40
SmokeBaffle(Right)
35329
SmokeBaffle(Left)
35330
StripProtector
Y
Qty2req.
Y
18320
UpperDoorTrack
15427
InstallationManual
4017-262
Owner'sManual
4017-263
Additionalservicepartsonfollowingpage.
Heatilator • A36/42C, A36/42CH Owners Manual • 4017-263 • Rev D • 05/01/14
4/14
21
A42C, A42CH
Service Parts
Beginning Manufacturing Date: June 1998
Ending Manufacturing Date: Active
IMPORTANT: THIS IS DATED INFORMATION. Parts must be ordered from a dealer or
distributor.Hearth and Home Technologies does not sell directly to consumers.Provide
modelnumberandserialnumberwhenrequestingservicepartsfromyourdealerordistributor.
ITEM
DESCRIPTION
COMMENTS
#8 Traditional Refractory
PART NUMBER
8.2
8.3
8.3
8.1
Traditional Refractory
8.1
HearthRefractory
8.2
BackRefractory
8.3
SideRefractory(Left/right)
#9 Herringbone Refractory
PreSn#AK652474
28391
PostSN#AK652474
4010-018
PreSn#AK652474
28394
PostSN#AK652474
4010-060
PreSN#AK652474
28393
PostSN#AK652474
4010-058
9.2
9.4
9.3
9.1
Herringbone Refractory
9.1
9.2
22
4010-018
HearthRefractory
BackRefractory
9.3
LeftHandRefractory
9.4
RightHandRefractory
PreSN#AK652474
4010-011
PostSN#AK652474
4010-064
PreSN#AK652474
4010-010
PostSN#AK652474
4010-061
PreSN#AK652474
4010-009
PostSN#AK652474
4010-062
Heatilator • A36/42C, A36/42CH Owners Manual • 4017-263 • Rev D • 05/01/14
Stocked
at Depot
B.Accessories
Doors
Bi-fold Glass Doors
DM1736, DM1742
Contour Cabinet Style Mesh Doors with Frame
Contour36BK, Contour36BZ
Contour42BK, Contour42BZ
Grand Vista Cabinet Style Mesh Door
GV36BK, GV36BZ
GV42BK, GV42BZ
Gasketed Cabinet Style Doors
GGD36BK, GGD42BK
TK6S Louver Trim Kit-Stainless Steel
Gas Inserts
Gas Log Sets
Gas Log Lighters
Wood-burning Inserts
Heatilator • A36/42C, A36/42CH Owners Manual • 4017-263 • Rev D • 05/01/14
23
C.Contact Information
Heatilator, a brand of Hearth & Home Technologies
7571 215th Street West, Lakeville, MN 55044
www.heatilator.com
Please contact your Heatilator dealer with any questions or concerns.
For the number of your nearest Heatilator dealer, please visit www.heatilator.com.
– NOTES –
CAUTION
DO NOT DISCARD THIS MANUAL
• Important operating
and maintenance
instructions included.
• Read, understand and follow
these instructions for safe
installation and operation.
• Leave this manual with
party responsible for use
and operation.
This product may be covered by one or more of the following patents: (United States) 5000162, 5016609, 5076254, 5113843,
5191877, 5218953, 5263471, 5328356, 5341794, 5347983, 5413089, 5429495, 5452708, 5542407, 5890485, 5931661, 5941237,
5947112, 5996575, 6006743, 6019099, 6048195, 6053165, 6145502, 6170481, 6237588, 6296474, 6374822, 6413079, 6439226,
6484712, 6543698, 6550687, 6601579, 6672860, 6688302, 6688302B2, 6715724B2, 6729551, 6736133, 6748940, 6748942,
6769426, 6774802, 6796302, 6840261, 6848441, 6863064, 6866205, 6869278, 6875012, 6880275, 6908039, 6919884,7047962,
7216645, D320652, D445174, D462436; (Canada) 1297749, 2195264, 2225408, 2313972; (Australia) 780250, 780403, 1418504 or
other U.S. and foreign patents pending.
Printed in U.S.A. - Copyright 2012
24
Heatilator • A36/42C, A36/42CH Owners Manual • 4017-263 • Rev D • 05/01/14