3M X31 Crib Toy User Manual

Digital Projector
X31/X36/X46
Network Guide
Thank you for purchasing this product.
This manual is intended to explain only the network function. For proper use of this
product, please refer to this manual and the other manuals for this product.
WARNING Ź%HIRUHXVLQJWKLVSURGXFWEHVXUHWRUHDGDOOPDQXDOVIRUWKLV
product. After reading them, store them in a safe place for future reference.
Features
This projector has the network function that brings you the following main features.
9 Network Presentation : allows the projector to project computer images transmitted
through a network. (37)
9 Web Control : allows you to monitor and control the projector through a network from a
computer. (45)
9 My Image : allows the projector to store up to four still images and project them. (70)
9 Messenger : allows the projector to display text sent from a computer through a network.
(72)
9 Network Bridge : allows you to control an external device through the projector from a
computer. (74)
NOTE ‡7KHLQIRUPDWLRQLQWKLVPDQXDOLVVXEMHFWWRFKDQJHZLWKRXWQRWLFH
‡7KHPDQXIDFWXUHUDVVXPHVQRUHVSRQVLELOLW\IRUDQ\HUURUVWKDWPD\DSSHDULQ
this manual.
‡7KHUHSURGXFWLRQWUDQVIHURUFRS\RIDOORUDQ\SDUWRIWKLVGRFXPHQWLVQRW
permitted without express written consent.
Trademark acknowledgment
‡0LFURVRIW®, Internet Explorer®, Windows®, Windows Vista® and Aero® are registered
WUDGHPDUNVRI0LFURVRIW&RUSRUDWLRQLQWKH86DQGRURWKHUFRXQWULHV
‡3HQWLXP®LVDUHJLVWHUHGWUDGHPDUNRI,QWHO&RUSRUDWLRQ
‡-DYD6FULSW®LVDUHJLVWHUHGWUDGHPDUNRI6XQ0LFURV\VWHPV,QF
‡+'0,WKH+'0,ORJRDQG+LJK'H¿QLWLRQ0XOWLPHGLD,QWHUIDFHDUHWUDGHPDUNVRU
UHJLVWHUHGWUDGHPDUNVRI+'0,/LFHQVLQJ//&LQWKH8QLWHG6WDWHVDQGRWKHUFRXQWULHV
‡7UDGHPDUN3-/LQNLVDWUDGHPDUNDSSOLHGIRUWUDGHPDUNULJKWVLQ
-DSDQWKH8QLWHG6WDWHVRI$PHULFDDQGRWKHUFRXQWULHVDQGDUHDV
All other trademarks are the properties of their respective owners.
3M™ Digital Projector X31/X36/X46
Contents
&RQWHQWV
1. Connection to the Network ...................................................... 4
6\VWHPUHTXLUHPHQWV ................................................................................. 4
5HTXLUHGHTXLSPHQWSUHSDUDWLRQ ..................................................................................... 4
+DUGZDUHDQGVRIWZDUHUHTXLUHPHQWIRUFRPSXWHU .......................................................... 4
,QVWDOOLQJWKH³/LYH9LHZHU´ .......................................................................... 6
,QVWDOOLQJWKH³/LYH9LHZHU´ ................................................................................................ 6
8SGDWLQJWKH³/LYH9LHZHU´................................................................................................ 7
3URFHVVWRFRQQHFWWKHQHWZRUN ................................................................. 8
3URFHVVRYHUYLHZ............................................................................................................. 8
6WDUWLQJWKH³/LYH9LHZHU´.................................................................................................. 9
6HOHFWLQJWKHQHWZRUNFRQQHFWLRQPRGH................................................... 6HOHFWLQJHLWKHUWKHZLUHOHVV/$1RUZLUHG/$1 ............................................................
6HOHFWLQJ0\&RQQHFWLRQ ...............................................................................................
6HOHFWLQJWKHQHWZRUNFRQQHFWLRQPHWKRG................................................ 3DVVFRGHFRQQHFWLRQ.....................................................................................................
0DQXDO&RQ¿JXUDWLRQ ............................................................................... 23
3UR¿OHFRQQHFWLRQ .......................................................................................................... 23
+LVWRU\FRQQHFWLRQ ......................................................................................................... 24
&RQ¿JXULQJWKHQHWZRUNVHWWLQJVPDQXDOO\............................................... &RQ¿UPLQJWKHFRQQHFWLRQWR\RXUGHVWLQDWLRQ ......................................... &RQQHFWLRQDQGWUDQVPLVVLRQ.........................................................................................
&RQQHFWLRQHUURU ............................................................................................................ 32
3UR¿OHGDWD ............................................................................................... 33
2XWOLQHRI3UR¿OHGDWD .................................................................................................... 33
0DNLQJ3UR¿OHGDWD ........................................................................................................ 33
(GLWLQJ3UR¿OHGDWD......................................................................................................... 34
5HJLVWHULQJ0\&RQQHFWLRQ............................................................................................
2. Network Presentation ............................................................. 37
8VLQJWKH³/LYH9LHZHU´ ............................................................................. 37
0DLQPHQXDQG2SHUDWLQJEXWWRQV................................................................................. 37
'LVSOD\LQJWKHVWDWXV...................................................................................................... 39
6ZLWFKLQJWKHGLVSOD\PRGH ...........................................................................................
2SWLRQPHQX ..................................................................................................................
6WDUWLQJWKH1HWZRUN3UHVHQWDWLRQ............................................................ 43
'LVSOD\PRGH ................................................................................................................. 43
3UHVHQWHUPRGH ............................................................................................................. 44
'LVSOD\8VHU1DPH ........................................................................................................ 44
2
‹0$OO5LJKWV5HVHUYHG
3M™ Digital Projector X31/X36/X46
Contents
3. Web Control ............................................................................ 45
/RJRQ ....................................................................................................... 46
1HWZRUN,QIRUPDWLRQ ................................................................................. 48
1HWZRUN6HWWLQJV ...................................................................................... 49
3RUW6HWWLQJV............................................................................................. 0DLO6HWWLQJV............................................................................................. $OHUW6HWWLQJV ............................................................................................ 6FKHGXOH6HWWLQJV .................................................................................... 'DWH7LPH6HWWLQJV ................................................................................... 6HFXULW\6HWWLQJV ...................................................................................... 3URMHFWRU&RQWURO .................................................................................... 5HPRWH&RQWURO....................................................................................... 67
3URMHFWRU6WDWXV...................................................................................... 68
1HWZRUN5HVWDUW...................................................................................... 69
4. My Image Function ................................................................. 70
5. Messeger Function ................................................................. 72
6. Network Bridge Function ....................................................... 74
&RQQHFWLQJGHYLFHV .................................................................................. 74
&RPPXQLFDWLRQVHWXS............................................................................... &RPPXQLFDWLRQSRUW ................................................................................. 6.4 Transmission method ............................................................................... 76
+$/)'83/(; .............................................................................................................. 76
)8//'83/(;............................................................................................................... 77
7. Other Functions ...................................................................... 78
(PDLO$OHUWV ............................................................................................. 78
3URMHFWRU0DQDJHPHQWXVLQJ6103 ........................................................ (YHQW6FKHGXOLQJ ..................................................................................... &RPPDQG&RQWUROYLDWKH1HWZRUN .......................................................... 84
8. Troubleshooting ..................................................................... 89
‹0$OO5LJKWV5HVHUYHG
3
3M™ Digital Projector X31/X36/X46
1. Connection to the network
&RQQHFWLRQWRWKHQHWZRUN
1.1 System requirements
1.1.1 Required equipment preparation
7KHIROORZLQJHTXLSPHQWLVUHTXLUHGWRFRQQHFWWKHSURMHFWRUWR\RXUFRPSXWHU
through the network.
9 Projector
9 LAN cable WRFRQQHFWWKHSURMHFWRUWRDQHWZRUN&$7RUJUHDWHU
9 Computer PLQLPXPVHWHTXLSSHGZLWKWKHQHWZRUNIHDWXUH
%DVH7;RU%DVH7
1.1.2 Hardware and software requirement for computer
7KH³/LYH9LHZHU´VRIWZDUHQHHGVWREHLQVWDOOHGRQDOOWKHFRPSXWHUVWRFRQQHFW
WRWKHSURMHFWRUWKURXJKDQHWZRUN7RXVHWKH³/LYH9LHZHU´\RXUFRPSXWHUQHHGV
WRPHHWWKHIROORZLQJUHTXLUHPHQWV
9 OS2QHRIWKHIROORZLQJ
Windows ®;3+RPH(GLWLRQ3URIHVVLRQDO(GLWLRQELWYHUVLRQRQO\
Windows Vista ®+RPH%DVLF+RPH3UHPLXP%XVLQHVV8OWLPDWH(QWHUSULVH
bit version only)
9 CPU3HQWLXP*+]RUKLJKHU
9 Graphic cardELW;*$RUKLJKHU
:KHQXVLQJWKH³/LYH9LHZHU´LWLVUHFRPPHQGHGWKDWWKHGLVSOD\UHVROXWLRQRI
\RXUFRPSXWHULVVHWWR[
9 Memory0%RUKLJKHU
9 Hard disk space0%RUKLJKHU
9 Web browser: Internet Explorer ®RUKLJKHU
9 CD-ROM drive
NOTE ‡7KHQHWZRUNFRPPXQLFDWLRQFRQWUROLVGLVDEOHGZKLOHWKHSURMHFWRULV
LQVWDQGE\PRGHLIWKH67$1'%<02'(LWHPLVVHWWR6$9,1*3OHDVHFRQQHFW
WKHQHWZRUNFRPPXQLFDWLRQWRWKHSURMHFWRUDIWHUVHWWLQJWKH67$1'%<02'(
WR1250$/SETUP menu in the Operator's Guide)
‡<RXFDQJHWWKHODWHVWYHUVLRQRIWKH³/LYH9LHZHU´DQGWKHODWHVWLQIRUPDWLRQ
for this product from our website. (7)
‡'HSHQGLQJRQWKHVSHFL¿FDWLRQRI\RXUFRPSXWHUWKHFRPSXWHUPD\VORZ
GRZQGXHWRKLJK&38XVDJHZKHQWKH³/LYH9LHZHU´LVUXQQLQJ
‡7KH³/LYH9LHZHU´GRHVQRWZRUNRQ:LQGRZV9LVWD® that is not updated to
6HUYLFH3DFNRUODWHU3OHDVHLQVWDOOWKHODWHVW6HUYLFH3DFNRQ\RXU:LQGRZV
Vista®.
4
‹0$OO5LJKWV5HVHUYHG
3M™ Digital Projector X31/X36/X46
1. Connection to the network
1.1 System requirements (continued)
NOTE ‡6HW\RXUFRPSXWHU¶VUHVROXWLRQWR;*$RUOHVV5HIHUWRWKHXVHU
PDQXDOIRU\RXUFRPSXWHURU:LQGRZV,ILWLVODUJHUWKDQ;*$WKHWUDQVPLVVLRQ
speed will be reduced.
‡,I\RXXVHDVFUHHQUHVROXWLRQJUHDWHUWKDQ;*$WKHSURMHFWRUZLOOVKULQNLWWR
;*$RQVFUHHQ
‡,PDJHVPLJKWQRWEHHQWUDQVPLWWHGFDXVHGE\26YHUVLRQRUWKHGULYHU
VRIWZDUHIRU1HWZRUN$GDSWHURQ\RXUFRPSXWHUV,WLVKLJKO\UHFRPPHQGHGWKDW
26DQGWKHGULYHUVKRXOGEHXSGDWHGWRWKHODWHVW
‹0$OO5LJKWV5HVHUYHG
3M™ Digital Projector X31/X36/X46
1. Connection to the network
1.2 Installing the “LiveViewer”
1.2.1 Installing the “LiveViewer”
7KH³/LYH9LHZHU´VRIWZDUHQHHGVWREHLQVWDOOHGRQDOOWKHFRPSXWHUVWRFRQQHFW
to the projector through a network.
,I\RXU26LV:LQGRZV;3RU9LVWD\RXQHHGWRORJLQDVDQDGPLQLVWUDWRUXVHUWR
install the software.
7XUQRQWKHFRPSXWHU
6KXWGRZQDOODSSOLFDWLRQV
,QVHUWWKHDFFRPSDQ\LQJ&'520LQWRWKHFRPSXWHU
V&'520GULYH
NOTE ‡$IWHUVHTXHQFHWKH8VHU$FFRXQW&RQWURO8$&GLDORJZLOODSSHDULI
\RXDUHXVLQJ:LQGRZV9LVWD3OHDVHFOLFNWKH[Allow] to continue installation.
$IWHUDPRPHQWWKH&KRRVH6HWXS/DQJXDJH
GLDORJZLOODSSHDUDVVKRZQRQWKHULJKW6HOHFW
what you like to use in the list, and click the [OK].
NOTE ‡,IWKH&KRRVH6HWXS/DQJXDJHGLDORJGRHVQ
WDSSHDUSURFHHGDVIROORZV
&OLFNRQWKH[Start]EXWWRQRQWKHWRROEDUDQGVHOHFWWKH³5XQ´
(2) Enter E:\software\setup.exe and then press the [OK].
,I\RXU&'520GULYHLVQRWGULYH(RQ\RXUFRPSXWHU\RXZLOOQHHGWR
UHSODFH(ZLWKWKHFRUUHFWGULYHOHWWHUDVVLJQHGWR\RXU&'520GULYH
,IWKHVRIWZDUHKDVEHHQDOUHDG\LQVWDOOHG8QLQVWDOODWLRQZLOOEHGRQH&OLFN
the [Cancel] button, then uninstallation will be canceled. If you uninstalled the
VRIWZDUHE\PLVVRSHUDWLRQSOHDVHUHLQVWDOOWKHVRIWZDUHIURP¿UVWSURFHGXUH
$IWHUDPRPHQWWKH:HOFRPHGLDORJZLOODSSHDU
DVVKRZQRQWKHULJKW3UHVVWKH[Next].
6
‹0$OO5LJKWV5HVHUYHG
3M™ Digital Projector X31/X36/X46
1. Connection to the network
1.2 Installing the “LiveViewer” (continued)
7KH/LFHQVH$JUHHPHQWGLDORJDSSHDUV,I
\RXDFFHSWLWVHOHFW³,DFFHSWWKHWHUPVRIWKH
OLFHQVHDJUHHPHQW´DQGSUHVVWKH [Next].
7KH&KRRVH'HVWLQDWLRQ/RFDWLRQGLDORJ
DSSHDUV3UHVVWKH[Next].
NOTE ‡7KH&?3URJUDP)LOHV?3URMHFWRU
7RROV?/LYH9LHZHUIROGHUZLOOEHFUHDWHGDQG
the program will be installed into that folder. If
you wish to install to a different folder, click the
[Browse] and select another folder.
&RQ¿UPWKHSURJUDPIROGHUQDPH,I³3URMHFWRU
7RROV´LVRND\SUHVVWKH[Next] to continue.
If not, enter the desired folder name and then
press the [Next].
7KH+DUGZDUH,QVWDOODWLRQGLDORJDSSHDUV
3UHVV&RQWLQXH$Q\ZD\
NOTE ‡$IWHUVHTXHQFHWKH:LQGRZV6HFXULW\
dialog will appear if you are using Windows Vista.
3OHDVHFOLFNWKH[Install this driver software
anyway] and continue installation.
$IWHUDPRPHQWLQVWDOODWLRQZLOOFRPSOHWHDQG
WKH6HWXS&RPSOHWHGLDORJZLOODSSHDUDV
VKRZQRQWKHULJKW&OLFNWKH[Finish]. This
completes the software installation. Then your
computer automatically restarts.
7RFRQ¿UPWKDWWKHVRIWZDUHKDVEHHQ
properly installed, press the [Start] button
RQWKHWRROEDUVHOHFW$OO3URJUDPVDQG
WKHQVHOHFWWKH3URMHFWRU7RROVIROGHU
7KH³/LYH9LHZHU´ZLOODSSHDULQWKDWIROGHU
if the installation was successful.
1.2.2 Updating the “LiveViewer”
3OHDVHFKHFNDQGJHWWKHODWHVWYHUVLRQDW0:HEVLWH
KWWSZZZPFRPPHHWLQJV
6RPHIXQFWLRQVH[SODLQHGLQWKLVPDQXDOUHTXLUHWKH³/LYH9LHZHU´9HUVLRQ[[,Q
WKHYHUVLRQLQIRUPDWLRQDQXPEHUEHWZHHQDQGZLOOUHSODFHWKH[[
‹0$OO5LJKWV5HVHUYHG
7
3M™ Digital Projector X31/X36/X46
1. Connection to the network
1.3 Process to connect the network
%HIRUHFRQQHFWLQJ\RXUFRPSXWHUDQGSURMHFWRUYLDDQHWZRUNPDNHVXUHWKDWWKH
LAN port is selected as the input source on the projector. (Operating in the
Operator's Guide2WKHUZLVHDFRQQHFWLRQFDQQRWEHHVWDEOLVKHG
1.3.1 Process overview
An overview of the process to connect your computer and the projector via a
network is shown below.
7KH³/LYH9LHZHU´DOORZV\RXWRVNLSVRPHRIWKHVWHSVEHORZWRHVWDEOLVKD
QHWZRUNFRQQHFWLRQTXLFNO\DQGHDVLO\
.6HOHFWLQJWKHQHWZRUNFRQQHFWLRQPRGH
:LUHOHVV/$1
:LUHG/$1
0\&RQQHFWLRQ
,I0\&RQQHFWLRQLV
selected
36HOHFWLQJWKHQHWZRUNFRQQHFWLRQPHWKRG
(QWHU3DVV&RGH
&RQ¿JXUH0DQXDOO\
6HOHFW)URP/LVW
,I(QWHU3DVV&RGHRU
6HOHFW)URP/LVWLV
selected
$0DQXDOFRQ¿JXUDWLRQ
3UR¿OH
+LVWRU\
&RQ¿JXUH1HWZRUN6HWWLQJV0DQXDOO\
,I3UR¿OHRU+LVWRU\LV
selected
/&RQ¿JXULQJWKHQHWZRUNVHWWLQJVPDQXDOO\
1&RQ¿UPLQJWKHFRQQHFWLRQWR\RXUGHVWLQDWLRQ
NOTE ‡:LUHOHVV/$1FDQEHVHOHFWHGRQO\ZKHQDQDFFHVVSRLQWWRFRQYHUW
ZLUHOHVV/$1WRZLUHG/$1H[LVWVEHWZHHQ\RXUFRPSXWHUDQGWKHSURMHFWRU
‡8SWRFRPSXWHUVFDQEHVLPXOWDQHRXVO\FRQQHFWHGWRWKHSURMHFWRUWKURXJK
a network.
8
‹0$OO5LJKWV5HVHUYHG
3M™ Digital Projector X31/X36/X46
1. Connection to the network
1.3 Process to connect the network (continued)
1.3.2 Starting the “LiveViewer”
6WDUWWKH³/LYH9LHZHU´LQ\RXUFRPSXWHUWDNLQJRQHRIWKHIROORZLQJV
'RXEOHFOLFNWKH³/LYH9LHZHU´LFRQRQWKH'HVNWRSLQ\RXUFRPSXWHU
6HOHFW³6WDUW´ĺ³$OO3URJUDPV´ĺ³3URMHFWRU7RROV´ĺ³/LYH9LHZHU´RQ
Windows menu.
Then, proceed to item 1.4 Selecting the network connection mode. (10)
‹0$OO5LJKWV5HVHUYHG
9
3M™ Digital Projector X31/X36/X46
1. Connection to the network
1.4 Selecting the network connection mode
$IWHUVWDUWLQJWKH³/LYH9LHZHU´WKH³6HOHFWWKH
1HWZRUN&RQQHFWLRQ´VFUHHQFRPHVXS
6HOHFWWKHQHWZRUNFRQQHFWLRQWKDW\RXZRXOGOLNH
to use. There are 3 options in the menu.
‡:LUHOHVV/$1
‡:LUHG/$1
‡0\&RQQHFWLRQ
,I\RXVHOHFWHLWKHUWKHZLUHOHVV/$1RUZLUHG/$1SURFHHGWRLWHP1.4.1 Selecting either
the wireless LAN or wired LAN. (below)
,I\RXVHOHFW0\&RQQHFWLRQMXPSWRLWHP1.4.2 Selecting My Connection. (12)
NOTE ‡7KLVGLDORJZLOOQRWEHGLVSOD\HGLIWKHFRPSXWHUKDVMXVWRQHQHWZRUNDGDSWHU
DQGQR0\&RQQHFWLRQLVUHJLVWHUHG3URFHHGWRLWHP1.5 Selecting the network
connection method. (14)
‡6HOHFW:LUHOHVV/$1RQO\ZKHQ\RXFRQQHFWWKHFRPSXWHUDQGWKHDFFHVVSRLQWYLD
wireless network and connect the access point and the projector via wired network,
VLQFHWKHSURMHFWRUGRHVQ
WKDYHZLUHOHVV/$1IXQFWLRQ
1.4.1 Selecting either the wireless LAN or wired LAN
,I\RXVHOHFWHLWKHUWKHZLUHOHVV/$1RUZLUHG/$1
a list of the network adapters in your computer is
shown in the menu.
6HOHFWZKDW\RXOLNHWRXVHLQWKHOLVWDQGFOLFNWKH
[Next].
Then, proceed to item 1.5 Selecting the network
connection method. (14)
NOTE ‡,I\RXVHOHFWWKHZLUHOHVV/$1WKHZLUHOHVV/$1DGDSWHUVLQ\RXUFRPSXWHU
are shown in the list.
‡,IWKHZLUHG/$1LVVHOHFWHGWKHZLUHG/$1DGDSWHUVLQ\RXUFRPSXWHUDUHVKRZQ
[Troubleshooting]
„ Are you sure that you want to turn on the network adapter?
The screen is displayed in the case that the
selected network adapter is invalid.
‡7RWXUQLWRQFOLFNWKH[Yes], and then proceed
to item 1.5. (14)
‡1RWWRWXUQLWRQFOLFNWKH[No], and then the
screen is back to the previous one to select
another network adapter. If no more adapter in
\RXUFRPSXWHUWKH³/LYH9LHZHU´ZLOOEHFORVHG
‹0$OO5LJKWV5HVHUYHG
3M™ Digital Projector X31/X36/X46
1. Connection to the network
1.4 Selecting the network connection mode (continued)
„ A network connection was not established.
The screen is displayed in the case that the
SURMHFWRULVQRWFRQQHFWHGZLWKD/$1FDEOH
WR\RXUFRPSXWHUZKHQWKHZLUHG/$1LV
selected.
%HVXUHWKDWWKHSURMHFWRULVFRQQHFWHGZLWK
D/$1FDEOHWR\RXUFRPSXWHU
&OLFNWKH[OK], then the screen is back to the previous one to select the network
connection mode.
„:LQGRZV¿UHZDOOLVHQDEOHG2Q
The screen is displayed in the case that
WKH¿UHZDOOVHWWLQJLQ:LQGRZV;39LVWDLV
DFWLYDWHGDQGWKH³/LYH9LHZHU´LVEORFNHG
E\WKH¿UHZDOO
‡7RWXUQLWGLVDEOHG2IIFOLFNWKH[Yes].
‡1RWWRWXUQLWGLVDEOHG2IIFOLFNWKH
[No], but the projector may not be able to
communicate with your computer through
the network.
‡,I\RXSXWDFKHFNPDUNLQWKH[Allow communication with LiveViewer by
adding it to the Exceptions list]ER[WKH³/LYH9LHZHU´ZLOOQHYHUEHEORFNHG
E\:LQGRZV¿UHZDOO
3URFHHGWRLWHP1.5 Selecting the network connection method. (14)
NOTE ‡,I\RXFOLFNWKH[Yes]WKHQHWZRUNDFFHVVE\WKH³/LYH9LHZHU´LV
WHPSRUDOO\SHUPLWWHGE\:LQGRZV¿UHZDOOXQWLOWKH³/LYH9LHZHU´LVFORVHG
‡,IDQ\DSSOLFDWLRQVRIWZDUHKDYLQJWKH¿UHZDOOIXQFWLRQLVLQVWDOOHGLQWR\RX
FRPSXWHUPDNHWKH¿UHZDOOIXQFWLRQLQYDOLGZLWKIROORZLQJWKH2SHUDWRU
V*XLGH
‹0$OO5LJKWV5HVHUYHG
3M™ Digital Projector X31/X36/X46
1. Connection to the network
1.4 Selecting the network connection mode (continued)
1.4.2 Selecting My Connection
6HOHFWWKH[My Connection] and click the
[Connect].
,I\RXVHOHFWWKH0\&RQQHFWLRQWKHFRPSXWHU
is connected to the projector through the
QHWZRUNE\XVLQJWKHSUR¿OHGDWDWKDWLVSUH
DVVLJQHGWR0\&RQQHFWLRQ35)
:KHQ\RXVHOHFWWKH0\&RQQHFWLRQWKH
computer immediately starts the connection to
the projector.
3URFHHGWRLWHP&RQ¿UPLQJWKHFRQQHFWLRQWR\RXUGHVWLQDWLRQ. (30)
NOTE ‡,IWKH'+&3LVVHWRQLQWKHSURMHFWRUWKHQHWZRUNFRQQHFWLRQ
EHWZHHQWKHSURMHFWRUDQGFRPSXWHUPD\QRWEHHVWDEOLVKHGVLQFH,3DGGUHVV
PD\EHYDULHG,I\RXOLNHWRXVHWKH0\&RQQHFWLRQVHWWKH'+&3RIILQWKH
projector.
‡,IQRSUR¿OHGDWDLVDVVLJQHGWRWKH0\&RQQHFWLRQLWFDQ¶WEHXVHG
[Troubleshooting]
„ A network connection could not be established.
:LQGRZVSUHYHQWHGQHWZRUNFRQ¿JXUDWLRQ
changes.
<RXPD\ORJLQWKH:LQGRZVXQGHU8VHU
authority.
&OLFNWKH[OK] to return to the screen to
select the network connection mode. (10)
&RQVXOWWRWKHQHWZRUNDGPLQLVWUDWRUDQGORJLQDJDLQXQGHUWKH$GPLQLVWUDWRU
authority. After that, please resume at item 1.3.2 Starting the “LiveViewer”.
(9)
‹0$OO5LJKWV5HVHUYHG
3M™ Digital Projector X31/X36/X46
1. Connection to the network
1.4 Selecting the network connection mode (continued)
„ Are you sure you want to connect the selected projector?
The message is appeared when the
wireless adapter you selected is already
used for another network connection.
‡7RFRQQHFWFOLFNWKH[Yes]3URFHHGWR
item &RQ¿UPLQJWKHFRQQHFWLRQWR
your destination. (30)
‡1RWWRFRQQHFWFOLFNWKH[No] to return
to the screen to select the network
connection mode. (10)
‹0$OO5LJKWV5HVHUYHG
3M™ Digital Projector X31/X36/X46
1. Connection to the network
1.5 Selecting the network connection method
There are some options to connect to the
network.
‡(QWHU3DVV&RGH
‡&RQ¿JXUH0DQXDOO\
‡6HOHFW)URP/LVW
6HOHFWRQHRIWKHPWRPHHW\RXUUHTXLUHPHQW
Enter PassCode
,I\RXZDQWWRXVHWKH3DVVFRGHIRUQHWZRUNFRQQHFWLRQVHOHFWWKH[Enter
PassCode] and click the [Next].
7KH3DVVFRGHLVJLYHQE\WKHSURMHFWRURQVFUHHQ$QG\RXVLPSO\LQSXWWKH
3DVVFRGHWRWKH³/LYH9LHZHU´WRFRQQHFWWKHQHWZRUN
3URFHHGWRLWHP1.5.1 Passcode connection. (15)
&RQ¿JXUH0DQXDOO\
6HOHFWWKH>&RQ¿JXUH0DQXDOO\@ and click the [Next].
Then, proceed to item 0DQXDO&RQ¿JXUDWLRQ. (23)
Select From List
%HIRUHVHOHFWLQJWKLVLWHP\RXUFRPSXWHUDQGWKHSURMHFWRUVQHHGWREHFRQQHFWHG
to the same network.
If the connection is already established, select the [Select From List].
From the list of the projectors connected to the network, select which projector
\RXZRXOGOLNHWRVHQG\RXULPDJHV3URFHHGWR&RQ¿UPLQJWKHFRQQHFWLRQ
to your destination. (30)
‹0$OO5LJKWV5HVHUYHG
3M™ Digital Projector X31/X36/X46
1. Connection to the network
1.5 Selecting the network connection method (continued)
1.5.1 Passcode connection
7KHXQLTXH3DVVFRGHV\VWHPEULQJV\RXYHU\TXLFNDQGVLPSOHFRQQHFWLRQWRWKH
network.
7KH3DVVFRGHLVDFRGHWKDWH[SUHVVHVWKHQHWZRUNVHWWLQJLQWKHSURMHFWRU,I\RX
LQSXWWKHFRGHLQWKH³/LYH9LHZHU´LQ\RXUFRPSXWHUWKHQHWZRUNVHWWLQJLQWKHSURMHFWRU
and computer can be matched and the connection will be established immediately.
7KHVHFWLRQLVLQWHQGHGWRH[SODLQKRZWRXVHWKH3DVVFRGH
(1) Getting the Passcode
7KH3DVVFRGHLVGLJLWFRGHFRQVLVWLQJRIDOSKDQXPHULFFKDUDFWHUV³´DQG
³$=´
([DPSOH3$66&2'($%&
7KH3DVVFRGHLVJLYHQRQWKHSURMHFWRUZKHQWKHLAN port is selected as input
source.
NOTE ‡7KH3DVVFRGHV\VWHPGRHVQRWZRUNXQGHUWKHFRQGLWLRQEHORZ,I
such is the case, establish the connection manually.
6XEQHWPDVNLVQRW&ODVV$RU%RU&
7KH3DVVFRGHV\VWHPDFFHSWV&ODVV$%DQG&RQO\
&ODVV$&ODVV%&ODVV&
7KHUHDUHWZRPHWKRGVWRJHWWKH3DVVFRGHIURPWKHSURMHFWRU
Method 1
7XUQRQWKHSURMHFWRUDQGPDNHVXUHWKDWWKHSURMHFWRULPDJHLVRQVFUHHQ
3UHVVWKHCOMPUTER button on the remote control or INPUT button on the
SURMHFWRUWRVHOHFWWKH/$1DVLQSXWSRUW
If there is no signal on the LANSRUW\RXFDQ¿QGWKH3DVVFRGHRQVFUHHQ
‹0$OO5LJKWV5HVHUYHG
3M™ Digital Projector X31/X36/X46
1. Connection to the network
1.5 Selecting the network connection method (continued)
Method 2
7XUQRQWKHSURMHFWRUDQGPDNHVXUHWKDWWKHSURMHFWRULPDJHLVRQVFUHHQ
3UHVVWKHMENUEXWWRQRQWKHUHPRWHFRQWURORUWKHŸźŻŹEXWWRQVRQ
the projector to show the menu on screen.
8VHWKHŸźFXUVRUEXWWRQVWRVHOHFWWKH*RWR$GYDQFHG0HQXDQGXVH
WKHŹFXUVRUEXWWRQWRHQWHUWKHLWHP
8VHWKHŸźFXUVRUEXWWRQVWRVHOHFWWKH1(7:25.DQGXVHWKHŹFXUVRU
button to enter the item.
8VHWKHŸźFXUVRUEXWWRQVWRVHOHFWWKH,1)250$7,21DQGXVHWKHŹ
FXUVRUEXWWRQWRGLVSOD\WKH,1)250$7,21
7KH3DVVFRGHDSSHDUVLQWKH,1)250$7,21ZLQGRZ
NOTE ‡7DNHWKHPHWKRGZKHQ\RXSURMHFW\RXUFRPSXWHULPDJHE\WKH
³/LYH9LHZHU´RUZKHQWKHLAN port is not selected as input source.
‡,IQRFRPPXQLFDWLRQEHWZHHQWKHSURMHFWRUDQGFRPSXWHULQPLQXWHVWKH
3DVVFRGHZLOOEHFKDQJHG
‹0$OO5LJKWV5HVHUYHG
3M™ Digital Projector X31/X36/X46
1. Connection to the network
1.5 Selecting the network connection method (continued)
(2) Entering the Passcode
If you select [Enter PassCode] at item 1.5,
WKH³3OHDVHHQWHUWKH3DVV&RGH´VFUHHQLV
GLVSOD\HG3OHDVHHQWHUWKH3DVVFRGHGLYLGHG
GLJLWHDFKLQER[HVWRWDOGLJLW
([DPSOH3$66&2'($%&
$IWHUHQWHULQJWKH3DVVFRGHFOLFNWKH[Connect] to start the connection to the
projector.
3URFHHGWRLWHP&RQ¿UPLQJWKHFRQQHFWLRQWR\RXUGHVWLQDWLRQ. (30)
If you click the [Back], the screen is back to item 1.5 Selecting the network
connection method. (14)
NOTE ‡:KHQHQWHULQJWKH3DVVFRGHFDSLWDODQGVPDOOOHWWHUVDUHQRW
distinguished.
‡,I\RXDUHXVLQJD6XEQHWPDVNRWKHUWKDQ&ODVV$%RU&\RXZLOOKDYHWR
establish the connection manually.
If the manual setting screen is displayed, please follow item 1.5.1 (3). (21)
[Troubleshooting]
„,QFRUUHFW3DVV&RGH
7KHLQFRUUHFW3DVVFRGHZDVLQSXW
&OLFNWKH[Back]WRUHWXUQWRWKH³3OHDVH
HQWHUWKH3DVV&RGH´VFUHHQ
&KHFNWKH3DVV&RGHRQWKHSURMHFWRU
screen (15) and enter the code again.
‹0$OO5LJKWV5HVHUYHG
3M™ Digital Projector X31/X36/X46
1. Connection to the network
1.5 Selecting the network connection method (continued)
„ A network connection could not be established.
:LQGRZVSUHYHQWHGQHWZRUNFRQ¿JXUDWLRQ
changes.
<RXPD\ORJLQWKH:LQGRZVXQGHU8VHU
authority.
&OLFNWKH[OK]WKHQWKH³/LYH9LHZHU´PDLQ
menu is displayed even though the network
LVQRWHVWDEOLVKHG&OLFN on the main and
go back to item 1.5 Selecting the network
connection method. (14)
&RQVXOWWRWKHQHWZRUNDGPLQLVWUDWRU/RJLQWKH:LQGRZVXQGHU$GPLQLVWUDWRU
authority. After that, please resume at item 1.3.2 Starting the “LiveViewer”.
(9)
„,I\RXQHHGWRDGGD1HWZRUNFRQ¿JXUDWLRQRQ\RXUFRPSXWHUWRFRQQHFWWRWKH
projector.
This dialog will be displayed when you
QHHGWRDGGD1HWZRUNFRQ¿JXUDWLRQRQ
your computer to connect to the projector.
&RQ¿UPZLWK\RXUQHWZRUNDGPLQLVWUDWRULI
WKH1HWZRUNFRQ¿JXUDWLRQGLVSOD\HGRQWKH
GLDORJLV2.DQGWKHQFOLFNWKH[Yes].
&OLFNWKH[NO]WKHQWKH³/LYH9LHZHU´PDLQPHQXLVGLVSOD\HGHYHQWKRXJKWKH
QHWZRUNLVQRWHVWDEOLVKHG&OLFN on the main menu and go back to item 1.5
Selecting the network connection method. (14)
‹0$OO5LJKWV5HVHUYHG
3M™ Digital Projector X31/X36/X46
1. Connection to the network
1.5 Selecting the network connection method (continued)
,I\RXSXWDFKHFNPDUNLQWKHER[³1RWGLVSOD\LQJFRQ¿UPDWLRQGLDORJIRUDGGLQJ
1HWZRUNVHWWLQJV´WKHSURMHFWRUPHPRUL]HVFXUUHQWFRQ¿JXUDWLRQDQGWKLVGLDORJ
LVQRWGLVSOD\HGDJDLQ7RGLVSOD\WKLVGLDORJDJDLQFOLFN2SWLRQ icon in the
³/LYH9LHZHU´PDLQPHQXDQGUHPRYHWKHFKHFNPDUNLQWKHER[³1RWGLVSOD\LQJ
FRQ¿UPDWLRQGLDORJIRUDGGLQJ1HWZRUNVHWWLQJV´
,I\RXZDQWWRFKDQJHWKH1HWZRUN
FRQ¿JXUDWLRQWRDGGFOLFNWKH[Change]. A
GLDORJIRUFKDQJLQJWKH1HWZRUNFRQ¿JXUDWLRQ
as shown to the right will be displayed. Enter
,3DGGUHVVDQGVXEQHWPDVNWKHQFOLFNWKH
[OK]3URFHGXUHWRFRQQHFWWRWKHSURMHFWRU
will start.
3URFHHGWRLWHP&RQ¿UPLQJWKH
connection to your destination. (30)
If you click the [Cancel], you will return to the
GLDORJIRUDGGLQJD1HWZRUNFRQ¿JXUDWLRQ
,IWKHHQWHUHG,3DGGUHVVDQGSURMHFWRU
V,3
address are the same, a warning dialog shown
to the right will be displayed.
&OLFNWKH[OK]DQGWKHQHQWHUDGLIIHUHQW,3
DGGUHVVIURPWKHSURMHFWRU
VRQHLQWKHGLDORJ
IRUFKDQJLQJ1HWZRUNFRQ¿JXUDWLRQ
If the connection is not available with the
HQWHUHG1HWZRUNFRQ¿JXUDWLRQDZDUQLQJ
dialog shown to the right will be displayed.
&OLFNWKH[OK] to return to the dialog for
FKDQJLQJWKH1HWZRUNFRQ¿JXUDWLRQDQGWKHQ
HQWHUDSSURSULDWHFRQ¿JXUDWLRQ
NOTE ‡,ID1HWZRUNFRQ¿JXUDWLRQWRFRQQHFWWRWKHSURMHFWRUKDVEHHQDGGHG
RQWKHFRPSXWHUWKHDGGHG1HWZRUNFRQ¿JXUDWLRQZLOOEHHUDVHGRQFHWKH
application software is closed.
‹0$OO5LJKWV5HVHUYHG
3M™ Digital Projector X31/X36/X46
1. Connection to the network
1.5 Selecting the network connection method (continued)
„ Are you sure you want to connect the selected projector?
The message is appeared when the wireless
adapter you selected is already used for
another network connection.
‡7RFRQQHFWFOLFNWKH[Yes]3URFHHGWRLWHP
&RQ¿UPLQJWKHFRQQHFWLRQWR\RXU
destination. (30)
‡1RWWRFRQQHFWFOLFNWKH[No] then the
³/LYH9LHZHU´PDLQPHQXLVGLVSOD\HGHYHQ
though the network is not established.
&OLFN on the main menu to go back
to item 1.5 Selecting the network
connection method. (14)
‹0$OO5LJKWV5HVHUYHG
3M™ Digital Projector X31/X36/X46
1. Connection to the network
1.5 Selecting the network connection method (continued)
&RQÀJXULQJPDQXDOO\
$IWHUHQWHULQJWKH3DVVFRGH17\RXDUHUHTXLUHGWRHQWHUWKHQHWZRUN
FRQ¿JXUDWLRQPDQXDOO\LI\RXXVHD6XEQHWPDVNRWKHUWKDQ&ODVV$%RU&15)
,I\RXXVHWKHZLUHG/$1JRWR22).
Wireless LAN
7KHSURMHFWRULVUHTXLUHGWREHFRQQHFWHGWRDQDFFHVVSRLQWE\D/$1FDEOH
7KHVHWWLQJRQWKHDFFHVVSRLQW*1
Enter the following information.
66,':LUHOHVV$FFHVV3RLQWH[DPSOH
(QFU\SWLRQ:(3ELWH[DPSOH
Encryption key *2: ********** (example)
2) The setting on the projector. *3
Enter the following information.
6XEQHWPDVN*4
(example)
&OLFNWKH[Connect].
4) The wireless connection will be established.
3URFHHGWRLWHP&RQ¿UPLQJWKHFRQQHFWLRQWR\RXUGHVWLQDWLRQ. (30)
*1&RQWDFWWKHQHWZRUNDGPLQLVWUDWRUWR¿QGRXWWKHVHWWLQJRQWKHDFFHVVSRLQW
*2,I\RXXVHDQHQFU\SWLRQ\RXQHHGWRVHWLW&RQWDFWWKHQHWZRUNDGPLQLVWUDWRU
to check the encryption key that is set in the projector.
7KHHQFU\SWLRQNH\LVDOZD\VVKRZQDV³**********´
*37R¿QGWKHQHWZRUNVHWWLQJRQWKHSURMHFWRUUHIHUWRWKH127(22)
*4,I\RXXVH6XEQHWPDVNH[FHSW&ODVV$%&SOHDVHVHWLW
‹0$OO5LJKWV5HVHUYHG
3M™ Digital Projector X31/X36/X46
1. Connection to the network
1.5 Selecting the network connection method (continued)
Wired LAN
(QWHUWKHIROORZLQJLQIRUPDWLRQIRUWKH
projector.
6XEQHWPDVN*1
(example)
&OLFNWKH[Connect].
3) The network connection will be established.
3URFHHGWRLWHP&RQ¿UPLQJWKH
connection to your destination. (30)
*1,I\RXXVHD6XEQHWPDVNRWKHUWKDQ&ODVV$%RU&WKLVVFUHHQDSSHDUV
NOTE ‡,I\RXUHTXLUHWKHQHWZRUNVHWWLQJLQIRUPDWLRQRQWKHSURMHFWRUWDNH
WKHIROORZLQJSURFHGXUHWR¿QGLWRXW
7XUQRQWKHSURMHFWRUDQGPDNHVXUHWKDWWKHSURMHFWRULPDJHLVRQVFUHHQ
3UHVVWKHMENUEXWWRQRQWKHUHPRWHFRQWURORUWKHŸźŻŹEXWWRQVRQ
the projector to show the menu on screen.
8VHWKHŸźFXUVRUEXWWRQVWRVHOHFWWKH*RWR$GYDQFHG0HQXDQGXVH
WKHŹFXUVRUEXWWRQWRHQWHUWKHLWHP
8VHWKHŸźFXUVRUEXWWRQVWRVHOHFWWKH1(7:25.DQGXVHWKHŹFXUVRU
button to enter the item.
8VHWKHŸźFXUVRUEXWWRQVWRVHOHFWWKH,1)250$7,21DQGSXVKWKHŹ
cursor button.
7KHVHWWLQJZLOOEHGLVSOD\HGLQWKH1(7:25.B,1)250$7,21ER[
22
‹0$OO5LJKWV5HVHUYHG
3M™ Digital Projector X31/X36/X46
1. Connection to the network
0DQXDOFRQÀJXUDWLRQ
There are 3 options for the manual
FRQ¿JXUDWLRQ
‡3UR¿OHbelow)
‡+LVWRU\24)
‡&RQ¿JXUH1HWZRUN6HWWLQJV0DQXDOO\25)
,I\RXVHOHFW&RQ¿JXUH1HWZRUN6HWWLQJV
0DQXDOO\SURFHHGWRLWHP&RQ¿JXULQJWKH
network settings manually. (25)
3URÀOHFRQQHFWLRQ
6HOHFWLQJDSUR¿OHGDWDFRQQHFWWKHQHWZRUN
with the projector.
,WLVUHTXLUHGWRVWRUHWKHSUR¿OHGDWDLQ
advance. (33)
6HOHFWWKH>3UR¿OH@.
&KRRVHDSUR¿OHGDWDOLVWHGLQWKHZLQGRZ
&OLFNWKH[Connect].
4) The network connection will be established.
3URFHHGWRLWHP&RQ¿UPLQJWKH
connection to your destination. (30)
NOTE ‡7RFKHFNWKHVHWWLQJLQDSUR¿OHGDWDIROORZWKHSURFHVVEHORZ
&KRRVHDSUR¿OHGDWDWKDW\RXZDQWWRFKHFN
0RYHWKHPRXVHFXUVRUWRWKHSUR¿OHGDWDDQGFOLFNWKHULJKWEXWWRQRQWKH
PRXVHWRGLVSOD\DSRSXSPHQX
6HOHFWWKH³3URSHUW\´LQWKHSRSXSPHQXDQGFOLFNWKHOHIWEXWWRQRQWKH
mouse.
7KHVHWWLQJLQIRUPDWLRQRIWKHVHOHFWHGSUR¿OHGDWDLVVKRZQ
‡,IWKH'+&3LVVHWRQLQWKHSURMHFWRUWKHQHWZRUNFRQQHFWLRQEHWZHHQWKH
SURMHFWRUDQGFRPSXWHUPD\QRWEHHVWDEOLVKHGVLQFH,3DGGUHVVPD\EHYDULHG
,I\RXOLNHWRXVHWKH3UR¿OHFRQQHFWLRQVHWWKH'+&3RIILQWKHSURMHFWRU
‹0$OO5LJKWV5HVHUYHG
23
3M™ Digital Projector X31/X36/X46
1. Connection to the network
0DQXDOFRQ¿JXUDWLRQFRQWLQXHG
1.6.2 History connection
7KH³/LYH9LHZHU´FDQUHPHPEHUWKHQHWZRUN
settings when connecting to the projector as
a history record. After that, selecting a history
UHFRUGFDQTXLFNO\FRQQHFWWKHQHWZRUNZLWKWKH
projector.
6HOHFWWKH[History].
&KRRVHDKLVWRU\UHFRUGOLVWHGLQWKHZLQGRZ
&OLFNWKH[Connect].
4) The network connection will be established.
3URFHHGWRLWHP&RQ¿UPLQJWKHFRQQHFWLRQWR\RXUGHVWLQDWLRQ. (30)
,I\RXZDQWWRFRS\DKLVWRU\UHFRUGWRDSUR¿OHGDWDVHOHFWRQHRIWKHKLVWRU\
record and click the >5HJLVWHUWRSUR¿OH@7KHSUR¿OHGDWDFDQQRWEHHUDVHG
automatically.
NOTE ‡7KHQXPEHURIWKHKLVWRU\UHFRUGLVPD[LPXPIRUHDFKQHWZRUN
DGDSWHU:KHQWKHWKGDWDLVVWRUHGWKHROGHVWUHFRUGDPRQJWKHZLOOEH
overwritten.
‡7KHGDWHWLPHLQIRUPDWLRQLQHDFKKLVWRU\UHFRUGLVUHQHZHGZKHQWKH
network is connected by using the history record.
‡,IWKH'+&3LVVHWRQLQWKHSURMHFWRUWKHQHWZRUNFRQQHFWLRQEHWZHHQWKH
SURMHFWRUDQGFRPSXWHUPD\QRWEHHVWDEOLVKHGVLQFH,3DGGUHVVPD\EH
varied.
‡(YHQLI\RXXVHWKHSUR¿OHFRQQHFWLRQLWZLOOEHPHPRUL]HGDVDKLVWRU\
record.
24
‹0$OO5LJKWV5HVHUYHG
3M™ Digital Projector X31/X36/X46
1. Connection to the network
&RQÀJXULQJWKHQHWZRUNVHWWLQJVPDQXDOO\
All setting for the network connection between
the projector and computer is input manually.
6HOHFWWKH>&RQ¿JXUH1HWZRUN6HWWLQJV
Manually].
The information to be input manually is different, depending on how you want to
connect the projector and computer.
Wireless LAN
7KHSURMHFWRULVUHTXLUHGWREHFRQQHFWHGWRDQDFFHVVSRLQWE\D/$1FDEOH*R
to (26).
Wired LAN
,I\RXXVHWKHZLUHG/$1JRWR27).
‹0$OO5LJKWV5HVHUYHG
3M™ Digital Projector X31/X36/X46
1. Connection to the network
&RQ¿JXULQJWKHQHWZRUNVHWWLQJVPDQXDOO\FRQWLQXHG
Wireless LAN
7KHVHWWLQJRQWKHDFFHVVSRLQW*1
Enter the following information.
66,':LUHOHVV$FFHVV3RLQWH[DPSOH
(QFU\SWLRQ:(3ELWH[DPSOH
Encryption key *2: ********** (example)
0RGH,1)5$6758&785(
&OLFNWKH[Next].
3) Enter the following information that is set in
the projector. *3
,3DGGUHVVH[DPSOH
6XEQHWPDVNH[DPSOH
&OLFNWKH[Connect].
7KHZLUHOHVVFRQQHFWLRQZLOOEHHVWDEOLVKHG
3URFHHGWRLWHP&RQ¿UPLQJWKHFRQQHFWLRQWR\RXUGHVWLQDWLRQ. (30)
*1&RQWDFWWKHQHWZRUNDGPLQLVWUDWRUWR¿QGRXWWKHVHWWLQJRQWKHDFFHVVSRLQW
*2,I\RXXVHDQHQFU\SWLRQ\RXQHHGWRVHWLW&RQWDFWWKHQHWZRUNDGPLQLVWUDWRU
to check the encryption key that is set in the projector.
7KHHQFU\SWLRQNH\LVDOZD\VVKRZQDV³**********´
*37R¿QGWKHQHWZRUNVHWWLQJRQWKHSURMHFWRUUHIHUWRWKH127(22)
26
‹0$OO5LJKWV5HVHUYHG
3M™ Digital Projector X31/X36/X46
1. Connection to the network
&RQ¿JXULQJWKHQHWZRUNVHWWLQJVPDQXDOO\FRQWLQXHG
Wired LAN
(QWHUWKHIROORZLQJLQIRUPDWLRQIRUWKH
projector. *1
,3DGGUHVVH[DPSOH
6XEQHWPDVNH[DPSOH
&OLFNWKH[Connect].
3) The network connection will be established.
3URFHHGWRLWHP&RQ¿UPLQJWKHFRQQHFWLRQWR\RXUGHVWLQDWLRQ. (30)
*17R¿QGWKHQHWZRUNVHWWLQJRQWKHSURMHFWRUUHIHUWRWKH127(22)
[Troubleshooting]
„ A network connection could not be established.
:LQGRZVSUHYHQWHGQHWZRUNFRQ¿JXUDWLRQ
changes.
<RXPD\ORJLQWKH:LQGRZVXQGHU8VHU
authority.
&OLFNWKH[OK]WKHQWKH³/LYH9LHZHU´PDLQ
menu is displayed even though the network
LVQRWHVWDEOLVKHG&OLFN on the main
menu and go back to item 1.5 Selecting the
network connection method. (14)
&RQVXOWWRWKHQHWZRUNDGPLQLVWUDWRU/RJLQWKH:LQGRZVXQGHU$GPLQLVWUDWRU
authority. After that, please resume at item 1.3.2 Starting the “LiveViewer”.
(9)
‹0$OO5LJKWV5HVHUYHG
27
3M™ Digital Projector X31/X36/X46
1. Connection to the network
&RQ¿JXULQJWKHQHWZRUNVHWWLQJVPDQXDOO\FRQWLQXHG
„,I\RXQHHGWRDGGD1HWZRUNFRQ¿JXUDWLRQRQ\RXUFRPSXWHUWRFRQQHFWWRWKH
projector.
This dialog will be displayed when you
QHHGWRDGGD1HWZRUNFRQ¿JXUDWLRQRQ
your computer to connect to the projector.
&RQ¿UPZLWK\RXUQHWZRUNDGPLQLVWUDWRULI
WKH1HWZRUNFRQ¿JXUDWLRQGLVSOD\HGRQWKH
GLDORJLV2.DQGWKHQFOLFNWKH[Yes].
&OLFNWKH[NO]WKHQWKH³/LYH9LHZHU´PDLQPHQXLVGLVSOD\HGHYHQWKRXJKWKH
QHWZRUNLVQRWHVWDEOLVKHG&OLFN on the main menu and go back to item 1.5
Selecting the network connection method. (14)
,I\RXSXWDFKHFNPDUNLQWKHER[³1RWGLVSOD\LQJFRQ¿UPDWLRQGLDORJIRUDGGLQJ
1HWZRUNVHWWLQJV´WKHSURMHFWRUPHPRUL]HVFXUUHQWFRQ¿JXUDWLRQDQGWKLVGLDORJ
LVQRWGLVSOD\HGDJDLQ7RGLVSOD\WKLVGLDORJDJDLQFOLFN2SWLRQ icon in the
³/LYH9LHZHU´PDLQPHQXDQGUHPRYHWKHFKHFNPDUNLQWKHER[³1RWGLVSOD\LQJ
FRQ¿UPDWLRQGLDORJIRUDGGLQJ1HWZRUNVHWWLQJV´
,I\RXZDQWWRFKDQJHWKH1HWZRUN
FRQ¿JXUDWLRQWRDGGFOLFNWKH[Change]. A
GLDORJIRUFKDQJLQJWKH1HWZRUNFRQ¿JXUDWLRQ
as shown to the right will be displayed. Enter
,3DGGUHVVDQGVXEQHWPDVNWKHQFOLFNWKH
[OK]3URFHGXUHWRFRQQHFWWRWKHSURMHFWRU
will start.
3URFHHGWRLWHP&RQ¿UPLQJWKH
connection to your destination. (30)
If you click the [Cancel], you will return to the
GLDORJIRUDGGLQJD1HWZRUNFRQ¿JXUDWLRQ
28
‹0$OO5LJKWV5HVHUYHG
3M™ Digital Projector X31/X36/X46
1. Connection to the network
&RQ¿JXULQJWKHQHWZRUNVHWWLQJVPDQXDOO\FRQWLQXHG
,IWKHHQWHUHG,3DGGUHVVDQGSURMHFWRU
V,3
address are the same, a warning dialog shown
to the right will be displayed.
&OLFNWKH[OK]DQGWKHQHQWHUDGLIIHUHQW,3
DGGUHVVIURPWKHSURMHFWRU
VRQHLQWKHGLDORJ
IRUFKDQJLQJ1HWZRUNFRQ¿JXUDWLRQ
If the connection is not available with the
HQWHUHG1HWZRUNFRQ¿JXUDWLRQDZDUQLQJ
dialog shown to the right will be displayed.
&OLFNWKH[OK] to return to the dialog for
FKDQJLQJWKH1HWZRUNFRQ¿JXUDWLRQDQGWKHQ
HQWHUDSSURSULDWHFRQ¿JXUDWLRQ
NOTE ‡,ID1HWZRUNFRQ¿JXUDWLRQWRFRQQHFWWRWKHSURMHFWRUKDVEHHQDGGHG
RQWKHFRPSXWHUWKHDGGHG1HWZRUNFRQ¿JXUDWLRQZLOOEHHUDVHGRQFHWKH
application software is closed.
„ Are you sure you want to connect the selected projector?
The message is appeared when the wireless
adapter you selected is already used for
another network connection.
‡7RFRQQHFWFOLFNWKH[Yes]3URFHHGWRLWHP
&RQ¿UPLQJWKHFRQQHFWLRQWR\RXU
destination. (30)
‡1RWWRFRQQHFWFOLFNWKH[No] then the
³/LYH9LHZHU´PDLQPHQXLVGLVSOD\HGHYHQ
though the network is not established.
&OLFN on the main menu to go back
to item 1.5 Selecting the network
connection method. (14)
‹0$OO5LJKWV5HVHUYHG
29
3M™ Digital Projector X31/X36/X46
1. Connection to the network
&RQÀUPLQJWKHFRQQHFWLRQWR\RXUGHVWLQDWLRQ
1.8.1 Connection and transmission
When the network connection is established,
WKH³&RQQHFWLRQWR3URMHFWRUVXFFHVVIXO´VFUHHQ
is displayed.
0DNHVXUHWKDWWKHULJKWSURMHFWRUWKDW\RXZDQW
to send your image to is selected, by checking
WKHSURMHFWRUQDPHDQG,3DGGUHVVVKRZQLQ
the screen.
‡To send images to the projector, click the [Yes]. The transmission will be started.
To display the transmitted images, select the LAN port as input source on the
projector.
‡1RWWRVHQGFOLFN the [No]WKHQWKH³/LYH9LHZHU´PDLQPHQXLVGLVSOD\HG
LQVWDQGE\PRGH6WDQGE\PRGHLVWKHVWDWHZKHUHWKHUHLVQRLPDJH
transmission, although the network connection is established.)
or EXWWRQRQWKH³/LYH9LHZHU´
The transmission can be started, if you click
main menu.
,I\RXZLVKWRXVHWKHFXUUHQWFRQQHFWLRQVHWWLQJDVDSUR¿OHGDWDIRU0\
&RQQHFWLRQFKHFNLQWKHER[IRU the [Register this setting to My Connection].
[Troubleshooting]
„7KLVSURMHFWRULVFXUUHQWO\LQXVH3UHVHQWLQJE\DQRWKHUXVHU
The projector you want to send your images
to is occupied by another computer in the
3UHVHQWHUPRGH
&OLFN the [OK]WKHQWKH³/LYH9LHZHU´PDLQ
PHQXLVGLVSOD\HGLQVWDQGE\PRGH5HWU\
WRVHQG\RXULPDJHVDIWHUWKH3UHVHQWHU
mode is off.
‹0$OO5LJKWV5HVHUYHG
3M™ Digital Projector X31/X36/X46
1. Connection to the network
&RQ¿UPLQJWKHFRQQHFWLRQWR\RXUGHVWLQDWLRQFRQWLQXHG
„ $6OLGHVKRZLVFXUUHQWO\UXQQLQJRQWKHSURMHFWRUWKDW\RXDUHWU\LQJWRGLVSOD\WR
The projector you want to send your images
WRLVLQWKH6OLGHVKRZPRGHLQWKH3&/(66
3UHVHQWDWLRQ
‡&OLFNthe [Yes], then the projector will stop
WKH6OLGHVKRZDQGVZLWFKWKHLQSXWVRXUFH
to the LAN port.
‡&OLFN the [No], then the projector
UHPDLQVLQWKH6OLGHVKRZPRGHDQGWKH
³/LYH9LHZHU´PDLQPHQXLVGLVSOD\HGLQ
VWDQGE\PRGHRQ\RXUFRPSXWHU
„$UH\RXVXUH\RXZDQWWRFKDQJHWKHLQSXWFKDQQHORIWKH3URMHFWRUWR/$1"
7KHSURMHFWRULVQRWVHWWRWKH/$1DVDQ
input signal.
‡&OLFN the [Yes], then the projector is
VZLWFKHGWRWKH/$1
‡&OLFN the [No], then the projector remains
DVLWLVDQGWKH³/LYH9LHZHU´PDLQPHQX
LVGLVSOD\HGLQVWDQGE\PRGHRQ\RXU
computer.
‹0$OO5LJKWV5HVHUYHG
3M™ Digital Projector X31/X36/X46
1. Connection to the network
&RQ¿UPLQJWKHFRQQHFWLRQWR\RXUGHVWLQDWLRQFRQWLQXHG
1.8.2 Connection error
When the connection to the projector could not
EHHVWDEOLVKHGDQHUURUPHVVDJH³1HWZRUN
&RQQHFWLRQQRWHVWDEOLVKHG´ZLOOFRPHXS
&OLFN the [OK]WKHQWKH³/LYH9LHZHU´PDLQ
menu is displayed even though the network
LVQRWHVWDEOLVKHG&OLFN on the main menu
to go back to item 1.5 Selecting the network
connection method. (14)
NOTE ‡,I0\&RQQHFWLRQLVVHOHFWHGDQGWKHFRQQHFWLRQFRXOGQRWEH
HVWDEOLVKHGWKH³/LYH9LHZHU´PDLQPHQXZLOOQRWEHGLVSOD\HG&KHFNWKH
network setting in the projector, and retry the connection from item 1.3.2
Staring the “LiveViewer”. (9)
32
‹0$OO5LJKWV5HVHUYHG
3M™ Digital Projector X31/X36/X46
1. Connection to the network
3URÀOHGDWD
2XWOLQHRI3URÀOHGDWD
The network setting to connect the projector and computer can be stored as a
SUR¿OHGDWD2QFHWKHGDWDLVVWRUHGDOO\RXQHHGWRGRLVWRVHOHFWWKHGDWDWR
connect to the network. It is recommended when the same network connection is
often used.
0DNLQJ3URÀOHGDWD
7KHSUR¿OHGDWDLVPDGHRQWKH0DQXDO
&RQ¿JXUDWLRQVFUHHQ23)
8SWRSUR¿OHGDWDFDQEHVWRUHGIRUHDFK
network adapter.
6HOHFW the >3UR¿OH@ and click the [New].
7KH³&UHDWHQHZSUR¿OH´ZLOOFRPHXS
,I\RXKDYHDOUHDG\PDGHSUR¿OHV\RX
cannot make a new one, until you delete a
stored data.
,QSXWDOOLQIRUPDWLRQUHTXLUHGIRU\RXU
network connection.
If you want to clear the information you input,
click the [Clear].
&OLFN the [OK], after all information is set.
,I\RXGRQ¶WZDQWWRVWRUHLWFOLFN the [Cancel].
7KHQHZSUR¿OHGDWDLVVKRZQLQWKHSUR¿OHOLVWLI\RXFOLFN the [OK].
NOTE ‡:KHQ\RXPDNHDQHZSUR¿OHGDWDLWLVVWURQJO\UHFRPPHQGHGWR
FKHFNWKDWWKHQHZGDWDZRUNVSURSHUO\E\VHOHFWLQJWKHGDWDDWWKH3UR¿OH
connection. (23)
‡,I\RXFKDQJHDQHWZRUNDGDSWHURQ\RXUFRPSXWHUPDNHDQHZSUR¿OHGDWD
for the adapter.
‹0$OO5LJKWV5HVHUYHG
33
3M™ Digital Projector X31/X36/X46
1. Connection to the network
3UR¿OHGDWDFRQWLQXHG
(GLWLQJ3URÀOHGDWD
,IQHFHVVDU\WKHSUR¿OHGDWDFDQEHHGLWHGRQ
WKH0DQXDO&RQ¿JXUDWLRQVFUHHQ23)
6HOHFW the >3UR¿OH@, and select one of the
data listed in the window.
&OLFN the [Edit].
7KH³(GLWSUR¿OH´VFUHHQZLOOFRPHXS
(GLWWKHLQIRUPDWLRQUHTXLUHGWREHUHYLVHG
If you want to clear all information in the
window, click the [Clear].
&OLFN the [OK], after the editing is completed.
,I\RXGRQ¶WZDQWWRVWRUHLWFOLFN the [Cancel].
7KHHGLWHGSUR¿OHGDWDLVVWRUHGDQGVKRZQ
LQWKHSUR¿OHOLVWZLWKWKHQHZGDWHFUHDWHG
information, if you click the [OK].
NOTE ‡:KHQ\RXHGLWDSUR¿OHGDWDLWLVVWURQJO\UHFRPPHQGHGWRFKHFNWKDW
WKHHGLWHGGDWDZRUNVSURSHUO\E\VHOHFWLQJWKHGDWDDWWKH3UR¿OHFRQQHFWLRQ
(23)
34
‹0$OO5LJKWV5HVHUYHG
3M™ Digital Projector X31/X36/X46
1. Connection to the network
3UR¿OHGDWDFRQWLQXHG
1.9.4 Registering My Connection
2QHRIWKHSUR¿OHGDWDZKLFKLVRIWHQXVHGFDQEHUHJLVWHUHGDVWKH0\
&RQQHFWLRQSUR¿OHGDWD2QFHWKHGDWDLVUHJLVWHUHGDOO\RXQHHGWRGRLVWRVHOHFW
WKH0\&RQQHFWLRQWRFRQQHFWWRWKHQHWZRUN12)
&OLFNWKH[My Connection].
7KH³$GG0\&RQQHFWLRQ´VFUHHQZLOOFRPH
up.
7KHFXUUHQWO\VHOHFWHGSUR¿OHGDWDIRUWKH0\
&RQQHFWLRQLVVKRZQZLWKDFKHFNPDUNLQ
the list.
6HOHFWRQHRIWKHSUR¿OHGDWDOLVWHGLQWKH
window and put a mark in the check box.
The data selected before is turned
unmarked.
&OLFNWKH[OK], then the window is closed.
,I\RXGRQ¶WZDQWWRVHOHFWDQHZRQHFOLFN
the [Cancel].
NOTE ‡,I\RXGRQ¶WZDQWWRXVHWKH0\&RQQHFWLRQPDUNQRGDWDOLVWHGLQWKH
window, and click the [OK].
‡,QWKHOLVWDOOSUR¿OHGDWDDUHVKRZQQRPDWWHUZKLFKQHWZRUNDGDSWHULV
VHOHFWHG<RXFDQUHJLVWHUDSUR¿OHGDWDWKDWLVQRWIRUFXUUHQWO\VHOHFWHG
QHWZRUNDGDSWHUDVWKH0\&RQQHFWLRQSUR¿OHGDWD
‹0$OO5LJKWV5HVHUYHG
3M™ Digital Projector X31/X36/X46
1. Connection to the network
3UR¿OHGDWDFRQWLQXHG
$OVR\RXFDQUHJLVWHUDSUR¿OHGDWDWR0\
&RQQHFWLRQZKHQWKHQHWZRUNFRQQHFWLRQ
is established. When it is established, the
³&RQQHFWLRQWR3URMHFWRUVXFFHVVIXO´VFUHHQLV
displayed. (30)
If you wish to use the current connection
VHWWLQJIRU0\&RQQHFWLRQFKHFNLQWKHER[IRU
the [Register this setting to My Connection].
And then, if it is okay to overwrite the present
GDWDIRU0\&RQQHFWLRQFOLFNWKH[OK].
$QHZSUR¿OHGDWDZLOOEHFUHDWHGDQGLWLV
UHJLVWHUHGDV0\&RQQHFWLRQSUR¿OHGDWD
NOTE ‡,IWKHUHDUHDOUHDG\SUR¿OHGDWDWKHFKHFNER[FDQQRWEHFKHFNHG
3OHDVHHUDVHRQHRIWKHH[LVWLQJSUR¿OHGDWD
‡7KHSUR¿OHQDPHIRUWKHVWRUHGGDWDLVDVVLJQHGE\WKH³/LYH9LHZHU´
automatically. The name will be shown at the right side of the check box.
36
‹0$OO5LJKWV5HVHUYHG
3M™ Digital Projector X31/X36/X46
2. Network Presentation
1HWZRUN3UHVHQWDWLRQ
2.1 Using the “LiveViewer”
When you get the connection between your projector and computer, the
³/LYH9LHZHU´PDLQPHQXZLOOEHVKRZQRQWKHFRPSXWHUVFUHHQ
2QWKHPDLQPHQX\RXFDQFRQ¿JXUHVHWWLQJVDQGRSHUDWHIXQFWLRQVWRVHQG\RXU
images to the projector.
2.1.1 Main menu and Operating buttons
1) Menu Type
There are 2 type of the main menu, Easy type and Advanced type, which can
be switched on screen.
‡:KHQWKH³/LYH9LHZHU´LVVWDUWHGWKHODVWXVHGW\SHZLOOEHRQVFUHHQ
‡:KHQWKHQHWZRUNFRQQHFWLRQLVQRWHVWDEOLVKHGWKH$GYDQFHGW\SHZLOOEHRQ
screen.
Easy Type
Advanced Type
0
.
$
"
6WDWXV'LVSOD\
/
3
6ZLWFKWR$GYDQFHGW\SH
6ZLWFKWR
Easy type
Indicator
1
4
2
(
,
2) Operating buttons
. Starting Capture button
The transmission to the projector is started and the images will be displayed.
7KH'LVSOD\PRGHZLOOEHWKH6LQJOH3&PRGHDW¿UVW$IWHUWKDWWKHODVW
'LVSOD\PRGHZLOOEHDSSOLHG
3 Stop button
The image transmission is stopped.
NOTE ‡7KHLPDJHVPD\QRWEHGLVSOD\HGRQVFUHHQLIWKH6WDUW6WRSEXWWRQV
are clicked repeatedly.
‡7KHSULPDU\LPDJHLVGLVSOD\HGLQPXOWLGLVSOD\HQYLURQPHQW
‹0$OO5LJKWV5HVHUYHG
37
3M™ Digital Projector X31/X36/X46
2. Network Presentation
2.1 Using the “LiveViewer” (continued)
$ Hold button
7KHLPDJHRQVFUHHQLVWHPSRUDOO\IUR]HQ
The last image before the button is clicked is remained on screen.
<RXFDQUHYLVHWKHLPDJHGDWDRQ\RXUFRPSXWHUZLWKRXWVKRZLQJLWRQWKH
SURMHFWRU¶VVFUHHQ
/ Display mode button (40)
7KHEXWWRQVZLWFKHVWKH6LQJOH3&PRGHDQG0XOWL3&PRGH
1 Connect button
The screen to select the connection mode is displayed.
*RWRLWHP1.5. (14)
4 Option button
The option screen is displayed.
2 Web control button
6WDUWVWKH:HEEURZVHURQ\RXUFRPSXWHUDQGGLVSOD\V:HEFRQWUROVFUHHQ
to control the projector and change various settings for the projector. (45)
( Information button
7KHYHUVLRQRIWKH³/LYH9LHZHU´LVGLVSOD\HG
,, " Close button
7KHQHWZRUNLVGLVFRQQHFWHGDQGWKH³/LYH9LHZHU´LVFORVHG
0 Minimize button
7KHPDLQPHQXLVFORVHGDQGWKH³/LYH9LHZHU´LFRQLVGLVSOD\HGRQWKH
task tray in your computer. The displayed icon changes as shown below
GHSHQGLQJRQWKHVWDWXVRIWKH³/LYH9LHZHU´,IWKHLFRQLVGRXEOHFOLFNHGWKH
last type of the main menu will be shown on screen.
Connected
38
Disconnected
Not connected
Hold
‹0$OO5LJKWV5HVHUYHG
3M™ Digital Projector X31/X36/X46
2. Network Presentation
2.1 Using the “LiveViewer” (continued)
2.1.2 Displaying the status
,QGLFDWRU
The indicator shows the following status.
Indicator
Status
Note
1RWFRQQHFWHG
The network connection to the projector is
not established yet.
+ROG
The network connection is established, but
the image transmissions on hold.
&RQQHFWHG
The network connection is established and
the images on the computer are being sent
to the projector.
'LVFRQQHFWHG
The network connection to the projector is
disconnected.
6WDWXV'LVSOD\LQ0XOWL3&PRGH
7KHLFRQLVGLVSOD\HGDWWKHULJKWHQGRIWKH'LVSOD\PRGHEXWWRQV
2QHRIWKHIROORZLQJLFRQVWRLQIRUPZKLFKTXDUWHUVFUHHQVDUHXVHGZLOOEH
shown.
Status
Status icon
1RFRPSXWHULVRQVFUHHQ
2QHFRPSXWHULVRQVFUHHQ
Two computers are on screen.
Three computers are on screen.
Four computers are on screen.
NOTE ‡7KHVWDWXVGLVSOD\LVUHIUHVKHGLQHYHU\VHFRQGV
‡,IWKHVWDWXVFDQQRWEHJRWWHQIURPWKHSURMHFWRULWZLOOQRWEHGLVSOD\HG
‹0$OO5LJKWV5HVHUYHG
39
3M™ Digital Projector X31/X36/X46
2. Network Presentation
2.1 Using the “LiveViewer” (continued)
2.1.3 Switching the display mode
7KH³/LYH9LHZHU´KDVWKH6LQJOH3&PRGHDQG0XOWL3&PRGH7KHPRGHVFDQEH
switched on the main menu.
&OLFNWKH button on the main menu.
The buttons below are displayed.
.
3
$
/
1
4
4:6WDWXV'LVSOD\
6HOHFWIURP. to 1 buttons, and click it.
.6ZLWFKLQJWRWKH6LQJOH3&PRGH<RXULPDJHLVGLVSOD\HGRQIXOOVFUHHQ
316ZLWFKLQJWRWKH0XOWL3&PRGH<RXULPDJHLVGLVSOD\HGRQDTXDUWHU
VFUHHQLGHQWL¿HGLQWKHEXWWRQ
3) The projector screen is switched to the mode selected above, and the
transmission of your computer image will be started to display your image on
the screen.
4) The icon
on the main menu is replaced by the icon you selected.
NOTE ‡7KHLPDJHWUDQVPLVVLRQZLOOEHVWRSSHGZKHQ\RXFOLFNWKH6LQJOH
PRGHEXWWRQZKLOHWKHSURMHFWRULVLQWKH6LQJOH3&PRGHRU\RXFOLFNRQHRIWKH
0XOWLPRGHEXWWRQVWKDWVKRZVWKHTXDUWHUVFUHHQZKLFKLVFXUUHQWO\GLVSOD\LQJ
\RXUFRPSXWHULPDJHVLQWKH0XOWL3&PRGH
‡,IWKH0XOWL3&PRGHLVVHOHFWHGWKHSURMHFWRUVFUHHQLVDXWRPDWLFDOO\GLYLGHG
WR]RQHV
‡,IWKH3UHVHQWHUPRGHLVVHWRQLQWKHFRPSXWHUZKRVHLPDJHLVFXUUHQWO\
RQVFUHHQLQWKH6LQJOH3&PRGHWKH button cannot be clicked on other
computers.
‡,I\RXVHOHFWWKHEXWWRQRIWKHTXDUWHUVFUHHQGLVSOD\LQJLPDJHVIURPDQRWKHU
computer, the image transmission from that computer will be stopped.
7KHGLVSOD\PRGHFDQEHVHWDOVRE\XVLQJWKH08/7,3&02'(LQWKH
35(6(17$7,21LWHPLQWKH1(7:25.PHQX7KHODVWVHWWLQJPDGHZLOOWDNH
HIIHFWUHJDUGOHVVRIWKHVHWWLQJPHWKRG5HIHUWRNETWORK menu in the
Operator's Guide for the function on the projector.)
‹0$OO5LJKWV5HVHUYHG
3M™ Digital Projector X31/X36/X46
2. Network Presentation
2.1 Using the “LiveViewer” (continued)
2.1.4 Option menu
&OLFNLQJWKH2SWLRQEXWWRQGLVSOD\VWKHRSWLRQPHQXRQVFUHHQ
.
3
$
/
.³1RWGLVSOD\LQJFRQ¿UPDWLRQGLDORJIRUDGGLQJ1HWZRUNVHWWLQJV´
7KLVVHWWLQJDOORZV\RXWRFKRRVHWRGLVSOD\RUQRWWKHFRQ¿UPDWLRQGLDORJIRU
DGGLQJD1HWZRUNFRQ¿JXUDWLRQ19, 28) when you connect your computer
to the projector. It is turned off by default.
3 Optimize Performance
7KH³/LYH9LHZHU´FDSWXUHVFRPSXWHUVFUHHQLQ-3(*GDWDDQGVHQGVWKH
-3(*GDWDWRWKHSURMHFWRU7KH³/LYH9LHZHU´KDVWZRRSWLRQVWKDWKDYH
GLIIHUHQWFRPSUHVVLRQUDWHRI-3(*GDWD
Transmission speed
6SHHGWDNHVSULRULW\RYHU,PDJHTXDOLW\
,WPDNHV-3(*FRPSUHVVLRQUDWHKLJKHU
7KHVFUHHQRQWKHSURMHFWRULVUHZULWWHQTXLFNHUEHFDXVHWKH
WUDQVIHUUHGGDWDLVVPDOOHUEXWWKHLPDJHTXDOLW\LVZRUVH
Image quality
,PDJHTXDOLW\WDNHVSULRULW\RYHU6SHHG
,WPDNHV-3(*FRPSUHVVLRQUDWHORZHU
The screen on the projector is rewritten slower because the
WUDQVIHUUHGGDWDLVODUJHUEXWWKHLPDJHTXDOLW\LVEHWWHU
‹0$OO5LJKWV5HVHUYHG
3M™ Digital Projector X31/X36/X46
2. Network Presentation
2.1 Using the “LiveViewer” (continued)
$ Presenter Mode
,QWKH6LQJOH3&PRGHWKHSURMHFWRUFDQEHRFFXSLHGE\RQHFRPSXWHU
DQGFDQEORFNDQDFFHVVIURPDQ\RWKHUFRPSXWHULIWKH3UHVHQWHUPRGHLV
VHOHFWHGLQWKH³/LYH9LHZHU´
:KLOHPDNLQJ\RXUSUHVHQWDWLRQ\RXGRQ¶WQHHGWRZRUU\WKDWWKHLPDJHRQ
screen is unexpectedly switched to an image sent by another computer.
If you want to turn it on, put a check mark in the check box.
NOTE ‡,IWKH0XOWL3&PRGHLVVHOHFWHGWKHVHWWLQJIRUWKH3UHVHQWHUPRGHLV
invalid.
‡:KHQVZLWFKLQJIURPWKH0XOWL3&PRGHWRWKH6LQJOH3&PRGHWKH3UHVHQWHU
mode setting of the computer is valid.
‡7KH3UHVHQWHU0RGHLVVHWYDOLGLQIDFWRU\GHIDXOWVHWWLQJ
‡,QDGGLWLRQWRXVLQJWKHVRIWZDUHPHQXRQWKHFRPSXWHURQZKLFK3UHVHQWHU
0RGHLVWXUQHGRQ\RXFDQFDQFHOWKLVIXQFWLRQE\XVLQJWKHSURMHFWRU
V26'
PHQX48,735(6(17(502'((;(&87(RIWKH35(6(17$7,21LWHPLQ
WKH1(7:25.PHQX
/ Display User Name
$³8VHU1DPH´WKDWLVXSWROHWWHUVFDQEHLQSXWE\XVLQJDOSKDQXPHULF
characters.
7KHXVHUQDPHFDQEHGLVSOD\HGRQWKHSURMHFWRUVFUHHQVR\RXFDQ¿QGRXW
whose image is currently on the screen.
5HIHUWRNETWORK menu in the Operator's Guide)
If the check box is not marked, the information is not sent to the projector.
42
‹0$OO5LJKWV5HVHUYHG
3M™ Digital Projector X31/X36/X46
2. Network Presentation
2.2 Starting the Network Presentation
7KLVFKDSWHUH[SODLQVWKH1HWZRUN3UHVHQWDWLRQIHDWXUHZLWKZKLFK\RXFDQSURMHFW
computer images transmitted through a network.
7KH³/LYH9LHZHU´DOORZV\RXWRSURMHFWLPDJHVIURPRQHRUPXOWLSOHFRPSXWHUVE\
connecting the projector to an existing network without using computer cables.
7KLV1HWZRUN3UHVHQWDWLRQIHDWXUHKHOSV\RXWRVPRRWKO\PDNH\RXUSUHVHQWDWLRQV
and conduct conferences.
7RVWDUWWKH1HWZRUN3UHVHQWDWLRQVHOHFWWKHLAN port as the input source on the
SURMHFWRUDQGFOLFNWKH6WDUWLQJ&DSWXUHEXWWRQRQWKH³/LYH9LHZHU´
2.2.1 Display mode
7ZRGLVSOD\PRGHV6LQJOH3&PRGHDQG0XOWL3&PRGHDUHDYDLODEOHIRUWKH
1HWZRUN3UHVHQWDWLRQ
6LQJOH3&PRGH
The projector displays images sent by one computer.
‹0$OO5LJKWV5HVHUYHG
43
3M™ Digital Projector X31/X36/X46
2. Network Presentation
2.2 Starting the Network Presentation (continued)
0XOWL3&PRGH
7KHSURMHFWRUVFUHHQLVGLYLGHGWR]RQHV7KHSURMHFWRUGLVSOD\VLPDJHVLQ
RQH]RQHVHQWE\DFRPSXWHUVRWKDWWKHSURMHFWRUFDQGLVSOD\LPDJHVVHQWE\
up to 4 computers at the same time.
1
2
3
4
2.2.2 Presenter mode
,QWKH6LQJOH3&PRGHWKHSURMHFWRUFDQEHRFFXSLHGE\RQHFRPSXWHUDQGFDQ
EORFNDQDFFHVVIURPDQ\RWKHUFRPSXWHULIWKH3UHVHQWHUPRGHLVVHOHFWHGLQWKH
³/LYH9LHZHU´
:KLOHPDNLQJ\RXUSUHVHQWDWLRQ\RXGRQ¶WQHHGWRZRUU\WKDWWKHLPDJHRQVFUHHQ
is unexpectedly switched to an image sent by another computer.
7KH3UHVHQWHUPRGHFDQEHVHWRQWKH2SWLRQPHQXLQWKH³/LYH9LHZHU´PDLQ
menu. (41)
2.2.3 Display User Name
$³8VHU1DPH´FDQEHLQSXWLQWKH³/LYH9LHZHU´ZKLFKLVGLVSOD\HGRQVFUHHQ
E\RSHUDWLQJWKHPHQXRQWKHSURMHFWRU6RLWFDQEHIRXQGRXWZKRVHLPDJHLV
currently displayed on screen. (41)
44
‹0$OO5LJKWV5HVHUYHG
3M™ Digital Projector X31/X36/X46
3. Web Control
:HE&RQWURO
<RXFDQDGMXVWRUFRQWUROWKHSURMHFWRUYLDDQHWZRUNIURPDZHEEURZVHURQD
computer that is connected to the same network.
NOTE ‡,QWHUQHW([SORUHURUODWHULVUHTXLUHG
‡,I-DYD6FULSWLVGLVDEOHGLQ\RXUZHEEURZVHUFRQ¿JXUDWLRQ\RXPXVWHQDEOH
-DYD6FULSWLQRUGHUWRXVHWKHSURMHFWRUZHESDJHVSURSHUO\6HHWKH+HOS¿OHV
IRU\RXUZHEEURZVHUIRUGHWDLOVRQKRZWRHQDEOH-DYD6FULSW
‡,WLVUHFRPPHQGHGWKDWDOOZHEEURZVHUXSGDWHVDUHLQVWDOOHG
‹0$OO5LJKWV5HVHUYHG
3M™ Digital Projector X31/X36/X46
3. Web Control
3.1 Logon
7RXVHWKH:HE&RQWUROIXQFWLRQ\RXQHHGWRORJRQZLWK\RXUXVHUQDPHDQG
password. (47)
5HIHUWRWKHIROORZLQJIRUFRQ¿JXULQJRUFRQWUROOLQJWKHSURMHFWRUYLDDZHEEURZVHU
Example,IWKH,3DGGUHVVRIWKHSURMHFWRULVVHWWR192.168.1.10:
'LVSOD\WKHORJRQZLQGRZDVVKRZQRQWKHULJKW
There are two options to display this window.
.8VLQJWKH³/LYH9LHZHU´
&RQQHFW\RXUFRPSXWHUDQGWKHSURMHFWRU
YLD1HWZRUNXVLQJWKH³/LYH9LHZHU´9)
7KHQFOLFNWKH:HE&RQWUROEXWWRQ on
WKH³/LYH9LHZHU´PDLQPHQX37) to
start the Web browser software.
38VLQJ:HEEURZVHUVRIWZDUH
0DNHVXUHWKDW\RXUFRPSXWHUDQGWKH
projector is connected via network, and
then start Web browser.
(QWHUWKHSURMHFWRU
V,3DGGUHVVLQWR85/
input box of the Web browser as the example below, and then press the
button.
Enter key or
Example,IWKH,3DGGUHVVRIWKHSURMHFWRULVVHWWR192.168.1.10:
(QWHU³http://192.168.1.10/´LQWRWKHDGGUHVVEDURIWKHZHE
button.
browser and press the Enter key or click
2) Enter your user name and password, and then click the [OK].
NOTE ‡7KHODQJXDJHXVHGRQWKH:HE&RQWUROVFUHHQLVWKHVDPHDVWKDW
RIWKH26'RQWKHSURMHFWRU,I\RXZDQWWRFKDQJHLW\RXQHHGWRFKDQJHWKH
26'ODQJXDJHRQWKHSURMHFWRUSCREEN menu in the Operator's Guide)
46
‹0$OO5LJKWV5HVHUYHG
3M™ Digital Projector X31/X36/X46
3. Web Control
3.1 Logon (Continued)
%HORZDUHWKHIDFWRU\GHIDXOWVHWWLQJVIRUXVHUQDPHDQGSDVVZRUG
User name
Password
Administrator
<blank>
If you logon successfully, the screen below will be displayed.
0DLQPHQX
&OLFNWKHGHVLUHGRSHUDWLRQRUFRQ¿JXUDWLRQLWHPRQWKHPDLQPHQX
‹0$OO5LJKWV5HVHUYHG
47
3M™ Digital Projector X31/X36/X46
3. Web Control
3.2 Network Information
'LVSOD\VWKHSURMHFWRU¶VFXUUHQWQHWZRUNFRQ¿JXUDWLRQVHWWLQJV
Item
Description
Projector Name
'LVSOD\VWKHSURMHFWRUQDPHVHWWLQJV
DHCP
'LVSOD\VWKH'+&3FRQ¿JXUDWLRQVHWWLQJV
IP Address
'LVSOD\VWKHFXUUHQW,3DGGUHVV
Subnet Mask
'LVSOD\VWKHVXEQHWPDVN
Default Gateway
'LVSOD\VWKHGHIDXOWJDWHZD\
DNS Server Address
'LVSOD\VWKH'16VHUYHUDGGUHVV
MAC Address
'LVSOD\VWKHHWKHUQHW0$&DGGUHVV
48
‹0$OO5LJKWV5HVHUYHG
3M™ Digital Projector X31/X36/X46
3. Web Control
3.3 Network Settings
'LVSOD\VDQGFRQ¿JXUHVQHWZRUNVHWWLQJV
Item
,3&RQ¿JXUDWLRQ
Description
&RQ¿JXUHVQHWZRUNVHWWLQJV
DHCP ON
(QDEOHV'+&3
DHCP OFF
'LVDEOHV'+&3
IP Address
&RQ¿JXUHVWKH,3DGGUHVVZKHQ'+&3LVGLVDEOHG
Subnet Mask
&RQ¿JXUHVWKHVXEQHWPDVNZKHQ'+&3LVGLVDEOHG
Default Gateway
&RQ¿JXUHVWKHGHIDXOWJDWHZD\ZKHQ'+&3LVGLVDEOHG
Projector Name
&RQ¿JXUHVWKHQDPHRIWKHSURMHFWRU
7KHOHQJWKRIWKH3URMHFWRU1DPHFDQEHXSWRDOSKDQXPHULF
FKDUDFWHUV2QO\DOSKDEHWVQXPEHUVDQGIROORZLQJV\PEROV
FDQEHXVHG
!"#>?@ABC^_`aDQGVSDFH
3DUWLFXODUSURMHFWRUQDPHLVSUHDVVLJQHGE\GHIDXOW
sysLocation (SNMP)
&RQ¿JXUHVWKHORFDWLRQWREHUHIHUUHGWRZKHQXVLQJ6103
7KHOHQJWKRIWKHV\V/RFDWLRQFDQEHXSWRDOSKDQXPHULF
FKDUDFWHUV2QO\QXPEHUVµ¶DQGDOSKDEHWµD]¶µ$=¶FDQEHXVHG
sysContact (SNMP)
&RQ¿JXUHVWKHFRQWDFWLQIRUPDWLRQWREHUHIHUUHGWRZKHQ
XVLQJ6103
7KHOHQJWKRIWKHV\V&RQWDFWFDQEHXSWRDOSKDQXPHULF
FKDUDFWHUV2QO\QXPEHUVµ¶DQGDOSKDEHWµD]¶µ$=¶FDQEHXVHG
DNS Server Address
&RQ¿JXUHVWKH'16VHUYHUDGGUHVV
AMX D.D.
(AMX Device Discovery)
&RQ¿JXUHVWKH$0;'HYLFH'LVFRYHU\VHWWLQJWRGHWHFWWKHSURMHFWRU
IURPWKHFRQWUROOHUVRI$0;FRQQHFWHGWRWKHVDPHQHWZRUN)RUWKH
GHWDLOVRI$0;'HYLFH'LVFRYHU\YLVLWWKH$0;ZHEVLWH
85/KWWSZZZDP[FRP
&OLFNWKH[Apply] button to save the settings.
NOTE ‡7KHQHZFRQ¿JXUDWLRQVHWWLQJVDUHDFWLYDWHGDIWHUUHVWDUWLQJWKHQHWZRUNFRQQHFWLRQ
:KHQWKHFRQ¿JXUDWLRQVHWWLQJVDUHFKDQJHG\RXPXVWUHVWDUWWKHQHWZRUNFRQQHFWLRQ<RXFDQ
restart the network connection by clicking the [Network Restart] on the main menu.
‡,I\RXFRQQHFWWKHSURMHFWRUWRDQH[LVWLQJQHWZRUNFRQVXOWDQHWZRUN
administrator before setting server addresses.
‹0$OO5LJKWV5HVHUYHG
49
3M™ Digital Projector X31/X36/X46
3. Web Control
3.4 Port Settings
'LVSOD\VDQGFRQ¿JXUHVFRPPXQLFDWLRQSRUWVHWWLQJV
Item
Network Control Port1
(Port:23)
&RQ¿JXUHVFRPPDQGFRQWUROSRUW3RUW
Port open
&OLFNWKH[Enable] check box to use port 23.
Authentication
&OLFNWKH[Enable]FKHFNER[ZKHQDXWKHQWLFDWLRQLVUHTXLUHG
for this port.
Network Control Port2
(Port:9715)
&RQ¿JXUHVFRPPDQGFRQWUROSRUW3RUW
Port open
&OLFNWKH[Enable]FKHFNER[WRXVHSRUW
Authentication
&OLFNWKH[Enable]FKHFNER[ZKHQDXWKHQWLFDWLRQLVUHTXLUHG
for this port.
PJLink TM Port
(Port:4352)
&RQ¿JXUHVWKH3-/LQN 70SRUW3RUW
Port open
&OLFNWKH[Enable]FKHFNER[WRXVHSRUW
Authentication
&OLFNWKH[Enable]FKHFNER[ZKHQDXWKHQWLFDWLRQLVUHTXLUHG
for this port.
My Image Port
(Port:9716)
&RQ¿JXUHVWKH0\,PDJH3RUW3RUW
Port open
&OLFNWKH[Enable]FKHFNER[WRXVHSRUW
Authentication
&OLFNWKH[Enable]FKHFNER[ZKHQDXWKHQWLFDWLRQLVUHTXLUHG
for this port.
Messenger Port
(Port:9719)
Description
&RQ¿JXUHVWKH0HVVHQJHU3RUW3RUW
Port open
&OLFNWKH[Enable]FKHFNER[WRXVHSRUW
Authentication
&OLFNWKH[Enable]FKHFNER[ZKHQDXWKHQWLFDWLRQLVUHTXLUHG
for this port.
‹0$OO5LJKWV5HVHUYHG
3M™ Digital Projector X31/X36/X46
3. Web Control
3.4 Port Settings (Continued)
Item
SNMP Port
Description
&RQ¿JXUHVWKH6103SRUW
Port open
&OLFNWKH[Enable]FKHFNER[WRXVH6103
Trap address
&RQ¿JXUHVWKHGHVWLQDWLRQRIWKH61037UDSLQ,3IRUPDW
‡7KHDGGUHVVDOORZVQRWRQO\,3DGGUHVVEXWDOVRGRPDLQ
QDPHLIWKHYDOLG'16VHUYHULVVHWXSLQWKHNetwork
Settings. The maximum length of host or domain name is up
WRFKDUDFWHUV
'RZQORDG0,%¿OH
'RZQORDGVD0,%¿OHIURPWKHSURMHFWRU
Network Bridge Port
Port Number
&RQ¿JXUHVWKH%ULGJHSRUWQXPEHU
Input the port number.
([FHSWIRU
EHWZHHQDQGFDQEHVHWXS,WLVVHWWRDV
the default setting.
&OLFNWKH[Apply] button to save the settings.
NOTE ‡7KHQHZFRQ¿JXUDWLRQVHWWLQJVDUHDFWLYDWHGDIWHUUHVWDUWLQJWKH
QHWZRUNFRQQHFWLRQ:KHQWKHFRQ¿JXUDWLRQVHWWLQJVDUHFKDQJHG\RXPXVW
UHVWDUWWKHQHWZRUNFRQQHFWLRQ<RXFDQUHVWDUWWKHQHWZRUNFRQQHFWLRQE\
clicking the [Network Restart] on the main menu.
‹0$OO5LJKWV5HVHUYHG
3M™ Digital Projector X31/X36/X46
3. Web Control
3.5 Mail Settings
'LVSOD\VDQGFRQ¿JXUHVHPDLODGGUHVVLQJVHWWLQJV
Item
Description
Send Mail
&OLFNWKH[Enable]FKHFNER[WRXVHWKHHPDLOIXQFWLRQ
&RQ¿JXUHWKHFRQGLWLRQVIRUVHQGLQJHPDLOXQGHUWKHAlert
Settings.
SMTP Server Address
&RQ¿JXUHVWKHDGGUHVVRIWKHPDLOVHUYHULQ,3IRUPDW
‡7KHDGGUHVVDOORZVQRWRQO\,3DGGUHVVEXWDOVRGRPDLQ
QDPHLIWKHYDOLG'16VHUYHULVVHWXSLQWKHNetwork
Settings. The maximum length of host or domain name is up
WRFKDUDFWHUV
Sender E-mail address
&RQ¿JXUHVWKHVHQGHUHPDLODGGUHVV
7KHOHQJWKRIWKHVHQGHUHPDLODGGUHVVFDQEHXSWR
alphanumeric characters.
&RQ¿JXUHVWKHHPDLODGGUHVVRIXSWR¿YHUHFLSLHQWV<RX
can also specify the [TO] or [CC] for each address. The
Recipient E-mail address
OHQJWKRIWKHUHFLSLHQWHPDLODGGUHVVFDQEHXSWR
alphanumeric characters.
&OLFNWKH[Apply] button to save the settings.
NOTE ‡<RXFDQFRQ¿UPZKHWKHUWKHPDLOVHWWLQJVZRUNFRUUHFWO\XVLQJWKH
[Send Test Mail]EXWWRQ3OHDVHHQDEOH6HQGPDLOVHWWLQJEHIRUHFOLFNLQJWKH
[Send Test Mail].
‡,I\RXFRQQHFWWKHSURMHFWRUWRDQH[LVWLQJQHWZRUNFRQVXOWDQHWZRUN
administrator before setting server addresses.
‹0$OO5LJKWV5HVHUYHG
3M™ Digital Projector X31/X36/X46
3. Web Control
3.6 Alert Settings
'LVSOD\VDQGFRQ¿JXUHVIDLOXUHDOHUWVHWWLQJV
Item
Description
Cover Error
7KHODPSFRYHUKDVQRWEHHQSURSHUO\¿[HG
Fan Error
The cooling fan is not operating.
Lamp Error
The lamp does not light, and there is a possibility that interior
portion has become heated.
Temp Error
There is a possibility that the interior portion has become
heated.
Air Flow Error
The internal temperature is rising.
Cold Error
There is a possibility that the interior portion has become
overcooled.
Filter Error
Filter time over.
Other Error
2WKHUHUURU
If displaying this error, please contact your dealer.
Schedule Execution
Error
6FKHGXOH([HFXWLRQHUURU55)
Lamp Time Alarm
/DPSWLPHRYHU$ODUP7LPHVHWWLQJ
Filter Time Alarm
Filter time over Alarm Time setting.
Transition Detector
Alarm
7UDQVLWLRQ'HWHFWRU$ODUPOPTION menu in the Operator's
Guide)
Cold Start
When the projector is supplied with the power, it works as
below.
‡,IWKH67$1'%<02'(LVVHWWRWKH1250$/WKHSURMHFWRU
V
SRZHUVWDWXVFKDQJHVIURP³2))´WR³6WDQGE\VWDWH´
‡,IWKH67$1'%<02'(LVVHWWRWKH6$9,1*WKHSURMHFWRU
VSRZHU
VWDWXVFKDQJHVIURP³6WDQGE\VWDWH´WR³21ODPSLVWXUQHGRQ´
(SETUP menu in the Operator's Guide)
Authentication Failure
7KH6103DFFHVVLVGHWHFWHGIURPWKHLQYDOLG6103FRPPXQLW\
5HIHUWR“Troubleshooting” in the Operator's Guide for further detailed
H[SODQDWLRQRI(UURUH[FHSW2WKHU(UURUDQG6FKHGXOH([HFXWLRQ(UURU
‹0$OO5LJKWV5HVHUYHG
3M™ Digital Projector X31/X36/X46
3. Web Control
3.6 Alert Settings (Continued)
The Alert Items are shown below.
Item
Description
Alarm Time
&RQ¿JXUHVWKHWLPHWRDOHUW
2QO\Lamp Time Alarm and Filter Time Alarm.)
SNMP Trap
&OLFNWKH[Enable]FKHFNER[WRHQDEOH61037UDSDOHUWV
Send Mail
&OLFNWKH[Enable]FKHFNER[WRHQDEOHHPDLODOHUWV
(Except Cold Start and Authentication Failure.)
Mail Subject
&RQ¿JXUHVWKHVXEMHFWOLQHRIWKHHPDLOWREHVHQW
7KHOHQJWKRIWKHVXEMHFWOLQHFDQEHXSWRDOSKDQXPHULF
characters.
(Except Cold Start and Authentication Failure.)
Mail Text
&RQ¿JXUHVWKHWH[WRIWKHHPDLOWREHVHQW
7KHOHQJWKRIWKHWH[WFDQEHXSWRDOSKDQXPHULF
characters, but if you are using some of special characters
below the length may be shorter.
6SHFLDOFKDUDFWHUV
?and space
(Except Cold Start and Authentication Failure.)
&OLFNWKH[Apply] button to save the settings.
NOTE ‡7KHWULJJHURIFilter ErrorHPDLOLVGHSHQGLQJRQWKH),/7(5
0(66$*(VHWWLQJLQWKH6(59,&(LWHPRIWKH237,21PHQXZKLFKGH¿QHV
WKHSHULRGXQWLOWKH¿OWHUPHVVDJHLVGLVSOD\HGRQWKHSURMHFWRUVFUHHQ7KH
HPDLOZLOOEHVHQWZKHQWKH¿OWHUWLPHUH[FHHGVRU
KRXUVEDVHGRQWKHFRQ¿JXUDWLRQ1RQRWL¿FDWLRQHPDLOZLOOEHVHQWLIWKH
),/7(50(66$*(LVVHWWR78512))OPTION menu in the Operator's
Guide)
‡Lamp Time AlarmLVGH¿QHGDVDWKUHVKROGIRUHPDLOQRWL¿FDWLRQUHPLQGHU
RIWKHODPSWLPHU:KHQWKHODPSKRXUH[FHHGVWKLVWKUHVKROGWKDWLVFRQ¿JXUHG
WKURXJKWKH:HESDJHWKHHPDLOZLOOEHVHQWRXW
‡Filter Time AlarmLVGH¿QHGDVDWKUHVKROGIRUHPDLOQRWL¿FDWLRQUHPLQGHU
RIWKH¿OWHUWLPH:KHQWKH¿OWHUKRXUH[FHHGVWKLVWKUHVKROGWKDWLVFRQ¿JXUHG
LQWKH:HESDJHWKHHPDLOZLOOEHVHQWRXW
‹0$OO5LJKWV5HVHUYHG
3M™ Digital Projector X31/X36/X46
3. Web Control
3.7 Schedule Settings
'LVSOD\VDQGFRQ¿JXUHVVFKHGXOHVHWWLQJV
Item
Description
Daily
&RQ¿JXUHVWKHGDLO\VFKHGXOH
Sunday
&RQ¿JXUHVWKH6XQGD\VFKHGXOH
Monday
&RQ¿JXUHVWKH0RQGD\VFKHGXOH
Tuesday
&RQ¿JXUHVWKH7XHVGD\VFKHGXOH
Wednesday
&RQ¿JXUHVWKH:HGQHVGD\VFKHGXOH
Thursday
&RQ¿JXUHVWKH7KXUVGD\VFKHGXOH
Friday
&RQ¿JXUHVWKH)ULGD\VFKHGXOH
Saturday
&RQ¿JXUHVWKH6DWXUGD\VFKHGXOH
6SHFL¿FGDWH1R
&RQ¿JXUHVWKHVSHFL¿FGDWH1RVFKHGXOH
6SHFL¿FGDWH1R
&RQ¿JXUHVWKHVSHFL¿FGDWH1RVFKHGXOH
6SHFL¿FGDWH1R
&RQ¿JXUHVWKHVSHFL¿FGDWH1RVFKHGXOH
6SHFL¿FGDWH1R
&RQ¿JXUHVWKHVSHFL¿FGDWH1RVFKHGXOH
6SHFL¿FGDWH1R
&RQ¿JXUHVWKHVSHFL¿FGDWH1RVFKHGXOH
‹0$OO5LJKWV5HVHUYHG
3M™ Digital Projector X31/X36/X46
3. Web Control
3.7 Schedule Settings (Continued)
The schedule settings are shown below.
Item
Description
Schedule
&OLFNWKH[Enable] check box to enable the schedule.
Date (Month/Day)
&RQ¿JXUHVWKHPRQWKDQGGDWH
7KLVLWHPDSSHDUVRQO\ZKHQ6SHFL¿FGDWH1RLV
selected.
&OLFNWKH[Apply] button to save the settings.
The current event settings are displayed on the schedule list. To add additional
functions and events, set the following items.
Item
Description
Time
&RQ¿JXUHVWKHWLPHWRH[HFXWHFRPPDQGV
Command
[Parameter]
&RQ¿JXUHVWKHFRPPDQGVWREHH[HFXWHG
Power
&RQ¿JXUHVWKHSDUDPHWHUVIRUSRZHUFRQWURO
Input Source
&RQ¿JXUHVWKHSDUDPHWHUVIRULQSXWVZLWFKLQJ
My Image
&RQ¿JXUHVWKHSDUDPHWHUVIRU0\,PDJHGDWDGLVSOD\70)
Messenger
&RQ¿JXUHVWKHSDUDPHWHUVIRU0HVVHQJHUGDWDGLVSOD\72)
Slideshow
&RQ¿JXUHVWKH6WDUW6WRSSDUDPHWHUVIRUWKH6OLGHVKRZ
&OLFNWKH[Register] button to add new commands to the schedule list.
&OLFNWKH[Delete] button to delete commands from the schedule list.
&OLFNWKH[Reset] button to delete all commands and reset the schedule settings
from the schedule list.
‹0$OO5LJKWV5HVHUYHG
3M™ Digital Projector X31/X36/X46
3. Web Control
3.7 Schedule Settings (Continued)
NOTE ‡$IWHUWKHSURMHFWRULVPRYHGFKHFNWKHGDWHDQGWLPHVHWIRUWKH
SURMHFWRUEHIRUHFRQ¿JXULQJWKHVFKHGXOHV6WURQJVKRFNPD\PDNHWKHGDWH
and time settings (58) get out of tune.
‡(YHQWV³My Image´DQG³Messenger´ZLOOQRWEHH[HFXWHGDSSURSULDWHO\EXW
UHVXOWLQ³VFKHGXOHH[HFXWLRQHUURU´VWDWXVLQFDVHODPSGRHVQRWOLJKWRUDQG
display data are not stored in the projector at the scheduled event execution
time.
‡(YHQWV³Input Source´DQG³My Image´ZLOOQRWEHH[HFXWHGLIVHFXULW\IHDWXUH
is enabled and the projector is locked due to the feature.
‡&HUWDLQHUURUVWDWHLQWKHSURMHFWRUVXFKDVWHPSHUDWXUHHUURUODPSHUURUZLOO
SUHYHQWWKHSURMHFWRUIURPDSSURSULDWHH[HFXWLRQRIVFKHGXOHGIXQFWLRQVHYHQWV
‡,IQR86%PHPRU\GHYLFHLVLQVHUWHGWRWKHSURMHFWRURUQRLPDJHGDWDIRU
display exists at the scheduled event time, a schedule execution error occurs
DJDLQVWWKHVFKHGXOHG6OLGHVKRZHYHQW
‡:KHQ\RXVWDUWWKH6OLGHVKRZLQSXWVRXUFHZLOOEHDXWRPDWLFDOO\VZLWFKHGWR
the USB TYPE A port.
‡,PDJH¿OHVVWRUHGLQWKHURRWGLUHFWRU\RIWKH86%PHPRU\GHYLFHZLOOEH
GLVSOD\HGIRUWKHVFKHGXOHG6OLGHVKRZ
‡3OHDVHUHIHUWR“Troubleshooting” in the Operator's Guide in case
VFKHGXOHGIXQFWLRQVHYHQWVDUHQRWH[HFXWHGDSSURSULDWHO\DV\RX
YHVHW
‹0$OO5LJKWV5HVHUYHG
3M™ Digital Projector X31/X36/X46
3. Web Control
3.8 Date/Time Settings
'LVSOD\VDQGFRQ¿JXUHVWKHGDWHDQGWLPHVHWWLQJV
Item
Description
Current Date
&RQ¿JXUHVWKHFXUUHQWGDWHLQyear/month/day format.
Current Time
&RQ¿JXUHVWKHFXUUHQWWLPHLQhour:minute:second format.
Daylight Savings Time
&OLFNWKH[ON] check box to enable daylight savings time and
set the following items.
&RQ¿JXUHVWKHGDWHDQGWLPHGD\OLJKWVDYLQJVWLPHEHJLQV
Start
Month
&RQ¿JXUHVWKHPRQWKGD\OLJKWVDYLQJVWLPHEHJLQVa
Week
&RQ¿JXUHVWKHZHHNRIWKHPRQWKGD\OLJKWVDYLQJVWLPH
EHJLQV)LUVW/DVW
Day
&RQ¿JXUHVWKHGD\RIWKHZHHNGD\OLJKWVDYLQJVWLPHEHJLQV
6XQ0RQ7XH:HG7KX)UL6DW
Time
hour
&RQ¿JXUHVWKHKRXUGD\OLJKWVDYLQJVWLPHEHJLQVa
minute
&RQ¿JXUHVWKHPLQXWHGD\OLJKWVDYLQJVWLPHEHJLQVa
&RQ¿JXUHVWKHGDWHDQGWLPHGD\OLJKWVDYLQJVWLPHHQGV
End
Month
&RQ¿JXUHVWKHPRQWKGD\OLJKWVDYLQJVWLPHHQGVa
Week
&RQ¿JXUHVWKHZHHNRIWKHPRQWKGD\OLJKWVDYLQJVWLPHHQGV
)LUVW/DVW
Day
&RQ¿JXUHVWKHGD\RIWKHZHHNGD\OLJKWVDYLQJVWLPHHQGV
6XQ0RQ7XH:HG7KX)UL6DW
Time
hour
&RQ¿JXUHVWKHKRXUGD\OLJKWVDYLQJVWLPHHQGVa
minute
&RQ¿JXUHVWKHPLQXWHGD\OLJKWVDYLQJVWLPHHQGVa
‹0$OO5LJKWV5HVHUYHG
3M™ Digital Projector X31/X36/X46
3. Web Control
3.8 Date/Time Settings (Continued)
Item
Description
Time difference
&RQ¿JXUHVWKHWLPHGLIIHUHQFH6HWWKHVDPHWLPHGLIIHUHQFH
as the one set on your computer. If unsure, consult your IT
manager.
SNTP
&OLFNWKH[ON]FKHFNER[WRUHWULHYH'DWHDQG7LPH
LQIRUPDWLRQIURPWKH6173VHUYHUDQGVHWWKHIROORZLQJLWHPV
&RQ¿JXUHVWKH6173VHUYHUDGGUHVVLQ,3IRUPDW
‡7KHDGGUHVVDOORZVQRWRQO\,3DGGUHVVEXWDOVRGRPDLQ
SNTP Server Address QDPHLIWKHYDOLG'16VHUYHULVVHWXSLQWKHNetwork
Settings. The maximum length of host or domain name is up
WRFKDUDFWHUV
Cycle
&RQ¿JXUHVWKHLQWHUYDODWZKLFKWRUHWULHYH'DWHDQG7LPH
LQIRUPDWLRQIURPWKH6173VHUYHUhour:minute).
&OLFNWKH[Apply] button to save the settings.
NOTE ‡7KHQHZFRQ¿JXUDWLRQVHWWLQJVDUHDFWLYDWHGDIWHUUHVWDUWLQJWKH
QHWZRUNFRQQHFWLRQ:KHQWKHFRQ¿JXUDWLRQVHWWLQJVDUHFKDQJHG\RXPXVW
UHVWDUWWKHQHWZRUNFRQQHFWLRQ<RXFDQUHVWDUWWKHQHWZRUNFRQQHFWLRQE\
clicking the [Network Restart] on the main menu.
‡,I\RXFRQQHFWWKHSURMHFWRUWRDQH[LVWLQJQHWZRUNFRQVXOWDQHWZRUN
administrator before setting server addresses.
‡7RHQDEOHWKH6173IXQFWLRQWKHWLPHGLIIHUHQFHPXVWEHVHW
‡7KHSURMHFWRUZLOOUHWULHYH'DWHDQG7LPHLQIRUPDWLRQIURPWKHWLPHVHUYHUDQG
RYHUULGHWLPHVHWWLQJVZKHQ6173LVHQDEOHG
‡7KHLQWHUQDOFORFN¶VWLPHPD\QRWUHPDLQDFFXUDWH8VLQJ6173LV
recommended to maintain accurate time.
‹0$OO5LJKWV5HVHUYHG
3M™ Digital Projector X31/X36/X46
3. Web Control
3.9 Security Settings
'LVSOD\VDQGFRQ¿JXUHVSDVVZRUGVDQGRWKHUVHFXULW\VHWWLQJV
Item
User Account
Description
&RQ¿JXUHVWKHXVHUQDPHDQGSDVVZRUG
User name
&RQ¿JXUHVWKHXVHUQDPH
The length of the text can be up to 32 alphanumeric
characters.
Password
&RQ¿JXUHVWKHSDVVZRUG
7KHOHQJWKRIWKHWH[WFDQEHXSWRDOSKDQXPHULF
characters.
Re-enter Password
5HHQWHUWKHDERYHSDVVZRUGIRUYHUL¿FDWLRQ
Network Control
&RQ¿JXUHVWKH$XWKHQWLFDWLRQSDVVZRUGIRUWKHFRPPDQG
control.
Authentication
Password
&RQ¿JXUHVWKH$XWKHQWLFDWLRQSDVVZRUG7KHOHQJWKRIWKH
text can be up to 32 alphanumeric characters.
Re-enter
Authentication
Password
5HHQWHUWKHDERYHSDVVZRUGIRUYHUL¿FDWLRQ
SNMP
Community name
&RQ¿JXUHVWKHFRPPXQLW\QDPHLI6103LVXVHG
&RQ¿JXUHVWKHFRPPXQLW\QDPH7KHOHQJWKRIWKHWH[WFDQ
be up to 64 alphanumeric characters.
&OLFNWKH[Apply@EXWWRQWRVDYHWKHVHWWLQJV
NOTE ‡7KHQHZFRQ¿JXUDWLRQVHWWLQJVDUHDFWLYDWHGDIWHUUHVWDUWLQJWKH
QHWZRUNFRQQHFWLRQ:KHQWKHFRQ¿JXUDWLRQVHWWLQJVDUHFKDQJHG\RXPXVW
UHVWDUWWKHQHWZRUNFRQQHFWLRQ<RXFDQUHVWDUWWKHQHWZRUNFRQQHFWLRQE\
clicking the [Network Restart] on the main menu.
‡2QO\QXPEHUVµ¶DQGDOSKDEHWµD]¶µ$=¶FDQEHXVHG
‹0$OO5LJKWV5HVHUYHG
3M™ Digital Projector X31/X36/X46
3. Web Control
3.10 Projector Control
The items shown in the table below can be
SHUIRUPHGXVLQJWKH3URMHFWRU&RQWUROPHQX
6HOHFWDQLWHPZLWKWKHPRXVH
0RVWRIWKHLWHPVKDYHDVXEPHQX5HIHUWRWKH
table below for details.
NOTE ‡7KHVHWWLQJYDOXHPD\QRWPDWFKZLWKWKHDFWXDOYDOXHLIWKHXVHU
changes the value manually. In that case, please refresh the page by clicking
the [Refresh] button.
&RQWUROVWKHSURMHFWRU
Item
Description
MAIN
POWER
INPUT SOURCE
PICTURE MODE
BLANK ON/OFF
MUTE
FREEZE
7XUQVWKHSRZHURQRII
6HOHFWVWKHLQSXWVRXUFH
6HOHFWVWKHSLFWXUHPRGHVHWWLQJ
7XUQV%ODQNRQRII
7XUQV0XWHRQRII
7XUQV)UHH]HRQRII
&RQWUROVWKHPDJQLI\VHWWLQJ
MAGNIFY
,QVRPHLQSXWVLJQDOVRXUFHVLWPLJKWVWRS³0DJQLI\´HYHQ
though it does not reach to maximum setting value.
MAGNIFY POSITION V Adjusts the vertical magnify position.
MAGNIFY POSITION H $GMXVWVWKHKRUL]RQWDOPDJQLI\SRVLWLRQ
TEMPLATE
7XUQVWHPSODWHRQRII
MY IMAGE
6HOHFWV0<,0$*(GDWD
MY IMAGE DELETE
'HOHWHV0<,0$*(GDWD
‹0$OO5LJKWV5HVHUYHG
3M™ Digital Projector X31/X36/X46
3. Web Control
3.10 Projector Control (Continued)
Item
PICTURE
BRIGHTNESS
CONTRAST
GAMMA
COLOR TEMP
COLOR
TINT
SHARPNESS
ACTIVE IRIS
MYMEMORY SAVE
MYMEMORY RECALL
IMAGE
ASPECT
OVER SCAN
V POSITION
H POSITION
H PHASE
H SIZE
AUTO ADJUST
EXECUTE
INPUT
PROGRESSIVE
VIDEO NR
COLOR SPACE
COMPONENT
S-VIDEO FORMAT
C-VIDEO FORMAT
HDMI FORMAT
HDMI RANGE
COMPUTER IN1
COMPUTER IN2
FRAME LOCK COMPUTER IN1
FRAME LOCK COMPUTER IN2
FRAME LOCK - HDMI
62
Description
Adjusts the brightness setting.
Adjusts the contrast setting.
6HOHFWVWKHJDPPDVHWWLQJ
6HOHFWVWKHFRORUWHPSHUDWXUHVHWWLQJ
Adjusts the color setting.
Adjusts the tint setting.
Adjusts the sharpness setting.
6HOHFWVWKHDFWLYHLULVVHWWLQJ
6DYHVWKH0\0HPRU\GDWD
5HFDOOVWKH0\0HPRU\GDWD
6HOHFWVWKHDVSHFWVHWWLQJ
Adjusts the over scan setting.
Adjusts the vertical position.
$GMXVWVWKHKRUL]RQWDOSRVLWLRQ
$GMXVWVWKHKRUL]RQWDOSKDVH
$GMXVWVWKHKRUL]RQWDOVL]H
3HUIRUPVWKHDXWRPDWLFDGMXVWPHQW
6HOHFWVWKHSURJUHVVLYHVHWWLQJ
6HOHFWVWKHYLGHRQRLVHUHGXFWLRQVHWWLQJ
6HOHFWVWKHFRORUVSDFH
6HOHFWVWKHCOMPONENT port setting.
6HOHFWVWKHVYLGHRIRUPDWVHWWLQJ
6HOHFWVWKHYLGHRIRUPDWVHWWLQJ
6HOHFWVWKH+'0,IRUPDWVHWWLQJ
6HOHFWVWKH+'0,UDQJHVHWWLQJ
6HOHFWVWKHCOMPUTER IN1 input signal type.
6HOHFWVWKHCOMPUTER IN2 input signal type.
7XUQVWKH)5$0(/2&.&20387(5,1IXQFWLRQRQRII
7XUQVWKH)5$0(/2&.&20387(5,1IXQFWLRQRQRII
7XUQVWKH)5$0(/2&.+'0,IXQFWLRQRQRII
‹0$OO5LJKWV5HVHUYHG
3M™ Digital Projector X31/X36/X46
3. Web Control
3.10 Projector Control (Continued)
Item
SETUP
AUTO KEYSTONE
EXECUTE
KEYSTONE V
AUTO ECO MODE
ECO MODE
MIRROR
STANDBY MODE
MONITOR OUT COMPUTER IN1
MONITOR OUT COMPUTER IN2
Description
3HUIRUPVWKHDXWRPDWLFNH\VWRQHGLVWRUWLRQVHWWLQJ
Adjusts the vertical keystone distortion setting.
7XUQVRQRIIWKHDXWRPDWLFHFRPRGHIXQFWLRQ
6HOHFWVWKHHFRPRGH
6HOHFWVWKHPLUURUVWDWXV
6HOHFWVWKHVWDQGE\PRGH
Assigns the MONITOR OUT when the COMPUTER IN1 input
port is selected.
Assigns the MONITOR OUT when the COMPUTER IN2 input
port is selected.
Assigns the MONITOR OUT when the LAN input port is
MONITOR OUT - LAN
selected.
MONITOR OUT - USB Assigns the MONITOR OUT when the USB TYPE A input
TYPE A
port is selected.
MONITOR OUT - USB Assigns the MONITOR OUT when the USB TYPE B input
TYPE B
port is selected.
MONITOR OUT Assigns the MONITOR OUT when the HDMI input port is
HDMI
selected.
MONITOR OUT Assigns the MONITOR OUT when the COMPONENT input
COMPONENT
port is selected.
MONITOR OUT Assigns the MONITOR OUT when the S-VIDEO input port is
S-VIDEO
selected.
MONITOR OUT Assigns the MONITOR OUT when the VIDEO input port is
VIDEO
selected.
MONITOR OUT Assigns the MONITOR OUT in the standby mode.
STANDBY
‹0$OO5LJKWV5HVHUYHG
63
3M™ Digital Projector X31/X36/X46
3. Web Control
3.10 Projector Control (Continued)
Item
AUDIO
VOLUME
SPEAKER
AUDIO SOURCE COMPUTER IN1
AUDIO SOURCE COMPUTER IN2
AUDIO SOURCE LAN
AUDIO SOURCE USB TYPE A
AUDIO SOURCE USB TYPE B
AUDIO SOURCE HDMI
AUDIO SOURCE COMPONENT
AUDIO SOURCE S-VIDEO
AUDIO SOURCE VIDEO
AUDIO SOURCE STANDBY
HDMI AUDIO
MIC LEVEL
MIC VOLUME
SCREEN
LANGUAGE
MENU POSITION V
MENU POSITION H
BLANK
START UP
MyScreen LOCK
MESSAGE
TEMPLATE
C.C. - DISPLAY
C.C. - MODE
C.C. - CHANNEL
64
Description
Adjusts the volume setting.
7XUQVWKHEXLOWLQVSHDNHURQRII
$VVLJQVWKH$8',26285&(COMPUTER IN1 input port.
$VVLJQVWKH$8',26285&(COMPUTER IN2 input port.
$VVLJQVWKH$8',26285&(LAN input port.
$VVLJQVWKH$8',26285&(USB TYPE A input port.
$VVLJQVWKH$8',26285&(USB TYPE B input port.
$VVLJQVWKH$8',26285&(HDMI input port.
$VVLJQVWKH$8',26285&(COMPONENT input port.
$VVLJQVWKH$8',26285&(S-VIDEO input port.
$VVLJQVWKH$8',26285&(VIDEO input port.
$VVLJQVWKH$8',26285&(LQWKHVWDQGE\PRGH
6HOHFWVWKH+'0,DXGLRVHWWLQJ
6HOHFWVWKHPLFURSKRQHOHYHO
Adjusts the microphone volume setting.
6HOHFWVWKHODQJXDJHIRUWKH26'
$GMXVWVWKHYHUWLFDO0HQXSRVLWLRQ
$GMXVWVWKHKRUL]RQWDO0HQXSRVLWLRQ
6HOHFWVWKH%ODQNPRGH
6HOHFWVWKHVWDUWXSVFUHHQPRGH
7XUQV0\6FUHHQORFNIXQFWLRQRQRII
7XUQVWKHPHVVDJHIXQFWLRQRQRII
6HOHFWVWKHWHPSODWHVHWWLQJ
6HOHFWV&ORVHG&DSWLRQ',63/$<VHWWLQJ
6HOHFWV&ORVHG&DSWLRQ02'(VHWWLQJ
6HOHFWV&ORVHG&DSWLRQ&+$11(/VHWWLQJ
‹0$OO5LJKWV5HVHUYHG
3M™ Digital Projector X31/X36/X46
3. Web Control
3.10 Projector Control (Continued)
Item
OPTION
AUTO SEARCH
AUTO KEYSTONE
DIRECT POWER ON
AUTO POWER OFF
USB TYPE B
MY BUTTON-1
MY BUTTON-2
MY SOURCE
REMOTE FREQ. NORMAL
REMOTE FREQ. HIGH
Description
7XUQVWKHDXWRPDWLFVLJQDOVHDUFKIXQFWLRQRQRII
Turns the automatic keystone distortion correction function
RQRII
7XUQVWKHGLUHFWSRZHURQIXQFWLRQRQRII
&RQ¿JXUHVWKHWLPHUWRVKXWRIIWKHSURMHFWRUZKHQQRVLJQDO
is detected.
6HOHFWVWKH86%7<3(%VHWWLQJ
Assigns the functions for the MY BUTTON-1 button on the
included remote control.
Assigns the functions for the MY BUTTON-2 button on the
included remote control.
6HOHFWVWKH0\6RXUFHVHWWLQJ
7XUQVWKHUHPRWHFRQWUROVLJQDOIUHTXHQF\QRUPDOIXQFWLRQ
RQRII
7XUQVWKHUHPRWHFRQWUROVLJQDOIUHTXHQF\KLJKIXQFWLRQRQ
off.
‹0$OO5LJKWV5HVHUYHG
3M™ Digital Projector X31/X36/X46
3. Web Control
3.10 Projector Control (Continued)
The items shown in the table below can be
performed using the Projector Control menu.
&OLFNWKH[QUIT PRESENTER MODE].
Item
Description
SERVICE
QUIT PRESENTER
MODE
66
([LWIURPWKH3UHVHQWHUPRGH
‹0$OO5LJKWV5HVHUYHG
3M™ Digital Projector X31/X36/X46
3. Web Control
3.11 Remote Control
<RXFDQXVH\RXU:HEEURZVHUWRFRQWUROWKH
projector.
‡'RQRWDWWHPSWWRFRQWUROWKHSURMHFWRUZLWK
WKHSURMHFWRU¶VUHPRWHFRQWURODQGYLD\RXU:HE
browser at the same time. It may cause some
operational errors in the projector.
7KHIXQFWLRQVRQWKHEXQGOHGUHPRWHFRQWURODUHDVVLJQHGWRWKH:HE5HPRWH
&RQWUROVFUHHQ
Item
Description
POWER
Assigned the same operation as STANDBY/ON button.
COMPUTER
Assigned the same operation as COMPUTER button.
VIDEO
Assigned the same operation as VIDEO button.
BLANK
Assigned the same operation as BLANK button.
FREEZE
Assigned the same operation as FREEZE button.
MUTE
Assigned the same operation as MUTE button.
MENU
Assigned the same operation as MENU button.
Ÿ
$VVLJQHGWKHVDPHRSHUDWLRQDVŸEXWWRQ
ź
$VVLJQHGWKHVDPHRSHUDWLRQDVźEXWWRQ
Ż
$VVLJQHGWKHVDPHRSHUDWLRQDVŻEXWWRQ
Ź
$VVLJQHGWKHVDPHRSHUDWLRQDVŹEXWWRQ
ENTER
Assigned the same operation as ENTER button.
RESET
Assigned the same operation as RESET button.
PAGE UP
Assigned the same operation as PAGE UP button.
PAGE DOWN
Assigned the same operation as PAGE DOWN button.
SLIDESHOW
6WDUWVWKH6OLGHVKRZ
NOTE ‡7KH:HE5HPRWH&RQWUROGRHVQRWVXSSRUWUHSHDWIXQFWLRQWKDW
performs an action while holding a button clicked down.
‡6LQFHWKHUHSHDWIXQFWLRQLVQRWDYDLODEOHFOLFNWKHEXWWRQUHSHDWHGO\DVPDQ\
WLPHVDV\RXUHTXLUH
‡(YHQLI\RXKROGWKHEXWWRQFOLFNHGGRZQIRUDZKLOHWKH:HE5HPRWH&RQWURO
VHQGV\RXUUHTXHVWFRPPDQGRQHWLPHRQO\5HOHDVHWKHEXWWRQWKHQFOLFNLWDJDLQ
‡When the [POWER]EXWWRQLVSXVKHGDPHVVDJHZLQGRZFRPHVXSWRFRQ¿UP
the operation. To control the power, push [OK], otherwise push [Cancel].
‡7KH[PAGE DOWN] and [PAGE UP]EXWWRQVRQWKH:HE5HPRWH&RQWURO
cannot be used as mouse emulation function of the projector.
‹0$OO5LJKWV5HVHUYHG
67
3M™ Digital Projector X31/X36/X46
3. Web Control
3.12 Projector Status
'LVSOD\VDQGFRQ¿JXUHVWKHFXUUHQWSURMHFWRUVWDWXV
Item
Description
Error Status
'LVSOD\VWKHFXUUHQWHUURUVWDWXV
Lamp Time
'LVSOD\VWKHXVDJHWLPHIRUWKHFXUUHQWODPS
Filter Time
'LVSOD\VWKHXVDJHWLPHIRUWKHFXUUHQW¿OWHU
Power Status
'LVSOD\VWKHFXUUHQWSRZHUVWDWXV
Input Status
'LVSOD\VWKHFXUUHQWLQSXWVLJQDOVRXUFH
Blank On/Off
'LVSOD\VWKHFXUUHQW%ODQNRQRIIVWDWXV
Mute
'LVSOD\VWKHFXUUHQW0XWHRQRIIVWDWXV
Freeze
'LVSOD\VWKHFXUUHQW)UHH]HVWDWXV
68
‹0$OO5LJKWV5HVHUYHG
3M™ Digital Projector X31/X36/X46
3. Web Control
3.13 Network Restart
5HVWDUWVWKHSURMHFWRU¶VQHWZRUNFRQQHFWLRQ
Item
Restart
Description
5HVWDUWVWKHSURMHFWRU¶VQHWZRUNFRQQHFWLRQLQRUGHUWR
DFWLYDWHQHZFRQ¿JXUDWLRQVHWWLQJV
NOTE ‡5HVWDUWLQJUHTXLUHV\RXWRUHORJRQLQRUGHUWRIXUWKHUFRQWURORU
FRQ¿JXUHWKHSURMHFWRUYLDDZHEEURZVHU:DLWVHFRQGVRUPRUHDIWHU
clicking the [Restart] button to log on again.
‹0$OO5LJKWV5HVHUYHG
69
3M™ Digital Projector X31/X36/X46
4. My Image Function
0\,PDJH)XQFWLRQ
The projector can display still images that are transferred via the network.
Transfer image data
'LVSOD\LPDJHGDWD 1 4 )
0<,0$*(WUDQVPLVVLRQUHTXLUHVDQH[FOXVLYHDSSOLFDWLRQIRU\RXUFRPSXWHU
³3-,PJ3URMHFWRU,PDJH7RRO´LVQHFHVVDU\WRXVH0<,0$*(WUDQVPLVVLRQ
,WFDQEHGRZQORDGHGIURPWKH0:HEVLWHKWWSZZZPFRPPHHWLQJV
5HIHUWRWKHPDQXDOIRUWKHDSSOLFDWLRQIRULQVWUXFWLRQV
7RGLVSOD\WKHWUDQVIHUUHGLPDJHVHOHFWWKH0<,0$*(LWHPLQWKH1(7:25.
PHQX)RUPRUHLQIRUPDWLRQSOHDVHVHHWKHGHVFULSWLRQRIWKH0<,0$*(LWHPRI
WKH1(7:25.PHQXNETWORK menu in Operator's Guide)
NOTE ‡,WLVSRVVLEOHWRDOORFDWHWKHLPDJH¿OHXSWRPD[LPXP
‡8VLQJMY BUTTONWKDWUHJLVWHUHG0<,0$*(FDQGLVSOD\WUDQVIHUUHGLPDJH
(OPTION menu in the Operator's Guide)
‡7KHLPDJH¿OHDOVRFDQEHGLVSOD\HGE\XVLQJVFKHGXOHIXQFWLRQIURPWKHZHE
EURZVHU5HIHUWRLWHP7.3 Event Scheduling (81) in detail.
‡,I\RXGLVSOD\0<,0$*(GDWDRQVFUHHQZKLOH\RXDUHXVLQJWKH86%'LVSOD\
IXQFWLRQWKHDSSOLFDWLRQIRUWKH86%'LVSOD\ZLOOEHFORVHG7RUHVWDUWWKH
DSSOLFDWLRQH[LWWKH0<,0$*(IXQFWLRQDQGWKHQWKHVRIWZDUHLQWKHSURMHFWRU
/LYH9LHZHU/LWH86%H[HZLOOUXQDJDLQUSB Display in the Operator's
Guide)
‹0$OO5LJKWV5HVHUYHG
3M™ Digital Projector X31/X36/X46
4. My Image Function
4. My Image Function (Continued)
&RQ¿JXUHWKHIROORZLQJLWHPVIURPDZHEEURZVHUZKHQ0<,0$*(IXQFWLRQLV
used.
Example,IWKH,3DGGUHVVRIWKHSURMHFWRULVVHWWR 192.168.1.10:
(QWHU"http://192.168.1.10/" into the address bar of the web browser.
2) Enter your user name and password, and then
click the [OK].
&OLFNWKH[Port Settings] on the main menu.
&OLFNWKH[Enable] check box to open the My
Image Port (Port: 9716)&OLFNWKH[Enable]
check box for the [Authentication] setting
ZKHQDXWKHQWLFDWLRQLVUHTXLUHGRWKHUZLVH
clear the check box.
&OLFNWKH[Apply] button to save the settings.
:KHQWKHDXWKHQWLFDWLRQVHWWLQJLVHQDEOHGWKHIROORZLQJVHWWLQJVDUHUHTXLUHG
&OLFNWKH[Security Settings] on the main menu.
6HOHFWWKH[Network Control] and enter the desired authentication password.
&OLFNWKH[Apply] button to save the settings.
NOTE ‡7KH$XWKHQWLFDWLRQ3DVVZRUGZLOOEHWKHVDPHIRUNetwork Control
Port1 (Port: 23), Network Control Port2 (Port: 9715), PJLink™ Port (Port:
4352), My Image Port (Port: 9716) and Messenger Port (Port: 9719).
‡7KHQHZFRQ¿JXUDWLRQVHWWLQJVDUHDFWLYDWHGDIWHUUHVWDUWLQJWKHQHWZRUN
FRQQHFWLRQ:KHQWKHFRQ¿JXUDWLRQVHWWLQJVDUHFKDQJHG\RXPXVWUHVWDUWWKH
QHWZRUNFRQQHFWLRQ<RXFDQUHVWDUWWKHQHWZRUNFRQQHFWLRQE\FOLFNLQJWKH
[Network Restart] on the main menu.
‹0$OO5LJKWV5HVHUYHG
3M™ Digital Projector X31/X36/X46
5. Messenger Function
0HVVHQJHU)XQFWLRQ
The projector can display the text data transferred via the network on the screen.
The text data can be displayed on the screen in two ways that displays the text
transferred from the computer on real time, and the other chooses and displays
the text data from the ones once stored in the projector.
Transfer text data
1
2
3
4
'LVSOD\WH[WGDWDH[ 4 )
0HVVHQJHUIXQFWLRQUHTXLUHVDQH[FOXVLYHDSSOLFDWLRQIRU\RXUFRPSXWHU7R
HGLWWUDQVIHUDQGGLVSOD\WKHWH[WGDWDXVHWKHDSSOLFDWLRQ<RXFDQGRZQORDG
LWIURPWKH0:HEVLWHKWWSZZZPFRPPHHWLQJV5HIHUWRWKHPDQXDO
IRUWKHDSSOLFDWLRQIRUWKHGHWDLOVRI0HVVHQJHUIXQFWLRQDQGLQVWUXFWLRQVRIWKH
application.
NOTE ‡,WLVSRVVLEOHWRVWRUHWKHWH[WGDWDXSWRPD[LPXP
‡8VLQJMY BUTTONWKDWUHJLVWHUHG0(66(1*(5FDQWXUQWKHGLVSOD\LQJ
PHVVHQJHUWH[WRQRII(OPTION menu in the Operator's Guide)
‡7KHWH[W¿OHDOVRFDQEHGLVSOD\HGE\XVLQJVFKHGXOHIXQFWLRQYLDWKHZHE
EURZVHU5HIHUWRLWHP7.3 Event Scheduling (81) for the detail.
72
‹0$OO5LJKWV5HVHUYHG
3M™ Digital Projector X31/X36/X46
5. Messenger Function
5. Messenger Function (Continued)
&RQ¿JXUHWKHIROORZLQJLWHPVIURPDZHEEURZVHUZKHQ0HVVHQJHUIXQFWLRQLV
used.
Example,IWKH,3DGGUHVVRIWKHSURMHFWRULVVHWWR 192.168.1.10:
(QWHU"http://192.168.1.10/" into the address bar of the web browser.
2) Enter your user name and password, and then
click the [OK].
&OLFNWKH[Port Settings] on the main menu.
&OLFNWKH[Enable] check box to open the
Messenger Port (Port: 9719)&OLFNWKH
[Enable] check box for the [Authentication]
VHWWLQJZKHQDXWKHQWLFDWLRQLVUHTXLUHG
otherwise clear the check box.
&OLFNWKH[Apply] button to save the settings.
:KHQWKHDXWKHQWLFDWLRQVHWWLQJLVHQDEOHGWKHIROORZLQJVHWWLQJVDUHUHTXLUHG
&OLFNWKH[Security Settings] on the main menu.
6HOHFWWKH[Network Control] and enter the desired authentication password.
&OLFNWKH[Apply] button to save the settings.
NOTE ‡7KH$XWKHQWLFDWLRQ3DVVZRUGZLOOEHWKHVDPHIRUNetwork Control
Port1 (Port: 23), Network Control Port2 (Port: 9715), PJLink™ Port (Port:
4352), My Image Port (Port: 9716) and Messenger Port (Port: 9719).
‡7KHQHZFRQ¿JXUDWLRQVHWWLQJVDUHDFWLYDWHGDIWHUUHVWDUWLQJWKHQHWZRUN
FRQQHFWLRQ:KHQWKHFRQ¿JXUDWLRQVHWWLQJVDUHFKDQJHG\RXPXVWUHVWDUWWKH
QHWZRUNFRQQHFWLRQ<RXFDQUHVWDUWWKHQHWZRUNFRQQHFWLRQE\FOLFNLQJWKH
[Network Restart] on the main menu.
‹0$OO5LJKWV5HVHUYHG
73
3M™ Digital Projector X31/X36/X46
6. Network Bridge Function
1HWZRUN%ULGJH)XQFWLRQ
7KLVSURMHFWRULVHTXLSSHGZLWKWKH1(7:25.%5,'*(IXQFWLRQWRSHUIRUP
mutual conversion of a network protocol and a serial interface.
8VLQJWKH1(7:25.%5,'*(IXQFWLRQDFRPSXWHUWKDWLVFRQQHFWHGZLWK
this projector by Ethernet communication can control an external device that is
FRQQHFWHGZLWKWKLVSURMHFWRUE\56&FRPPXQLFDWLRQDVDQHWZRUNWHUPLQDO
7&3,3GDWD
3URWRFROFKDQJH
Ethernet
/$1FDEOH
&RPSXWHU
LAN port
6HULDOGDWD
56&
56&FDEOH
External device
CONTROL port
6.1 Connecting devices
&RQQHFWWKHSURMHFWRU¶VLANSRUWDQGWKHFRPSXWHU¶V/$1SRUWZLWKD/$1
cable, for Ethernet communication.
&RQQHFWWKHSURMHFWRU¶VCONTROL SRUWDQGWKHGHYLFH¶V56&SRUWZLWK
DQ56&FDEOHIRU56&FRPPXQLFDWLRQ
NOTE ‡%HIRUHFRQQHFWLQJWKHGHYLFHVUHDGWKHPDQXDOVIRUWKHGHYLFHVWR
ensure the connection.
)RU56&FRQQHFWLRQFKHFNWKHVSHFL¿FDWLRQVRIHDFKSRUWDQGXVHWKH
suitable cable. (“Connection to the ports” in the Operator's Guide
TECHNICAL)
74
‹0$OO5LJKWV5HVHUYHG
3M™ Digital Projector X31/X36/X46
6. Network Bridge Function
6.2 Communication setup
7RFRQ¿JXUHWKHVHWXSRIWKHFRPPXQLFDWLRQXVLQJ1(7:25.%5,'*(IRU
WKHSURMHFWRUXVHLWHPVLQWKH&20081,&$7,21PHQX2SHQWKHPHQXRI
WKHSURMHFWRUDQGVHOHFWWKH237,216(59,&(&20081,&$7,21PHQX
(OPTION menu – SERVICE – COMMUNICATION in the Operator's Guide)
8VLQJWKH&20081,&$7,217<3(PHQXVHOHFWWKH1(7:25.%5,'*(
for the CONTROL port.
8VLQJWKH6(5,$/6(77,1*6PHQXVHOHFWWKHSURSHUEDXGUDWHDQGSDULW\
for the CONTROLSRUWDFFRUGLQJWRWKHVSHFL¿FDWLRQRIWKH56&SRUWRI
the connected device.
Item
%$8'5$7(
3$5,7<
Condition
ESVESVESVESV
121(2''(9(1
'DWDOHQJWK
ELW¿[HG
6WDUWELW
ELW¿[HG
6WRSELW
ELW¿[HG
8VLQJWKH75$160,66,210(7+2'PHQXVHWXSWKHSURSHUPHWKRGIRUWKH
CONTROL port according to your use.
NOTE ‡7KH2))LVVHOHFWHGIRUWKH&20081,&$7,217<3(DVWKHGHIDXOW
setting.
‡8VLQJWKH&20081,&$7,21PHQXVHWXSWKHFRPPXQLFDWLRQ5HPHPEHU
that an unsuitable setup could cause malfunction of communication.
‡:KHQ&20081,&$7,217<3(LVVHWWR1(7:25.%5,'*(WKHCONTROL
SRUWGRHVQ
WDFFHSW56&FRPPDQGV
6.3 Communication port
)RUWKH1(7:25.%5,'*(IXQFWLRQVHQGWKHGDWDIURPWKHFRPSXWHUWRWKH
projector with using the Network Bridge PortWKDWLVFRQ¿JXUHGLQWKH³3RUW
6HWWLQJV´RIZHEEURZVHU50)
NOTE ‡([FHSWIRUEHWZHHQ
DQGFDQEHVHWXSDVWKHNetwork Bridge PortQXPEHU,WLVVHWWR
as the default setting.
‹0$OO5LJKWV5HVHUYHG
3M™ Digital Projector X31/X36/X46
6. Network Bridge Function
6.4 Transmission method
The transmission method can be selected from the menus, only when the
1(7:25.%5,'*(LVVHOHFWHGIRUWKH&20081,&$7,217<3(
(OPTION menu – SERVICE – COMMUNICATION in the Operator's Guide)
+$/)'83/(;)8//'83/(;
6.4.1 HALF-DUPLEX
This method lets the projector make two way communication, but only one
direction, either transmitting or receiving data, is allowed at a time.
The method does not allow the projector to receive the data from the computer
while waiting for response data from an external device. After the projector
receives the response data from an external device or the response limit time is
past, the projector can receive the data from the computer.
That means that the projector controls transmitting and receiving the data to
V\QFKURQL]HWKHFRPPXQLFDWLRQ
7RXVHWKH+$/)'83/(;PHWKRGVHWXSWKH5(63216(/,0,77,0(IROORZLQJ
the instructions below.
7&3,3GDWD
Ethernet
/$1FDEOH
&RPSXWHU
3URWRFROFKDQJH
6HULDOGDWD
56&
56&FDEOH
External device
Transmitting data
Transmitting data
'LVFDUGLQJGDWD
5HVSRQVHGDWD
5HVSRQVHOLPLW
time
5HVSRQVHGDWD
Transmitting data
8VLQJWKH5(63216(/,0,77,0(PHQXVHWWKHZDLWLQJWLPHIRUUHVSRQVHGDWD
from an external device. (OPTION menu – SERVICE – COMMUNICATION
in the Operator's Guide)
2))V 2s 3s (2))
76
‹0$OO5LJKWV5HVHUYHG
3M™ Digital Projector X31/X36/X46
6. Network Bridge Function
6.4 Transmission method (Continued)
NOTE ‡:LWKXVLQJWKH+$/)'83/(;PHWKRGWKHSURMHFWRUFDQVHQGRXW
E\WHGDWDDVPD[LPXPDWRQFH
‡,ILWLVQRWUHTXLUHGWRPRQLWRUWKHUHVSRQVHGDWDIURPDQH[WHUQDOGHYLFHDQG
WKH5(63216(/,0,77,0(LVVHWWR2))WKHSURMHFWRUFDQUHFHLYHWKHGDWD
from the computer and send it out to an external device continuously.
7KH2))LVVHOHFWHGDVWKHGHIDXOWVHWWLQJ
6.4.2 FULL-DUPLEX
This method lets the projector make two way communication, transmitting and
receiving data at the same time, without monitoring response data from an
external device.
With using this method, the computer and an external device will send the data
RXWRIV\QFKURQL]DWLRQ,ILWLVUHTXLUHGWRV\QFKURQL]HWKHPVHWWKHFRPSXWHUWR
PDNHWKHV\QFKURQL]DWLRQ
‹0$OO5LJKWV5HVHUYHG
77
3M™ Digital Projector X31/X36/X46
7. Other Functions
2WKHU)XQFWLRQV
7.1 E-mail Alerts
7KHSURMHFWRUFDQDXWRPDWLFDOO\VHQGDQDOHUWPHVVDJHWRWKHVSHFL¿HGHPDLO
DGGUHVVHVZKHQWKHSURMHFWRUGHWHFWVDFHUWDLQFRQGLWLRQWKDWLVUHTXLULQJ
maintenance or detected an error.
NOTE ‡8SWR¿YHHPDLODGGUHVVHVFDQEHVSHFL¿HG
‡7KHSURMHFWRUPD\EHQRWDEOHWRVHQGHPDLOLIWKHSURMHFWRUVXGGHQO\ORVHV
power.
Mail Settings (52)
7RXVHWKHSURMHFWRU¶VHPDLODOHUWIXQFWLRQSOHDVHFRQ¿JXUHWKHIROORZLQJLWHPV
through a web browser.
Example,IWKH,3DGGUHVVRIWKHSURMHFWRULVVHWWR192.168.1.10:
(QWHU“http://192.168.1.10/” into the address bar of the web browser.
2) Enter your user name and password, and then click the [OK].
&OLFNWKH[Mail Settings]DQGFRQ¿JXUHHDFKLWHP5HIHUWRLWHP3.5 Mail
Settings (52) for further information.
&OLFNWKH[Apply] button to save the settings.
NOTE ‡&OLFNWKH[Send Test Mail] button in the [Mail Settings]WRFRQ¿UP
WKDWWKHHPDLOVHWWLQJVDUHFRUUHFW7KHIROORZLQJPDLOZLOOEHGHOLYHUHGWRWKH
VSHFL¿HGDGGUHVVHV
6XEMHFWOLQH 7HVW0DLO
7H[W
6HQG7HVW0DLO
'DWH
Time
,3$GGUHVV
0$&$GGUHVV
78
3URMHFWRUQDPH!
7HVWLQJGDWH!
<Testing time>
3URMHFWRU,3DGGUHVV!
3URMHFWRU0$&DGGUHVV!
‹0$OO5LJKWV5HVHUYHG
3M™ Digital Projector X31/X36/X46
7. Other Functions
7.1 E-mail Alerts (Continued)
&OLFNWKH[Alert Settings]RQWKHPDLQPHQXWRFRQ¿JXUHWKH(PDLO$OHUWV
settings.
6HOHFWDQGFRQ¿JXUHHDFKDOHUWLWHP5HIHUWRLWHP3.6 Alert Setting (53) for
further information.
&OLFNWKH[Apply] button to save the settings.
)DLOXUH:DUQLQJHPDLOVDUHIRUPDWWHGDVIROORZV
6XEMHFWOLQH
7H[W
0DLOWLWOH!
0DLOWH[W!
'DWH
7LPH
,3$GGUHVV
0$&$GGUHVV
3URMHFWRUQDPH!
)DLOXUH:DUQLQJGDWH!
)DLOXUH:DUQLQJWLPH!
3URMHFWRU,3DGGUHVV!
3URMHFWRU0$&DGGUHVV!
‹0$OO5LJKWV5HVHUYHG
79
3M™ Digital Projector X31/X36/X46
7. Other Functions
7.2 Projector Management using SNMP
7KH61036LPSOH1HWZRUN0DQDJHPHQW3URWRFROHQDEOHVWRPDQDJHWKH
projector information, which is a failure or warning status, from the computer on
WKHQHWZRUN7KH6103PDQDJHPHQWVRIWZDUHZLOOEHUHTXLUHGRQWKHFRPSXWHU
to use this function.
NOTE ‡,WLVUHFRPPHQGHGWKDW6103IXQFWLRQVEHFDUULHGRXWE\DQHWZRUN
administrator.
‡6103PDQDJHPHQWVRIWZDUHPXVWEHLQVWDOOHGRQWKHFRPSXWHUWRPRQLWRU
WKHSURMHFWRUYLD6103
SNMP Settings (50)
&RQ¿JXUHWKHIROORZLQJLWHPVYLDDZHEEURZVHUWRXVH6103
Example,IWKH,3DGGUHVVRIWKHSURMHFWRULVVHWWR192.168.1.10:
(QWHU“http://192.168.1.10/” into the address bar of the web browser.
2) Enter your user name and password, and then click the [OK].
&OLFNWKH[Port Settings] on the main menu.
&OLFNWKH>'RZQORDG0,%¿OH@WRGRZQORDGD0,%¿OH
NOTE ‡7RXVHWKHGRZQORDGHG0,%¿OHVSHFLI\WKH¿OHE\\RXU6103
manager.
&OLFNWKH[Enable] check box to open the SNMP Port6HWWKH,3DGGUHVVWR
VHQGWKH6103WUDSWRZKHQD)DLOXUH:DUQLQJRFFXUV
NOTE ‡$1HWZRUN5HVWDUWLVUHTXLUHGDIWHUWKHSNMP PortFRQ¿JXUDWLRQ
VHWWLQJVKDYHEHHQFKDQJHG&OLFNWKH[Network Restart]DQGFRQ¿JXUHWKH
following items.
&OLFNWKH[Security Settings] on the main menu.
&OLFNWKH[SNMP] and set the community name on the screen that is displayed.
NOTE ‡$1HWZRUN5HVWDUWLVUHTXLUHGDIWHUWKHCommunity name has been
FKDQJHG&OLFNWKH[Network Restart]DQGFRQ¿JXUHWKHIROORZLQJLWHPV
&RQ¿JXUHWKHVHWWLQJVIRU7UDSWUDQVPLVVLRQRI)DLOXUHV:DUQLQJV&OLFNWKH
[Alert Settings]RQWKHPDLQPHQXDQGVHOHFWWKH)DLOXUH:DUQLQJLWHPWREH
FRQ¿JXUHG
&OLFNWKH[Enable]FKHFNER[WRVHQGRXWWKH6103WUDSIRU)DLOXUHV:DUQLQJV
&OHDUWKH[Enable]FKHFNER[ZKHQ6103WUDSWUDQVPLVVLRQLVQRWUHTXLUHG
&OLFNWKH[Apply] button to save the settings.
‹0$OO5LJKWV5HVHUYHG
3M™ Digital Projector X31/X36/X46
7. Other Functions
7.3 Event Scheduling
7KHVFKHGXOLQJIXQFWLRQHQDEOHVWRVHWXSVFKHGXOHGHYHQWVLQFOXGLQJSRZHURQ
SRZHURII,WHQDEOHVWREH³VHOIPDQDJHPHQW´SURMHFWRU
NOTE ‡<RXFDQVFKHGXOHWKHIROORZLQJFRQWUROHYHQWV3RZHU,QSXW6RXUFH
0\,PDJH0HVVHQJHU6OLGHVKRZ56)
‡7KHSRZHURQRIIHYHQWKDVWKHORZHVWSULRULW\DPRQJWKHDOOHYHQWVWKDWDUH
GH¿QHGDWWKHVDPHWLPH
‡7KHUHDUHW\SHVRI6FKHGXOLQJGDLO\ZHHNO\VSHFL¿FGDWH55)
‡7KHSULRULW\IRUVFKHGXOHGHYHQWVLVDVIROORZVVSHFL¿FGDWHZHHNO\
daily.
‡8SWR¿YHVSHFL¿FGDWHVDUHDYDLODEOHIRUVFKHGXOHGHYHQWV3ULRULW\LVJLYHQWR
those with the lower numbers when more than one event has been scheduled
IRUWKHVDPHGDWHDQGWLPHHJµ6SHFL¿FGDWH1R¶KDVSULRULW\RYHUµ6SHFL¿F
GDWH1R¶DQGVRRQ
‡%HVXUHWRVHWWKHGDWHDQGWLPHEHIRUHHQDEOLQJVFKHGXOHGHYHQWV58)
‹0$OO5LJKWV5HVHUYHG
3M™ Digital Projector X31/X36/X46
7. Other Functions
7.3 Event Scheduling(Continued)
Schedule Settings (55)
6FKHGXOHVHWWLQJVFDQEHFRQ¿JXUHGIURPDZHEEURZVHU
Example,IWKH,3DGGUHVVRIWKHSURMHFWRULVVHWWR192.168.1.10:
(QWHU“http://192.168.1.10/” into the address bar of the web browser.
2) Enter your user name and password, and then click the [OK].
&OLFNWKH[Schedule Settings]RQWKHPDLQPHQXDQGVHOHFWWKHUHTXLUHG
schedule item. For example, if you want to perform the command every
6XQGD\SOHDVHVHOHFWWKH[Sunday].
&OLFNWKH[Enable] check box to enable scheduling.
(QWHUWKHGDWHPRQWKGD\IRUVSHFL¿FGDWHVFKHGXOLQJ
&OLFNWKH[Apply] button to save the settings.
$IWHUFRQ¿JXUHWKHWLPHFRPPDQGDQGSDUDPHWHUVFOLFNWKH[Register] to add
the new event.
&OLFNWKH[Delete] button when you want to delete a schedule.
There are three types of scheduling.
'DLO\3HUIRUPWKHVSHFL¿HGRSHUDWLRQDWDVSHFL¿HGWLPHHYHU\GD\
6XQGD\a6DWXUGD\3HUIRUPWKHVSHFL¿HGRSHUDWLRQDWWKHVSHFL¿HGWLPHRQD
VSHFL¿HGGD\RIWKHZHHN
6SHFL¿FGDWH3HUIRUPWKHVSHFL¿HGRSHUDWLRQRQWKHVSHFL¿HGGDWHDQGWLPH
NOTE ‡,QVWDQGE\PRGHWKHPOWERLQGLFDWRUZLOOÀDVKJUHHQIRUDSSUR[
VHFRQGVZKHQDWOHDVW³3RZHU21´VFKHGXOHLVVDYHG
‡:KHQWKHVFKHGXOHIXQFWLRQLVXVHGWKHSRZHUFRUGPXVWEHFRQQHFWHGWRWKH
projector and the outlet. The schedule function does not work when the breaker
in a room is tripped. The power indicator will lights orange or green when the
SURMHFWRULVUHFHLYLQJ$&SRZHU
82
‹0$OO5LJKWV5HVHUYHG
3M™ Digital Projector X31/X36/X46
7. Other Functions
7.3 Event Scheduling(Continued)
Date/Time Settings (58)
7KH'DWH7LPHVHWWLQJFDQEHDGMXVWHGYLDDZHEEURZVHU
Example,IWKH,3DGGUHVVRIWKHSURMHFWRULVVHWWR192.168.1.10:
(QWHU“http://192.168.1.10/” into the address bar of the web browser.
2) Enter your user name and password, and then click the [OK].
&OLFNWKH[Date/Time Settings]RQWKHPDLQPHQXDQGFRQ¿JXUHHDFKLWHP
5HIHUWRLWHP3.8 Date/Time Settings (58) for further information.
&OLFNWKH[Apply] button to save the settings.
NOTE ‡7KHEDWWHU\IRUWKHEXLOWLQFORFNPD\EHGHDGLIWKHFORFNORVHVWLPH
HYHQZKHQWKHGDWHDQGWLPHKDYHEHHQVHWFRUUHFWO\5HSODFHWKHEDWWHU\E\
following the instructions on replacing the battery.
(Replacing the internal clock battery in the Product Warranty and Safety
Guide)
‡7KHLQWHUQDOFORFN¶VWLPHPD\QRWUHPDLQDFFXUDWH8VLQJ6173LVUHFRPPHQGHG
to maintain accurate time.
‹0$OO5LJKWV5HVHUYHG
83
3M™ Digital Projector X31/X36/X46
7. Other Functions
7.4 Command Control via the Network
<RXFDQFRQ¿JXUHDQGFRQWUROWKHSURMHFWRUYLDWKHQHWZRUNXVLQJ56&
commands.
Communication Port
The following two ports are assigned for the command control.
7&3(Network Control Port1 (Port: 23))
7&3(Network Control Port2 (Port: 9715))
NOTE ‡&RPPDQGFRQWUROLVDYDLODEOHRQO\YLDWKHVSHFL¿HGSRUWDERYH
Command Control Settings (50)
&RQ¿JXUHWKHIROORZLQJLWHPVIURPDZHEEURZVHUZKHQFRPPDQGFRQWUROLVXVHG
Example,IWKH,3DGGUHVVRIWKHSURMHFWRULVVHWWR192.168.1.10:
(QWHU “http://192.168.1.10/” into the address bar of the web browser.
2) Enter your user name and password, and then click the [OK].
&OLFNWKH[Port Settings] on the main menu.
&OLFNWKH[Enable] check box to open Network Control Port1 (Port: 23) to use
7&3&OLFNWKH[Enable] check box for the [Authentication] setting when
DXWKHQWLFDWLRQLVUHTXLUHGRWKHUZLVHFOHDUWKHFKHFNER[
&OLFNWKH[Enable] check box to open Network Control Port2 (Port: 9715) to
XVH7&3&OLFNWKH[Enable] check box for the [Authentication] setting
ZKHQDXWKHQWLFDWLRQLVUHTXLUHGRWKHUZLVHFOHDUWKHFKHFNER[
&OLFNWKH[Apply] button to save the settings.
84
‹0$OO5LJKWV5HVHUYHG
3M™ Digital Projector X31/X36/X46
7. Other Functions
7.4 Command Control via the Network (Continued)
:KHQWKHDXWKHQWLFDWLRQVHWWLQJLVHQDEOHGWKHIROORZLQJVHWWLQJVDUHUHTXLUHG
(60)
&OLFNWKH[Security Settings] on the main menu.
&OLFNWKH[Network Control] and enter the desired authentication password.
6HH127(
&OLFNWKH[Apply] button to save the settings.
NOTE ‡7KH$XWKHQWLFDWLRQ3DVVZRUGZLOOEHWKHVDPHIRUNetwork Control
Port1 (Port: 23), Network Control Port2 (Port: 9715), PJLink™ Port (Port:
4352), My Image Port (Port: 9716) and Messenger Port (Port: 9719).
‡7KHQHZFRQ¿JXUDWLRQVHWWLQJVDUHDFWLYDWHGDIWHUUHVWDUWLQJWKHQHWZRUN
FRQQHFWLRQ:KHQWKHFRQ¿JXUDWLRQVHWWLQJVDUHFKDQJHG\RXPXVWUHVWDUWWKH
QHWZRUNFRQQHFWLRQ<RXFDQUHVWDUWWKHQHWZRUNFRQQHFWLRQE\FOLFNLQJWKH
[Network Restart] on the main menu.
‹0$OO5LJKWV5HVHUYHG
3M™ Digital Projector X31/X36/X46
7. Other Functions
7.4 Command Control via the Network (Continued)
Command Format
&RPPDQGIRUPDWVGLIIHUDPRQJWKHGLIIHUHQWFRPPXQLFDWLRQSRUWV
Ɣ7&3
<RXFDQXVHWKH56&FRPPDQGVZLWKRXWDQ\FKDQJHV7KHUHSO\
GDWDIRUPDWLVWKHVDPHDVWKH56&FRPPDQGV“RS-232C
Communication” in the Operator's Guide TECHNICAL)
+RZHYHUWKHIROORZLQJUHSO\ZLOOEHVHQWEDFNLQWKHHYHQWRIDXWKHQWLFDWLRQ
failure when authentication is enabled.
5HSO\LQWKHHYHQWRIDQDXWKHQWLFDWLRQHUURU!
Reply
[)
Error code
[
[
Ɣ7&3
Send Data format
7KHIROORZLQJIRUPDWWLQJLVDGGHGWRWKHKHDGHU['DWDOHQJWK['
&KHFNVXPE\WHDQG&RQQHFWLRQ,'E\WHRIWKH56&FRPPDQGV
Header
Data length
RS-232Ccommand
Check Sum
Connection
ID
[
['
E\WHV
E\WH
E\WH
+HDGHU
ĺ [)L[HG
'DWDOHQJWK
ĺ 56&FRPPDQGVE\WHOHQJWK[')L[HG
56&FRPPDQG ĺ 5
6&FRPPDQGVWKDWVWDUWZLWK[%([()
E\WHV
&KHFN6XP
ĺ 7KLVLVWKHYDOXHWRPDNH]HURRQWKHDGGLWLRQRIWKH
lower 8 bits from the header to the checksum.
&RQQHFWLRQ,'
ĺ 5DQGRPYDOXHIURPWR7KLVYDOXHLVDWWDFKHG
to the reply data)
86
‹0$OO5LJKWV5HVHUYHG
3M™ Digital Projector X31/X36/X46
7. Other Functions
7.4 Command Control via the Network (Continued)
Reply Data format
7KHFRQQHFWLRQ,'WKHGDWDLVVDPHDVWKHFRQQHFWLRQ,'GDWDRQWKHVHQGLQJ
GDWDIRUPDWLVDWWDFKHGWRWKH56&FRPPDQGVUHSO\GDWD
$&.UHSO\!
Reply
Connection
ID
[
E\WH
1$.UHSO\!
Reply
Connection
ID
[
E\WH
<Error reply>
Reply
Error code
Connection
ID
[&
2 bytes
E\WH
Reply
Data
Connection
ID
['
2 bytes
E\WH
Reply
Status code
Connection
ID
[)
2 bytes
E\WH
'DWDUHSO\!
3URMHFWRUEXV\UHSO\!
<Authentication error reply>
Reply
Authentication
Error code
[)
[
[
‹0$OO5LJKWV5HVHUYHG
Connection
ID
E\WH
87
3M™ Digital Projector X31/X36/X46
7. Other Functions
7.4 Command Control via the Network (Continued)
Automatic Connection Break
7KH7&3FRQQHFWLRQZLOOEHDXWRPDWLFDOO\GLVFRQQHFWHGDIWHUWKHUHLVQR
FRPPXQLFDWLRQIRUVHFRQGVDIWHUEHLQJHVWDEOLVKHG
Authentication
The projector does not accept commands without authentication success
when authentication is enabled. The projector uses a challenge response type
DXWKHQWLFDWLRQZLWKDQ0'0HVVDJH'LJHVWDOJRULWKP
:KHQWKHSURMHFWRULVXVLQJD/$1DUDQGRPE\WHVZLOOEHUHWXUQHGLI
DXWKHQWLFDWLRQLVHQDEOHG%LQGWKLVUHFHLYHGE\WHVDQGWKH$XWKHQWLFDWLRQ
3DVVZRUGDQGGLJHVWWKLVGDWDZLWKWKH0'DOJRULWKPDQGDGGWKLVLQIURQWRIWKH
commands to send.
)ROORZLQJLVDVDPSOHLIWKH$XWKHQWLFDWLRQ3DVVZRUGLVVHWWR³SDVVZRUG´DQGWKH
UDQGRPE\WHVDUH³DIF´
6HOHFWWKHSURMHFWRU
5HFHLYHWKHUDQGRPE\WHV³DIF´IURPWKHSURMHFWRU
%LQGWKHUDQGRPE\WHV³DIF´DQGWKH$XWKHQWLFDWLRQ3DVVZRUG
³SDVVZRUG´DQGLWEHFRPHV³DIFSDVVZRUG´
'LJHVWWKLVELQG³DIFSDVVZRUG´ZLWK0'DOJRULWKP
,WZLOOEH³HGDGIIDEFHIGEGH´
$GGWKLV³HGDGIIDEFHIGEGH´LQIURQWRIWKHFRPPDQGV
and send the data.
6HQG³HGDGIIDEFHIGEGH´FRPPDQG
6) When the sending data is correct, the command will be performed and the
UHSO\GDWDZLOOEHUHWXUQHG2WKHUZLVHDQDXWKHQWLFDWLRQHUURUZLOOEHUHWXUQHG
NOTE ‡$VIRUWKHWUDQVPLVVLRQRIWKHVHFRQGRUVXEVHTXHQWFRPPDQGVWKH
authentication data can be omitted when the same connection.
88
‹0$OO5LJKWV5HVHUYHG
3M™ Digital Projector X31/X36/X46
8. Troubleshooting
8. Troubleshooting
Problem
1RLPDJH
&RQQHFWLRQWRWKH1HWZRUN
The projector
that you want
to connect to is
nowhere to be
found on the
list of available
projectors
&DQ
W
communicate
Likely Cause
Things to Check
Reference
Page
Number
The projector is not turned
on.
,VWKHSURMHFWRU¶VODPSRQ"
7KHSURMHFWRU¶VLQSXWVRXUFH
LVQ¶WVZLWFKHGWR/$1
Is the projector switched to
/$1"
7KHFRPSXWHUDQGRU
SURMHFWRU¶VQHWZRUNVHWWLQJV
are not configured correctly.
&KHFNWKHQHWZRUN
configurations of the
computer and projector. If
\RXFKDQJHWKHSURMHFWRU¶V
settings, turn off the
SURMHFWRU¶V$&SRZHUDQG
then turn it on again. If you
simply put the projector in
67$1'%<SRZHUPRGHDQG
then turn it on again, the new
settings might not take effect.
8
5HIHUWRWKHPDQXDOIRUWKH
¿UHZDOOVRIWZDUHDQGWDNH
Firewall software other than one of the following actions:
Windows® Firewall is installed ([FOXGHWKH³/LYH9LHZHU´
in your computer.
from blocking item list
'LVDEOHWKH¿UHZDOOZKLOH
XVLQJWKH³/LYH9LHZHU´
–
7KHFRPSXWHUDQGRU
SURMHFWRU
VQHWZRUNVHWWLQJV
DUHQRWFRQ¿JXUHGFRUUHFWO\
&KHFNWKHQHWZRUN
configurations of the
computer and projector.
8
7KHSURMHFWRULQSXWSRUWLVQ
W
VZLWFKHGWR/$1
&KHFNWKHSURMHFWRU
VLQSXW
port setting.
8VHQHWZRUNXWLOLWLHVWKDWPD\
come with your computer
An access point is used, and
RUZLUHOHVV/$1FDUGWR
your computer is connected
establish wireless network
to the access point via
connection. For detail,
ZLUHOHVV/$1
refer to the manual of the
computer or the card.
(continued on next page)
‹0$OO5LJKWV5HVHUYHG
–
2SHUDWRU
V*XLGH
89
3M™ Digital Projector X31/X36/X46
8. Troubleshooting
8. Troubleshooting (Continued)
Problem
Likely Cause
7KHSURMHFWRULVQ¶WFDSDEOH
of relaying dynamic images
The projected VXFKDV3RZHU3RLQW®
image is rather animation at full speed.
slow compared
to that of the
The compression rate being
computer
used for transferring the
images is too low.
Things to Check
Reference
Page
Number
6ZLWFKLQJWKHSULRULW\WR
µ7UDQVPLVVLRQ6SHHG¶XQGHU
the options menu may help
to improve speed.
6ZLWFKLQJWKHSULRULW\WR
µ7UDQVPLVVLRQ6SHHG¶XQGHU
the options menu may help
to improve speed.
–
1HWZRUN3UHVHQWDWLRQ
1R,PDJH
8VLQJ3KRWR*DOOHU\6OLGH
6KRZLQ:LQGRZV9LVWD®.
7KH³/LYH9LHZHU´FDQQRW
send computer screen data
while using Windows Vista®
3KRWR*DOOHU\6OLGH6KRZ
3OHDVHFORVH3KRWR*DOOHU\
6OLGH6KRZEHIRUHXVLQJWKH
³/LYH9LHZHU´
&DQ
WGLVSOD\
the movies
correctly.
In some combinations of
FRPSXWHU
VYLGHRFDUGDQG
application software, there is
DSRVVLELOLW\WKDWWUXHLPDJH
especially movies played by media
SOD\HUFDQQRWEHWUDQVIHUUHGWR
WKHSURMHFWRUZLWKWKH³/LYH9LHZHU´
If there is a video
acceleration level adjustment
function in your application,
SOHDVHWU\WRDGMXVWLW5HIHU
your application manual in
detail.
–
1HWZRUNFRQQHFWLRQ
between the
computer and
projector is
disconnected
when computer
display resolution
is changed
GXULQJ1HWZRUN
3UHVHQWDWLRQ
7KHFRPSXWHU3URMHFWRU
network connection might be
disconnected when computer
display resolution is changed
while displaying picture.
3OHDVHUHFRQQHFWXVLQJ
³&RQQHFWEXWWRQ´DIWHU
changing computer display
resolution, or change display
resolution before connecting
ZLWKWKH³/LYH9LHZHU´
37
Images
contain lots of
interference.
The compression rate being
used for transferring the
images is too high.
7U\VHWWLQJWKHSULRULW\WR
,PDJH
4XDOLW\
LQWKH³/LYH9LHZHU´
2SWLRQPHQX<RXPD\
experience a drop in speed.
7KH³/LYH9LHZHU´GRHVQRW
support these features of
Windows Vista® Aero®.
–
1HLWKHUWUDQVSDUHQF\
8VLQJWKH³/LYH9LHZHU´ZLWK
nor translucency
Windows® Aero® mode.
HIIHFWV*ODVV
(continued on next page)
‹0$OO5LJKWV5HVHUYHG
3M™ Digital Projector X31/X36/X46
8. Troubleshooting
8. Troubleshooting (Continued)
Problem
2WKHUV
,QIRUPDWLRQIURPWKH
projector to computer is
not correct or completed
7KHSURMHFWRUGRHVQRW
respond
,PDJHRQVFUHHQLV
IUR]HQ
Likely Cause
&RPPXQLFDWLRQEHWZHHQ
the projector and computer
is not working well.
1(7:25.)XQFWLRQVRI
the projector is not working
well.
Things to Check
Reference
Page
Number
7U\³5(67$57´LQ
6(59,&(PHQXXQGHUWKH
1(7:25.PHQX
*66
2SHUDWRU
V*XLGH
‹0$OO5LJKWV5HVHUYHG
Important Notice
All statements, technical information, and recommendations related to 3M’s products are based on information believed to be
reliable, but the accuracy or completeness is not guaranteed. Before using this product, you must evaluate it and determine if it is
suitable for your intended application. You assume all risks and liability associated with such use. Any statements related to the
product which are not contained in 3M’s current publication, or any contrary statements contained on your purchase order shall
KDYHQRIRUFHRUHIIHFWXQOHVVH[SUHVVO\DJUHHGXSRQLQZULWLQJE\DQDXWKRUL]HGRI¿FHURI0
Warranty
3M warrants that when the 3M Product is used according to 3M’s Intended Use Statement (www.3M.com/meetings), it will
perform satisfactorily for the warranted durability period as stated in the applicable 3M Product Manual in effect at the time of
purchase. The warranties stated in the applicable 3M Product Manuals are exclusive and are made in place of any and all express
RULPSOLHGZDUUDQWLHVRUFRQGLWLRQVLQFOXGLQJDQ\LPSOLHGZDUUDQW\RIPHUFKDQWDELOLW\RU¿WQHVVIRUDSDUWLFXODUSXUSRVHRUDQ\
industry practice or custom or trade usage.
3M Austin Center
Building A147-5N-01
6801 River Place Blvd.
Austin, TX 78726-9000
3M Canada
P.O. Box 5757
London, Ontario
N6A 4T1
3M Mexico, S.A. de C.V.
Apartado Postal 14-139
Mexico, D.F. 07000
Mexico
3M Europe
Boulevard de l’Oise
95006 Cerge Pontoise Cedex
France
/LWKRLQ&KLQD
‹0$OO5LJKWV5HVHUYHG
5HY%