Whirlpool MAGICOOL User manual

Whirlpool MAGICOOL User manual
Fantasia
HOME APPLIANCES
® Registered trademark/TM Trademark of Whirlpool, U.S.A.
© 2009 Whirlpool of India Ltd. All rights reserved.
Due to advancement of technology and constant R&D the specifications, models and designs are subject to change without prior notice.
1476302-02
HOME APPLIANCES
Kapil
6SOLW7\SH5RRP$LU&RQGLWLRQHU-R410a
8VHDQG&DUH0DQXDO
8QGHU3UHSDUDWLRQEHIRUHXVH
6DIHW\3UHFDXWLRQV
,GHQWLILFDWLRQRISDUWV
'LVSOD\LQWURGXFWLRQ
5HPRWHFRQWUROOHU
5&EDWWHULHVORDGLQJ
2SHUDWLQJ,QVWUXFWLRQVIRU5&
$LUIORZ'LUHFWLRQ&RQWURO
WK6HQVH0RGH
7LPHU0RGH
6OHHS0RGH
7XUER0RGH
)XQFWLRQVDYDLODEOHLQGLIIHUHQWPRGHV
0DLQWHQDQFH
3URWHFWLRQ
7URXEOHVKRRWLQJ
7URXEOHVKRRWLQJFKDUW
,QVWDOODWLRQLQVWUXFWLRQV
,QVWDOODWLRQLQVWUXFWLRQIRU,'8
,QVWDOODWLRQLQVWUXFWLRQIRUSLSLQJFRQQHFWLRQ
&DEOHFRQQHFWLRQ,QVWUXFWLRQ
:LULQJGLDJUDP
,QVWDOODWLRQLQVWUXFWLRQIRU2'8
+RZWRSXUJH
:DUUDQW\WHUPV
6HUYLFHFRXSRQV
a
,QVWDOODWLRQGHPRVKHHWFXVWRPHUFRS\
a
,QVWDOODWLRQGHPRVKHHWFRPSDQ\FRS\
:KLUOSRRO6HUYLFH
7KDQN\RXYHU\PXFKIRUSXUFKDVLQJ a:KLUOSRRO$LU&RQGLWLRQHUSOHDVHUHDGWKLV8VH
&DUH0DQXDOFDUHIXOO\EHIRUHLQVWDOOLQJDQGXVLQJWKLVDSSOLDQFHDQGNHHSWKLVPDQXDO
IRUIXWXUHUHIHUHQFHV
,PSRUWHG%\:KLUOSRRORI,QGLD/LPLWHG
$0,'&5DQMDQJDRQ7DOXND6KLUXU'LVWW3XQH0DKDUDVKWUDVWDWH,QGLD3,1
:KLUOSRROLVDUHJLVWHUHGWUDGHPDUNRIWKH:KLUOSRRO&RUSRUDWLRQ86$8VHXQGHUOLFHQVH
Under Preparation before use
Before using the air conditioner, be sure to check and preset as the following.
Remote Controller (RC)
7KHUHPRWHFRQWUROOHUFDQFRYHUDOOWKHIXQFWLRQVRIFRROLQJPRGHOV+HDWLQJPRGHLVQRWDSSOLFDEOHIRU
FRROLQJPRGHOV
Auto-Restart Function
,I\RXZDQWWRXVHDXWRUHVWDUWVZLWFKRQWKHSRZHUVXSSO\EXWWRQSUHVVWKH212))EXWWRQRQWKH,QGRRU
8QLWKROGIRURYHUVHFRQGV$XWR5HVWDUWLVQRZVHWZLWKEX]]VRXQG
,IWKHDXWRUHVWDUWKDVEHHQVHWKROGGRZQWKH212))EXWWRQRQWKHLQGRRUXQLWIRURYHU6HFRQGVDXWR
UHVWDUWIXQFWLRQLVQRZFDQFHOOHGZLWKDEX]]VRXQGDLUFRQGLWLRQHULVQRZRQVWDQGE\
Auto Turbo Mode
Turbo mode is used to start or stop fast cooling.
)DVWFRROLQJFKDQJHVWKHWHPSHUDWXUHWRKLJKIDQVSHHGDQGRSHUDWHVDXWRPDWLFDOO\WLOOWHPSHUDWXUHUHGXFHV
WRGHJUHHV&HOVLXVIRUPLQXWHVWKHQVZLWFKHVWRSUHVHWPRGH
x
x
7XUERPRGHFDQEHVHWZKHQWKHDSSOLDQFHLVLQRSHUDWLRQRU powered on
,QWXUERPRGH\RXFDQVHWDLUIORZGLUHFWLRQRUWLPHU,I\RXZDQWWRUHWXUQWRWKHRULJLQDOPRGHSUHVV 32:(502'()$1212))RU7(03(5$785(6(77,1*%87721
1RWH
x
x
x
6OHHSDQGWKVHQVHEXWWRQVDUHQRWDYDLODEOHLQWXUERPRGH
7XUEREXWWRQLVLQHIIHFWLYHLQKHDWLQJPRGH
7KHDSSOLDQFHZLOOFRQWLQXHZRUNLQJLQWXUERPRGHZLWKVHWWHPSHUDWXUHRIGHJUHH&HOVLXVWLOORWKHU
EXWWRQVPHQWLRQHGDERYHDUHSUHVVHG
Safety precautions
6\PEROVLQWKLV8VHDQG&DUH0DQXDODUHLQWHUSUHWHGDVVKRZQEHORZ
%HVXUHQRWWRGR
3D\DWWHQWLRQWRVXFKDVLWXDWLRQ
8VHFRUUHFWSRZHUVXSSO\LQ
DFFRUGDQFHZLWKWKHUDWLQJSODWH
UHTXLUHPHQW2WKHUZLVHVHULRXV
IDXOWVRUKD]DUGPD\RFFXURUD
ILUHPD\EHEUHDNRXW
'RQRWbendSXOORUSUHVVWKHSRZHUVXSSO\
FRUGOHVWWKHSRZHUVXSSO\FRUGEHEURNHQ
$QHOHFWULFVKRFNRUILUHmay beFDXVHG
E\DEURNHQSRZHUVXSSO\FRUG
*URXQGLQJLVHVVHQWLDO
:DUQLQJ,QFRUUHFWKDQGOLQJFRXOG
FDXVHDVHULRXVKD]DUGVXFKDVGHDWK
VHULRXVLQMXU\HWF
21
21
2))
.HHSWKHSRZHUVXSSO\FLUFXLWEUHDNHU
RUSOXJ awayIURPGLUW&RQQHFWWKHSRZHU
VXSSO\FRUGWRLWILUPO\DQGFRUUHFWO\
OHVWDQHOHFWULFVKRFNRUDILUHEUHDNRXW
GXHWRLQVXIILFLHQWFRQWDFW
1HYHULQVHUWDVWLFNRUVLPLODUREVWDFOH
WRWKHXQLW6LQFHWKHIDQURWDWHVDWKLJK
VSHHGWKLVPD\FDXVHDQLQMXU\
2))
'RQRWXVHWKHSRZHUVXSSO\FLUFXLW
EUHDNHURUSXOORIIWKHSOXJWRWXUQLWRII
GXULQJRSHUDWLRQ7KLVPD\FDXVHDILUH
GXHWRVSDUNHWF
,WLVKDUPIXOWR\RXUKHDOWKLIWKHFRRODLU
UHDFKHV\RXIRUDORQJWLPH,WLVDGYLVDEOH
WROHWWKHDLUIORZEHGHIOHFWHGWRaroundWKHURRP
NO
&
FFO
FFO/NO
N AF
EDOM
REPUS
PEELS
GNIWS
REMMID
LEEFI
TR A M S
KCOLC
FFO REMIT NO REMIT
7XUQRIIWKHDSSOLDQFHE\UHPRWHFRQWURO
ILUVWEHIRUHFXWWLQJRIISRZHUVXSSO\LI any
PDOIXQFWLRQRFFXUV
'RQRWWRXFKWKHRSHUDWLRQEXWWRQV
ZKHQ\RXUKDQGVDUHZHW
'RQRWUHSDLUWKHDSSOLDQFHE\\RXUVHOI
,IWKLVLVGRQHLQFRUUHFWO\LWPD\FDXVHD
HOHFWULFVKRFNHWF
'RQRWSXWDQ\REMHFWVRQWKHRXWGRRU
XQLW
2
3UHYHQWWKHDLUIORZIURPUHDFKLQJWKHJDV
EXUQHUVDQGVWRYH
,WLVWKHXVHU
VUHVSRQVLELOLW\WRJHWWKH
$SSOLDQFHHDUWKHGDFFRUGLQJWRORFDO requirements
E\DOLFHQVHGWHFKQLFLDQ
Identification of parts
Indoor unit
Air Intake
Front Panel
Display Box
Air Outlet
Emergency Box
Vertical Adjustment
Louver
Horizontal Adjustment
Louver
Air Filter
Remote Controller
Air Intake
Outdoor unit
Pipes and Power
Connection Cord
Drain Hose
Note: Condensate water drains
at COOLING or DRY operation.
Air Outlet
The figures in this manual are based on the external view of a standard model.
Consequently, the shape may differ fromthat of the air conditioner you have selected.
3
Display introduction
Fantasia display indicator
Running indicator 1
It lights up when the AC is running.
It flashes during defrosting.
1
Timer indicator 2
2
It lights up during set time.
The symbols may be different from these models, but the functions are similar.
4
Remote controller
Remote controller
The remote controller transmits signals to the system.
1 ON/OFF BUTTON
The appliance will be switched on or
Off on pressing this button
2
MODE BUTTON
Press this button to select the operation mode.
3 FAN BUTTON
Used to select fan speed in sequence
auto, high, medium or low.
4 55
ROOM TEMPERATURE
SETTING BUTTONS
8
2
13
SENSE BUTTON
Used to enter fuzzy logic operation directly,
regardless of the unit is on or off.
7
5
3
Used to adjust the room temperature and
the timer, also real time.
6
4
1
7
9
SWING BUTTON
14
6
Used to stop or start vertical adjustment
louver swinging and set the desired up/down
10
airflow direction.
8
12
SLEEP BUTTON
11
Used to set or cancel Sleep Mode operation.
9
AROUND U BUTTON
Used to set or cancel AROUND U Mode operation.
10 POWER SAVER BUTTON
Used to enter or quit POWER SAVER mode
11 12 TIMER ON/CLOCK BUTTON
11 TIMER OFF BUTTON
Used to cancel the timer operation.
13 TURBO BUTTON
Used to set timer operation and clock.
14
DIM BUTTON
When you press this button, all the display of
indoor unit will be switched off. Press any button to
resume display.
Used to start or stop the fast cooling.
Indication symbols on LCD:
Cooling indicator
Auto fan speed
6th sense indicator
Dry indicator
High fan speed
Sleep indicator
Fan only indicator
Medium fan speed
Around U
Heating indicator
Low fan speed
Turbo indicator
Power saver indicator
Note: Each mode and relevant function will be further specified in following pages.
5
Signal transmit
ON
Display set timer
OFF
Display current time
Display set temperature
Remote controller
5HPRWHFRQWUROOHU
7RLQVHUWDSLQDQG3XVK'RZQ
WKHQIROORZLQJWKHGLUHFWLRQDV
WKHDUURZVKRZVWRUHPRYHWKH
EDWWHU\FRYHU
How to Insert the Batteries
5HPRYHWKHEDWWHU\FRYHUDFFRUGLQJWRWKHDUURZGLUHFWLRQ
,QVHUWQHZEDWWHULHVPDNLQJVXUHWKDWWKHDQGRI
EDWWHU\DUHPDWFKHGFRUUHFWO\
5HDWWDFKWKHFRYHUE\VOLGLQJLWEDFNLQWRSRVLWLRQ
Note:
Use 2 LR03 AAA(1.5volt) batteries. Do not use rechargeable batteries.
Replace batteries with new ones of the same type when the display
becomes dim.
Storage and Tips for Using the Remote Controller
7KHUHPRWHFRQWUROOHUPD\EHVWRUHGPRXQWHGRQDZDOOZLWKDKROGHU
Note: The remote controller holder is an optional part.
How to Use
7RRSHUDWHWKHURRPDLUFRQGLWLRQHUDLP
WKHUHPRWHFRQWUROOHUWRWKHVLJQDOUHFHSWRU
7KHUHPRWHFRQWUROOHUZLOORSHUDWHWKHDLU
FRQGLWLRQHUDWDGLVWDQFHRIXSWRPZKHQ
SRLQWLQJDWVLJQDOUHFHSWRURILQGRRUXQLW
2
)
2
12)) 02
'(
6:
, *
1
7
0
)
$1
60
$ 7
5
52
,
(
7, 52
1
)
&2
/
.
&
6
4
7
8
Room temperature
decrease by 1.5℃ after
operate for 3 minutes
Around U button
9
Operating Instructions
7LPHUPRGH 7LPHU0RGH7KLVPRGHDOORZV\RXWRVZLWFKDLUFRQGLWLRQHURQRIIDIWHUDFHUWDLQDPRXQW RIWLPHWKDWKDVEHHQVHW
+RZWRVHW7,0(521
7,0(521EXWWRQFDQEHXVHGWRVHWWKHWLPHUSURJUDPPLQJDVZLVKHGLQRUGHUWR
VZLWFKRQWKHDSSOLDQFHDW\RXUGHVLUHGWLPH
L3UHVV7,0(521EXWWRQ21IODVKHVRQWKH/&'WKHQ\RX
FDQSUHVVWKH
DSSOLDQFHRQ
RU
EXWWRQVWRVHOHFW\RXUGHVLUHGWLPHIRU
,QFUHDVH
1
'HFUHDVH
3UHVVWKH7,0(521EXWWRQRQFHWRLQFUHDVHRUGHFUHDVHWKHWLPHVHWWLQJE\PLQXWH
3UHVVWKH7,0(521EXWWRQRQHDQGDKDOIVHFRQGVWRLQFUHDVHRUGHFUHDVHWKHWLPH
VHWWLQJE\PLQXWH
3UHVVWKH7,0(521EXWWRQIRUDORQJHUWLPHWRLQFUHDVHRUGHFUHDVHWKHWLPHE\KRXU
Note: If you don't set the time in 10 seconds after you press TIMER ON button, the remote controller
will exit the TIMER ON mode automatically.
LL:KHQ\RXUGHVLUHGWLPHGLVSOD\HGRQ/&'SUHVVWKH7,0(521EXWWRQDQGFRQILUPLW
A "beep" can be heard.
"ON" stops flashing.
The TIMER indicator on the indoor unit lights up.
LL,$IWHUWKHVHWWLPHUGLVSOD\HGIRUVHFRQGVWKHFORFNZLOOEHGLVSOD\HGRQWKH/&'
RIWKHUHPRWHFRQWUROOHULQVWHDGRIVHWWLPHU
+RZWRFDQFHO7,0(521
7,0(52))FDQEHXVHGWRVZLWFKRIIWKHDSSOLDQFHDXWRPDWLFDOO\DW\RXUGHVLUHGWLPH
Note: 3UHVVWKH7,0(521EXWWRQDJDLQD³EHHS´FDQEHKHDUGDQGWKHLQGLFDWRUGLVDSSHDUV
the TIMER ON mode has been canceled.
10
Operating Instructions
SLEEP mode
SLEEP mode
SLEEP mode can be set in COOLING HEATING or DRYING operation mode.
This function gives you a more comfortable environment for sleep.
In SLEEP mode,
The appliance will stop operation automatically after operating for 8 hours.
Fan speed is automatically set at low speed.
*Set temperature will rise by 1ć if the appliance operates continuously in
cooling mode for 2 hours constantly, then remains steady.
*Note: In cooling mode, if room temperature is 26ćor above, set temperature
will not change.
Note: Heating is NOT available for cooling only air conditioner.
TURBO mode
TURBO mode
„ Turbo mode is used to reduce the temperature of your room at the
highest possible rate, by operating at highest fan speed and changing the
set temperature to 18ć.
„ In TURBO mode, you can set airflow direction or timer. If you want to
escape from TURBO mode, press TURBO , MODE, FAN, ON/OFF,SLEEP
or TEMPERATURE SETTING button, the display will return to the original
mode.
*Note:
6TH SENSE button is not available in TURBO mode.
The Appliance will continue working in TURBO mode , if you don't exit from it by
pressing any of the buttons mentioned above.
11
12
Maintenance
)URQWSDQHOPDLQWHQDQFH
$LUILOWHUPDLQWHQDQFH
&XWRIIWKHSRZHUVXSSO\
,WLVQHFHVVDU\WRFOHDQWKHDLUILOWHU
DIWHUXVLQJLWIRUDERXWKRXUV
7XUQRIIWKHDSSOLDQFH
ILUVWEHIRUHGLVFRQQHFWLQJ
IURPSRZHUVXSSO\
&OHDQLWDVIROORZV
D
+ROGSRVLWLRQDDQG
SXOORXWZDUGWRUHPRYHWKH
IURQWSDQHO
6ZLWFKRIIWKHDSSOLDQFHDQGUHPRYH
WKHDLUILOWHU
D
2SHQWKHIURQWSDQHO
3UHVVWKHKDQGOHRIWKHILOWHUJHQWO\
IURPWKHIURQW
*UDVSWKHKDQGOHDQGVOLGHRXWWKHILOWHU
8VHOXNHZDUPZDWHU
EHORZćWRFOHDQ
LIWKHDSSOLDQFH
LVYHU\GLUW\
:LSHZLWKDVRIW
DQGGU\FORWK
8VHDGU\DQG
VRIWFORWKWR
FOHDQLW
1HYHUXVHYRODWLOHVXEVWDQFH
VXFKDVJDVROLQHRUSROLVKLQJ
SRZGHUWRFOHDQWKHDSSOLDQFH
&OHDQDQGUHLQVWDOOWKHDLUILOWHU
,IWKHILOWHULVGLUW\
ZDVKLWZLWKDVROXWLRQRI
GHWHUJHQWLQOXNHZDUPZDWHU
$IWHUFOHDQLQJGU\ZHOOLQ
VKDGH
1HYHUVSULQNOHZDWHURQWRWKH
LQGRRUXQLW
'DQJHURXV
(OHFWULF
VKRFN
&ORVHWKHIURQWSDQHODJDLQ
5HLQVWDOODQGVKXWWKHIURQWSDQHO
5HLQVWDOODQGVKXWWKHIURQWSDQHOE\
SUHVVLQJSRVLWLRQEGRZQZDUG
E
E
Clean the air filter every two weeks
if the air conditioner operates in an
extremely dusty environment.
13
14
Troubleshooting
The following cases may not always be a malfunction, please check it before asking for service.
7URXEOH
$QDO\VLV
,sWKHSURWHFWRUWULSRUIXVHLVEORZQ?
3OHDVHZDLWIRUPLQXWHVDQGVWDUWDJDLQ
SURWHFWRUGHYLFHPD\EHSUHYHQWLQJXQLWfromZRUNing?
'RHVQRWUXQ
Are theEDWWHULHVLQWKHUHPRWHFRQWUROOHUH[KDXVWHG?
,s WKHSOXJLVQRWSURSHUO\SOXJJHG?
,VWKHLQWHUQDOXQLWDLUILOWHUGLUW\"
1RFRROLQJRU
KHDWLQJDLU
$UHWKHYHQWVRIWKHH[WHUQDOXQLWEORFNHG"
,VWKHLQSXWYROWDJHOHVVWKDQ9"
,VWKHWHPSHUDWXUHVHWSURSHUO\"
,QHIIHFWLYHFRQWURO
/DJLQWKH
FRPSUHVVRUZRUNLQJ
GRQ
WUXQ
3HFXOLDURGRU
$VRXQGRI
IORZLQJZDWHU
&UDFNLQJVRXQGLV
KHDUG
6SUD\PLVWIURP
WKHRXWOHW
&KHFNLIWKHEDWWHULHVLQWKHUHPRWHFRQWUROOHUDUH
QRWH[KDXVWHG
&KHFNLIWKHEDWWHULHVLQWKHUHPRWHFRQWUROOHUDUH
QRWH[KDXVWHG
&KDQJLQJPRGHGXULQJRSHUDWLRQZLOOOHDGWR
PLQXWHVGHOD\
7KLVRGRUPD\FRPHIURPDQRWKHUVRXUFH
VXFKDVIXUQLWXUHFLJDUHWWHHWFZKLFKLV
VXFNHGLQWKHXQLWDQGEORZnRXWZLWKWKHDLU
&DXVHGE\WKHIORZRIUHIULJHUDQWLQWKH
DLUFRQGLWLRQHUQRWDLVVXH
15
7KHVRXQGPD\EHJHQHUDWHGE\WKHH[SDQVLRQ
RUFRQWUDFWLRQRIWKHIURQWSDQHOGXHWRFKDQJH
RIWHPSHUDWXUH
0LVWDSSHDUVZKHQWKHURRPDLUEHFRPHV
YHU\FROGEHFDXVHRIFRRODLUGLVFKDUJHG
IURPLQGRRUXQLWGXULQJ&22/,1*RU'5<
RSHUDWLRQPRGH
Troubleshooting chart
)DXOW
6\PSWRPV
6XSSO\$LULVFROGEXW
URRPLVQRWFRROHG
3UREDEOHFDXVH
7URXEOH3RLQW
([FHVVLYH&RROLQJORDG
5HPHG\
5RRPLVWRRODUJHIRUFKRRVHQFDSDFLW\
5HFDOFXODWHWKHFRROLQJORDG
'LUHFW6XQOLJKWHQWHUVWKHURRPEHLQJ
'RQRWLQVDWDOODLUFRQGLWLRQHUQHDUKHDWHU
FRROHG
DQGRWKHUVRXUFHV
'RRUVDUHRSHQHGDQGFORVHGIUHTXHQWO\RU
URRPFRQWDLQWRRPDQ\SHUVRQV
+HDWVRXUFHVVXFKDVKHDWHUVDQGFRRNLQJ
VWRYHVHWFDUHSUHVHQWV
8QVXLWDEOHLQVWDOODWLRQORFDWLRQ
&KHFNLIURRPDLUFRQGLWLRQHULVLQVWDOOHGLQ
&KDQJHLQVWDOODWLRQORFDWLRQ
5HPRYHDQ\REVWUXFWLQJREMHFW
FRUQHU
&KHFNIRUDQ\REVWUXFWLQJREMHFWLQIURQWRI
URRPDLUFRQGLWLRQHU
/(66&22/,1*
,QVXIILFLHQWDLUIORZ
'XVWDFFXPXODWHVLQWKHDLUILOWHU
:DVKRXWWKHGXVWRQWKHDLUILOWHU
'XVWDGKHUHVWRILQVZKLFKFDXVHVOHVVDLU
&OHDQWKHILQVZLWKEUXVDQGZDWHU
&KHFNHDFKVHFWLRQZLWKKDORJHQJDVOHDN
IORZ
&RPSUHVVRULVRSHUDWLQJ
'HIHFWLYHUHIULJHUDWLQJF\FOH
EXWVXSSO\DLULVQRW
5HIULJHUDQWOHDNDJHIURPWKHEUD]HG
VHFWLRQLQSLSLQJ
GHWHFWRUDQGUHSDLULWLPPHGLDWHO\ZKHQD
FRROHGVXIILFLHQWO\
OHDNLQJVHFWLRQLVGHWHFWHG
DPELHQWFRQGLWLRQ
FRPSUHVVRUEHFRPHVRYHUORDGHGDQG
FKHFNIRUGLUHFWVXQOLJKWRQDLUFRQGLWLRQHU
XVHVWDELOL]HUVIRUUHJXODWHGSRZHUVXSSO\
FKHFNIRUDQ\VXQOLJKWRQDLUFRQGLWLRQHU
UHSODFHWKHGHIHFWLYHFDSDFLWRU
UHSDLUUHIULJHUDWLQJF\FOHDQGRYHUORDG
VWRSVZLWKWKHDFWXDWLRQRIRYHUORDGUHOD\
FRPSUHVVRUVWRSVVRRQ
DIWHUVWDUWLQJ
YDULDWLRQRISRZHUVRXUVHYROWDJHDQG
SRZHUVRXUVHFDSDFLW\
VXSSO\YROWDJHLVQRWLQUDQJHRIRI
UDWHG
DPELHQWFRQGLWLRQ
FRPSUHVVRUUXQQLQJFDSDFLWRUEHFRPHV
FRPSUHVVRUEHFRPHVRYHUORDGHGDQG
VWRSVZLWKWKHDFWXDWLRQRIRYHUORDGUHOD\
SRRURUGLVFRQQHFWHG
FKHFNHOHFWULFDOZLUHDQGFRPSUHVVRU
UXQQLQJFDSDFLWRUZLWKFDSDFLWRU
GHIHFWLYHUHIULJHUDWLQJF\FOHDQGRYHUORDG
PHDVXUHWKHYROWDJHDQGFXUUHQW
DERQRUPDOLW\
GHIHFWLYHFRPSUHVVRU
FKHFNFRPSUHVVRUZLQGLQJUHVLVWDQFHDQG
UHOD\
UHSODFHDQ\GHIHFWLYHFRPSUHVVRU
UHSODFHDQ\SOXJRUSDUWZLWKSRRUFRQWDFW
FRPSDUHZLWKVSHFLILFDWLRQ
)DQPRWRUGRHVQRWUXQ
SRRUFRQWDFWRISOXJEURNHQZLUH
VZLWFKHVWKHUPLVWRU
PHDVXUHWKHFRQWLQXLW\RIFRUGRUYROWDJH
ZLWKDWHVWHU
IDQPRWRUIDLOXUH
FKHFNWKHEURNHQFRQQHFWLRQLQIDQPRWRU
RUFRUGZLWKEURNHQDULYH
LWVHOIEXUQWDQGHIIHFW
IDQPRWRULVUXQQLQJEXW
FRPSUHVVRUGRHVQRW
YDULDWLRQRISRZHUVRXUVHYROWDJHDQG
SRZHUVRXUVHFDSDFLWRU
VXSSO\YROWDJHLVQRWLQUDQJHRIaRI
FKHFNZLWK'&PRWRUWHVWLQJMLJLIIDXOW\
UHSODFHWKH
XVHVWDELOL]HUVIRUUHJXODWHGSRZHUVXSSO\
FKHFNIRUDQ\GLUHFWVXQOLJKWRQDLU
UDWHG
'2(6127&22/$7$//
RSHUDWH
DPELHQWFRQGLWLRQ
FRPSUHVVRUEHFRPHVRYHUORDGHGDQG
VWRSVZLWKWKHDFWXDWLRQRIRYHUORDGUHOD\
FRPSUHVVRUUXQQLQJFDSDFLWRUEHFRPHV
SRRURUGLVFRQQHFWHG
FRQGLWLRQHU
UHSODFHWKHGHIHFWLYHFDSDFLWRU
UHSDLUUHIULJHUDWLQJF\FOHDQGRYHUORDG
UXQQLQJFDSDFLWRUZLWKFDSDFLWRU
GHIHFWLYHUHIULJHUDQWF\FOHRURYHUORDG
UHOD\
FKHFNHOHFWULFDOZLUHDQGFRPSUHVVRU
PHDVXUHWKHYROWDJHDQGFXUUHQW
DERQRUPDOLW\
GHIHFWLYHFRPSUHVVRU
FKHFNFRPSUHVVRUZLQGLQJUHVLVWDQFHDQG
UHOD\
UHSODFHDQ\GHIHFWLYHFRPSUHVVRU
&KHFNHDFKVHFWLRQZLWKKDORJHQJDVOHDN
FRPSDUHZLWKVSHFLILFDWLRQ
FRPSUHVVRULVRSHUDWLQJ
JDVOHDNDJH
EXWDLULVQRWFRROHGDWDOO
PHDVXUHWKHYROWDJHDQGFXUUHQW
DERQRUPDOLW\
GHWHFWRUDQGUHSDLULWLPPHGLDWHO\ZKHQD
OHDNLQJVHFWLRQLVGHWHFWHG
FRPSUHVVRUZLWKGHIHFWLYHYDOYH
FRPSUHVVRUZLWKGDPDJHGSLSLQJ
FRPSUHVVRUQRLVH
.QRFNLQJQRLVH
UHSODFHDQ\GHIHFWLYHFRPSRQHQW
REVHUYHIRUDQ\QRUPDOQRLVH
UHSODFHWKHFRPSUHVVRU
FKHFNIRUDQ\REMHFWDURXQGIDQ
UHPRYHDQ\IRUHLJQPDWHULDOIURPWKH
&KHFNWKHGHJUHHRIYLEUDWLRQDQG
WDNHSURSHUPHDVXUHWRFRUUHFW
12,6(
9,%5$7,21
VXVSHQVLRQVSULQJ
EORZHUIDQRUSURIDQKLWWLQJZLWKIRUHLJQ
PDWHULDO
5HDVRQLQJQRLVHGXHWR
YLEUDWLRQ
,QVWDOODWLRQLVQRWSURSHUDQGSDUWVRIDLU
V\VWHP
FRQGLWLRQHUDUHORRVHRULQWHUQDOSDUWVRI
LQVWDOODWLRQZLWKDFFXUDF\
WKHFRPSUHVVRUDUHGDPDJHG
:$7(5
'5,33,1*
:DWHUGULSSLQJLQVLGH
7LOWHGXQLWLQVWDOODWLRQ
&KHFNXQLWLQVWDOODWLRQ
LIQHFHVVDU\UHLQVWDOOWKHXQLW
$LUILOWHUPD\EHGLUW\RUFORJJHG
&KHFNDLUILOWHU
FOHDQGLUW\ILOWHU
URRP
16
Installation instructions
Installation diagram
Distance from ceiling
should be over 150 mm
Distance from wall
should be over 150mm
Distance from the wall
should be over 150mm
Distance from floor
should be over 6.56 feet
Recommendations:
I) Ensure to install ODU on sheet Metal ODU stand,
tightened up with proper Nut and bolts.
II) Rubber Pad shall be there below Outdoor unit legs
in order to absorb the vibration of running unit.
III) Ensure to have conical washer (plastic item) in
between Flare nut and service valves of ODU.
Air intake distance from the wall
should be over 250mm
Air intake distance from
the wall should be
over 250mm
air
sh outl
ou et
ld
d
be ista
ov nce
er
50 from
0m th
m ew
Above figure is only a simple presentation
all
of the unit, it may not match the external
appearance of the unit you purchased.
Installation must be performed in accordance with
the national wiring standards by authorized personnel only.
17
over 250mm
Installation instructions
Select the installation location
Location for Installing Indoor Unit
Where there is no obstacle near the air outlet and air can be
easily blown to every corner.
Where piping and wall hole can be easily arranged.
Keep the required space from the unit to the ceiling and wall
according to the installation diagram on previous page.
Where the air filter can be easily removed.
Keep the unit and remote controller 1m or more apart from
television, radio etc.
To prevent the effects of a fluorescent lamps, keep as far as
possible.
Do not put anything near the air inlet to obstruct it from air
absorption.
Where there is strong enough to bear the weight
and is not tend to increase operation noise and vibration.
Do not install above the enterance i.e. Door or in front of the door.
installation area should have sufficient strength and durability.
IDU should not install far away from desired cooling area.
Do not place any electronic equipment below the IDU unit. Ex:
LCD, Computer etc.
Indoor unit
Pipe length is
15 meters Max.
be less than 5m
Height should
Outdoor unit
X
X
Location for Installing Outdoor Unit
Outdoor unit
Where it is convenient to install and well ventilated.
Do not install ODU face to face.Avoid the installation
in South and West direction.
Avoid installing it where flammable gas could leak.
Keep the required distance apart from the wall.
The distance between Indoor and outdoor unit should
be 4 meters and can go up to maximum 15 meters
with additional refrigerant charge.
Pipe length is
15 meters Max.
Keep the outdoor unit away from a place of greasy dirt,
vulcanization gas exit.
Avoid installing it at the roadside where there is a risk of
muddy water.
A fixed base where is not subject to increasing operation
Indoor unit
noise.
Where there is not any blockage for air outlet.(Don’t install in shaft)
Installation area should have sufficient strength and durability.
To get optimize efficiency, install under shed.
Model
5K~30K
Max. Allowable Tubing
Length at Shipment (m)
5
Limit of Tubing
Length (m)
15
Limit of Elevation
Required amount of
Difference H (m) additional refrigerant (g/m)
5
18
20
Installation instructions
,QGRRUXQLWLQVWDOODWLRQ
1. Installing the Mounting Plate
'HFLGHDQLQVWDOOLQJORFDWLRQIRUWKHPRXQWLQJSODWHDFFRUGLQJWRWKHLQGRRUXQLWORFDWLRQDQGSLSLQJGLUHFWLRQ
.HHSWKHPRXQWLQJSODWHKRUL]RQWDOO\ZLWKDKRUL]RQWDOUXOHURUGURSSLQJOLQH
'ULOOKROHVRIPPLQGHSWKRQWKHZDOOIRUIL[LQJWKHSODWH
,QVHUWWKHSODVWLFSOXJVWRWKHKROHIL[WKHPRXQWLQJSODWHZLWKWDSSLQJVFUHZV
,QVSHFWLIWKHPRXQWLQJSODWHLVZHOOIL[HG7KHQGULOODKROHIRUSLSLQJ
/LQHGURSVIURPKHUH
+RRNWKHOLQHKHUH
0RXQWLQJSODWH
'URSSLQJOLQH
KROHVIRUIL[LQJ
Note: The shape of your mounting plate may be different from the one above, but installation method is similar.
2. Drill a Hole for Piping
'HFLGHWKHSRVLWLRQRIKROHIRUSLSLQJDFFRUGLQJWRWKH
ORFDWLRQRIPRXQWLQJSODWH
'ULOODKROHRQWKHZDOOZLWKWKHKHOSRIGULOOPDFKLQH
7KHKROHVKRXOGWLOWDOLWWOHGRZQZDUGWRZDUGRXWVLGH
:DOOKROHVOHHYH
KDUGSRO\WKHQHWXEH
SUHSDUHGE\XVHU
PP
PP
WLOWGRZQZDUG
,QVWDOODVOHHYHWKURXJKWKHZDOOKROHWRNHHSWKHZDOO
WLG\DQGFOHDQ
3. Indoor Unit Piping Installation
3XWWKHSLSLQJOLTXLGDQGJDVSLSHDQGFDEOHVWKURXJKWKHZDOOKROHIURPRXWVLGHRUSXWWKHPWKURXJK
IURPLQVLGHDIWHULQGRRUSLSLQJDQGFDEOHVFRQQHFWLRQFRPSOHWHVRDVWRFRQQHFWWRRXWGRRUXQLW
&KHFNXQORDGLQJSLHFHRIILQDFFRUGDQFHZLWKWKHSLSLQJGLUHFWLRQDVVKRZQEHORZ
DQGXVHWXEHEHQGHUWKHFRSSHUSLSH
3LSLQJGLUHFWLRQ
WURXJK
8QORDGLQJ
SLHFH
6DZWKHXQORDGLQJSLHFH
RIIDORQJWKHWURXJK
Note: When installing the pipe at the directions
1,2 or 4, saw the corresponding unloading piece
off the indoor unit base.
$IWHUFRQQHFWLQJSLSLQJDVUHTXLUHGLQVWDOOWKHGUDLQKRVH7KHQFRQQHFWWKHSRZHUFRUGV$IWHUFRQQHFWLQJ
ZUDSWKHSLSLQJFRUGVDQGGUDLQKRVHWRJHWKHUZLWKWKHUPDOLQVXODWLRQPDWHULDOV
,'8VKRXOGEHPRXQWHGSHUIHFWO\RQPRXQWLQJSODWH/RFNVKRXOGEHSURSHUO\LQVHUWHG
19
Installation instructions
Piping Joints Thermal Insulation:
:UDSWKHSLSLQJMRLQWVZLWKWKHUPDO
LQVXODWLRQPDWHULDOVDQGWKHQZUDS
ZLWKDYLQ\OWDSH
ZUDSSHGZLWKYLQ\OW\SH
7KHUPDOLQVXODWLRQ
Piping Thermal Insulation:
/DUJHSLSH
D3ODFHWKHGUDLQKRVHXQGHUWKHSLSLQJ
E,QVXODWLRQPDWHULDOXVHVSRO\WKHQHIRDPRYHUPPLQWKLFNQHVV
7KHUPDOLQVXODWLRQ
WXEH
3RZHUFRUG
Note: Drain hose is prepared by user.
'UDLQSLSHVKRXOGSRLQWGRZQZDUGIRUHDV\GUDLQIORZ
'RQRWDUUDQJHWKHGUDLQSLSHWZLVWHGVWLFNLQJRXWRUZDYH
DURXQGGRQRWLPPHUVHWKHHQGRILWLQZDWHU
3RZHUFRUG
IRUKHDWSXPS
,IDQH[WHQVLRQGUDLQKRVHLVFRQQHFWHGWRWKHGUDLQSLSHPDNH
VXUHWRWKHUPDOLQVXODWHGZKHQSDVVLQJDORQJWKHLQGRRUXQLW
6PDOO
SLSH
'UDLQKRVH
SUHSDUHGE\XVHU
'HIURVWFDEOHIRUKHDWSXPS
:KHQWKHSLSLQJLVGLUHFWHGWRWKHULJKWSLSLQJSRZHU
&RUGDQGGUDLQSLSHVKRXOGEHWKHUPDOLQVXODWHGDQG
IL[HGRQWRWKHEDFNRIWKHXQLWZLWKDSLSLQJIL[HU
,QVHUWKHUH
ODUJH
SLSH
GUDLQ
KRVH
%DVH
3LSLQJIL[HU
$,QVHUWWKHSLSHIL[HUWRWKHVORW
ODUJH
SLSH
GUDLQ
KRVH
VPDOO
SLSH
3LSLQJIL[HU
%DVH
VPDOO
SLSH
%DVH
+RRNKHUH
%3UHVVWRKRRNWKHSLSHIL[HURQWRWKHEDVH
Piping Connection:
D&RQQHFWLQGRRUXQLWSLSHVZLWKWZRIL[VSDQQHUV3D\VSHFLDODWWHQWLRQ
WRWKHDOORZHGWRUTXHDVVKRZQEHORZWRSUHYHQWWKHSLSHVFRQQHFWRUV
DQGIODUHQXWVIURPEHLQJGHIRUPHGDQGGDPDJHG'RQRWXVHDGMXVWDEOHZUHQFKHV
E3UHWLJKWHQWKHPZLWKILQJHUVDWILUVWWKHQXVHWKHVSDQQHUV
'RQRWFXWWKHSLSHLIFRQQHFWLQJSLSHUHTXLUHGLVOHVVWKDQPHWHU
5ROOIL[WKHSLSHZLWK2'8LQRUGHUWRJHWRSWLPXPSHUIRUPDQFHLQKRWVXPPHUFRQGLWLRQ
20
Installation instructions
4. Connecting of the Cable
)URQWSDQHO
Indoor Unit
&RQQHFWWKHSRZHUFRQQHFWLQJFRUGWRWKHLQGRRUXQLW
E\FRQQHFWLQJWKHZLUHVWRWKHWHUPLQDOVRQWKHFRQWURO
ERDUGLQGLYLGXDOO\LQDFFRUGDQFHZLWKWKHRXWGRRUXQLW
FRQQHFWLRQ
Indoor unit
Note: For some models, it is necessary to remove the cabinet to
7HUPLQDOLQVLGH
&DELQHW
&KDVVLV
connect to indoor unit terminal.
Outdoor Unit
5HPRYHWKHDFFHVVGRRUIURPWKHXQLWE\ORRVHQLQJ
WKHVFUHZ&RQQHFWWKHZLUHVWRWKHWHUPLQDOVRQWKH
FRQWUROERDUGLQGLYLGXDOO\DVWKHIROORZLQJ
6HFXUHWKHSRZHUFRQQHFWLQJFRUGRQWRWKHFRQWURO
ERDUGZLWKFDEOHFODPS
5HLQVWDOOWKHDFFHVVGRRUWRWKHRULJLQDOSRVLWLRQ
$FFHVVGRRU
7HUPLQDOLQVLGH
Outdoor unit
ZLWKWKHVFUHZ
4) 8VHDUHFRJQL]HGFLUFXLWEUHDNHUIRU.PRGHOEHWZHHQ
7KHSRZHUVRXUFHDQGWKHXQLW$GLVFRQQHFWLRQGHYLFHWR $GHTXDWHO\GLVFRQQHFWDOOVXSSO\OLQHPXVWEHILWWHG
The figures in this manual are based on the external
view of a standard model. Consequently, the shape
may differ from that of the air conditioner you have
selected.
Caution:
1. Never fail to have an individual power circuit specifically for the air conditioner. As for the method of
wiring, refer to the circuit diagram posted on the inside of the access door .
2.Comfirm that the cable thickness is as specified in the power source specification.
3.Check the wires and make sure that they are all tightly fastened after cable connection.
4. Be sure to install an earth leakage circuit breaker in wet or moist area.
Cable Specifications
21
Installation instructions
Wiring Diagram
Make sure that the color of wires of the outdoor unit and the terminal No. are the same as those
of the indoor unit.
12K,18K On/off Model
For above models, the power supply are connected from indoor unit.
COOLING ONLY
Indoor unit
Outd or unit
Terminal
1L
N
Terminal
B
ro
w
n(
B
la
ck
)
Blue(White)
Br
n
ow
la
(B
)
ck
Blue(White)
1L
N
Power connecting cord
Yellow/Green
Yellow/Green
Electric Box
18K Inverter Model
For above models, the power supply are connected from indoor unit.
22
Installation instructions
Outdoor unit installation
1.Install Drain Port and Drain Hose (for heat-pump model only)
Washer
Drain hose
(prepare by user)
2. Install and Fix Outdoor Unit
Use rubber pad to fix with bolts and nuts tightly on a flat and strong
floor.If installed on the wall or roof, make sure to fix the mounting stand and rubber
pad well to prevent it from shaking due to serious vibration or strong wind.
3. Outdoor Unit Piping Connection
Remove the valve caps from the 2-way and 3-way valve.
Connect the pipes to the 2-way and 3-way valves separately according to the required torque.
4. Outdoor Unit Cable Connection (see previous page)
Leak Test/Evacuation/Gas Charging
This step is necessary and it can not be missed
Note: To protect the environment, be sure not to discharge the refrigerant to the air directly.
See next page for air purging steps.
Vacuum pump
indoor unit
Refrigerant flow direction
2-way valve
3-way valve diagram
3-way valve
connect to indoor unit
(6) Open 1/4 turn
Service
port
(7) Turn to fully open the
valve
open position
spindle
(1) Turn
(8) Tighten
(1) Turn
(2) Turn
(8) Tighten
(7) Turn to fully open the valve
valve cap
needle
Valve cap
(8) Tighten
Connect to outdoor unit
Valve core
23
service port cap
How to evacuate air by vacuum pump:
(1). Unscrew and remove caps from 2 and 3-way valves.
(2). Unscrew and remove cap from service valve.
(3). Connect vacuum pump flexible hose to the service valve.
(4). Start vacuum pump for 15-20 minutes untill reaching a vacuum of 0 Mp a.
(5). While vacuum pump is still running, close the low pressure knob on vacuum pump
p ressure meter, then stop vacuum pump.
leakage detection:
(6). Open 2-way valve 1/4 turn then close it after 10 seconds. Check tightness of
all joints using liquid soap or an electronic leak detector.
(7) Turn 2 and 3-way valves stem to fully open the valves. Disconnect vacuum pump flexible hose.
(8). Replace and tighten all valve caps.
To guarantee the unit working normally, please read the manual carefully before installation,
and try to install strictly according to this manual.
Do not let air enter the refrigeration system or discharge refrigerant when moving the air conditioner.
Earth the air conditioner properly.
Check the connecting cables and pipes carefully, make sure they are correct and firm before
connecting the power of the air conditioner.
There must be an air-break switch.
After installing, the consumer must operate the air conditioner correctly according to this manual,
keep a suitable storage for maintenance and move of the air conditioner in the future.
Type of fuse used on indoor unit controller is Φ5×20, with rating 2.5A/250V or 3.15A/250V. .
Caution: Mount with the lowest moving parts of indoor unit at Least 2.4m above floor or grade Level.
Warning: Risk of electric shock can cause injury or death: Disconnect all Remote electric power
supplies before servicing .
The maximum length of the connecting pipe between the indoor unit and outdoor unit should be less
than 5 meters. It will affect the efficiency of the air conditioner if the distance longer than that length.
This appliance is not intended for use by persons (including children) with reduced physical,
sensory or mental capabilities, or lack of experience and knowledge, unless they have been given
supervision or instruction concerning use of the appliance by a person responsible for their safety.
Children should be supervised to ensure that they do not play with the appliance.
If the supply cord is damaged, it must be replaced by the manufacturer, its service agent or similarly
qualified persons in order to avoid a hazard.
The means for disconnection from a power supply shall be incorporated in the fixed wiring and have
an air gap contact separation of at least 3mm in each active(phase) conductors.
( If a stationary appliance is not fitted with a supply cord and a plug, or with other means for
disconnection from the supply mains having a contact separation in all poles that provide full
disconnection under overvoltage category III conditions, the instructions shall state that means for
disconnection must be incorporated in the fixed wiring in accordance with the wiring rules.)
The appliance shall be installed in accordance with national wiring .
When charging refrigerant into the system, make sure to charge in liquid state,
need to reverse refrigerant tank. Otherwise, chemical composition of refrigerant
inside the system may change and thus affect performance of the air conditioner.
According to the character of refrigerant(R410a), the pressure of the tube is very
high, so be sure to careful when you install and repair the appliance.
When charging refrigerant, need to make sure pressure is appropriate based on R410a
characteristics (pressure VS temperature). Please refer to service technical information.
When it found leakage, need to release all refrigerant, fix the leakage point. Evacuate
air by vacuum pump and recharge the refrigerant. It’s not allowed to recharge without
evacuating air by vacuum pump.
If the supply cord is damaged, it must be replaced by the manufacturer, its service agent
of similary qualified persons in order to avoid a hazard.
The air conditioner must be installed by professional engineer.
24
Warranty term
A RELATIONSHIP FOR LIFE
WITH 5 YEARS WARRANTY
Whirlpool Fantasia Air-Conditioner
25
Warranty term
7KLV:DUUDQW\KROGVJRRGRQO\VRORQJDVWKHUHLVFRUUHFWXVHDQGPDLQWHQDQFHRI
WKHDLUFRQGLWLRQHUDVGHWDLOHGLQWKH8VHUDQG&DUHJXLGH
7KLV:DUUDQW\ZLOOFRQWLQXHWREHLQIRUFHIRUWKHWHUPKHUHLQVSHFLILHGLUUHVSHFWLYH
RIZKDWUHSODFHPHQWVPD\EHSURYLGHGXQGHULWDQG6XFKUHSODFHPHQWLQFOXGLQJRQ
FRPSUHVVRUVKDOOQRWDWWUDFWDQ\IUHVK:DUUDQW\
7KLV :DUUDQW\ LV YDOLG DQG ELQGLQJ SURYLGHG WKDW QR VHUYLFH RU UHSDLU KDV EHHQ
DWWHPSWHG RU HIIHFWHG E\ DQ\RQH RWKHU WKDQ WKH $XWKRUL]HG 6HUYLFH )UDQFKLVHH DQG
WKDWLPPHGLDWHQRWLILFDWLRQRIDQ\DOOHJHGGHIHFW LVJLYHQWR:2,/RUWKH$XWKRUL]HG
6HUYLFH)UDQFKLVHH
7KLV:DUUDQW\ZLOOFHDVHWREHDSSOLFDEOHWRGHIHFWVDULVLQJRXWRISXOOHGRXWSRZHU
FDUGEORZQIXVHRULPSURSHUHOHFWULFDOFLUFXLWZKLFKUHVXOWLQQRQRSHUDWLRQRIWKHDLU
FRQGLWLRQHU
:2,/
V HPSOR\HHV RU GHDOHUV DQG RU $XWKRUL]HG 6HUYLFH )UDQFKLVHH KDYH QR
DXWKRULW\WRYDU\WKHWHUPVRIWKLV:DUUDQW\
D7KH2QH<HDU:DUUDQW\ZLOODXWRPDWLFDOO\WHUPLQDWHRQWKHH[SLU\RIWKH:DUUDQW\
SHULRG RI WZHOYH PRQWKV IURP GDWH RI SXUFKDVH DV SHU LQYRLFH HYHQ LI WKH DLU
FRQGLWLRQHUPD\QRWEHLQXVHIRUDQ\WLPHGXULQJWKH:DUUDQW\SHULRGIRUDQ\UHDVRQ
ZKDWVRHYHU LQFOXGLQJ DQ\ WHFKQLFDO EUHDNGRZQV DQG WKH WLPH WRNHQ IRU VXFK
UHSDLUVUHSODFHPHQWV RI SDUWV DQG WUDQVLW ZKHWKHU XQGHU WKLV :DUUDQW\ RU RWKHUZLVH
VKDOOQRWEHH[FOXGHGIURPWKH:DUUDQW\SHULRG
E 7KH :DUUDQW\ RQ FRPSUHVVRU ZLOO DXWRPDWLFDOO\ WHUPLQDWH RQ WKH H[SLU\ RI )RXU
<HDUVHYHQLIWKHDLUFRQGLWLRQHUPD\QRWEHLQXVHIRUDQ\UHDVRQZKDWVRHYHU
D :KLOH :2,/ ZLOO PDNH HYHU\ HIIRUW WR FDUU\ RXW UHSDLUVUHSODFHPHQWV RI SDUWV
XQGHUWKLV:DUUDQW\DVVRRQDVSRVVLEOHLWLVH[SUHVVO\PDGHFOHDUWKDW:2,/VKDOO
QRWEHOLDEOHWRGRVRZLWKLQDQ\VSHFLILHGSHULRGRIWLPH
E,QWKHHYHQWRIDWUHSDLUVUHSODFHPHQWVRIDQ\SDUWVWKLV:DUUDQW\ZLOOWKHUHDIWHU
FRQWLQXHWRUHPDLQLQIRUFHRQO\IRUWKHXQH[SLUHGSHULRGRIWKH:DUUDQW\
,WLVHQWLUHO\OHIWWR:2,/
VGLVFUHWLRQWRHIIHFWUHSDLUVUHSODFHPHQWVRISDUWVDWWKLV
VLWHRILQVWDOODWLRQRUDWDQ\VHUYLFHVWDWLRQRILWV%UDQFKHVRURILWV$XWKRUL]HG6HUYLFH
)UDQFKLVHH
7KH :DUUDQW\ ZLOO VWDQG YRLG LI DLU FRQGLWLRQHU LV LQVWDOOHG VHUYLFHG RSHQHG
WDPSHUHGUHSDLUHGHWFE\DQ\XQDXWKRUL]HGSHUVRQ
26
Warranty term
:2,/ZLOOQRWEHUHVSRQVLEOHIRUFRROLQJDQGFRQGHQVHUFRLOLIWKHDLUFRQGLWLRQHU
LV LQVWDOOHG QHDU WKH PXGG\ VHZDJHVDV WR[LF JDVHV DUH KDUPIXO IRU WKH $LU
&RQGLWLRQHU :2,/DEVROYHVDOOOLDELOLW\LQFDVHZKHUHWKHIROORZLQJVLWXDWLRQVDUHIRXQGE\WKH
VHUYLFHHQJLQHHUGXULQJWKHLUYLVLWVWRFXVWRPHUSUHPLVHVRQVHUYLFHFDOO
D)DXOW\6XEVWDQGDUGZLULQJXVHG
E'HIHFWLYH6WDELOL]HU
F'LUW\)LOWHU
G3DUWVGDPDJHGGXHWR5DWELWLQJ
,QFDVHVWKHDERYHFRQGLWLRQVDUHREVHUYHGDWWKHWLPHRIYLVLWE\WKH(QJLQHHUWKHQ
WKHFXVWRPHUVKDOOEHOLDEOHWREHDUWKHYLVLWFKDUJHVRI56RYHUDQGDERYHWKH
RWKHUUHSDLUFKDUJHVLQFXUUHGGXULQJWKHSURFHVV
7KH&RPSDQ\UHVHUYHVWKHULJKWWRUHYLVHWKHYLVLWFKDUJHVDWLWVRZQGLVFUHWLRQDQG
WKHFXVWRPHUZLOOEHOLDEOHWRSD\WKHUHYLVHGYLVLWFKDUJHVDVPD\EHDSSOLFDEOHRQ
WKHGDWHRIYLVLW
7KH FXVWRPHU DW DOO WLPHV VKDOO SUHVHUYH WKH RULJLQDO LQYRLFH IRU QHFHVVDU\
YHULILFDWLRQDQGSURGXFHDVDQGZKHQUHTXLUHGE\:2,/
:2,/UHVHUYHVWKHULJKWWRDOWHUWKHWHUPVDQGFRQGLWLRQVRIWKHSUHVHQWZDUUDQW\DW
DQ\WLPHZLWKLWVVROHGLVFUHWLRQZLWKRXWDQ\SULRUQRWLFH
27
28
:KLUOSRRORI,QGLD/WG
&XVWRPHU&RS\
,QVWDOODWLRQ'HPR&KHFN6KHHW$LUFRQGLWLRQHU
&XVWRPHU0DFKLQHGHWDLOV
'DWHRI,QVSHFWLRQ
%UDQFK
&XVWRPHU1DPH$GGUHVV
631DPH
0RGHO1R
'DWHRI3XUFKDVH'23
0DFKLQH6UQR
3KRQHQR
,'86U1R
0RELOH1R
2'86U1R
3XUFKDVHGIURP'HDOHU1DPH
,QVWDOOHG%\,QVWDOOHU
V1DPH
66'730RGHUQ7UDGH,QVWLWXWLRQDOVDOH2WKHUV
66'7363/RFDO
,'8/RFDWLRQ
2N1RW2N
2'8ORFDWLRQ
,'8OHYHO&KHFNZLWK6SULWOHYHO
2N1RW2N
/HQJWKRI&RSSHUSLSH
'UDLQ3LSHVORSH
2N1RW2N
'LVWDQFH%HWZHHQ,'82'8
,QVWDOODWLRQ&RQGLWLRQV6$&
2N1RW2N
(OHFWULFDO2WKHUGHWDLO
&RQGLWLRQRI+RXVH:LULQJ
$PS6WDELOL]HU
0&%5DWLQJ
<HV1R
0DNH
(DUWKLQJFRQGLWLRQV
,I9ROWDJHEHWZHHQ(1LV9$GYLVH
&XVWRPHUWRFRQVXOWDQHOHFWULFLDQ
6WDELOL]HU,QSXW
9ROWV
6WDELOL]HU2XWSXW
9ROWV
$PSHUV'UDZQ
3(5)250$1&(5810$&+,1()250,187(6 &+(&.7+()2//2:,1*
$PELHQW7HPSR&
'HOWD7 77VKRXOGEHDSSUR[7RR&
$LU,QOHW7HPSR&7
*ULOO7HPSR&7
)HDWXUHV([SODQDWLRQV
&RROPRGH
<HV1R
'LPIXQFWLRQ
<HV1R
'U\0RGH
<HV1R
$URXQG8
<HV1R
)DQ0RGH
<HV1R
<HV1R
7XUER4XLFN&RRO
<HV1R
)LOWHU&OHDQLQJPHWKRG
5HVHWWLQJ)LOWHU
FOHDQLQJ/('
6OHHSPRGH
<HV1R
3RZHU6DYHU
<HV1R
6ZLQJ
<HV1R
WK6HQVH
<HV1R
7LPHUVHWWLQJ
<HV1R
7HPSHUDWXUHVHWWLQJ
<HV1R
<HV1R
*ULOODQG3ODVWLFSDUWVEH\RQGGD\VIURPWKH'DWHRI3XUFKDVHDUHQRWFRYHUGXQGHUZDUUDQW\
1RWH0DQXIDFWXUHUDEVROYHDOOOLDELOLW\LIIROORZLQJVLWXDWLRQVDUHREVHUYHGE\6HUYLFH(QJLQHHU
$)DXOW\6XE6WDQGDUG:LULQJ
&6WDELOL]HU1:3/'HIHFWLYH
%)LOWHUFOHDQLQJ
'5H'HPR
,QFDVHDERYHVLWXDWLRQVDUHQRWLFHGE\6HUYLFH(QJLQHHU:LWKLQ<UIURP'239LVLWFKDUJHVRI5VZLOOEHSD\DEOHE\
WKHFXVWRPHURYHUDQGDERYHWKHWKHRWKHUUHSDLULQJFKDUJHVLIDSSOLFDEOHLQFXUUHGGXULQJWKHSURFHVV
1DPH6LJQRI(QJLQHHU
29
&XVWRPHUV6LJQDWXUH
,KDYHXQGHUVWRRGDOOWKHZDUUDQW\WHUPV
Installation commissioning
813$&.,1*
6UQR &KHFNSRLQWV
0DFKLQHFKHFNHGIRUGDPDJHV'DPDJHVREVHUYHG
2EVHUYDWLRQV
<HV1R
5HPDUNV
,I\HVSURYLGHGHWDLOV
5HPRYHKDQGXQLWIURP,'8
<HV1R
5HPRYH)LEUHWDSHVIURPWKHIURQWFRYHU
<HV1R
,VWKHVWUHQJWKRILQVWDOODWLRQHQRXJKERWK,'82'8
'LUHFWLRQRIFRQGHQVRURIPDFKLQHLVWRZDUGV
7KHXQLWLVVHFXUHGIL[HGZLWKKDQJHUSODWH
<HV1R
1RUWK6RXWK:HVW(DVW
<HV1R
<HV1R
<HV1R
<HV1R
<HV1R
%UHGWKZLVHOHYHO'HSWKZLVHLQFOLQDWLRQRIURRPDLUFRQGLWLRQHUDUHQRUPDO
DQGQRDLUORFNVLVLQWKHGUDLQSLSH
7KHKHDWLQVXODWLYHPDWHULDOLVVHFXUHO\DWWDFKHGRQWKHFRQQHFWLRQVRIWKH
SLSLQJVRIWKH,'8
3XWSXWW\WRFORVHSLSLQJKROHLQVLGHRXWVLGHRIWKHZDOOWRDYRLGDLUOHDNDJH
LQVWDOODWLRQ
7KHUHLVQRREVWDFOHVDERXWWKHDLURXWOHWV
*DV/HDNDJHLVFKHFNHGDWHDFKRIWKHSLSHFRQQHFWLRQV
7KHYROWDJHDWWKHH[FOXVLYHSRZHURXWOHWLVZLWKLQWKHUDQJHRIUDWHGYROWDJH
<HV1R
,VWKHIXVHDQGZLUHJDXJHXVHGDUHWKHRIIROORZLQJVSHFLILFDWLRQ
$OZD\VXVHYROWDJHVWDEOLVHU
<HV1R
30
:KLUOSRRORI,QGLD/WG
&RPSDQ\&RS\
,QVWDOODWLRQ'HPR&KHFN6KHHW$LUFRQGLWLRQHU
&XVWRPHU0DFKLQHGHWDLOV
'DWHRI,QVSHFWLRQ
%UDQFK
&XVWRPHU1DPH$GGUHVV
631DPH
0RGHO1R
'DWHRI3XUFKDVH'23
0DFKLQH6UQR
3KRQHQR
,'86U1R
0RELOH1R
2'86U1R
3XUFKDVHGIURP'HDOHU1DPH
,QVWDOOHG%\,QVWDOOHU
V1DPH
66'730RGHUQ7UDGH,QVWLWXWLRQDOVDOH2WKHUV
66'7363/RFDO
,'8/RFDWLRQ
2N1RW2N
2'8ORFDWLRQ
,'8OHYHO&KHFNZLWK6SULWOHYHO
2N1RW2N
/HQJWKRI&RSSHUSLSH
'UDLQ3LSHVORSH
2N1RW2N
'LVWDQFH%HWZHHQ,'82'8
,QVWDOODWLRQ&RQGLWLRQV6$&
2N1RW2N
(OHFWULFDO2WKHUGHWDLO
&RQGLWLRQRI+RXVH:LULQJ
$PS6WDELOL]HU
0&%5DWLQJ
<HV1R
0DNH
(DUWKLQJFRQGLWLRQV
,I9ROWDJHEHWZHHQ(1LV9$GYLVH
&XVWRPHUWRFRQVXOWDQHOHFWULFLDQ
6WDELOL]HU,QSXW
9ROWV
6WDELOL]HU2XWSXW
9ROWV
$PSHUV'UDZQ
3(5)250$1&(5810$&+,1()250,187(6 &+(&.7+()2//2:,1*
$PELHQW7HPSR&
'HOWD7 77VKRXOGEHDSSUR[7RR&
$LU,QOHW7HPSR&7
*ULOO7HPSR&7
)HDWXUHV([SODQDWLRQV
&RROPRGH
<HV1R
'LPIXQFWLRQ
<HV1R
'U\0RGH
<HV1R
$URXQG8
<HV1R
)DQ0RGH
<HV1R
<HV1R
7XUER4XLFN&RRO
<HV1R
)LOWHU&OHDQLQJPHWKRG
5HVHWWLQJ)LOWHU
FOHDQLQJ/('
6OHHSPRGH
<HV1R
3RZHU6DYHU
<HV1R
6ZLQJ
<HV1R
WK6HQVH
<HV1R
7LPHUVHWWLQJ
<HV1R
7HPSHUDWXUHVHWWLQJ
<HV1R
<HV1R
*ULOODQG3ODVWLFSDUWVEH\RQGGD\VIURPWKH'DWHRI3XUFKDVHDUHQRWFRYHUGXQGHUZDUUDQW\
1RWH0DQXIDFWXUHUDEVROYHDOOOLDELOLW\LIIROORZLQJVLWXDWLRQVDUHREVHUYHGE\6HUYLFH(QJLQHHU
$)DXOW\6XE6WDQGDUG:LULQJ
&6WDELOL]HU1:3/'HIHFWLYH
%)LOWHUFOHDQLQJ
'5H'HPR
,QFDVHDERYHVLWXDWLRQVDUHQRWLFHGE\6HUYLFH(QJLQHHU:LWKLQ<UIURP'239LVLWFKDUJHVRI5VZLOOEHSD\DEOHE\
WKHFXVWRPHURYHUDQGDERYHWKHWKHRWKHUUHSDLULQJFKDUJHVLIDSSOLFDEOHLQFXUUHGGXULQJWKHSURFHVV
1DPH6LJQRI(QJLQHHU
31
&XVWRPHUV6LJQDWXUH
,KDYHXQGHUVWRRGDOOWKHZDUUDQW\WHUPV
32
Declaration on Hazardous Substances : EWaste Rules
Some components used in manufacturing this Air Conditioner contain low content of some
Government of India. These do not pose any risk to the conditioning of air inside the room.
Nor does physical contact with the Air Conditioner during the life of the product
endanger health or safety to humans or any living creature. However, if the Air Conditioner
is not disposed safely at the end of its life, inappropriate handling of waste may pose risks
to health and environment. Hence, it is our advice that you contact Whirlpool when you
are ready to discard the product so that we can channelize the appliance and its
components for safe disposal.
33
Was this manual useful for you? yes no
Thank you for your participation!

* Your assessment is very important for improving the work of artificial intelligence, which forms the content of this project

Download PDF

advertisement