Top-Freezer
Refrigerators
GEAppliances.com
Safety Instructions . . . . . . . . . . 2–4
Operating Instructions
Temperature Controls . . . . . . . . . . . . . .5
Shelves . . . . . . . . . . . . . . . . . . . . . . . . . 5, 6
Storage Drawers . . . . . . . . . . . . . . . . 6, 7
Automatic Icemaker . . . . . . . . . . . . . . . .7
Care and Cleaning . . . . . . . . . . . . . . . . .8
Owner’s Manual and
Installation Instructions
Models 16, 17, 18
Installation Instructions
Preparing to Install
the Refrigerator . . . . . . . . . . . . . . . . . . . .9
Water Line Installation . . . . . . . . 10–12
Reversing the Door Swing . . . . . 13–16
Troubleshooting Tips
Normal Operating Sounds . . . . . . . . 17
Before You Call For Service ...... 18, 19
Consumer Support
Refrigerator Warranty . . . . . . . . . . 23
Consumer Support . . . . . . Back Cover
Write the model and serial
numbers here:
Model # ____________________
Serial # _____________________
<RXFDQ¿QGWKHPRQDODEHORQ
the upper left side of the fresh food
compartment.
197D8622P001 49-60655-3 09-13 GE
IMPORTANT SAFETY INFORMATION.
READ ALL INSTRUCTIONS BEFORE USING.
DANGER! RISK OF CHILD ENTRAPMENT
PROPER DISPOSAL OF THE REFRIGERATOR
&KLOGHQWUDSPHQWDQGVXȺRFDWLRQDUHQRWSUREOHPVRI
WKHSDVW-XQNHGRUDEDQGRQHGUHIULJHUDWRUVDUHVWLOO
GDQJHURXV«HYHQLIWKH\ZLOOVLWIRU´MXVWDIHZGD\Vµ,I
you are getting rid of your old refrigerator, please follow
WKHLQVWUXFWLRQVEHORZWRKHOSSUHYHQWDFFLGHQWV
Before You Throw Away Your Old
Refrigerator or Freezer:
Refrigerants
All refrigeration products contain refrigerants, which
XQGHUIHGHUDOODZPXVWEHUHPRYHGSULRUWRSURGXFW
disposal. If you are getting rid of an old refrigeration
product, check with the company handling the
GLVSRVDODERXWZKDWWRGR
„7DNHRȺWKHGRRUV
„ Leave the shelves in place so that children may not
HDVLO\FOLPELQVLGH
„,IWKHUHIULJHUDWRUKDVDORFNPDNHLWXQXVDEOH
USE OF EXTENSION CORDS
Because of potential safety hazards under certain conditions, we strongly recommend against the
XVHRIDQH[WHQVLRQFRUG
+RZHYHULI\RXPXVWXVHDQH[WHQVLRQFRUGLWLVDEVROXWHO\QHFHVVDU\WKDWLWEHD8/OLVWHGZLUHJURXQGLQJW\SH
DSSOLDQFHH[WHQVLRQFRUGKDYLQJDJURXQGLQJW\SHSOXJDQGRXWOHWDQGWKDWWKHHOHFWULFDOUDWLQJRIWKHFRUGEH
DPSHUHVPLQLPXPDQGYROWV
IMPORTANTE INFORMACIÓN DE SEGURIDAD.
LEA TODAS LAS INSTRUCCIONES ANTES DE SU USO.
¡PELIGRO! RIESGO DE ENCIERRO DE NIÑOS
DESECHE EL REFRIGERADOR CORRECTAMENTE
(OHQFLHUURRVRIRFDFLyQGHQLxRVQRHVXQSUREOHPD
del pasado. Los refrigeradores desechados o
DEDQGRQDGRVVRQWRGDYtDSHOLJURVLQFOXVRVL
VyORYDQDSHUPDQHFHU´XQRVSRFRVGtDVµ6LYD
a desechar su refrigerador, por favor siga las
siguientes instrucciones para ayudar a evitar
accidentes.
Antes de desechar su viejo refrigerador o
congelador:
„ Retire las puertas y deséchelas de forma
separada.
„Deje los estantes en su lugar de manera que los
QLxRVQRSXHGDQVXELUIiFLOPHQWH
„ Si el refrigerador tiene una llave, póngala en uso.
Refrigerantes
Todos los aparatos de refrigeración contienen
UHIULJHUDQWHVORVFXDOHVVHGHEHQUHWLUDUDQWHVGH
la eliminación del producto de acuerdo con la ley
federal. Si va a desechar algún aparato antiguo de
UHIULJHUDFLyQFRQVXOWHFRQODFRPSDxtDDFDUJR
GHGHVHFKDUHODSDUDWRSDUDVDEHUTXpKDFHU
USO DE CABLES DE EXTENSIÓN
'HELGRDSHOLJURVSRWHQFLDOHVGHVHJXULGDGEDMRFLHUWDVFRQGLFLRQHVQRVRSRQHPRVDOXVRGHFDEOHVGHH[WHQVLyQ
6LQHPEDUJRVLGHEHXVDUXQFDEOHGHH[WHQVLyQHVDEVROXWDPHQWHQHFHVDULRTXHVHDXQWLSRGHFDEOHGH
H[WHQVLyQSDUDDSDUDWRVFRQFRQH[LyQDWLHUUDGHWUHVFDEOHVTXHHVWpHQODOLVWDGH8/HQORV(VWDGRV8QLGRVRHQ
ODOLVWD&6$HQ&DQDGiTXHWHQJDXQHQFKXIHGHWLSRFRQH[LyQDWLHUUD\VDOLGD\TXHHOJUDGRHOpFWULFRGHOFDEOH
VHDGHDPSHULRVPtQLPR\YROWLRV
2
IMPORTANT SAFETY INFORMATION.
READ ALL INSTRUCTIONS BEFORE USING.
GEAppliances.com
WARNING!
8VHWKLVDSSOLDQFHRQO\IRULWVLQWHQGHGSXUSRVHDVGHVFULEHGLQWKLV2ZQHU·V0DQXDO
SAFETY PRECAUTIONS
:KHQXVLQJHOHFWULFDODSSOLDQFHVEDVLFVDIHW\SUHFDXWLRQVVKRXOGEHIROORZHGLQFOXGLQJWKHIROORZLQJ
NOTE: :HVWURQJO\UHFRPPHQGWKDWDQ\VHUYLFLQJEH
„7KLVUHIULJHUDWRUPXVWEHSURSHUO\LQVWDOOHGDQGORFDWHG
SHUIRUPHGE\DTXDOL¿HGLQGLYLGXDO
LQDFFRUGDQFHZLWKWKH,QVWDOODWLRQ,QVWUXFWLRQVEHIRUH
it is used.
„ In refrigerators with automatic icemakers, avoid
contact with the moving parts of the ejector
„'RQRWDWWHPSWWRRUDOORZFKLOGUHQWRFOLPEVWDQG
PHFKDQLVPRUZLWKWKHKHDWLQJHOHPHQWORFDWHGRQ
or hang on the shelves in the refrigerator. They
WKHERWWRPRIWKHLFHPDNHUWKDWUHOHDVHVWKHFXEHV
could damage the refrigerator and seriously injure
'RQRWSODFH¿QJHUVRUKDQGVRQWKHDXWRPDWLF
themselves.
icemaking mechanism while the refrigerator is
„ Do not touch the cold surfaces in the freezer
plugged in.
compartment when hands are damp or wet. Skin may
„ Turning the temperature control to the OFF position
VWLFNWRWKHVHH[WUHPHO\FROGVXUIDFHV
does not remove power to the light circuit.
„'RQRWVWRUHRUXVHJDVROLQHRURWKHUÀDPPDEOH
„ Do not refreeze frozen foods which have thawed
vapors and liquids in the vicinity of this or any other
completely.
appliance.
„.HHS¿QJHUVRXWRIWKH´SLQFKSRLQWµDUHDVFOHDUDQFHV „ Before replacing a burned-out light bulb, the
refrigerator should be unplugged in order to avoid
EHWZHHQWKHGRRUVDQGEHWZHHQWKHGRRUVDQG
FRQWDFWZLWKDOLYHZLUH¿ODPHQW$EXUQHGRXWOLJKW
FDELQHWDUHQHFHVVDULO\VPDOO%HFDUHIXOFORVLQJGRRUV
PD\EUHDNZKHQEHLQJUHSODFHG
when children are in the area.
„8QSOXJWKHUHIULJHUDWRUEHIRUHFOHDQLQJDQGPDNLQJ
repairs.
IMPORTANTE INFORMACIÓN DE SEGURIDAD.
LEA TODAS LAS INSTRUCCIONES ANTES DE SU USO.
¡ADVERTENCIA!
8VHHVWHDSDUDWRVyORFRQHO¿QSDUDHOFXDOIXHGLVHxDGRFRPRVHGHVFULEHHQHVWH0DQXDOGHOSURSLHWDULR
MESURES DE SÉCURITÉ
$OXVDUDSDUDWRVHOpFWULFRVVHGHEHQVHJXLUSUHFDXFLRQHVEiVLFDVGHVHJXULGDGLQFOX\HQGRODVVLJXLHQWHV
„ No intente ni permita que los niños se trepen, paren
o cuelguen de los estantes del refrigerador. Este
UHIULJHUDGRUGHEHLQVWDODUVH\XELFDUVHFRUUHFWDPHQWH
según las Instrucciones de instalación antes de su
uso.
„ No intente ni permita que los niños se trepen, paren
RFXHOJXHQGHORVHVWDQWHVGHOUHIULJHUDGRU3RGUtDQ
dañar el refrigerador y sufrir graves daños.
„1RWRTXHODVVXSHU¿FLHVIUtDVHQHOFRPSDUWLPLHQWR
del congelador con las manos húmedas o
PRMDGDV/DSLHOVHSXHGHSHJDUDHVWDVVXSHU¿FLHV
H[WUHPDGDPHQWHIUtDV
„ No almacene o use gasolina u otros vapores y
OtTXLGRVLQÀDPDEOHVHQODViUHDVFHUFDQDVDHVWHRD
cualquier otro aparato.
„0DQWHQJDORVGHGRVDOHMDGRVGHODViUHDVHVWUHFKDV
los espacios entre las puertas y entre las puertas y
ORVJDELQHWHVVRQQHFHVDULDPHQWHSHTXHxRV7HQJD
cuidado al cerrar las puertas cuando haya niños en el
iUHD
„ Desconecte el refrigerador antes de limpiar y hacer
reparaciones.
127$5HFRPHQGDPRVHQIiWLFDPHQWHTXHFXDOTXLHU
VHUYLFLRVHDUHDOL]DGRSRUXQLQGLYLGXRFDOL¿FDGR
„(QORVUHIULJHUDGRUHVFRQPiTXLQDVGHKLHOR
DXWRPiWLFDVHYLWHHOFRQWDFWRFRQOas partes en
movimiento del mecanismo eyector, o con el
HOHPHQWRGHFDOHIDFFLyQXELFDGRHQODSDUWHLQIHULRU
GHODPiTXLQDGHKLHORVTXHH[SXOVDORVFXERV1R
coloque los dedos o las manos en el mecanismo de
ODPiTXLQDGHKLHORVPLHQWUDVHOUHIULJHUDGRUHVWp
conectado.
„ Girar el control de temperatura a la posición apagado
no retira la corriente del circuito de luz.
„ No vuelva a congelar alimentos que se han
descongelado por completo.
„ Antes de reemplazar una lámpara de luz quemada,
se deberá desenchufar HOUHIULJHUDGRUD¿QGHHYLWDU
HOFRQWDFWRFRQHO¿ODPHQWRTXHD~QWLHQHFRUULHQWH
8QDOiPSDUDGHOX]TXHPDGDVHSXHGHTXHEUDUDO
VHUUHHPSOD]DGD
3
IMPORTANT SAFETY INFORMATION.
READ ALL INSTRUCTIONS BEFORE USING.
WARNING!
HOW TO CONNECT ELECTRICITY
'RQRWXQGHUDQ\FLUFXPVWDQFHVFXWRUUHPRYHWKHWKLUGJURXQGSURQJIURPWKHSRZHUFRUG
)RUSHUVRQDOVDIHW\WKLVDSSOLDQFHPXVWEHSURSHUO\JURXQGHG
The power cord of this appliance is equipped with a 3-prong
JURXQGLQJSOXJZKLFKPDWHVZLWKDVWDQGDUGSURQJ
JURXQGLQJZDOORXWOHWWRPLQLPL]HWKHSRVVLELOLW\RIHOHFWULF
shock hazard from this appliance.
+DYHWKHZDOORXWOHWDQGFLUFXLWFKHFNHGE\DTXDOL¿HG
electrician to make sure the outlet is properly grounded.
Where a ungrounded 2-prong wall outlet is encountered,
LWLV\RXUSHUVRQDOUHVSRQVLELOLW\DQGREOLJDWLRQWRKDYHLW
replaced with a properly grounded 3-prong wall outlet.
7KHUHIULJHUDWRUVKRXOGDOZD\VEHSOXJJHGLQWRLWVRZQ
individual electrical outlet which has a voltage, wattage and
frequency that match the rating plate.
7KLVSURYLGHVWKHEHVWSHUIRUPDQFHDQGDOVRSUHYHQWV
RYHUORDGLQJKRXVHZLULQJFLUFXLWVZKLFKFRXOGFDXVHD¿UH
hazard from overheated wires.
1HYHUXQSOXJ\RXUUHIULJHUDWRUE\SXOOLQJRQWKHSRZHUFRUG
$OZD\VJULSSOXJ¿UPO\DQGSXOOVWUDLJKWRXWIURPWKHRXWOHW
Repair or replace immediately all power cords that have
EHFRPHIUD\HGRURWKHUZLVHGDPDJHG'RQRWXVHDFRUG
WKDWVKRZVFUDFNVRUDEUDVLRQGDPDJHDORQJLWVOHQJWKRUDW
either end.
:KHQPRYLQJWKHUHIULJHUDWRUDZD\IURPWKHZDOOEH
careful not to roll over or damage the power cord.
READ AND FOLLOW THIS SAFETY INFORMATION CAREFULLY.
SAVE THESE INSTRUCTIONS
IMPORTANTE INFORMACIÓN DE SEGURIDAD.
LEA TODAS LAS INSTRUCCIONES ANTES DE SU USO.
¡ADVERTENCIA!
CÓMO CONECTAR LA ELECTRICIDAD
%DMRQLQJXQDFLUFXQVWDQFLDQRFRUWHQLUHWLUHODWHUFHUDSDWDFRQH[LyQDWLHUUDGHOFDEOHGHHOHFWULFLGDG3RU
VHJXULGDGSHUVRQDOHVWHDSDUDWRGHEHHVWDUFRUUHFWDPHQWHFRQHFWDGRDWLHUUD
(OFDEOHHOpFWULFRGHHVWHDSDUDWRHVWiSURYLVWRGHXQ
(VWRRIUHFHHOPHMRUGHVHPSHxR\WDPELpQHYLWD
HQFKXIHGHWUHVSDWDVFRQH[LyQDWLHUUDTXHHQFDMD
VREUHFDUJDUORVFLUFXLWRVHOpFWULFRVGHODFDVDTXH
HQXQWRPDFRUULHQWHHVWiQGDUGHRUL¿FLRVFRQH[LyQ
SRGUtDQFDXVDUXQLQFHQGLRDSDUWLUGHORVFDEOHV
DWLHUUDSDUDPLQLPL]DUODSRVLELOLGDGGHSHOLJURGHXQ
recalentados.
choque eléctrico de este aparato.
1XQFDGHVFRQHFWHVXUHIULJHUDGRUKDODQGRGHOFDEOH
Haga que el tomacorriente de la pared y el circuito
HOpFWULFR6LHPSUHWRPHHOHQFKXIH¿UPHPHQWH\KiOHOR
VHDQUHYLVDGRVSRUXQHOHFWULFLVWDFDOL¿FDGRSDUD
directamente del tomacorriente.
DVHJXUDUTXHHOWRPDFRUULHQWHWLHQHODFRQH[LyQDWLHUUD 5HSDUHRUHHPSODFHGHLQPHGLDWRWRGRVORVFDEOHV
apropiada.
eléctricos que se hayan desgastado o dañado. No use
En caso de contar con un tomacorriente de pared
XQFDEOHTXHWHQJDJULHWDVRGDxRVGHDEUDVLyQHQVX
GHFODYLMDVHVVXUHVSRQVDELOLGDG\REOLJDFLyQ
ORQJLWXGRHQFXDOTXLHUH[WUHPR
reemplazarlo por un tomacorriente de pared de 3
Al retirar el refrigerador de la pared, tenga cuidado de no
clavijas correctamente conectado a tierra.
HQUROODURGDxDUHOFDEOHHOpFWULFR
(OUHIULJHUDGRUGHEHUtDHVWDUVLHPSUHFRQHFWDGRDXQ
HQFKXIHHVSHFt¿FRFRQXQtQGLFHGHYROWDMHYDWDMH\
IUHFXHQFLDHTXLYDOHQWHVORVTXH¿JXUDQHQVXHWLTXHWD
GHFDUDFWHUtVWLFDVWpFQLFDV
LEA Y SIGA CUIDADOSAMENTE ESTA INFORMACIÓN DE SEGURIDAD.
CONSERVE ESTAS INSTRUCCIONES
4
About the temperature control dial.
GEAppliances.com
Turning the dial to OFF VWRSVFRROLQJLQERWKFRPSDUWPHQWV³IUHVKIRRGDQGIUHH]HU,WGRHVQRWVKXWRȺSRZHUWR
the refrigerator.
OF
F
OF
F
Temperature Control Dial RQVRPHPRGHOV
The temperature control dial adjust refrigerator from warmest to coldest.
The recommended factory setting is shown in illustration to the left. For colder
WHPSHUDWXUHWXUQGLDOFORFNZLVHWRZDUGVQRZÀDNH)RUZDUPHUWHPSHUDWXUHWXUQ
GLDOFRXQWHUFORFNZLVHDZD\IURPVQRZÀDNHDOORZKRXUVIRUDGMXVWPHQW
OF
F
OF
F
Recommened
factory setting
Coldest setting
Warmest setting
About the fresh food compartment shelves.
Shelf supports at various levels allow you to custom-space your shelves. Not all features are on all models.
Half-Width Shelves
2 Lift up and out
1 Tilt up
One end of the shelf rests on a molded side-wall
VXSSRUWDEUDFNHWRQWKHRWKHUHQGKRRNVLQWR
DWUDFNRQWKHUHDUFDELQHWZDOO
7RUHPRYHOLIWWKHVKHOIXSDWIURQWWKHQRȺWKH
support and out of the track.
To replace, select desired shelf height. With
VKHOIIURQWUDLVHGVOLJKWO\KRRNWKHEUDFNHW·VWRS
lug into the track, then lower the shelf onto the
support.
NOTE: The shelf to the right of the track is
GHVLJQHGWRKRRNLQWRWKHULJKWKDQGVORWWKH
shelf to the left is designed
to hook into the left-hand
slot.
Full-Width Shelves
Lift rear
Pull forward
Some models have a stationary tempered
glass shelf, a spillproof shelf, or two steel
wire stationary shelves. These shelves can
EHPRYHGWRDQRWKHUSODFHLQWKHIUHVKIRRG
compartment.
When placed correctly on the shelf supports,
WKHVKHOIZLOOVWRSEHIRUHFRPLQJFRPSOHWHO\
out of the refrigerator and will not tilt when
you place food on it or remove food from it.
Lift rear
Pull forward and down
To remove a full-width shelf when the
fresh food compartment door cannot
EHRSHQHGIXOO\
To remove the full-width shelves
5
About the freezer compartment shelves.
Step Shelf RQVRPHPRGHOV
7RUHPRYHWKHVWHSVKHOI
Lift left side of shelf slightly.
1
2
3
1
Move shelf to the left to free its right ends
2 IURPKROHVLQWKHFDELQHWZDOO
Lower right side of shelf, move shelf to the
3 right
and take it out.
To replace the step shelf:
1 :LWKVKHOIWLOWHGDVVKRZQ¿WOHIWHQGVRI
VKHOILQWRKROHVLQFDELQHWZDOO
Lift left side of shelf slightly, swing shelf up,
2 ¿WULJKWHQGVRIVKHOILQWRKROHVLQFDELQHW
wall, and lower shelf into place.
Ice Trays RQVRPHPRGHOV
,FHWUD\VDUHGHVLJQHGWRUHOHDVHLFHFXEHV
easily. Hold tray upside-down over a
FRQWDLQHUDQGWZLVWERWKHQGVWRUHOHDVH
FXEHV
For only one or two ice cubes, leave the tray
ULJKWVLGHXSWZLVWERWKHQGVVOLJKWO\DQG
UHPRYHGHVLUHGQXPEHURIFXEHV Wash ice
trays and storage bin in lukewarm water
only. Do not put them in an automatic
dishwasher.
About the storage drawers.
Not all features are on all models.
Fruit and Vegetable Drawers
([FHVVZDWHUWKDWPD\DFFXPXODWHLQWKH
ERWWRPRIWKHGUDZHUVVKRXOGEHHPSWLHG
and the drawers wiped dry.
Snacks Drawer
7KHVQDFNVGUDZHUFDQEHPRYHGWRWKH
PRVWXVHIXOORFDWLRQIRU\RXUIDPLO\·VQHHGV
Adjustable Humidity Drawer RQVRPHPRGHOV
Slide the control all the way to the
HIGH setting to provide high humidity
UHFRPPHQGHGIRUPRVWYHJHWDEOHV
6
Slide the control all the way to the LOW
setting to provide lower humidity levels
recommended for most fruits.
About storage drawer and cover removal.
GEAppliances.com
Not all features are on all models.
Drawer and Cover Removal
'UDZHUVFDQEHUHPRYHGHDVLO\E\JUDVSLQJ
the sides and lifting up slightly while pulling
drawers past the stop location.
7RUHPRYHWKHFRYHUOLIWLWRȺLWVVXSSRUWV
pull it forward, tilt it and take it out.
Twin Drawer Shelf
7RUHPRYH
Remove the drawers.
1
2
3
Reach in, push the front of glass cover up,
and at the same time, pull it forward as far
as it will come.
Tilt it and take it out. Avoid cleaning the cold
JODVVFRYHUZLWKKRWZDWHUEHFDXVHWKH
H[WUHPHWHPSHUDWXUHGLȺHUHQFHPD\FDXVHLW
WREUHDN
5HPRYHWKHGUDZHUIUDPH$OZD\VUHPRYH
WKHJODVVFRYHUEHIRUH\RXWDNHRXWWKH
GUDZHUIUDPH
/LIWWKHIUDPHRȺWKHVXSSRUWVDWHDFKVLGH
DQGEDFNSXOOLWIRUZDUGWLOWLWDQGWDNHLWRXW
7RUHSODFH
Lower the frame until it rests on the
VXSSRUWVDWHDFKVLGHDQGEDFN
Replace the glass cover, pushing its rear
HGJH¿UPO\LQWRWKHUHDUIUDPHFKDQQHO
and gently lowering the front into place.
Replace the drawers.
1
2
3
About the automatic icemaker.
$QHZO\LQVWDOOHGUHIULJHUDWRUPD\WDNHWRKRXUVWREHJLQPDNLQJLFH
7KHUHDUHW\SHVRILFHPDNHUV
Ice maker
ON
OFF
Feeler Arm
Power Switch
Power switch model
Feeler Arm
in the STOP
Feeler Arm in XSSRVLWLRQ
the ONGRZQ
position
Automatic Icemaker RQVRPHPRGHOV
7KHLFHPDNHUZLOOSURGXFHDSSUR[LPDWHO\
FXEHVLQDKRXUSHULRGGHSHQGLQJ
on the freezer compartment temperature, room
WHPSHUDWXUHQXPEHURIGRRURSHQLQJVDQGRWKHU
use conditions.
,IWKHUHIULJHUDWRULVRSHUDWHGEHIRUHWKHZDWHU
connection is made to the icemaker, set the switch
to OFF or move the feeler arm to the STOPXS
position.
:KHQWKHUHIULJHUDWRUKDVEHHQFRQQHFWHG
to the water supply, set the switch to the ON
position or move the feeler arm to the ON
GRZQSRVLWLRQ
7KHLFHPDNHUZLOO¿OOZLWKZDWHUZKHQLWFRROVWR
15°F. A newly-installed refrigerator may take 12 to
KRXUVWREHJLQPDNLQJLFHFXEHV
Once the icemaker starts to make ice, it may
WDNHXSWRKRXUVWR¿OOWKHELQGHSHQGLQJRQ
WKHWHPSHUDWXUHVHWWLQJVDQGQXPEHURIGRRU
openings.
<RXZLOOKHDUDEX]]LQJVRXQGHDFKWLPHWKH
LFHPDNHU¿OOVZLWKZDWHU
7KURZDZD\WKH¿UVWIHZEDWFKHVRILFHWRDOORZ
the water line to clear.
Be sure nothing interferes with the sweep of the
feeler arm.
:KHQWKHELQ¿OOVWRWKHOHYHORIWKHIHHOHUDUP
the icemaker will stop producing ice.
,WLVQRUPDOIRUVHYHUDOFXEHVWREHMRLQHG
together.
,ILFHLVQRWXVHGIUHTXHQWO\ROGLFHFXEHVZLOO
EHFRPHFORXG\WDVWHVWDOHVKULQNRUIXVH
together.
Icemaker Accessory Kit
If your refrigerator did not already come equipped
with an automatic icemaker, an icemaker
DFFHVVRU\NLWLVDYDLODEOHDWH[WUDFRVW
&KHFNWKHEDFNRIWKHUHIULJHUDWRUIRU
WKHVSHFL¿FLFHPDNHUNLWQHHGHGIRU
your model.
Feeler arm model
7
Care and cleaning of the refrigerator.
Cleaning the Outside
Moving the Refrigerator
The door handles and trimRQVRPHPRGHOV&OHDQZLWKD
cloth dampened with soapy water. Dry with a soft cloth.
Be careful when moving the refrigerator away from
WKHZDOO$OOW\SHVRIÀRRUFRYHULQJVFDQEHGDPDJHG
SDUWLFXODUO\FXVKLRQHGFRYHULQJVDQGWKRVHZLWKHPERVVHG
surfaces.
Keep the outside clean. Wipe with a clean cloth lightly
GDPSHQHGZLWKNLWFKHQDSSOLDQFHZD[RUPLOGOLTXLGGLVK
detergent. Dry and polish with a clean, soft cloth.
The stainless steel panels and door handles RQVRPH
PRGHOVFDQEHFOHDQHGZLWKDFRPPHUFLDOO\DYDLODEOH
VWDLQOHVVVWHHOFOHDQHU&OHDQHUVZLWKR[DOLFDFLGVXFKDV
Bar Keepers Friend® Soft Cleanser will remove rust, tarnish
DQGVPDOOEOHPLVKHV8VHRQO\DOLTXLGFOHDQVHUIUHHRIJULW
DQGUXELQWKHGLUHFWULRQRIWKHEUXVKOLQHVZLWKDGDPSVRIW
VSRQJH'RQRWXVHDSSOLDQFHZD[RUSROLVKRQWKHVWDLQOHVV
steel.
Do not wipe the refrigerator with a soiled dish cloth or wet
towel. These may leave a residue that can erode the paint.
Do not use scouring pads, powdered cleaners, bleach or
cleaners containing either bleach or ammonia because these
SURGXFWVFDQVFUDWFKDQGZHDNHQWKHSDLQW¿QLVK
Cleaning the Inside
To help prevent odorsOHDYHDQRSHQER[RIEDNLQJVRGDLQ
the fresh food and freezer compartments.
Unplug the refrigerator before cleaning.
,IWKLVLVQRWSUDFWLFDOZULQJH[FHVVPRLVWXUHRXWRIVSRQJH
or cloth when cleaning around switches, lights or controls.
8VHZDUPZDWHUDQGEDNLQJVRGDVROXWLRQ³DERXWD
WDEOHVSRRQPORIEDNLQJVRGDWRDTXDUWOLWHURIZDWHU
7KLVERWKFOHDQVDQGQHXWUDOL]HVRGRUV5LQVHDQGZLSHGU\
After cleaning the door gaskets, apply a thin layer of
petroleum jelly to the door gaskets at the hinge side. This
KHOSVNHHSWKHJDVNHWVIURPVWLFNLQJDQGEHQGLQJRXWRI
shape.
Avoid cleaning cold glass shelves (on some models) with
KRWZDWHUEHFDXVHWKHH[WUHPHWHPSHUDWXUHGLȺHUHQFH
may cause them to break. Handle glass shelves carefully.
Bumping tempered glass can cause it to shatter.
Do not wash any plastic refrigerator parts in the dishwasher.
Condenser
Cleaning the condenser coils.
There is no need for routine
condenser cleaning in normal
home operating environments.
However, in environments that
PD\EHSDUWLFXODUO\GXVW\RU
greasy, the condenser should
EHFOHDQHGSHULRGLFDOO\IRU
HȻFLHQWUHIULJHUDWRURSHUDWLRQ
To clean the condenser, turn the temperature control dial to
OFF. Sweep away or vacuum up dust.
)RUEHVWUHVXOWVXVHDEUXVKVSHFLDOO\GHVLJQHGIRUWKLV
SXUSRVH,WLVDYDLODEOHDWPRVWDSSOLDQFHSDUWVVWRUHV
8
Turn the leveling legs at each front corner of the refrigerator
counterclockwise until the rollers support the refrigerator. Pull
WKHUHIULJHUDWRUVWUDLJKWRXWDQGUHWXUQLWWRSRVLWLRQE\SXVKLQJ
it straight in. Moving the refrigerator in a side direction may
UHVXOWLQGDPDJHWRWKHÀRRUFRYHULQJRUUHIULJHUDWRU
When pushing the refrigerator back, make sure you don’t
roll over the power cord or icemaker supply line (on some
models).
$IWHUUROOLQJWKHUHIULJHUDWRUEDFNLQWRSODFHWXUQWKH
OHJVFORFNZLVHXQWLOWKHOHJVDJDLQEHDUWKHZHLJKWRIWKH
refrigerator.
Light Bulb Replacement
7RUHSODFHDEXUQHGRXWEXOEXQSOXJWKHUHIULJHUDWRUIURP
LWVHOHFWULFDORXWOHWXQVFUHZWKHEXOEZKHQFRRODQGUHSODFH
LWZLWKDQDSSOLDQFHEXOERIWKHVDPHRUORZHUZDWWDJH
Turning the control to the OFF position does not remove
power to the light circuit.
Preparing for Vacation
)RUORQJYDFDWLRQVRUDEVHQFHVUHPRYHIRRGDQGXQSOXJ
the refrigerator. Move the temperature control dial to the
OFFSRVLWLRQDQGFOHDQWKHLQWHULRUZLWKDEDNLQJVRGD
VROXWLRQRIRQHWDEOHVSRRQPORIEDNLQJVRGDWRRQH
TXDUWOLWHURIZDWHU/HDYHWKHGRRUVRSHQ
Move the feeler arm to the STOP XSSRVLWLRQRUPRYHWKH
switch to the OFF position on the slide switch model and
VKXWRȺWKHZDWHUVXSSO\WRWKHUHIULJHUDWRU
,IWKHWHPSHUDWXUHFDQGURSEHORZIUHH]LQJKDYHDTXDOL¿HG
VHUYLFHUGUDLQWKHZDWHUVXSSO\V\VWHPRQVRPHPRGHOVWR
SUHYHQWVHULRXVSURSHUW\GDPDJHGXHWRÀRRGLQJ
Preparing to Move
6HFXUHDOOORRVHLWHPVVXFKDVJULOOHVKHOYHVDQGGUDZHUVE\
taping them securely in place to prevent damage.
Be sure the refrigerator stays in an upright position during
moving.
Installation Instructions Models 16, 17, 18
If you have questions, call 1.800.GE.CARES or YLVLWRXU:HEVLWHDWGEAppliances.com
BEFORE YOU BEGIN
CLEARANCES
Read these instructions completely and carefully.
Allow the following clearances for ease of installation,
SURSHUDLUFLUFXODWLRQDQGSOXPELQJDQGHOHFWULFDO
connections.
‡
IMPORTANT – Save these instructions
IRUORFDOLQVSHFWRU·VXVH
‡
‡6LGHVµPP
‡7RSµPP
‡%DFNµPP
IMPORTANT – 2EVHUYHDOOJRYHUQLQJ
codes and ordinances.
‡ Note to Installer – Be sure to leave these
instructions with the Consumer.
‡ Note to Consumer – Keep these instructions
for future reference.
‡ Skill level – Installation of this appliance requires
EDVLFPHFKDQLFDOVNLOOV
‡ Completion time – Refrigerator Installation
15 minutes
Reversing the Door Swing
1 hour
‡ 3URSHULQVWDOODWLRQLVWKHUHVSRQVLELOLW\RIWKHLQVWDOOHU
‡ 3URGXFWIDLOXUHGXHWRLPSURSHULQVWDOODWLRQLVQRW
covered under the Warranty.
ROLLERS AND LEVELING LEGS
Leveling legs near each front corner of the refrigerator
DUHDGMXVWDEOH7KH\¿UPO\SRVLWLRQWKHUHIULJHUDWRU
and prevent it from moving when the doors are
RSHQHG/HYHOLQJOHJVVKRXOGEHVHWVRWKHIURQWRIWKH
refrigerator is raised just enough that the doors close
HDVLO\ZKHQRSHQHGDERXWKDOIZD\
Turn the leveling legs clockwise to raise the refrigerator,
counterclockwise to lower it.
RollersQH[WWRWKHOHYHOLQJOHJVDOORZ\RXWRPRYHWKH
refrigerator away from the wall for cleaning.
Turn the legs counterclockwise until the weight of the
refrigerator is transferred from them to the rollers. After
UROOLQJWKHUHIULJHUDWRUEDFNLQWRSODFHWXUQWKHOHJV
FORFNZLVHXQWLOWKHOHJVDJDLQEHDUWKHZHLJKWRIWKH
refrigerator.
WATER SUPPLY TO THE ICEMAKER (on
some models)
,IWKHUHIULJHUDWRUKDVDQLFHPDNHULWZLOOKDYHWREH
connected to a cold water line. A water supply kit
FRQWDLQLQJFRSSHUWXELQJVKXWRȺYDOYH¿WWLQJVDQG
LQVWUXFWLRQVLVDYDLODEOHDWH[WUDFRVWIURP\RXUGHDOHU
E\YLVLWLQJRXU:HEVLWHDWGEAppliances.com or from
Parts and Accessories, 1.877.959.8688.
REFRIGERATOR LOCATION
‡Do not install the refrigerator where the temperature
ZLOOJREHORZƒ)ƒ&EHFDXVHLWZLOOQRWUXQRIWHQ
enough to maintain proper temperatures.
‡,QVWDOOLWRQDÀRRUVWURQJHQRXJKWRVXSSRUWLWIXOO\
loaded.
9
Installation Instructions
1 INSTALLING THE WATER LINE (ON SOME MODELS)
WHAT YOU WILL NEED Cont
BEFORE YOU BEGIN
GE SmartConnect™5HIULJHUDWRU7XELQJ.LWVDUHDYDLODEOH
LQWKHIROORZLQJOHQJWKV
·P
²:;;
·P
²:;;
·P
²:;;
Recommended copper water supply kits are WX8X2,
:;;RU:;;GHSHQGLQJRQWKHDPRXQWRIWXELQJ
you need. Approved plastic water supply lines are GE
SmartConnect™5HIULJHUDWRU7XELQJ:;;
:;;DQG:;;
When connecting your refrigerator to a GE Reverse
Osmosis Water System, the only approved installation is
with a GE RVKit. For other reverse osmosis water systems,
IROORZWKHPDQXIDFWXUHU·VUHFRPPHQGDWLRQV
7KLVZDWHUOLQHLQVWDOODWLRQLVQRWZDUUDQWHGE\WKH
refrigerator or icemaker manufacturer. Follow these
LQVWUXFWLRQVFDUHIXOO\WRPLQLPL]HWKHULVNRIH[SHQVLYH
water damage.
:DWHUKDPPHUZDWHUEDQJLQJLQWKHSLSHVLQKRXVH
SOXPELQJFDQFDXVHGDPDJHWRUHIULJHUDWRUSDUWVDQG
OHDGWRZDWHUOHDNDJHRUÀRRGLQJ&DOODTXDOL¿HGSOXPEHU
WRFRUUHFWZDWHUKDPPHUEHIRUHLQVWDOOLQJWKHZDWHU
supply line to the refrigerator.
7RSUHYHQWEXUQVDQGSURGXFWGDPDJHGRQRWKRRNXS
the water line to the hot water line.
,I\RXXVH\RXUUHIULJHUDWRUEHIRUHFRQQHFWLQJWKHZDWHU
line, make sure the ice maker power switch is in the OFF
SRVLWLRQRQSRZHUVZLWFKPRGHOVRUWKH feeler arm in the
STOPXSSRVLWLRQRQIHHOHUDUPPRGHOV
'RQRWLQVWDOOWKHLFHPDNHUWXELQJLQDUHDVZKHUH
WHPSHUDWXUHVIDOOEHORZIUHH]LQJ
:KHQXVLQJDQ\HOHFWULFDOGHYLFHVXFKDVDSRZHUGULOO
GXULQJLQVWDOODWLRQEHVXUHWKHGHYLFHLVGRXEOHLQVXODWHG
or grounded in a manner to prevent the hazard of electric
VKRFNRULVEDWWHU\SRZHUHG
$OOLQVWDOODWLRQVPXVWEHLQDFFRUGDQFHZLWKORFDO
SOXPELQJFRGHUHTXLUHPHQWV
%HVXUHWKDWWKHNLW\RXVHOHFWDOORZVDWOHDVW·PDV
GHVFULEHGDERYH
NOTE: The only GE approved plastic tubing is that
supplied in GE SmartConnect™ Refrigerator Tubing kits.
Do not use any other plastic water supply line because
the line is under pressure at all times. Certain types of
plastic will crack or rupture with age and cause water
damage to your home.
‡A GE water supply kit FRQWDLQLQJWXELQJVKXWRȺYDOYH
DQG¿WWLQJVOLVWHGEHORZLVDYDLODEOHDWH[WUDFRVWIURP
your dealer or from Parts and Accessories.
‡A cold water supply 7KHZDWHUSUHVVXUHPXVWEH
EHWZHHQDQGSVL²EDU
‡Power drill.
‡1/2µ or adjustable wrench.
‡Straight and Phillips
blade screwdriver.
‡Two 1/4µ outer diameter
compression nuts and
2 ferrules (sleeves)³WRFRQQHFW
WKHFRSSHUWXELQJWRWKHVKXWRȺ
valve and the refrigerator water
valve.
OR
‡,I\RXDUHXVLQJD*(6PDUW&RQQHFW™ Refrigerator
7XELQJNLWWKHQHFHVVDU\¿WWLQJVDUHSUHDVVHPEOHGWR
WKHWXELQJ
‡,I\RXUH[LVWLQJFRSSHUZDWHUOLQHKDVDÀDUHG¿WWLQJ
at the end, you will need an adapterDYDLODEOHDW
SOXPELQJVXSSO\VWRUHVWRFRQQHFWWKHZDWHUOLQHWRWKH
refrigerator OR \RXFDQFXWRȺWKHÀDUHG¿WWLQJZLWKD
tube cutter DQGWKHQXVHDFRPSUHVVLRQ¿WWLQJ'RQRW
cut formed end from GE SmartConnect™ Refrigerator
WXELQJ
WARNING! &RQQHFWWRSRWDEOHZDWHU
supply only.
¡ADVERTENCIA! Conecte al
VXPLQLVWURGHDJXDSRWDEOHVRODPHQWH
WHAT YOU WILL NEED
‡Copper or GE SmartConnect™ Refrigerator Tubing kit,
µRXWHUGLDPHWHUWRFRQQHFWWKHUHIULJHUDWRUWRWKH
ZDWHUVXSSO\,IXVLQJFRSSHUEHVXUHERWKHQGVRIWKH
WXELQJDUHFXWVTXDUH
‡6KXWRȹYDOYH to connect to the cold water line. The
VKXWRȺYDOYHVKRXOGKDYHDZDWHULQOHWZLWKDPLQLPXP
LQVLGHGLDPHWHURIµDWWKHSRLQWRIFRQQHFWLRQWR
the COLD WATER LINE 6DGGOHW\SHVKXWRȺYDOYHVDUH
included in many water supply kits. Before purchasing,
make sure a saddle-type valve complies with your local
SOXPELQJFRGHV
7RGHWHUPLQHKRZPXFKWXELQJ\RXQHHGPHDVXUH
WKHGLVWDQFHIURPWKHZDWHUYDOYHRQWKHEDFNRIWKH
UHIULJHUDWRUWRWKHZDWHUVXSSO\SLSH7KHQDGG·
P%HVXUHWKHUHLVVXȻFLHQWH[WUDWXELQJDERXW·>
P@FRLOHGLQWRWXUQVRIDERXWµ>FP@GLDPHWHUWR
allow the refrigerator to move out from the wall after
installation.
10
Installation Instructions
,QVWDOOWKHVKXWRȺYDOYHRQWKHQHDUHVWIUHTXHQWO\XVHGGULQNLQJZDWHUOLQH
4 ROUTE THE TUBING
1 SHUT OFF THE MAIN WATER SUPPLY
AND UNPLUG REFRIGERATOR
5RXWHWKHWXELQJEHWZHHQWKHFROGZDWHUOLQHDQGWKH
refrigerator.
5RXWHWKHWXELQJWKURXJKDKROHGULOOHGLQWKHZDOORU
ÀRRUEHKLQGWKHUHIULJHUDWRURUDGMDFHQWEDVHFDELQHW
DVFORVHWRWKHZDOODVSRVVLEOH
NOTE:%HVXUHWKHUHLVVXȻFLHQWH[WUDWXELQJDERXW
IHHW>FP@FRLOHGLQWRWXUQVRIDERXWµ>FP@
GLDPHWHUWRDOORZWKHUHIULJHUDWRUWRPRYHRXWIURP
the wall after installation.
7XUQRQWKHQHDUHVWIDXFHWFRXQWHUFORFNZLVHORQJ
enough to clear the line of water.
2 DRILL THE HOLE FOR THE VALVE
Choose a location for the valve that is easily
DFFHVVLEOH,WLVEHVWWRFRQQHFWLQWRWKHVLGHRID
vertical water pipe. When it is necessary to connect
into a horizontal water pipe, make the connection to
WKHWRSRUVLGHUDWKHUWKDQDWWKHERWWRPWRDYRLG
GUDZLQJRȺDQ\VHGLPHQWIURPWKHZDWHUSLSH
5 CONNECT THE TUBING TO THE VALVE
3ODFHWKHFRPSUHVVLRQQXWDQGIHUUXOHVOHHYHIRU
FRSSHUWXELQJRQWRWKHHQGRIWKHWXELQJDQGFRQQHFW
LWWRWKHVKXWRȺYDOYH
0DNHVXUHWKHWXELQJLVIXOO\LQVHUWHGLQWRWKHYDOYH
Tighten the compression nut securely.
)RUSODVWLFWXELQJIURPD*(6PDUW&RQQHFW™
5HIULJHUDWRU7XELQJNLWLQVHUWWKHPROGHGHQGRIWKH
WXELQJLQWRWKHVKXWRȺYDOYHDQGWLJKWHQFRPSUHVVLRQ
nut until it is hand tight, then tighten one additional
turn with a wrench. Overtightening may cause leaks.
'ULOODµKROHLQWKHZDWHUSLSHHYHQLIXVLQJDVHOI
SLHUFLQJYDOYHXVLQJDVKDUSELW5HPRYHDQ\EXUUV
resulting from drilling the hole in the pipe. Take care
not to allow water to drain into the drill. Failure to
GULOODµKROHPD\UHVXOWLQUHGXFHGLFHSURGXFWLRQ
RUVPDOOHUFXEHV
Saddle-Type
6KXWRȺ9DOYH
SmartConnect™
7XELQJ
Packing Nut
3 FASTEN THE SHUTOFF VALVE
Compression
Nut
Outlet Valve
)DVWHQWKHVKXWRȺYDOYHWRWKHFROGZDWHUSLSHZLWKWKH
pipe clamp.
)HUUXOHVOHHYH
NOTE:&RPPRQZHDOWKRI0DVVDFKXVHWWV3OXPELQJ
&RGHV&05VKDOOEHDGKHUHGWR6DGGOHYDOYHV
are illegal and use is not permitted in Massachusetts.
&RQVXOWZLWK\RXUOLFHQVHGSOXPEHU
Tighten the clamp screws until the sealing washer
EHJLQVWRVZHOO
NOTE'RQRWRYHUWLJKWHQRU\RXPD\FUXVKWKHWXELQJ
Washer
Pipe Clamp
Inlet End
6 FLUSH OUT THE TUBING
Clamp
Screw
Saddle-Type
6KXWRȺ9DOYH
7XUQWKHPDLQZDWHUVXSSO\RQFRXQWHUFORFNZLVHDQG
ÀXVKRXWWKHWXELQJXQWLOWKHZDWHULVFOHDU
6KXWWKHZDWHURȺDWWKHZDWHUYDOYHDIWHUDERXW
RQHTXDUWOLWHURIZDWHUKDVEHHQÀXVKHGWKURXJK
WKHWXELQJ
Vertical Cold
Water Pipe
NOTE:&RPPRQZHDOWKRI0DVVDFKXVHWWV3OXPELQJ
&RGHV&05VKDOOEHDGKHUHGWR6DGGOHYDOYHV
are illegal and use is not permitted in Massachusetts.
&RQVXOWZLWK\RXUOLFHQVHGSOXPEHU
11
Installation Instructions
1 INSTALLING THE WATER LINE (CONT.)
7 CONNECT THE TUBING TO THE
8 TURN THE WATER
REFRIGERATOR
ON AT THE
SHUTOFF VALVE
NOTES:
‡%HIRUHPDNLQJWKHFRQQHFWLRQWRWKHUHIULJHUDWRUEH
sure the refrigerator power cord is not plugged into
the wall outlet.
‡:HUHFRPPHQGLQVWDOOLQJDZDWHU¿OWHULI\RXUZDWHU
supply has sand or particles that could clog the screen
RIWKHUHIULJHUDWRU·VZDWHUYDOYH,QVWDOOLWLQWKHZDWHU
line near the refrigerator. If using GE SmartConnect™
5HIULJHUDWRU7XELQJNLW\RXZLOOQHHGDQDGGLWLRQDOWXEH
:;;WRFRQQHFWWKH¿OWHU'RQRWFXWSODVWLF
WXEHWRLQVWDOO¿OWHU
Remove the access cover.
Tighten any connections
that leak.
9 INSTALLING THE REFRIGERATOR
Plug in the refrigerator.
$UUDQJHWKHFRLORIWXELQJVR
WKDWLWGRHVQRWYLEUDWHDJDLQVW
WKHEDFNRIWKHUHIULJHUDWRU
or against the wall. Push the
UHIULJHUDWRUEDFNWRWKHZDOO
5HPRYHWKHSODVWLFÀH[LEOH
cap from the water valve
UHIULJHUDWRUFRQQHFWLRQ
3ODFHWKHFRPSUHVVLRQQXWDQGIHUUXOHVOHHYHRQWR
WKHHQGRIWKHWXELQJDVVKRZQ2Q*(6PDUW&RQQHFW™
5HIULJHUDWRU7XELQJNLWWKHQXWVDUHDOUHDG\DVVHPEOHG
WRWKHWXELQJ
,QVHUWWKHHQGRIWKHWXELQJLQWRWKHZDWHUYDOYH
FRQQHFWLRQDVIDUDVSRVVLEOH:KLOHKROGLQJWKHWXELQJ
WLJKWHQWKH¿WWLQJ
)RUSODVWLFWXELQJIURPD*(6PDUW&RQQHFW™
5HIULJHUDWRU7XELQJNLWLQVHUWWKHPROGHGHQGRIWKH
WXELQJLQWRWKHVKXWRȺYDOYHDQGWLJKWHQFRPSUHVVLRQ
nut until it is hand tight, then tighten one additional
turn with a wrench. Overtightening may cause leaks.
)DVWHQWKHWXELQJLQWRWKHFODPSSURYLGHGWRKROGLWLQD
vertical position. You may need to pry open the clamp.
10 START THE ICEMAKER
On power switch models, set the icemaker power
switch to the 0N position. On feeler arm models,
move the feeler arm to the ONGRZQSRVLWLRQ7KH
LFHPDNHUZLOOQRWEHJLQWRRSHUDWHXQWLOLWUHDFKHVLWV
RSHUDWLQJWHPSHUDWXUHRIƒ)²ƒ&RUEHORZ,WZLOO
WKHQEHJLQRSHUDWLRQDXWRPDWLFDOO\
Power
switch
ON
1/4”
Copper
7XELQJ
OFF
7XELQJ
Clamp
Power switch model
1/4” Compression
Nut
Ferrule
VOHHYH
Refrigerator Connection
Feeler Arm in the
STOPXSSRVLWLRQ
SmartConnect™
7XELQJ
Feeler Arm in
the ONGRZQSRVLWLRQ
Reattach the access cover.
Feeler arm model
NOTE: In lower water pressure conditions, the water
valve may turn on up to 3 times to deliver enough
water to the icemaker.
12
Installation Instructions
2 REVERSING THE DOOR SWING
2 REMOVE THE FREEZER DOOR
IMPORTANT NOTES
2.1 Tape the door shut with masking tape.
:KHQUHYHUVLQJWKHGRRUVZLQJ
‡5HDGWKHLQVWUXFWLRQVDOOWKHZD\WKURXJKEHIRUHVWDUWLQJ
‡+DQGOHSDUWVFDUHIXOO\WRDYRLGVFUDWFKLQJSDLQW
‡6HWVFUHZVGRZQE\WKHLUUHODWHGSDUWVWRDYRLGXVLQJ
them in the wrong places.
‡3URYLGHDQRQVFUDWFKLQJZRUNVXUIDFHIRUWKHGRRUV
IMPORTANT:2QFH\RXEHJLQGRQRWPRYHWKHFDELQHWXQWLO
door-swing reversal is completed.
These instructions are for changing the hinges from the
ULJKWVLGHWRWKHOHIWVLGH³LI\RXHYHUZDQWWRFKDQJHWKH
KLQJHVEDFNWRWKHULJKWVLGHIROORZWKHVHVDPHLQVWUXFWLRQV
and reverse all references to left and right.
2.2 With a 5/16”KH[KHDGVRFNHWGULYHUUHPRYHWKH
VFUHZVWKDWKROGWKHWRSKLQJHWRWKHFDELQHW
2.3 Lift the hinge straight up to free the hinge pin
from the socket in the top of the door and set it
aside, along with its screws.
TOOLS REQUIRED
Phillips screwdriver
5/16”KH[KHDG
socket driver
Putty knife or thinEODGHVFUHZGULYHU
Top Hinge
Masking tape
2.4 Remove the tape and tilt the door away from the
FDELQHW/LIWLWRȺWKHFHQWHUKLQJHSLQ
7RU77RU[GULYHU
QHHGHGIRUVRPH
PRGHOV
5/16” open-end
wrench
2.5 Set the door on a non-scratching surface with
the outside up.
1 BEFORE YOU START
2.6 Transfer the 2 screws from the opposite side of
WKHFDELQHWWRWKHVFUHZKROHVYDFDWHGE\WKHWRS
hinge removal.
1.1 Unplug the refrigerator from its electrical outlet.
1.2 Empty all door shelves, including the dairy
compartment.
CAUTION: 'RQRWOHWHLWKHUGRRUGURSWRWKHÀRRU7R
do so could damage the door stop.
13
Installation Instructions
2 REVERSING THE DOOR SWING (CONT.)
3 REMOVE THE FRESH FOOD DOOR (CONT.)
3 REMOVE THE FRESH FOOD DOOR
3.5 Transfer the two screws from the opposite side of the
FDELQHWWRWKHVFUHZKROHVYDFDWHGE\WKHFHQWHUKLQJH
removal.
3.1 Tape the door shut with masking tape.
3.67UDQVIHUWKHZDVKHULI\RXUPRGHOKDVRQHWRWKH
opposite side.
3.2 Using a 5/16”KH[KHDGVRFNHWVFUHZGULYHUDQGD
5/16” open-end wrench, remove the two screws
KROGLQJWKHFHQWHUKLQJHWRWKHFDELQHW/LIWWKH
center hinge to free its pin from the socket in the
top of the door, and set hinge and screws aside.
Be careful not to lose the center hinge spacer and
washer.
3.7 Take one of the screws removed in step 2 and start
it in the outermost screw hole on the opposite side.
'RQRWGULYHLWDOOWKHZD\GRZQ³OHDYHHQRXJKVSDFH
XQGHUWKHVFUHZKHDGIRUWKLFNQHVVRIWKHEUDFNHW
4 REVERSING THE HARDWARE
3.3 Remove the tape and tilt the door away from the
FDELQHW/LIWWKHGRRUIURPWKHSLQLQWKHERWWRP
KLQJHEUDFNHW,IWKHSODVWLFZDVKHUVWLFNVWRWKHGRRU
ERWWRPSXWLWEDFNRQWKHKLQJH
4.1 0RYHWKHERWWRPKLQJHEUDFNHWDQGSODVWLFZDVKHUIURP
the right side to the left side.
Plastic
Washer
Switch the hinge pin to the
RSSRVLWHVLGHRIWKHEUDFNHW
Hinge
Bracket
3.4 Set the door outside-up on a non-scratching surface.
14
Installation Instructions
4 REVERSING THE HARDWARE (CONT.)
5 REVERSING THE DOOR HANDLES (CONT.)
4.2 Interchange hinge and screws at top right with
VFUHZVDWWRSOHIWRIFDELQHWDo not tighten screws
on hinge side at this time.
5.1.3 5HPRYHSOXJEXWWRQIURPWKHWRSKLQJHKROHRQWKH
left side of the door and insert it into the hole on the
RSSRVLWHVLGHWKDWZDVYDFDWHGE\UHPRYDORIWKHWRS
hinge.
Plug Button
Installing the hinge on
the left.
5.1.43XOOWKHSOXJEXWWRQIURPWKHIURQWRIWKHGRRUDQG
transfer it to the opposite side.
Installing the hinge on
the right.
NOTES:
‡ 6RPHKLQJHVKDYHIRXUKROHV:KLFKKROHV\RXXVH
for installing the hinge depends on which side you
install the hinge.
‡ 7KHRXWHUHGJHRIWKHKLQJHVKRXOGEHSDUDOOHOWR
the edge of the case for correct installation.
Plug Button
5 REVERSING THE DOOR HANDLES
To reattach the
handle on the
opposite side.
5.2 Transfer door stop
5.2.1 Move the plastic door stop and screws from
the right side to the left side.
5.1 Transfer fresh food door handle
5.1.1 Remove the handle plug using a tape-tipped
putty knife under the edge, and remove the
screw underneath. Remove the two screws
holding the handle to the top of the door.
Plastic Door Stop
Right Side
Left Side
Top
5.3 Reinstall the fresh food door handle
Plug
5.3.1 Attach the handle to the right side of the
door with screws at the top
and under the handle plug.
5.3.2 Reinstall the handle plug.
5.1.2 Remove the handle.
15
Installation Instructions
2 REVERSING THE DOOR SWING (CONT.)
6 RE-HANGING THE DOORS (CONT.)
5 REVERSING THE DOOR HANDLES (CONT.)
5.4 Transfer Freezer Door Handle
5.4.1 Remove the screw
holding the handle
to the top of the
door and the two
screws holding the
KDQGOHWRWKHERWWRP
of the door.
5.4.2 Remove the handle.
6.1.2 Insert the pin on the center hinge into the socket in the
top of the door. Place the spacer, then the washer, on
the hinge pin.
Hinge Pin
NOTE: The center hinge must
EHWXUQHGRYHUDVVKRZQZKHQ
mounted on the left side.
TOP
Top
Plastic Washer
and Spacer
6.1.3 7LOWWKHGRRUWRZDUGWKHFDELQHW$VWKHGRRULVEURXJKW
into position, slide the hinge under the head of the screw
ZKLFKHDUOLHUKDGEHHQSDUWO\GULYHQLQWRWKHRXWHUPRVW
KROH,QVHUWWKHUHPDLQLQJVFUHZWKHQWLJKWHQERWK
screws securely.
BOTTOM
Bottom
5.4.3 Remove the screw from the
right top edge of the door
and insert it into the handle
screw hole on the left side.
6.2 Re-hang the freezer door
6.2.1 Lower the freezer door
onto the center hinge
pin. Be sure the
Center Hinge Pin
washer and spacer
are in place on the pin.
5.4.4 Transfer the door stop as shown in preceding
section 5.2.
5.4.5 Attach the handle to the
right edge of the door with
VFUHZVDWWRSDQGERWWRP
XVLQJERWWRPKROHVYDFDWHG
E\UHPRYDORIWKHGRRUVWRS
screws.
Plastic Washer
and Spacer
6.2.2 7LOWWKHGRRUWRZDUGWKHFDELQHWOLIWLQJWKHWRSKLQJHVR
WKHSLQ¿WVLQWRWKHVRFNHWRQWKHWRSRIWKHGRRU
6 RE-HANGING THE DOORS
6.1 Re-hang the fresh food door
6.1.1/RZHUWKHIUHVKIRRGGRRURQWRWKHERWWRP
hinge pin. Be sure the washer is in place on
the pin.
6.2.3. 0DNHVXUHWKHGRRULVVOLJKWO\DERYHWKHWRSRIWKH
FDELQHWDQGWKHJDSEHWZHHQWKHGRRUVLVHYHQ
across the front. Tighten the top hinge screws. Do not
overtighten these screws–tighten them until they are
just snug, then turn them another one-half turn.
Plastic
Washer
Hinge
Bracket
16
Normal operating sounds.
GEAppliances.com
1HZHUUHIULJHUDWRUVVRXQGGLȺHUHQWIURPROGHUUHIULJHUDWRUV0RGHUQUHIULJHUDWRUVKDYHPRUHIHDWXUHV
and use newer technology.
Do you hear what I hear? These sounds are normal.
„ 7KHQHZKLJKHȻFLHQF\
HUMMM...
WHOOSH...
compressor may run
faster and longer than
your old refrigerator and
you may hear a high-pitched hum or pulsating sound
while it is operating.
„ You may hear a whooshing sound when the doors close.
This is due to pressure equalizing within the refrigerator.
CLICKS, POPS,
CRACKS and CHIRPS
„ You may hear cracking or popping sounds when the
UHIULJHUDWRULV¿UVWSOXJJHGLQ7KLVKDSSHQVDVWKHUHIULJHUDWRU
cools to the correct temperature.
„ The compressor may cause a clicking or chirping sound when
DWWHPSWLQJWRUHVWDUWWKLVFRXOGWDNH
XSWRPLQXWHV
„ ([SDQVLRQDQGFRQWUDFWLRQRIFRROLQJFRLOVGXULQJDQGDIWHU
defrost can cause a cracking or popping sound.
„ On models with an icemaker, after an icemaking cycle, you
PD\KHDUWKHLFHFXEHVGURSSLQJLQWRWKHLFHEXFNHW
„ You may hear the fans spinning at high
speeds.
This happens when the refrigerator is
¿UVWSOXJJHGLQZKHQWKHGRRUVDUH
opened frequently or when
a large amount of food is added to the refrigerator or
freezer compartments. The fans are helping to maintain
the correct temperatures.
WATER SOUNDS
„ 7KHÀRZRIUHIULJHUDQWWKURXJKWKHIUHH]HUFRROLQJFRLOVPD\
PDNHDJXUJOLQJQRLVHOLNHERLOLQJZDWHU
„ Water dropping on the defrost heater can cause a sizzling,
SRSSLQJRUEX]]LQJVRXQGGXULQJWKHGHIURVWF\FOH
„ A water dripping noise may occur during the defrost cycle as ice
melts from the evaporator and flows into the drain pan.
„ Closing the door may cause a gurgling sound due to pressure
equalization.
For additional information on normal
icemaker operating sounds, see the
About the automatic icemaker section.
17
Before you call for service…
7URXEOHVKRRWLQJ7LSV
Save time and money! Review the charts on the following
SDJHV¿UVWDQG\RXPD\QRWQHHGWRFDOOIRUVHUYLFH
Problem
Possible Causes
What To Do
Refrigerator does not
operate
Refrigerator in defrost cycle.
:DLWDERXWPLQXWHVIRUGHIURVWF\FOHWRHQG
Temperature control dial in OFF
position.
Move the temperature control dial to a temperature setting.
Refrigerator is unplugged.
Push the plug completely into the outlet.
The fuse is blown/circuit breaker is
tripped.
5HSODFHIXVHRUUHVHWWKHEUHDNHU
Vibration or rattling (slight
vibration is normal)
Roller screws or leveling legs need
adjusting.
See Rollers and Leveling Legs.
Fresh food or freezer
compartment too warm
Temperature control dial not set cold
enough.
See About the temperature control dial.
Warm weather or frequent door
openings.
Set the temperature control dial one step colder. See About
the temperature control dial.
Door left open.
Check to see if package is holding door open.
Package blocking air duct in freezer
compartment.
&KHFNWRVHHLISDFNDJHLVEORFNLQJDLUGXFWLQIUHH]HU
compartment.
1RUPDOZKHQUHIULJHUDWRULV¿UVW
plugged in.
Wait 24 hours for the refrigerator to completely cool down.
Often occurs when large amounts of
food are placed in refrigerator.
This is normal.
Door left open.
Check to see if package is holding door open.
Hot weather or frequent door
openings.
This is normal.
Temperature control dial set at the
coldest setting.
See About the temperature control dial.
Grille and condenser need cleaning.
See Care and cleaning.
Frost or ice crystals on
frozen food (frost within
package is normal)
Door left open.
Check to see if package is holding door open.
Automatic icemaker does
not work (on some models)
Icemaker is not on.
Move the feeler arm to the ONGRZQSRVLWLRQRUPRYHWKH
power switch to the ON position
:DWHUVXSSO\WXUQHGRȹRUQRW
connected.
See Installing the water line.
Freezer compartment too warm.
Wait 24 hours for the refrigerator to completely cool down.
Piled up cubes in the storage bin
FDXVHWKHLFHPDNHUWRVKXWRȹ
/HYHOFXEHVE\KDQG
Frequent “buzzing” sound
supply to the refrigerator
has not been connected
Icemaker is on but the water
Move the feeler arm to the STOPXSSRVLWLRQRUPRYH
the power switch to the OFF position, Keeping it on will
damage the water valve..
Cubes too small
:DWHUVKXWRȹYDOYHFRQQHFWLQJ
refrigerator to water line may be
clogged.
&DOOWKHSOXPEHUWRFOHDUWKHYDOYH
Door left open.
Check to see if package is holding door open.
Temperature control dial not set cold
enough.
See About the temperature control dial.
Motor operates for
long periods or cycles
RQDQGRȹIUHTXHQWO\
(Modern refrigerators
with more storage space
and a larger space and
a larger freezer require
more operating time.
They start and stop
often to maintain even
temperatures.)
Slow ice cube freezing
18
Too frequent or too long door
openings.
GEAppliances.com
7URXEOHVKRRWLQJ7LSV
Problem
Possible Causes
What To Do
Ice cubes have odor/taste
Ice storage bin needs cleaning.
(PSW\DQGZDVKELQ'LVFDUGROGFXEHV
Food transmitting odor/taste to ice cubes.
Wrap foods well.
Interior of refrigerator needs cleaning
See Care and cleaning.
Moisture forms on cabinet
surface between the doors
Not unusual during periods of high
humidity.
Wipe surface dry and reset temperature control
dial one setting colder.
Moisture collects inside (in
humid weather, air carries
moisture into refrigerator
when doors reopened)
Too frequent or too long door openings.
Refrigerator has odor
Foods transmitting odor to refrigerator.
)RRGVZLWKVWURQJRGRUVVKRXOGEHWLJKWO\ZUDSSHG
.HHSDQRSHQER[RIEDNLQJVRGDLQWKH
UHIULJHUDWRUUHSODFHHYHU\WKUHHPRQWKV
Interior needs cleaning.
See Care and cleaning.
19
Notes.
20
Notes.
GEAppliances.com
21
Notes.
22
Refrigerator Warranty.
$OOZDUUDQW\VHUYLFHSURYLGHGE\RXU)DFWRU\6HUYLFH&HQWHUV
or an authorized Customer Care® technician. To schedule
service, on-line, 24 hours a day, visit us at GEAppliances.com, or
FDOO*(&$5(63OHDVHKDYHVHULDOQXPEHUDQG
PRGHOQXPEHUDYDLODEOHZKHQFDOOLQJIRUVHUYLFH
Staple your receipt here.
Proof of the original purchase
GDWHLVQHHGHGWRREWDLQ
service under the warranty.
For The Period Of: GE Will Replace:
GE and GE PROFILE MODELS:
One Year
Any part of the refrigerator which fails due to a defect in materials or workmanship.
From the date of the
During this limited one-year warranty, GE will also provide, free of charge, DOOODERUDQG
original purchase
related service to replace the defective part.
Thirty Days
Any part RIWKHZDWHU¿OWHUFDUWULGJHZKLFKIDLOVGXHWRDGHIHFWLQPDWHULDOVRUZRUNPDQVKLS
:DWHU¿OWHULILQFOXGHG 'XULQJWKLVlimited thirty-day warranty, GE will also provide, free of charge, a replacement water
)URPWKHRULJLQDO
¿OWHUFDUWULGJH
purchase date of
the refrigerator
GE PROFILE MODELS ONLY:
Five Years
*(3UR¿OHPRGHOVRQO\
From the date of the
original purchase
Any part of the sealed refrigerating system WKHFRPSUHVVRUFRQGHQVHUHYDSRUDWRU
DQGDOOFRQQHFWLQJWXELQJZKLFKIDLOVGXHWRDGHIHFWLQPDWHULDOVRUZRUNPDQVKLS
During this OLPLWHG¿YH\HDUVHDOHGUHIULJHUDWLQJV\VWHPZDUUDQW\GE will also provide,
free of charge,DOOODERUDQGUHODWHGVHUYLFHWRUHSODFHWKHGHIHFWLYHSDUWLQWKHVHDOHG
refrigerating system.
What GE Will Not Cover:
„ Service trips to your home to teach you how to use the
product.
„ Improper installation, delivery or maintenance.
„ Failure of the product if it is abused, misused, or used for
other than the intended purpose or used commercially.
„ Loss of food due to spoilage.
„ Replacement of house fuses or resetting of circuit
breakers.
„ 'DPDJHWRWKH¿QLVKPXVWEHUHSRUWHGZLWKLQKRXUV
following delivery of the appliance.
„ 'DPDJHWR¿QLVKLQFOXGLQJUXVWWDUQLVKRUVPDOO
blemishes, after delivery.
„ Products which are not defective, broken, or which are
working as described in the Owner’s Manual.
„ 5HSODFHPHQWRIWKHZDWHU¿OWHUFDUWULGJHLILQFOXGHGGXH
WRZDWHUSUHVVXUHWKDWLVRXWVLGHWKHVSHFL¿HGRSHUDWLQJ
range or due to excessive sediment in the
water supply.
„ 5HSODFHPHQWRIWKHOLJKWEXOEVLILQFOXGHGRUZDWHU¿OWHU
cartridge, if included, other than as noted above.
„ 'DPDJHWRWKHSURGXFWFDXVHGE\DFFLGHQW¿UHÀRRGV
or acts of God.
„ Incidental or consequential damage caused by possible
defects with this appliance.
„ Product not accessible to provide required service.
(;&/86,212),03/,(':$55$17,(6³<RXUVROHDQGH[FOXVLYHUHPHG\LVSURGXFWUHSDLUDVSURYLGHGLQ
this Limited Warranty. Any implied warranties, including the implied warranties of merchantability or
¿WQHVVIRUDSDUWLFXODUSXUSRVHDUHOLPLWHGWRRQH\HDURUWKHVKRUWHVWSHULRGDOORZHGE\ODZ
7KLVZDUUDQW\LVH[WHQGHGWRWKHRULJLQDOSXUFKDVHUDQGDQ\VXFFHHGLQJRZQHUIRUSURGXFWVSXUFKDVHGIRU
KRPHXVHZLWKLQWKH86$,IWKHSURGXFWLVORFDWHGLQDQDUHDZKHUHVHUYLFHE\D*($XWKRUL]HG6HUYLFHULV
QRWDYDLODEOH\RXPD\EHUHVSRQVLEOHIRUDWULSFKDUJHRU\RXPD\EHUHTXLUHGWREULQJWKHSURGXFWWRDQ
$XWKRUL]HG*(6HUYLFHORFDWLRQIRUVHUYLFH,Q$ODVNDWKHZDUUDQW\H[FOXGHVWKHFRVWRIVKLSSLQJRUVHUYLFHFDOOV
to your home.
6RPHVWDWHVGRQRWDOORZWKHH[FOXVLRQRUOLPLWDWLRQRILQFLGHQWDORUFRQVHTXHQWLDOGDPDJHV7KLVZDUUDQW\
JLYHV\RXVSHFL¿FOHJDOULJKWVDQG\RXPD\DOVRKDYHRWKHUULJKWVZKLFKYDU\IURPVWDWHWRVWDWH7RNQRZZKDW
\RXUOHJDOULJKWVDUHFRQVXOW\RXUORFDORUVWDWHFRQVXPHUDȺDLUVRȻFHRU\RXUVWDWH·V$WWRUQH\*HQHUDO
Warrantor: General Electric Company. Louisville, KY 40225
23
Consumer Support.
*($SSOLDQFHV:HEVLWH
GEAppliances.com
www.Hotpoint.com
+DYHDTXHVWLRQRUQHHGDVVLVWDQFHZLWK\RXUDSSOLDQFH"7U\WKH*($SSOLDQFHV:HEVLWHKRXUVDGD\
DQ\GD\RIWKH\HDU)RUJUHDWHUFRQYHQLHQFHDQGIDVWHUVHUYLFH\RXFDQQRZGRZQORDG2ZQHU·V0DQXDOV
order parts, or even schedule service on-line.
Schedule Service
GEAppliances.com
www.Hotpoint.com
([SHUW*(UHSDLUVHUYLFHLVRQO\RQHVWHSDZD\IURP\RXUGRRU*HWRQOLQHDQGVFKHGXOH\RXUVHUYLFHDW\RXU
FRQYHQLHQFHKRXUVDQ\GD\RIWKH\HDU2UFDOO*(&$5(6GXULQJQRUPDOEXVLQHVVKRXUV
Real Life Design Studio
GEAppliances.com
*(VXSSRUWVWKH8QLYHUVDO'HVLJQFRQFHSW³SURGXFWVVHUYLFHVDQGHQYLURQPHQWVWKDWFDQEHXVHGE\SHRSOHRI
DOODJHVVL]HVDQGFDSDELOLWLHV:HUHFRJQL]HWKHQHHGWRGHVLJQIRUDZLGHUDQJHRISK\VLFDODQGPHQWDODELOLWLHV
DQGLPSDLUPHQWV)RUGHWDLOVRI*(·V8QLYHUVDO'HVLJQDSSOLFDWLRQVLQFOXGLQJNLWFKHQGHVLJQLGHDVIRUSHRSOHZLWK
GLVDELOLWLHVFKHFNRXWRXU:HEVLWHWRGD\)RUWKHKHDULQJLPSDLUHGSOHDVHFDOO7''*($&
([WHQGHG:DUUDQWLHV
GEAppliances.com
3XUFKDVHD*(H[WHQGHGZDUUDQW\DQGOHDUQDERXWVSHFLDOGLVFRXQWVWKDWDUHDYDLODEOHZKLOH\RXUZDUUDQW\LVVWLOO
LQHȺHFW<RXFDQSXUFKDVHLWRQOLQHDQ\WLPHRUFDOOGXULQJQRUPDOEXVLQHVVKRXUV*(&RQVXPHU
+RPH6HUYLFHVZLOOVWLOOEHWKHUHDIWHU\RXUZDUUDQW\H[SLUHV
Parts and Accessories
GEAppliancesParts.com
,QGLYLGXDOVTXDOL¿HGWRVHUYLFHWKHLURZQDSSOLDQFHVFDQKDYHSDUWVRUDFFHVVRULHVVHQWGLUHFWO\WRWKHLUKRPHV9,6$
0DVWHU&DUGDQG'LVFRYHUFDUGVDUHDFFHSWHG2UGHURQOLQHWRGD\KRXUVHYHU\GD\RUE\SKRQHDW
GXULQJQRUPDOEXVLQHVVKRXUV
,QVWUXFWLRQVFRQWDLQHGLQWKLVPDQXDOFRYHUSURFHGXUHVWREHSHUIRUPHGE\DQ\XVHU2WKHUVHUYLFLQJJHQHUDOO\VKRXOG
EHUHIHUUHGWRTXDOL¿HGVHUYLFHSHUVRQQHO&DXWLRQPXVWEHH[HUFLVHGVLQFHLPSURSHUVHUYLFLQJPD\FDXVHXQVDIH
operation.
Contact Us
GEAppliances.com
www.Hotpoint.com
,I\RXDUHQRWVDWLV¿HGZLWKWKHVHUYLFH\RXUHFHLYHIURP*(FRQWDFWXVRQRXU:HEVLWHZLWKDOOWKHGHWDLOVLQFOXGLQJ
\RXUSKRQHQXPEHURUZULWHWR *
HQHUDO0DQDJHU&XVWRPHU5HODWLRQV
GE Appliances, Appliance Park
Louisville, KY 40225
Register Your Appliance
GEAppliances.com
www.Hotpoint.com
5HJLVWHU\RXUQHZDSSOLDQFHRQOLQH³DW\RXUFRQYHQLHQFH Timely product registration will allow for
enhanced communication and prompt service under the terms of your warranty, should the need arise.
You may also mail in the pre-printed registration card included in the packing material.
Printed in the United States
Printed on Recycled Paper