5973N MSD Hardware Manual

5973Network
Mass Selective Detector
Hardware Manual
‹&RS\ULJKW
,QVWUXPHQW
$JLOHQW7HFKQRORJLHV
,GHQWLILFDWLRQ
$OO5LJKWV5HVHUYHG
5HSURGXFWLRQDGDSWDWLRQRU
WUDQVODWLRQZLWKRXWSULRU
ZULWWHQSHUPLVVLRQLV
SURKLELWHGH[FHSWDVDOORZHG
XQGHUWKHFRS\ULJKWODZV
'RFXPHQW+LVWRU\
&DXWLRQV
(DFK10DVV6HOHFWLYH
&DXWLRQVFDOODWWHQWLRQWR
'HWHFWRU06'LVLGHQWLILHG
SURFHGXUHVZKLFKLIQRW
E\DXQLTXHFKDUDFWHUVHULDO
FRUUHFWO\SHUIRUPHGRU
QXPEHU7KLVVHULDOQXPEHULV
DGKHUHGWRFRXOGUHVXOWLQ
ORFDWHGRQDODEHORQWKHORZHU
GDPDJHWRWKHLQVWUXPHQW
OHIWVLGHQHDUWKHIURQWRIWKH
LQVWUXPHQWVHHSDJH2Q
:DUQLQJV
&,XSJUDGHVDVHULDOQXPEHULV
:DUQLQJVFDOODWWHQWLRQWR
ORFDWHGXQGHUWKHFRYHURIWKH
SURFHGXUHVZKLFKLIQRW
IORZPRGXOH
FRUUHFWO\SHUIRUPHGRU
3XEOLFDWLRQQXPEHU
*
0DQXDO&RQYHQWLRQV
DGKHUHGWRFRXOGUHVXOWLQ
:KHQFRUUHVSRQGLQJZLWK
SHUVRQDOLQMXU\
$JLOHQW7HFKQRORJLHVDERXW
)LUVWHGLWLRQ
3ULQWHGLQ86$
\RXULQVWUXPHQWEHVXUHWR
LQFOXGHWKHPRGHOQXPEHUDQG
ERWKIXOOFKDUDFWHUVHULDO
:DUUDQW\
QXPEHUV
3DUW1XPEHUV
,QWKLVPDQXDO$JLOHQW
7HFKQRORJLHVSDUWQXPEHUV
DUHJHQHUDOO\OLVWHGLQ
SDUHQWKHVHVDIWHUWKHQDPHRI
7KHLQIRUPDWLRQFRQWDLQHGLQ
:ULWHWKHVHULDOQXPEHURI
WKLVGRFXPHQWLVVXEMHFWWR
\RXU106'KHUHIRU
FKDQJHZLWKRXWQRWLFH
UHIHUHQFH
WKHSDUWRULQWDEOHVLQWKH
3DUWVFKDSWHU0RVWSDUW
QXPEHUVDUHHLWKHUIRXUGLJLW
E\IRXUGLJLW
$JLOHQW7HFKQRORJLHVPDNHVQR
ZDUUDQW\RIDQ\NLQGZLWK
106'YHUVLRQ
WKHLPSOLHGZDUUDQWLHVRI
PHUFKDQWDELOLW\DQGILWQHVVIRU
DSDUWLFXODUSXUSRVH
$JLOHQW7HFKQRORJLHVVKDOOQRW
EHOLDEOHIRUHUURUVFRQWDLQHG
KHUHLQRUIRULQFLGHQWDORU
FRQVHTXHQWLDOGDPDJHVLQ
FRQQHFWLRQZLWKWKH
IXUQLVKLQJSHUIRUPDQFHRUXVH
GLJLWQXPEHUV
$IHZWRROVDQGVXSSOLHVOLVWHG
KDYHQRSDUWQXPEHUVDQGDUH
106'VDUHHTXLSSHG
QRWDYDLODEOHIURP$JLOHQW
ZLWKHLWKHUDGLIIXVLRQSXPSRU
7HFKQRORJLHV0RVWRIWKHVH
RQHRIWZRWXUERPROHFXODU
FDQEHREWDLQHGIURP
WXUERSXPSV&KHPLFDO
ODERUDWRU\VXSSO\FRPSDQLHV
,RQL]DWLRQLVDYDLODEOHIRUWKH
SURGXFWQXPEHUWKDWWHOOV
6DIHW\,QIRUPDWLRQ
ZKDWNLQGRI06'\RXKDYH
6DIHW\6\PEROV
*$
UHOLDELOLW\RILWVVRIWZDUHRQ
*$
IXUQLVKHGE\$JLOHQW
6WDQGDUGWXUER(,
06'
7HFKQRORJLHV
*$
3HUIRUPDQFHWXUER
(,06'
*$
6WDQGDUGWXUER(,
3&,06'
'HXWVFK
/S$G%DP$UEHLWVSODW]
QRUPDOHU%HWULHEQDFK(1
(QJOLVK
/S$G%RSHUDWRU
SRVLWLRQQRUPDORSHUDWLRQSHU
,62
EHHQGHVLJQHGDQGWHVWHGLQ
DFFRUGDQFHZLWK,(&
3XEOLFDWLRQ6DIHW\
5HTXLUHPHQWVIRU(OHFWULFDO
(TXLSPHQWIRU0HDVXUHPHQW
&RQWURODQG/DERUDWRU\8VH
:$51,1*
&RQQHFWLQJDQ06'WRDSRZHU
VRXUFHZKLFKLVQRWHTXLSSHG
ZLWKDSURWHFWLYHHDUWKFRQWDFW
FUHDWHVDVKRFNKD]DUGIRUWKH
RSHUDWRUDQGFDQGDPDJHWKH
LQVWUXPHQW/LNHZLVH
LQWHUUXSWLQJWKHSURWHFWLYH
FRQGXFWRULQVLGHRURXWVLGH
WKH06'RUGLVFRQQHFWLQJWKH
SURWHFWLYHHDUWKWHUPLQDO
FUHDWHVDVKRFNKD]DUGIRUWKH
RSHUDWRUDQGFDQGDPDJHWKH
LQVWUXPHQW
*$
3HUIRUPDQFHWXUER
(,3&,1&,06'
:$51,1*
0DNHVXUHWKDWRQO\IXVHVZLWK
WKHUHTXLUHGFXUUHQWUDWLQJ
DQGRIWKHVSHFLILHGW\SHDUH
XVHGIRUUHSODFHPHQW7KHXVH
RILQFRUUHFWRUPDNHVKLIWIXVHV
RUWKHVKRUWFLUFXLWLQJRIIXVH
KROGHUVFUHDWHVDVKRFNKD]DUG
:$51,1*
'LIIXVLRQ3XPS(,
06'
QRUHVSRQVLELOLW\IRUWKHXVHRU
1RLVH'HFODUDWLRQ
&ODVV,LQVWUXPHQWDQGKDV
GDPDJHWKHLQVWUXPHQW
QXPEHUODEHOGLVSOD\VD
RQHTXLSPHQW
HTXLSPHQWWKDWLVQRW
'HWHFWRU06'LVD6DIHW\
IRUWKHRSHUDWRUDQGFDQ
WXUER06'VRQO\7KHVHULDO
RIWKLVPDWHULDO
$JLOHQW7HFKQRORJLHVDVVXPHV
7KH10DVV6HOHFWLYH
QXPEHUVRUILYHGLJLWE\ILYH
BBBBBBBBBBBBBBBBBBBBBBBB
UHJDUGWRWKLVPDWHULDO
LQFOXGLQJEXWQRWOLPLWHGWR
6DIHW\FODVV
$Q\DGMXVWPHQWPDLQWHQDQFH
RUUHSDLURIWKHRSHQHG
LQVWUXPHQWZKLOHLWLV
;
=
+
3
5HIHUWRRSHUDWLQJ
LQVWUXFWLRQV
FRQQHFWHGWRDSRZHUVRXUFH
VKRXOGEHDYRLGHGLISRVVLEOH
DQGLIUHTXLUHGVKRXOGEH
FDUULHGRXWRQO\E\WUDLQHG
,QGLFDWHVKD]DUGRXV
SHUVRQVZKRDUHDZDUHRIWKH
YROWDJH
KD]DUGVLQYROYHG
6DIHW\,QIRUPDWLRQLVFRQWLQ
XHGRQWKHLQVLGHRIWKHEDFN
,QGLFDWHVKRWVXUIDFH
,QGLFDWHVHDUWK
JURXQGWHUPLQDO
FRYHU
5973Network
Mass Selective Detector
Hardware Manual
In This Manual
This manual describes the operation, troubleshooting, and maintenance of
the Agilent Technologies 5973Network Mass Selective Detector (5973N
MSD)
106'9HUVLRQ
5973N MSDs are equipped with either a diffusion pump or one of two
turbomolecular (turbo) pumps. Chemical Ionization is available for the
turbo pump MSDs only. The serial number label displays a product number
that tells what kind of MSD you have. In this manual, the term “CI MSD”
applies to both the EI/PCI MSD and the EI/PCI/NCI MSD.
p=Fd˜m¤h*F
¢Q••
¢Q•G
¢Q•n
¢QGG
¢QGn
F’4az›apm
aOO¤’apm˜¤hz˜˜
›"m="=˜›¤*p˜˜
FOph"m4F˜›¤*p˜˜
›"m="=˜›¤*p˜—˜
FOph"m4F˜›¤*p˜——˜
• Chapter 1 shows you how to prepare and install a capillary column.
• Chapter 2 describes basic tasks such as setting temperatures, monitoring
pressures, tuning, and venting, and pumpdown.
• Chapter 3 describes basic tasks necessary to operate a CI MSD in CI
mode.
• Chapter 4 provides a quick reference for identifying causes of poor
instrument performance or malfunctions.
• Chapter 5 provides a quick reference for identifying problems unique to
CI MSDs.
• Chapter 6 features maintenance procedures.
• Chapter 7 features maintenance procedures unique to CI MSDs.
4
^F˜VadFm›˜F4^mpdpVaF’˜Qn•F›§pc˜˜"’’˜FdF4›a¦F˜F›F4›p
• Chapter 8 describes operation of the components of the vacuum system.
• Chapter 9 describes the GC/MSD interface, and the CI flow module.
• Chapter 10 describes operation of the analyzer (ion source, mass filter,
and detector).
• Chapter 11 describes the electronics that control the MSD.
• Chapter 12 contains illustrated parts identification and part numbers.
• Appendix A is an overview of chemical ionization theory.
For updated information, check the Agilent Technologies Chemical Analysis
web site at ^››z9——§§§"VadFm›4ph—4^Fh.
Other User Information
5973 Mass Selective Detector Reference Collection
This CD-ROM includes the following multimedia resources:
• Software tutorial: hands-on training
• 5968-7358E 5973Network Mass Selective Detector Specifications
• Mass Spectrometer Fundamentals: Mass spectrometer hardware, and
Acquiring and evaluating (mass) spectra
5
The 5973Network MSD
The 5973N MSD is a stand-alone capillary GC detector
The 5973N Mass Selective Detector (MSD) is designed for use with the
6890 Plus Series Gas Chromatograph. The MSD features:
• Control panel for locally monitoring and operating the MSD
• One of three different high vacuum pumps
• Rotary vane foreline pump
• Independently heated electron-ionization ion source
• Independently heated hyperbolic quadrupole mass filter
• High-energy dynode (HED) electron multiplier detector
• Independently heated GC/MSD interface
• Chemical ionization (EI/PCI or EI/PCI/NCI) models available
Physical description
The 5973N MSD is a rectangular box, approximately 42 cm high, 26 cm wide,
65 cm deep. The weight is 25 kg for the diffusion pump mainframe, 26 kg for
the standard turbo pump mainframe and 29 kg for the performance turbo
pump mainframe. The attached rough pump weighs an additional 11 kg.
The basic components of the instrument are: the frame/cover assemblies,
the control panel, the vacuum system, the GC interface, the electronics, and
the analyzer.
The control panel allows local monitoring and operation of the MSD
The control panel acts as a local user interface to the MSD. You can perform
some basic tasks such as running a tune, a method, or a sequence; and
monitor MSD status from the control panel.
6
^F˜VadFm›˜F4^mpdpVaF’˜Qn•F›§pc˜˜"’’˜FdF4›a¦F˜F›F4›p
An optional gauge controller is available for measuring vacuum
The 5973N MSD is equipped with a triode ionization gauge tube. With an
59864B Gauge Controller, the tube can be used to measure pressure (high
vacuum) in the vacuum manifold. Installation and operation of the gauge
controller is described in this manual.
The gauge controller is required for chemical ionization (CI) operation.
Qn•˜˜hp=Fd’˜"m=˜OF"›¤F’
F"›¤F
¢Q••
¢Q•G
¢Q•n
¢QGG
¢QGn
aV^˜¦"4˜z¤hz
z›ah"d˜F˜4pd¤hm˜Odp§˜
hd—ham˜
"¨ah¤h˜F4phhFm=F=˜
V"’˜Odp§:˜hd—ham"
"¨ah¤h˜V"’˜Odp§:
hd—ham*
"¨˜4pd¤hm˜a=
˜4"z"*ada›©
˜4"z"*ada›©
|=˜"›©}
aOO¤’apm˜z¤hz
s
›"m="=˜›¤*p˜
s
FOph"m4F˜›¤*p˜ ›"m="=˜›¤*p˜
s˜›p˜¢
s
FOph"m4F˜›¤*p˜
s˜›p˜¢
sQ
¢¬
T
¢¬
T
¢
¢T
–Q
¢T
–Q
¬¢Q˜hh˜|¬˜h}
mp
©F’
¬¢˜hh˜|¬h}˜
mp
©F’
¬Q˜hh˜|¬˜h}˜
mp
©F’
¬¢˜hh˜|¬˜h}
˜
mp
¬Q˜hh˜|¬˜h}
—
mp
" p›"d˜V"’˜Odp§˜am›p˜›^F˜9˜4pd¤hm˜Odp§˜zd¤’˜F"VFm›˜V"’˜Odp§˜|aO˜"zzda4"*dF}
* ¨zF4›˜=FV"="›apm˜pO˜’zF4›"d˜zFOph"m4F˜"m=˜’Fm’a›a¦a›©
7
^F˜VadFm›˜F4^mpdpVaF’˜Qn•F›§pc˜˜"’’˜FdF4›a¦F˜F›F4›p
CI MSD hardware description
In this manual, the term “CI MSD” applies to both the EI/PCI MSD and the
EI/PCI/NCI MSD. The CI hardware allows the 5973N MSD to produce highquality, classical CI spectra, which include molecular adduct ions. A variety
of reagent gases can be used.
The 5973N CI system adds to the 5973N MSD:
• Redesigned EI/CI GC/MSD interface
• CI ion source and interface tip seal
• Reagent gas flow control module
• Bipolar HED power supply (for PCI/NCI MSDs only)
• A methane/isobutane gas purifier is provided, and is required. It removes
oxygen, water, hydrocarbons, and sulfur compounds.
A high vacuum gauge controller (59864B) is required for CI MSDs.
To achieve the relatively high source pressure required for CI while still
maintaining high vacuum in the quadrupole and detector, the MSD CI
system has been carefully optimized. Special seals along the flow path of the
reagent gas and very small openings in the ion source keep the source gases
in the ionization volume long enough for the appropriate reactions to occur.
The EI/CI interface has special plumbing for reagent gas. A spring-loaded
insulating seal fits onto the tip of the interface.
Switching back and forth between CI and EI takes less than an hour,
although a 1– to 2–hour wait is required in order to purge the reagent gas
lines and bake out water and other contaminants. Switching from PCI to NCI
requires about 2 hours for the ion source to cool.
8
^F˜VadFm›˜F4^mpdpVaF’˜Qn•F›§pc˜˜"’’˜FdF4›a¦F˜F›F4›p
–Gn¬˜FaF’
˜›p§F
–Gn¬˜FaF’
˜›"©
QnG–T˜aV^˜"4¤¤h˜
"¤VF˜
pm›pddF
˜V"’˜Odp§˜hp=¤dF
|—˜"m=˜——˜’˜pmd©}
Qn•˜
"’’˜FdF4›a¦F˜F›F4›p
Qn•˜˜4pm›pd˜z"mFd
–Gn¬˜d¤’
"’˜^ph"›pV"z^
Qn•˜˜’Fa"d˜m¤h*F
’›a4cF
9
10
Table of Contents
Chapter 1
Installing GC Columns
To prepare a capillary column for installation, 22
To install a capillary column in a split/splitless inlet, 24
To condition a capillary column, 26
To install a capillary column in the GC/MSD interface, 28
To install a capillary column using the installation tool, 30
Chapter 2
Operating the MSD
To view MSD analyzer temperature and vacuum status, 38
To set monitors for MSD temperature and vacuum status, 40
To set the MSD analyzer temperatures, 42
To set the GC/MSD interface temperature from the PC, 44
To monitor high vacuum pressure, 46
To measure column flow linear velocity, 48
To calculate column flow, 49
To tune the MSD, 50
To verify system performance, 51
To remove the MSD covers, 52
To vent the MSD, 54
To open the analyzer chamber, 56
To close the analyzer chamber, 58
To pump down the MSD, 60
To pump down the CI MSD, 62
To connect the gauge controller, 63
To move or store the MSD, 65
To set the interface temperature from a 6890 Plus GC, 67
To vent the MSD without the ChemStation, 68
pm›Fm›’
Chapter 3
Operating the CI MSD
To switch from EI to CI operating mode, 72
To set up the software for CI operation, 73
To operate the reagent gas flow control module, 74
To set up methane reagent gas flow, 76
CI autotune, 78
To perform a positive CI autotune (methane only), 80
To perform a negative CI autotune (any reagent gas), 82
To verify positive CI performance, 84
To verify negative CI performance, 85
To monitor high vacuum pressure, 86
Typical pressure readings, 87
To use other reagent gases, 88
Isobutane CI, 90
Ammonia CI, 90
Carbon dioxide NCI, 91
To switch from CI to EI operating mode, 92
Chapter 4
Troubleshooting the MSD
General symptoms, 96
GC does not turn on, 96
MSD does not turn on, 96
Foreline pump is not operating, 96
MSD turns on but then the foreline pump shuts off, 97
Control panel says “No server found”, 97
Chromatographic symptoms, 98
No peaks, 98
Peaks are tailing, 99
Peaks are fronting, 99
Peaks have flat tops, 100
Peaks have split tops, 100
Baseline is rising, 100
Baseline is high, 100
Baseline is falling, 100
Baseline wanders, 101
Retention times for all peaks drift – shorter, 101
Retention times for all peaks drift – longer, 101
Poor sensitivity, 102
Poor Repeatability, 102
12
pm›Fm›’
Mass spectral symptoms, 103
No peaks, 103
Isotopes are missing or isotope ratios are incorrect, 103
High background, 103
High abundances at m/z 18, 28, 32, and 44 or at m/z 14 and 16, 104
Mass assignments are incorrect, 104
Peaks have precursors, 104
Peak widths are inconsistent, 104
Relative abundance of m/z 502 is less than 3%, 105
Spectra look different from those acquired with other MSDs, 105
High mass sensitivity is poor, 106
Pressure symptoms, 107
Foreline pressure is too high, 107
Analyzer chamber pressure is too high (EI operating mode), 107
Foreline pressure is too low, 108
Analyzer chamber pressure is too low, 108
Gauge controller displays 9.9+9 and then goes blank, 108
Power indicator on the gauge controller does not light, 109
Temperature symptoms, 110
Ion source will not heat up, 110
Mass filter (quad) heater will not heat up, 111
GC/MSD interface will not heat up, 111
Error messages, 112
Difficulty in mass filter electronics, 112
Difficulty with the electron multiplier supply, 112
Difficulty with the fan, 113
Difficulty with the HED supply, 113
Difficulty with the high vacuum pump, 113
Foreline pressure has exceeded 300 mTorr, 114
Internal MS communication fault, 114
Lens supply fault, 114
Log amplifier ADC error, 114
No peaks found, 114
Temperature control disabled, 115
Temperature control fault, 115
The high vacuum pump is not ready, 116
The system is in standby, 116
The system is in vent state, 117
There is no emission current, 117
There is not enough signal to begin tune, 117
Air leaks, 118
Contamination, 119
13
pm›Fm›’
Chapter 5
CI Troubleshooting
Troubleshooting tips and tricks, 123
Air leaks, 124
How do I know if I have an air leak?, 124
How do I find the air leak?, 126
Pressure-related symptoms (overview), 128
Poor vacuum without reagent gas flow, 129
High pressure with reagent gas flow, 130
Pressure does not change when reagent flow is changed, 131
Signal-related symptoms (overview), 132
No peaks, 133
No reagent gas peaks in PCI, 133
No PFDTD peaks in PCI, 134
No reagent gas peaks in NCI, 134
No PFDTD calibrant peaks in NCI, 134
No sample peaks in NCI, 134
Large peak at m/z 238 in NCI OFN spectrum, 134
No or low reagent gas signal, 135
No or low PFDTD signal, but reagent ions are normal, 138
Excessive noise or low signal-to-noise ratio, 140
Large peak at m/z 19, 141
Peak at m/z 32, 142
Tuning-related symptoms (overview), 144
Reagent gas ion ratio is difficult to adjust or unstable, 145
High electron multiplier voltage, 147
Can not complete autotune, 148
Peak widths are unstable, 149
Chapter 6
Maintaining the MSD
Before starting, 152
Maintaining the vacuum system, 159
To check and add foreline pump oil, 160
To drain the foreline pump, 162
To refill the foreline pump, 164
To replace the oil trap, 166
To check the diffusion pump fluid, 168
To replace the turbo pump, 170
To separate the MSD from the GC, 171
To remove the diffusion pump, 173
14
pm›Fm›’
To replace the diffusion pump fluid, 175
To reinstall the diffusion pump, 177
To reconnect the MSD to the GC, 179
To remove the EI calibration vial, 181
To refill and reinstall the EI calibration vial, 183
To purge the calibration valves, 185
EI calibration valve, 185
CI calibration valve, 185
To remove the foreline gauge, 186
To reinstall a foreline gauge, 188
To remove the EI calibration valve, 190
To reinstall the EI calibration valve, 192
To replace the fan for the high vacuum pump, 194
To remove the triode gauge tube, 196
To reinstall a triode gauge tube, 198
To lubricate the side plate O-ring, 200
To lubricate the vent valve O-ring, 202
Maintaining the analyzer 204
To remove the ion source, 206
To disassemble the ion source, 208
To clean the ion source, 210
To reassemble the ion source, 214
To reinstall the ion source, 216
To remove a filament, 218
To reinstall a filament, 220
To remove the heater and sensor from the ion source, 222
To reinstall the heater and sensor in the ion source, 224
To remove the heater and sensor from the mass filter, 226
To reinstall the heater and sensor in the mass filter, 228
To replace the electron multiplier horn, 230
Maintaining the GC/MSD interface 232
To remove the GC/MSD interface heater and sensor, 234
To reinstall the GC/MSD interface heater and sensor, 236
Maintaining the electronics 238
To adjust the RF coils, 240
To replace the primary fuses, 242
15
pm›Fm›’
Chapter 7
CI Maintenance
To set up your MSD for CI operation, 247
To install the CI ion source, 248
To install the CI interface tip seal, 250
To clean the CI ion source, 252
Frequency of cleaning, 252
Cleaning procedure, 252
To minimize foreline pump damage from ammonia, 254
To replace the methane/isobutane gas purifier, 255
To clean the reagent gas supply lines (tubing), 256
To refill the CI calibrant vial, 257
Chapter 8
Vacuum System
Diffusion pump MSD vacuum system, 264
Turbo pump MSD vacuum system, 265
Diffusion pump analyzer chamber, 266
Turbo pump analyzer chamber, 267
Side plate, 268
Vacuum seals, 270
Face seals, 270
KF (NW) seals, 270
Compression seals, 270
High voltage feedthrough seal, 271
Foreline pump, 272
Foreline gauge, 274
Diffusion pump and fan, 276
Turbomolecular pump and fan, 280
Standard turbo pump, 281
Performance turbo pump, 282
Calibration valves and vent valve, 283
Calibration valves, 283
EI calibration valve, 283
CI calibration valve, 283
Vent valve, 283
Triode gauge tube, 285
Gauge controller, 287
16
pm›Fm›’
Chapter 9
GC/MSD Interfaces and
CI Flow Control
EI GC/MSD interface, 291
EI/CI GC/MSD interface (CI interface), 292
Reagent gas flow control module, 293
Chapter 10
Analyzer
Ion source, 300
Ion source body, 300
Filaments, 302
Magnet, 303
Repeller, 303
Drawout plate and cylinder, 304
Ion focus, 304
Entrance lens, 304
CI ion source, 306
Quadrupole mass filter, 308
AMU gain, 308
AMU offset, 309
219 width, 309
DC polarity, 310
Mass (axis) gain, 310
Mass (axis) offset, 310
Quadrupole maintenance, 311
Detector, 312
Detector focus lens, 312
High energy dynode, 312
Electron multiplier horn, 312
Analyzer heaters and radiators, 314
17
pm›Fm›’
Chapter 11
Electronics
Control panel and power switch, 320
Side board, 322
Electronics module, 323
Main board, 324
Signal amplifier board, 325
AC board, 326
LAN/MSD control card, 330
Power supplies, 331
Back panel and connectors, 332
Interfacing to external devices, 334
Chapter 12
Parts
Electronics, 339
Vacuum system, 344
Analyzer, 352
EI GC/MSD interface, 358
Consumables and maintenance supplies, 360
CI Parts, 364
Appendix A
Chemical Ionization Theory
Chemical ionization overview, 374
References on chemical ionization, 375
Positive CI theory, 376
Proton transfer, 378
Hydride abstraction, 380
Addition, 380
Charge exchange, 381
Negative CI theory, 382
Electron capture, 384
Dissociative electron capture, 385
Ion pair formation, 385
Ion-molecule reactions, 386
18
1
To prepare a capillary column for installation, 22
To install a capillary column in a split/splitless inlet, 24
To condition a capillary column, 26
To install a capillary column in the GC/MSD interface, 28
To install a capillary column using the installation tool, 30
Installing GC Columns
How to connect GC columns to the 5973N MSD
Installing GC columns
Before you can operate your GC/MSD system, you must select, condition,
and install a GC column. This chapter will show you how to install and
condition a column. For correct column and flow selection, you must know
what type of vacuum system your MSD has. The serial number tag on the
lower front of the left side panel shows the model number.
Many types of GC columns can be used with the MSD but there are
some restrictions
During tuning or data acquisition the rate of column flow into the MSD
should not exceed the maximum recommended flow. Therefore, there are
limits to column length and flow. Exceeding recommended flow will result
in degradation of mass spectral and sensitivity performance.
Remember that column flows vary greatly with oven temperature (unless
the GC is set for constant flow). See To measure column flow linear
velocity (page 48) for instructions on how to measure actual flow in your
column. Use the Flow Calculation software to determine whether a given
column will give acceptable flow with realistic head pressure.
F"›¤F
¢Q••
¢Q•G
¢Q•n
aV^˜¦"4˜z¤hz
aOO¤’apm˜z¤hz
›"m="=˜›¤*p˜
s
¢¬
FOph"m4F˜›¤*p˜ ›"m="=˜›¤*p:
—
s˜›p˜¢
s
T
¢¬
FOph"m4F˜›¤*p:˜
——
s˜›p˜¢
T
¢T
–Q
¢T
T
¬¢hh˜|¬h}˜
¬Q˜hh˜|¬h}˜
¬¢hh˜|¬h}
¬Qhh˜|¬h}
z›ah"d˜V"’˜Odp§:˜hd—ham"˜s
"¨ah¤h˜F4phhFm=F=˜ sQ
V"’˜Odp§:˜hd—ham
"¨ah¤h˜V"’˜Odp§:
¢
hd—ham*
"¨˜4pd¤hm˜a=
¬¢Qhh˜|¬h}
¢QGG
" p›"d˜V"’˜Odp§˜am›p˜›^F˜9˜4pd¤hm˜Odp§˜zd¤’˜F"VFm›˜V"’˜Odp§˜|aO˜"zzda4"*dF}
* ¨zF4›˜=FV"="›apm˜pO˜’zF4›"d˜zFOph"m4F˜"m=˜’Fm’a›a¦a›©
20
¢QGn
s˜˜˜˜m’›"ddamV˜
˜pd¤hm’
Conditioning a column before it is installed into the GC/MSD
interface is essential
A small portion of the capillary column stationary phase is often carried
away by the carrier gas. This is called column bleed. Column bleed deposits
traces of the stationary phase in the MSD ion source. This decreases MSD
sensitivity and makes cleaning the ion source necessary.
Column bleed is most common in new or poorly cross-linked columns. It is
much worse if there are traces of oxygen in the carrier gas when the column
is heated. To minimize column bleed, all capillary columns should be conditioned before they are installed in the GC/MSD interface.
Conditioning ferrules is also beneficial
Heating ferrules to their maximum expected operating temperature a few
times before they are installed can reduce chemical bleed from the ferrules.
Tips and hints
• Note that the column installation procedure for the 5973 MSDs is
different from that for all previous MSDs. Using the procedure from
another instrument will not work, and may damage the column or the
MSD.
• You can remove old ferrules from column nuts with an ordinary push pin.
• Always use carrier gas that is at least 99.999% pure.
• Because of thermal expansion, new ferrules may loosen after heating and
cooling a few times. Check for tightness after two or three heating cycles.
• Always wear clean gloves when handling columns, especially the end that
will be inserted into the GC/MSD interface.
O˜©p¤˜"F˜¤’amV˜^©=pVFm˜"’˜"˜4"aF˜V"’:˜=p˜mp›˜’›"›˜4"aF˜V"’˜Odp§˜¤m›ad˜›^F˜
4pd¤hm˜a’˜am’›"ddF=˜am˜›^F˜:˜"m=˜›^F˜˜^"’˜*FFm˜z¤hzF=˜=p§m˜O˜›^F˜¦"4¤¤h˜
z¤hz’˜"F˜pOO:˜^©=pVFm˜§add˜"44¤h¤d"›F˜am˜›^F˜˜"m=˜"m˜F¨zdp’apm˜h"©˜p44¤˜
F"=˜›^F˜©=pVFm˜"aF˜
"’˜"OF›©˜
¤a=F˜|QnQQ_QnG}˜*FOpF˜pzF"›amV˜›^F˜˜
§a›^˜^©=pVFm˜4"aF˜V"’
d§"©’˜§F"˜’"OF›©˜Vd"’’F’˜§^Fm˜^"m=damV˜4"zadd"©˜4pd¤hm’˜’F˜4"F˜›p˜"¦pa=˜
z¤m4›¤amV˜©p¤˜’cam˜§a›^˜›^F˜Fm=˜pO˜›^F˜4pd¤hm˜
21
s˜˜˜˜m’›"ddamV˜
˜pd¤hm’
p˜zFz"F˜"˜4"zadd"©˜4pd¤hm˜Op˜am’›"dd"›apm
To prepare a capillary column for installation
"›Fa"d’˜mFF=F=9
Capillary column
Column cutter (5181-8836)
Ferrules
0.27-mm id, for 0.10-mm id columns (5062-3518)
0.37-mm id, for 0.20-mm id columns (5062-3516)
0.40-mm id, for 0.25-mm id columns (5181-3323)
0.47-mm id, for 0.32-mm id columns (5062-3514)
0.74-mm id, for 0.53-mm id columns (5062-3512)
Gloves, clean
large (8650-0030)
small (8650-0029)
Inlet column nut (5181-8830)
Magnifying glass
Septum (may be old, used inlet septum)
1 Slide a septum, column nut, and conditioned ferrule onto the free end of
the column.
The tapered end of the ferrule should point away from the column nut.
2 Use the column cutter to score the column 2 cm from the end.
3 Break off the end of the column.
Hold the column against the column cutter with your thumb. Break the column
against edge of the column cutter.
4 Inspect the end for jagged edges or burrs.
If the break is not clean and even, repeat steps 2 and 3.
5 Wipe the outside of the free end of the column with a lint-free cloth
moistened with methanol.
22
s˜˜˜˜m’›"ddamV˜
˜pd¤hm’
p˜zFz"F˜"˜4"zadd"©˜4pd¤hm˜Op˜am’›"dd"›apm
"zadd"©˜4pd¤hm
pd¤hm˜4¤››F
F¤dF
mdF›˜4pd¤hm˜m¤›
Fz›¤h
23
s˜˜˜˜m’›"ddamV˜
˜pd¤hm’
p˜am’›"dd˜"˜4"zadd"©˜4pd¤hm˜am˜"˜’zda›—’zda›dF’’˜amdF›
To install a capillary column in a split/splitless inlet
"›Fa"d’˜mFF=F=9
Gloves, clean
large (8650-0030)
small (8650-0029)
Metric ruler
Wrench, open-end, 1/4-inch × 5/16-inch (8710-0510)
To install columns in other types of inlets, refer to your 6890 Series Gas
Chromatograph Operating Manual.
1 Prepare the column for installation (page 22).
2 Position the column so it extends 4 to 6 mm past the end of the ferrule.
3 Slide the septum to place the nut and ferrule in the correct position.
4 Insert the column in the inlet.
5 Slide the nut up the column to the inlet base and finger tighten the nut.
6 Adjust the column position so the septum is even with the bottom of the
column nut.
7 Tighten the column nut an additional 1/4 to 1/2 turn.
The column should not slide with a gentle tug.
8 Start carrier gas flow.
9 Verify flow by submerging the free end of the column in isopropanol. Look
for bubbles.
24
s˜˜˜˜m’›"ddamV˜
˜pd¤hm’
p˜am’›"dd˜"˜4"zadd"©˜4pd¤hm˜am˜"˜’zda›—’zda›dF’’˜amdF›
m’¤d"›apm˜4¤z
F=¤4amV˜m¤›
"zadd"©˜4pd¤hm
T˜›p˜–˜hh
F¤dF˜|mp›˜¦a’a*dF}
mdF›˜4pd¤hm˜m¤›
Fz›¤h
25
s˜˜˜˜m’›"ddamV˜
˜pd¤hm’
p˜4pm=a›apm˜"˜4"zadd"©˜4pd¤hm
To condition a capillary column
"›Fa"d’˜mFF=F=9
Carrier gas, (99.999% pure or better)
Wrench, open-end, 1/4-inch × 5/16-inch (8710-0510)
p˜mp›˜4pm=a›apm˜©p¤˜4"zadd"©˜4pd¤hm˜§a›^˜^©=pVFm˜©=pVFm˜"44¤h¤d"›apm˜am˜›^F˜
˜p¦Fm˜4"m˜F’¤d›˜am˜"m˜F¨zdp’apm˜O˜©p¤˜zd"m˜›p˜¤’F˜^©=pVFm˜"’˜©p¤˜4"aF˜V"’:˜
Oa’›˜4pm=a›apm˜›^F˜4pd¤hm˜§a›^˜¤d›"z¤F˜|nnnnn~˜p˜*F››F}˜amF›˜V"’˜’¤4^˜"’˜^Fda¤h:˜
ma›pVFm:˜p˜"Vpm
1 Install the column in the GC inlet, page 24.
2 Allow the carrier gas to flow through the column for 5 minutes without
heating GC oven.
3 Ramp the oven temperature at 5°C/minute to 10°C above your highest
analytical temperature.
4 Once the oven temperature exceeds 80°C, inject 5 µl methanol into GC;
repeat two more times at 5-minute intervals.
This will help remove any contamination from the column before it is installed into
the GC/MSD interface.
p˜mp›˜F¨4FF=˜›^F˜h"¨ah¤h˜›FhzF"›¤F˜"›amV˜pO˜›^F˜4pd¤hm
5 Hold this temperature. Allow the carrier gas to flow for several hours.
6 Return the GC oven temperature to a low standby temperature.
FF˜d’p
For more information about installing a capillary column, refer to the
application note:
Optimizing splitless injections on your GC for high performance MS analysis,
publication number 5091-4587E.
26
s˜˜˜˜m’›"ddamV˜
˜pd¤hm’
p˜4pm=a›apm˜"˜4"zadd"©˜4pd¤hm
27
s˜˜˜˜m’›"ddamV˜
˜pd¤hm’
p˜am’›"dd˜"˜4"zadd"©˜4pd¤hm˜am˜›^F˜
—˜am›FO"4F
To install a capillary column in the GC/MSD interface
"›Fa"d’˜mFF=F=9
Column cutter (5181-8836)
Ferrules
0.3-mm id, for 0.10-mm id columns (5062-3507)
0.4-mm id, for 0.20- and 0.25-mm id columns (5062-3508)
0.5-mm id, for 0.32-mm id columns (5062-3506)
0.8-mm id, for 0.53-mm id columns (5062-3538)
Flashlight
Hand lens (magnifying glass)
Gloves, clean
large (8650-0030)
small (8650-0029)
Interface column nut (05988-20066)
Safety glasses
Wrench, open-end, 1/4-inch × 5/16-inch (8710-0510)
p›F˜›^"›˜›^F˜4pd¤hm˜am’›"dd"›apm˜zp4F=¤F˜Op˜›^F˜Qn•˜’˜a’˜=aOOFFm›˜Oph˜›^"›˜Op˜
"dd˜zF¦ap¤’˜’˜’amV˜›^F˜zp4F=¤F˜Oph˜"mp›^F˜am’›¤hFm›˜F’¤d›˜am˜zpp˜’Fm’a›a¦a›©:˜
"m=˜zp’’a*d©˜="h"VF˜›^F˜
1 Condition the column (page 26).
2 Vent the MSD (page 54) and open the analyzer chamber (page 56).
Be sure you can see the end of the GC/MSD interface.
3 Slide an interface nut and conditioned ferrule onto the free end of the GC
column.
The tapered end of the ferrule must point towards the nut.
4 Slide the column into the GC/MSD interface until you can pull it out
through the analyzer chamber.
5 Break 1 cm off the end of the column (page 22).
Do not let any column fragments fall into the analyzer chamber. They could damage the turbo pump.
28
s˜˜˜˜m’›"ddamV˜
˜pd¤hm’
p˜am’›"dd˜"˜4"zadd"©˜4pd¤hm˜am˜›^F˜
—˜am›FO"4F
pd¤hm
m›FO"4F˜4pd¤hm˜m¤›
—˜am›FO"4F
|
˜Fm=}
m"d©«F˜4^"h*F
—˜am›FO"4F
|˜Fm=}
s˜›p˜¢˜hh
˜p¦Fm
6 Clean the outside of the free end of the column with a lint-free cloth
moistened with methanol.
7 Adjust the column so it projects 1 to 2 mm past the end of the GC/MSD
interface.
Use the flashlight and hand lens if necessary to see the end of the column inside
the analyzer chamber. Do not use your finger to feel for the column end.
8 Hand tighten the nut.
Make sure the position of the column does not change as you tighten the nut.
9 Tighten the nut 1/4 to 1/2 turn.
Check the tightness after one or two heat cycles.
29
s˜˜˜˜m’›"ddamV˜
˜pd¤hm’
p˜am’›"dd˜"˜4"zadd"©˜4pd¤hm˜¤’amV˜›^F˜am’›"dd"›apm˜›ppd
To install a capillary column using the installation tool
"›Fa"d’˜mFF=F=9
Column cutter (5181-8836)
Column installation tool (not supplied with the MSD) (G1099-20030)
Ferrules
0.3-mm id, for 0.10-mm id columns (5062-3507)
0.4-mm id, for 0.20- and 0.25-mm id columns (5062-3508)
0.5-mm id, for 0.32-mm id columns (5062-3506)
0.8-mm id, for 0.53-mm id columns (5062-3538)
Gloves, clean
large (8650-0030)
small (8650-0029)
Interface column nut (05988-20066)
Septum (may be old, used inlet septum)
Wrenches, open-end, 1/4-inch × 5/16-inch (8710-0510) – 2 required
p›F9
The column installation tool is not recommended for applications requiring optimal
sensitivity performance. See “To install a capillary column without the installation
tool”, page 28.
1 Vent the MSD. See page 54.
2 Slide a septum, interface column nut, and conditioned ferrule onto the
free end of the column.
The tapered end of the ferrule should point toward the nut.
3 Insert the column into the column installation tool.
Slide the column through until the end extends past the end of the tool.
4 Cut 1 cm off the end of the column (page 22).
5 Position the column so that 1 to 2 mm extends past the end of the tool.
Hand tighten the nut.
6 Slide the septum to touch the end of the nut.
The septum will help assure that the position is correct.
7 Use two wrenches to tighten the nut 1/4 to 1/2 turn.
The column should not slide when tugged gently.
30
s˜˜˜˜m’›"ddamV˜
˜pd¤hm’
p˜am’›"dd˜"˜4"zadd"©˜4pd¤hm˜¤’amV˜›^F˜am’›"dd"›apm˜›ppd
pd¤hm˜
m›FO"4F˜4pd¤hm˜m¤›
pd¤hm˜am’›"dd"›apm˜›ppd
s˜›p˜¢˜hh
m›FO"4F˜OF¤dF
Fz›¤h
8 Remove the column and nut from the installation tool.
The total length from the septum to the end of the column is 176 mm.
9 Clean the outside of the end of the column with a lint-free cloth moistened
with methanol.
10 Insert the column into the GC/MSD interface.
11 Tighten the nut 1/4 to 1/2 turn.
Check tightness after one or two heat cycles.
12 Pump down the MSD.
^F˜4pd¤hm˜am’›"dd"›apm˜›ppd˜h¤’›˜*F˜cFz›˜4dF"m˜›p˜zF¦Fm›˜4pm›"ham"›amV˜›^F˜4pd¤hm˜"m=˜
›^F˜apm˜’p¤4F˜FFz˜a›˜am˜a›’˜’›p"VF˜›¤*F:˜"m=˜4dF"m˜a›˜*©˜Od¤’^amV˜§a›^˜hF›^"mpd˜"O›F˜F"4^˜
¤’F
31
32
2
To view MSD analyzer temperature and vacuum status, 38
To set monitors for MSD temperature and vacuum status, 40
To set the MSD analyzer temperatures, 42
To set the GC/MSD interface temperature from the PC, 44
To monitor high vacuum pressure, 46
To measure column flow linear velocity, 48
To calculate column flow, 49
To tune the MSD, 50
To set the interface temperature from a 6890 Plus GC, 67
To remove the MSD covers, 52
To vent the MSD, 54
To open the analyzer chamber, 56
To close the analyzer chamber, 58
To pump down the MSD, 60
To connect the gauge controller, 63
To move or store the MSD, 65
To vent the MSD without the ChemStation, 68
Operating the MSD
How to perform some basic operating procedures for the MSD
Operating the MSD
Operation of the MSD from the data system
The software performs tasks such as pumpdown, monitoring pressures,
setting temperatures, tuning, and preparing to vent. These tasks are described in this chapter. Data acquisition and data analysis are described in
the manuals and online help supplied with the MSD ChemStation software.
Operation of the MSD from the control panel
You can use the 5973N MSD control panel to perform many of the same tasks
that the ChemStation can perform. See the 5973N Control Panel Quick
Reference G2589-90011for more information.
Some conditions must be met before you turn on the MSD
Verify the following before you turn on or attempt to operate the MSD.
• The vent valve must be closed (the knob turned all the way clockwise).
• All other vacuum seals and fittings must be in place and fastened
correctly. (The the front side plate screw should not be tightened, unless
hazardous carrier or reagent gasses are being used.
• The MSD is connected to a grounded power source.
• The GC/MSD interface extends into the GC oven.
• A conditioned capillary column is installed in the GC inlet and in the
GC/MSD interface.
• The GC is on, but the heated zones for the GC/MSD interface, the
injection port, and the oven are off.
• Carrier gas of at least 99.999% purity is plumbed to the GC with the
recommended traps.
• If hydrogen is used as carrier gas, carrier gas flow must be off, and the
front sideplate thumbscrew must be loosely fastened.
• The foreline pump exhaust is properly vented.
34
¢˜˜˜˜zF"›amV˜›^F˜
^F˜F¨^"¤’›˜Oph˜›^F˜OpFdamF˜z¤hz˜4pm›"am’˜’pd¦Fm›’˜"m=˜›^F˜4^Fha4"d’˜©p¤˜"F˜
"m"d©«amV˜›˜"d’p˜4pm›"am’˜›"4F’˜pO˜z¤hz˜pad˜^F˜’¤zzdaF=˜pad˜›"z˜’›pz’˜pmd©˜z¤hz˜
pad˜›˜=pF’˜mp›˜›"z˜p˜Oad›F˜p¤›˜›p¨a4˜4^Fha4"d’˜O˜©p¤˜"F˜¤’amV˜›p¨a4˜’pd¦Fm›’˜p˜
"m"d©«amV˜›p¨a4˜4^Fha4"d’:˜Fhp¦F˜›^F˜pad˜›"z˜m’›"dd˜"˜^p’F˜|ss˜hh˜a=}˜›p˜›"cF˜›^F˜
OpFdamF˜z¤hz˜F¨^"¤’›˜p¤›’a=F˜p˜›p˜"˜O¤hF˜|F¨^"¤’›}˜^pp=
O˜©p¤˜"F˜¤’amV˜^©=pVFm˜"’˜"˜4"aF˜V"’:˜=p˜mp›˜’›"›˜4"aF˜V"’˜Odp§˜¤m›ad˜›^F˜˜
^"’˜*FFm˜z¤hzF=˜=p§m˜O˜›^F˜¦"4¤¤h˜z¤hz’˜"F˜pOO:˜^©=pVFm˜§add˜"44¤h¤d"›F˜am˜
›^F˜˜"m=˜"m˜F¨zdp’apm˜h"©˜p44¤˜F"=˜›^F˜©=pVFm˜"aF˜
"’˜"OF›©˜
¤a=F˜
|QnQQ_QnG}˜*FOpF˜pzF"›amV˜›^F˜˜§a›^˜^©=pVFm˜4"aF˜V"’
The data system or control panel help you pump down the MSD
Pumpdown is mostly automated. Once you close the vent valve and turn on
the main power switch (while pressing on the sideplate), the MSD pumps
down by itself. The data system software contains a program that monitors
and displays system status during pumpdown. When the pressure is low
enough, the program turns on the ion source and mass filter heaters. It also
prompts you to turn on the GC/MSD interface heater. 5973N MSDs will
shutdown if they cannot pump down correctly.
Pressure in the MSD can be monitored two ways
The diffusion pump MSD is equipped with a gauge that measures foreline
pressure. Foreline pressure can be monitored only through the data system.
The turbo pump MSD does not have a foreline gauge. Instead, the data
system displays turbo pump motor speed.
Each MSD is equipped with a triode ionization gauge tube. If your MSD is
also equipped with an 59864B Gauge Controller, the triode gauge can
measure the pressure in the analyzer chamber. The high vacuum pressure
measured by the triode gauge cannot be monitored through the data system.
It is displayed on the gauge controller.
35
¢˜˜˜˜zF"›amV˜›^F˜
MSD temperatures are controlled through the data system
The MSD has independent heaters and temperature sensors for the ion
source and quadrupole mass filter. You can adjust the setpoints and view
these temperatures from the data system, or from the control panel.
The GC/MSD interface heater is powered and controlled by the Thermal
Aux #2 heated zone of the 6890 Plus GC. The GC/MSD interface temperature can be set and monitored from the data system or from the
GC keypad.
Column flow is controlled through the data system
Carrier gas flow through the GC column is controlled by head pressure in
the GC. For a given head pressure, the column flow will decrease as the GC
oven temperature increases. With electronic pneumatic control (EPC) set
to pm’› dp§˜(constant flow), the same column flow is be maintained regardless of oven temperature.
The MSD can be used to measure actual column flow. You inject a small
amount of air or other unretained chemical, and time how long it takes to
reach the MSD. With this time measurement, you can calculate the column
flow. See page 48..
The data system aids in venting
A program in the data system guides you through the venting process. It
switches off the GC and MSD heaters and the diffusion pump heater or turbo
pump at the correct time. It also lets you monitor temperatures in the MSD
and indicates when to vent the MSD.
The MSD will be damaged by incorrect venting. A diffusion pump will
backstream vaporized pump fluid onto the analyzer if the MSD is vented
before the diffusion pump has fully cooled. A turbo pump will be damaged
if it is vented while spinning at more than 50% of its normal operating speed.
36
¢˜˜˜˜zF"›amV˜›^F˜

"cF˜’¤F˜›^F˜
—˜am›FO"4F˜"m=˜›^F˜"m"d©«F˜«pmF’˜"F˜4ppd˜|*Fdp§˜s¬¬@}˜
*FOpF˜©p¤˜¦Fm›˜›^F˜˜˜s¬¬@˜a’˜’›add˜^p›˜Fmp¤V^˜›p˜*¤m˜’cam”˜"d§"©’˜§F"˜4dp›^˜
Vdp¦F’˜§^Fm˜^"m=damV˜"m"d©«F˜z"›’
O˜©p¤˜"F˜¤’amV˜^©=pVFm˜"’˜"˜4"aF˜V"’:˜›^F˜4"aF˜V"’˜Odp§˜h¤’›˜*F˜pOO˜*FOpF˜
›¤mamV˜pOO˜›^F˜˜zp§F˜˜O˜›^F˜OpFdamF˜z¤hz˜a’˜pOO:˜^©=pVFm˜§add˜"44¤h¤d"›F˜am˜
›^F˜˜"m=˜"m˜F¨zdp’apm˜h"©˜p44¤˜˜F"=˜›^F˜©=pVFm˜"aF˜
"’˜"OF›©˜
¤a=F˜
|QnQQ_QnG}˜*FOpF˜pzF"›amV˜›^F˜˜§a›^˜^©=pVFm˜4"aF˜V"’
F¦F˜¦Fm›˜›^F˜˜*©˜"ddp§amV˜"a˜am˜›^p¤V^˜Fa›^F˜Fm=˜pO˜›^F˜OpFdamF˜^p’F˜˜’F˜›^F˜
¦Fm›˜¦"d¦F˜p˜Fhp¦F˜›^F˜4pd¤hm˜m¤›˜"m=˜4pd¤hm
p˜mp›˜¦Fm›˜p˜’^¤›˜pOO˜›^F˜zp§F˜pm˜"˜=aOO¤’apm˜z¤hz˜˜§^adF˜›^F˜z¤hz˜a’˜^p›
p˜mp›˜¦Fm›˜§^adF˜›^F˜›¤*p˜z¤hz˜a’˜’›add˜’zammamV˜"›˜hpF˜›^"m˜Q¬~
p˜mp›˜F¨4FF=˜›^F˜h"¨ah¤h˜F4phhFm=F=˜›p›"d˜V"’˜Odp§˜FF˜‰Qn•˜˜hp=Fd’˜"m=˜
OF"›¤F’Š˜pm˜z"VF •
Moving or storing the MSD requires special care
The best way to keep your MSD functioning properly is to keep it pumped
down and hot, with carrier gas flow. If you plan to move or store your MSD,
a few additional precautions are required. The MSD must remain upright at
all times; this requires special caution when moving. The MSD should not be
left vented to atmosphere for long periods.
37
¢˜˜˜˜zF"›amV˜›^F˜
p˜¦aF§˜˜"m"d©«F˜›FhzF"›¤F˜"m=˜¦"4¤¤h˜’›"›¤’
To view MSD analyzer temperature and vacuum status
pO›§"F˜4^"mVF’
The software is revised periodically. If the steps in this procedure do not match
your MSD ChemStation software, refer to the manuals and online help supplied
with the software for more information.
FF˜"d’p
You can also use the Control Panel to perform this task. See the 5973N Control
Panel Quick Reference Guide for more information.
1 In Instrument Control view, select =a›˜˜¤mF˜""hF›F’ from the
Instrument menu.
2 Select the tune file you plan to use with your method from the p"=˜˜¤mF˜
adF dialog box.
3 Analyzer temperatures and vacuum status are displayed in the !pmF’ field.
Unless you have just begun the pumpdown process, the foreline pressure should
be less than 300 mTorr, or the turbo pump should be running at least 80% speed.
MSD heaters remain off as long as the diffusion pump is cold or the turbo pump is
operating at less than 80%. Normally, the foreline pressure will be below 100
mTorr, or the turbo pump speed will be at 100%.
The MSD heaters turn off at the beginning of the vent cycle, and turn on at the end
of the pumpdown cycle. Note that the reported setpoints will not change during
venting or pumpdown, even though both the MSD zones are turned off.
38
¢˜˜˜˜zF"›amV˜›^F˜
p˜¦aF§˜˜"m"d©«F˜›FhzF"›¤F˜"m=˜¦"4¤¤h˜’›"›¤’
39
¢˜˜˜˜zF"›amV˜›^F˜
p˜’F›˜hpma›p’˜Op˜˜›FhzF"›¤F˜"m=˜¦"4¤¤h˜’›"›¤’
To set monitors for MSD temperature and vacuum status
Monitors display the current value of a single instrument parameter. They can be
added to the standard instrument control window. Monitors can be set to change
color if the actual parameter value varies beyond a user-determined limit from the
parameter setpoint. This procedure describes how to add monitors to your instrument control view.
pO›§"F˜4^"mVF’
The software is revised periodically. If the steps in this procedure do not match
your MSD ChemStation software, refer to the manuals and online help supplied
with the software for more information.
1 Select ˜pma›p’ from the Instrument menu.
2 In the Edit MS Monitors box, under Type, select !pmF.
3 Under Parameter, select ˜p¤4F and click ==.
4 Under Parameter, select ˜¤"=˜and click ==.
5 Under Parameter, select pFdamF (or ¤*pz=) and click ==.
6 Click .
The new monitors will be stacked on top of each other in the lower right corner of
the Instrument Control window. They must be moved for you to see them all.
7 Click and drag each monitor to the desired position.
See the accompanying illustration for an example of arranging the monitors.
8 To make the new settings part of the method, select "¦F from the Method
menu.
40
¢˜˜˜˜zF"›amV˜›^F˜
p˜’F›˜hpma›p’˜Op˜˜›FhzF"›¤F˜"m=˜¦"4¤¤h˜’›"›¤’
41
¢˜˜˜˜zF"›amV˜›^F˜
p˜’F›˜›^F˜˜"m"d©«F˜›FhzF"›¤F’
To set the MSD analyzer temperatures
Setpoints for the MSD ion source and mass filter (quad) temperatures are stored
in the current tune (*.u) file. When a method is loaded, the setpoints in the tune
file associated with that method are downloaded automatically.
pO›§"F˜4^"mVF’
The software is revised periodically. If the steps in this procedure do not match
your MSD ChemStation software, refer to the manuals and online help supplied
with the software for more information.
1 In Instrument Control view, select =a›˜˜¤mF˜""hF›F’ from the
Instrument menu.
2 Select the tune file you plan to use with your method from the Load MS
Tune File dialog box.
3 Select FhzF"›¤F’ from the MoreParams menu.
4 Type the desired Source and Quad (mass filter) temperatures in the
setpoint fields and click 
Table 1 on page 43 for recommended setpoints
The GC/MSD interface, ion source, and quadrupole heated zones interact. The
analyzer heaters may not be able to accurately control temperatures if the setpoint
for one zone is much lower than that of an adjacent zone.
p˜mp›˜F¨4FF=˜¢¬¬@˜Op˜›^F˜„¤"=¤zpdF˜p˜¢Q¬@˜Op˜›^F˜’p¤4F
5 Click˜ in the Edit Parameters window to apply the new temperature
setpoints.
6 When the "¦F˜˜¤mF˜adF˜dialog˜box appears, either click to save your
changes to the same file or type a new file name and click .
42
¢˜˜˜˜zF"›amV˜›^F˜
p˜’F›˜›^F˜˜"m"d©«F˜›FhzF"›¤F’
"*dF˜s
F4phhFm=F=˜›FhzF"›¤F˜’F››amV’
˜p¤4F
˜¤"=
˜pzF"›apm
¢¬
sQ¬
˜pzF"›apm
sQ¬
sQ¬
˜pzF"›apm
sQ¬
sQ¬
43
¢˜˜˜˜zF"›amV˜›^F˜
p˜’F›˜›^F˜
—˜am›FO"4F˜›FhzF"›¤F˜Oph˜›^F˜
To set the GC/MSD interface temperature from the PC
pO›§"F˜4^"mVF’
The software is revised periodically. If the steps in this procedure do not match
your MSD ChemStation software, refer to the manuals and online help supplied
with the software for more information.
FF˜"d’p
You can also use the Control Panel to perform this task. See the 5973N Control
Panel Quick Reference Guide for more information.
1 Select m’›¤hFm›˜pm›pd˜from the View menu.
2 Click the ¤¨ button to display the m’›¤hFm› | =a› | ¤¨9˜|–Gn¬} window.
3 Verify that is selected under Type and ^Fh"d˜¤¨˜o¢ is selected under
Aux Channel.
4 Turn the heater on, and type the setpoint in the F¨›˜@ column. Do not set
temperature ramps.
5 The typical setpoint is 280°C.
The limits are 0°C and 350°C. A setpoint below ambient temperature turns off the
interface heater.
F¦F˜F¨4FF=˜›^F˜h"¨ah¤h˜›FhzF"›¤F˜Op˜©p¤˜4pd¤hm
6 Click zzd© to download setpoints or click to download setpoints and
close the window.
7 To make the new settings part of the method, select "¦F from the Method
menu.
"cF˜’¤F˜›^"›˜›^F˜4"aF˜V"’˜a’˜›¤mF=˜pm˜"m=˜›^F˜4pd¤hm˜^"’˜*FFm˜z¤VF=˜pO˜"a˜*FOpF˜
^F"›amV˜›^F˜
—˜am›FO"4F˜p˜›^F˜
˜p¦Fm
44
¢˜˜˜˜zF"›amV˜›^F˜
p˜’F›˜›^F˜
—˜am›FO"4F˜›FhzF"›¤F˜Oph˜›^F˜
45
¢˜˜˜˜zF"›amV˜›^F˜
p˜hpma›p˜^aV^˜¦"4¤¤h˜zF’’¤F
To monitor high vacuum pressure
"›Fa"d’˜mFF=F=9
Gauge controller (59864B)
Triode ionization gauge cable (8120-6573)
F¦F˜4pmmF4›˜p˜=a’4pmmF4›˜›^F˜4"*dF˜Oph˜›^F˜›ap=F˜V"¤VF˜›¤*F˜§^adF˜›^F˜˜a’˜
¤m=F˜¦"4¤¤h˜a’c˜pO˜ahzdp’apm˜"m=˜amb¤©˜=¤F˜›p˜*pcFm˜Vd"’’˜F¨a’›’
O˜©p¤˜"F˜¤’amV˜^©=pVFm˜"’˜"˜4"aF˜V"’:˜=p˜mp›˜›¤m˜pm˜›^F˜›ap=F˜V"¤VF˜›¤*F˜aO˜›^FF˜
a’˜"m©˜zp’’a*ada›©˜›^"›˜^©=pVFm˜^"’˜"44¤h¤d"›F=˜am˜›^F˜"m"d©«F˜4^"h*F˜^F˜›ap=F˜
V"¤VF˜Oad"hFm›˜4"m˜aVma›F˜^©=pVFm˜F"=˜›^F˜©=pVFm˜"aF˜
"’˜"OF›©˜
¤a=F˜
|QnQQ_QnG}˜*FOpF˜pzF"›amV˜›^F˜˜§a›^˜^©=pVFm˜4"aF˜V"’
1 Connect the gauge controller to the ionization gauge tube (page 63).
2 Start up and pump down the MSD (page 60).
3 Switch on the power switch on the back of the gauge controller.
4 Press and release the button.
After a few seconds, the pressure should be displayed.
Pressure is displayed in the format˜ J where˜J˜ is the base 10 exponent.
Units are Torr.
The gauge controller will not turn on if the pressure in the MSD is above approximately 8 × 10_ Torr. The gauge controller will display all 9s and then go blank. The
triode gauge tube can measure pressures between approximately 8 × 10_ and less
than 2 × 10_– Torr. The gauge controller is calibrated for nitrogen, but all pressures
listed in this manual are for helium. Refer to the manual for the 59864B for information on relative sensitivity to different gases.
The largest influence on operating pressure in EI mode is the carrier gas (column)
flow. The following table lists typical pressures for various helium carrier gas flows.
These pressures are approximate and will vary from instrument to instrument, by
as much as 30%
46
¢˜˜˜˜zF"›amV˜›^F˜
p˜hpma›p˜^aV^˜¦"4¤¤h˜zF’’¤F
"*dF˜¢
©za4"d˜˜zF’’¤F˜F"=amV’˜Op˜¦"ap¤’˜^Fda¤h˜4"aF˜V"’˜Odp§˜"›F’
aOO¤’apm˜z¤hz˜
pd¤hm˜Odp§˜|hd—ham}
ap=F˜V"¤VF˜F"=amV˜|p}
pFdamF˜V"¤VF˜F"=amV˜|p}
s¬
Q¬˜×˜s¬_Q˜
T¬
sQ
•Q˜×˜s¬_Q˜
Q
¢¬˜
s¬˜×˜s¬_T˜|p›˜
F4phhFm=F=}
––
¤*p˜z¤hz˜’
pd¤hm˜Odp§˜|hd—ham}
ap=F˜V"¤VF˜F"=amV˜|p}:˜
FOph"m4F˜›¤*p˜z¤hz
ap=F˜V"¤VF˜F"=amV˜|p}:˜
›"m="=˜›¤*p˜z¤hz
s¬
sQ˜˜×˜s¬_Q˜˜
T¬˜×˜s¬_Q
¢¬
¬˜˜×˜s¬_Q˜
G¬×˜s¬_Q˜
¢T
Q˜×˜s¬_Q˜
s¬˜×˜s¬_T˜|p›˜F4phhFm=F=}
¬
TQ˜˜×˜s¬_Q˜
p›˜’¤zzp›F=
T¬
Q¬˜˜×˜s¬_Q˜
p›˜’¤zzp›F=
If the pressure is consistently higher than those listed, refer to the online help in
the MSD ChemStation software for information on troubleshooting air leaks and
other vacuum problems.
If the pressure rises above approximately 8 × 10_ Torr, the gauge controller
will turn off the triode gauge tube. The gauge tube GRHVQRW turn back on
automatically.
47
¢˜˜˜˜zF"›amV˜›^F˜
p˜hF"’¤F˜4pd¤hm˜Odp§˜damF"˜¦Fdp4a›©
To measure column flow linear velocity
"›Fa"d’˜mFF=F=9
Syringe
1 Set Data Acquisition for splitless manual injection and selected ion
monitoring (SIM) of m/z 28.
2 Press the Fz˜¤m˜button on the GC keypad.
3 Inject 1 µl of air into the injection port and press the ›"›˜¤m˜button.
4 Wait until a peak elutes at m/z 28.
Note the retention time.
5 Calculate the average linear velocity.
Average linear velocity (cm/sec) = 100/
W
where:
L = length of the column in meters
t = retention time in seconds
Be sure to account for any pieces of column broken off. A 1-meter section missing
from a 25-meter column can yield a 4% error.
6 Use this value to verify the MSD ChemStation flow calculations (page 49).
If the numbers disagree, click the ^"mVF button to calibrate the column dimensions.
7 To calculate the volumetric flow rate.
2
D /
Volumetric flow rate (ml/min) = W
where:
D = internal column diameter in millimeters
L = the column length in meters
t = the retention time in minutes
48
¢˜˜˜˜zF"›amV˜›^F˜
p˜4"d4¤d"›F˜4pd¤hm˜Odp§
To calculate column flow
1 In the Instrument Control view, click the pd¤hm’ icon.
2 Check that the correct column dimensions are entered.
3 Type the desired value in the pressure field.
4 If the Average Velocity displayed is different from that obtained on
page 48, click the ^"mVF button to calibrate the column dimensions.
49
¢˜˜˜˜zF"›amV˜›^F˜
p˜›¤mF˜›^F˜
To tune the MSD
pO›§"F˜4^"mVF’
The software is revised periodically. If the steps in this procedure do not match
your MS ChemStation software, refer to the manuals and online help supplied with
the software for more information.
FF˜"d’p
You can also use the Control Panel to run the autotune that is currently loaded in
the PC memory. See the 5973N Control Panel Quick Reference Guide for more
information.
1 In the Instrument Control View, select FOph˜˜¤›p›¤mF from the
Instrument menu.
2 Select the tune program you wish to use.
The tune will start immediately. For most applications, ¤›p›¤mF gives the best
results. ›"m="=˜¤mF is not recommended, as it may reduce sensitivity.
¤a4c˜¤mF is used to adjust peak width, mass assignment, and abundance, without
changing ion ratios. Always tune the MSD with the same GC oven temperature and
column flow, and the same analyzer temperatures that will be used for data acquisition.
3 Wait for the tune to complete and to generate the report.
Save your tune reports. To view history of tune results, select aF§˜¤mF’ under
the Qualify menu.
4 To manually tune your MSD or to perform special autotunes, select
"m¤"d˜¤mF from the View menu.
In the Manual Tune view, you can manually adjust most tune parameters to suit
special needs.
From the Tune menu, in addition to the tunes available from Instrument Control,
you can select special autotunes for specific spectral results: ˜¤mF,
˜¤mF, or "VF›˜¤mF.
See the manuals or online help provided with your MSD ChemStation software for
additional information about tuning.
50
¢˜˜˜˜zF"›amV˜›^F˜
p˜¦FaO©˜’©’›Fh˜zFOph"m4F
To verify system performance
"›Fa"d’˜mFF=F=9
1 pg/µl (0.001 ppm) OFN sample (8500-5441)
Verify the tune performance
1 Verify that the system has been pumping down for at least 60 minutes.
2 Set the GC oven temperature to 150°C, and the column flow to 1.0 ml/min.
3 In the Instrument Control view, select ^F4cp¤›˜¤mF˜from the Qualify menu.
The software will perform an autotune and print out the report.
4 When the autotune has completed, save the method, and then select ¤mF˜
¦"d¤"›apm from the Qualify menu.
The software will evaluate the last autotune and print a System Verification – Tune
report.
Verify the sensitivity performance
1 Set up to inject 1 µl of OFN, either with the ALS or manually.
2 In the Instrument Control view, select Fm’a›a¦a›©˜^F4c˜from the Qualify
menu.
3 Click the appropriate icons in the Instrument | Edit window to edit the
method for the type of injection.
4 Click to run the method.
When the method is completed, an evaluation report will print out.
Verify that rms signal-to-noise ratio meets the published specification. See the
5973Network Mass Selective Detector Specifications (5968-7358E.).
51
¢˜˜˜˜zF"›amV˜›^F˜
p˜Fhp¦F˜›^F˜˜4p¦F’
To remove the MSD covers
"›Fa"d’˜mFF=F=9
Screwdriver, TORX T-15 (8710-1622)
The analyzer cover is removed for venting and for many maintenance procedures.
The lower MSD cover is removed to check the fluid level in the diffusion pump and
for a few maintenance procedures. If you need to remove one of the MSD covers,
follow these procedures:
Analyzer cover
1 Grasp the front of the analyzer cover and lift up enough to unlatch the five
front tabs.
2 Reach back and grasp the back edge of the analyzer cover.
3 Pull forward to disengage the rear spring latch.
It may take a firm pull to disengage the latch.
To reinstall the analyzer cover, reverse these steps.
Lower MSD cover
1 Remove the analyzer cover.
2 Remove the 3 screws that hold the lower MSD cover in place.
3 Pull the cover left slightly to disengage the two right side tabs and then
pull it straight forward.
To reinstall the lower MSD cover, reverse these steps.
p˜mp›˜Fhp¦F˜"m©˜4p¦F’˜p›^F˜›^"m˜›^F˜¤zzF˜"m=˜dp§F˜˜4p¦F’˜˜"mVFp¤’˜
¦pd›"VF’˜"F˜zF’Fm›˜¤m=F˜p›^F˜4p¦F’
52
¢˜˜˜˜zF"›amV˜›^F˜
p˜Fhp¦F˜›^F˜˜4p¦F’
m"d©«F˜4p¦F
"›4^˜›"*’
p§F˜4p¦F
dp›’˜Op˜›"*’
p˜mp›˜¤’F˜F¨4F’’a¦F˜Op4F:˜p˜›^F˜zd"’›a4˜›"*’˜›^"›˜^pd=˜›^F˜4p¦F˜›p˜›^F˜h"amO"hF˜§add˜
*F"c˜pOO
53
¢˜˜˜˜zF"›amV˜›^F˜
p˜¦Fm›˜›^F˜
To vent the MSD
ah§"F˜4^"mVF’
The firmware is revised periodically. If the steps in this procedure do not match
your MSD control panel, refer to the manuals and online help supplied with the
software, or the 5973N MSD Control Panel Quick Reference for more information.
1 If your system is equipped with a gauge controller, switch off the triode
gauge controller.
2
Before venting a CI MSD, press the "’˜OO button (turns off the reagent
gas flow and closes the isolation valve.)
m˜"˜˜:˜›^F˜
"’˜OO˜daV^›˜h¤’›˜*F˜pm˜§^Fm˜›^F˜˜a’˜¦Fm›amV
3 Select Fm› from the from the Vacuum menu in the software. Follow the
instructions presented.
4 Set the GC/MSD interface heater and the GC oven temperatures to
ambient (25°C). O˜©p¤˜"F˜¤’amV˜^©=pVFm˜"’˜"˜4"aF˜V"’:˜›^F˜4"aF˜V"’˜Odp§˜h¤’›˜*F˜pOO˜*FOpF˜
›¤mamV˜pOO˜›^F˜˜zp§F˜˜O˜›^F˜OpFdamF˜z¤hz˜a’˜pOO:˜^©=pVFm˜§add˜"44¤h¤d"›F˜am˜
›^F˜˜"m=˜"m˜F¨zdp’apm˜h"©˜p44¤˜F"=˜›^F˜©=pVFm˜"aF˜
"’˜"OF›©˜
¤a=F˜
|QnQQ_QnG}˜*FOpF˜pzF"›amV˜›^F˜˜§a›^˜^©=pVFm˜4"aF˜V"’˜
F˜’¤F˜›^F˜
˜p¦Fm˜"m=˜›^F˜
—˜am›FO"4F˜"F˜4ppd˜*FOpF˜›¤mamV˜pOO˜4"aF˜V"’˜Odp§
5 When prompted, turn off the MSD power switch.
6 Unplug the MSD power cord.
^Fm˜›^F˜˜a’˜¦Fm›F=:˜=p˜mp›˜z¤›˜›^F˜^Fh›"›apm˜am›p˜pz˜¦aF§˜pamV˜’p˜§add˜›¤m˜pm˜
›^F˜am›FO"4F˜^F"›F
7 Remove the analyzer cover (page 52).
54
¢˜˜˜˜zF"›amV˜›^F˜
p˜¦Fm›˜›^F˜
8 Turn the vent valve knob counterclockwise only 3/4 turns or until you hear
the hissing sound of air flowing into the analyzer chamber.
Do not turn the knob too far, or the O-ring may fall out of its groove. Be sure to
retighten the knob before pumping down.
˜ddp§˜›^F˜"m"d©«F˜›p˜4ppd˜›p˜mF"˜pph˜›FhzF"›¤F˜*FOpF˜›p¤4^amV˜a›˜
d§"©’˜§F"˜4dF"m˜Vdp¦F’˜§^adF˜^"m=damV˜"m©˜z"›’˜›^"›˜Vp˜am’a=F˜›^F˜"m"d©«F˜4^"h*F
^Fm˜›^F˜˜a’˜¦Fm›F=:˜=p˜mp›˜z¤›˜›^F˜^Fh›"›apm˜am›p˜pz˜¦aF§˜pamV˜’p˜§add˜›¤m˜pm˜
›^F˜am›FO"4F˜^F"›F
55
¢˜˜˜˜zF"›amV˜›^F˜
p˜pzFm˜›^F˜"m"d©«F˜4^"h*F
To open the analyzer chamber
"›Fa"d’˜mFF=F=9
Gloves, clean, lint-free
large (8650-0030)
small (8650-0029)
Wrist strap, anti-static
small (9300-0969)
medium (9300-1257)
large (9300-0970)
dF4›p’›"›a4˜=a’4^"VF’˜›p˜"m"d©«F˜4phzpmFm›’˜"F˜4pm=¤4›F=˜›p˜›^F˜’a=F˜*p"=˜§^FF˜
›^F©˜4"m˜="h"VF˜’Fm’a›a¦F˜4phzpmFm›’˜F"˜"˜Vp¤m=F=˜"m›a_’›"›a4˜§a’›˜’›"z˜"m=˜›"cF˜
p›^F˜"m›a_’›"›a4˜zF4"¤›apm’˜|’FF˜z"VF˜sQG}˜*FOpF˜©p¤˜pzFm˜›^F˜"m"d©«F˜4^"h*F
1 Vent the MSD (page 54).
2 Disconnect the side board control cable and the source power cable from
the side board.
3 Loosen the side plate thumbscrews, if they are fastened.
The rear side plate thumbscrew should be unfastened during normal use. It is only
fastened during shipping. The front side plate thumbscrew should only be fastened for CI operation or if hydrogen or other flammable or toxic substances are
used for carrier gas.
4 Gently swing the side plate out.
^F˜"m"d©«F:˜
—˜am›FO"4F:˜"m=˜p›^F˜4phzpmFm›’˜am˜›^F˜"m"d©«F˜4^"h*F˜
pzF"›F˜"›˜¦F©˜^aV^˜›FhzF"›¤F’˜p˜mp›˜›p¤4^˜"m©˜z"›˜¤m›ad˜©p¤˜"F˜’¤F˜a›˜a’˜4ppd
d§"©’˜§F"˜4dF"m˜Vdp¦F’˜›p˜zF¦Fm›˜4pm›"ham"›apm˜§^Fm˜§pcamV˜am˜›^F˜"m"d©«F˜4^"h*F
O˜©p¤˜OFFd˜F’a’›"m4F:˜’›pz˜p˜mp›˜›©˜›p˜Op4F˜›^F˜’a=F˜zd"›F˜pzFm˜FaO©˜›^"›˜˜a’˜
¦Fm›F=˜FaO©˜›^"›˜*p›^˜›^F˜Opm›˜"m=˜F"˜’a=F˜zd"›F˜’4F§’˜"F˜4phzdF›Fd©˜dpp’F
56
¢˜˜˜˜zF"›amV˜›^F˜
p˜pzFm˜›^F˜"m"d©«F˜4^"h*F
pm›˜›^¤h*’4F§˜
F"˜›^¤h*’4F§˜J˜
=p˜mp›˜›aV^›Fm
p¤4F˜zp§F˜4"*dF
a=F˜*p"=˜4pm›pd˜4"*dF
a=F˜zd"›F
57
¢˜˜˜˜zF"›amV˜›^F˜
p˜4dp’F˜›^F˜"m"d©«F˜4^"h*F
To close the analyzer chamber
"›Fa"d’˜mFF=F=9
Gloves, clean, lint-free
large (8650-0030)
small (8650-0029)
1 Make sure all the internal analyzer electrical leads are correctly attached.
2 Check the side plate O-ring.
Make sure the O-ring has a very light coat of Apiezon L high vacuum grease. If the
O-ring is very dry, it may not seal well. If the O-ring looks shiny, it has too much
grease on it. See page 200 for instructions for lubricating the side plate O-ring.
3 Close the side plate.
4 Reconnect the side board control cable and source power cable to the side
board.
5 Make sure the vent valve is closed.
6 Pump down the MSD (page 60).
7 Gently hand tighten the front side plate thumbscrew.
This is only necessary for CI MSDs, or if hydrogen or other flammable or toxic substance is used for carrier gas.
^a’˜›^¤h*’4F§˜h¤’›˜*F˜O"’›FmF=˜Op˜˜pzF"›apm˜p˜aO˜^©=pVFm˜|p˜p›^F˜^"«"=p¤’˜
V"’}˜a’˜*FamV˜¤’F=˜"’˜›^F˜
˜4"aF˜V"’˜m˜›^F˜¤mdacFd©˜F¦Fm›˜pO˜"m˜F¨zdp’apm:˜a›˜h"©˜
zF¦Fm›˜›^F˜’a=F˜zd"›F˜Oph˜pzFmamV
p˜mp›˜p¦F›aV^›Fm˜›^F˜›^¤h*’4F§”˜a›˜4"m˜4"¤’F˜"a˜dF"c’˜p˜zF¦Fm›˜’¤44F’’O¤d˜
z¤hz=p§m˜˜p˜mp›˜¤’F˜"˜’4F§=a¦F˜›p˜›aV^›Fm˜›^F˜›^¤h*’4F§
8 Once the MSD has pumped down, reinstall the analyzer cover.
Wait until after pumpdown to reinstall the analyzer cover.
58
¢˜˜˜˜zF"›amV˜›^F˜
p˜4dp’F˜›^F˜"m"d©«F˜4^"h*F
pm›˜›^¤h*’4F§˜
F"˜›^¤h*’4F§˜J˜
=p˜mp›˜›aV^›Fm
p¤4F˜zp§F˜4"*dF
a=F˜*p"=˜4pm›pd˜4"*dF
a=F˜zd"›F
59
¢˜˜˜˜zF"›amV˜›^F˜
p˜z¤hz˜=p§m˜›^F˜
To pump down the MSD
pO›§"F˜4^"mVF’
The software is revised periodically. If the steps in this procedure do not match
your MSD ChemStation software, refer to the manuals and online help supplied
with the software for more information.
FF˜"d’p
You can also use the Control Panel to perform this task. See the 5973N Control
Panel Quick Reference Guide for more information.
"cF˜’¤F˜©p¤˜˜hFF›’˜"dd˜›^F˜4pm=a›apm’˜da’›F=˜am˜›^F˜am›p=¤4›apm˜›p˜›^a’˜4^"z›F˜
|z"VF˜T}˜*FOpF˜’›"›amV˜¤z˜"m=˜z¤hzamV˜=p§m˜›^F˜˜"ad¤F˜›p˜=p˜’p˜4"m˜F’¤d›˜
am˜zF’pm"d˜amb¤©
O˜©p¤˜"F˜¤’amV˜^©=pVFm˜"’˜"˜4"aF˜V"’:˜=p˜mp›˜’›"›˜4"aF˜V"’˜Odp§˜¤m›ad˜›^F˜˜
^"’˜*FFm˜z¤hzF=˜=p§m˜O˜›^F˜¦"4¤¤h˜z¤hz’˜"F˜pOO:˜^©=pVFm˜§add˜"44¤h¤d"›F˜am˜
›^F˜˜"m=˜"m˜F¨zdp’apm˜h"©˜p44¤˜F"=˜›^F˜©=pVFm˜"aF˜
"’˜"OF›©˜
¤a=F˜
|QnQQ_QnG}˜*FOpF˜pzF"›amV˜›^F˜˜§a›^˜^©=pVFm˜4"aF˜V"’
1 Plug in the MSD power cord.
2 Select a"Vmp’›a4’—"4¤¤h˜pm›pd from the View menu.
6HOHFW¤hz˜p§mIURPWKH9DFXXPPHQX
3 When prompted, switch on the MSD
4 Press lightly on the side board to ensure a correct seal.
Press on the metal box on the side board.
The rough pump will make a gurgling noise. This noise should stop within a minute.
If the noise continues, there is a large air leak in your system, probably at the side
plate seal, the interface column nut, or the vent valve.
5 Once communication with the PC has been established, click .
60
¢˜˜˜˜zF"›amV˜›^F˜
p˜z¤hz˜=p§m˜›^F˜
a›^am˜s¬˜›p˜sQ˜ham¤›F’˜›^F˜=aOO¤’apm˜z¤hz˜’^p¤d=˜*F˜^p›:˜p˜›^F˜›¤*p˜z¤hz˜’zFF=˜¤z˜›p˜
G¬~˜^F˜›¤*p˜z¤hz˜’zFF=˜’^p¤d=˜F¦Fm›¤"dd©˜F"4^˜nQ~˜O˜›^F’F˜4pm=a›apm’˜"F˜mp›˜hF›:˜
›^F˜˜FdF4›pma4’˜§add˜’^¤›˜pOO˜›^F˜OpFdamF˜z¤hz˜m˜p=F˜›p˜F4p¦F˜Oph˜›^a’˜4pm=a›apm:˜
©p¤˜h¤’›˜zp§F˜4©4dF˜›^F˜˜O˜›^F˜˜=pF’˜mp›˜z¤hz˜=p§m˜4pF4›d©:˜’FF˜›^F˜h"m¤"d˜
p˜pmdamF˜^Fdz˜Op˜amOph"›apm˜pm˜›p¤*dF’^pp›amV˜"a˜dF"c’˜"m=˜p›^F˜¦"4¤¤h˜zp*dFh’
6 When prompted, turn on the GC/MSD interface heater and GC oven. Click
when you have done so.
The software will turn on the ion source and mass filter (quad) heaters. The temperature setpoints are stored in the current autotune (*.u) file.
p˜mp›˜›¤m˜pm˜"m©˜
˜^F"›F=˜«pmF’˜¤m›ad˜4"aF˜V"’˜Odp§˜a’˜pm˜F"›amV˜"˜4pd¤hm˜§a›^˜mp˜
4"aF˜V"’˜Odp§˜§add˜="h"VF˜›^F˜4pd¤hm˜
7 After the message c"©˜›p˜¤m˜appears, wait two hours for the MSD to reach
thermal equilibrium.
Data acquired before the MSD has reached thermal equilibrium may not be
reproducible.
8 Reinstall the MSD top cover.
The top cover was removed during the vent procedure.
61
¢˜˜˜˜zF"›amV˜›^F˜
p˜z¤hz˜=p§m˜›^F˜˜
To pump down the CI MSD
pO›§"F˜4^"mVF’
The software is revised periodically. If the steps in this procedure do not match your
MSD ChemStation software, refer to the manuals and online help supplied with the
software for more information.
FF˜"d’p
You can also use the Control Panel to perform this task. See the 5973N Control
Panel Quick Reference Guide for more information.
1 Follow the instructions in the previous module.
See “To pump down the MSD” on page 60.
After the software prompts you to turn on the interface heater and GC oven,
perform the following steps.
2 Check vacuum gauge controller to verify that the pressure is decreasing.
3 Press "’˜ and ¤VF: and verify that the "’˜ and ¤VF lights are on.
4 Verify that T˜is loaded, and accept the temperature setpoints.
Always start up, and verify system performance in PCI mode before switching to
NCI.
5 Set the GC/MSD interface to 320°C.
6 Purge for at least one hour.
7 Press the ¤VF button to turn off ¤VF
8 Set "’˜ to 20%.
9 Let system bake out and purge for at least two hours. If you will be running
NCI, best sensitivity, bake the MSD out overnight.
62
¢˜˜˜˜zF"›amV˜›^F˜
p˜4pmmF4›˜›^F˜V"¤VF˜4pm›pddF
To connect the gauge controller
"›Fa"d’˜mFF=F=9
Gauge controller (59864B)
Power cord
Triode gauge cable (8120-6573)
The high-vacuum gauge controller is required for operating the MSD in CI mode.
F¦F˜4pmmF4›˜p˜=a’4pmmF4›˜›^F˜4"*dF˜Oph˜›^F˜›ap=F˜V"¤VF˜›¤*F˜§^adF˜›^F˜˜a’˜
¤m=F˜¦"4¤¤h˜a’c˜pO˜ahzdp’apm˜"m=˜amb¤©˜=¤F˜›p˜*pcFm˜Vd"’’˜F¨a’›’
F˜’¤F˜›p˜paFm›˜›^F˜4"*dF˜"m=˜›^F˜V"¤VF˜›¤*F˜"’˜add¤’›"›F=˜¨4F’’a¦F˜Op4F˜pm˜›^F˜zam’˜
4"m˜*F"c˜›^F˜›¤*F˜p˜mp›˜’›F’’˜›^F˜4"*dF
1 Connect the triode gauge cable to the triode gauge tube.
2 Connect the other end of the triode gauge cable to the gauge controller.
3 Connect the power cord to the gauge controller.
4 Connect the other end of the power cord to an appropriate electrical
outlet.
If you wish to share one controller among MSDs, obtain one cable for each instrument. Leave a cable connected to the triode gauge tube on each MSD. This will
avoid having to vent the MSD before connecting the controller.
5 Pump down the MSD.
p˜mp›˜¤’F˜"˜QnG–T˜|pd=F˜hp=Fd}˜›ap=F˜V"¤VF˜4pm›pddF˜=¤amV˜="›"˜"4„¤a’a›apm˜^a’˜
hp=Fd˜4"m˜*F˜¤’F=˜Op˜=a"Vmp’›a4˜z¤zp’F’˜pmd©
63
¢˜˜˜˜zF"›amV˜›^F˜
p˜4pmmF4›˜›^F˜V"¤VF˜4pm›pddF
ap=F˜V"¤VF˜›¤*F
ap=F˜V"¤VF˜4"*dF
"¤VF˜4pm›pddF
ap=F˜V"¤VF˜4"*dF
p§F˜4p=
64
¢˜˜˜˜zF"›amV˜›^F˜
p˜hp¦F˜p˜’›pF˜›^F˜
To move or store the MSD
"›Fa"d’˜mFF=F=9
Ferrule, blank (5181-3308)
Interface column nut (05988-20066)
Wrench, open-end, 1/4-inch × 5/16-inch (8710-0510)
1 Vent the MSD (page 54).
2 Remove the column and install a blank ferrule and interface nut.
3 Tighten the vent valve.
4 If the MSD has a gauge controller, disconnect the cable from the triode
gauge tube.
5 Move the MSD away from the GC (page 171).
Unplug the GC/MSD interface heater cable from the GC.
6 Install the interface nut with the blank ferrule.
7 Remove the analyzer cover (page 52).
8 Tighten the side plate thumbscrews to “finger tight”.
p˜mp›˜p¦F›aV^›Fm˜›^F˜’a=F˜zd"›F˜›^¤h*’4F§’˜¦F›aV^›FmamV˜§add˜’›az˜›^F˜›^F"=’˜am˜›^F˜
"m"d©«F˜4^"h*F˜›˜§add˜"d’p˜§"z˜›^F˜’a=F˜zd"›F˜"m=˜4"¤’F˜dF"c’
9 Plug the MSD power cord in.
10 Switch the MSD on to establish a rough vacuum.
Verify that the foreline pressure is below 300 mTorr or the turbo pump speed
greater than 50%.
11 Switch the MSD off.
12 Reinstall the analyzer cover.
65
¢˜˜˜˜zF"›amV˜›^F˜
p˜hp¦F˜p˜’›pF˜›^F˜
pm›˜’a=F˜zd"›F˜›^¤h*’4F§
F"˜’a=F˜zd"›F˜›^¤h*’4F§
13 Disconnect the LAN, remote, and power cables.
The MSD can now be stored or moved. The foreline pump cannot be disconnected.
It must be moved with the MSD. Make sure the MSD remains upright and is never
tipped on its side or inverted.
^F˜˜h¤’›˜Fh"am˜¤zaV^›˜"›˜"dd˜›ahF’˜O˜©p¤˜mFF=˜›p˜’^az˜©p¤˜˜›p˜"mp›^F˜dp4"›apm:˜
4pm›"4›˜©p¤˜VadFm›˜F4^mpdpVaF’˜’F¦a4F˜FzF’Fm›"›a¦F˜Op˜"=¦a4F˜"*p¤›˜z"4camV˜"m=˜
’^azzamV˜
66
¢˜˜˜˜zF"›amV˜›^F˜
p˜’F›˜›^F˜am›FO"4F˜›FhzF"›¤F˜Oph˜"˜–Gn¬˜d¤’˜
To set the interface temperature from a 6890 Plus GC
1 Press the ¤¨˜o key on the GC keypad.
2 Press˜¢
By default, the GC/MSD interface is powered by heated zone Thermal Aux #2 on
the 6890 Series GC. Verify that the display shows ˜˜¢˜|}.
3 Use the number keys to type in the new temperature setpoint.
The typical setpoint is 280°C. The limits are 0°C and 350°C. A setpoint below
ambient temperature turns off the interface heater.
F¦F˜F¨4FF=˜›^F˜h"¨ah¤h˜›FhzF"›¤F˜pO˜©p¤˜4pd¤hm
"cF˜’¤F˜›^"›˜›^F˜4"aF˜V"’˜a’˜›¤mF=˜pm˜"m=˜›^F˜4pd¤hm˜^"’˜*FFm˜z¤VF=˜pO˜"a˜*FOpF˜
^F"›amV˜›^F˜
—˜am›FO"4F˜p˜›^F˜
˜p¦Fm
4 Press the m›F key to download the new setpoint.
If you want the new setpoint to become part of the current method, click "¦F
under the Method menu. Otherwise, the first time a method is loaded, all the setpoints in the method will overwrite those set from the GC keyboard.
67
¢˜˜˜˜zF"›amV˜›^F˜
p˜¦Fm›˜›^F˜˜§a›^p¤›˜›^F˜^Fh›"›apm
To vent the MSD without the ChemStation
If the MSD ChemStation is functioning, use the procedure on page 54. This procedure should only be used if it is absolutely necessary, if communication has failed.
1 If your system is equipped with a gauge controller, switch off the triode
gauge tube and gauge controller.
2 From the GC keypad, turn off the GC zone controlling the GC/MSD
interface heater and set the GC oven to 30°C (see page 67).
3 Disconnect the ˜˜cable from the back panel.
This turns off the MS heaters and the diffusion pump heater or turbo pump, but
the cooling fans and foreline pump stay on.
4 After 45 minutes, turn off the MSD power switch.
5 Unplug the MSD power cord.
O˜©p¤˜"F˜¤’amV˜^©=pVFm˜"’˜"˜4"aF˜V"’:˜›^F˜4"aF˜V"’˜Odp§˜h¤’›˜*F˜pOO˜*FOpF˜
›¤mamV˜pOO˜›^F˜˜zp§F˜˜O˜›^F˜OpFdamF˜z¤hz˜a’˜pOO:˜^©=pVFm˜§add˜"44¤h¤d"›F˜am˜
›^F˜˜"m=˜"m˜F¨zdp’apm˜h"©˜p44¤˜˜F"=˜›^F˜©=pVFm˜"aF˜
"’˜"OF›©˜
¤a=F˜
|QnQQ_QnG}˜*FOpF˜pzF"›amV˜›^F˜˜§a›^˜^©=pVFm˜4"aF˜V"’
F˜’¤F˜›^F˜
˜p¦Fm˜"m=˜›^F˜
—˜am›FO"4F˜"F˜4ppd˜*FOpF˜›¤mamV˜pOO˜4"aF˜V"’˜Odp§
6 Reconnect the ˜˜cable.
7 Remove the analyzer cover (page 52).
8 Turn the vent valve knob counterclockwise to admit air into the analyzer
chamber.
Do not remove the knob. Be sure to retighten the knob before pumping down.
FF˜d’p˜
To open the analyzer chamber, page 56
68
3
To operate the CI MSD, 70
To switch from EI to CI operating mode, 72
To set up the software for CI operation, 73
To set up methane reagent gas flow, 76
CI autotune, 78
To perform a positive CI autotune (methane only), 80
To perform a negative CI autotune (any reagent gas), 82
To verify positive CI performance, 84
To verify negative CI performance, 85
To operate the reagent gas flow control module, 74
To monitor high vacuum pressure, 86
To use other reagent gases, 88
To switch from CI to EI operating mode, 92
Operating the CI MSD
Operating the MSD in CI mode
This chapter provides information and instructions about operating the
5973N CI MSDs in CI mode. Most of the material is related to methane
chemical ionization but one section discusses the use of other reagent gases.
F„¤Fm4amV˜a’˜mp›˜"zzpza"›F˜Op˜"¤›ph"›amV˜hF›^p=’˜›^"›˜¤’F˜=aOOFFm›˜F"VFm›˜V"’F’˜p˜
V"’˜Odp§’:˜"’˜›^F’F˜z""hF›F’˜h¤’›˜*F˜’F›˜h"m¤"dd©˜
The software provides instructions for setting the reagent gas flow and for
performing CI autotunes. Autotunes are provided for PCI with methane
reagent gas and for NCI with any reagent gas.
General guidelines
• Always use the highest purity methane (and other reagent gases, if
applicable.) Methane must be at least 99.99% pure.
• Always verify that the MSD is performing well in EI mode before
switching to CI. See “To verify system performance” on page 51.
• Make sure the CI ion source and GC/MSD interface tip seal are installed.
• Make sure the reagent gas plumbing has no air leaks. This is determined
in PCI mode, checking for m/z 32 after the methane pre-tune.
To operate the CI MSD
Operating your MSD in the CI mode is slightly more complicated than
operating in the EI mode. After tuning, gas flow, source temperature, and
electron energy may need to be optimized for your specific analyte.
FhzF"›¤F’˜Op˜˜pzF"›apm
pm˜’p¤4F˜
¢Q¬@
sQ¬@
¤"=¤zpdF˜
˜sQ¬@
˜sQ¬@
—˜am›FO"4F
¢¬@
¢G¬@˜
Start the system in PCI mode first.
By bringing the system up in PCI mode first, you will be able to do the
following:
• Set up the MSD with methane first, even if you are going to use another
reagent gas.
• Check the interface tip seal by looking at the m/z 28 to 27 ratio (in the
methane flow adjust panel.).
• Tell if a gross air leak is present by monitoring the ions at m/z19
(protonated water) and 32.
• Confirm if the MS is generating “real” ions and not just background noise.
It is nearly impossible to perform any diagnostics on the system in NCI. In
NCI, there are no reagent gas ions to monitor for any gas. It is difficult to
diagnose an air leak and difficult to tell whether a good seal is being created
between the interface and the ion volume.
^F˜˜|’›"m="=˜›¤*p˜z¤hz}˜˜F„¤aF’˜dp§F˜F"VFm›˜V"’˜Odp§’˜"m=˜dp§F˜F"VFm›˜
apm˜"›ap’˜›^"m˜›^F˜—˜
˜˜˜˜zF"›amV˜›^F˜˜
p˜’§a›4^˜Oph˜˜›p˜˜pzF"›amV˜hp=F
To switch from EI to CI operating mode
d§"©’˜¦FaO©˜˜zFOph"m4F˜am˜˜*FOpF˜’§a›4^amV˜›p˜˜pzF"›apm˜FF˜z"VF˜Qs˜
d§"©’˜’F›˜¤z˜›^F˜˜˜am˜˜Oa’›:˜F¦Fm˜aO˜©p¤˜"F˜VpamV˜›p˜¤m˜
1 Vent the MSD. See page 54.
2 Open the analyzer.
3 Remove the EI ion source.
dF4›p’›"›a4˜=a’4^"VF’˜›p˜"m"d©«F˜4phzpmFm›’˜"F˜4pm=¤4›F=˜›p˜›^F˜’a=F˜*p"=˜§^FF˜
›^F©˜4"m˜="h"VF˜’Fm’a›a¦F˜4phzpmFm›’˜F"˜"˜Vp¤m=F=˜"m›a_’›"›a4˜§a’›˜’›"z˜
FF˜‰dF4›p’›"›a4˜=a’4^"VF˜a’˜"˜›^F"›˜›p˜›^F˜˜FdF4›pma4’˜=¤amV˜h"am›Fm"m4FŠ˜pm˜
z"VF sQG˜"cF˜"m›a_’›"›a4˜zF4"¤›apm’˜*FOpF˜©p¤˜pzFm˜›^F˜"m"d©«F˜4^"h*F
4 Install the CI ion source. See page 248.
5 Install the interface tip seal. See page 250.
6 Close the analyzer.
7 Pump down the MSD. See page 60.
72
˜˜˜˜zF"›amV˜›^F˜˜
p˜’F›˜¤z˜›^F˜’pO›§"F˜Op˜˜pzF"›apm
To set up the software for CI operation
1 Switch to the Manual Tune view.
2 Select p"=˜¤mF˜"d¤F’ from the adF menu.
3 Select the tune file T
4 If CI autotune has never been run for this tune file, the software will
prompt you through a series of dialog boxes. Accept the default values
unless you have a very good reason for changing anything.
The tune values have a dramatic effect on MSD performance. Always start with the
default values when first setting up for CI, and then make adjustments for your
specific application. See the table below for default values for the Tune Control
Limits box.
FO"¤d›˜¤mF˜pm›pd˜aha›’:˜¤’F=˜*©˜˜"¤›p›¤mF˜pmd©˜^F’F˜daha›’˜’^p¤d=˜mp›˜*F˜4pmO¤’F=˜§a›^˜›^F˜z""hF›F’˜
’F›˜am˜=a›˜˜""hF›F’:˜p˜§a›^˜›^p’F˜"zzF"amV˜pm˜›^F˜›¤mF˜Fzp›
F"VFm›˜V"’
pm˜zpd"a›©
*¤m="m4F˜›"VF›*:
F"c§a=›^˜›"VF›=
"¨ah¤h˜FzFddF
"¨ah¤h˜Fha’’apm˜4¤Fm›F
"¨˜FdF4›pm˜FmFV©:˜F
F›^"mF
p’a›a¦F
s¨s¬–
¬–
T
¢T¬
¢T¬
FV"›a¦F"
s¨s¬–
¬–
T
Q¬
¢T¬
’p*¤›"mF"
p’a›a¦F"
—4
—4
—4
—4
—4
FV"›a¦F"
s¨s¬–
¬–
T
Q¬
¢T¬
hhpma""
p’a›a¦F"
—4
—4
—4
—4
—4
FV"›a¦F"
s¨s¬–
¬–
T
Q¬
¢T¬
" d§"©’˜’F›˜¤z˜am˜˜§a›^˜hF›^"mF˜Oa’›:˜›^Fm˜’§a›4^˜›p˜©p¤˜=F’aF=˜apm˜zpd"a›©˜"m=˜F"VFm›˜V"’
* =b¤’›˜^aV^F˜p˜dp§F˜›p˜VF›˜=F’aF=˜’aVm"d˜"*¤m="m4F˜aV^F˜’aVm"d˜"*¤m="m4F˜"d’p˜Va¦F’˜^aV^F˜mpa’F˜
"*¤m="m4F˜^a’˜a’˜"=b¤’›F=˜Op˜="›"˜"4„¤a’a›apm˜*©˜’F››amV˜›^F˜˜am˜›^F˜hF›^p=
4 ^FF˜"F˜mp˜˜apm’˜OphF=˜am˜˜§a›^˜"m©˜F"VFm›˜V"’˜*¤›˜hF›^"mF:˜^Fm4F:˜˜"¤›p›¤mF˜a’˜mp›˜"¦"ad"*dF˜
§a›^˜›^F’F˜4pmOaV¤"›apm’
= aV^F˜zF"c§a=›^˜¦"d¤F’˜Va¦F˜*F››F˜’Fm’a›a¦a›©:˜dp§F˜¦"d¤F’˜Va¦F˜*F››F˜F’pd¤›apm
F z›ah¤h˜Fha’’apm˜4¤Fm›˜h"¨ah¤h˜Op˜˜a’˜¦F©˜4phzp¤m=_’zF4aOa4:˜"m=˜h¤’›˜*F˜’FdF4›F=˜Fhzaa4"dd©˜z›a_
h¤h˜Fha’’apm˜4¤Fm›˜Op˜zF’›a4a=F’:˜Op˜F¨"hzdF:˜h"©˜*F˜"*p¤›˜¢¬¬µ
73
˜˜˜˜zF"›amV˜›^F˜˜
p˜pzF"›F˜›^F˜F"VFm›˜V"’˜Odp§˜4pm›pd˜hp=¤dF
To operate the reagent gas flow control module
For a video demonstration of the gas flow control module, see the
5973N MSD Maintenance CD-ROM.
dp§˜4pm›pd˜hp=¤dF˜’›"›F˜=a"V"h9
F’¤d›
"’˜˜Odp§’
"’˜˜Odp§’
¤VF˜
§a›^˜
"’˜˜
¤VF˜
§a›^˜
"’˜˜
¤hz˜p¤›
Odp§˜hp=¤dF
›"m=*©:˜¦Fm›F=:˜
p˜˜hp=F
m
OO
m
OO
OO
OO
"’˜˜|"h*F} OO
m
OO
m
OO
OO
¤VF˜|F=}
OO
OO
m
m
m
OO
"’˜OO˜|F=}
OO˜
OO˜
OO˜
OO˜
m
m
"d¦F˜
zFm
dp’F=
zFm
dp’F=
dp’F=
dp’F=
"d¦F˜
dp’F=
zFm
dp’F=
zFm
dp’F=
dp’F=
˜’F››amV
m˜→˜’F›zpam›
m˜→˜’F›zpam›
m˜→˜s¬¬~
m˜→˜s¬¬~
m˜→˜s¬¬~
OO˜|→¬~}
zFm
zFm
zFm
zFm
dp’F=
pm›pd˜z"mFd˜daV^›’˜|’}
"’˜˜|VFFm}
"d¦F˜’›"›F
’pd"›apm˜¦"d¦F zFm
74
˜˜˜˜zF"›amV˜›^F˜˜
p˜pzF"›F˜›^F˜F"VFm›˜V"’˜Odp§˜4pm›pd˜hp=¤dF
dp§˜4pm›pd˜cmp*˜|h"’’˜Odp§˜4pm›pd˜cmp*}
dp§˜4pm›pd˜=a’zd"©
75
˜˜˜˜zF"›amV˜›^F˜˜
p˜’F›˜¤z˜hF›^"mF˜F"VFm›˜V"’˜Odp§
To set up methane reagent gas flow
The reagent gas flow must be adjusted for maximum stability before tuning the CI
system. Do the initial setup with methane in positive ion mode (PCI). No flow
adjustment procedure is available for NCI, as no negative reagent ions are formed.
Adjusting the methane reagent gas flow is a three-step process: setting the flow
control, pre-tuning on the reagent gas ions, and adjusting the flow for stable
reagent ion ratios, for methane, m/z 28/27.
Your data system will prompt you through the flow adjustment procedure.
O›F˜›^F˜’©’›Fh˜^"’˜*FFm˜’§a›4^F=˜Oph˜˜›p˜˜hp=F:˜p˜¦Fm›F=˜Op˜"m©˜p›^F˜F"’pm:˜›^F˜
˜h¤’›˜*F˜*"cF=˜p¤›˜Op˜"›˜dF"’›˜¢˜^p¤’˜*FOpF˜›¤mamV˜
1 Press the "’˜ button. Verify that only the "’˜ light is on.
2 Adjust the flow to 20% for PCI/NCI MSDs, or 10% for PCI MSDs.
3 Check the vacuum gauge controller to verify correct pressure. See page 86.
4 Select F›^"mF˜F›¤mF˜from the Setup menu.
The methane pretune tunes the instrument for optimum monitoring of the ratio of
methane reagent ions m/z 28/27.
5 Examine the displayed profile scan of the reagent ions.
• Make sure there is no visible peak at m/z 32. A peak there indicates an air leak.
If such a peak is present, find and repair the leak before proceeding. Operating
in the CI mode with an air leak will rapidly contaminate the ion source.
• Make sure that the peak at m/z 19 (protonated water) is less than 50% of the
peak at m/z 17.
6 Perform the Methane Flow Adjust.
Adjust the methane flow on the PCI/NCI MSD to get the ratio of m/z 28/27
between 1.5 and 5.0. Adjust the methane flow on the PCI MSD to get the ratio of
m/z 28/27 between 0.5 and 3.0.
76
˜˜˜˜zF"›amV˜›^F˜˜
p˜’F›˜¤z˜hF›^"mF˜F"VFm›˜V"’˜Odp§
pm›am¤amV˜§a›^˜˜"¤›p›¤mF˜aO˜›^F˜˜^"’˜"m˜"a˜dF"c˜p˜d"VF˜"hp¤m›’˜pO˜§"›F˜§add˜F’¤d›˜
am˜’F¦FF˜apm˜’p¤4F˜4pm›"ham"›apm˜O˜›^a’˜^"zzFm’:˜©p¤˜§add˜mFF=˜›p˜¦Fm›˜›^F˜˜"m=˜
4dF"m˜›^F˜apm˜’p¤4F
F›^"mF˜zF_›¤mF˜"O›F˜hpF˜›^"m˜"˜="©˜pO˜*"camV˜p¤›˜p›F˜›^F˜dp§˜"*¤m="m4F˜pO˜h—«˜sn˜"m=˜
"*’Fm4F˜pO˜"m©˜¦a’a*dF˜zF"c˜"›˜h—«˜¢˜ p¤˜˜§add˜zp*"*d©˜’^p§˜hpF˜§"›F˜"›˜Oa’›:˜*¤›˜›^F˜
"*¤m="m4F˜pO˜h—«˜sn˜’^p¤d=˜’›add˜*F˜dF’’˜›^"m˜Q¬~˜pO˜h—«˜s•
77
˜˜˜˜zF"›amV˜›^F˜˜
˜"¤›p›¤mF
CI autotune
After the reagent gas flow is adjusted, the lenses and electronics of the MSD
should be tuned. Perfluoro-5,8-dimethyl-3,6,9-trioxidodecane (PFDTD) is used as
the calibrant. Instead of flooding the entire vacuum chamber, the PFDTD is introduced directly into the ionization chamber through the GC/MSD interface by
means of the gas flow control module.
O›F˜›^F˜’©’›Fh˜^"’˜*FFm˜’§a›4^F=˜Oph˜˜›p˜˜hp=F:˜p˜¦Fm›F=˜Op˜"m©˜p›^F˜F"’pm:˜›^F˜
˜h¤’›˜*F˜z¤VF=˜"m=˜*"cF=˜p¤›˜Op˜"›˜dF"’›˜¢˜^p¤’˜*FOpF˜›¤mamV˜pmVF˜*"cFp¤›˜a’˜
F4phhFm=F=˜*FOpF˜¤mmamV˜’"hzdF’˜F„¤aamV˜pz›ah"d˜’Fm’a›a¦a›©
There is a PCI autotune for methane only, as there are no PFDTD ions produced
by other gases in positive mode. PFDTD ions are visible in NCI for any reagent gas.
Always tune for methane PCI first regardless of which mode or reagent gas you
wish to use for your analysis.
There are no tune performance criteria. If CI autotune completes, it passes.
EMVolts (electron multiplier voltage) at or above 2600V, however, indicates a
problem. If your method requires EMVolts set at +400, you may not have adequate
sensitivity in your data acquisition.
d§"©’˜¦FaO©˜˜zFOph"m4F˜am˜˜*FOpF˜’§a›4^amV˜›p˜˜pzF"›apm˜FF˜z"VF˜Qs˜
d§"©’˜’F›˜¤z˜›^F˜˜˜am˜˜Oa’›:˜F¦Fm˜aO˜©p¤˜"F˜VpamV˜›p˜¤m˜
FO"¤d›˜|’›"›amV}˜˜›¤mF˜z""hF›F’}
78
˜˜˜˜zF"›amV˜›^F˜˜
˜"¤›p›¤mF
¤VVF’›F=˜’›"›amV˜z""hF›F’˜Op˜——˜’
F"VFm›˜V"’
pm˜zpd"a›©
ha’’apm˜
dF4›pm˜FmFV©
ad"hFm›
FzFddF
pm˜Op4¤’
m›"m4F˜dFm’˜pOO’F›
pd›’
"’˜OO
"’˜’FdF4›˜¦"d¦F
¤VVF’›F=˜Odp§
p¤4F˜›Fhz
¤"=˜›Fhz
m›FO"4F˜›Fhz
¤›p›¤mF
F›^"mF
p’a›a¦F
sQ¬˜µ
sQ¬˜F
s
˜
s¬˜
¢¬
s¢¬¬
OO
¢¬~
¢Q¬@
sQ¬@
¢¬@
F’
’p*¤›"mF
FV"›a¦F
Q¬˜µ
sQ¬F
s
˜
s¬˜
¢¬
s¢¬¬
OO
T¬~
sQ¬@
sQ¬@
¢G¬@
F’
p’a›a¦F
sQ¬˜µ
sQ¬F
s
˜
s¬˜
¢¬
s¢¬¬
OO
¢¬~
¢Q¬@
sQ¬@
¢¬@
p
FV"›a¦F
Q¬˜µ
sQ¬F
s
˜
s¬˜
¢¬
s¢¬¬
OO
T¬~
sQ¬@
sQ¬@
¢G¬@
F’
hhpma"
p’a›a¦F
sQ¬˜µ
sQ¬F
s
˜
s¬˜
¢¬
s¢¬¬
OO
¢¬~
¢Q¬@
sQ¬@
¢¬@
p
FV"›a¦F
Q¬˜µ
sQ¬F
s
˜
s¬˜
¢¬
s¢¬¬
OO
T¬~
sQ¬@
sQ¬@
¢G¬@
F’
—
Q˜µ
•¬
s˜p˜¢
¬˜
n¬˜
¢Q
s¢¬¬
m
pmF
—
¢¬@
sQ¬@
¢G¬@
F’
¤VVF’›F=˜’›"›amV˜z""hF›F’˜Op˜—˜’
F"VFm›˜V"’
pm˜zpd"a›©9˜zp’a›a¦F˜pmd©
ha’’apm˜
dF4›pm˜FmFV©
ad"hFm›
FzFddF
pm˜Op4¤’
m›"m4F˜dFm’˜pOO’F›
pd›’
"’˜OO
"’˜’FdF4›˜¦"d¦F
¤VVF’›F=˜Odp§
p¤4F˜›Fhz
¤"=˜›Fhz
m›FO"4F˜›Fhz
¤›p›¤mF
F›^"mF
sQ¬˜µ
sQ¬˜F
s
˜
s¬˜
¢¬
s¢¬¬
OO
s¬~
¢Q¬@
sQ¬@
¢¬@
F’
’p*¤›"mF
sQ¬˜µ
sQ¬F
s
˜
s¬˜
¢¬
s¢¬¬
OO
s¬~
¢Q¬@
sQ¬@
¢¬@
p
hhpma"
sQ¬˜µ
sQ¬F
s
˜
s¬˜
¢¬
s¢¬¬
OO
s¬~
¢Q¬@
sQ¬@
¢¬@
p
Q˜µ
•¬
s˜p˜¢
¬˜
n¬˜
¢Q
s¢¬¬
m
pmF
—
¢¬@
sQ¬@
¢G¬@
F’
79
˜˜˜˜zF"›amV˜›^F˜˜
p˜zFOph˜"˜zp’a›a¦F˜˜"¤›p›¤mF˜|hF›^"mF˜pmd©}
To perform a positive CI autotune (methane only)
d§"©’˜¦FaO©˜˜zFOph"m4F˜am˜˜*FOpF˜’§a›4^amV˜›p˜˜pzF"›apm˜FF˜z"VF˜Qs˜
d§"©’˜’F›˜¤z˜›^F˜˜˜am˜˜Oa’›:˜F¦Fm˜aO˜©p¤˜"F˜VpamV˜›p˜¤m˜
1 Verify that the MSD performs correctly in EI mode first. See page 51.
2 Load the T tune file (or an existing tune file for the reagent gas you
are using).
If you use an existing tune file, be sure to save it with a new name if you don’t want
to over write the existing values.
3 Accept the default settings.
4 Perform methane setup. See page 76.
5 Under the Tune menu, click ˜¤›p›¤mF.
¦pa=˜›¤mamV˜hpF˜pO›Fm˜›^"m˜a’˜"*’pd¤›Fd©˜mF4F’’"©”˜›^a’˜§add˜hamaha«F˜˜*"4cVp¤m=˜
mpa’F:˜"m=˜^Fdz˜zF¦Fm›˜apm˜’p¤4F˜4pm›"ham"›apm
There are no tune performance criteria. If autotune completes, it passes. If the
tune sets the electron multiplier voltage (EMVolts) at or above 2600V, however,
you may not be able to acquire data successfully if your method sets EMVolts to
“+400” or higher.
The autotune report contains information about air and water in the system.
The 19/29 ratio shows the abundance of water.
The 32/29 ratio shows the abundance of oxygen.
80
˜˜˜˜zF"›amV˜›^F˜˜
p˜zFOph˜"˜zp’a›a¦F˜˜"¤›p›¤mF˜|hF›^"mF˜pmd©}
81
˜˜˜˜zF"›amV˜›^F˜˜
p˜zFOph˜"˜mFV"›a¦F˜˜"¤›p›¤mF˜|"m©˜F"VFm›˜V"’}
To perform a negative CI autotune (any reagent gas)
d§"©’˜¦FaO©˜˜zFOph"m4F˜am˜˜*FOpF˜’§a›4^amV˜›p˜˜pzF"›apm˜FF˜z"VF˜Qs˜
d§"©’˜’F›˜¤z˜›^F˜˜˜am˜˜Oa’›:˜F¦Fm˜aO˜©p¤˜"F˜VpamV˜›p˜¤m˜
1 Load T (or an existing tune file for the reagent gas you are using).
If you use an existing tune file, be sure to save it with a new name if you don’t want
to over write the existing values.
2 Accept the default temperature and other settings.
3 If you don’t already have an NCI tune file for your reagent gas, use
FdF4›˜F"VFm›˜
"’ under the Setup menu.
4 Under the Tune menu, click ˜¤›p›¤mF.
¦pa=˜›¤mamV˜¤mdF’’˜"*’pd¤›Fd©˜mF4F’’"©”˜›^a’˜§add˜hamaha«F˜˜*"4cVp¤m=˜mpa’F:˜"m=˜
^Fdz˜zF¦Fm›˜apm˜’p¤4F˜4pm›"ham"›apm
There are no tune performance criteria. If autotune completes, it passes. If the
tune sets the electron multiplier voltage (EMVolts) at or above 2600V, however,
you may not be able to acquire data successfully if your method sets EMVolts to
“+400” or higher.
82
˜˜˜˜zF"›amV˜›^F˜˜
p˜zFOph˜"˜mFV"›a¦F˜˜"¤›p›¤mF˜|"m©˜F"VFm›˜V"’}
83
˜˜˜˜zF"›amV˜›^F˜˜
p˜¦FaO©˜zp’a›a¦F˜˜zFOph"m4F
To verify positive CI performance
"›Fa"d’˜mFF=F=9
Benzophenone, 100 pg/µl (8500-5440)
d§"©’˜¦FaO©˜˜zFOph"m4F˜am˜˜*FOpF˜’§a›4^amV˜›p˜˜pzF"›apm˜FF˜z"VF˜Qs˜
d§"©’˜’F›˜¤z˜›^F˜˜˜am˜˜Oa’›:˜F¦Fm˜aO˜©p¤˜"F˜VpamV˜›p˜¤m˜
1 Verify that the PCICH4.U tune file is loaded.
2 On the flow control panel, turn ¤VF off.
3 Set "’˜ to 20% flow for PCI/NCI MSDs, or 10% for PCI MSDs.
4 In Manual Tune view, perform CI setup. See page 76.
5 Run ˜¤›p›¤mF. See page 78.
6 Run the PCI sensitivity method: BENZ_PCI.M, using 1 µl of 100pg/µl
Benzophenone.
7 Verify that the system conforms to the published sensitivity specification.
FF˜"d’p
The 5973Network Series Mass Selective Detector Specifications, 5968-7358E.
84
˜˜˜˜zF"›amV˜›^F˜˜
p˜¦FaO©˜mFV"›a¦F˜˜zFOph"m4F
To verify negative CI performance
This procedure is for EI/PCI/NCI MSDs only
"›Fa"d’˜mFF=F=9
OFN, 1 pg/µl (8500-5441)
d§"©’˜¦FaO©˜˜zFOph"m4F˜am˜˜*FOpF˜’§a›4^amV˜›p˜˜pzF"›apm˜FF˜z"VF˜Qs˜
d§"©’˜’F›˜¤z˜›^F˜˜˜am˜˜Oa’›:˜F¦Fm˜aO˜©p¤˜"F˜VpamV˜›p˜¤m˜
1 Verify that the MSD performs correctly in EI mode.
2 Load the NCICH4.U tune file, and accept the temperature setpoints.
3 Turn ¤VF and "’˜ on and let the system stabilize for 90 minutes.
4 Turn ¤VF off, and set "’˜ to 40% flow.
5 In Manual Tune view, run ˜¤›p›¤mF. See page 85.
Note that there are no criteria for a “passing” Autotune in CI. If the Autotune completes, it passes.
6 Run the NCI sensitivity method: OFN_NCI.M using 1 µl of 1pg/µl OFN.
7 Verify that the system conforms to the published sensitivity specification.
FF˜"d’p
The 5973Network Series Mass Selective Detector Specifications (5968-7358E.)
85
˜˜˜˜zF"›amV˜›^F˜˜
p˜hpma›p˜^aV^˜¦"4¤¤h˜zF’’¤F
To monitor high vacuum pressure
"›Fa"d’˜mFF=F=9
Gauge controller (59864B)
Triode gauge cable (8120-6573)
F¦F˜4pmmF4›˜p˜=a’4pmmF4›˜›^F˜4"*dF˜Oph˜›^F˜›ap=F˜V"¤VF˜›¤*F˜§^adF˜›^F˜˜a’˜
¤m=F˜¦"4¤¤h˜a’c˜pO˜ahzdp’apm˜"m=˜amb¤©˜=¤F˜›p˜*pcFm˜Vd"’’˜F¨a’›’
O˜©p¤˜"F˜¤’amV˜^©=pVFm˜"’˜"˜4"aF˜V"’:˜=p˜mp›˜›¤m˜pm˜›^F˜›ap=F˜V"¤VF˜›¤*F˜aO˜›^FF˜
a’˜"m©˜zp’’a*ada›©˜›^"›˜^©=pVFm˜^"’˜"44¤h¤d"›F=˜am˜›^F˜h"maOpd=˜^F˜›ap=F˜V"¤VF˜
Oad"hFm›˜4"m˜aVma›F˜^©=pVFm˜F"=˜›^F˜©=pVFm˜"aF˜
"’˜"OF›©˜
¤a=F˜|QnQQ_
QnG}˜*FOpF˜pzF"›amV˜›^F˜˜§a›^˜^©=pVFm˜4"aF˜V"’
1 Connect the gauge controller to the triode gauge tube. See page 63.
2 Start up and pump down the MSD. See page 60.
3 Switch on the power switch on the back of the gauge controller.
4 Press and release the button.
After a few seconds, the pressure should be displayed.
Pressure is displayed in the format˜ J where˜J˜ is the base 10 exponent.
Units are Torr.
The gauge controller will not turn on if the pressure in the MSD is above approximately 8 × 10_ Torr. The gauge controller will display all 9s and then go blank. The
triode gauge tube can measure pressures between approximately 8 × 10_ and
3 × 10_– Torr. The gauge controller is calibrated for nitrogen, but all pressures
listed in this manual are for helium.
The largest influence on operating pressure is the carrier gas (column) flow. The
following table lists typical pressures for various helium carrier gas flows. These
pressures are approximate and will vary from instrument to instrument.
86
˜˜˜˜zF"›amV˜›^F˜˜
p˜hpma›p˜^aV^˜¦"4¤¤h˜zF’’¤F
Typical pressure readings
Use the 59864B high-vacuum gauge controller. Note that the mass flow controller
is calibrated for methane, and the high vacuum gauge controller is calibrated for
nitrogen, so these measurements are not accurate, but are intended as a guide to
typical observed readings. They were taken with the following set of conditions.
Note that these are typical PCI temperatures:
p¤4F˜›FhzF"›¤F
¤"=˜›FhzF"›¤F
m›FO"4F˜›FhzF"›¤F
Fda¤h˜4"aF˜V"’˜Odp§
˜|~}
F’’¤F˜|p}
F›^"mF
s¬
sQ
¢¬
¢Q
¬
Q
T¬
¢Q¬@
sQ¬@
¢¬@
shd—ham
hhpma"
——˜˜ —˜˜
——˜˜ —˜˜
|FOph"m4F˜ |›"m="=˜
|FOph"m4F˜ |›"m="=˜
›¤*p˜z¤hz}
›¤*p˜z¤hz}˜p›
›¤*p˜z¤hz}
›¤*p˜z¤hz}
Q¬˜× s¬ JQ sQ˜× s¬ JT
QQ˜× s¬ JQ ¢¬˜× s¬ JT
G¬˜× s¬ JQ ¢Q˜× s¬ JT
•¬˜× s¬ JQ ¢¬˜× s¬ JT
JT
JT
s¬˜× s¬
¬˜× s¬
GQ˜× s¬ JQ ¬˜× s¬ JT
s¢˜× s¬ JT p›˜F4phhFm=F=
s¬˜× s¬ JT p›˜F4phhFm=F=
s¢˜× s¬ JT p›˜F4phhFm=F=
sQ˜× s¬ JT p›˜F4phhFm=F=
JT
¢¬˜× s¬
p›˜F4phhFm=F=
sQ˜× s¬ JT p›˜F4phhFm=F=
¢¬˜× s¬ JT p›˜F4phhFm=F=
¢Q˜× s¬ JT p›˜F4phhFm=F=
Familiarize yourself with the measurements on your system under operating conditions, and watch for changes that may indicate a vacuum or gas flow problem.
Measurements will vary by as much as 30% from one MSD and gauge controller to
the next.
87
˜˜˜˜zF"›amV˜›^F˜˜
p˜¤’F˜p›^F˜F"VFm›˜V"’F’
To use other reagent gases
This section describes the use of isobutane or ammonia as the reagent gas. You
should be familiar with operating the CI-equipped 5973N MSD with methane
reagent gas before attempting to use other reagent gases.
p˜mp›˜¤’F˜ma›p¤’˜p¨a=F˜"’˜"˜F"VFm›˜V"’˜›˜"=a4"dd©˜’^p›Fm’˜›^F˜daOF˜’z"m˜pO˜›^F˜Oad"hFm›
Changing the reagent gas from methane to either isobutane or ammonia changes
the chemistry of the ionization process and yields different ions. The principal
chemical ionization reactions encountered are described in general in Appendix A,
Chemical Ionization Theory. If you are not experienced with chemical ionization, we suggest reviewing that material before you proceed.
p›˜"dd˜’F›¤z˜pzF"›apm’˜4"m˜*F˜zFOphF=˜am˜"dd˜hp=F’˜§a›^˜"dd˜F"VFm›˜V"’F’˜FF˜›^F˜
Opddp§amV˜›"*dF˜Op˜=F›"ad’
88
˜˜˜˜zF"›amV˜›^F˜˜
p˜¤’F˜p›^F˜F"VFm›˜V"’F’
F"VFm›˜V"’—˜hp=F F"VFm›˜apm˜
h"’’F’
F›^"mF—˜
F›^"mF—˜
’p*¤›"mF—˜
’p*¤›"mF—˜
hhpma"—˜
hhpma"—˜
s•:˜¢n:˜Ts"
s•:˜Q:˜¢Q*
n:˜T:˜Q•
s•:˜Q:˜¢Q
sG:˜Q:˜Q¢
s•:˜Q:˜¢Q
"da*"m›˜apm’
dp§˜"=b˜apm’9˜"›ap
——˜˜
FOph"m4F˜›¤*p˜z¤hz
F4phhFm=F=˜Odp§9˜¢¬~
dp§˜"=b˜apm’9˜"›ap
—˜
›"m="=˜›¤*p˜z¤hz
F4phhFm=F=˜Odp§9˜s¬~
Ts:˜¢–•:˜Qnn
sGQ:˜Qs:˜TTn
—
sGQ:˜Qs:˜TTn
—
sGQ:˜Qs:˜Qs•
¢G—¢•9˜sQ˜J˜Q¬
—
Q•—T9˜Q¬˜J˜¬¬
—
Q—sG9˜¬s˜J˜s¬
—
¢G—¢•9˜¬Q˜J˜¬˜
p˜mFV"›a¦F˜˜4"z"*ada›©
Q•—T9˜s¬˜J˜Q¬
p˜mFV"›a¦F˜˜4"z"*ada›©
Q—sG9˜¬¬¢˜J˜¬¢
p˜mFV"›a¦F˜˜4"z"*ada›©
" ^FF˜"F˜mp˜˜apm’˜OphF=˜§a›^˜"m©˜F"VFm›˜V"’˜*¤›˜hF›^"mF˜¤mF˜§a›^˜hF›^"mF˜"m=˜¤’F˜›^F˜’"hF˜
z""hF›F’˜Op˜›^F˜p›^F˜V"’
* ^FF˜"F˜mp˜mFV"›a¦F˜F"VFm›˜V"’˜apm’˜OphF=˜p˜zF›¤mF˜am˜mFV"›a¦F˜hp=F:˜¤’F˜*"4cVp¤m=˜apm’9˜s•˜|_
}:˜Q˜|d_}:˜"m=˜¢Q˜|F_}˜^F’F˜apm’˜4"m˜mp›˜*F˜¤’F=˜Op˜F"VFm›˜V"’˜Odp§˜"=b¤’›hFm›˜F›˜Odp§˜›p˜T¬~˜Op˜
˜"m=˜"=b¤’›˜"’˜mF4F’’"©˜›p˜VF›˜"44Fz›"*dF˜F’¤d›’˜Op˜©p¤˜"zzda4"›apm
Isobutane CI
Isobutane (C4H10) is commonly used for chemical ionization when less fragmentation is desired in the chemical ionization spectrum. This is because the proton
affinity of isobutane is higher than that of methane; hence, less energy is transferred in the ionization reaction. Addition and proton transfer are the ionization
mechanisms most often associated with isobutane. The sample itself influences
which mechanism dominates.
89
˜˜˜˜zF"›amV˜›^F˜˜
p˜¤’F˜p›^F˜F"VFm›˜V"’F’
Ammonia CI
Ammonia (NH3) is commonly used for chemical ionization when less fragmentation is desired in the chemical ionization spectrum. This is because the proton
affinity of ammonia is higher than that of methane; hence, less energy is transferred in the ionization reaction. Because many compounds of interest have insufficient proton affinities, ammonia chemical-ionization spectra often result from the
addition of NH4+ and then, in some cases, from the subsequent loss of water.
Ammonia reagent ion spectra have principal ions at m/z 18, 35, and 52, corresponding to NH4+, NH4(NH3)+, and NH4(NH3)2+.
To adjust your MSD for isobutane or ammonia chemical ionization, use the following procedure:
1 Perform a standard Positive CI autotune with methane and PFDTD.
2 Under the F›¤z menu, click FdF4›˜F"VFm›˜
"’ and select ’p*¤›"mF or
hhpma".
This will change the menus to use the selected gas, and select appropriate default
tune parameters.
3 Select a new tune file name, or load an existing PCI tune file for the
specific gas.
If you use an existing tune file, be sure to save it with a new name if you don’t want
to over write the existing values. Accept the default temperature and other settings.
4 Turn "’˜ on.
After the amber light stops flashing and the Purge light goes off, set the gas flow to
20%.
5 Click ’p*¤›"mF˜|p˜hhpma"}˜dp§˜=b¤’›˜on the Setup menu˜
There is no CI autotune for isobutane or ammonia in PCI.
6 If you wish to run NCI with isobutane or ammonia, load T:˜or load
an existing NCI tune file for the specific gas.
’F˜pO˜"hhpma"˜"OOF4›’˜›^F˜h"am›Fm"m4F˜F„¤aFhFm›’˜pO˜›^F˜˜FF˜›^F˜h"am›Fm"m4F˜
4^"z›F˜Op˜hpF˜amOph"›apm
90
˜˜˜˜zF"›amV˜›^F˜˜
p˜¤’F˜p›^F˜F"VFm›˜V"’F’
^F˜zF’’¤F˜pO˜›^F˜"hhpma"˜’¤zzd©˜h¤’›˜*F˜dF’’˜›^"m˜Q˜z’aV˜aV^F˜zF’’¤F’˜4"m˜F’¤d›˜
am˜"hhpma"˜4pm=Fm’amV˜Oph˜"˜V"’˜›p˜"˜da„¤a=˜
d§"©’˜cFFz˜›^F˜"hhpma"˜›"mc˜am˜"m˜¤zaV^›˜zp’a›apm:˜*Fdp§˜›^F˜dF¦Fd˜pO˜›^F˜Odp§˜hp=¤dF˜
pad˜›^F˜"hhpma"˜’¤zzd©˜›¤*amV˜am›p˜’F¦F"d˜¦F›a4"d˜dppz’˜*©˜§"zzamV˜›^F˜›¤*amV˜"p¤m=˜
"˜4"m˜p˜*p››dF˜^a’˜§add˜^Fdz˜cFFz˜"m©˜da„¤a=˜"hhpma"˜p¤›˜pO˜›^F˜Odp§˜hp=¤dF
Ammonia tends to break down vacuum pump fluids and seals. Ammonia CI makes
more frequent vacuum system maintenance necessary.
FF˜"d’p
To minimize foreline pump damage from ammonia, 254.
^Fm˜¤mmamV˜"hhpma"˜Op˜Oa¦F˜p˜hpF˜^p¤’˜"˜="©:˜›^F˜OpFdamF˜z¤hz˜h¤’›˜*F˜*"dd"’›F=˜
Op˜"›˜dF"’›˜pmF˜^p¤˜"˜="©˜›p˜hamaha«F˜="h"VF˜›p˜z¤hz˜’F"d’˜FF˜z"VF˜¢QT˜d§"©’˜z¤VF˜
›^F˜˜§a›^˜hF›^"mF˜"O›F˜Odp§amV˜"hhpma"
Frequently, a mixture of 5% ammonia and 95% helium or 5% ammonia and 95%
methane is used as a CI reagent gas. This is enough ammonia to achieve good
chemical ionization while minimizing its negative effects.
Carbon dioxide NCI
Carbon dioxide is often used as a buffer gas for negative CI. It has obvious advantages of availability and safety.
91
˜˜˜˜zF"›amV˜›^F˜˜
p˜’§a›4^˜Oph˜˜›p˜˜pzF"›amV˜hp=F
To switch from CI to EI operating mode
1 Press the "’˜OO button to close the isolation valve.
2 Vent the MSD. See page 54.
The software will prompt you for the appropriate actions.
3 Open the analyzer.
4 Remove the CI interface tip seal. See page 250.
5 Remove the CI ion source. See page 248.
6 Install the EI ion source. See page 216.
7 Place the CI ion source and interface tip seal in the ion source storage box.
8 Pump down the MSD. See page 60.
9 Load your EI tune file.
d§"©’˜§F"˜4dF"m˜Vdp¦F’˜§^adF˜›p¤4^amV˜›^F˜"m"d©«F˜p˜"m©˜p›^F˜z"›’˜›^"›˜Vp˜am’a=F˜›^F˜
"m"d©«F˜4^"h*F
dF4›p’›"›a4˜=a’4^"VF’˜›p˜"m"d©«F˜4phzpmFm›’˜"F˜4pm=¤4›F=˜›p˜›^F˜’a=F˜*p"=˜§^FF˜
›^F©˜4"m˜="h"VF˜’Fm’a›a¦F˜4phzpmFm›’˜F"˜"˜Vp¤m=F=˜"m›a_’›"›a4˜§a’›˜’›"z˜
"m=˜›"cF˜p›^F˜"m›a_’›"›a4˜zF4"¤›apm’˜*FOpF˜©p¤˜pzFm˜›^F˜"m"d©«F˜4^"h*F
FF˜z"VF˜sQG
92
*HQHUDOV\PSWRPV
&KURPDWRJUDSKLFV\PSWRPV
0DVVVSHFWUDOV\PSWRPV
3UHVVXUHV\PSWRPV
7HPSHUDWXUHV\PSWRPV
(UURUPHVVDJHV
$LUOHDNV
&RQWDPLQDWLRQ
7URXEOHVKRRWLQJWKH06'
+RZWRLGHQWLI\WKHV\PSWRPVDQGFDXVHVRISUREOHPVLQ\RXU06'
7URXEOHVKRRWLQJWKH06'
7KLVFKDSWHULVDTXLFNUHIHUHQFHWRV\PSWRPVDQGSRVVLEOHFDXVHVRIWKH
PRVWFRPPRQSUREOHPVH[SHULHQFHGE\WKH10DVV6HOHFWLYH'HWHFWRU
06'5HODWHGV\PSWRPVDUHJURXSHGLQWKHVHFDWHJRULHV
‡ *HQHUDOV\PSWRPV
‡ &KURPDWRJUDSKLFV\PSWRPV
‡ 0DVVVSHFWUDOV\PSWRPV
‡ 3UHVVXUHV\PSWRPV
‡ 7HPSHUDWXUHV\PSWRPV
‡ (UURUPHVVDJHV
‡ &RQWDPLQDWLRQ
‡ $LUOHDNV
)RUHDFKV\PSWRPRQHRUPRUHSRVVLEOHFDXVHVDUHOLVWHG7KHSRVVLEOH
FDXVHVOLVWHGDUHQRWLQDVWULFWRUGHU,QJHQHUDOKRZHYHUWKHSRVVLEOH
FDXVHVOLVWHGILUVWDUHWKHPRVWOLNHO\FDXVHVRUWKHHDVLHVWWRFKHFNDQG
FRUUHFW6HH&,7URXEOHVKRRWLQJIRUKHOSZLWK&,VSHFLILFSUREOHPV
7KLVVHFWLRQLVRQO\DTXLFNUHIHUHQFH1RFRUUHFWLYHDFWLRQVDUHOLVWHGIRUWKH
SRVVLEOHFDXVHVIRUHDFKV\PSWRP)RUPRUHH[WHQVLYHWURXEOHVKRRWLQJ
LQIRUPDWLRQVHHWKH7URXEOHVKRRWLQJ106'VHFWLRQLQWKHRQOLQH
KHOSRIWKH06'&KHP6WDWLRQVRIWZDUH7KHRQOLQHWURXEOHVKRRWLQJSURYLGHV
PRUHH[SODQDWLRQDQGLQPDQ\FDVHVFRUUHFWLYHDFWLRQV
^a’˜4^"z›F˜=pF’˜mp›˜am4d¤=F˜4pF4›a¦F˜"4›apm’˜Op˜›^F˜zp’’a*dF˜4"¤’F’˜da’›F=˜phF˜
pO˜›^F˜4pF4›a¦F˜"4›apm’˜F„¤aF=˜h"©˜*F˜="mVFp¤’˜aO˜zFOphF=˜am4pF4›d©˜p˜mp›˜
"››Fhz›˜"m©˜4pF4›a¦F˜"4›apm’˜¤mdF’’˜©p¤˜"F˜’¤F˜©p¤˜cmp§˜›^F˜4pF4›˜zp4F=¤F˜
"m=˜›^F˜="mVF’˜am¦pd¦F=˜FF˜›^F˜p¤*dF’^pp›amV˜|Qn•˜}˜’F4›apm˜am˜›^F˜pmdamF˜
^Fdz˜"m=˜›^F˜p›^F˜4^"z›F’˜am˜›^a’˜h"m¤"d˜Op˜hpF˜amOph"›apm
T˜˜˜˜p¤*dF’^pp›amV˜›^F˜
,IWKHPDWHULDOLQWKLVFKDSWHUDQGLQWKHRQOLQHKHOSSURYHVLQVXIILFLHQWWR
KHOS\RXGLDJQRVHDSUREOHPFRQWDFW\RXU$JLOHQW7HFKQRORJLHVVHUYLFH
UHSUHVHQWDWLYH
7URXEOHVKRRWLQJWLSVDQGWULFNV
7KHIROORZLQJDUHJHQHUDOUXOHVIRUWURXEOHVKRRWLQJZLWKVSHFLILFH[DPSOHV
Rule 1: “Look for what has been changed.”
0DQ\SUREOHPVDUHLQWURGXFHGDFFLGHQWDOO\E\KXPDQDFWLRQV(YHU\WLPH
DQ\V\VWHPLVGLVWXUEHGWKHUHLVDFKDQFHRILQWURGXFLQJDQHZSUREOHP
‡ ,IWKH06'ZDVMXVWSXPSHGGRZQDIWHUPDLQWHQDQFHVXVSHFWDLUOHDNV
RULQFRUUHFWDVVHPEO\
‡ &DUULHUJDVRUKHOLXPJDVSXULILHUZHUHMXVWFKDQJHGVXVSHFWOHDNVRU
FRQWDPLQDWHGRULQFRUUHFWJDV
‡ ,IWKH*&FROXPQZDVMXVWUHSODFHGVXVSHFWDLUOHDNVRUFRQWDPLQDWHGRU
EOHHGLQJFROXPQ
Rule 2: “If complex isn’t working, go back to simple.”
$FRPSOH[WDVNLVQRWRQO\PRUHGLIILFXOWWRSHUIRUPEXWDOVRPRUHGLIILFXOW
WRWURXEOHVKRRWDVZHOO
‡ ,I\RXªUHKDYLQJWURXEOHGHWHFWLQJ\RXUVDPSOHYHULI\WKDWDXWRWXQHLV
VXFFHVVIXO
Rule 3: “Divide and conquer.”
7KLVWHFKQLTXHLVNQRZQDV§KDOIVSOLW¨WURXEOHVKRRWLQJ,I\RXFDQLVRODWHWKH
SUREOHPWRRQO\SDUWRIWKHV\VWHPLWLVPXFKHDVLHUWRORFDWH
‡ 7RGHWHUPLQHZKHWKHUDQDLUOHDNLVLQWKH*&RUWKH06'\RXFDQYHQW
WKH06'UHPRYHWKHFROXPQDQGLQVWDOOWKHEODQNLQWHUIDFHIHUUXOH,I
WKHOHDNJRHVDZD\LWZDVLQWKH*&
T˜˜˜˜p¤*dF’^pp›amV˜›^F˜
FmF"d˜’©hz›ph’
*HQHUDOV\PSWRPV
7KLVVHFWLRQGHVFULEHVV\PSWRPV\RXPLJKWREVHUYHZKHQILUVWWXUQLQJRQWKH
*&06'V\VWHP$OORIWKHVHV\PSWRPVZRXOGSUHYHQWRSHUDWLRQRIWKHV\VWHP
*&GRHVQRWWXUQRQ
7KLVUHIHUVWRDFRQGLWLRQLQZKLFKQRWKLQJKDSSHQVZKHQWKH*&LVVZLWFKHGRQ
7KH*&IDQVGRQRWWXUQRQDQGWKHNH\SDGGLVSOD\GRHVQRWOLJKW
‡
‡
‡
‡
'LVFRQQHFWHG*&SRZHUFRUG
1RYROWDJHRULQFRUUHFWYROWDJHDWWKHHOHFWULFDORXWOHW
)DLOHGIXVHLQWKH*&
*&SRZHUVXSSO\LVQRWZRUNLQJFRUUHFWO\
06'GRHVQRWWXUQRQ
7KLVUHIHUVWRDFRQGLWLRQLQZKLFKQRWKLQJKDSSHQVZKHQWKH06'LVVZLWFKHGRQ
7KHIRUHOLQHSXPSGRHVQRWVWDUW7KHFRROLQJIDQIRUWKHKLJKYDFXXPSXPSGRHV
QRWWXUQRQ7KHFRQWUROSDQHOLVQRWRQ
‡
‡
‡
‡
'LVFRQQHFWHG06'SRZHUFRUG
1RYROWDJHRULQFRUUHFWYROWDJHDWWKHHOHFWULFDORXWOHW
)DLOHGSULPDU\IXVHV
06'HOHFWURQLFVDUHQRWZRUNLQJFRUUHFWO\
)RUHOLQHSXPSLVQRWRSHUDWLQJ
7KLVUHIHUVWRDFRQGLWLRQZKHUHWKH06'LVUHFHLYLQJSRZHUWKHIDQLVRSHUDWLQJ
DQGWKHFRQWUROSDQHOLVOLWEXWWKHIRUHOLQHSXPSLVQRW
RSHUDWLQJ
‡ /DUJHDLUOHDNXVXDOO\WKHDQDO\]HUGRRURSHQKDVFDXVHGSXPSGRZQIDLOXUH
6HH§3XPSGRZQIDLOXUHVKXWGRZQ¨RQSDJH 1RWHWKDW\RXPXVWSRZHUF\FOH
WKH06'WRUHFRYHUIURPWKLVVWDWH
‡ 'LVFRQQHFWHGIRUHOLQHSXPSSRZHUFRUG
‡ 0DOIXQFWLRQLQJIRUHOLQHSXPS
T˜˜˜˜p¤*dF’^pp›amV˜›^F˜
FmF"d˜’©hz›ph’
06'WXUQVRQEXWWKHQWKHIRUHOLQHSXPSVKXWVRII
06'VZLOOVKXWGRZQERWKWKHIRUHOLQHSXPSDQGWKHKLJKYDFXXPSXPSLIWKHV\V
WHPIDLOVWRSXPSGRZQFRUUHFWO\7KLVLVXVXDOO\EHFDXVHRIDODUJHDLUOHDNHLWKHU
WKHVLGHSODWHKDVQRWVHDOHGFRUUHFWO\RUWKHYHQWYDOYHLVVWLOORSHQ7KLVIHDWXUH
KHOSVSUHYHQWWKHIRUHOLQHSXPSIURPVXFNLQJDLUWKURXJKWKHV\VWHPZKLFKFDQ
GDPDJHWKHDQDO\]HUDQGSXPS
6HH§3XPSGRZQIDLOXUHVKXWGRZQ¨RQSDJH 1RWHWKDW\RXPXVWSRZHUF\FOH
WKH06'WRUHFRYHUIURPWKLVVWDWH
&RQWUROSDQHOVD\V§1RVHUYHUIRXQG¨
‡ 'LVFRQQHFWHG/$1FDEOHEHWZHHQ06'DQGWKHKXERUWKHKXEDQGWKH3&
‡ 3&LVWXUQHGRII
T˜˜˜˜p¤*dF’^pp›amV˜›^F˜
^ph"›pV"z^a4˜’©hz›ph’
&KURPDWRJUDSKLFV\PSWRPV
7KLVVHFWLRQGHVFULEHVV\PSWRPV\RXPD\REVHUYHLQWKHFKURPDWRJUDPVJHQHU
DWHGE\GDWDDFTXLVLWLRQ,QJHQHUDOWKHVHV\PSWRPVGRQRWSUHYHQW\RXIURP
RSHUDWLQJ\RXU*&06'V\VWHP7KH\LQGLFDWHKRZHYHUWKDWWKHGDWD\RXDUH
DFTXLULQJPD\QRWEHWKHEHVWGDWDREWDLQDEOH7KHVHV\PSWRPVFDQEHFDXVHGE\
LQVWUXPHQWPDOIXQFWLRQVEXWDUHPRUHOLNHO\FDXVHGE\LQFRUUHFWFKURPDWRJUDSKLF
WHFKQLTXH
7ZRRIWKHV\PSWRPV,IVHQVLWLYLW\LVORZDQG,IUHSHDWDELOLW\LVSRRUDOVRDSSO\
WRPDVVVSHFWUDOGDWD
1RSHDNV
,IDQDQDO\VLVVKRZVQRFKURPDWRJUDSKLFSHDNVRQO\DIODWEDVHOLQHRUPLQRUQRLVH
UXQRQHRIWKHDXWRPDWHGWXQHSURJUDPV,IWKH06'SDVVHVWXQHWKHSUREOHPLV
PRVWOLNHO\UHODWHGWRWKH*&,IWKH06'GRHVQRWSDVVWXQHWKHSUREOHPLVPRVW
OLNHO\LQWKH06'
3DVVHVWXQH
‡
‡
‡
‡
‡
‡
‡
‡
,QFRUUHFWVDPSOHFRQFHQWUDWLRQ
1RDQDO\WHVSUHVHQW
6\ULQJHPLVVLQJIURPWKH$/6RUQRWLQVWDOOHGFRUUHFWO\
,QMHFWLRQDFFLGHQWDOO\PDGHLQVSOLWPRGHLQVWHDGRIVSOLWOHVVPRGH
(PSW\RUDOPRVWHPSW\VDPSOHYLDO
'LUW\LQMHFWLRQSRUW
/HDNLQJLQMHFWLRQSRUW
/RRVHFROXPQQXWDWWKHLQMHFWLRQSRUW
7KHVHFRXOGFDXVHDIDXOWFRQGLWLRQLQWKH*&WKDWZRXOGSUHYHQWWKH*&IURP
RSHUDWLQJ
T˜˜˜˜p¤*dF’^pp›amV˜›^F˜
^ph"›pV"z^a4˜’©hz›ph’
'RHVQRWSDVVWXQH
‡
‡
‡
‡
‡
‡
‡
‡
‡
&DOLEUDWLRQYLDOLVHPSW\
([FHVVLYHIRUHOLQHRUDQDO\]HUFKDPEHUSUHVVXUH
9HU\GLUW\LRQVRXUFH
&DOLEUDWLRQYDOYHLVQRWZRUNLQJFRUUHFWO\
%DGVLJQDOFDEOHFRQQHFWLRQ
)LODPHQWKDVIDLOHGRULVQRWFRQQHFWHGFRUUHFWO\
%DGLRQVRXUFHZLULQJFRQQHFWLRQ
%DGGHWHFWRUZLULQJFRQQHFWLRQ
)DLOHGHOHFWURQPXOWLSOLHUKRUQ
3HDNVDUHWDLOLQJ
‡
‡
‡
‡
‡
‡
$FWLYHVLWHVLQWKHVDPSOHSDWK
,QMHFWLRQLVWRRODUJH
,QFRUUHFWLQMHFWLRQSRUWWHPSHUDWXUH
,QVXIILFLHQWFROXPQIORZ
*&06'LQWHUIDFHWHPSHUDWXUHLVWRRORZ
,RQVRXUFHWHPSHUDWXUHLVWRRORZ
3HDNVDUHIURQWLQJ
‡ &ROXPQILOPWKLFNQHVVPLVPDWFKHGZLWKDQDO\WHFRQFHQWUDWLRQ
FROXPQRYHUORDG
‡ ,QLWLDORYHQWHPSHUDWXUHLVWRRORZ
‡ $FWLYHVLWHVLQWKHVDPSOHSDWK
‡ ,QMHFWLRQLVWRRODUJH
‡ ,QMHFWLRQSRUWSUHVVXUHWRRKLJK
‡ ,QVXIILFLHQWFROXPQIORZ
T˜˜˜˜p¤*dF’^pp›amV˜›^F˜
^ph"›pV"z^a4˜’©hz›ph’
3HDNVKDYHIODWWRSV
‡
‡
‡
‡
,QVXIILFLHQWVROYHQWGHOD\
,QFRUUHFWVFDOHRQWKHGLVSOD\
,QMHFWLRQLVWRRODUJH
(OHFWURQPXOWLSOLHUYROWDJHLVWRRKLJK
3HDNVKDYHVSOLWWRSV
‡ %DGLQMHFWLRQWHFKQLTXH
‡ ,QMHFWLRQLVWRRODUJH
%DVHOLQHLVULVLQJ
‡ &ROXPQEOHHG
‡ 2WKHUFRQWDPLQDWLRQ
%DVHOLQHLVKLJK
‡ &ROXPQEOHHG
‡ 2WKHUFRQWDPLQDWLRQ
‡ (OHFWURQPXOWLSOLHUYROWDJHLVWRRKLJK
%DVHOLQHLVIDOOLQJ
$IDOOLQJEDVHOLQHLQGLFDWHVFRQWDPLQDWLRQLVEHLQJVZHSWDZD\:DLWXQWLOWKHEDVH
OLQHUHDFKHVDQDFFHSWDEOHOHYHO&RPPRQFDXVHVLQFOXGH
‡
‡
‡
‡
5HVLGXDOZDWHUDLUDQGZDWHUIURPDUHFHQWYHQWLQJ
&ROXPQEOHHG
6HSWXPEOHHG
6SOLWOHVVLQMHFWLRQWLPHWRRORQJLQOHWLVQRWSURSHUO\VZHSWUHVXOWLQJLQH[FHVV
VROYHQWRQWKHFROXPQDQGVORZVROYHQWGHFD\
T˜˜˜˜p¤*dF’^pp›amV˜›^F˜
^ph"›pV"z^a4˜’©hz›ph’
%DVHOLQHZDQGHUV
‡ ,QVXIILFLHQWFDUULHUJDVVXSSO\SUHVVXUH
‡ 0DOIXQFWLRQLQJIORZRUSUHVVXUHUHJXODWRU
‡ ,QWHUPLWWHQWOHDNLQWKHLQMHFWLRQSRUW
7KHVHFRXOGFDXVHDIDXOWFRQGLWLRQLQWKH*&WKDWZRXOGSUHYHQWWKH*&IURP
RSHUDWLQJ
5HWHQWLRQWLPHVIRUDOOSHDNVGULIW¥VKRUWHU
‡ &ROXPQKDVEHHQVKRUWHQHG
‡ ,QLWLDORYHQWHPSHUDWXUHZDVLQFUHDVHG
‡ &ROXPQLVJHWWLQJROG
5HWHQWLRQWLPHVIRUDOOSHDNVGULIW¥ORQJHU
‡
‡
‡
‡
&ROXPQIORZKDVEHHQUHGXFHG
,QLWLDORYHQWHPSHUDWXUHZDVGHFUHDVHG
$FWLYHVLWHVLQWKHVDPSOHSDWK
/HDNVLQWKHLQMHFWLRQSRUW
7KLVFRXOGFDXVHDIDXOWFRQGLWLRQLQWKH*&WKDWZRXOGSUHYHQWWKH*&IURP
RSHUDWLQJ
T˜˜˜˜p¤*dF’^pp›amV˜›^F˜
^ph"›pV"z^a4˜’©hz›ph’
3RRUVHQVLWLYLW\
‡
‡
‡
‡
‡
‡
‡
‡
‡
‡
‡
‡
‡
‡
‡
,QFRUUHFWWXQLQJ
7XQHILOHWKDWGRHVQRWPDWFKWKHW\SHRIDQDO\VLV
5HSHOOHUYROWDJHLVWRRORZ
,QFRUUHFWWHPSHUDWXUHVRYHQ*&06'LQWHUIDFHLRQVRXUFHRUPDVVILOWHU
,QFRUUHFWVDPSOHFRQFHQWUDWLRQ
/HDNLQJLQMHFWLRQSRUW
'LUW\LQMHFWLRQSRUW
,QFRUUHFWVSOLWUDWLR
3XUJHRIIWLPHLQVSOLWOHVVPRGHLVWRRVKRUW
([FHVVLYHSUHVVXUHLQWKH06'
'LUW\LRQVRXUFH
$LUOHDN
3RRUILODPHQWRSHUDWLRQ
'HWHFWRU+('HOHFWURQPXOWLSOLHULVQRWZRUNLQJFRUUHFWO\
,QFRUUHFWPDVVILOWHUSRODULW\
7KLVFRXOGFDXVHDIDXOWFRQGLWLRQLQWKH*&WKDWZRXOGSUHYHQWWKH*&IURP
RSHUDWLQJ
3RRU5HSHDWDELOLW\
‡
‡
‡
‡
‡
‡
‡
‡
‡
'LUW\V\ULQJHQHHGOH
'LUW\LQMHFWLRQSRUW
/HDNLQJLQMHFWLRQSRUW
,QMHFWLRQLVWRRODUJH
/RRVHFROXPQFRQQHFWLRQV
9DULDWLRQVLQSUHVVXUHFROXPQIORZDQGWHPSHUDWXUH
'LUW\LRQVRXUFH
/RRVHFRQQHFWLRQVLQWKHDQDO\]HU
*URXQGORRSV
7KLVFRXOGFDXVHDIDXOWFRQGLWLRQLQWKH*&WKDWZRXOGSUHYHQWWKH*&IURP
RSHUDWLQJ
T˜˜˜˜p¤*dF’^pp›amV˜›^F˜
"’’˜’zF4›"d˜’©hz›ph’
0DVVVSHFWUDOV\PSWRPV
7KLVVHFWLRQGHVFULEHVV\PSWRPV\RXPLJKWREVHUYHLQPDVVVSHFWUD6RPHRI
WKHVHV\PSWRPVZLOODSSHDULQWKHPDVVVSHFWUDRIVDPSOHV2WKHUV\RXZLOO
REVHUYHRQO\LQDWXQHUHSRUW6RPHRIWKHVHV\PSWRPVKDYHFDXVHVWKDWFDQEH
FRUUHFWHGE\WKHRSHUDWRU2WKHUVKRZHYHUUHTXLUHVHUYLFHE\DQ$JLOHQW7HFKQRO
RJLHVVHUYLFHUHSUHVHQWDWLYH
7ZRV\PSWRPVOLVWHGXQGHU&KURPDWRJUDSKLFV\PSWRPV,IVHQVLWLYLW\LVSRRU
DQG,IUHSHDWDELOLW\LVSRRUDOVRDSSO\WRPDVVVSHFWUD
1RSHDNV
‡
‡
‡
‡
,RQVRXUFHFDEOHVQRWFRQQHFWHG
%DGFRQQHFWLRQVWRRUIURPWKHGHWHFWRU
+('SRZHUVXSSO\RXWSXWFDEOHKDVIDLOHGZKLWHFDEOH
2WKHUHOHFWURQLFVIDLOXUH
,VRWRSHVDUHPLVVLQJRULVRWRSHUDWLRVDUHLQFRUUHFW
‡
‡
‡
‡
‡
‡
‡
3HDNVDUHWRRZLGHRUWRRQDUURZ
6FDQVSHHGLVWRRKLJKVFDQPRGH
'ZHOOWLPHLVWRRVKRUW6,0PRGH
(OHFWURQPXOWLSOLHUYROWDJHLVWRRKLJK
5HSHOOHUYROWDJHLVWRRKLJK
+LJKEDFNJURXQG
'LUW\LRQVRXUFH
+LJKEDFNJURXQG
‡ 3UHVVXUHLQWKHDQDO\]HUFKDPEHULVWRRKLJK
‡ $LUOHDN
‡ &RQWDPLQDWLRQ
T˜˜˜˜p¤*dF’^pp›amV˜›^F˜
"’’˜’zF4›"d˜’©hz›ph’
+LJKDEXQGDQFHVDWP]DQGRUDWP]DQG
‡ 6\VWHPZDVUHFHQWO\YHQWHGUHVLGXDODLUDQGZDWHU
‡ $LUOHDN
/DUJHSHDNVDWP]DQGDUHV\PSWRPDWLFRIHVSHFLDOO\ODUJHOHDNV
0DVVDVVLJQPHQWVDUHLQFRUUHFW
6PDOOVKDSHFKDQJHVDWWKHWRSRIWKHPDVVSHDNVFDQFDXVHDPXVKLIWVLQPDVV
DVVLJQPHQWV6KLIWVJUHDWHUWKDQDPXLQGLFDWHDSRVVLEOHPDOIXQFWLRQ
‡
‡
‡
‡
06'KDVQRWKDGHQRXJKWLPHWRUHDFKWKHUPDOHTXLOLEULXP
/DUJHYDULDWLRQVLQWKHWHPSHUDWXUHRIWKHODERUDWRU\
06'KDVQRWEHHQWXQHGUHFHQWO\RUDWWKHWHPSHUDWXUHDWZKLFKLWLVRSHUDWLQJ
,QFRUUHFWWXQHILOHLQDSSURSULDWHSDUDPHWHUV
3HDNVKDYHSUHFXUVRUV
7KHWXQHUHSRUWOLVWVWKHVL]HRIWKHSUHFXUVRUVIRUWKHWXQHPDVVHV6PDOOSUHFXU
VRUVDUHQRWXQXVXDO,IWKHSUHFXUVRUVDUHXQDFFHSWDEO\ODUJHIRU\RXUDSSOLFDWLRQ
RQHRIWKHIROORZLQJPD\EHUHVSRQVLEOH
‡
‡
‡
‡
5HSHOOHUYROWDJHLVWRRKLJK
3HDNVDUHWRRZLGH
,QFRUUHFWGFSRODULW\RQWKHTXDGUXSROHPDVVILOWHU
'LUW\TXDGUXSROHPDVVILOWHU
3HDNZLGWKVDUHLQFRQVLVWHQW
‡
‡
‡
‡
‡
‡
‡
‡
06'KDVQRWKDGHQRXJKWLPHWRUHDFKWKHUPDOHTXLOLEULXP
/DUJHYDULDWLRQVLQWKHWHPSHUDWXUHRIWKHODERUDWRU\
,QFRUUHFWWXQLQJ
&DOLEUDWLRQYLDOLVHPSW\RUDOPRVWHPSW\
&DOLEUDWLRQYDOYHLVQRWZRUNLQJFRUUHFWO\
'LUW\LRQVRXUFH
(OHFWURQPXOWLSOLHULVQHDULQJWKHHQGRILWXVHIXOOLIHWLPH
*URXQGORRSSUREOHPV
T˜˜˜˜p¤*dF’^pp›amV˜›^F˜
"’’˜’zF4›"d˜’©hz›ph’
5HODWLYHDEXQGDQFHRIP]LVOHVVWKDQ
$XWRWXQHVKRXOGJLYHDQP]UHODWLYHDEXQGDQFHJUHDWHUWKDQ7KHUHOD
WLYHDEXQGDQFHRIP]FDQKRZHYHUYDU\DJUHDWGHDOGHSHQGLQJRQFROXPQ
IORZLRQVRXUFHWHPSHUDWXUHDQGRWKHUYDULDEOHV$VORQJDVUHODWLYHDEXQGDQFH
LVDERYHWKHVWDELOLW\RIWKHUHODWLYHDEXQGDQFHLVPRUHLPSRUWDQWWKDQWKH
DEVROXWHYDOXH,I\RXREVHUYHVLJQLILFDQWFKDQJHVLQWKHUHODWLYHDEXQGDQFHRI
P]IRUDIL[HGVHWRIRSHUDWLQJSDUDPHWHUVWKHUHPD\EHDSUREOHP7KH
FKDUWVLQWKH06'&KHP6WDWLRQVRIWZDUHDUHXVHIXOIRULGHQWLI\LQJFKDQJHV6HOHFW
aF§˜¤mF’IURPWKH4XDOLI\PHQXLQWKH,QVWUXPHQW&RQWUROYLHZ
/RZUHODWLYHDEXQGDQFHRIP]VKRXOGQRWEHFRQIXVHGZLWKORZDEVROXWH
DEXQGDQFHVDWKLJKPDVVHV6HQVLWLYLW\DWKLJKPDVVHVFDQEHH[FHOOHQWHYHQLIWKH
UHODWLYHDEXQGDQFHRIP]LVQHDU,I\RXU06'SURGXFHVORZDEVROXWH
DEXQGDQFHVDWKLJKPDVVHVUHIHUWRWKHV\PSWRP+LJKPDVVVHQVLWLYLW\LVSRRU
7XQHSURJUDPVRWKHUWKDQDXWRWXQHKDYHGLIIHUHQWUHODWLYHDEXQGDQFHWDUJHWV7KH
')733DQG%)%WDUJHWWXQHSURJUDPVWXQHWKH106'WRDFKLHYHDERXWD
UDWLRRIP]
‡ 7XQHSURJUDPWXQHILOHKDVDGLIIHUHQWUHODWLYHDEXQGDQFHWDUJHW
RQO\DSSOLHVWR$XWRWXQH
‡ 1RWHQRXJKWLPHIRUWKH06'WRZDUPXSDQGSXPSGRZQ
‡ $QDO\]HUFKDPEHUSUHVVXUHLVWRRKLJK
‡ ,RQVRXUFHWHPSHUDWXUHLVWRRKLJK
‡ &ROXPQFDUULHUJDVIORZLVWRRKLJK
‡ 3RRUILODPHQWRSHUDWLRQ
‡ 'LUW\LRQVRXUFH
‡ $LUOHDN
‡ ,QFRUUHFWGFSRODULW\RQWKHTXDGUXSROHPDVVILOWHU
6SHFWUDORRNGLIIHUHQWIURPWKRVHDFTXLUHGZLWKRWKHU06'V
,RQUDWLRVDUHGLIIHUHQWIURPWKRVHLQROGHU06'V7KLVLVGXHWRWKH+('GHWHFWRU
DQGLVQRUPDO7RJHWVSHFWUDVLPLODUWRROGHU06'VXVH›"m="=˜zF4›"˜¤mF:DYDLO
DEOHLQWKH0DQXDO7XQHYLHZ1RWHWKDWWKLVWXQHWDNHVPXFKORQJHUWRFRPSOHWH
WKDQ¤›p›¤mF
T˜˜˜˜p¤*dF’^pp›amV˜›^F˜
"’’˜’zF4›"d˜’©hz›ph’
+LJKPDVVVHQVLWLYLW\LVSRRU
7KLVUHIHUVWRDFRQGLWLRQZKHUHWKHDEVROXWHDEXQGDQFHDWWKHXSSHUHQGRIWKH
PDVVUDQJHLVSRRU$EVROXWHDEXQGDQFHVKRXOGQRWEHFRQIXVHGZLWKWKHUHODWLYH
DEXQGDQFHSHUFHQWDJHRIP]WRP]6HQVLWLYLW\DWKLJKPDVVHVFDQEH
H[FHOOHQWHYHQLIWKHUHODWLYHDEXQGDQFHRIP]LVORZ
‡
‡
‡
‡
‡
‡
‡
‡
‡
‡
:URQJWXQHSURJUDP
:URQJWXQHILOH
5HSHOOHUYROWDJHLVWRRORZ
1RWHQRXJKWLPHIRUWKH06'WRZDUPXSDQGSXPSGRZQ
$QDO\]HUFKDPEHUSUHVVXUHLVWRRKLJK
&ROXPQFDUULHUJDVIORZLVWRRKLJK
3RRUILODPHQWRSHUDWLRQ
'LUW\LRQVRXUFH
$LUOHDN
,QFRUUHFWGFSRODULW\RQWKHTXDGUXSROHPDVVILOWHU
T˜˜˜˜p¤*dF’^pp›amV˜›^F˜
F’’¤F˜’©hz›ph’
3UHVVXUHV\PSWRPV
7KLVVHFWLRQGHVFULEHVXQXVXDOSUHVVXUHUHDGLQJVDQGWKHLUSRVVLEOHFDXVHV7KH
V\PSWRPVLQWKLVVHFWLRQDUHEDVHGRQW\SLFDOSUHVVXUHV$WW\SLFDOFROXPQIORZ
UDWHVPOPLQXWHWKHIRUHOLQHSUHVVXUHZLOOEHDSSUR[LPDWHO\WR
P7RUU7KHDQDO\]HUFKDPEHUSUHVVXUHZLOOEHDSSUR[LPDWHO\×_–WR
×_T7RUU7KHVHSUHVVXUHVFDQYDU\ZLGHO\IURPLQVWUXPHQWWRLQVWUXPHQWVR
LWLVYHU\LPSRUWDQWWKDW\RXDUHIDPLOLDUZLWKWKHSUHVVXUHVWKDWDUHW\SLFDOIRU
\RXULQVWUXPHQWDWJLYHQFDUULHUJDVIORZV
7KHIRUHOLQHSUHVVXUHVOLVWHGFDQRQO\EHPHDVXUHGRQGLIIXVLRQSXPSHTXLSSHG
V\VWHPV7XUERPROHFXODUSXPSVDUHFRQWUROOHGDFFRUGLQJWRWKHLUVSHHGDQGGR
QRWKDYHIRUHOLQHSUHVVXUHJDXJHV7KHDQDO\]HUFKDPEHUSUHVVXUHVFDQRQO\EH
PHDVXUHGLI\RXUV\VWHPLVHTXLSSHGZLWKWKHRSWLRQDOJDXJHFRQWUROOHU
)RUHOLQHSUHVVXUHLVWRRKLJK
,IWKHSUHVVXUH\RXREVHUYHLVDERYHP7RUURULIWKHSUHVVXUH\RXREVHUYHIRUD
JLYHQFROXPQIORZKDVLQFUHDVHGRYHUWLPHFKHFNWKHIROORZLQJ
‡
‡
‡
‡
‡
‡
&ROXPQFDUULHUJDVIORZLVWRRKLJK
$LUOHDNXVXDOO\WKHVLGHSODWHLVQRWSXVKHGLQRUYHQWYDOYHLVRSHQ
)RUHOLQHSXPSRLOOHYHOLVORZRURLOLVFRQWDPLQDWHG
)RUHOLQHKRVHLVFRQVWULFWHG
)RUHOLQHJDXJHLVQRWZRUNLQJFRUUHFWO\
)RUHOLQHSXPSLVQRWZRUNLQJFRUUHFWO\
$QDO\]HUFKDPEHUSUHVVXUHLVWRRKLJK(,RSHUDWLQJPRGH
,IWKHSUHVVXUH\RXREVHUYHLVDERYH×_T7RUURULIWKHSUHVVXUH\RXREVHUYH
IRUDJLYHQFROXPQIORZKDVLQFUHDVHGRYHUWLPHFKHFNWKHIROORZLQJ
‡
‡
‡
‡
‡
&ROXPQFDUULHUJDVIORZLVWRRKLJK
$LUOHDN
)RUHOLQHSXPSLVQRWZRUNLQJFRUUHFWO\VHH)RUHOLQHSUHVVXUHLVWRRKLJK
'LIIXVLRQSXPSIOXLGOHYHOLVORZRUIOXLGLVFRQWDPLQDWHG
7XUERPROHFXODUSXPSLVQRWZRUNLQJFRUUHFWO\
T˜˜˜˜p¤*dF’^pp›amV˜›^F˜
F’’¤F˜’©hz›ph’
)RUHOLQHSUHVVXUHLVWRRORZ
,IWKHSUHVVXUHV\RXREVHUYHDUHEHORZP7RUUFKHFNIRUWKHIROORZLQJ
‡
‡
‡
‡
‡
&ROXPQFDUULHUJDVIORZLVWRRORZ
&ROXPQSOXJJHGRUFUXVKHGE\DQRYHUWLJKWHQHGQXW
(PSW\RULQVXIILFLHQWFDUULHUJDVVXSSO\
%HQWRUSLQFKHGFDUULHUJDVWXELQJ
)RUHOLQHJDXJHLVQRWZRUNLQJFRUUHFWO\
7KHVHFRXOGFUHDWHDIDXOWFRQGLWLRQLQWKH*&WKDWZRXOGSUHYHQWWKH*&IURP
RSHUDWLQJ
$QDO\]HUFKDPEHUSUHVVXUHLVWRRORZ
,IWKHSUHVVXUHV\RXREVHUYHDUHEHORZ×_–7RUUFKHFNIRUWKHIROORZLQJ
‡
‡
‡
‡
&ROXPQFDUULHUJDVIORZLVWRRORZ
&ROXPQSOXJJHGRUFUXVKHGE\RYHUWLJKWHQHGQXW
(PSW\RULQVXIILFLHQWFDUULHUJDVVXSSO\
%HQWRUSLQFKHGFDUULHUJDVWXELQJ
7KHVHFRXOGFUHDWHDIDXOWFRQGLWLRQLQWKH*&WKDWZRXOGSUHYHQWWKH*&IURP
RSHUDWLQJ
*DXJHFRQWUROOHUGLVSOD\VDQGWKHQJRHVEODQN
7KLVLQGLFDWHVWKHSUHVVXUHLQWKHDQDO\]HUFKDPEHULVDERYH×_7RUU
‡
‡
‡
‡
‡
‡
‡
‡
6ROYHQWSHDNIURPDQRQFROXPQLQMHFWLRQ
06'KDVQRWKDGHQRXJKWLPHWRSXPSGRZQ
([FHVVLYHIRUHOLQHSUHVVXUH
%DGFRQQHFWLRQRUEDGFDEOHEHWZHHQWKHWULRGHJDXJHDQGJDXJHFRQWUROOHU
'LIIXVLRQSXPSIOXLGOHYHOLVORZRUIOXLGLVFRQWDPLQDWHG
7ULRGHJDXJHWXEHKDVIDLOHG
/LQHYROWDJHWRRORZ
7XUERPROHFXODUSXPSLVQRWZRUNLQJFRUUHFWO\
T˜˜˜˜p¤*dF’^pp›amV˜›^F˜
F’’¤F˜’©hz›ph’
3RZHULQGLFDWRURQWKHJDXJHFRQWUROOHUGRHVQRWOLJKW
‡ 8QSOXJJHGJDXJHFRQWUROOHUSRZHUFRUG
‡ ,QFRUUHFWRULQDGHTXDWHOLQHYROWDJHDWWKHHOHFWULFDORXWOHW
‡ )DLOHGJDXJHFRQWUROOHUIXVH
T˜˜˜˜p¤*dF’^pp›amV˜›^F˜
FhzF"›¤F˜’©hz›ph’
7HPSHUDWXUHV\PSWRPV
7KH06'KDVWKUHHKHDWHG]RQHV
‡ ,RQVRXUFHp¤4FLQWKH06'&KHP6WDWLRQVRIWZDUH
‡ 0DVVILOWHU¤"=LQWKH06'&KHP6WDWLRQVRIWZDUH
‡ *&06'LQWHUIDFH^Fh"d˜¤¨˜o¢LQWKH06'&KHP6WDWLRQVRIWZDUH
(DFKRIWKHVHKHDWHG]RQHVKDVDKHDWHUFDUWULGJHDQGWHPSHUDWXUHVHQVRU7KHLRQ
VRXUFHDQGPDVVILOWHUDUHSRZHUHGDQGFRQWUROOHGE\WKH06'7KH*&06'
LQWHUIDFHLVSRZHUHGDQGFRQWUROOHGE\WKH*&
,RQVRXUFHZLOOQRWKHDWXS
‡
‡
‡
‡
‡
‡
‡
‡
‡
+LJKYDFXXPSXPSLVRIIRUKDVQRWUHDFKHGQRUPDORSHUDWLQJFRQGLWLRQV
,QFRUUHFWWHPSHUDWXUHVHWSRLQW
,RQVRXUFHKDVQRWKDGHQRXJKWLPHWRUHDFKWHPSHUDWXUHVHWSRLQW
,RQVRXUFHKHDWHUFDUWULGJHLVQRWFRQQHFWHG
,RQVRXUFHWHPSHUDWXUHVHQVRULVQRWFRQQHFWHG
,RQVRXUFHKHDWHUIDLOHGEXUQHGRXWRUVKRUWHGWRJURXQG
,RQVRXUFHWHPSHUDWXUHVHQVRUIDLOHG
6RXUFHSRZHUFDEOHLVQRWFRQQHFWHGWRWKHVLGHERDUG
06'HOHFWURQLFVDUHQRWZRUNLQJFRUUHFWO\
7KHVHZLOOFDXVHDQ
T˜˜˜˜p¤*dF’^pp›amV˜›^F˜
FhzF"›¤F˜’©hz›ph’
0DVVILOWHUTXDGKHDWHUZLOOQRWKHDWXS
‡
‡
‡
‡
‡
‡
‡
‡
‡
+LJKYDFXXPSXPSLVRIIRUKDVQRWUHDFKHGQRUPDORSHUDWLQJFRQGLWLRQV
,QFRUUHFWWHPSHUDWXUHVHWSRLQW
0DVVILOWHUKDVQRWKDGHQRXJKWLPHWRUHDFKWHPSHUDWXUHVHWSRLQW
0DVVILOWHUKHDWHUFDUWULGJHLVQRWFRQQHFWHG
0DVVILOWHUWHPSHUDWXUHVHQVRULVQRWFRQQHFWHG
0DVVILOWHUKHDWHUIDLOHGEXUQHGRXWRUVKRUWHGWRJURXQG
0DVVILOWHUWHPSHUDWXUHVHQVRUIDLOHG
6RXUFHSRZHUFDEOHLVQRWFRQQHFWHGWRWKHVLGHERDUG
06'HOHFWURQLFVDUHQRWZRUNLQJFRUUHFWO\
7KHVHZLOOFDXVHDQHUURUPHVVDJH
*&06'LQWHUIDFHZLOOQRWKHDWXS
‡
‡
‡
‡
‡
‡
‡
‡
‡
,QFRUUHFWVHWSRLQW
6HWSRLQWHQWHUHGLQZURQJKHDWHG]RQH
*&06'LQWHUIDFHKDVQRWKDGHQRXJKWLPHWRUHDFKWHPSHUDWXUHVHWSRLQW
*&LVRII
*&H[SHULHQFHGDIDXOWDQGQHHGVWREHUHVHW
*&06'LQWHUIDFHKHDWHUVHQVRUFDEOHLVQRWFRQQHFWHG
*&06'KHDWHUIDLOHGEXUQHGRXW
*&06'VHQVRUIDLOHG
*&HOHFWURQLFVDUHQRWZRUNLQJFRUUHFWO\
7KHVHZLOOFDXVHD*&HUURUPHVVDJH*&HUURUPHVVDJHVDUHGHVFULEHGLQWKH
GRFXPHQWDWLRQVXSSOLHGZLWK\RXU*&
T˜˜˜˜p¤*dF’^pp›amV˜›^F˜
p˜hF’’"VF’
(UURUPHVVDJHV
6RPHWLPHVDSUREOHPLQ\RXU06'ZLOOFDXVHDQHUURUPHVVDJHWRDSSHDULQWKH
06'&KHP6WDWLRQVRIWZDUH6RPHHUURUPHVVDJHVDSSHDURQO\GXULQJWXQLQJ
2WKHUPHVVDJHVZLOODSSHDUGXULQJWXQLQJRUGDWDDFTXLVLWLRQ6RPHWLPHVLQVWHDG
RIDPHVVDJHRQO\DQXPEHUZLOODSSHDU7KLVQXPEHUZLOOUHSUHVHQWRQHRUPRUH
HUURUPHVVDJHV7RWUDQVODWHDQXPEHULQWRDQHUURUPHVVDJH
1RWHWKHQXPEHU
6HOHFWa"Vmp’›a4’—"4¤¤h˜pm›pdIURPWKH9LHZPHQX
6HOHFW˜p˜p=F’IURPWKH6WDWXVPHQX
7\SHLQWKHHUURUQXPEHUDQGSUHVVm›F
7KHFRUUHVSRQGLQJHUURUPHVVDJHVZLOODSSHDU
6RPHHUURUPHVVDJHVDUH§ODWFKHG¨7KHVHPHVVDJHVUHPDLQDFWLYHLQ\RXUGDWD
V\VWHPHYHQLIWKHFRQGLWLRQWKDWFDXVHGWKHPHVVDJHKDVFRUUHFWHGLWVHOI,IWKH
FDXVHLVUHPRYHGWKHVHPHVVDJHVFDQEHUHPRYHGE\FKHFNLQJLQVWUXPHQWVWDWXV
WKURXJKWKHGDWDV\VWHP
'LIILFXOW\LQPDVVILOWHUHOHFWURQLFV
‡
‡
‡
‡
‡
3UHVVXUHLQWKHDQDO\]HUFKDPEHULVWRRKLJK
5)3$LVQRWDGMXVWHGFRUUHFWO\
0DVVILOWHUTXDGFRQWDFWVDUHVKRUWHGRURWKHUZLVHQRWZRUNLQJFRUUHFWO\
0DVVILOWHULVQRWZRUNLQJFRUUHFWO\
06'HOHFWURQLFVDUHQRWZRUNLQJFRUUHFWO\
'LIILFXOW\ZLWKWKHHOHFWURQPXOWLSOLHUVXSSO\
‡ /DUJHSHDNVXFKDVWKHVROYHQWSHDNHOXWHGZKLOHWKHDQDO\]HUZDVRQ
‡ 3UHVVXUHLQWKHDQDO\]HUFKDPEHULVWRRKLJK
‡ 06'HOHFWURQLFVDUHQRWZRUNLQJFRUUHFWO\
T˜˜˜˜p¤*dF’^pp›amV˜›^F˜
p˜hF’’"VF’
'LIILFXOW\ZLWKWKHIDQ
,IDFRROLQJIDQIDXOWRFFXUVWKHYDFXXPFRQWUROHOHFWURQLFVDXWRPDWLFDOO\VKXWRII
WKHKLJKYDFXXPSXPSDQGWKHLRQVRXUFHDQGPDVVILOWHUKHDWHUV7KHUHIRUHWKH
PHVVDJH7KHV\VWHPLVLQYHQWVWDWHPD\DOVRDSSHDU,WLVLPSRUWDQWWRQRWHWKDW
HYHQWKRXJKWKHKLJKYDFXXPSXPSLVRIIWKHDQDO\]HUFKDPEHUPD\QRWDFWXDOO\
EHYHQWHG6HH7KHV\VWHPLVLQYHQWVWDWHLQWKLVVHFWLRQIRUSUHFDXWLRQVWRWDNH
‡ 2QHRIWKHIDQVLVGLVFRQQHFWHG
‡ 2QHRIWKHIDQVKDVIDLOHG
‡ 06'HOHFWURQLFVDUHQRWZRUNLQJFRUUHFWO\
'LIILFXOW\ZLWKWKH+('VXSSO\
7KHRQO\WLPHWKLVHUURURFFXUVLVLIWKHRXWSXWRIWKHVXSSO\FDQQRWJHWWRLWVGHV
WLQDWLRQWKH+('
‡ /DUJHSHDNVXFKDVWKHVROYHQWSHDNHOXWHGZKLOHWKHDQDO\]HUZDVRQ
‡ 3UHVVXUHLQWKHDQDO\]HUFKDPEHULVWRRKLJK
‡ 'HWHFWRULVQRWZRUNLQJFRUUHFWO\
‡ 06'HOHFWURQLFVDUHQRWZRUNLQJFRUUHFWO\
'LIILFXOW\ZLWKWKHKLJKYDFXXPSXPS
,QDQ06'HTXLSSHGZLWKDGLIIXVLRQSXPSWKLVLQGLFDWHVWKHGLIIXVLRQSXPS
EHFDPHWRRKRW,QDQ06'HTXLSSHGZLWKDWXUERPROHFXODUSXPSWKLVLQGLFDWHV
WKHSXPSIDLOHGWRUHDFKRIIXOOVSHHGZLWKLQPLQXWHVRUH[SHULHQFHGDIDXOW
<RXPXVWVZLWFKWKH06'RIIDQGEDFNRQWRUHPRYHWKLVHUURUPHVVDJH%HVXUH
WKHGLIIXVLRQSXPSKDVFRROHGRUWKHWXUERSXPSKDVVORZHGGRZQEHIRUHVZLWFK
LQJRIIWKH06'7KHPHVVDJHZLOOUHDSSHDULIWKHXQGHUO\LQJSUREOHPKDVQRW
EHHQFRUUHFWHG
'LIIXVLRQSXPS
‡
‡
‡
‡
‡
$LULQWDNHVWRWKHFRROLQJIDQDUHEORFNHG
/DERUDWRU\WHPSHUDWXUHLVWRRKLJKJHQHUDOO\DERYHƒ&
+LJKYDFXXPVLJQDOFDEOHLVGLVFRQQHFWHGRUQRWZRUNLQJFRUUHFWO\
'LIIXVLRQSXPSWHPSHUDWXUHVHQVRULVQRWZRUNLQJFRUUHFWO\
06'HOHFWURQLFVDUHQRWZRUNLQJFRUUHFWO\
T˜˜˜˜p¤*dF’^pp›amV˜›^F˜
p˜hF’’"VF’
7XUERPROHFXODUSXPS
‡
‡
‡
‡
‡
/DUJHYDFXXPOHDNLVSUHYHQWLQJWKHWXUERSXPSIURPUHDFKLQJRIIXOOVSHHG
)RUHOLQHSXPSLVQRWZRUNLQJFRUUHFWO\
7XUERSXPSLVQRWZRUNLQJFRUUHFWO\
7XUERSXPSFRQWUROOHULVQRWZRUNLQJFRUUHFWO\
06'HOHFWURQLFVDUHQRWZRUNLQJFRUUHFWO\
)RUHOLQHSUHVVXUHKDVH[FHHGHGP7RUU
2QO\GLIIXVLRQSXPSHTXLSSHG06'VKDYHDIRUHOLQHSUHVVXUHJDXJH
‡
‡
‡
‡
‡
‡
‡
([FHVVLYHFDUULHUJDVIORZW\SLFDOO\!POPLQ
([FHVVLYHVROYHQWYROXPHLQMHFWHG
/DUJHYDFXXPOHDN
6HYHUHO\GHJUDGHGIRUHOLQHSXPSRLO
&ROODSVHGRUNLQNHGIRUHOLQHKRVH
)RUHOLQHSXPSLVQRWZRUNLQJFRUUHFWO\
)RUHOLQHJDXJHLVQRWZRUNLQJFRUUHFWO\
,QWHUQDO06FRPPXQLFDWLRQIDXOW
‡ 06'HOHFWURQLFVDUHQRWZRUNLQJFRUUHFWO\
/HQVVXSSO\IDXOW
‡ (OHFWULFDOVKRUWLQWKHDQDO\]HU
‡ 06'HOHFWURQLFVDUHQRWZRUNLQJFRUUHFWO\
/RJDPSOLILHU$'&HUURU
‡ 06'HOHFWURQLFVDUHQRWZRUNLQJFRUUHFWO\
1RSHDNVIRXQG
‡
‡
‡
‡
(PLVVLRQFXUUHQWZDVVHWWR
(OHFWURQPXOWLSOLHUYROWDJHLVWRRORZ
$PXJDLQRURIIVHWLVWRRKLJK
3RRUPDVVD[LVFDOLEUDWLRQ
T˜˜˜˜p¤*dF’^pp›amV˜›^F˜
p˜hF’’"VF’
‡
‡
‡
‡
‡
‡
‡
‡
‡
‡
$PXJDLQRURIIVHWLVWRRKLJK
&DOLEUDWLRQYLDOLVHPSW\RUDOPRVWHPSW\
([FHVVLYHSUHVVXUHLQWKHDQDO\]HUFKDPEHU
$LUOHDN
(OHFWURQPXOWLSOLHUYROWDJHLVWRRORZ
6LJQDOFDEOHLVQRWFRQQHFWHG
(OHFWULFDOOHDGVWRWKHGHWHFWRUDUHQRWFRQQHFWHGFRUUHFWO\
+('SRZHUVXSSO\RXWSXWFDEOHIDLOHG
(OHFWULFDOOHDGVWRWKHLRQVRXUFHDUHQRWFRQQHFWHGFRUUHFWO\
)LODPHQWVKRUWHGWRWKHVRXUFHERG\
7HPSHUDWXUHFRQWUROGLVDEOHG
‡ 2QHRIWKHKHDWHUIXVHVKDVIDLOHG
‡ 06'HOHFWURQLFVDUHQRWZRUNLQJFRUUHFWO\
7HPSHUDWXUHFRQWUROIDXOW
7KLVLQGLFDWHVWKDWVRPHWKLQJKDVJRQHZURQJZLWKWKHWHPSHUDWXUHFRQWURORI
HLWKHUWKHLRQVRXUFHRUPDVVILOWHUTXDGKHDWHU7KHFDXVHFDQEHIXUWKHULVR
ODWHGE\VHOHFWLQJ›"›¤’—˜Fhz˜›d˜›"›¤’LQWKH'LDJQRVWLFV9DFXXP&RQWURO
YLHZ2QHRIWKHIROORZLQJVKRXOGEHGLVSOD\HGDVWKHFDXVH
‡
‡
‡
‡
‡
‡
‡
6RXUFHWHPSHUDWXUHVHQVRULVRSHQ
6RXUFHWHPSHUDWXUHVHQVRULVVKRUWHG
0DVVILOWHUTXDGWHPSHUDWXUHVHQVRULVRSHQ
0DVVILOWHUTXDGWHPSHUDWXUHVHQVRULVVKRUWHG
1RKHDWHUYROWDJHKHDWHUIXVHKDVSUREDEO\IDLOHG
+HDWHUYROWDJHLVWRRORZ
7HPSHUDWXUH]RQHKDVWLPHGRXWKHDWHUIDLOHGEDGKHDWHUZLULQJRUORRVH
WHPSHUDWXUHVHQVRU
‡ 3UREOHPZLWKWKHWHPSHUDWXUHFRQWUROHOHFWURQLFV
T˜˜˜˜p¤*dF’^pp›amV˜›^F˜
p˜hF’’"VF’
7KHKLJKYDFXXPSXPSLVQRWUHDG\
‡ 'LIIXVLRQSXPSLVRQEXWKDVQRWKDGHQRXJKWLPHPLQXWHVWRUHDFKLWV
QRUPDORSHUDWLQJWHPSHUDWXUH
‡ 7XUERPROHFXODUSXPSLVRQEXWKDVQRWKDGHQRXJKWLPHPLQXWHVWRUHDFK
RILWVQRUPDORSHUDWLQJVSHHG
‡ /HYHORIIOXLGLQWKHGLIIXVLRQSXPSLVWRRKLJK
‡ 'LIIXVLRQSXPSVWDFNLVQRWDOLJQHGFRUUHFWO\
‡ 7XUERPROHFXODUSXPSLVQRWZRUNLQJFRUUHFWO\
‡ 06'HOHFWURQLFVDUHQRWZRUNLQJFRUUHFWO\
7KHV\VWHPLVLQVWDQGE\
7KLVPHVVDJHLVWULJJHUHGE\DVKXWGRZQVLJQDORQWKHUHPRWHVWDUWFDEOH,WLVXVX
DOO\FDXVHGE\D*&IDXOWDQ$/6IDXOWRUDEDGFDEOHFRQQHFWLRQ2QFHWKHFDXVH
RIWKHIDXOWLVFRUUHFWHGVHOHFWLQJ˜RUFKHFNLQJ06'VWDWXVVKRXOGUHPRYH
WKHPHVVDJH
T˜˜˜˜p¤*dF’^pp›amV˜›^F˜
p˜hF’’"VF’
7KHV\VWHPLVLQYHQWVWDWH
$OWKRXJKWKHPHVVDJHVD\VWKHV\VWHPLVLQYHQWVWDWHLIWKHIDXOWKDVMXVWRFFXUUHG
WKH06'PD\DFWXDOO\VWLOOEHXQGHUYDFXXPDQGWKHGLIIXVLRQSXPSPD\VWLOOEH
KRWRUWKHWXUERSXPSPD\VWLOOEHDWKLJKVSHHG:DLWDWOHDVWPLQXWHVDIWHU
VHHLQJWKLVPHVVDJHEHIRUH\RXDFWXDOO\YHQWWKH06'
Fm›amV˜›^F˜˜›pp˜’ppm˜"O›F˜›^a’˜hF’’"VF˜"zzF"’˜4"m˜F’¤d›˜am˜›^F˜*"4c’›F"hamV˜pO˜
"˜=aOO¤’apm˜z¤hz˜p˜="h"VF˜›p˜"˜›¤*phpdF4¤d"˜z¤hz
‡ 6\VWHPZDVYHQWHGRQSXUSRVHQRSUREOHP
‡ )DQIDXOWKDVWXUQHGRIIWKHKLJKYDFXXPSXPSSRZHUF\FOHWKH06'WRFOHDU
WKHIDXOW
‡ )XVHIRUWKHKLJKYDFXXPSXPSKDVIDLOHG
‡ 'LIIXVLRQSXPSKHDWHUFDUWULGJHKDVIDLOHG
‡ 06'HOHFWURQLFVDUHQRWZRUNLQJFRUUHFWO\
7KHUHLVQRHPLVVLRQFXUUHQW
‡ )LODPHQWLVQRWFRQQHFWHGSURSHUO\7U\WKHRWKHUILODPHQW
‡ )LODPHQWKDVIDLOHG7U\WKHRWKHUILODPHQW
‡ 06'HOHFWURQLFVDUHQRWZRUNLQJFRUUHFWO\
7KHUHLVQRWHQRXJKVLJQDOWREHJLQWXQH
‡
‡
‡
‡
‡
‡
‡
‡
‡
‡
‡
&RUUXSWHGWXQHILOH
3RRUPDVVD[LVFDOLEUDWLRQ
$PXJDLQRURIIVHWLVWRRKLJK
&DOLEUDWLRQYLDOLVHPSW\RUDOPRVWHPSW\
([FHVVLYHSUHVVXUHLQWKHDQDO\]HUFKDPEHU
$LUOHDN
(OHFWURQPXOWLSOLHUYROWDJHLVWRRORZ
6LJQDOFDEOHLVQRWFRQQHFWHG
(OHFWULFDOOHDGVWRWKHGHWHFWRUDUHQRWFRQQHFWHGFRUUHFWO\
(OHFWULFDOOHDGVWRWKHLRQVRXUFHDUHQRWFRQQHFWHGFRUUHFWO\
)LODPHQWVKRUWHGWRWKHVRXUFHERG\
T˜˜˜˜p¤*dF’^pp›amV˜›^F˜
a˜dF"c’
$LUOHDNV
$LUOHDNVDUHDSUREOHPIRUDQ\LQVWUXPHQWWKDWUHTXLUHVDYDFXXPWRRSHUDWH
/HDNVDUHJHQHUDOO\FDXVHGE\YDFXXPVHDOVWKDWDUHGDPDJHGRUQRWIDVWHQHGFRU
UHFWO\6\PSWRPVRIOHDNVLQFOXGH
‡
‡
‡
‡
‡
+LJKHUWKDQQRUPDODQDO\]HUFKDPEHUSUHVVXUHRUIRUHOLQHSUHVVXUH
+LJKHUWKDQQRUPDOEDFNJURXQG
3HDNVFKDUDFWHULVWLFRIDLUP]DQGRUP]DQG
3RRUVHQVLWLYLW\
/RZUHODWLYHDEXQGDQFHRIP]WKLVYDULHVZLWKWKHWXQHSURJUDPXVHG
/HDNVFDQRFFXULQHLWKHUWKH*&RUWKH06'7KHPRVWOLNHO\SRLQWIRUDQDLUOHDN
LVDVHDO\RXUHFHQWO\RSHQHG
,QWKH*&PRVWOHDNVRFFXULQ
‡ ,QMHFWLRQSRUWVHSWXP
‡ ,QMHFWLRQSRUWFROXPQQXW
‡ %URNHQRUFUDFNHGFDSLOODU\FROXPQ
/HDNVFDQRFFXULQPDQ\PRUHSODFHVLQWKH06'
‡
‡
‡
‡
‡
‡
‡
‡
‡
‡
*&06'LQWHUIDFHFROXPQQXW
6LGHSODWH2ULQJDOOWKHZD\DURXQG
9HQWYDOYH2ULQJ
7ULRGHJDXJHWXEHFUDFNHGDWFRQQHFWRU
&DOLEUDWLRQYDOYH
*&06'LQWHUIDFH2ULQJZKHUHWKHLQWHUIDFHDWWDFKHVWRWKHDQDO\]HU
FKDPEHU
)URQWDQGUHDUHQGSODWH2ULQJV
'LIIXVLRQSXPS.)VHDO
'LIIXVLRQSXPSEDIIOHDGDSWHU2ULQJ
7XUERPROHFXODUSXPS2ULQJ
T˜˜˜˜p¤*dF’^pp›amV˜›^F˜
pm›"ham"›apm
&RQWDPLQDWLRQ
&RQWDPLQDWLRQLVXVXDOO\LGHQWLILHGE\H[FHVVLYHEDFNJURXQGLQWKHPDVVVSHFWUD
,WFDQFRPHIURPWKH*&RUIURPWKH06'7KHVRXUFHRIWKHFRQWDPLQDWLRQFDQ
VRPHWLPHVEHGHWHUPLQHGE\LGHQWLI\LQJWKHFRQWDPLQDQWV6RPHFRQWDPLQDQWV
DUHPXFKPRUHOLNHO\WRRULJLQDWHLQWKH*&2WKHUVDUHPRUHOLNHO\WRRULJLQDWHLQ
WKH06'
&RQWDPLQDWLRQRULJLQDWLQJLQWKH*&W\SLFDOO\FRPHVIURPRQHRIWKHVHVRXUFHV
‡
‡
‡
‡
‡
‡
‡
&ROXPQRUVHSWXPEOHHG
'LUW\LQMHFWLRQSRUW
,QMHFWLRQSRUWOLQHU
&RQWDPLQDWHGV\ULQJH
3RRUTXDOLW\FDUULHUJDV
'LUW\FDUULHUJDVWXELQJ
)LQJHUSULQWVLPSURSHUKDQGOLQJRIFOHDQSDUWV
&RQWDPLQDWLRQRULJLQDWLQJLQWKH06'W\SLFDOO\FRPHVIURPRQHRIWKHIROORZLQJ
VRXUFHV
‡
‡
‡
‡
‡
$LUOHDN
&OHDQLQJVROYHQWVDQGPDWHULDOV
'LIIXVLRQSXPSIOXLG
)RUHOLQHSXPSRLO
)LQJHUSULQWVLPSURSHUKDQGOLQJRIFOHDQSDUWV
7KHIROORZLQJWDEOHOLVWVVRPHRIWKHPRUHFRPPRQFRQWDPLQDQWVWKHLRQVFKDUDF
WHULVWLFRIWKRVHFRQWDPLQDQWVDQGWKHOLNHO\VRXUFHVRIWKRVHFRQWDPLQDQWV
T˜˜˜˜p¤*dF’^pp›amV˜›^F˜
pm›"ham"›apm
"*dF˜
phhpm˜4pm›"ham"m›’˜
pm’˜|h—«}
phzp¤m=
p’’a*dF˜’p¤4F
sG:˜¢G:˜¢:˜TT˜p˜sT:˜s–
¢¬:˜¢:˜¢:˜¢˜p˜:˜
F’a=¤"d˜"a˜"m=˜§"›F:˜"a˜
dF"c’:˜p¤›V"’’amV˜Oph˜F’zFd˜
OF¤dF’
s:˜Qs:˜–n:˜s¬¬:˜ssn:˜ss:
s–n:˜sGs:˜¢sT:˜¢sn:˜¢–T:˜•–:˜
TsT:˜T¢–:˜T–T:˜Q¬¢:˜Q•–:˜–sT
˜"m=˜Fd"›F=˜apm’
˜|›¤mamV˜4phzp¤m=}˜
s
F›^"mpd
dF"mamV˜’pd¦Fm›
T:˜QG
4F›pmF
dF"mamV˜’pd¦Fm›
•G
Fm«FmF
dF"mamV˜’pd¦Fm›
ns:˜n¢˜
pd¤FmF˜p˜¨©dFmF
dF"mamV˜’pd¦Fm›
s¬Q:˜s¬–
©dFmF˜
dF"mamV˜’pd¦Fm›
sQs:˜sQ
a4^dppF›^"mF
dF"mamV˜’pd¦Fm›
–n
pFdamF˜z¤hz˜pad˜p˜
pFdamF˜z¤hz˜pad˜¦"zp˜p˜
4"da*"›apm˜¦"d¦F˜dF"c
•:˜sT•:˜¢¬•:˜¢¢s:˜¢Gs:˜¢nQ:˜
QQ:˜T¢n
ahF›^©dzpd©’adp¨"mF
Fz›¤h˜*dFF=˜p˜hF›^©d˜
’ada4pmF˜4pd¤hm˜*dFF=
••:˜nT:˜ssQ:˜sTs:˜s–G:˜s•¬:
¢–¢:˜QT:˜TT–
aOO¤’apm˜z¤hz˜Od¤a=˜"m=
Fd"›F=˜apm’
aOO¤’apm˜z¤hz˜Od¤a=
sTn
d"’›a4a«F˜|z^›^"d"›F’}
"4¤¤h˜’F"d’˜|_amV’}˜="h"V_˜
F=˜*©˜^aV^˜›FhzF"›¤F’:˜¦am©d˜
Vdp¦F’
F"c’˜’z"4F=˜sT˜"h¤˜"z"›
©=p4"*pm’
amVFzam›’:˜OpFdamF˜z¤hz˜pad
5
Common CI-specific problems, 122
Air leaks, 124
Pressure-related symptoms (overview), 128
Poor vacuum without reagent gas flow, 129
High pressure with reagent gas flow, 130
Pressure does not change when reagent flow is changed, 131
Signal-related symptoms (overview), 132
No peaks, 133
No or low reagent gas signal, 135
No or low PFDTD signal, but reagent ions are normal, 138
Excessive noise or low signal-to-noise ratio, 140
Large peak at m/z 19, 141
Peak at m/z 32, 142
Tuning-related symptoms (overview), 144
Reagent gas ion ratio is difficult to adjust or unstable, 145
High electron multiplier voltage, 147
Can not complete autotune, 148
Peak widths are unstable, 149
CI Troubleshooting
Troubleshooting
This chapter outlines the troubleshooting of 5973N MSDs equipped with
PCI/NCI. Most of the troubleshooting information in the previous chapter
also applies to CI MSDs.
Common CI-specific problems
Because of the added complexity of the parts required for CI, there are many
potential problems added. By far the greatest number and most serious
problems with CI are associated with leaks or contamination in the reagent
gas introduction system. NCI is especially sensitive to the presence of air,
and air leaks small enough to cause no problems in PCI can destroy NCI
sensitivity.
As with EI, if the MSD tunes well, and no air leak is present, sample
sensitivity problems should be addressed by GC injection port maintenance
first.
• Wrong reagent gas
• Reagent gas not hooked up or hooked up to wrong reagent gas inlet port
• Wrong ions entered in tune file
• Wrong tune file selected
• Not enough bake-out time has elapsed since vent (background is too
high)
• Wrong column positioning (extending > 2 mm past tip of interface.)
• Interface tip seal not installed
• EI source installed in CI mode
• EI filament or other EI source parts in CI ion source
• Air leaks in reagent gas flow path
• CI filament has stretched and sagged:
High EMV
Linear (no inflection point) electron energy (EleEnergy) ramp.
122
Q˜˜˜˜˜p¤*dF’^pp›amV
p¤*dF’^pp›amV˜›az’˜"m=˜›a4c’
Troubleshooting tips and tricks
The following are general rules for troubleshooting, with specific CI examples.
Rule 1: “Look for what has been changed.”
Many problems are introduced accidentally by human actions. Every time
any system is disturbed, there is a chance of introducing a new problem.
• If the MSD was just pumped down after maintenance, suspect air leaks or
incorrect assembly.
• If the reagent gas bottle or gas purifier were just changed, suspect leaks or
contaminated or incorrect gas.
• If the GC column was just replaced, suspect air leaks or contaminated or
bleeding column.
• If you have just switched ion polarity or reagent gas, suspect the tune file you
have loaded in memory. Is it the appropriate file for your mode of operation?
Rule 2: “If complex isn’t working, go back to simple.”
A complex task is not only more difficult to perform, but also more difficult
to troubleshoot as well. For example, CI requires more parts to work
correctly than EI does.
• If you’re having trouble with NCI, verify that PCI still works.
• If you’re having trouble with other reagent gases, verify that methane still works.
• If you’re having trouble with CI, verify that EI still works.
Rule 3: “Divide and conquer.”
This technique is known as “half-split” troubleshooting. If you can isolate the
problem to only part of the system, it is much easier to locate.
• To isolate an air leak, start by shutting the gas select valve while leaving the
isolation valve and MFC open (turn on ¤VF and "’˜OO.) If abundance of m/z
32 decreases, the problem is “upstream” of the flow module.
123
Q˜˜˜˜˜p¤*dF’^pp›amV
a˜dF"c’
Air leaks
How do I know if I have an air leak?
Large air leaks can be detected by vacuum symptoms: loud gurgling noise from
the foreline pump, inability of the turbo pump to reach 95% speed, or, in the case
of smaller leaks, high pressure readings on the high vacuum gauge controller.
Note that the mass flow controller is calibrated for methane, and the high vacuum
gauge controller is calibrated for nitrogen, so these measurements are not accurate in absolute terms, but are intended as a guide to typical observed readings.
They were taken with the following set of conditions:
p¤4F˜›FhzF"›¤F
¤"=˜›FhzF"›¤F
m›FO"4F˜›FhzF"›¤F
Fda¤h˜4pd¤hm˜Odp§
˜|~}
F’’¤F˜|p}
F›^"mF
s¬
sQ
¢¬
¢Q
¬
Q
T¬
¢Q¬@
sQ¬@
¢¬@
shd—ham
FOph"m4F˜
›¤*p˜z¤hz
QQ˜× s¬ JQ
G¬˜× s¬ JQ
s¬˜× s¬ JT
s¢˜× s¬ JT
sQ× s¬ JT
¢¬˜× s¬ JT
¢Q˜× s¬ JT
hhpma"
›"m="=˜
FOph"m4F˜
›¤*p˜z¤hz
›¤*p˜z¤hz
JT
¢¬˜× s¬
Q¬˜× s¬ JQ
JT
¢Q˜× s¬
•¬˜× s¬ JQ
¬× s¬ JT
GQ˜× s¬ JQ
p›˜F4phhFm=F=
s¬˜× s¬ JT
p›˜F4phhFm=F=
s¢˜× s¬ JT
p›˜F4phhFm=F=
sQ˜× s¬ JT
p›˜F4phhFm=F=
¢¬˜× s¬ JT
›"m="=˜›¤*p˜z¤hz
sQ˜× s¬ JT
¢¬˜× s¬ JT
¬˜× s¬ JT
p›˜F4phhFm=F=
p›˜F4phhFm=F=
p›˜F4phhFm=F=
p›˜F4phhFm=F=
Familiarize yourself with the measurements on your system under operating conditions, and watch for changes that may indicate a vacuum or gas flow problem.
124
Q˜˜˜˜˜p¤*dF’^pp›amV
a˜dF"c’
Always look for small air leaks when setting up methane flow. Run the methane
pretune (starting with a good PCI tune file). The abundance of m/z 19 (protonated
water) should be less 50% of m/z 17 for acceptable PCI performance; for NCI, the
abundance of m/z 19 (protonated water) should be less than 25% that of m/z 17. If
the MSD was just pumped down, look for the abundance of m/z 19 to be decreasing.
There should not be any peak visible at m/z 32 (O2). This almost always indicates
an air leak.
zF4a"d˜mFV"›a¦F˜˜
mp›F’
Since NCI is so extremely sensitive, air leaks that are not detectable in EI or PCI
can cause sensitivity problems in NCI. To check for this kind of air leak in NCI,
inject OFN. The base peak should be at m/z 272. If the abundance of m/z 238 is
much greater than that of m/z 272, you have an air leak.
125
Q˜˜˜˜˜p¤*dF’^pp›amV
a˜dF"c’
How do I find the air leak?
1 Look for the last seal that was disturbed.
• If you just pumped down the MSD, press on the sideplate to check for proper
seal. Poor alignment between the analyzer and the GC/MSD interface seal can
prevent the sideplate from sealing.
• If you just replaced the reagent gas bottle or gas purifier, check the fittings you
just opened and refastened.
2 Check for tightness of seals at injection port and interface column nuts.
Ferrules for capillary columns often loosen after several heat cycles. Do not overtighten the interface nut.
3 If any of the VCR fittings in the flow module have been loosened and then
retightened, the gasket must be replaced. These gaskets are good for one
use only.
p˜mp›˜dpp’Fm˜›^F˜m¤›’˜pm˜"m©˜˜Oa››amV’˜¤mdF’’˜©p¤˜am›Fm=˜›p˜Fzd"4F˜›^F˜V"’cF›’˜
›^F§a’F:˜©p¤˜§add˜4F"›F˜"m˜"a˜dF"c
4 Remember that most small air leaks visible in CI mode are located in either
the carrier gas or reagent gas flow paths.
Leaks into the analyzer chamber are not likely to be seen in CI because of the
higher pressure inside the ionization chamber.
5 Half-split the system.
• By closing valves starting at the gas select valves (
"’˜OO and ¤VF turned on),
then moving farther “downstream” to the isolation valve (
"’˜OO turned on and
¤VF turned off.)
• You can cool and vent the MSD, remove the GC column, and cap off the interface.
If you are used to using argon or other introduced gas to find air leaks, note that
this does not work well for the reagent gas flow system — it takes as long as 15
minutes for the peak to reach the ion source if the leak is at the inlet to the flow
module.
126
Q˜˜˜˜˜p¤*dF’^pp›amV
a˜dF"c’
4^Fh"›a4˜pO˜˜Odp§˜
4pm›pd˜hp=¤dF
CI ion
source
Green
light
Gas A
(Methane)
supply
Isolation
valve
Gas select
valve A
Mass
Flow
Controller
Gas select
valve B
Gas B
(Other gas)
supply
EI/CI
GC/MSD
interface
Calibration
valve
Amber
light
Restrictor
PFDTD
vial
GC column
dp§˜hp=¤dF˜’›"›F˜=a"V"h9
F’¤d›
"’˜˜Odp§’
"’˜˜Odp§’
¤VF˜
§a›^˜
"’˜˜
¤VF˜
§a›^˜
"’˜˜
¤hz˜p¤›
Odp§˜hp=¤dF
›"m=*©:˜¦Fm›F=:˜
p˜˜hp=F
m
OO
m
OO
OO
OO
"’˜˜|"h*F} OO
m
OO
m
OO
OO
¤VF˜|F=}
OO
OO
m
m
m
OO
"’˜OO˜|F=}
OO˜
OO˜
OO˜
OO˜
m
m
"d¦F˜
zFm
dp’F=
zFm
dp’F=
dp’F=
dp’F=
"d¦F˜
dp’F=
zFm
dp’F=
zFm
dp’F=
dp’F=
m˜→˜’F›zpam›
m˜→˜’F›zpam›
m˜→˜s¬¬~
m˜→˜s¬¬~
m˜→˜s¬¬~
OO˜|→¬~}
zFm
zFm
zFm
zFm
dp’F=
pm›pd˜z"mFd˜daV^›’˜|’}
"’˜˜|VFFm}
"d¦F˜’›"›F
’pd"›apm˜¦"d¦F zFm
127
Q˜˜˜˜˜p¤*dF’^pp›amV
F’’¤F_Fd"›F=˜’©hz›ph’˜|p¦F¦aF§}
Pressure-related symptoms (overview)
The following symptoms are all related to high vacuum pressure. Each symptom is
discussed in more detail in the following pages.
The mass flow controller is calibrated for methane, and the high vacuum gauge
controller is calibrated for nitrogen, so these measurements are not accurate in
absolute terms, They are intended as a guide to typical observed readings. They
were taken with the following set of conditions:
p¤4F˜›FhzF"›¤F
¤"=˜›FhzF"›¤F
m›FO"4F˜›FhzF"›¤F
Fda¤h˜4"aF˜V"’˜Odp§
˜|~}
¢Q¬@
sQ¬@
¢¬@
shd—ham
F’’¤F˜|p}
F›^"mF
s¬
sQ
¢¬
¢Q
¬
Q
T¬
128
FOph"m4F˜
›¤*p˜z¤hz
QQ˜× s¬ JQ
G¬˜× s¬ JQ
s¬˜× s¬ JT
s¢˜× s¬ JT
sQ× s¬ JT
¢¬˜× s¬ JT
¢Q˜× s¬ JT
hhpma"
›"m="=˜
›¤*p˜z¤hz
¢¬˜× s¬ JT
¢Q˜× s¬ JT
¬× s¬ JT
T¬˜× s¬ JT
Q¬˜× s¬ JT
QQ˜× s¬ JT
–Q˜× s¬ JT
FOph"m4F˜
›¤*p˜z¤hz
Q¬˜× s¬ JQ
•¬˜× s¬ JQ
GQ˜× s¬ JQ
s¬˜× s¬ JT
s¢˜× s¬ JT
sQ˜× s¬ JT
¢¬˜× s¬ JT
›"m="=˜›¤*p˜
z¤hz
sQ˜× s¬ JT
¢¬˜× s¬ JT
¬˜× s¬ JT
Q˜× s¬ JT
T¬˜× s¬ JT
TQ˜× s¬ JT
QQ˜× s¬ J_T
Q˜˜˜˜˜p¤*dF’^pp›amV
pp˜¦"4¤¤h˜§a›^p¤›˜F"VFm›˜V"’˜Odp§
Poor vacuum without reagent gas flow
p’’a*dF˜"¤’F
Excess water in the background.
4›apm
Scan from 10 – 40 amu. A large peak at m/z 19 (> m/z 17) indicates water in the
background. If water is present, allow the instrument to bake out more and flow
reagent gas through the lines to purge any accumulated water.
p’’a*dF˜"¤’F
Air leak.
4›apm
Run Methane Pretune. See page 76. A visible peak at m/z 32 indicates air in the
system. Check for and correct any leaks. See the Leaks section at the beginning of
this chapter.
p’’a*dF˜"¤’F
The foreline pump is not working properly.
4›apm
Replace the pump oil. If that does not help, it may be necessary to replace the
pump. Contact your local Agilent Technologies Customer Engineer.
p’’a*dF˜"¤’F
The turbo pump is not working properly.
4›apm
Check the pump speed. It should be at least 95%. Contact your local Agilent Technologies service representative
’F˜pO˜"hhpma"˜"’˜F"VFm›˜V"’˜4"m˜’^p›Fm˜›^F˜daOF˜pO˜›^F˜OpFdamF˜z¤hz˜pad˜"m=˜zp’’a*d©˜
pO˜›^F˜OpFdamF˜z¤hz˜a›’FdO˜FF˜›^F˜"am›Fm"m4F˜4^"z›F˜am˜›^a’˜h"m¤"d
129
Q˜˜˜˜˜p¤*dF’^pp›amV
aV^˜zF’’¤F˜§a›^˜F"VFm›˜V"’˜Odp§
High pressure with reagent gas flow
p’’a*dF˜"¤’F
The reagent gas flow rate is too high.
4›apm
On the flow controller, turn down reagent gas flow as appropriate. Verify that
reagent ion ratios are correct. See page 76.
p’’a*dF˜"¤’F
Air leak.
4›apm
Run Methane Pretune. See page 76. Visible peak at m/z 32 indicates air in the system. Check for and correct any leaks. See the Leaks section at the beginning of
this chapter.
p’’a*dF˜"¤’F
Interface tip seal wasn’t installed.
4›apm
Check the source storage box. If the seal is not in the box, vent the MSD and verify
that the seal is correctly installed.
130
Q˜˜˜˜˜p¤*dF’^pp›amV
F’’¤F˜=pF’˜mp›˜4^"mVF˜§^Fm˜F"VFm›˜Odp§˜a’˜4^"mVF=
Pressure does not change when reagent flow is changed
p’’a*dF˜"¤’F
The reagent gas regulator is closed.
4›apm
Check and, if necessary, open the reagent gas regulator.
p’’a*dF˜"¤’F
The reagent gas regulator is set to the wrong pressure.
4›apm
Set the reagent gas regulator to 10 psi (70 kPa) for methane or to 3 – 10 psi
(20 – 70 kPa) for isobutane or ammonia.
p’’a*dF˜"¤’F
The valve on the reagent gas bottle is closed.
4›apm
Check and, if necessary, open the valve on the reagent gas bottle.
p’’a*dF˜"¤’F
The reagent gas supply is empty.
4›apm
Check, and if necessary, replace the reagent gas supply.
p’’a*dF˜"¤’F
Reagent lines kinked, bent, pinched, or disconnected.
4›apm
Inspect the reagent lines and repair any defects. Check especially to make sure the
reagent line is connected to the rear of the flow module. Be sure the methane line
is connected to the Gas A inlet.
p’’a*dF˜"¤’F
GC/MSD interface clogged or damaged.
4›apm
Check for flow and repair or replace components as indicated.
131
Q˜˜˜˜˜p¤*dF’^pp›amV
aVm"d_Fd"›F=˜’©hz›ph’˜|p¦F¦aF§}
Signal-related symptoms (overview)
This section describes symptoms related to the signal. The symptom may be too
much signal, too little signal, a noisy signal, or an incorrect signal. Signal-related
symptoms are generally observed during tuning but may also be observed during
data acquisition.
Error messages in autotune due to insufficient signal may vary.
The following symptoms are covered in more detail in this section:
•
•
•
•
•
•
•
•
No peaks
No or low reagent gas signal. See page 135.
No or low PFDTD signal. See page 138.
Excessive noise. See page 140.
Low chromatographic signal abundance. See page 140.
Low signal-to-noise ratio. See page 140.
Large peak at m/z 19. See page 141.
Peak at m/z 32. See page 142.
132
Q˜˜˜˜˜p¤*dF’^pp›amV
p˜zF"c’
No peaks
When troubleshooting “no peaks” it is important to specify what mode of operation
is being used, and what kind of peaks are not being seen. Always start with methane PCI and verify presence of reagent ions.
No reagent gas peaks in PCI
If MSD has been working well and nothing seems to have been changed
• Wrong tune file loaded, or tune file corrupted
• Wrong ion polarity (there are no reagent ions visible in NCI)
• No reagent gas flow; look for background ions and check pressure
• Wrong reagent gas selected for the tune file (looking for wrong ions)
• Large air leak
• Dirty ion source
• Poor vacuum (pump problem). See page 128.
If MSD was recently switched from EI to CI
• Interface tip seal not installed
• No reagent gas flow
• Analyzer not sealed (big air leak)
• Wrong tune file loaded or tune file corrupted
• Ion source not assembled or connected correctly
• Wrong reagent gas selected for the tune file (looking for wrong ions)
133
Q˜˜˜˜˜p¤*dF’^pp›amV
p˜zF"c’
No PFDTD peaks in PCI
• Incorrect reagent gas. There are no PCI PFDTD peaks created with isobutane
or ammonia. Switch to methane.
• Analyzer not sealed (big air leak)
• No calibrant in vial
• Defective calibration valve
• Air leak in carrier or reagent gas path
No reagent gas peaks in NCI
• Reagent gases do not ionize in NCI; look for background ions instead.
• Verify tune parameters
• If no background ions are visible, go back to methane PCI
No PFDTD calibrant peaks in NCI
• Look for background ions: 17 (OH-), 35 (Cl-), and 235 (ReO3-).
• Verify tune parameters
• Go back to methane PCI
No sample peaks in NCI
• Look for background ions: 17 (OH-), 35 (Cl-), and 235 (ReO3-).
• Go back to methane PCI
• Poor quality reagent gas (purity less than 99.99%)
Large peak at m/z 238 in NCI OFN spectrum
• Look for background ions: 17 (OH-), 35 (Cl-), and 235 (ReO3-).
• Find and fix your small air leak
134
Q˜˜˜˜˜p¤*dF’^pp›amV
p˜p˜dp§˜F"VFm›˜V"’˜’aVm"d
No or low reagent gas signal
p’’a*dF˜"¤’F
If you have just installed the CI ion source, and have an air leak or large amounts of
water in the system, and have run one or more autotunes, the ion source is probably dirty now.
4›apm
Fix the air leak.
Clean the ion source. Then bake out for two hours before tuning. See “To set up
your MSD for CI operation” on page 247..
p’’a*dF˜"¤’F
The wrong reagent gas is flowing.
4›apm
Turn on the correct reagent gas for your tune file.
p’’a*dF˜"¤’F
Ion polarity is set to FV"›a¦F. No reagent gas ions are formed in NCI.
4›apm
Switch to p’a›a¦F ionization mode.
p’’a*dF˜"¤’F
The reagent gas flow is set too low.
4›apm
Increase the reagent gas flow.
p’’a*dF˜"¤’F
Reagent gas supply tubing is blocked, kinked, pinched, or disconnected.
4›apm
Inspect and, if necessary, repair or replace the reagent gas supply tubing.
p’’a*dF˜"¤’F
Wrong filament wires are connected to filament.
4›apm
Make sure that the filament 1 wires are connected to the CI ion source filament
and that the filament 2 wires are connected to the dummy filament.
135
Q˜˜˜˜˜p¤*dF’^pp›amV
p˜p˜dp§˜F"VFm›˜V"’˜’aVm"d
p’’a*dF˜"¤’F
Carbon has built up on the filament, or filament has sagged out of alignment.
4›apm
Inspect the filament. If necessary, replace the filament.
p’’a*dF˜"¤’F
Too much air or water in the system.
4›apm
Run the methane pretune. Peaks at m/z 32 and 19 usually indicate air and water,
respectively. Bake out and purge the instrument until there is no visible peak at
m/z 32 and the peak at m/z 19 is reduced to a very low level. If the peak at m/z 32
does not decrease, an air leak is likely. See the Leaks section at the end of this
chapter for more information.
p’’a*dF˜"¤’F
The signal cable is not connected.
4›apm
Check and, if necessary, reconnect the signal cable.
p’’a*dF˜"¤’F
The filament or filament support is shorted to the ion source body or repeller.
4›apm
Inspect the filament. If necessary, realign the filament support arms.
p’’a*dF˜"¤’F
The electron inlet hole is blocked.
4›apm
Inspect the electron inlet hole. If necessary, clean the hole with a clean toothpick
and a slurry of aluminum oxide powder and methanol. If the electron inlet hole is
that dirty, the entire ion source probably needs to be cleaned. See the Maintenance chapter in this manual for more information.
p’’a*dF˜"¤’F
Ion source wires are not connected, or incorrectly connected.
4›apm
Inspect the repeller. Make sure the repeller lead is firmly attached to the repeller.
Inspect the wires to the ion focus and entrance lenses. If the connections are
reversed, correct the problem.
136
Q˜˜˜˜˜p¤*dF’^pp›amV
p˜p˜dp§˜F"VFm›˜V"’˜’aVm"d
p’’a*dF˜"¤’F
One of the detector leads (in the analyzer chamber) is not connected.
4›apm
Check and, if necessary, reconnect the electron multiplier leads.
p’’a*dF˜"¤’F
Saturated methane / isobutane gas purifier.
4›apm
Replace the gas purifier.
p’’a*dF˜"¤’F
Poor quality methane (purity below 99.99%.)
4›apm
Replace the methane with high-purity methane. If necessary, clean and purge the
reagent gas lines and clean the ion source.
137
Q˜˜˜˜˜p¤*dF’^pp›amV
p˜p˜dp§˜˜’aVm"d:˜*¤›˜F"VFm›˜apm’˜"F˜mph"d
No or low PFDTD signal, but reagent ions are normal
p’’a*dF˜"¤’F
You are flowing any reagent gas but methane in PCI.
4›apm
Switch to methane.
p’’a*dF˜"¤’F
Wrong or corrupted tune file loaded.
4›apm
Check your tune file.
p’’a*dF˜"¤’F
No PFDTD in the calibrant vial.
4›apm
Inspect the calibration vial on the back of the flow controller. If necessary, fill the
vial with PFDTD. Do not fill the vial completely; keep the level at least 0.5 cm from
the top of the vial.
p’’a*dF˜"¤’F
The pressure of the methane entering the flow controller is too high.
4›apm
Make sure the regulator on the methane supply is set to 10 psig (70 kPa).
p’’a*dF˜"¤’F
The CI ion source is dirty.
4›apm
Clean the ion source. See the Maintenance chapter in this manual for more information.
p’’a*dF˜"¤’F
The calibration valve was not purged after the vial was refilled.
4›apm
Purge the calibration valve as described in the Maintenance chapter. Then clean
the ion source.
138
Q˜˜˜˜˜p¤*dF’^pp›amV
p˜p˜dp§˜˜’aVm"d:˜*¤›˜F"VFm›˜apm’˜"F˜mph"d
p’’a*dF˜"¤’F
The calibrant vial was overfilled. Excess PFDTD can quench the chemical ionization reactions.
4›apm
Check the level of the PFDTD in the calibration vial as described in Maintenance
chapter.
p’’a*dF˜"¤’F
Poor quality methane (purity below 99.99%.)
4›apm
Replace the methane with high-purity methane. If necessary, clean and purge the
reagent gas lines and clean the ion source.
139
Q˜˜˜˜˜p¤*dF’^pp›amV
¨4F’’a¦F˜mpa’F˜p˜dp§˜’aVm"d_›p_mpa’F˜"›ap
Excessive noise or low signal-to-noise ratio
p’’a*dF˜"¤’F
The GC injection port needs maintenance.
4›apm
Refer to the 6890 Plus GC manual.
p’’a*dF˜"¤’F
The CI ion source is dirty.
4›apm
Clean the ion source. See the Maintenance chapter in this manual for more information.
p’’a*dF˜"¤’F
Poor vacuum
4›apm
Check the pressure on the high vacuum gauge controller.
p’’a*dF˜"¤’F
Air leak.
4›apm
Run Methane Pretune (in PCI). Large peak at m/z 32 indicates air in the system.
Check for and correct any leaks. See the Leaks section at the beginning of this
chapter.
p’’a*dF˜"¤’F
Saturated methane / isobutane gas purifier.
4›apm
Replace the gas purifier.
p’’a*dF˜"¤’F
Poor quality methane (purity below 99.99%.)
4›apm
Replace the methane with high-purity methane. If necessary, clean and purge the
reagent gas lines and clean the ion source.
p’’a*dF˜"¤’F
Reagent gas flows too high (in EI/PCI MSDs).
4›apm
Verify that the reagent gas setup is correct.
140
Q˜˜˜˜˜p¤*dF’^pp›amV
"VF˜zF"c˜"›˜h—«˜sn
Large peak at m/z 19
If the abundance of the peak at m/z 19 is more than half abundance of the peak at
m/z 17, then there is probably too much water in the system.
p’’a*dF˜"¤’F
The system was not baked out sufficiently after it was last vented.
4›apm
Bake out the system as described in the Maintenance chapter of this manual.
p’’a*dF˜"¤’F
Moisture left over in the reagent gas supply tubing and flow module.
4›apm
Purge the reagent gas supply lines for at least 60 minutes. See the Maintenance
chapter.
p’’a*dF˜"¤’F
Contaminated reagent gas supply.
4›apm
Replace the reagent gas supply and purge the lines and flow module.
p’’a*dF˜"¤’F
Saturated methane / isobutane gas purifier.
4›apm
Replace the gas purifier.
141
Q˜˜˜˜˜p¤*dF’^pp›amV
F"c˜"›˜h—«˜¢
Peak at m/z 32
A visible peak at m/z 32 in methane pretune often indicates air in the system.
p’’a*dF˜"¤’F
Residual air from recent venting — check for water indicated by a large peak at
m/z 19.
4›apm
Bake out the system as described in the Maintenance chapter of this manual.
p’’a*dF˜"¤’F
New or dirty reagent gas supply tubing.
4›apm
Purge the reagent gas supply lines and flow module for at least 60 minutes. See
“To set up your MSD for CI operation” on page 247..
p’’a*dF˜"¤’F
Air leak.
4›apm
Check for leaks and correct any that you find. See the Leaks section at the end of
this chapter for more information. After all leaks have been corrected, clean the
ion source.
p’’a*dF˜"¤’F
Contaminated reagent gas supply. Suspect this if you have recently replaced your
gas tank, and you have ruled out air leaks.
4›apm
Replace the reagent gas supply.
p’’a*dF˜"¤’F
The capillary column is broken or disconnected.
4›apm
Inspect the capillary column. Make sure it is not broken and it is installed correctly.
142
Q˜˜˜˜˜p¤*dF’^pp›amV
F"c˜"›˜h—«˜¢
p’’a*dF˜"¤’F
Saturated methane / isobutane gas purifier.
4›apm
Replace the gas purifier.
143
Q˜˜˜˜˜p¤*dF’^pp›amV
¤mamV_Fd"›F=˜’©hz›ph’˜|p¦F¦aF§}
Tuning-related symptoms (overview)
This section describes symptoms related to tuning. Most symptoms involve difficulties with tuning or with the results of tuning. The following symptoms are covered in this section:
•
•
•
•
CI ion ratio is difficult to adjust or unstable
High electron multiplier voltage
Can not complete autotune
Peak widths are unstable
144
Q˜˜˜˜˜p¤*dF’^pp›amV
F"VFm›˜V"’˜apm˜"›ap˜a’˜=aOOa4¤d›˜›p˜"=b¤’›˜p˜¤m’›"*dF
Reagent gas ion ratio is difficult to adjust or unstable
p’’a*dF˜"¤’F
The interface tip seal is incorrectly placed, damaged, or missing.
4›apm
Inspect the interface tip seal. If necessary, remove and reinstall it to insure a good
seal with the CI ion source. Replace it if it is damaged. Install it if it is missing.
p’’a*dF˜"¤’F
Residual air and water in the MSD or in the reagent gas supply lines.
4›apm
Run the methane pretune. Air will appear as a peak at m/z 32 and excessive water
as a peak at m/z 19 > m/z 17. If either of conditions is present, purge the reagent
gas supply lines and bake out the MSD. See page 256. Continued presence of a
large peak at m/z 32 may indicate an air leak. After correcting the problems, you
may need to clean the ion source.
p’’a*dF˜"¤’F
Air leak.
4›apm
Run Methane Pretune (in PCI). Large peak at m/z 32 indicates air in the system.
Check for and correct any leaks. See the Leaks section at the beginning of this
chapter.
p’’a*dF˜"¤’F
The reagent gas supply is at the wrong pressure.
4›apm
Check the regulator on the reagent gas supply. It should be adjusted to
20 psi (140 kPa).
p’’a*dF˜"¤’F
A leak in the reagent gas delivery path. This is especially likely if you have set the
methane flow much higher than normal and the ratio is still too low.
4›apm
Check the reagent gas path. Tighten fittings.
145
p’’a*dF˜"¤’F
The CI ion source is dirty.
4›apm
Clean the ion source. See the Maintenance chapter of this manual for more information.
146
Q˜˜˜˜˜p¤*dF’^pp›amV
aV^˜FdF4›pm˜h¤d›azdaF˜¦pd›"VF
High electron multiplier voltage
The electron multiplier voltage can range from a few hundred volts to 3000 V. If
the CI autotune program consistently sets the electron multiplier voltage at or
above 2600V, but can still find peaks and complete the tune, it may indicate a
problem.
p’’a*dF˜"¤’F
The filament is worn out. The CI filament may wear out without actually breaking.
Check the Electron Energy ramp; the curve should have a definite maximum with
an inflection point. If the curve is linear with a positive slope and no inflection
point, and the EMV is high, the filament has stretched to the point where it does
not line up with the hole in the ion source body, and most electrons are not getting
into the source.
4›apm
Replace the filament.
p’’a*dF˜"¤’F
The analyzer is not at the proper operating temperature.
4›apm
Verify the ion source and quadrupole temperatures. The default source temperature is 250°C for PCI and 150°C for NCI. The quadrupole temperature is 150°C for
both CI modes.
p’’a*dF˜"¤’F
The CI ion source is dirty.
4›apm
Clean the ion source. See the Maintenance chapter in this manual for more information.
p’’a*dF˜"¤’F
The electron multiplier (detector) is failing. Switch to EI mode and confirm.
4›apm
Replace the electron multiplier.
147
Q˜˜˜˜˜p¤*dF’^pp›amV
"m˜mp›˜4phzdF›F˜"¤›p›¤mF
Can not complete autotune
p’’a*dF˜"¤’F
Wrong or corrupted tune file.
4›apm
Check the tune parameters.
p’’a*dF˜"¤’F
The m/z 28/27 ion ratio (for methane) is incorrect. The correct ratio should be
between 1.5 and 5.0.
4›apm
If the ion ratio is incorrect, adjust it. See page 88.
p’’a*dF˜"¤’F
The CI ion source is dirty.
4›apm
Clean the ion source. See the Maintenance chapter in this manual for more information.
p’’a*dF˜"¤’F
Too much air or water in the system.
4›apm
See the Leaks section of this chapter for more information. After eliminating these
problems, clean the ion source.
148
Q˜˜˜˜˜p¤*dF’^pp›amV
F"c˜§a=›^’˜"F˜¤m’›"*dF
Peak widths are unstable
p’’a*dF˜"¤’F
Wrong or corrupted tune file.
4›apm
Check the tune parameters.
p’’a*dF˜"¤’F
The CI ion source is dirty.
4›apm
Clean the ion source. See the Maintenance chapter of this manual for more information.
p’’a*dF˜"¤’F
Air leak.
4›apm
Run Methane Pretune (in PCI). A visible peak at m/z 32 indicates air in the system.
Check for and correct any leaks. See the Leaks section at the beginning of this
chapter. After eliminating all air leaks, clean the ion source.
149
150
6
Before starting, 152
Maintaining the vacuum system, 159
Maintaining the analyzer, 204
Maintaining the GC/MSD interface, 232
Maintaining the electronics, 238
Maintaining the MSD
How to perform common maintenance procedures for the MSD. Many of
these procedures are demonstrated on the MSD Maintenance
CD-ROM.
Before starting
You can perform much of the maintenance required by your MSD. For your
safety, read all of the information in this introduction before performing any
maintenance tasks.
Some parts of the MSD require regularly scheduled maintenance
Common maintenance tasks are listed in Table 4. Performing these tasks
when scheduled can reduce operating problems, prolong system life, and
reduce overall operating costs.
Keep a record of system performance (tune reports) and maintenance
operations performed. This makes it easier to identify variations from normal operation and to take corrective action.
"*dF˜T
"am›Fm"m4F˜’4^F=¤dF
"’c
¤mF˜›^F˜
^F4c˜›^F˜OpFdamF˜z¤hz˜pad˜dF¦Fd
^F4c˜›^F˜4"da*"›apm˜¦a"d|’}
Fzd"4F˜›^F˜OpFdamF˜z¤hz˜pads
Fzd"4F˜›^F˜=aOO¤’apm˜z¤hz˜Od¤a=
dF"m˜›^F˜apm˜’p¤4F
^F4c˜›^F˜4"aF˜V"’˜›"z|’}˜pm˜›^F˜
Fzd"4F˜›^F˜§pm˜p¤›˜z"›’
¤*a4"›F˜’a=Fzd"›F˜p˜¦Fm›˜¦"d¦F˜_amV’¢
¦F©
§FFc
¦F©
–˜hpm›^’
¦F©
©F"
’
mFF=F=
✓
✓
✓
✓
✓
✓
✓
✓
✓
s ¦F©˜˜hpm›^’˜Op˜˜’˜¤’amV˜"hhpma"˜F"VFm›˜V"’
¢ "4¤¤h˜’F"d’˜p›^F˜›^"m˜›^F˜’a=F˜zd"›F˜_amV˜"m=˜¦Fm›˜¦"d¦F˜_amV˜=p˜mp›˜mFF=˜›p˜*F˜d¤*a4"›F=˜
¤*a4"›amV˜p›^F˜’F"d’˜4"m˜am›FOFF˜§a›^˜›^Fa˜4pF4›˜O¤m4›apm
152
–˜˜˜˜"am›"amamV˜›^F˜
Maintenance requires the proper tools, spare parts, and supplies
Some of the required tools, spare parts, and supplies are included in the
MSD shipping kit or MSD tool kit. You must supply others yourself. Each
maintenance procedure includes a list of the materials required for that
procedure. Tables 5 and 6 summarize these.
"*dF˜Q
ppd’
F’4az›apm
"dd˜=a¦F
sQ_hh
¢¬_hh
¢Q_hh
¤mmFd
F¨˜m¤›˜=a¦F:˜QQ_hh
daF’:˜dpmV_mp’F˜|sQ_am4^˜mp’F}
4F§=a¦F
Od"›_*d"=F:˜d"VF
p¨:˜_s¬
p¨:˜_sQ
p¨:˜_¢¬
§FF«F’:˜mpm_h"VmF›a4
Fm4^:˜pzFm_Fm=
s—T_am4^˜×˜Q—s–_am4^
s¬_hh
a’›˜’›"z:˜"m›a_’›"›a4
’h"dd
hF=a¤h
d"VF
"›˜m¤h*F
˜G•s¬_sQ•¬
˜G•s¬_sG¬T
˜G•s¬_s–Gs
IIII
˜G•s¬_s¢¢¬
˜G•s¬_s¬nT
˜˜G•¬_¬¬¬¢
˜˜G•s¬_s–¢
˜˜G•s¬_s–¢¢
˜˜G•s¬_s–sQ
˜˜G•s¬_¬n¬•
˜G•s¬_¬Qs¬
˜G•s¬_¢Q
˜n¬¬_¬n–n
˜n¬¬_s¢Q•
˜n¬¬_¬n•¬
153
–˜˜˜˜"am›"amamV˜›^F˜
"*dF˜–
z"F˜z"›’˜"m=˜’¤zzdaF’
F’4az›apm
*"’a¦F˜z"zF
d¤ham"˜"*"’a¦F˜zp§=F
d¤ham¤h˜Opad:˜4dF"m
F"cF’:˜Vd"’’:˜Q¬˜hd˜"m=˜Q¬¬˜hd
dp›^’:˜4dF"m:˜dam›_OFF˜|„¤"m›a›©˜¢¬}
pm›"amF:˜Op˜4"›4^amV˜pd=˜OpFdamF˜z¤hz˜pad:˜≈˜Q¬¬˜hd
p››pm˜’§"*’˜|„¤"m›a›©˜s¬¬}
aOO¤’apm˜z¤hz˜Od¤a=
dF4›pm˜h¤d›azdaF˜^pm
ad"hFm›˜"’’Fh*d©
pFdamF˜F¨^"¤’›˜pad˜›"z
pFdamF˜z¤hz˜pad:˜s˜da›F
dp¦F’
4^Fha4"d_F’a’›"m›˜|F’a’›"m›˜›p˜pad’˜"m=˜’pd¦Fm›’}
4dF"m:˜dam›_OFF˜|d"VF}
4dF"m:˜dam›_OFF˜|’h"dd}
F"’F:˜zaF«pm˜:˜^aV^˜¦"4¤¤h
F"›F—’Fm’p˜"’’Fh*daF’
—˜am›FO"4F
apm˜’p¤4F
h"’’˜Oad›F
4›"Od¤ppm"z^›^"dFmF:˜s˜zV—¤d
FOd¤pp›a*¤›©d"hamF˜|}:˜4F›aOaF=˜|s˜V"h}˜
˜’"hzdF˜ca›
pd¦Fm›’:˜F"VFm›_V"=F˜I˜"4F›pmF:˜hF›^"mpd:˜hF›^©dFmF˜4^dpa=F
ap=F˜V"¤VF˜›¤*F
d›"’pma4˜*"›^
154
"›˜m¤h*F
˜˜Q¬–s_QGn–
˜˜G––¬_¬•ns
˜˜IIII
˜˜IIII
¬QnG¬_–¬¬Qs
˜˜IIII
˜˜Q¬G¬_QT¬¬
˜˜–¬T¬_¬G¬n
¬Qn•s_G¬s¬
¬Qn•¢_G¬¬Q
s¬nn_G¬¬•
˜˜–¬T¬_¬GT
˜˜IIII
˜˜G–Q¬_¬¬¬
˜˜G–Q¬_¬¬¢n
˜˜–¬T¬_¬¢Gn
s¬nn_–¬s¬•
s¬nn_–¬s••
s¬nn_–¬s•¢
˜˜GQ¬¬_QTTs
˜GQ¬¬_¬–Q–
¬Qn•s_–¬Q•s
˜˜IIII
˜˜¬n–¬_¬Gn•
˜˜IIII
–˜˜˜˜"am›"amamV˜›^F˜
Many parts of the MSD carry high voltages that are
potentially dangerous
Whenever the MSD is plugged in, even if the power switch is off, potentially
dangerous voltage (120 V ac or 200/240 V ac) exists on:
• The wiring and fuses between where the power cord enters the
instrument and the power switch
When the power switch is on, potentially dangerous voltages exist on:
• Electronic circuit boards
• Toroidal transformer
• Turbomolecular pump controller
• Wires and cables between these boards
• Wires and cables between these boards and the connectors on the back
panel of the MSD
• Some connectors on the back panel (for example, the foreline power
receptacle)
Normally, all of these parts are shielded by safety covers. As long as the
safety covers are in place, it should be difficult to accidentally make contact
with dangerous voltages.
FOph˜mp˜h"am›Fm"m4F˜§a›^˜›^F˜˜›¤mF=˜pm˜p˜zd¤VVF=˜am›p˜a›’˜zp§F˜’p¤4F˜
¤mdF’’˜©p¤˜"F˜am’›¤4›F=˜›p˜*©˜pmF˜pO˜›^F˜zp4F=¤F’˜am˜›^a’˜4^"z›F
155
–˜˜˜˜"am›"amamV˜›^F˜
One or two procedures in this chapter require access to the inside of the
MSD while the power switch is on. Do not remove any of the electronics
safety covers in any of these procedures. To reduce the risk of electric
shock, follow the procedures carefully.
If your instrument is equipped with the optional gauge controller, potentially dangerous voltage also exists where the cable from the gauge controller
connects to the triode gauge tube. Turn off the gauge controller if you are
going to be working near the triode gauge tube.
Many parts are hot enough to be dangerous
Many parts in the MSD operate at, or reach, temperatures high enough to
cause serious burns. These parts include, but are not limited to:
• GC/MSD interface
• Analyzer parts
• Vacuum pumps
F¦F˜›p¤4^˜›^F’F˜z"›’˜§^adF˜©p¤˜˜a’˜pm˜˜O›F˜›^F˜˜a’˜›¤mF=˜pOO:˜Va¦F˜›^F’F˜
z"›’˜Fmp¤V^˜›ahF˜›p˜4ppd˜*FOpF˜^"m=damV˜›^Fh
^F˜
—˜am›FO"4F˜^F"›F˜a’˜zp§FF=˜*©˜›^F˜^Fh"d˜¤¨˜o¢˜^F"›F=˜«pmF˜pm˜›^F˜
˜˜^F˜am›FO"4F˜^F"›F˜4"m˜*F˜pm:˜"m=˜"›˜"˜="mVFp¤’d©˜^aV^˜›FhzF"›¤F:˜F¦Fm˜
›^p¤V^˜›^F˜˜a’˜pOO˜˜^F˜
—˜am›FO"4F˜a’˜§Fdd˜am’¤d"›F=˜˜¦Fm˜"O›F˜a›˜a’˜›¤mF=˜
pOO:˜a›˜4ppd’˜¦F©˜’dp§d©˜
The GC injection ports and GC oven also operate at very high temperatures.
Use the same caution around these parts. See the documentation supplied
with your GC for more information.
156
–˜˜˜˜"am›"amamV˜›^F˜
Chemical residue is another potential danger
Only a small portion of your sample is ionized by the ion source. The
majority of any sample passes through the ion source without being ionized.
It is pumped away by the vacuum system. As a result, the exhaust from the
foreline pump will contain traces of the carrier gas and your samples. It will
also contain tiny droplets of foreline pump oil.
An oil trap is supplied with the foreline pump. This trap stops only pump oil
droplets. It does not trap any other chemicals. If you are using toxic solvents
or analyzing toxic chemicals, do not use the oil trap. Instead, install a hose
to take the exhaust from the foreline pump outdoors or into a fume hood
vented to the outdoors. Be sure to comply with your local air quality
regulations.
^F˜pad˜›"z˜’›pz’˜pmd©˜OpFdamF˜z¤hz˜pad˜›˜=pF’˜mp›˜›"z˜p˜Oad›F˜p¤›˜›p¨a4˜4^Fha4"d’˜
O˜©p¤˜"F˜¤’amV˜›p¨a4˜’pd¦Fm›’˜p˜"m"d©«amV˜›p¨a4˜4^Fha4"d’:˜Fhp¦F˜›^F˜pad˜›"z˜p˜
mp›˜¤’F˜›^F˜›"z˜aO˜©p¤˜^"¦F˜"˜˜˜m’›"dd˜"˜^p’F˜›p˜›"cF˜›^F˜OpFdamF˜z¤hz˜F¨^"¤’›˜
p¤›’a=F˜p˜›p˜"˜O¤hF˜^pp=
The fluids in the diffusion pump and foreline pump also collect traces of the
samples being analyzed. All used pump fluid should be considered hazardous and handled accordingly. Dispose of used fluid correctly, as specified
by your local regulations.
^Fm˜Fzd"4amV˜z¤hz˜Od¤a=:˜¤’F˜"zzpza"›F˜4^Fha4"d_F’a’›"m›˜Vdp¦F’˜"m=˜’"OF›©˜
Vd"’’F’˜˜¦pa=˜"dd˜4pm›"4›˜§a›^˜›^F˜Od¤a=
157
–˜˜˜˜"am›"amamV˜›^F˜
Electrostatic discharge is a threat to the MSD electronics during
maintenance
All of the printed circuit boards in the MSD contain components that can be
damaged by electrostatic discharge (ESD). Do not handle or touch these
boards unless absolutely necessary. In addition, wires, contacts, and cables
can conduct ESD to the electronics boards to which they are connected.
This is especially true of the mass filter (quadrupole) contact wires which
can carry ESD to sensitive components on the side board. ESD damage may
not cause immediate failure but it will gradually degrade the performance
and stability of your MSD.
When you work on or near printed circuit boards, or when you work on
components with wires, contacts, or cables connected to printed circuit
boards, always use a grounded anti-static wrist strap and take other antistatic precautions. The wrist strap should be connected to a known good
Earth ground. If that is not possible, it should be connected to a conductive
(metal) part of the assembly being worked on, but not to electronic components, exposed wires or traces, or pins on connectors.
Take extra precautions, such as a grounded, anti-static mat, if you must
work on components or assemblies that have been removed from the MSD.
This includes the analyzer.
m˜p=F˜›p˜*F˜FOOF4›a¦F:˜"m˜"m›a_’›"›a4˜§a’›˜’›"z˜h¤’›˜Oa›˜’m¤Vd©˜|mp›˜›aV^›}˜˜˜dpp’F˜’›"z˜
zp¦a=F’˜da››dF˜p˜mp˜zp›F4›apm
m›a_’›"›a4˜zF4"¤›apm’˜"F˜mp›˜s¬¬~˜FOOF4›a¦F˜"m=dF˜FdF4›pma4˜4a4¤a›˜*p"=’˜"’˜da››dF˜"’˜
zp’’a*dF:˜"m=˜›^Fm˜pmd©˜*©˜›^F˜F=VF’˜F¦F˜›p¤4^˜4phzpmFm›’:˜F¨zp’F=˜›"4F’:˜p˜zam’˜pm˜
4pmmF4›p’˜"m=˜4"*dF’
158
–˜˜˜˜"am›"amamV˜›^F˜
Maintaining the vacuum system
The vacuum system requires some periodic maintenance
As listed earlier in Table 4, some maintenance tasks for the vacuum system
must be performed periodically. These include:
• Checking the foreline pump fluid (every week)
• Checking the calibration vial (every 6 months)
• Ballasting the foreline pump (daily in MSDs using ammonia reagent gas)
• Replacing the foreline pump oil (every 6 months; every 3 months for CI
MSDs using ammonia reagent gas)
• Tightening the foreline pump oil box screws (first oil change after
installation)
• Replacing the diffusion pump fluid (once a year)
Failure to perform these tasks as scheduled can result in decreased instrument performance. It can also result in damage to your instrument.
Other procedures should be performed as needed
Tasks such as replacing a foreline vacuum gauge or triode gauge tube should
be performed only when needed. See Chapter 4, Troubleshooting the MSD,
on page 107, and see the online help in the MSD ChemStation software for
symptoms that indicate this type of maintenance is required.
More information is available
If you need more information about the locations or functions of vacuum
system components, refer to Chapter 8, Vacuum System, on page 259.
Most of the procedures in this chapter are illustrated with video clips in the
5973N MSD Maintenance CD-ROM.
159
–˜˜˜˜"am›"amamV˜›^F˜
p˜4^F4c˜"m=˜"==˜OpFdamF˜z¤hz˜pad
To check and add foreline pump oil
"›Fa"d’˜mFF=F=9
Foreline pump oil (6040-0834)
Funnel
FF˜"d’p
A video demonstration of this procedure is on the
5973N MSD Maintenance CD-ROM.
A slow loss of oil is normal for the foreline pump. Therefore, it is especially important to check the oil level regularly.
1 Examine the oil level window.
The oil level should be above the lower line. The foreline pump oil should be
almost clear. If the oil level is near or below the lower line, follow the steps 2 – 6 to
add foreline pump oil.
F¦F˜"==˜pad˜§^adF˜›^F˜OpFdamF˜z¤hz˜a’˜pm
If your MSD is nearing its scheduled time for replacement of the foreline pump oil,
replace the oil instead of adding oil. If the oil is dark or cloudy, replace it. See page
162 for instructions about replacing the foreline pump oil.
2 Vent the MSD. See page 54.
3 Remove the fill cap.
4 Add pump fluid until the oil level in the window is near, but not above, the
upper line.
5 Reinstall the fill cap.
6 Pump down the MSD. See page 60.
160
–˜˜˜˜"am›"amamV˜›^F˜
p˜4^F4c˜"m=˜"==˜OpFdamF˜z¤hz˜pad
add˜4"z
zzF˜damF
ad˜dF¦Fd˜§am=p§
p§F˜damF
161
–˜˜˜˜"am›"amamV˜›^F˜
p˜="am˜›^F˜OpFdamF˜z¤hz
To drain the foreline pump
"›Fa"d’˜mFF=F=9
Book or other solid object approximately 5 cm thick
Container for catching old pump oil, 500 ml
Gloves, oil- and solvent-resistant
Screwdriver, flat-blade, large (8730-0002)
FF˜"d’p
A video demonstration of this procedure is on the
5973N MSD Maintenance CD-ROM.
1 Vent the MSD. See page 54.
2 If necessary, slide the foreline pump out from under the analyzer chamber.
The foreline pump may be located on the floor, on the lab bench next to or behind
the MSD, or under the analyzer chamber at the back of the MSD.
^F˜OpFdamF˜z¤hz˜h"©˜*F˜^p›
3 Place a book or other object under the pump motor to tilt it up slightly.
4 Remove the fill cap.
5 Place a container under the drain plug.
6 Remove the drain plug.
Allow the pump oil to drain out. The oil drains faster if it is still warm.
^F˜pd=˜z¤hz˜pad˜h"©˜4pm›"am˜›p¨a4˜4^Fha4"d’˜F"›˜a›˜"’˜^"«"=p¤’˜§"’›F
7 Refill the foreline pump. See page 164.
162
–˜˜˜˜"am›"amamV˜›^F˜
p˜="am˜›^F˜OpFdamF˜z¤hz
add˜4"z
¤hz˜hp›p
"am˜zd¤V
163
–˜˜˜˜"am›"amamV˜›^F˜
p˜FOadd˜›^F˜OpFdamF˜z¤hz
To refill the foreline pump
"›Fa"d’˜mFF=F=9
Foreline pump oil (6040-0834) – approximately 0.28 liters required
Funnel
Gloves, oil- and solvent-resistant
Screwdriver, flat-blade, large (8730-0002)
Drain plug O-ring (if required) (0905-1515)
FF˜"d’p
A video demonstration of this procedure is on the
5973N MSD Maintenance CD-ROM.
1 Drain the foreline pump. See page 162.
2 Reinstall the drain plug.
If the old O-ring appears worn or damaged, replace it.
3 Remove the propping object from under the pump motor.
4 Add foreline pump oil until the oil level in the window is near, but not
above, the upper line.
The foreline pump requires approximately 0.28 liters of oil.
5 Wait a few minutes for the oil to settle.
If the oil level drops, add oil to bring the oil level to near the upper line.
6 Reinstall the fill cap.
7 If necessary, slide the foreline pump back under the analyzer chamber.
The foreline pump may be located on the floor, on the lab bench next to or behind
the MSD, or under the analyzer chamber at the back of the MSD.
8 Pump down the MSD. See page 60.
164
–˜˜˜˜"am›"amamV˜›^F˜
p˜FOadd˜›^F˜OpFdamF˜z¤hz
add˜4"z
zzF˜damF
ad˜dF¦Fd˜§am=p§
"am˜zd¤V
165
–˜˜˜˜"am›"amamV˜›^F˜
p˜Fzd"4F˜›^F˜pad˜›"z
To replace the oil trap
"›Fa"d’˜mFF=F=9
Gloves, oil- and solvent-resistant
Oil trap, foreline exhaust (G1099-80037)
If you are using an oil trap on the exhaust port of the foreline pump, you should
replace the trap whenever the white filter element turns brown. The trap can be
replaced without turning off the MSD.
p˜mp›˜*F"›^F˜›^F˜z¤hz˜F¨^"¤’›”˜a›˜h"©˜4pm›"am˜z¤hz˜pad˜¦"zp˜p˜mp›˜Fzd"4F˜›^F˜
›"z˜§^adF˜’"hzdF’˜"F˜*FamV˜"m"d©«F=
p˜mp›˜¤’F˜›^F˜›"z˜§a›^˜"˜˜:˜p˜aO˜©p¤˜"F˜¤’amV˜›p¨a4˜’pd¦Fm›’˜p˜"m"d©«amV˜›p¨a4˜
4^Fha4"d’^F˜›"z˜’›pz’˜pmd©˜OpFdamF˜z¤hz˜pad˜›˜=pF’˜mp›˜›"z˜p˜Oad›F˜p¤›˜›p¨a4˜
4^Fha4"d’˜m’›"dd˜"˜^p’F˜›p˜›"cF˜›^F˜OpFdamF˜z¤hz˜F¨^"¤’›˜p¤›’a=F˜p˜›p˜"˜O¤hF˜^pp=
1 Remove the clamp that holds the oil trap to the trap adapter.
p˜mp›˜›p¤4^˜›^F˜OpFdamF˜z¤hz”˜a›˜h"©˜*F˜^p›
2 Remove the oil trap.
Make sure the O-ring assembly stays on the adapter.
3 Install a new oil trap.
4 Reinstall the clamp that holds the oil trap to the trap adapter.
^F˜pad˜›"z˜§add˜4pm›"am˜›"4F’˜pO˜pad:˜’pd¦Fm›’:˜"m=˜"m"d©›F’˜F"›˜a›˜"’˜^"«"=p¤’˜
a’zp’F˜pO˜›^F˜pad˜›"z˜am˜"44p="m4F˜§a›^˜dp4"d˜Fm¦apmhFm›"d˜"m=˜’"OF›©˜
FV¤d"›apm’
O˜›^F˜›"z˜^"’˜›¤mF=˜*p§m˜„¤a4cd©:˜›^F˜˜zp*"*d©˜^"’˜"˜d"VF˜"a˜dF"c:˜§^a4^˜a’˜4"¤’amV˜
z¤hz˜pad˜›p˜VF›˜*dp§m˜p¤›˜›^F˜F¨^"¤’›˜zp›˜am=˜"m=˜Fz"a˜›^F˜"a˜dF"c˜*FOpF˜am’›"ddamV˜"˜
mF§˜›"z˜FF˜›^F˜Qn•˜˜"am›Fm"m4F˜_
166
–˜˜˜˜"am›"amamV˜›^F˜
p˜Fzd"4F˜›^F˜pad˜›"z
ad˜›"z
¤hz˜p¤›dF›˜
zp›
pFdamF˜z¤hz
167
–˜˜˜˜"am›"amamV˜›^F˜
p˜4^F4c˜›^F˜=aOO¤’apm˜z¤hz˜Od¤a=
To check the diffusion pump fluid
"›Fa"d’˜mFF=F=9
Screwdriver, Torx T-15 (8710-1622)
1 Remove the upper and lower MSD covers. See page 52.
p˜mp›˜Fhp¦F˜"m©˜p›^F˜4p¦F’˜˜Fhp¦amV˜p›^F˜4p¦F’˜h"©˜F¨zp’F˜^"«"=p¤’˜
¦pd›"VF’
2 Check the diffusion pump fluid level.
The diffusion pump fluid level can be seen through the window below the fan at
the front of the MSD. The diffusion pump fluid level should be between the top
and bottom of one of the ranges. There are two sets of marks. Use the marks if the diffusion pump is on and is at its normal operating temperature. Use
the marks if the pump is off and has had time to cool. If the fluid level is
below the bottom of the appropriate range, replace the diffusion pump fluid. Do
not just add fluid.
The pump fluid should be clear or almost clear. Dark or cloudy pump fluid indicates an air leak or excessive heat. If the pump fluid appears dark or cloudy,
replace it. Then, check for an air leak.
The diffusion pump fluid should be replaced at least once a year, or more often if
the pump fluid level is low or if the fluid is dark or cloudy.
FFz˜©p¤˜^"a˜"§"©˜Oph˜›^F˜4ppdamV˜O"m˜aO˜›^F˜˜a’˜›¤mF=˜pm
168
–˜˜˜˜"am›"amamV˜›^F˜
p˜4^F4c˜›^F˜=aOO¤’apm˜z¤hz˜Od¤a=
"m
d¤a=˜dF¦Fd˜§am=p§
|’aV^›˜Vd"’’}
169
–˜˜˜˜"am›"amamV˜›^F˜
p˜Fzd"4F˜›^F˜›¤*p˜z¤hz
To replace the turbo pump
The turbo pumps are not customer-replaceable parts. The procedure is demonstrated on the 5973N Maintenance CD-ROM, and is for use by Agilent Technologies service personnel only.
170
–˜˜˜˜"am›"amamV˜›^F˜
p˜’Fz""›F˜›^F˜˜Oph˜›^F˜
To separate the MSD from the GC
"›Fa"d’˜mFF=F=9
Fm4^:˜pzFm_Fm=:˜s—T_am4^˜×˜Q—s–_am4^˜|G•s¬_¬Qs¬}
FF˜"d’p
A video demonstration of this procedure is on the
5973N MSD Maintenance CD-ROM.
1 Vent the MSD. See page 54.
2 Turn off the GC.
3 Remove the capillary column from the GC/MSD interface.
"cF˜’¤F˜›^F˜
—˜am›FO"4F˜"m=˜
˜p¦Fm˜^"¦F˜4ppdF=˜*FOpF˜©p¤˜Fhp¦F˜›^F˜
4pd¤hm
4 If necessary, slide the foreline pump out from under the analyzer chamber.
The foreline pump may be located on the floor, on the lab bench next to or behind
the MSD, or under the analyzer chamber at the back of the MSD.
5 Move the MSD away from the GC until you have access to the GC/MSD
interface cable.
6 Place a column nut with a blank ferrule on the end of the interface.
This will help prevent contamination out of the MSD.
7 Disconnect the GC/MSD interface cable.
Disconnecting the cable with the GC on can cause a fault condition.
8 Continue to move the MSD until you have access to the part requiring
maintenance.
171
–˜˜˜˜"am›"amamV˜›^F˜
p˜’Fz""›F˜›^F˜˜Oph˜›^F˜
172
–˜˜˜˜"am›"amamV˜›^F˜
p˜Fhp¦F˜›^F˜=aOO¤’apm˜z¤hz
To remove the diffusion pump
"›Fa"d’˜mFF=F=9
Aluminum foil, clean
Gloves, oil-resistant
FF˜"d’p
The 5973N MSD Maintenance CD-ROM.
1 Vent the MSD. See page 54.
2 Separate the MSD from the GC. See page 171.
^F˜=aOO¤’apm˜z¤hz˜pzF"›F’˜"›˜¦F©˜^aV^˜›FhzF"›¤F’˜"cF˜’¤F˜a›˜^"’˜4ppdF=˜
*FOpF˜^"m=damV˜a›
3 Disconnect the foreline gauge assembly from the diffusion pump outlet.
The foreline gauge cable can be disconnected or can remain connected to the foreline gauge.
4 Disconnect the diffusion pump temperature sensor wires from the wiring
harness.
These are on the side of the diffusion pump not shown in the illustration.
5 Disconnect high vacuum power (˜) cable from the back panel
of the MSD.
This is the thick black cable that emerges near the bottom of the pump.
6 Support the diffusion pump with one hand.
7 Remove the KF50 clamp.
8 Lower the diffusion pump.
173
–˜˜˜˜"am›"amamV˜›^F˜
p˜Fhp¦F˜›^F˜=aOO¤’apm˜z¤hz
pFdamF˜V"¤VF˜"’’Fh*d©
Q¬˜4d"hz
_amV˜"’’Fh*d©
aOO¤’apm˜z¤hz
aOO¤’apm˜z¤hz˜p¤›dF›
9 Remove the O-ring assembly from the top of the diffusion pump.
The O-ring will have diffusion pump fluid on it and will be very sticky. Place the
O-ring on clean aluminum foil (shiny side down) to keep your lab bench and the Oring clean.
10 Remove the diffusion pump through the side of the MSD.
You may have to tilt the pump slightly to remove it. Do not tilt the pump past 45° if
the pump is warm.
174
–˜˜˜˜"am›"amamV˜›^F˜
p˜Fzd"4F˜›^F˜=aOO¤’apm˜z¤hz˜Od¤a=
To replace the diffusion pump fluid
"›Fa"d’˜mFF=F=9
Aluminum foil, clean
Cloths, clean, lint-free (05980-60051)
Container for old diffusion pump fluid
Diffusion pump fluid, 18.5 ml (6040-0809) – 2 required
Gloves
oil- and solvent-resistant
thermally insulated
1 Remove the diffusion pump from the MSD. See page 173.
Make sure you remove the O-ring assembly from the top of the diffusion pump.
2 Cover the top of the diffusion pump with aluminum foil (shiny side up).
3 Heat the diffusion pump at 60 °C for 15 minutes in your GC oven.
^F˜z¤hz˜"m=˜z¤hz˜Od¤a=˜§add˜*F˜^p›˜˜F"˜zp›F4›a¦F˜Vdp¦F’˜§^Fm˜©p¤˜Fhp¦F˜›^F˜
z¤hz˜Oph˜›^F˜p¦Fm
4 Pour the old diffusion pump fluid out the top of the pump.
Even after heating, the pump fluid pours very slowly.
F"›˜›^F˜pd=˜z¤hz˜Od¤a=˜"’˜^"«"=p¤’˜˜›˜h"©˜4pm›"am˜›"4F’˜pO˜›p¨a4˜4^Fha4"d’
^"F=˜p˜*d"4cFmF=˜
z¤hz˜Od¤a=
If the diffusion pump has been heated with insufficient pump fluid (or with a large
air leak in the MSD), the remaining pump fluid may be severely blackened. Blackened pump fluid may also be baked onto the internal parts (stack) of the pump. If
so, you may have to remove the diffusion pump stack and clean its parts, and the
interior of the pump, with methylene chloride. Be very careful when reinstalling
the stack. Misalignment of stack components can seriously reduce diffusion pump
performance.
F›^©dFmF˜4^dpa=F˜a’˜"˜^"«"=p¤’˜’pd¦Fm›˜˜pc˜am˜"˜O¤hF˜^pp=˜"m=˜›"cF˜"dd˜
"zzpza"›F˜zF4"¤›apm’
175
–˜˜˜˜"am›"amamV˜›^F˜
p˜Fzd"4F˜›^F˜=aOO¤’apm˜z¤hz˜Od¤a=
md©˜¤’F˜"*p¤›˜^"dO˜pO˜›^F˜
’F4pm=˜*p››dF
5 Wipe clean the diffusion pump flange on the analyzer chamber.
Follow the instructions on the bottle for pre-heating the diffusion pump fluid.
6 Pour new diffusion pump fluid into diffusion pump until the fluid level is
within the ˜ range.
The recommended charge for this pump is 30 ml. It will require approximately 1.5
of the bottles (18.5 ml each) of diffusion pump fluid. Pour the fluid between the
center stack and the side wall. Watch the sight glass while pouring. Do not overfill.
7 Reinstall the diffusion pump. See page 177.
176
–˜˜˜˜"am›"amamV˜›^F˜
p˜Fam’›"dd˜›^F˜=aOO¤’apm˜z¤hz
To reinstall the diffusion pump
"›Fa"d’˜mFF=F=9
Gloves, oil-resistant
Vacuum cleaner, non-ESD generating (92175V or equivalent)
This procedure works best with two people, one to hold the pump and one to
install the clamp.
1 Vacuum the fan that cools the diffusion pump.
Keeping the fan clean helps ensure maximum cooling. This is one of the few times
you will have convenient access to the pump side of the fan.
2 Slide the diffusion pump into the MSD.
You may have to tilt the pump slightly to get it into the MSD. Do not tilt it past 45°.
3 Install the O-ring assembly on the diffusion pump.
4 Lift the diffusion pump into its normal position.
5 Install the KF50 clamp.
6 Reconnect the diffusion pump temperature sensor wires to the wiring
harness.
7 Reconnect the high vacuum power cable to the ˜ connector on
the back panel of the MSD.
This is the thick black cable that emerges near the bottom of the pump.
8 Reconnect the foreline gauge fitting to the outlet of the diffusion pump.
If you disconnected the foreline gauge cable, reconnect it to the foreline gauge.
9 Move the MSD back to its normal position. See page 179.
177
–˜˜˜˜"am›"amamV˜›^F˜
p˜Fam’›"dd˜›^F˜=aOO¤’apm˜z¤hz
pFdamF˜V"¤VF˜"’’Fh*d©
Q¬˜4d"hz
_amV˜"’’Fh*d©
aOO¤’apm˜z¤hz
aOO¤’apm˜z¤hz˜p¤›dF›
178
–˜˜˜˜"am›"amamV˜›^F˜
p˜F4pmmF4›˜›^F˜˜›p˜›^F˜
To reconnect the MSD to the GC
"›Fa"d’˜mFF=F=9
Wrench, open-end, 1/4-inch × 5/16-inch (8710-0510)
1 Position the MSD so the end of the GC/MSD interface is near the GC.
2 Reconnect the GC/MSD interface cable.
3 Slide the MSD to its regular position next to the GC.
Be careful not to damage the GC/MSD interface as it passes into the GC. Make
sure the end of the GC/MSD interface extends into the GC oven.
4 If necessary, slide the foreline pump back under the analyzer chamber.
The foreline pump may be located on the floor, on the lab bench next to or behind
the MSD, or under the analyzer chamber at the back of the MSD.
5 Reinstall the capillary column. See page 28.
6 Pump down the MSD. See page 60.
7 Turn on the GC.
Re-establish appropriate temperature setpoints for the GC/MSD interface and GC
oven.
179
–˜˜˜˜"am›"amamV˜›^F˜
p˜F4pmmF4›˜›^F˜˜›p˜›^F˜
180
–˜˜˜˜"am›"amamV˜›^F˜
p˜Fhp¦F˜›^F˜˜4"da*"›apm˜¦a"d
To remove the EI calibration vial
"›Fa"d’˜mFF=F=9
None
1 Stop any tuning or data acquisition.
2 Turn off the analyzer.
There are several ways to turn off the analyzer:
• In the Diagnostics/Vacuum Control view, select ˜ from the Diagnostics
menu.
• In the Instrument Control view in the Edit Parameters dialog box, select ˜
from the Execute menu.
• In the Manual Tune view, select ˜ from the Execute menu.
3 If your MSD is equipped with a gauge controller, switch off the triode
gauge and the gauge controller.
4 Remove the analyzer cover. See page 52.
5 Loosen the calibration vial collar by turning it counterclockwise.
Counterclockwise as viewed from the bottom (vial side) of the collar. Do not
remove the collar.
6 Pull the calibration vial out.
You may feel some resistance due to residual vacuum.
181
–˜˜˜˜"am›"amamV˜›^F˜
p˜Fhp¦F˜›^F˜˜4"da*"›apm˜¦a"d
"da*"›apm˜¦"d¦F
pdd"
"da*"›apm˜¦a"d
182
–˜˜˜˜"am›"amamV˜›^F˜
p˜FOadd˜"m=˜Fam’›"dd˜›^F˜˜4"da*"›apm˜¦a"d
To refill and reinstall the EI calibration vial
"›Fa"d’˜mFF=F=9
PFTBA (05971-60571) or other tuning compound
1 Remove the calibration vial. See page 190.
2 Pour PFTBA into the vial, or use a pipette.
Leave the top 6-mm of the vial unfilled.
3 Push the calibration vial into the valve as far as possible.
4 Withdraw the vial 1 mm.
This prevents damage when you tighten the collar.
5 Turn the collar clockwise to tighten it.
Clockwise as viewed from the bottom (vial side) of the collar. The collar should be
snug but not overly tight. Do not use a tool to tighten the collar. It does not
require that much force.
6 Reinstall the analyzer cover.
7 Select ¤VF˜"d˜"d¦F from the Vacuum menu in the Diagnostics/Vacuum
Control view.
"ad¤F˜›p˜z¤VF˜›^F˜4"da*"›apm˜¦"d¦F˜§add˜F’¤d›˜am˜="h"VF˜›p˜›^F˜Oad"hFm›’˜"m=˜=F›F4›p
183
–˜˜˜˜"am›"amamV˜›^F˜
p˜FOadd˜"m=˜Fam’›"dd˜›^F˜˜4"da*"›apm˜¦a"d
"da*"›apm˜¦"d¦F
pdd"
˜˜˜˜˜–˜hh
"da*"›apm˜¦a"d
184
–˜˜˜˜"am›"amamV˜›^F˜
p˜z¤VF˜›^F˜4"da*"›apm˜¦"d¦F’
To purge the calibration valves
O›F˜Fhp¦amV˜"˜4"da*"m›˜¦a"d:˜©p¤˜h¤’›˜z¤VF˜›^F˜4"da*"›apm˜¦"d¦F˜"ad¤F˜›p˜=p˜’p˜§add˜
F’¤d›˜am˜="h"VF˜›p˜›^F˜Oad"hFm›’˜"m=˜›^F˜FdF4›pm˜h¤d›azdaF
EI calibration valve
After adding new PFTBA to the calibrant vial, you must purge the air out of the
vial and valve.
1 If the vacuum gauge controller is on, turn it off.
2 In Diagnostics and Vacuum Control view, select ¤VF˜"d˜"d¦F under the
Vacuum menu.
This will open the CI calibration valve for several minutes with all analyzer voltages
turned off.
zF4a"d˜p4F=¤F˜Op˜
˜
CI calibration valve
After adding new PFDTD to the calibrant vial, you must purge the air out of the
vial and valve.
3 If the vacuum gauge controller is on, turn it off.
4 Turn on "’˜
5 Turn on ¤VF
6 Verify that T˜is loaded.
7 In Diagnostics and Vacuum Control view, select ¤VF˜"d˜"d¦F under the
Vacuum menu.
This will open the CI calibration valve for several minutes with all analyzer voltages
turned off.
185
–˜˜˜˜"am›"amamV˜›^F˜
p˜Fhp¦F˜›^F˜OpFdamF˜V"¤VF
To remove the foreline gauge
"›Fa"d’˜mFF=F=9
Screwdriver, flat-blade, large (8730-0002)
1 Vent the MSD. See page 54.
2 Separate the MSD from the GC. See page 171.
^F˜OpFdamF˜z¤hz˜"m=˜=aOO¤’apm˜z¤hz˜h"©˜’›add˜*F˜^p›
3 Unplug the foreline gauge cable from the foreline gauge.
4 Disconnect the foreline gauge assembly from the diffusion pump outlet.
5 Loosen the hose clamp.
6 Pull the foreline gauge assembly out of the foreline hose.
F˜’¤F˜›^F˜˜a’˜¦Fm›F=˜›p˜"›hp’z^FF˜*FOpF˜*F"camV˜›^F˜’F"d˜"›˜›^F˜OpFdamF˜V"¤VF˜
F¦F˜¦Fm›˜›^F˜˜"›˜›^F˜z¤hz˜Fm=”˜¤’F˜›^F˜¦Fm›˜¦"d¦F
186
–˜˜˜˜"am›"amamV˜›^F˜
p˜Fhp¦F˜›^F˜OpFdamF˜V"¤VF
pFdamF˜^p’F˜"m=˜^p’F˜4d"hz
pFdamF˜V"¤VF˜"’’Fh*d©
aOO¤’apm˜z¤hz˜p¤›dF›
pFdamF˜V"¤VF
pFdamF˜V"¤VF˜4"*dF
187
–˜˜˜˜"am›"amamV˜›^F˜
p˜Fam’›"dd˜"˜OpFdamF˜V"¤VF
To reinstall a foreline gauge
"›Fa"d’˜mFF=F=9
Foreline gauge assembly (G1099-60545)
Screwdriver, flat-blade, large (8730-0002)
1 Connect a new foreline gauge assembly to the foreline hose.
2 Tighten the hose clamp.
3 Reconnect the foreline gauge cable to the foreline gauge.
4 Reconnect the foreline gauge assembly to the diffusion pump outlet.
5 Reconnect the MSD to the GC. See page 179.
6 If necessary, slide the foreline pump back under the analyzer chamber.
The foreline pump may be located on the floor, on the lab bench next to or behind
the MSD, or under the analyzer chamber at the back of the MSD.
7 Pump down the MSD. See page 60.
188
–˜˜˜˜"am›"amamV˜›^F˜
p˜Fam’›"dd˜"˜OpFdamF˜V"¤VF
pFdamF˜^p’F˜"m=˜^p’F˜4d"hz
pFdamF˜V"¤VF˜"’’Fh*d©
aOO¤’apm˜z¤hz˜p¤›dF›
pFdamF˜V"¤VF
pFdamF˜V"¤VF˜4"*dF
189
–˜˜˜˜"am›"amamV˜›^F˜
p˜Fhp¦F˜›^F˜˜4"da*"›apm˜¦"d¦F
To remove the EI calibration valve
"›Fa"d’˜mFF=F=9
Screwdriver, Torx T-15 (8710-1622)
1 Vent the MSD. See page 54.
2 Disconnect the calibration valve cable from the connector next to the fan.
3 Loosen the collar and remove the calibration vial.
Turn the collar counterclockwise as viewed from the bottom (vial side) of the
thumbscrew. Just loosen the collar, do not remove it.
Fhp¦amV˜›^F˜¦"d¦F˜§a›^˜›^F˜¦a"d˜am’›"ddF=˜4"m˜F’¤d›˜am˜da„¤a=˜4"da*"m›˜VF››amV˜am›p˜›^F˜
F’›a4›p˜pO˜›^F˜¦"d¦F˜a„¤a=˜am˜›^F˜F’›a4›p˜§add˜zF¦Fm›˜=aOO¤’apm˜pO˜˜am›p˜›^F˜
"m"d©«F˜4^"h*F˜Op˜›¤mamV˜O˜›^a’˜^"zzFm’:˜›^F˜¦"d¦F˜’^p¤d=˜*F˜Fzd"4F=
4 Remove the calibration valve from the front end plate.
190
–˜˜˜˜"am›"amamV˜›^F˜
p˜Fhp¦F˜›^F˜˜4"da*"›apm˜¦"d¦F
"da*"›apm˜¦"d¦F˜_amV
pm›˜Fm=˜zd"›F
"da*"›apm˜¦"d¦F
pdd"
"da*"›apm˜¦a"d
191
–˜˜˜˜"am›"amamV˜›^F˜
p˜Fam’›"dd˜›^F˜˜4"da*"›apm˜¦"d¦F
To reinstall the EI calibration valve
"›Fa"d’˜mFF=F=9
Calibration valve
for diffusion pump or standard turbo (G1099-60201)
for performance turbomolecular pump (G1099-60204)
O-ring, for calibration valve (0905-1217) – replace if the old O-ring is damaged
PFTBA (05971-60571) or other tuning compound
Screwdriver, Torx T-15 (8710-1622)
1 Remove the old calibration valve. See page 190.
2 Make sure the calibration valve O-ring is in place.
If the O-ring is worn or damaged, replace it.
3 Install the calibration valve.
Tighten the screws that hold it in place. Make sure you use the calibration valve
that matches the high vacuum pump in your MSD. The different calibration valves
have different restrictors. Using the wrong valve will interfere with tuning.
4 Reconnect the calibration valve cable to the connector next to the fan.
5 Remove the vial from the new calibration valve. See page 181.
The valve is supplied with a vial already installed.
6 Fill and reinstall the calibration vial. See page 183.
7 Pump down the MSD. See page 60.
8 Select ¤VF˜"d˜"d¦F from the Vacuum menu in the Diagnostics/Vacuum
Control view.
"ad¤F˜›p˜z¤VF˜›^F˜4"da*"›apm˜¦"d¦F˜§add˜F’¤d›˜am˜="h"VF˜›p˜›^F˜Oad"hFm›’˜"m=˜=F›F4›p
192
–˜˜˜˜"am›"amamV˜›^F˜
p˜Fam’›"dd˜›^F˜˜4"da*"›apm˜¦"d¦F
"da*"›apm˜¦"d¦F˜_amV
pm›˜Fm=˜zd"›F
"da*"›apm˜¦"d¦F
pdd"
"da*"›apm˜¦a"d
193
–˜˜˜˜"am›"amamV˜›^F˜
p˜Fzd"4F˜›^F˜O"m˜Op˜›^F˜^aV^˜¦"4¤¤h˜z¤hz
To replace the fan for the high vacuum pump
"›Fa"d’˜mFF=F=9
Fan (3160-1037)
Screwdriver, Torx T-15 (8710-1622)
1 Vent the MSD. See page 54.
2 Remove the upper and lower MSD covers. See page 52.
3 Disconnect the fan wiring from the connector on the MSD frame.
4 Remove the 4 fan screws and remove the fan.
Keep the 4 screws.
p˜mp›˜›p¤4^˜›^F˜^aV^˜¦"4¤¤h˜z¤hz˜˜^F˜^aV^˜¦"4¤¤h˜z¤hz’:˜F’zF4a"dd©˜›^F˜
=aOO¤’apm˜z¤hz:˜pzF"›F˜"›˜="mVFp¤’d©˜^aV^˜›FhzF"›¤F’˜"m=˜4p¤d=˜’›add˜*F˜^p›˜
Fmp¤V^˜›p˜*¤m˜©p¤
5 Disconnect the fan wiring and safety grill from the old fan.
The fan wiring ends in a small connector on the back of the fan.
6 Connect the fan wiring and safety grill to the new fan.
7 Install the new fan and reinstall the 4 screws.
The flow arrow on the side of the fan points towards the pump.
"cF˜’¤F˜›^F˜’"OF›©˜Vadd˜›^"›˜’^aFd=’˜›^F˜O"m˜*d"=F’˜a’˜am˜zd"4F
8 Connect the fan wiring to the fan connector on the MSD frame.
9 Reinstall the MSD covers.
10 Pump down the MSD. See page 60.
194
–˜˜˜˜"am›"amamV˜›^F˜
p˜Fzd"4F˜›^F˜O"m˜Op˜›^F˜^aV^˜¦"4¤¤h˜z¤hz
"m˜§aamV˜J˜=a’4pmmF4›˜Oph˜
*"4c˜’a=F˜pO˜O"m˜"d’p
"m
"OF›©˜Vadd
195
–˜˜˜˜"am›"amamV˜›^F˜
p˜Fhp¦F˜›^F˜›ap=F˜V"¤VF˜›¤*F
To remove the triode gauge tube
"›Fa"d’˜mFF=F=9
Gloves, clean, lint-free
large (8650-0030)
small (8650-0029)
1 Vent the MSD. See page 54.
2 Disconnect the cable from the triode gauge tube.
F¦F˜4pmmF4›˜p˜=a’4pmmF4›˜›^F˜4"*dF˜Oph˜›^F˜›ap=F˜V"¤VF˜›¤*F˜§^adF˜›^F˜˜a’˜
¤m=F˜¦"4¤¤h˜˜^F˜’›F’’˜4p¤d=˜4"¤’F˜›^F˜›¤*F˜›p˜ahzdp=F
3 Loosen the triode gauge collar by turning it counterclockwise.
Do not remove the collar.
4 Pull the triode gauge tube out of the collar.
5 Remove the baffle from the open end of the triode gauge tube.
Wear clean gloves when handling the baffle. If you set the baffle down, make sure
it is on a clean surface.
196
–˜˜˜˜"am›"amamV˜›^F˜
p˜Fhp¦F˜›^F˜›ap=F˜V"¤VF˜›¤*F
"OOdF
ap=F˜V"¤VF˜›¤*F
ap=F˜V"¤VF˜4"*dF
ap=F˜V"¤VF˜4pdd"
197
–˜˜˜˜"am›"amamV˜›^F˜
p˜Fam’›"dd˜"˜›ap=F˜V"¤VF˜›¤*F
To reinstall a triode gauge tube
"›Fa"d’˜mFF=F=9
Gloves, clean, lint-free
large (8650-0030)
small (8650-0029)
Triode gauge tube (0960-0897)
1 Remove the old triode gauge tube. See page 196.
2 Slide the baffle into the open end of the new triode gauge tube.
Wear clean gloves when handling the baffle and new triode gauge tube. If you set
the baffle down, make sure it is on a clean surface.
3 Slide the triode gauge tube into the collar.
Leave 3 mm of the metal sleeve exposed. Be sure the pins are oriented as in the
illustration.
4 Gently hand tighten the collar by turning it clockwise.
p˜mp›˜p¦F›aV^›Fm”˜©p¤˜4"m˜*F"c˜›^F˜›¤*F˜p˜="h"VF˜›^F˜_amV
5 Reconnect the cable from the gauge controller to the triode gauge tube.
Route the cable so it does not put stress on the triode gauge tube.
F˜4"FO¤d˜§^Fm˜"››"4^amV˜›^F˜4"*dF˜pp˜h¤4^˜Op4F˜4"m˜*F"c˜›^F˜›¤*F˜p˜mp›˜hp¦F˜
›^F˜4pm›pddF˜p˜4"*dF˜§^adF˜4pmmF4›F=˜›p˜›^F˜›¤*F
6 Pump down the MSD. See page 60.
198
–˜˜˜˜"am›"amamV˜›^F˜
p˜Fam’›"dd˜"˜›ap=F˜V"¤VF˜›¤*F
"OOdF
ap=F˜V"¤VF˜›¤*F
ap=F˜V"¤VF˜4"*dF
ap=F˜V"¤VF˜4pdd"
199
–˜˜˜˜"am›"amamV˜›^F˜
p˜d¤*a4"›F˜›^F˜’a=F˜zd"›F˜_amV
To lubricate the side plate O-ring
"›Fa"d’˜mFF=F=9
Cloths, clean (05980-60051)
Gloves, clean, lint-free
large (8650-0030)
small (8650-0029)
Grease, Apiezon L, high vacuum (6040-0289)
The side plate O-ring needs a thin coat of grease to ensure a good vacuum seal. If
the side plate O-ring appears dry, or does not seal correctly, lubricate it using this
procedure. A good test is to wipe off the side plate with methanol, then close the
analyzer chamber. If the O-ring has enough grease on it, it will leave a faint trace
on the side plate.
"4¤¤h˜’F"d’˜p›^F˜›^"m˜›^F˜’a=F˜zd"›F˜_amV˜"m=˜¦Fm›˜¦"d¦F˜_amV˜=p˜mp›˜mFF=˜›p˜*F˜
d¤*a4"›F=˜˜¤*a4"›amV˜p›^F˜’F"d’˜4"m˜am›FOFF˜§a›^˜›^Fa˜4pF4›˜O¤m4›apm
1 Vent the MSD. See page 54.
2 Open the analyzer chamber. See page 56.
3 Use a clean, lint-free cloth or glove to spread a thin coat of high vacuum
grease only on the exposed surface of the O-ring.
p˜mp›˜¤’F˜"m©›^amV˜F¨4Fz›˜›^F˜F4phhFm=F=˜¦"4¤¤h˜VF"’F˜¨4F’’˜VF"’F˜4"m˜›"z˜"a˜
"m=˜=a›˜
F"’F˜pm˜’¤O"4F’˜pO˜›^F˜_amV˜p›^F˜›^"m˜›^F˜F¨zp’F=˜’¤O"4F˜4"m˜›"z˜"a:˜
F’¤d›amV˜am˜"a˜’zacF’˜=¤amV˜pzF"›apm
4 Use a clean, lint-free cloth or glove to wipe away excess grease.
If the O-ring looks shiny, there is too much grease on it.
5 Close the analyzer chamber. See page 58.
6 Pump down the MSD. See page 60.
200
–˜˜˜˜"am›"amamV˜›^F˜
p˜d¤*a4"›F˜›^F˜’a=F˜zd"›F˜_amV
a=F˜zd"›F˜_amV
FF˜"d’p
A video demonstration of this procedure is on the
5973N MSD Maintenance CD-ROM.
201
To lubricate the vent valve O-ring
"›Fa"d’˜mFF=F=9
Cloths, clean (05980-60051)
Gloves, clean, lint-free
large (8650-0030)
small (8650-0029)
Grease, Apiezon L, high vacuum (6040-0289)
O-ring, vent valve (0905-1217) - replace if the old O-ring is worn or damaged
The vent valve O-ring needs a thin coat of lubrication to ensure a good vacuum
seal and smooth operation. If the vent valve O-ring does not turn smoothly, or
does not seal correctly, lubricate it using this procedure.
"4¤¤h˜’F"d’˜p›^F˜›^"m˜›^F˜’a=F˜zd"›F˜_amV˜"m=˜¦Fm›˜¦"d¦F˜_amV˜=p˜mp›˜mFF=˜›p˜*F˜
d¤*a4"›F=˜˜¤*a4"›amV˜p›^F˜’F"d’˜4"m˜am›FOFF˜§a›^˜›^Fa˜4pF4›˜O¤m4›apm
1 Vent the MSD. See page 54.
2 Completely remove the vent valve knob.
3 Inspect the O-ring.
If the O-ring appears damaged, replace it.
4 Use a clean, lint-free cloth or glove to spread a thin coat of high vacuum
grease on the exposed surface of the O-ring.
¨4F’’˜VF"’F˜4"m˜›"z˜"a˜"m=˜=a›˜˜
F"’F˜pm˜’¤O"4F’˜pO˜›^F˜_amV˜p›^F˜›^"m˜›^F˜F¨zp’F=˜
’¤O"4F˜4"m˜›"z˜"a:˜F’¤d›amV˜am˜"a˜’zacF’˜=¤amV˜pzF"›apm
5 Use a clean, lint-free cloth or glove to wipe away excess grease.
If the O-ring looks shiny, there is too much grease on it.
202
–˜˜˜˜"am›"amamV˜›^F˜
p˜d¤*a4"›F˜›^F˜¦Fm›˜¦"d¦F˜_amV
pm›˜Fm=˜zd"›F
Fm›˜¦"d¦F˜_amV
Fm›˜¦"d¦F˜cmp*
6 Reinstall the vent valve knob.
F˜¦F©˜4"FO¤d˜§^Fm˜Fam’›"ddamV˜›^F˜¦Fm›˜¦"d¦F˜cmp*˜›˜a’˜¦F©˜F"’©˜›p˜4p’’˜›^F"=˜›^F˜
cmp*˜"m=˜="h"VF˜›^F˜›^F"=’˜am˜›^F˜Opm›˜Fm=˜zd"›F˜F˜’¤F˜›^F˜_amV˜’›"©’˜am˜zd"4F
7 Pump down the MSD. See page 60.
203
Maintaining the analyzer
The analyzer requires no periodic maintenance
None of the analyzer components requires periodic maintenance. Some
tasks, however, must be performed when MSD behavior indicates they are
necessary. These tasks include:
• Cleaning the ion source
• Replacing filaments
• Replacing the electron multiplier horn
Troubleshooting the MSD, on page 93 provides information about symptoms that indicate the need for analyzer maintenance. The troubleshooting
material in the online help in the MSD ChemStation software provides more
extensive information.
Care must be taken during analyzer maintenance to keep
components clean
Analyzer maintenance involves opening the analyzer chamber and removing
parts from the analyzer. During analyzer maintenance procedures, care
must be take to avoid contaminating the analyzer or interior of the analyzer
chamber. Clean gloves should be worn during all analyzer maintenance
procedures. After cleaning, parts must be thoroughly baked out before they
are reinstalled. After cleaning, analyzer parts should be placed only on clean,
lint-free cloths.
O˜mp›˜=pmF˜4pF4›d©:˜"m"d©«F˜h"am›Fm"m4F˜4"m˜am›p=¤4F˜4pm›"ham"m›’˜am›p˜›^F˜
^F˜"m"d©«F˜pzF"›F’˜"›˜^aV^˜›FhzF"›¤F’˜p˜mp›˜›p¤4^˜"m©˜z"›˜¤m›ad˜©p¤˜"F˜’¤F˜
a›˜a’˜4ppd
204
–˜˜˜˜"am›"amamV˜›^F˜
Some parts can be damaged by electrostatic discharge
The wires, contacts, and cables connected to the analyzer components can
carry electrostatic discharges (ESD) to the electronics boards to which they
are connected. This is especially true of the mass filter (quadrupole) contact
wires which can conduct ESD to sensitive components on the side board.
ESD damage may not cause immediate failure but will gradually degrade
performance and stability. See page 158 for more information.
dF4›p’›"›a4˜=a’4^"VF’˜›p˜"m"d©«F˜4phzpmFm›’˜"F˜4pm=¤4›F=˜›p˜›^F˜’a=F˜*p"=˜§^FF˜
›^F©˜4"m˜="h"VF˜’Fm’a›a¦F˜4phzpmFm›’˜F"˜"˜Vp¤m=F=˜"m›a_’›"›a4˜§a’›˜’›"z˜
|’FF˜z"VF˜sQG}˜"m=˜›"cF˜p›^F˜"m›a_’›"›a4˜zF4"¤›apm’˜*FOpF˜©p¤˜pzFm˜›^F˜"m"d©«F˜
4^"h*F
Some analyzer parts should not be disturbed
The mass filter (quadrupole) requires no periodic maintenance. In general,
the mass filter should never be disturbed. In the event of extreme contamination, it can be cleaned, but such cleaning should only be done by a trained
Agilent Technologies service representative. The HED ceramic must never
be touched.
m4pF4›˜^"m=damV˜p˜4dF"mamV˜pO˜›^F˜h"’’˜Oad›F˜4"m˜="h"VF˜a›˜"m=˜^"¦F˜"˜’Fap¤’:˜mFV"›a¦F˜
FOOF4›˜pm˜am’›¤hFm›˜zFOph"m4F
p˜mp›˜›p¤4^˜›^F˜˜4F"ha4˜am’¤d"›p˜
More information is available
If you need more information about the locations or functions of analyzer
components, refer to Chapter 10, Analyzer, on page 297.
Most of the procedures in this chapter are illustrated with video clips in the
5973N MSD Maintenance CD-ROM.
205
–˜˜˜˜"am›"amamV˜›^F˜
p˜Fhp¦F˜›^F˜apm˜’p¤4F
To remove the ion source
"›Fa"d’˜mFF=F=9
Gloves, clean, lint-free
large (8650-0030)
small (8650-0029)
Pliers, long-nose (8710-1094)
1 Vent the MSD. See page 54.
2 Open the analyzer chamber. See page 56.
Make sure you use an anti-static wrist strap and take other anti-static precautions
before touching analyzer components.
3 Disconnect the seven wires from the ion source.
Do not bend the wires any more than necessary.
¤dd˜pm˜›^F˜4pmmF4›p’:˜mp›˜pm˜›^F˜§aF’
4 Disconnect the wires for the ion source heater and temperature sensor
from the feedthrough board.
5 Remove the thumbscrews that hold the ion source in place.
6 Pull the ion source out of the source radiator.
^F˜"m"d©«F˜pzF"›F’˜"›˜^aV^˜›FhzF"›¤F’˜p˜mp›˜›p¤4^˜"m©˜z"›˜¤m›ad˜©p¤˜"F˜’¤F˜
a›˜a’˜4ppd
206
–˜˜˜˜"am›"amamV˜›^F˜
p˜Fhp¦F˜›^F˜apm˜’p¤4F
p¤4F˜"=a"›p
FF=›^p¤V^˜*p"=
pm˜’p¤4F
^¤h*’4F§
^¤h*’4F§
p¤4F˜^F"›F˜"m=˜
›FhzF"›¤F˜’Fm’p˜§aF’
207
–˜˜˜˜"am›"amamV˜›^F˜
p˜=a’"’’Fh*dF˜›^F˜apm˜’p¤4F
To disassemble the ion source
"›Fa"d’˜mFF=F=9
Gloves, clean, lint-free
large (8650-0030)
small (8650-0029)
Hex ball driver, 1.5-mm (8710-1570)
Hex ball driver, 2.0-mm (8710-1804)
Hex nut driver, 5.5-mm (8710-1220)
Wrench, open-end, 10-mm (8710-2353)
1 Remove the ion source. See page 206.
2 Remove the filaments.
3 Separate the repeller assembly from the source body.
The repeller assembly includes the source heater assembly, repeller, and related
parts.
4 Remove the repeller.
5 Unscrew the interface socket.
A 10-mm open-end wrench fits on the flats on the interface socket.
6 Remove the setscrew for the lenses.
7 Push the lenses out of the source body.
208
–˜˜˜˜"am›"amamV˜›^F˜
p˜=a’"’’Fh*dF˜›^F˜apm˜’p¤4F
m›FO"4F˜’p4cF›
p¤4F˜*p=©
F›˜’4F§
FzFddF
FzFddF˜am’¤d"›p
ad"hFm›
p¤4F˜^F"›F˜"’’Fh*d©
FzFddF˜am’¤d"›p
"’^F
FzFddF˜m¤›˜|=p˜mp›˜p¦F_
›aV^›Fm}
pm˜Op4¤’˜dFm’
"§p¤›˜4©dam=F
"§p¤›˜zd"›F
Fm’˜am’¤d"›p˜|pmF˜pO˜"˜z"a}
m›"m4F˜dFm’
209
–˜˜˜˜"am›"amamV˜›^F˜
p˜4dF"m˜›^F˜apm˜’p¤4F
To clean the ion source
"›Fa"d’˜mFF=F=9
Abrasive paper (5061-5896)
Alumina abrasive powder (8660-0791)
Aluminum foil, clean
Cloths, clean (05980-60051)
Cotton swabs (5080-5400)
Glass beakers, 500 ml
Gloves, clean, lint-free
large (8650-0030)
small (8650-0029)
Solvents
acetone, reagent-grade
methanol, reagent-grade
methylene chloride, reagent grade
Ultrasonic bath
1 Disassemble the ion source. See page 208.
2 Collect the following parts to be cleaned:
•
•
•
•
•
•
•
Repeller
Interface socket
Source body
Drawout plate
Drawout cylinder
Ion focus lens
Entrance lens
These are the parts that contact the sample or ion beam. The other parts normally
should not require cleaning.
O˜am’¤d"›p’˜"F˜=a›©:˜4dF"m˜›^Fh˜§a›^˜"˜4p››pm˜’§"*˜="hzFmF=˜§a›^˜F"VFm›_V"=F˜
hF›^"mpd˜˜O˜›^"›˜=pF’˜mp›˜4dF"m˜›^F˜am’¤d"›p’:˜Fzd"4F˜›^Fh˜˜p˜mp›˜"*"’a¦Fd©˜p˜
¤d›"’pma4"dd©˜4dF"m˜›^F˜am’¤d"›p’
210
–˜˜˜˜"am›"amamV˜›^F˜
p˜4dF"m˜›^F˜apm˜’p¤4F
p¤4F˜*p=©
FzFddF
m›FO"4F˜’p4cF›
"§p¤›˜zd"›F
"§p¤›˜4©dam=F
pm˜Op4¤’˜dFm’
m›"m4F˜dFm’
211
–˜˜˜˜"am›"amamV˜›^F˜
p˜4dF"m˜›^F˜apm˜’p¤4F
"bp˜4pm›"ham"›apm
In the event of a diffusion pump backstream or other major contamination, the
other source components must be cleaned (ultrasonically but not abrasively) or
replaced.
^F˜Oad"hFm›’:˜’p¤4F˜^F"›F˜"’’Fh*d©:˜"m=˜am’¤d"›p’˜4"mmp›˜*F˜4dF"mF=˜¤d›"’pma4"dd©˜˜
Fzd"4F˜›^F’F˜4phzpmFm›’˜aO˜h"bp˜4pm›"ham"›apm˜p44¤’
3 Abrasively clean the surfaces that contact the sample or ion beam.
Use an abrasive slurry of alumina powder and reagent-grade methanol on a cotton
swab. Use enough force to remove all discolorations. Polishing the parts is not necessary; small scratches will not harm performance. Also abrasively clean the discolorations where electrons from the filaments enter the source body.
4 Rinse away all abrasive residue with reagent-grade methanol.
Make sure all abrasive residue is rinsed way before ultrasonic cleaning. If the
methanol becomes cloudy or contains visible particles, rinse again.
5 Separate the parts that were abrasively cleaned from the parts that were
not abrasively cleaned.
6 Ultrasonically clean the parts for 15 minutes in each of the following
solvents:
Ultrasonically clean each group of parts separately.
• Methylene chloride (reagent-grade)
• Acetone (reagent-grade)
• Methanol (reagent-grade)
dd˜pO˜›^F’F˜’pd¦Fm›’˜"F˜^"«"=p¤’˜˜pc˜am˜"˜O¤hF˜^pp=˜"m=˜›"cF˜"dd˜"zzpza"›F˜
zF4"¤›apm’
7 Place the parts in a clean beaker. Loosely cover the beaker with clean
aluminum foil (dull side down).
8 Dry the cleaned parts in an oven at 100 ° – 150 °C for 30 minutes.
F›˜›^F’F˜z"›’˜4ppd˜*FOpF˜©p¤˜^"m=dF˜›^Fh
212
–˜˜˜˜"am›"amamV˜›^F˜
p˜4dF"m˜›^F˜apm˜’p¤4F
"cF˜4"F˜›p˜"¦pa=˜F4pm›"ham"›amV˜4dF"mF=˜"m=˜=aF=˜z"›’˜¤›˜pm˜mF§:˜4dF"m˜Vdp¦F’˜
*FOpF˜^"m=damV˜›^F˜z"›’˜p˜mp›˜’F›˜›^F˜4dF"mF=˜z"›’˜pm˜"˜=a›©˜’¤O"4F˜F›˜›^Fh˜pmd©˜pm˜
4dF"m:˜dam›_OFF˜4dp›^’
213
–˜˜˜˜"am›"amamV˜›^F˜
p˜F"’’Fh*dF˜›^F˜apm˜’p¤4F
To reassemble the ion source
"›Fa"d’˜mFF=F=9
Gloves, clean, lint-free
large (8650-0030)
small (8650-0029)
Hex ball driver, 1.5-mm (8710-1570)
Hex ball driver, 2.0-mm (8710-1804)
Hex nut driver, 5.5-mm (8710-1220)
Wrench, open-end, 10-mm (8710-2353)
1 Slide the drawout plate and the drawout cylinder into the source body.
2 Assemble the ion focus lens, entrance lens, and lens insulators.
3 Slide the assembled parts into the source body.
4 Install the setscrew that holds the lenses in place.
5 Reinstall the repeller, repeller insulators, washer, and repeller nut into
the source heater assembly.
The resulting assembly is called the repeller assembly.
p˜mp›˜p¦F›aV^›Fm˜›^F˜FzFddF˜m¤›:˜p˜›^F˜4F"ha4˜FzFddF˜am’¤d"›p’˜§add˜*F"c˜§^Fm˜›^F˜
’p¤4F˜^F"›’˜¤z˜^F˜m¤›˜’^p¤d=˜pmd©˜*F˜‰OamVF_›aV^›Š
6 Reconnect the repeller assembly to the source body.
The repeller assembly includes the source heater assembly, repeller, and related
parts.
7 Reinstall the filaments.
8 Reinstall the interface socket.
p˜mp›˜p¦F›aV^›Fm˜›^F˜am›FO"4F˜’p4cF›˜¦F›aV^›FmamV˜4p¤d=˜’›az˜›^F˜›^F"=’
214
–˜˜˜˜"am›"amamV˜›^F˜
p˜F"’’Fh*dF˜›^F˜apm˜’p¤4F
m›FO"4F˜’p4cF›
p¤4F˜*p=©
F›˜’4F§
FzFddF
FzFddF˜am’¤d"›p
ad"hFm›
p¤4F˜^F"›F˜"’’Fh*d©
FzFddF˜am’¤d"›p
"’^F
FzFddF˜m¤›
|=p˜mp›˜p¦F_›aV^›Fm}
pm˜Op4¤’˜dFm’
"§p¤›˜4©dam=F
"§p¤›˜zd"›F
Fm’˜am’¤d"›p˜|pmF˜pO˜"˜z"a}
m›"m4F˜dFm’
215
–˜˜˜˜"am›"amamV˜›^F˜
p˜Fam’›"dd˜›^F˜apm˜’p¤4F
To reinstall the ion source
"›Fa"d’˜mFF=F=9
Gloves, clean, lint-free
large (8650-0030)
small (8650-0029)
Pliers, long-nose (8710-1094)
1 Slide the ion source into the source radiator.
2 Install and hand tighten the source thumbscrews.
Do not overtighten the thumbscrews.
3 Reconnect the 7 wires to the appropriate pins on the ion source.
aF˜4pdp
pmmF4›’˜›p
¤h*F˜pO˜dF"=’
d¤F
m›"m4F˜dFm’
s
"mVF
pm˜Op4¤’
s
^a›F
ad"hFm›˜s˜|›pz˜Oad"hFm›}
¢
F=
FzFddF
s
d"4c
ad"hFm›˜¢˜|*p››ph˜Oad"hFm›}
¢
4 Reconnect the source heater and temperature sensor wires to the pins on
the feedthrough board.
5 Close the analyzer chamber. See page 58.
6 Pump down the MSD. See page 60.
216
–˜˜˜˜"am›"amamV˜›^F˜
p˜Fam’›"dd˜›^F˜apm˜’p¤4F
p¤4F˜"=a"›p
FF=›^p¤V^˜*p"=
pm˜’p¤4F
^¤h*’4F§
^¤h*’4F§
p¤4F˜^F"›F˜"m=˜’Fm’p˜
§aF’
pm˜Op4¤’˜zam˜|p"mVF˜§aF}
m›"m4F˜dFm’˜zam˜|*d¤F˜§aF}
217
–˜˜˜˜"am›"amamV˜›^F˜
p˜Fhp¦F˜"˜Oad"hFm›
To remove a filament
"›Fa"d’˜mFF=F=9
Gloves, clean, lint-free
large (8650-0030)
small (8650-0029)
Hex ball driver, 1.5-mm (8710-1570)
1 Vent the MSD. See page 54.
2 Open the analyzer chamber. See page 56.
3 Remove the ion source. See page 206.
4 Remove the filament(s) to be replaced.
^F˜"m"d©«F˜pzF"›F’˜"›˜^aV^˜›FhzF"›¤F’˜p˜mp›˜›p¤4^˜"m©˜z"›˜¤m›ad˜©p¤˜"F˜’¤F˜
a›˜a’˜4ppd
218
–˜˜˜˜"am›"amamV˜›^F˜
p˜Fhp¦F˜"˜Oad"hFm›
ad"hFm›˜s
ad"hFm›˜¢
219
–˜˜˜˜"am›"amamV˜›^F˜
p˜Fam’›"dd˜"˜Oad"hFm›
To reinstall a filament
"›Fa"d’˜mFF=F=9
Filament assembly (G1099-60053)
Gloves, clean, lint-free
large (8650-0030)
small (8650-0029)
Hex ball driver, 1.5-mm (8710-1570)
1 Install the new filament.
2 Reinstall the ion source. See page 216.
3 Close the analyzer chamber. See page 58.
4 Pump down the MSD. See page 60.
5 Autotune the MSD. See page 50.
6 In the Edit Parameters dialog box (Instrument/Edit MS Tune Parameters),
select the other filament.
7 Autotune the MSD again.
8 Select and use the filament that give the best results.
If you decide to use the first filament, run Autotune again to make sure the tune
parameters are compatible with the filament.
9 Select "¦F˜¤mF˜""hF›F’ from the File menu.
220
–˜˜˜˜"am›"amamV˜›^F˜
p˜Fam’›"dd˜"˜Oad"hFm›
ad"hFm›˜s
ad"hFm›˜¢
221
–˜˜˜˜"am›"amamV˜›^F˜
p˜Fhp¦F˜›^F˜^F"›F˜"m=˜’Fm’p˜Oph˜›^F˜apm˜’p¤4F
To remove the heater and sensor from the ion source
"›Fa"d’˜mFF=F=9
Gloves, clean, lint-free
large (8650-0030)
small (8650-0029)
Hex ball driver, 1.5-mm (8710-1570)
Hex ball driver, 2.0-mm (8710-1804)
Hex nut driver, 5.5-mm (8710-1220)
1 Vent the MSD. See page 54.
2 Open the analyzer chamber. See page 56.
3 Remove the ion source from the source radiator. See page 206.
4 Remove the filaments.
5 Remove the repeller assembly.
The repeller assembly includes the source heater assembly, repeller, and related
parts.
6 Remove the repeller nut, washer, repeller insulators, and repeller.
You do not need to remove the heater and temperature sensor from the
heater block. The new source heater assembly includes all three parts already
assembled.
222
–˜˜˜˜"am›"amamV˜›^F˜
p˜Fhp¦F˜›^F˜^F"›F˜"m=˜’Fm’p˜Oph˜›^F˜apm˜’p¤4F
p¤4F˜*p=©
FzFddF
FzFddF˜am’¤d"›p
ad"hFm›
FzFddF˜am’¤d"›p
"’^F
FzFddF˜m¤›
ad"hFm›
p¤4F˜^F"›F˜"’’Fh*d©
223
–˜˜˜˜"am›"amamV˜›^F˜
p˜Fam’›"dd˜›^F˜^F"›F˜"m=˜’Fm’p˜am˜›^F˜apm˜’p¤4F
To reinstall the heater and sensor in the ion source
"›Fa"d’˜mFF=F=9
Gloves, clean, lint-free
large (8650-0030)
small (8650-0029)
Hex ball driver, 1.5-mm (8710-1570)
Hex ball driver, 2.0-mm (8710-1804)
Hex nut driver, 5.5-mm (8710-1220)
Source heater assembly (G1099-60177)
1 Unpack the new source heater assembly.
The heater, temperature sensor, and heater block are already assembled.
2 Reinstall the repeller, repeller insulators, washer, and repeller nut.
The resulting assembly is called the repeller assembly.
p˜mp›˜p¦F›aV^›Fm˜›^F˜FzFddF˜m¤›:˜p˜›^F˜4F"ha4˜FzFddF˜am’¤d"›p’˜§add˜*F"c˜§^Fm˜›^F˜
’p¤4F˜^F"›’˜¤z˜^F˜m¤›˜’^p¤d=˜pmd©˜*F˜‰OamVF_›aV^›Š
3 Connect the repeller assembly to the source body.
4 Reinstall the filaments.
5 Reinstall the ion source in the source radiator. See page 216.
Do not forget to reconnect the wires from the feedthrough board to the ion source.
Do not forget to reconnect the heater and temperature sensor wires to the
feedthrough board.
6 Close the analyzer chamber. See page 58.
7 Pump down the MSD. See page 60.
224
–˜˜˜˜"am›"amamV˜›^F˜
p˜Fam’›"dd˜›^F˜^F"›F˜"m=˜’Fm’p˜am˜›^F˜apm˜’p¤4F
p¤4F˜*p=©
FzFddF
FzFddF˜am’¤d"›p
ad"hFm›
FzFddF˜am’¤d"›p
"’^F
FzFddF˜m¤›
ad"hFm›
p¤4F˜^F"›F˜"’’Fh*d©
225
–˜˜˜˜"am›"amamV˜›^F˜
p˜Fhp¦F˜›^F˜^F"›F˜"m=˜’Fm’p˜Oph˜›^F˜h"’’˜Oad›F
To remove the heater and sensor from the mass filter
"›Fa"d’˜mFF=F=9
Gloves, clean, lint-free
large (8650-0030)
small (8650-0029)
Hex ball driver, 1.5-mm (8710-1570)
Hex ball driver, 2.0-mm (8710-1804)
1 Vent the MSD. See page 54.
2 Open the analyzer chamber. See page 56.
3 Disconnect the mass filter heater and temperature sensor wires from the
feedthrough board.
4 Remove the mass filter heater assembly from the mass filter radiator.
p˜mp›˜›p¤4^˜›^F˜h"’’˜Oad›F˜4pm›"4›˜dF"=’˜^a’˜4p¤d=˜4"¤’F˜˜="h"VF˜›p˜›^F˜’a=F˜*p"=
226
–˜˜˜˜"am›"amamV˜›^F˜
p˜Fhp¦F˜›^F˜^F"›F˜"m=˜’Fm’p˜Oph˜›^F˜h"’’˜Oad›F
"’’˜Oad›F˜4pm›"4›˜dF"=˜J˜
=p˜mp›˜›p¤4^M
"’’˜Oad›F˜"=a"›p
"’’˜Oad›F˜^F"›F˜"’’Fh*d©
FF=›^p¤V^˜*p"=
"’’˜Oad›F˜4pm›"4›˜dF"=˜J˜
=p˜mp›˜›p¤4^M
227
–˜˜˜˜"am›"amamV˜›^F˜
p˜Fam’›"dd˜›^F˜^F"›F˜"m=˜’Fm’p˜am˜›^F˜h"’’˜Oad›F
To reinstall the heater and sensor in the mass filter
"›Fa"d’˜mFF=F=9
Gloves, clean, lint-free
large (8650-0030)
small (8650-0029)
Hex ball driver, 1.5-mm (8710-1570)
Hex ball driver, 2.0-mm (8710-1804)
Mass filter heater assembly (G1099-60172)
1 Unpack the new mass filter heater assembly.
The heater, temperature sensor, and heater block are already assembled.
2 Install the heater assembly on top of the mass filter radiator.
3 Connect the heater and temperature sensor wires to the feedthrough
board.
4 Close the analyzer chamber. See page 58.
5 Pump down the MSD. See page 60.
p˜mp›˜›p¤4^˜›^F˜h"’’˜Oad›F˜4pm›"4›˜dF"=’˜^a’˜4p¤d=˜4"¤’F˜˜="h"VF˜›p˜›^F˜’a=F˜*p"=
228
–˜˜˜˜"am›"amamV˜›^F˜
p˜Fam’›"dd˜›^F˜^F"›F˜"m=˜’Fm’p˜am˜›^F˜h"’’˜Oad›F
"’’˜Oad›F˜4pm›"4›˜dF"=˜J˜
=p˜mp›˜›p¤4^M
"’’˜Oad›F˜"=a"›p
"’’˜Oad›F˜^F"›F˜"’’Fh*d©
FF=›^p¤V^˜*p"=
"’’˜Oad›F˜4pm›"4›˜dF"=˜J˜
=p˜mp›˜›p¤4^M
229
–˜˜˜˜"am›"amamV˜›^F˜
p˜Fzd"4F˜›^F˜FdF4›pm˜h¤d›azdaF˜^pm
To replace the electron multiplier horn
"›Fa"d’˜mFF=F=9
Electron multiplier horn (05971-80103)
Gloves, clean, lint-free
large (8650-0030)
small (8650-0029)
1 Vent the MSD. See page 54.
2 Open the analyzer chamber. See page 56.
3 Open the retaining clip.
Pinch the two arms of the clip together and swing the clip down.
4 Remove the electron multiplier horn.
5 Install the new electron multiplier horn.
6 Close the retaining clip.
The signal pin on the horn should rest on the outside of the loop in the contact
strip. Do not put the signal pin on the inside of the loop in the contact strip. Incorrect installation will result in poor sensitivity or no signal.
7 Close the analyzer chamber. See page 58.
8 Pump down the MSD. See page 60.
230
–˜˜˜˜"am›"amamV˜›^F˜
p˜Fzd"4F˜›^F˜FdF4›pm˜h¤d›azdaF˜^pm
pm›"4›˜’›az
F›"amamV˜4daz
dF4›pm˜h¤d›azdaF˜^pm
aVm"d˜zam
aVm"d˜zam
231
Maintaining the GC/MSD interface
The GC/MSD interface requires no periodic maintenance
Rarely, the heater cartridge in the GC/MSD interface fails. In those cases, it
is necessary to replace the heater and sensor. This section contains procedures for removing the heater and sensor and installing new ones.
More information is available
If you need more information about the locations or functions of GC/MSD
interface components, refer to GC/MSD Interface, on page 291.
Most of the procedures in this chapter are illustrated with video clips in the
5973N MSD Maintenance CD-ROM.
232
–˜˜˜˜"am›"amamV˜›^F˜
˜am›FO"4F˜4p¦F
˜am›FO"4F˜am’¤d"›p
˜am›FO"4F˜^F"›F˜4d"hz
˜am›FO"4F˜§Fd=hFm›
m›FO"4F˜›az˜’F"d
˜apma«"›apm˜4^"h*F
p¤4F˜"=a"›p
m"d©«F˜4^"h*F
F"›F—’Fm’p˜4"*dF
F"VFm›˜V"’˜amdF›
˜amdF›
233
–˜˜˜˜"am›"amamV˜›^F˜
p˜Fhp¦F˜›^F˜
—˜am›FO"4F˜^F"›F˜"m=˜’Fm’p
To remove the GC/MSD interface heater and sensor
"›Fa"d’˜mFF=F=9
Screwdriver, Torx T-15 (8710-1622)
Hex driver, 1.5 mm (8710-1570)
1 Vent the MSD. See page 54.
Make sure you turn off the GC/MSD interface heater. This heater is controlled and
powered by the GC.
2 Separate the MSD from the GC. See page 171.
3 Remove the cover from the GC/MSD interface.
^F˜
—˜am›FO"4F˜pzF"›F’˜"˜¦F©˜^aV^˜›FhzF"›¤F’˜˜›˜a’˜"d’p˜§Fdd˜am’¤d"›F=˜˜
"cF˜’¤F˜›^F˜am›FO"4F˜a’˜4ppd˜*FOpF˜©p¤˜›p¤4^˜a›
4 Slide the insulation off of the GC/MSD interface.
5 Loosen the two heater sleeve screws.
6 Slide the heater sleeve off of the GC/MSD interface.
It may be necessary to gently pry open the slot in the heater sleeve to loosen the
heater sleeve from the interface.
7 Loosen the setscrew and remove the heater and temperature sensor from
the heater sleeve.
Heat and oxidation often result in a heater, or less frequently a temperature sensor, being “welded” inside the heater sleeve. The holes for the heater and sensor
pass all the way through the heater sleeve. A rod can be inserted to drive the
stuck part out. However, to function correctly the heater and sensor must have
perfect contact with their holes. If a heater or sensor is difficult to remove, the
holes will probably be damaged enough that the heater sleeve should be replaced.
Polishing the holes is not an acceptable solution since it will enlarge the holes.
m’›"ddamV˜"˜mF§˜^F"›F˜"m=˜’Fm’p˜am˜"˜="h"VF=˜^F"›F˜’dFF¦F˜§add˜F’¤d›˜am˜zpp˜
zFOph"m4F˜pO˜›^F˜^F"›F=˜«pmF˜"m=˜4p¤d=˜F=¤4F˜›^F˜daOF›ahF˜pO˜›^F˜mF§˜z"›’
234
–˜˜˜˜"am›"amamV˜›^F˜
p˜Fhp¦F˜›^F˜
—˜am›FO"4F˜^F"›F˜"m=˜’Fm’p
F"›F˜’dFF¦F
F"›F˜’dFF¦F˜’4F§
F"›F˜’dFF¦F˜’4F§
F›˜’4F§
FhzF"›¤F˜’Fm’p
F"›F
m›FO"4F˜§Fd=F=˜"’’Fh*d©
m’¤d"›apm
p¦F
235
–˜˜˜˜"am›"amamV˜›^F˜
p˜Fam’›"dd˜›^F˜
—˜am›FO"4F˜^F"›F˜"m=˜’Fm’p
To reinstall the GC/MSD interface heater and sensor
"›Fa"d’˜mFF=F=9
GC/MSD interface heater assembly (G1099-60107)
Heater sleeve (G1099-20210) – replace the old sleeve if it is damaged
Screwdriver, Torx T-15 (8710-1622)
Hex driver, 1.5 mm (8710-1570)
1 Slide the new heater and temperature sensor into the heater sleeve.
2 Reinstall the setscrew.
3 Slide the heater sleeve onto the GC/MSD interface.
Align the heater sleeve so the screws are on top. Tighten the screws evenly.
4 Slide the insulation onto the GC/MSD interface.
^FF˜a’˜"˜’^"ddp§˜Vpp¦F˜"dpmV˜›^F˜ammF˜’¤O"4F˜pO˜›^F˜am’¤d"›apm˜˜^a’˜Vpp¦F˜h¤’›˜damF˜
¤z˜§a›^˜›^F˜^F"=’˜pO˜›^F˜’4F§’˜am˜›^F˜^F"›F˜’dFF¦F˜˜O˜a›˜=pF’˜mp›:˜©p¤˜4"m˜4"4c˜p˜
p›^F§a’F˜="h"VF˜›^F˜am’¤d"›apm
5 Reinstall the GC/MSD interface cover.
Make sure the wires from the heater and sensor pass through the cutout in the
interface cover.
6 Reconnect the MSD to the GC. See page 179.
7 Make sure you reconnect the GC/MSD interface cable to the GC. Make
sure you reinstall the capillary column.
8 Pump down the MSD. See page 60.
9 Turn on the GC.
Re-establish appropriate temperature setpoints for the GC/MSD interface and GC
oven.
236
–˜˜˜˜"am›"amamV˜›^F˜
p˜Fam’›"dd˜›^F˜
—˜am›FO"4F˜^F"›F˜"m=˜’Fm’p
F"›F˜’dFF¦F
F"›F˜’dFF¦F˜’4F§
F"›F˜’dFF¦F˜’4F§
F›˜’4F§
FhzF"›¤F˜’Fm’p
F"›F
m›FO"4F˜§Fd=F=˜"’’Fh*d©
m’¤d"›apm
p¦F
237
–˜˜˜˜"am›"amamV˜›^F˜
Maintaining the electronics
The MSD electronics do not require any scheduled maintenance
None of the electronic components of the MSD need to be replaced on a
regular schedule. None of the electronic components in the MSD need to be
adjusted or calibrated on a regular schedule. Avoid unnecessary handling of
the MSD electronics.
Very few of the electronic components are operator serviceable
The primary fuses can be replaced by the operator. The RF coils can be
adjusted by the operator. All other maintenance of the electronics should be
performed by your Agilent Technologies service representative.
hzpzF˜¤’F˜pO˜›^F’F˜zp4F=¤F’˜4p¤d=˜4F"›F˜"˜’Fap¤’˜’"OF›©˜^"«"=˜˜hzpzF˜¤’F˜
pO˜›^F’F˜zp4F=¤F’˜4p¤d=˜"d’p˜F’¤d›˜am˜’Fap¤’˜="h"VF˜›p:˜p˜am4pF4›˜pzF"›apm˜pO:˜
›^F˜
Fm›˜›^F˜˜"m=˜=a’4pmmF4›˜a›’˜zp§F˜4p=˜*FOpF˜zFOphamV˜"m©˜pO˜›^F’F˜
zp4F=¤F’˜F¨4Fz›˜"=b¤’›amV˜›^F˜˜4pad’
Electrostatic discharge is a threat to the MSD electronics during
maintenance
All of the printed circuit boards in the MSD contain components that can be
damaged by electrostatic discharge (ESD). Do not handle or touch these
boards unless absolutely necessary. In addition, wires, contacts, and cables
can conduct ESD to the printed circuit boards to which they are connected.
This is especially true of the mass filter (quadrupole) contact wires which
can carry ESD to sensitive components on the side board. ESD damage may
not cause immediate failure but it will gradually degrade the performance
and stability of your MSD.
238
–˜˜˜˜"am›"amamV˜›^F˜
When you work on or near printed circuit boards, or when you work on
components with wires, contacts, or cables connected to printed circuit
boards, always use a grounded anti-static wrist strap and take other antistatic precautions. The wrist strap should be connected to a known good
Earth ground. If that is not possible, it should be connected to a conductive
(metal) part of the assembly being worked on, but not to electronic components, exposed wires or traces, or pins on connectors.
Take extra precautions, such as a grounded, anti-static mat, if you must
work on components or assemblies that have been removed from the MSD.
This includes the analyzer.
m˜p=F˜›p˜*F˜FOOF4›a¦F:˜"m˜"m›a_’›"›a4˜§a’›˜’›"z˜h¤’›˜Oa›˜’m¤Vd©˜|mp›˜›aV^›}˜˜˜dpp’F˜’›"z˜
zp¦a=F’˜da››dF˜p˜mp˜zp›F4›apm
m›a_’›"›a4˜zF4"¤›apm’˜"F˜mp›˜s¬¬~˜FOOF4›a¦F˜"m=dF˜FdF4›pma4˜4a4¤a›˜*p"=’˜"’˜da››dF˜"’˜
zp’’a*dF:˜"m=˜›^Fm˜pmd©˜*©˜›^F˜F=VF’˜F¦F˜›p¤4^˜›^F˜4phzpmFm›’:˜F¨zp’F=˜›"4F’:˜p˜zam’˜
pm˜4pmmF4›p’˜"m=˜4"*dF’
More information is available
If you need more information about the functions of electronic components,
refer to Chapter 8, Electronics, on page 317.
Most of the procedures in this chapter are illustrated with video clips in the
5973N MSD Maintenance CD-ROM.
239
–˜˜˜˜"am›"amamV˜›^F˜
p˜"=b¤’›˜›^F˜˜4pad’
To adjust the RF coils
"›Fa"d’˜mFF=F=9
Screwdriver, flat-blade, large (8730-0002)
1 Make sure the MSD is at thermal equilibrium.
It takes at least 2 hours after all heated zones have reached their setpoints for the
MSD to reach thermal equilibrium.
2 Remove the analyzer cover See page 52.
p˜mp›˜Fhp¦F˜›^F˜’a=F˜*p"=˜4p¦F:˜›^F˜˜4p¦F:˜p˜"m©˜p›^F˜4p¦F’˜˜"mVFp¤’˜
¦pd›"VF’˜"F˜zF’Fm›˜¤m=F˜›^F’F˜4p¦F’
3 Make sure the RF cover is secure and no screws are missing.
A loose RF cover or missing screw can significantly affect coil adjustment.
4 In the Diagnostics/Vacuum Control view, select F›˜ from the
Diagnostics menu.
5 Enter an amu value of 100.
6 Slowly turn the RF coil adjustment screws to minimize the voltage
displayed.
Turn the adjustment screws alternately. Turn each screw only a little bit at a time.
Keep the screws at equal extension. The minimum voltage is typically between 70
and 100 mV.
p˜mp›˜¤’F˜"˜4pam˜›p˜"=b¤’›˜›^F˜˜4pad’˜˜O˜©p¤˜=pz˜a›:˜a›˜4p¤d=˜O"dd˜am›p˜›^F˜FdF4›pma4’˜O"m˜
"m=˜4"¤’F˜’aVmaOa4"m›˜="h"VF
7 When the voltage is minimized, click the ›pz button.
240
–˜˜˜˜"am›"amamV˜›^F˜
p˜"=b¤’›˜›^F˜˜4pad’
˜4pad˜"=b¤’›hFm›˜’4F§
˜4pad˜"=b¤’›hFm›˜’4F§
8 Repeat steps 4 through 7 for 650 amu.
The minimum voltage is typically between 500 and 650 mV.
9 Exit the Set RFPA program.
10 Select ˜ from the Diagnostics menu.
11 Reinstall the analyzer cover.
12 Tune the MSD. See page 50.
241
–˜˜˜˜"am›"amamV˜›^F˜
p˜Fzd"4F˜›^F˜zah"©˜O¤’F’
To replace the primary fuses
"›Fa"d’˜mFF=F=9
Fuse, T8 A, 250 V (2110-0969) – 2 required
Screwdriver, flat-blade (8730-0002)
The most likely cause of failure of the primary fuses is a problem with the foreline
pump. If the primary fuses in your MSD fail, check the foreline pump.
1 Vent the MSD and unplug the power cord from the electrical outlet.
If one of the primary fuses has failed, the MSD will already be off, but for safety
you should switch off the MSD and unplug the power cord. It is not necessary to
allow air into the analyzer chamber.
F¦F˜Fzd"4F˜›^F˜zah"©˜O¤’F’˜§^adF˜›^F˜˜a’˜4pmmF4›F=˜›p˜"˜zp§F˜’p¤4F
O˜©p¤˜"F˜¤’amV˜^©=pVFm˜"’˜"˜
˜4"aF˜V"’:˜"˜zp§F˜O"ad¤F˜h"©˜"ddp§˜a›˜›p˜
"44¤h¤d"›F˜am˜›^F˜"m"d©«F˜4^"h*F˜m˜›^"›˜4"’F:˜O¤›^F˜zF4"¤›apm’˜"F˜F„¤aF=˜
FF˜›^F˜©=pVFm˜"aF˜
"’˜"OF›©˜
¤a=F˜|QnnQ_QnG}
2 Turn one of the fuse holders counterclockwise until it pops out.
The fuse holders are spring loaded.
3 Remove the old fuse from the fuse holder.
4 Install a new fuse in the fuse holder.
5 Reinstall the fuse holder.
242
–˜˜˜˜"am›"amamV˜›^F˜
p˜Fzd"4F˜›^F˜zah"©˜O¤’F’
ah"©˜O¤’F’˜am˜^pd=F’
6 Repeat steps 3 - 6 for the other fuse.
Always replace both fuses.
7 Reconnect the MSD power cord to the electrical outlet.
8 Pump down the MSD. See page 60.
Always replace both fuses.
243
244
7
To set up your MSD for CI operation, 247
To install the CI ion source, 248
To install the CI interface tip seal, 250
To clean the CI ion source, 252
To minimize foreline pump damage from ammonia, 254
To replace the methane/isobutane gas purifier, 255
To clean the reagent gas supply lines (tubing), 256
To refill the CI calibrant vial, 257
CI Maintenance
245
CI Maintenance
This chapter describes maintenance procedures and requirements that are
unique to 5973N MSDs equipped with the Chemical Ionization hardware.
Maintenance videos on the multimedia manual in the 5973N User
Preparation Kit
Most of these maintenance procedures are demonstrated on the multimedia
MSD Reference Collection CD-ROM. Please view these videos.
CI increases the need for ion source cleaning
The primary effect of operating the MSD in CI mode is the need for more
frequent ion source cleaning. In CI operation, the ion source chamber is
subject to more rapid contamination than in EI operation because of the
higher source pressures required for CI.
Always perform any maintenance procedures using hazardous solvents under a
fume hood. Be sure to operate the MSD in a well-vented room.
Ammonia CI increases the need for foreline pump maintenance
Ammonia, when used as a reagent gas, it will also change the maintenance
requirements slightly. Ammonia causes the foreline pump oil to break down
more quickly. Therefore, the oil in the foreline vacuum pump must be
checked and replaced more frequently.
Always purge the MSD with methane after flowing ammonia.
Be sure to install the ammonia so the tank is in an upright position. This will
help prevent liquid ammonia from getting into the flow module.
246
7˜˜˜˜˜"am›Fm"m4F
To set up your MSD for CI operation
To set up your MSD for CI operation
Setting up your CI MSD for operation in CI mode requires special care to avoid
contamination and air leaks.
General guidelines
• Before venting in EI mode, verify that the GC/MSD system is performing
correctly. See To verify system performance, 51.
• Make sure the reagent gas inlet line(s) are equipped with gas purifiers (not
applicable for ammonia.)
• Use extra-high purity reagent gases; 99.99% or better for methane and as pure
as is available for other reagent gases.
247
7˜˜˜˜˜"am›Fm"m4F
To install the CI ion source
To install the CI ion source
dF4›p’›"›a4˜=a’4^"VF’˜›p˜"m"d©«F˜4phzpmFm›’˜"F˜4pm=¤4›F=˜›p˜›^F˜’a=F˜*p"=˜§^FF˜
›^F©˜4"m˜="h"VF˜’Fm’a›a¦F˜4phzpmFm›’˜F"˜"˜Vp¤m=F=˜"m›a_’›"›a4˜§a’›˜’›"z˜
"m=˜›"cF˜p›^F˜"m›a_’›"›a4˜zF4"¤›apm’˜*FOpF˜©p¤˜pzFm˜›^F˜"m"d©«F˜4^"h*F
1 Vent the MSD and open the analyzer. See page 54.
2 Remove the EI ion source. See page 206.
3 Remove the CI ion source from its storage box and insert the ion source
into the radiator.
4 Reinstall the thumbscrews.
5 Connect the dummy filament, repeller, and CI filament wires.
6 Reconnect colored wires to the appropriate pins on the ion source.
aF˜4pdp
pmmF4›’˜›p
¤h*F˜pO˜dF"=’
d¤F
m›"m4F˜dFm’
s
"mVF
pm˜Op4¤’
s
^a›F
ad"hFm›˜s˜|›pz˜Oad"hFm›}
¢
F=
FzFddF
s
d"4c
¤hh©˜Oad"hFm›˜‰|ad"hFm›˜¢Š}
¢
7 Connect the heater and sensor cables.
248
7˜˜˜˜˜"am›Fm"m4F
To install the CI ion source
p¤4F˜"=a"›p
FF=›^p¤V^˜*p"=
˜Oad"hFm›
FzFddF˜
¤hh©˜Oad"hFm›
p¤4F˜^F"›F˜"m=˜’Fm’p˜
§aF’
pm˜Op4¤’˜zam˜|p"mVF˜§aF}
m›"m4F˜dFm’˜zam˜|*d¤F˜§aF}
249
7˜˜˜˜˜"am›Fm"m4F
To install the CI interface tip seal
To install the CI interface tip seal
"›Fa"d’˜mFF=F=9
Interface tip seal (G1099-60412)
The interface tip seal must be in place for CI operation. It is necessary to achieve
adequate ion source pressure for CI.
dF4›p’›"›a4˜=a’4^"VF’˜›p˜"m"d©«F˜4phzpmFm›’˜"F˜4pm=¤4›F=˜›p˜›^F˜’a=F˜*p"=˜§^FF˜
›^F©˜4"m˜="h"VF˜’Fm’a›a¦F˜4phzpmFm›’˜F"˜"˜Vp¤m=F=˜"m›a_’›"›a4˜§a’›˜’›"z˜
"m=˜›"cF˜p›^F˜"m›a_’›"›a4˜zF4"¤›apm’˜*FOpF˜©p¤˜pzFm˜›^F˜"m"d©«F˜4^"h*F
1 Remove the seal from the ion source storage box.
2 Place the seal over the end of the interface. See the illustration on the
previous page.
To remove the seal, reverse the above steps.
3 Verify that the CI ion source is installed.
4 Gently check the alignment of the analyzer and the interface.
When the analyzer is aligned correctly, the analyzer can be closed all the way with
no resistance except the spring tension from the interface tip seal.
p4amV˜›^F˜"m"d©«F˜4dp’F=˜aO˜›^F’F˜z"›’˜"F˜ha’"daVmF=˜§add˜="h"VF˜›^F˜’F"d˜p˜›^F˜
am›FO"4F˜p˜›^F˜apm˜’p¤4F:˜p˜§add˜cFFz˜›^F˜’a=Fzd"›F˜Oph˜’F"damV
5 You can align the analyzer and interface by wiggling the side plate on its
hinge.
If the analyzer still won’t close, contact your Agilent Technologies service
representative.
The figure opposite shows the alignment of the interface, tip seal, and CI ion source.
250
7˜˜˜˜˜"am›Fm"m4F
To install the CI interface tip seal
˜apm˜’p¤4F˜*p=©
˜Oad"hFm›
˜’p¤4F˜^F"›F˜
"’’Fh*d©
˜am›FO"4F˜›az˜’F"d
˜
—˜
am›FO"4F˜›az
˜am›FO"4F˜4p¦F
p¤4F˜^F"›F˜"m=˜
’Fm’p˜4"*dF’
pm˜Op4¤’˜dFm’˜zam
m›"m4F˜dFm’˜zam
251
7˜˜˜˜˜"am›Fm"m4F
To clean the CI ion source
To clean the CI ion source
The CI ion source has slightly different cleaning requirements than the standard EI
ion source. See the procedure in the 5973N MSD Maintenance CD-ROM.
Frequency of cleaning
Because the CI ion source operates at much higher pressures than the EI ion source,
it will probably require more frequent cleaning than the EI ion source. Cleaning of
the source is not a scheduled, periodic maintenance procedure. The source should
be cleaned whenever there are performance anomalies that are associated with a
dirty ion source. See the Troubleshooting chapter for symptoms that indicate a
dirty ion source. Visual appearance is not an accurate guide to cleanliness of the
CI ion source. The CI ion source can show little or no discoloration yet still need
cleaning. Let analytical performance be your guide.
Cleaning procedure
Cleaning the CI ion source is very similar to cleaning the EI ion source. Use the
cleaning procedure in To clean the ion source, 210 with the following exceptions:
• The CI ion source may not look dirty but deposits left by chemical ionization are
very difficult to remove. Clean the CI ion source thoroughly.
• Use a round wooden toothpick to gently clean out the electron entrance hole in
the source body and the ion exit hole in the drawout plate.
• Do not use halogenated solvents, and use hexane for the final rinse.
FF˜d’p
Refer to the MSD Reference Collection CD-ROM for video demonstrations of ion
source cleaning and other maintenance procedures.
p˜mp›˜¤’F˜"m©˜^"dpVFm"›F=˜’pd¦Fm›’˜›p˜4dF"m˜›^F˜˜apm˜’p¤4F˜
252
7˜˜˜˜˜"am›Fm"m4F
To clean the CI ion source
253
7˜˜˜˜˜"am›Fm"m4F
To minimize foreline pump damage from ammonia
To minimize foreline pump damage from ammonia
Gas ballasting for an hour every day removes most, of the ammonia from the pump
oil. This will greatly increase the life of the pump.
md©˜zFOph˜›^a’˜zp4F=¤F˜aO˜›^F˜z¤hz˜a’˜"›˜mph"d˜pzF"›amV˜›FhzF"›¤F˜^F˜§"›F˜am˜
›^F˜"a˜4"m˜4"¤’F˜4pm=Fm’"›apm˜pO˜›^F˜"hhpma"˜"›˜›^F˜*"dd"’›˜¦"d¦F˜aO˜›^F˜z¤hz˜a’˜4pd=
"dd"’›˜4pm›pd
1 Open the ballast valve on the foreline pump all the way (several turns
counterclockwise)
2 The sound of the pump will get much louder.
3 Leave the ballast valve open for one hour.
You can continue to run samples while the pump is ballasting.
4 Close the ballast valve.
Leaving the ballast valve open all the time will result in loss of pump oil and damage
to the pump.
d§"©’˜z¤VF˜›^F˜Odp§˜hp=¤dF˜§a›^˜hF›^"mF˜"O›F˜Odp§amV˜"hhpma"˜
^F˜¤’F˜pO˜"hhpma"˜F"VFm›˜V"’˜"d’p˜F„¤aF’˜›^"›˜›^F˜OpFdamF˜z¤hz˜pad˜*F˜4^"mVF=˜F¦F©˜
¢J˜hpm›^’˜am’›F"=˜pO˜›^F˜¤’¤"d˜’a¨˜hpm›^’
254
7˜˜˜˜˜"am›Fm"m4F
To replace the methane/isobutane gas purifier
To replace the methane/isobutane gas purifier
"›Fa"d’˜mFF=F=9
Methane/isobutane gas purifier (G1999-80410)
Front ferrule for 1/8-inch tubing (5180-4110)
Rear ferrule for 1/8-inch tubing (5180-4116)
Tubing cutter (8710-1709)
The methane/isobutane gas purifier needs to be replaced after four tanks of reagent
gas. This frequency may vary depending on purity of the gas and care taken in
uncapping and installing the gas purifier. A large leak upstream from the gas purifier
can quickly exhaust the reduced metal of its oxygen and moisture traps.
1 To install the methane/isobutane gas purifier, follow the instructions on
the label for installation and replacement intervals.
F˜’¤F˜mp›˜›p˜Fhp¦F˜›^F˜4"z’˜¤m›ad˜©p¤˜"F˜F"=©˜›p˜am’›"dd˜›^F˜V"’˜z¤aOaF˜md©˜Fhp¦F˜
›^F˜4"z’˜am˜›^F˜V"’˜Odp§˜›p˜zF¦Fm›˜4pm›"ham"›apm˜*©˜"a
Methane is flammable. Extinguish all flames in the area before turning on gas
flow.
2 Disconnect the fittings on the old filter.
3 Remove the ferrules from the tubing at the outlet of the gas purifier.
Using the tubing cutter, cut off the end of the tubing with the ferrules.
4 Install the new filter.
5 Purge the new filter.
6 Cap the old filter and prepare it to be sent for regeneration.
See the instructions on the label.
255
7˜˜˜˜˜"am›Fm"m4F
To clean the reagent gas supply lines (tubing)
To clean the reagent gas supply lines (tubing)
"›Fa"d’˜mFF=F=9
Clean, dry nitrogen
Heat gun
Tubing cutter (8710-1709)
If the reagent gas lines become contaminated, they can be cleaned.
1 Disconnect the reagent gas tubing from the gas supply, the gas purifier,
and the MSD.
2 Cap the gas purifier following the instructions on the label.
3 Connect one end of the tubing to a supply of clean, dry nitrogen and turn
on gas flow.
4 Use the heat gun to warm the tubing, starting at the supply end and
working your way to the free end.
5 Repeat for any other pieces of tubing that need to be cleaned.
6 Reconnect the tubing to the gas supply, gas purifier, and MSD.
Follow the instructions on the gas purifier label.
Do not heat the gas tubing when reagent gas is flowing.
p˜mp›˜z¤›˜da„¤a=’˜am›p˜›^F˜›¤*amV˜p˜mp›˜^F"›˜›^F˜›¤*amV˜§^Fm˜a›˜a’˜4pmmF4›F=˜›p˜›^F˜
256
7˜˜˜˜˜"am›Fm"m4F
To refill the CI calibrant vial
To refill the CI calibrant vial
"›Fa"d’˜mFF=F=9
PFDTD calibrant (8500-8130)
1 Set the reagent gas flow to "’˜OO
2 Vent the MSD.
3 Remove the capillary column from the GC/MSD interface.
4 Pull the MSD away from the GC. See page 171.
5 Loosen the nut holding the vial in place.
6 Remove the calibrant vial.
p˜not am’F˜›^F˜¦a"d˜§a›^˜"m©˜’pd¦Fm›’˜F¦F˜F¨zp’F˜›^F˜am’a=F˜pO˜›^F˜¦a"d˜›p˜4^dpam"›F=˜
’pd¦Fm›’˜p˜a’pzpz©d˜"d4p^pd˜p˜§"›F˜I˜›^a’˜§add˜F’¤d›˜am˜’F¦FF˜dp’’˜pO˜˜’Fm’a›a¦a›©˜
7 Fill the vial to no closer than 6 mm of the top with fresh PFDTD calibrant
(8500-8130).
8 Replace the vial and tighten the nut.
9 Reposition the MSD next to the GC. See page 179.
10 Reinstall the capillary column.
11 Pump down the MSD. See page 60.
12 Purge the calibration valve. See page 185.
O›F˜Fhp¦amV˜›^F˜4"da*"m›˜¦a"d:˜©p¤˜must˜z¤VF˜›^F˜4"da*"›apm˜¦"d¦F˜"ad¤F˜›p˜=p˜’p˜
§add˜F’¤d›˜am˜’F¦FF˜4pm›"ham"›apm˜pO˜›^F˜apm˜’p¤4F˜"m=˜="h"VF˜›p˜›^F˜Oad"hFm›˜"m=˜
FdF4›pm˜h¤d›azdaF
257
258
8
Diffusion pump MSD vacuum system, 264
Turbo pump MSD vacuum system, 265
Diffusion pump analyzer chamber, 266
Turbo pump analyzer chamber, 267
Side plate, 268
Vacuum seals, 270
Foreline pump, 272
Foreline gauge, 274
Diffusion pump and fan, 276
Turbomolecular pump and fan, 280
Calibration valves and vent valve, 283
Triode gauge tube, 285
Gauge controller, 287
Vacuum System
This chapter describes components of the vacuum system in the MSD
Vacuum System
The vacuum system is essential to MSD operation
The vacuum system creates the high vacuum (low pressure) required for
the MSD to operate. Without the vacuum, the molecular mean free path
would be too short, and ions would collide with air molecules before they
could reach the detector. Operation at high pressures also would damage
analyzer components.
The 5973N MSD has one of three kinds of vacuum system: diffusion pump
or one of two turbomolecular (turbo) pumps; this determines the maximum
column flow that the MSD will support.
p=Fd˜m¤h*F
F’4az›apm
¢Q••
¢Q•G
¢QGG
¢Q•n
¢QGn
aOO¤’apm˜¤hz:˜
›"m="=˜¤*p˜¤hz:˜
›"m="=˜¤*p˜¤hz:˜:˜
FOph"m4F˜¤*p˜¤hz:˜
FOph"m4F˜¤*p˜¤hz:˜:˜:˜
"¨ah¤h˜
F4phhFm=F=
4pd¤hm˜Odp§
sQ˜hd—ham
¢¬˜hd—ham
¢¬˜hd—ham
T¬˜hd—ham
T¬˜hd—ham
Many parts of the vacuum system are common to both, but some parts are
specific to the high vacuum pump.
Most vacuum system operation is automated. Operator interaction is
through the data system or control panel. Monitoring of the vacuum system
is done through the data system and or control panel, and through the
optional gauge controller.
260
G˜˜˜˜"4¤¤h˜©’›Fh
Common vacuum system problems
The most common problems associated with any vacuum system are air
leaks. Symptoms of air leaks include:
• Loud gurgling noise from the foreline pump (very large leak.)
• Inability of the turbo pump to reach 95% speed
• High foreline pressure in diffusion pump MSDs
• Higher than normal high vacuum gauge controller readings
The 5973N MSD will not pump down successfully unless you press on the
side plate (analyzer door) when you turn on the MSD power. Continue to
press until the sound from the foreline pump becomes quieter.
Pumpdown failure shutdown
The system will shut down both the high vacuum and the foreline pump if
the system fails to pump down correctly. The conditions that trigger shutdown are:
• Diffusion pump MSD: foreline pressure above 300 mTorr after 7 minutes
• Turbo pump MSDs: turbo pump speed below 80% after 7 minutes
This is usually because of a large air leak: either the sideplate has not sealed
correctly or the vent valve is still open. This feature helps prevent the
foreline pump from sucking air through the system, which can damage the
analyzer and pump.
To restart the MSD, find and correct the air leak, then switch the power off
and on. Be sure to press on the sideplate when turning on the MSD power
to ensure a good seal.
261
G˜˜˜˜"4¤¤h˜©’›Fh
Many components make up the vacuum system
• Analyzer chamber
• Side plate (analyzer door), and front and rear end plates
• Vacuum seals
• Foreline (rough) pump
• High vacuum pump (vapor diffusion or turbomolecular pump)
• Calibration valve(s) and vent valve
• Vacuum control electronics
• Vacuum gauges and gauge control electronics
Each of these is discussed in more detail in the following material.
262
G˜˜˜˜"4¤¤h˜©’›Fh
"da*"›apm˜¦"d¦F
Fm›˜¦"d¦F
pm›˜’a=F˜zd"›F˜›^¤h*’4F§
m"d©«F˜4^"h*F
a=F˜zd"›F
a=F˜zd"›F˜^amVF
ap=F˜V"¤VF˜›¤*F
F"˜’a=F˜zd"›F˜›^¤h*’4F§
aV^˜¦"4¤¤h˜z¤hz˜4d"hz’
pFdamF˜z¤hz˜
pFdamF˜^p’F
aV^˜¦"4¤¤h˜z¤hz
aV^˜¦"4¤¤h˜4ppdamV˜O"m
263
G˜˜˜˜"4¤¤h˜©’›Fh
aOO¤’apm˜z¤hz˜˜¦"4¤¤h˜’©’›Fh
Diffusion pump MSD vacuum system
The diffusion pump requires baffling to prevent vapor from migrating into the analyzer chamber. Foreline pressure is monitored by the foreline gauge. The ac board
controls the diffusion pump heater.
"da*"›apm˜¦"d¦F
aOO¤’apm˜z¤hz
aOO¤’apm˜z¤hz˜*"OOdF˜"="z›F
"maOpd=˜4ppdamV˜Oam’
aOO¤’apm˜z¤hz˜"m"d©«F˜
pp˜^p›˜’§a›4^
pp˜4pd=˜’§a›4^
pFdamF˜V"¤VF˜
aV^˜¦"4¤¤h˜4ppdamV˜O"m˜
|=aOO¤’apm˜z¤hz˜zp’a›apm}
264
G˜˜˜˜"4¤¤h˜©’›Fh
¤*p˜z¤hz˜˜¦"4¤¤h˜’©’›Fh
Turbo pump MSD vacuum system
The 5973N MSD can have one of two turbo pumps. The performance turbo pump
can accept up to 4 ml/min carrier gas flow, while the standard turbo pump can
accept up to 2.4 ml/min carrier gas flow. The turbo pump has a screen to keep
debris out of the pump, but no baffle is necessary. Pump speed is controlled by the
turbo controller; there is no foreline gauge.
"da*"›apm˜¦"d¦F:˜’zF4aOa4˜›p˜›©zF˜pO˜›¤*p˜z¤hz
¤*p˜z¤hz˜"m"d©«F˜4^"h*F
¤*p˜z¤hz˜4pm›pddF
FOph"m4F˜›¤*p˜z¤hz˜p
›"m="=˜›¤*p˜z¤hz
aV^˜¦"4¤¤h˜4ppdamV˜O"m
|›¤*p˜z¤hz˜zp’a›apm}
265
G˜˜˜˜"4¤¤h˜©’›Fh
aOO¤’apm˜z¤hz˜"m"d©«F˜4^"h*F
Diffusion pump analyzer chamber
The analyzer chamber is the chamber in which the analyzer operates. The manifold is extruded and machined from an aluminum alloy. Large openings in the side,
front, and rear of the analyzer chamber are closed by plates. O-rings provide the
seals between the plates and the manifold. Ports in the manifold and the plates
provide attachment points for the triode gauge tube, calibration valve, vent valve,
GC/MSD interface, and high vacuum pump.
The diffusion pump attaches with a KF50 seal to a baffle adapter that is clamped
to the bottom of the manifold. A vapor baffle helps prevent migration of pump fluid
vapor into the manifold. Cooling fins on the bottom of the manifold keep the baffle
cool so the vapor will condense on it.
"da*"›apm˜¦"d¦F˜zp›
Fm›˜¦"d¦F˜zp›
a=F˜zd"›F˜_amV˜Vpp¦F
pm›˜Fm=˜zd"›F
—˜am›FO"4F˜zp›
ap=F˜V"¤VF˜zp›˜
|*F^am=˜’^aFd=}
F"˜Fm=˜zd"›F
ap=F˜V"¤VF˜zp›˜’^aFd=
ppdamV˜Oam’
"zp˜*"OOdF
266
G˜˜˜˜"4¤¤h˜©’›Fh
¤*p˜z¤hz˜"m"d©«F˜4^"h*F
Turbo pump analyzer chamber
The manifold for the turbo pump does not have a baffle or cooling fins. The turbo
pump and the mounting bracket for the turbo controller are clamped directly to
the manifold.
In every other respect, the two manifolds are identical.
"da*"›apm˜¦"d¦F˜zp›
Fm›˜¦"d¦F˜zp›
a=F˜zd"›F˜_amV˜Vpp¦F
pm›˜Fm=˜zd"›F
—˜am›FO"4F˜zp›
ap=F˜V"¤VF˜zp›˜
|*F^am=˜’^aFd=}
F"˜Fm=˜zd"›F
ap=F˜V"¤VF˜zp›˜’^aFd=
267
G˜˜˜˜"4¤¤h˜©’›Fh
a=F˜zd"›F
Side plate
The side plate is a flat stainless steel plate that covers the large opening in the side
of the analyzer chamber. The side plate is attached to the manifold with a hinge.
The analyzer assembly is attached to the side plate inside the analyzer chamber.
The hinge allows the side plate to swing away from the manifold for easy access to
the analyzer.
Several electrical feedthroughs are built into the side plate. Wires connect the
feedthroughs to analyzer components. The electronic side board is mounted on
the atmospheric side of the side plate.
Thumbscrews are located at each end of the side plate.
"’›Fm˜*p›^˜’a=F˜zd"›F˜›^¤h*’4F§’˜Op˜’^azzamV˜p˜’›p"VF˜pmd©˜p˜mph"d˜pzF"›apm˜›^F˜
*p›^˜›^¤h*’4F§’˜’^p¤d=˜*F˜dpp’F˜p˜pzF"›apm˜§a›^˜^©=pVFm˜4"aF˜V"’:˜p˜§a›^˜
Od"hh"*dF˜p˜F¨zdp’a¦F˜˜F"VFm›˜V"’F’:˜›^F˜Opm›˜›^¤h*’4F§˜’^p¤d=˜*F˜O"’›FmF=˜b¤’›˜
OamVF˜›aV^›˜¦F›aV^›FmamV˜§add˜§"z˜›^F˜’a=F˜zd"›F˜"m=˜4"¤’F˜"a˜dF"c’˜p˜mp›˜¤’F˜"˜›ppd˜
›p˜›aV^›Fm˜›^F˜’a=F˜zd"›F˜›^¤h*’4F§’
^Fm˜©p¤˜›¤m˜pm˜›^F˜zp§F˜›p˜z¤hz˜=p§m˜›^F˜:˜*F˜’¤F˜›p˜zF’’˜pm˜›^F˜’a=F˜*p"=˜
›p˜Fm’¤F˜"˜Vpp=˜’F"d˜
268
G˜˜˜˜"4¤¤h˜©’›Fh
a=F˜zd"›F
a=F˜zd"›F˜^amVF
˜¦pd›"VF˜OFF=›^p¤V^˜
aVm"d˜|=F›F4›p˜p¤›z¤›}˜
OFF=›^p¤V^
"’’˜Oad›F˜|„¤"=¤zpdF}˜
OFF=›^p¤V^
a=F˜*p"=
4F§’˜Op˜"=a"›p˜
hp¤m›amV˜*"4cF›’
pm›˜’a=F˜zd"›F˜
›^¤h*’4F§
pm˜’p¤4F˜"m=˜^F"›F˜
OFF=›^p¤V^’
pm˜’p¤4F˜"m=˜^F"›F˜
OFF=›^p¤V^’
"’’˜Oad›F˜|„¤"=¤zpdF}˜
OFF=›^p¤V^
F›F4›p˜Op4¤’˜OFF=›^p¤V^
aV^˜¦pd›"VF˜|}˜
OFF=›^p¤V^
F"˜’a=F˜zd"›F˜›^¤h*’4F§
m"d©«F˜4^"h*F
a=F˜zd"›F˜_amV
269
G˜˜˜˜"4¤¤h˜©’›Fh
"4¤¤h˜’F"d’
Vacuum seals
Several types of Viton elastomer O-ring seals are used to prevent air leaks into the
analyzer chamber. All these O-rings, and the surfaces to which they must seal,
must be kept clean and protected from nicks and scratches. A single hair, piece of
lint, or scratch can produce a serious vacuum leak. Two of the O-rings are lightly
lubricated with Apiezon-L vacuum grease: the side plate O-ring and the vent valve
O-ring.
Face seals
A face seal is an O-ring that fits in a shallow groove. The sealing surface is usually a
flat plate. The manifold side plate and end plate O-rings fit into grooves around the
large openings in the analyzer chamber. The side plate swings into place against
the side plate O-ring, and must be held in place when the MSD is turned on for
pumpdown in order to assure a good seal.
The front and rear end plates are screwed onto the manifold, and should not need
to be removed. The GC/MSD interface fastens to the manifold with three screws.
The calibration valve assembly is fastened onto the front end plate by two screws.
The vent valve knob threads into the front end plate. Small O-rings in grooves in
the front end plate provide vacuum seals.
The diffusion pump baffle adapter has a groove for its O-ring. The baffle adapter is
clamped to the manifold with 4 claw grips.
KF (NW) seals
Most of the seals for the high vacuum pumps, foreline gauge, and foreline pump
are KF seals. KF seals have an O-ring supported by a centering ring. The centering
ring can be either on the inside or the outside of the O-ring. The clamp presses two
flanges against the O-ring, making a seal. KF clamps must not be overtightened.
Compression seals
A compression fitting consists of a threaded fitting on the analyzer chamber and a
threaded collar with a ferrule and O-ring. A cylindrical part fits inside the collar.
Tightening the collar presses the ferrule, compressing the O-ring around the part.
The triode gauge tube and calibration vial use compression seals.
270
G˜˜˜˜"4¤¤h˜©’›Fh
"4¤¤h˜’F"d’
High voltage feedthrough seal
The high voltage (HED) feedthrough seal is an O-ring that is compressed against
the side plate by a threaded collar.
m"d©«F˜4^"h*F
a=F˜zd"›F˜_amV
a=F˜zd"›F
˜’F"d˜§a›^˜am›Fm"d
4Fm›FamV˜amV
˜Od"mVF˜|4d"hz˜mp›˜’^p§m}
˜Od"mVF˜|4d"hz˜mp›˜’^p§m}
˜’F"d˜§a›^˜F¨›Fm"d
4Fm›FamV˜amV
pdd"
_amV
m"d©«F˜4^"h*F
F¤dF
ap=F˜›¤*F
271
G˜˜˜˜"4¤¤h˜©’›Fh
pFdamF˜z¤hz
Foreline pump
The foreline pump reduces the pressure in the analyzer chamber so the high vacuum pump can operate. It also pumps away the gas load from the high vacuum
pump. The foreline pump is connected to the high vacuum pump by a 130-cm hose
called the foreline hose.
The foreline pump is a two-stage rotary-vane pump. The foreline pump turns on
when the MSD power is turned on. The foreline pump has a built-in anti-suckback
valve to help prevent backstreaming in the event of a power failure.
The foreline pump can be placed under the analyzer chamber at the rear of the
MSD (with the exhaust outlet to the rear), or on the floor below the MSD.
An oil trap (not shown) is available that can be used to filter pump oil out of the
foreline pump exhaust. This trap stops only pump oil. Do not use the trap if you
are analyzing toxic chemicals or using toxic solvents, or if you have a CI MSD.
Instead, install an 11-mm id hose to remove the exhaust from your lab.
^F˜OpFdamF˜z¤hz˜F¨^"¤’›˜4pm›"am’˜›"4F’˜pO˜’pd¦Fm›’:˜"m"d©›F’:˜"m=˜OpFdamF˜z¤hz˜
pad˜^F˜’¤zzdaF=˜pad˜›"z˜’›pz’˜pmd©˜z¤hz˜pad˜›˜=pF’˜mp›˜›"z˜p˜Oad›F˜p¤›˜›p¨a4˜
4^Fha4"d’˜O˜©p¤˜"F˜¤’amV˜›p¨a4˜’pd¦Fm›’˜p˜"m"d©«amV˜›p¨a4˜4^Fha4"d’:˜Fhp¦F˜›^F˜
pad˜›"z˜"m=˜am’›"dd˜"˜^p’F˜›p˜›"cF˜›^F˜OpFdamF˜z¤hz˜F¨^"¤’›˜p¤›’a=F˜p˜›p˜"˜O¤hF˜^pp=
p˜mp›˜zd"4F˜›^F˜OpFdamF˜z¤hz˜mF"˜"m©˜F„¤azhFm›˜›^"›˜a’˜’Fm’a›a¦F˜›p˜¦a*"›apm˜
^F˜*"dd"’›˜4pm›pd˜cmp*˜4pm›pd’˜›^F˜"hp¤m›˜pO˜"a˜"ddp§F=˜am›p˜›^F˜z¤hz˜FFz˜›^F˜*"dd"’›˜
4pm›pd˜4dp’F=˜|O¤dd©˜4dp4c§a’F}˜"›˜"dd˜›ahF’:˜F¨4Fz›˜§^Fm˜*"dd"’›amV˜›^F˜z¤hz
A window (sight glass) in the front of the foreline pump shows the level of the
foreline pump oil. There are two marks next to the window. The level of the pump
oil should never be above the upper mark or below the lower mark. If the level of
pump oil is near the lower mark, add foreline pump oil.
FF˜d’p
To check and add foreline pump oil, see page 160.
272
G˜˜˜˜"4¤¤h˜©’›Fh
pFdamF˜z¤hz
pFdamF˜^p’F
|Oph˜^aV^˜¦"4¤¤h˜z¤hz˜
"dd"’›˜4pm›pd
ad˜Oadd˜4"z
¨^"¤’›˜p¤›dF›
|¤’F˜ss_hh˜a=˜^p’F
ad˜=az˜›"©
"am˜zd¤V
ad˜dF¦Fd˜§am=p§˜|’aV^›˜Vd"’’}
273
G˜˜˜˜"4¤¤h˜©’›Fh
pFdamF˜V"¤VF
Foreline gauge
The foreline gauge monitors the pressure (vacuum) at the exit of the diffusion
pump. The primary function of the foreline gauge is diffusion pump control. When
the foreline pump has reduced the pressure in the analyzer chamber to below
300 mTorr (0.3 Torr), the diffusion pump is automatically switched on. If the foreline pressure rises above 400 mTorr (0.4 Torr), the ac board switches off the diffusion pump heater and the analyzer electronics.
The foreline pressure can be monitored from your data system.
The turbo pump MSD does not require a foreline gauge. Instead, the motor speed
is monitored.
FF˜d’p
To view MSD temperature and vacuum status, page 38
Gauge controller, page 287
Table 2. Typical MSD pressure readings for various carrier gas flow rates,
page 47
274
G˜˜˜˜"4¤¤h˜©’›Fh
pFdamF˜V"¤VF
aOO¤’apm˜z¤hz˜p¤›dF›
pFdamF˜V"¤VF˜
"’’Fh*d©
s¬—s–˜’F"d
s¬—s–˜4d"hz
pFdamF˜V"¤VF˜4"*dF˜J˜z"›˜pO˜
^aV^˜¦"4¤¤h˜4pm›pd˜4"*dF
pFdamF˜^p’F˜"m=˜
^p’F˜4d"hz
275
G˜˜˜˜"4¤¤h˜©’›Fh
aOO¤’apm˜z¤hz˜"m=˜O"m
Diffusion pump and fan
The diffusion pump in the MSD is an air-cooled vapor diffusion pump with 90
liters/second capacity. It mounts with a KF50 fitting to a baffle adapter clamped to
the bottom of the analyzer chamber.
The diffusion pump has a cylindrical body surrounded by fins to help dissipate
heat. Its inlet is open to the interior of the analyzer chamber, through the adapter
and baffle. A structure called the stack is located at the center of the pump body.
An electric heater is located at the bottom of the stack
The diffusion pump transports gas by momentum transfer. The heater boils a special fluid (a polyphenyl ether) inside the stack. As the vapor pressure increases,
the pump fluid vapor is forced out and downward through nozzles in the stack.
The vapor forced out of these nozzles strikes the gas molecules that are present.
This forces the gas molecules down toward the outlet near the bottom of the
pump. Another nozzle in the stack points directly at the outlet and forces the gas
molecules out. The vapor condenses on the sides of the pump and the liquid drains
down to the bottom. The liquid is boiled again and is reused continuously.
.A cooling fan is located between the diffusion pump and the front cover of the
MSD. The fan draws air through the cover and blows it over the pump. Without
this cooling, the pump fluid vapor would not condense correctly, but would diffuse
into the analyzer chamber.
The foreline pump is connected by the foreline hose to the outlet of the diffusion
pump. It removes the gas molecules that reach the outlet.
The diffusion pump operation is controlled by the ac board. The ac board turns on
the diffusion pump heater automatically as soon as the foreline pump lowers the
pressure in the analyzer chamber below approximately 300 mTorr (0.3 Torr). Until
the foreline pressure drops below 300 mTor, the diffusion pump heater will not
turn on. If the pressure does not drop below 300 mT within seven minutes of turning the MSD on, the foreline pump will shut off. During operation, if the foreline
pressure rises above 400 mTorr, the diffusion pump heater will turn off. The ac
board allows the analyzer electronics to turn on when the diffusion pump is hot.
The diffusion pump typically maintains an indicated pressure below 1.0 × 10_T Torr
for GC helium carrier gas flows up to 2 ml/minute. High vacuum (manifold) pressure can only be measured if your MSD is equipped with the optional gauge controller.
276
G˜˜˜˜"4¤¤h˜©’›Fh
aOO¤’apm˜z¤hz˜"m=˜O"m
FF˜d’p
Gauge controller, page 287
Table 2: Typical MSD pressure readings for various carrier gas flow rates,
page 47.
The small size of the diffusion pump allows it to heat up and cool down quickly.
This simplifies pumpdown and venting. From initial power-on, the system can
pump down to operating pressure in approximately 15 minutes. If the power fails,
the diffusion pump fluid stops boiling before the analyzer chamber pressure begins
to rise significantly. This helps prevent back diffusion of pump fluid into the analyzer chamber. Your data system has pumpdown and venting programs to guide
you through these procedures. Follow their instructions carefully.
FF˜d’p
To pump down the MSD, page 60
Diffusion pump control, page 328
To vent the MSD, page 54
Diffusion pump operational readiness is monitored by two thermal switches.
"*dF˜•
aOO¤’apm˜z¤hz˜›^Fh"d˜’§a›4^F’
^Fh"d˜§a›4^
pp˜pd=
pp˜p›
ph"d˜’›"›F
ph"dd©˜pzFm
ph"dd©˜4dp’F=
^"mVF’˜"›
s•¬@˜a’amV”˜sT¬@˜O"ddamV
–Q@˜a’amV
¤m4›apm
FFz’˜"m"d©«F˜›¤mF=˜pOO˜¤m›ad
›^F˜z¤hz˜a’˜^p›˜Fmp¤V^˜›p˜Op˜
"=F„¤"›F˜¦"4¤¤h˜F¦Fm›’˜
"m"d©«F˜="h"VF
^¤›’˜pOO˜=aOO¤’apm˜z¤hz˜"m=˜
"m"d©«F˜aO˜›^F˜z¤hz˜p¦F^F"›’˜
F¦Fm›’˜="h"VF˜›p˜›^F˜z¤hz˜"m=˜
"m"d©«F
F’’"VF
^F˜^aV^˜¦"4¤¤h˜z¤hz˜a’
mp›˜F"=©
aOOa4¤d›©˜§a›^˜›^F˜^aV^˜¦"4¤¤h˜z¤hz
^"›˜a›˜hF"m’
ph"d˜=¤amV˜z¤hz=p§m
d§"©’˜am=a4"›F’˜"˜zp*dFh
^"›˜›p˜=p
"a›˜Op˜z¤hz˜›p˜^F"›˜¤z
^F4c˜›^F˜dF¦Fd˜"m=˜4pm=a›apm˜pO˜›^F˜
Od¤a=˜"cF˜’¤F˜z¤hz˜a’˜4ppd:˜"m=˜
zp§F_4©4dF˜˜›p˜F’F›
277
G˜˜˜˜"4¤¤h˜©’›Fh
aOO¤’apm˜z¤hz˜"m=˜O"m
You can check the condition and level of the diffusion pump fluid through the window (sight glass) near the base of the front of the pump. If the level drops below
the appropriate marker (there are separate ranges for hot and cold conditions) or
if the fluid turns dark brown or black, replace the fluid. Otherwise, replace the
fluid once a year.
Diffusion pump fluid that is exposed to air at operating temperature will break
down and turn dark brown or black. This reaction is called cracking. Cracked
pump fluid gives two symptoms: higher manifold pressure and high background
with a large peak at m/z 446.
FF˜d’p
Maintaining the vacuum system, 159
Troubleshooting (5973N MSD) in the online help for information on troubleshooting air leaks and other vacuum problems
278
G˜˜˜˜"4¤¤h˜©’›Fh
aOO¤’apm˜z¤hz˜"m=˜O"m
aOO¤’apm˜z¤hz˜p¤›dF›
mdF›
ppdamV˜Oam’
pp˜^p›˜’Fm’p
pp˜4pd=˜’Fm’p
d¤a=˜dF¦Fd˜§am=p§
aOO¤’apm˜z¤hz˜^F"›F˜
4"*dF
pd=˜Od¤a=˜dF¦Fd˜h"cF
p›˜Od¤a=˜dF¦Fd˜h"cF
279
G˜˜˜˜"4¤¤h˜©’›Fh
¤*phpdF4¤d"˜z¤hz˜"m=˜O"m
Turbomolecular pump and fan
The turbo pump in the MSD is clamped directly to the bottom of the analyzer
chamber.
The turbo pump has a cylindrical body with its inlet open to the interior of the analyzer chamber. Inside the pump body is a central shaft or cylinder. Sets of small
blades (airfoils) radiate from the central shaft. The shaft spins at up to 60,000 revolutions per minute in the performance turbo pump, and 90,000 rpm in the standard turbo pump.
The turbo pump transports gas by momentum transfer. The turbine blades are
angled so that when they strike a gas molecule it is deflected downward. Each set
of blades pushes the gas molecules further down toward the pump outlet. The
foreline pump is connected by a hose to the outlet of the turbo pump. It removes
the gas molecules that reach the outlet.
A controller regulates current to the pump and monitors pump motor speed and
temperature. A cooling fan is located between the turbo pump and the front panel
of the MSD. The fan draws air from outside the MSD and blows it over the pump.
The turbo pump turns on automatically as soon as the MSD power is switched on.
The system will allow the analyzer to be turned on when the turbo pump is greater
than 80% speed, but the pump normally operates at 100% speed. Turbo pump
MSDs typically maintain an indicated pressure below 8 x 10-5 Torr for helium column flows up to 4 ml/minute for the performance turbo pump, and up to 2 ml/
minute for the standard turbo pump. Pressure (vacuum) can only be measured if
your MSD is equipped with the optional gauge controller.
The turbo pump spins up (starts) and spins down (stops) quickly. This simplifies
pumpdown and venting. From initial power-on, the system can pump down to
operating pressure in 5 to 10 minutes.
FF˜d’p
Gauge controller, page 287
To pump down the MSD, page 60
To vent the MSD, page 54
Turbo pump control, see 326
Table 2. Typical MSD pressure readings for various carrier gas flow rates,
page 47
280
G˜˜˜˜"4¤¤h˜©’›Fh
›"m="=˜›¤*p˜z¤hz
Standard turbo pump
¤*p˜z¤hz˜amdF›˜§a›^˜’4FFm
¤*p˜p¤›dF›˜zp›
pmmF4›p˜›¤*p˜4pm›pddF
281
G˜˜˜˜"4¤¤h˜©’›Fh
FOph"m4F˜›¤*p˜z¤hz
Performance turbo pump
¤*p˜z¤hz˜amdF›˜§a›^˜
’4FFm
m›F’›"VF˜zp›˜|*d"mcF=˜pOO}
¤*p˜p¤›dF›˜zp›˜
pmmF4›p˜›¤*p˜4pm›pddF
282
G˜˜˜˜"4¤¤h˜©’›Fh
"da*"›apm˜¦"d¦F’˜"m=˜¦Fm›˜¦"d¦F
Calibration valves and vent valve
Calibration valves
A calibration valve is an electromechanical valve with a vial to hold the tuning
compound. When a calibration valve is opened, tuning compound in the vial diffuses into the ion source. EI MSDs have only one calibration valve, while CI MSDs
have another calibration valve for the CI tuning compound. The valves are controlled by the MSD ChemStation.
EI calibration valve
The EI calibration valve is held onto the front end plate of the analyzer chamber by
two screws. A small O-ring provides a face seal.
The diffusion pump and the standard turbo pump MSDs have a calibration valve
with restrictor with less restriction than that in the performance turbo MSD; this is
to allow the correct diffusion of calibrant for each vacuum system.
Perfluorotributylamine (PFTBA) is the most commonly used tuning compound
for EI operation. PFTBA is required for automatic tuning of the MSD. Other compounds can be used for manual tuning.
CI calibration valve
The CI tuning compound is perfluoro-5,8-dimethyl-3,6,9-trioxidodecane
(PFDTD). The CI calibration valve is part of the reagent gas flow control module.
It is controlled by the ChemStation software, and opens automatically during CI
autotune or manual tuning, allowing PFDTD to diffuse through the GC/MSD interface and into the ion source.
Vent valve
The vent valve knob screws into a threaded port in the front end plate. An O-ring
is compressed between the knob and the end plate to form a seal. The threaded
end of the knob has an air passage inside it, allowing air to flow into the manifold
when the knob is partially unscrewed. If you turn the knob too far, the O-ring can
come out of its slot.
283
G˜˜˜˜"4¤¤h˜©’›Fh
"da*"›apm˜¦"d¦F’˜"m=˜¦Fm›˜¦"d¦F
˜4"da*"›apm˜¦"d¦F˜
Fm›˜¦"d¦F˜cmp*
"da*"›apm˜¦a"d
˜4"da*"›apm˜¦"d¦F˜
Fm›˜¦"d¦F˜cmp*
_amV
a˜z"’’"VF
˜"d¦F˜4dp’F=
284
˜"d¦F˜pzFm
"d¦F˜pzFm˜›pp˜O"
G˜˜˜˜"4¤¤h˜©’›Fh
ap=F˜V"¤VF˜›¤*F
Triode gauge tube
The MSD is equipped with a triode gauge tube connected to the analyzer chamber.
With the optional 59864B Gauge Controller, the triode gauge can be used to measure the pressure (high vacuum) in the analyzer chamber. The triode gauge will
not operate at pressures above 8 × 10_ Torr. The triode gauge cannot be used
without the gauge controller.
"›’˜pO˜›^F˜›ap=F˜V"¤VF˜›¤*F˜pzF"›F˜"›˜"zzp¨ah"›Fd©˜sQ¬˜˜=4˜¤m˜pOO˜›^F˜›ap=F˜
V"¤VF˜*FOpF˜§pcamV˜mF"˜a›
^F˜›ap=F˜Oad"hFm›˜4"m˜aVma›F˜^©=pVFm˜F¦F˜›¤m˜pm˜›^F˜›¤*F˜aO˜›^FF˜a’˜"˜zp’’a*ada›©˜
›^"›˜^©=pVFm˜^"’˜"44¤h¤d"›F=˜am˜›^F˜h"maOpd=
The triode gauge relies on the ionization of gas molecules to establish a pressuredependent current flow. In the triode gauge, a regulated electrical current is
passed through a filament called the cathode, causing it to emit electrons. The
electrons accelerate from the filament toward a surrounding grid which is held at a
higher potential (+150 V dc).
The emitted electrons ionize gas molecules in the tube. Positive ions are driven to
a grounded wire mesh collector. At the collector, the positive ions regain missing
electrons. This generates current in the collector. The number of ions formed is a
function of the number of gas molecules present, that is, the gas pressure. Therefore, pressure can be calculated based on the current applied to the filament
(cathode) and the current measured in the collector.
Since one end of the triode gauge tube is open to the analyzer chamber, the pressure in the triode gauge is essentially the same as the pressure in the analyzer
chamber. To prevent electronic noise from the triode gauge tube from interfering
with the detector, a small z-fold baffle is inserted into the stem of the triode gauge
tube; and a shield is installed in the analyzer chamber between the tube port and
the ion source.
Unlike some other pressure gauges that work by ionization, the triode gauge does
not require degassing to remove accumulated ions from the surfaces in the gauge.
In some cases, however, new gauge tubes will not display pressures accurately
until they have been turned on for several hours.
285
ad"hFm›˜¦pd›"VF˜"m=˜Fha’’apm˜4¤Fm›
FV¤d"›F=˜*©˜V"¤VF˜4pm›pddF
a=˜¦pd›"VF˜
’¤zzdaF=˜*©˜V"¤VF˜4pm›pddF
ad"hFm›˜¦pd›"VF˜"m=˜Fha’’apm˜4¤Fm›˜
FV¤d"›F=˜*©˜V"¤VF˜4pm›pddF
pddF4›p˜|apm}˜4¤Fm›˜
hF"’¤F=˜*©˜V"¤VF˜4pm›pddF
a=
ad"hFm›˜|4"›^p=F}
pddF4›p
zFm˜›p˜"m"d©«F˜4^"h*F
The glass around the connector pins is easily cracked if the pins are moved too
much. Be very careful when connecting and disconnecting the cable to avoid damage to the tube and creating air leaks.
286
G˜˜˜˜"4¤¤h˜©’›Fh
"¤VF˜4pm›pddF
Gauge controller
The optional 59864B Gauge Controller allows you to use the triode gauge tube to
monitor the pressure in the MSD analyzer chamber. This can aid in everyday operation and in troubleshooting.
The 59864B Gauge Controller includes the controller and a cable for connecting
the controller to the triode gauge. A power cord is supplied with a plug appropriate for the country from which the order was placed. The gauge controller can
operate on all voltages between 100 and 240 V ac (nominal) and at ac frequencies
of 50 to 60 hertz. The fuse in the gauge controller is appropriate for all allowed
voltages.
The gauge controller regulates emission current to the filament of the triode gauge
tube. It also measures the ion current in the collector. From these data, the gauge
controller calculates and displays the pressure present in the analyzer chamber.
The analyzer chamber pressure (in Torr) is displayed on the front panel of the
controller.
The gauge controller is calibrated for nitrogen (N2). The carrier gas is usually
helium, which has does not ionize as readily as nitrogen. Therefore, the indicated
pressure for helium is approximately 6 times lower than the absolute pressure. For
example, a reading of 2.0 × 10_Q Torr versus an absolute pressure of 1.2 × 10_T˜Torr.
In a CI MSD, the indicated pressure reflects the contribution of both the carrier
gas and the reagent gas. The distinction between indicated and absolute pressure
is not important for normal operation of the MSD. Of greater concern are changes
in pressure from hour to hour or day to day. These changes can indicate air leaks
or other problems with the vacuum system. All the pressures listed in this manual
are indicated pressures for helium carrier gas. The gauge controller setpoints are
also indicated pressures.
FF˜d’p
To monitor high vacuum pressure, page 46
^F˜Oad"hFm›˜am˜›^F˜›ap=F˜V"¤VF˜›¤*F˜4"m˜aVma›F˜^©=pVFm˜F¦F˜›¤m˜pm˜›^F˜›¤*F˜aO˜
›^FF˜a’˜"˜zp’’a*ada›©˜›^"›˜^©=pVFm˜^"’˜"44¤h¤d"›F=˜am˜›^F˜h"maOpd=
287
G˜˜˜˜"4¤¤h˜©’›Fh
"¤VF˜4pm›pddF
F’’¤F˜=a’zd"©
p§F˜am=a4"›p
"¤VF˜|pm—pOO}˜’§a›4^
p§F˜4p=
p§F˜’§a›4^
"*dF˜›p˜›ap=F˜V"¤VF˜›¤*F
¤’F
p¤m=˜zpam›
288
9
EI GC/MSD interface, 291
EI/CI GC/MSD interface (CI interface), 292
Reagent gas flow control module, 293
GC/MSD Interfaces and
CI Flow Control
This chapter describes the function of the GC/MSD interfaces and the CI
reagent gas flow control module
GC/MSD interface
The GC/MSD interface is a heated conduit into the MSD for the capillary
column. It is bolted onto the right side of the analyzer chamber, with an
O-ring seal. A channel machined into the flange for the seal provides thermal
isolation between the heated interface and the O-ring and manifold. The GC/
MSD interface is covered by a protective cover which should be left in place.
One end of the GC/MSD interface passes through the side of the gas
chromatograph and extends into the GC oven. This end is threaded
(thread size is 10 × 32), allowing connection of the column with a nut and
ferrule. The other end of the GC/MSD interface fits into the ion source. The
last two millimeters of the capillary column extend past the end of the guide
tube and into the ionization chamber.
The GC/MSD interface is heated by an electric cartridge heater. The heater
is powered and controlled by Thermal Aux #2 heated zone of the 6890 Series
GC. The GC/MSD interface temperature can be set from the MSD ChemStation or from the keypad of the gas chromatograph. A sensor (thermocouple)
in the GC/MSD interface monitors the temperature.
The GC/MSD interface should be operated in the 250° to 350°C range.
Subject to that restriction, the GC/MSD interface temperature should be
slightly higher than the maximum GC oven temperature, but never higher
than the maximum column temperature.
FF˜d’p
To install a capillary column in the GC/MSD interface, 28
F¦F˜F¨4FF=˜›^F˜h"¨ah¤h˜4pd¤hm˜›FhzF"›¤F:˜Fa›^F˜am˜›^F˜am›FO"4F˜p˜›^F˜
˜p¦Fm
^F˜
—˜am›FO"4F˜pzF"›F’˜"›˜^aV^˜›FhzF"›¤F’˜O˜©p¤˜›p¤4^˜a›˜§^Fm˜a›˜a’˜^p›:˜a›˜
§add˜*¤m˜©p¤
290
n˜˜˜˜
—˜m›FO"4F’˜"m=˜˜dp§˜pm›pd
˜
—˜am›FO"4F
EI GC/MSD interface
F"›F˜’dFF¦F
F"›F˜’dFF¦F˜’4F§’
Fd=F=˜am›FO"4F˜"’’Fh*d©
m›FO"4F˜’p4cF›
pma«"›apm˜4^"h*F
_amV
m"d©«F˜
4F§
F"›F—’Fm’p˜"’’Fh*d©
m›FO"4F˜4p¦F
m’¤d"›apm
¤a=F˜›¤*F
"zadd"©˜4pd¤hm
291
EI/CI GC/MSD interface (CI interface)
The CI interface mounts onto the side of the analyzer chamber, with one end in the
GC oven and the other in the MSD. Reagent gas is plumbed into the interface. The
tip of the interface assembly extends into the ionization chamber. A spring-loaded
seal keeps reagent gases from leaking out around the tip. The reagent gas is
plumbed into the interface body, and mixes with carrier gas and sample in the ion
source. This interface is also used for EI operation in CI MSDs.
˜am›FO"4F˜4p¦F
˜am›FO"4F˜am’¤d"›p
˜am›FO"4F˜^F"›F˜4d"hz
˜am›FO"4F˜§Fd=hFm›
m›FO"4F˜›az˜’F"d
˜apma«"›apm˜4^"h*F
p¤4F˜"=a"›p
m"d©«F˜4^"h*F
F"›F—’Fm’p˜4"*dF
F"VFm›˜V"’˜amdF›
˜amdF›
292
n˜˜˜˜
—˜m›FO"4F’˜"m=˜˜dp§˜pm›pd
F"VFm›˜V"’˜Odp§˜4pm›pd˜hp=¤dF
Reagent gas flow control module
The CI reagent gas flow control module regulates the flow of reagent gas into the
EI/CI GC/MSD interface. The flow control module consists of a mass flow controller
(MFC), gas select valves, CI calibration valve, isolation valve, control panel, control
and display electronics, and plumbing. The back panel provides Swagelok inlet
fittings for methane and one other reagent gas. The other fittings in the flow module
are VCR fittings; VCR fittings have a disposable gasket that must be replaced every
time the seal is opened. Operation of the flow module is through the control panel
on the front. "’˜ must be plumbed with Methane. "’˜ can be plumbed with any
other reagent gas.
Operation of the flow module is through the control panel on the front.
dp§˜4pm›pd˜cmp*
dp§˜4pm›pd˜=a’zd"©
• Each button on the control pane has an LED (light) next to it. When that button
is active, the light is on.
• "’˜˜or˜
"’˜˜opens the chosen gas select valve. Only one can be open at a time.
• "’˜OO closes the gas select and isolation valves. "’˜OO also sets the MFC to 0%
flow, unless ¤VF is on. The "’˜OO LED must be off to turn on "’˜˜or˜
"’˜
• The flow control knob is used to adjust the flow. When no gases are turned on
the Flow Control display will show dashes: ––.
• ¤VF˜sets the MFC to 100% of total flow (fully open), regardless of the position
of the flow control knob or the state of the select valves.
• The flow control display shows the gas flow as a percentage of the total possible
flow (5 ml/min for methane). If the display is flashing, the controller cannot
maintain the selected flow. This usually means that the reagent gas supply does
not have high enough pressure.
293
n˜˜˜˜
—˜m›FO"4F’˜"m=˜˜dp§˜pm›pd
F"VFm›˜V"’˜Odp§˜4pm›pd˜hp=¤dF
• The flow control knob adjusts the gas flow. If the selected flow rate can not be
achieved or maintained, the numbers in the flow control display will flash.
• The CI calibration valve is controlled by the ChemStation software, and opens
automatically during CI autotune or manual tuning, allowing PFDTD to diffuse
into the ion source.
• The isolation valve prevents contamination of the flow control module by
atmosphere while the MSD is vented or by PFTBA during EI operation.
F"˜Odp§˜hp=¤dF˜4p¦F
’pd"›apm˜¦"d¦F
dp§˜4pm›pd˜*p"=˜|¤m=F˜4p¦F}
pm›pd˜z"mFd
—˜
—˜am›FO"4F
˜4"da*"›apm˜¦"d¦F
"’’˜Odp§˜4pm›pddF
F"VFm›˜V"’˜’FdF4›˜¦"d¦F
F"VFm›˜V"’˜amdF›˜damF’
©˜›p˜"¦pa=˜›¤mamV˜"m©˜hpF˜pO›Fm˜›^"m˜"*’pd¤›Fd©˜mF4F’’"©˜›p˜hamaha«F˜˜
*"4cVp¤m=˜"m=˜apm˜’p¤4F˜4pm›"ham"›apm
294
n˜˜˜˜
—˜m›FO"4F’˜"m=˜˜dp§˜pm›pd
F"VFm›˜V"’˜Odp§˜4pm›pd˜hp=¤dF
F"VFm›˜V"’˜Odp§˜4pm›pd˜hp=¤dF˜’4^Fh"›a4
CI ion
source
Green
light
Gas A
(Methane)
supply
Isolation
valve
Gas select
valve A
Mass
Flow
Controller
Gas select
valve B
Gas B
(Other gas)
supply
Calibration
valve
Amber
light
EI/CI
GC/MSD
interface
Restrictor
PFDTD
vial
GC column
When you turn off one gas and turn on the other, the system sets a 6-minute delay
with "’˜OO and ¤VF both on to pump out the flow control module. The light for
the selected reagent gas will flash, indicating the delay timer is active. Once the
delay is finished, the ¤VF and "’˜OO lights will turn off, and the light for the
selected gas will stop flashing and stay on.
When the MSD is turned off, all valves are closed, and all lights are off. At startup,
all valves are closed and all lights are off, except "’˜OO.
The flow control board remembers the flow setting for each gas. When either gas is
selected, the control board automatically sets the same flow that was used for that
gas last time.
295
n˜˜˜˜
—˜m›FO"4F’˜"m=˜˜dp§˜pm›pd
F"VFm›˜V"’˜Odp§˜4pm›pd˜hp=¤dF
dp§˜4pm›pd˜hp=¤dF˜’›"›F˜=a"V"h9
F’¤d›
"’˜˜Odp§’
"’˜˜Odp§’
¤VF˜
§a›^˜
"’˜˜
¤VF˜
§a›^˜
"’˜˜
¤hz˜p¤›
Odp§˜hp=¤dF
›"m=*©:˜¦Fm›F=:˜
p˜˜hp=F
m
OO
m
OO
OO
OO
"’˜˜|"h*F} OO
m
OO
m
OO
OO
¤VF˜|F=}
OO
OO
m
m
m
OO
"’˜OO˜|F=}
OO˜
OO˜
OO˜
OO˜
m
m
"d¦F˜
zFm
dp’F=
zFm
dp’F=
dp’F=
dp’F=
"d¦F˜
dp’F=
zFm
dp’F=
zFm
dp’F=
dp’F=
m˜→˜’F›zpam›
m˜→˜’F›zpam›
m˜→˜s¬¬~
m˜→˜s¬¬~
m˜→˜s¬¬~
OO˜|→¬~}
zFm
zFm
zFm
zFm
dp’F=
pm›pd˜z"mFd˜daV^›’˜|’}
"’˜˜|VFFm}
"d¦F˜’›"›F
’pd"›apm˜¦"d¦F zFm
296
10
Ion source, 300
CI ion source, 306
Quadrupole mass filter, 308
Detector, 312
Analyzer heaters and radiators, 314
Analyzer
This chapter describes the parts of the analyzer
Analyzer
The analyzer is the heart of the MSD
The analyzer ionizes the sample, filters the ions, and detects them. The
sample components exiting the GC column flow into the ion source. In the
ion source, the sample molecules are ionized and fragmented. The resulting
positive ions are repelled from the ion source into the quadrupole mass
filter. The mass filter allows selected ions to pass through the filter and
strike the detector. The detector generates a signal current proportional to
the number of ions striking it.
The analyzer is attached to the vacuum side of the side plate. The side plate
is hinged to allow easy access to the analyzer. Both the ion source and the
mass filter are independently heated. Each is mounted inside a radiator for
correct heat distribution.
Each of the parts of the analyzer is discussed in the following material.
The analyzer has four basic components
The analyzer consists of the following components:
• Ion source
• Mass filter
• Detector
• Heaters and radiators
298
s¬˜˜˜˜m"d©«F
F›F4›p˜|˜FdF4›pm˜
h¤d›azdaF}
F›F4›p˜Fm=˜hp¤m›amV˜
*"4cF›
"’’˜Oad›F˜4pm›"4›˜4"*dF
"’’˜Oad›F˜|am’a=F˜
"=a"›p}
"’’˜Oad›F˜^F"›F˜
"’’Fh*d©
pm˜’p¤4F˜
|am’a=F˜"=a"›p}
a=F˜*p"=
FF=›^p¤V^˜*p"=
a=F˜zd"›F
p¤4F˜Fm=˜hp¤m›amV˜
*"4cF›
"’’˜Oad›F˜4pm›"4›˜4"*dF
299
s¬˜˜˜˜m"d©«F
pm˜’p¤4F
Ion source
The ion source operates by electron ionization (EI). The sample enters the ion
source from the GC/MSD interface. Electrons emitted by a filament enter the ionization chamber, guided by a magnetic field. The high-energy electrons interact
with the sample molecules, ionizing and fragmenting them. The positive voltage
on the repeller pushes the positive ions into the lens stack, where they pass
through several electrostatic lenses. These lenses concentrate the ions into a tight
beam, which is directed into the mass filter.
Ion source body
The ion source body is a cylinder. Its cylindrical geometry ensures proper alignment of the lens stack. It holds the other parts of the ion source. With the repeller
and the drawout plate, it forms the ionization chamber. The ionization chamber is
the space where the ions are formed. Slots in the source body help the vacuum
system to pump away carrier gas and un-ionized sample molecules or fragments.
ad"hFm›
p¤4F˜*p=©
pma«"›apm˜4^"h*F
m›"m4F˜dFm’
pm˜Op4¤’˜dFm’
Fm’˜am’¤d"›p’
"§p¤›˜4©dam=F
"§p¤›˜zd"›F
FzFddF
300
s¬˜˜˜˜m"d©«F
pm˜’p¤4F
p¤4F˜"=a"›p
FF=›^p¤V^˜*p"=
pm˜’p¤4F
^¤h*’4F§
^¤h*’4F§
p¤4F˜^F"›F˜"m=˜’Fm’p˜
§aF’
pm˜Op4¤’˜zam˜|p"mVF˜§aF}
m›"m4F˜dFm’˜zam˜|*d¤F˜§aF}
301
s¬˜˜˜˜m"d©«F
pm˜’p¤4F
Filaments
Two filaments are located on opposite sides of the outside of the ion source. The
active filament carries an adjustable ac emission current. The emission current
heats the filament, causing it to emit electrons; these electrons ionize the sample
molecules. In addition, both filaments have an adjustable dc bias voltage. The bias
voltage determines the energy on the electrons, usually -70 eV.
The CI ion source has only one filament of a different design from the EI filaments.
A“dummy” filament provides connections for the Filament 2 wires.
The filament is shut off automatically if there is a general instrument shutdown.
There are three parameters that affect the filaments: filament selection (ad"hFm›),
filament emission (ha’’apm) current, and electron energy (dFmFV©).
Filament selection
The filament selection parameter (ad"hFm›) allows you to select which filament in
the ion source is active.
Sometimes, one filament will give better performance than the other. To select the
better of the two filaments, run two autotunes, one with each filament. Use the filament that gives the best results.
Emission current
The filament emission current (ha’’apm} is variable between 0 and -315 µA, but
should be set to the software default for normal operation.
Electron energy
The electron energy (dFmFV©) is the amount of energy on the ionizing electrons.
The electron energy is determined by the bias voltage; -70 V dc bias on the filament causes emitted electrons to possess -70 eV (electron volts). This value is
adjustable between -5 to -241 V dc, but for normal operation, set this parameter to
70.
302
s¬˜˜˜˜m"d©«F
pm˜’p¤4F
Filament care
Like the filaments in incandescent light bulbs, the ion source filaments will eventually burn out. Certain practices will reduce the chance of early failure:
• If you have an optional 59864B Gauge Controller, use it to verify that the system
has an adequate vacuum before turning on the analyzer, especially after any
maintenance has been performed.
• If you are controlling your MSD from the Edit Parameters screen, always select
OO before changing any of the filament parameters.
• When setting up data acquisition parameters, set the solvent delay so that the
analyzer will not turn on while the solvent peak is eluting.
• When the software prompts ¦Fa=F˜’pd¦Fm›˜=Fd"©… at the beginning of a run,
always select .
• Higher emission current will reduce filament life.
• Higher electron energy will reduce filament life.
• Leaving the filament on for short times (≤ 1 minute) during data acquisition will
reduce filament life.
Magnet
The field created by the magnet directs the electrons emitted by the filament into
and across the ionization chamber. The magnet assembly is a permanent magnet
with a charge of 350 gauss in the center of the field.
Repeller
The repeller forms one wall of the ionization chamber. A positive charge on the
repeller pushes positively-charged ions out of the source through a series of
lenses. The repeller voltage is also known as the ion energy, although the ions only
receive about 20% of the repeller energy. The repeller voltage can be varied from 0
to +42.8 V dc. Some tune programs use a fixed repeller voltage. Others ramp the
repeller voltage to find the optimum setting.
• Setting repeller voltage too low results in poor sensitivity and poor high mass
response.
• Setting repeller voltage too high results in precursors (poor mass filtering) and
poor low mass resolution.
303
s¬˜˜˜˜m"d©«F
pm˜’p¤4F
Drawout plate and cylinder
The drawout plate forms another wall of the ionization chamber. The ion beam
passes through the hole in the drawout plate and into the drawout cylinder. The
drawout cylinder is slotted. The slots correspond to slots in the source body.
These slots allow carrier gas and un-ionized sample molecules or fragments to be
pulled away by the vacuum system. The drawout plate and drawout cylinder are
both at ground potential.
Ion focus
The voltage on the ion focus lens can be varied from 0 to -127 V dc. A typical voltage is between -70 and -90 V dc. In general:
• Increasing the ion focus voltage improves sensitivity at lower masses.
• Decreasing the ion focus voltage improves sensitivity at higher masses.
• Incorrect ion focus adjustment results in poor high mass response.
Entrance lens
The entrance lens is located at the entrance to the quadrupole mass filter.
This lens minimizes the fringing fields of the quadrupole which discriminate
against high-mass ions. There is a permanent +4.4 volt voltage added to the
entrance lens. The total voltage applied to the entrance lens is the sum of the
entrance lens offset and entrance lens gain and the +4.4 volt permanent offset.
m›"m4F˜dFm’˜¦pd›"VF˜˜K˜˜‚TT˜˜=4˜‚˜pOO’F›˜‚˜|V"am˜×˜h"’’}
Entrance lens offset
The entrance lens offset (m›OO) controls the fixed voltage applied to the entrance
lens. It can be varied from 0 to -64 V dc (-20 V is typical). Increasing the entrance
lens offset generally increases the abundance of ions at low masses without substantially decreasing the abundance of high mass ions.
Entrance lens gain
Entrance lens gain (m›Fm’) controls the variable voltage applied to the entrance
lens. It determines how many volts are applied for each amu. It can be varied from
0 to -128 mV/amu. A typical range is 0 to -40 mV/amu.
304
s¬˜˜˜˜m"d©«F
pm˜’p¤4F
m›FO"4F˜’p4cF›
p¤4F˜*p=©
F›˜’4F§
FzFddF
FzFddF˜am’¤d"›p
ad"hFm›
p¤4F˜^F"›F˜"’’Fh*d©
FzFddF˜am’¤d"›p
"’^F
FzFddF˜m¤›˜
ad"hFm›
pm˜Op4¤’˜dFm’
"§p¤›˜4©dam=F
"§p¤›˜zd"›F
Fm’˜am’¤d"›p˜|pmF˜pO˜"˜z"a}
m›"m4F˜dFm’
305
s¬˜˜˜˜m"d©«F
˜apm˜’p¤4F
CI ion source
The CI ion source is similar to the EI source, but only has one part in common with
the EI source — the entrance lens. The single CI filament has a straight wire and a
reflector. There is a “dummy” filament to provide connections for the other wires.
The holes in the ion source (electron-entrance and ion-exit) are very small (0.5
mm), making it possible to pressurize the ionization chamber. Both the source body
and the plate are at repeller potential, electrically isolated from the radiator and the
CI interface tip. The seal for the interface tip ensures a leak-tight seal and electrical
isolation between the CI interface and ion source.
˜apm˜’p¤4F˜*p=©
˜Oad"hFm›
˜’p¤4F˜^F"›F˜
"’’Fh*d©
˜am›FO"4F˜›az˜’F"d
˜am›FO"4F˜›az
˜am›FO"4F˜4p¦F
p¤4F˜^F"›F˜"m=˜
’Fm’p˜4"*dF’
pm˜Op4¤’˜dFm’
m›"m4F˜dFm’
306
s¬˜˜˜˜m"d©«F
˜apm˜’p¤4F
˜apm˜’p¤4F˜*p=©
F›’4F§
˜FzFddF
˜FzFddF˜am’¤d"›p
˜Oad"hFm›
˜’p¤4F˜^F"›F˜
"’’Fh*d©
¤hh©˜Oad"hFm›
˜dFm’˜am’¤d"›p
˜apm˜Op4¤’˜dFm’˜
˜="§p¤›˜4©dam=F
˜="§p¤›˜zd"›F
˜dFm’˜am’¤d"›p
m›"m4F˜dFm’
˜am›FO"4F˜›az˜’F"d
307
s¬˜˜˜˜m"d©«F
¤"=¤zpdF˜h"’’˜Oad›F
Quadrupole mass filter
The mass filter separates ions according to their mass-to-charge ratio (m/z).
At a given time, only ions of a selected mass-to-charge ratio can pass through the
filter to the detector. The mass filter in the MSD is a quadrupole.
The quadrupole is a fused-silica (quartz) tube coated with a thin layer of gold. The
four hyperbolic surfaces create the complex electric fields necessary for mass
selection. Opposing segments are connected; adjacent segments are electrically
isolated. One pair has positive voltages applied, the other negative.
A combined direct current (dc) and radio frequency (RF) signal is applied to the
two pairs of segments. The magnitude of the RF voltage determines the mass-tocharge ratio of the ions that pass through the mass filter and reach the detector.
The ratio of dc-to-RF voltage determines the resolution (widths of the mass
peaks). There are several parameters that control the dc and RF voltages. All
these parameters are set by Autotune, but also can be manually adjusted in the
Edit Parameters window:
• AMU gain (h¤
"am)
• AMU offset (h¤OO’)
• 219 width (a=¢sn)
• DC polarity (˜pd)
• Mass (axis) gain ("’’
"am)
• Mass (axis) offset ("’’OO’)
AMU gain
AMU gain (h¤
"am) affects the ratio of dc voltage to RF frequency on the mass
filter. This controls the widths of the mass peaks.
• Higher gain yields narrower peaks.
• AMU gain affects peaks at high masses more than peaks at low masses.
308
s¬˜˜˜˜m"d©«F
¤"=¤zpdF˜h"’’˜Oad›F
AMU offset
AMU offset (h¤OO’) also affects the ratio of dc voltage to RF frequency on the
mass filter.
• Higher offset yields narrower peaks.
• AMU offset generally affects peak widths equally at all masses.
219 width
m/z 219 is a prominent ion near the middle of the mass range of PFTBA. The
width parameter (a=¢sn) makes small corrections to the m/z 219 peak width.
Amu gain and amu offset must be readjusted after the 219 width is changed. If you
are tuning with a compound other than PFTBA, there may not be an ion at m/z
219. In that case, set the 219 width to the last value found for it by Autotune or set
it to 0.
309
s¬˜˜˜˜m"d©«F
¤"=¤zpdF˜h"’’˜Oad›F
DC polarity
The dc polarity (˜pd) parameter selects the orientation of the direct current
applied to the quadrupole mass filter. The dc polarity that works best for your
MSD is determined at the factory. It is listed on the final test sheet accompanying
your MSD. It is also listed on a label on the cover over the RF coils. This cover can
be viewed by removing the upper MSD cover.
’amV˜›^F˜mpm_zFOFF=˜=4˜zpd"a›©˜h"©˜F’¤d›˜am˜¦F©˜zpp˜zFOph"m4F˜˜d§"©’˜¤’F˜›^F˜
O"4›p©_’zF4aOaF=˜zpd"a›©˜
Mass (axis) gain
Mass gain ("’’
"am) controls the mass assignment, that is, assignment of a particular peak to the correct m/z value.
• A higher gain yields higher mass assignment.
• Mass gain affects peaks at high masses more than peaks at low masses.
Mass (axis) offset
Mass offset ("’’OO’) also controls the mass assignment.
• A higher offset yields higher mass assignment.
• Mass offset generally affects peaks equally at all masses.
310
s¬˜˜˜˜m"d©«F
¤"=¤zpdF˜h"’’˜Oad›F
Quadrupole maintenance
The mass filter requires no periodic maintenance. It should not be removed
from the radiator. If absolutely necessary (that is, if the only alternative is
replacement), the quadrupole can be cleaned. Cleaning must be performed by Agilent Technologies service personnel.
F¦F˜z¤›˜›^F˜„¤"=¤zpdF˜am˜"m˜¤d›"’pma4˜4dF"mF˜
F¦F˜4^"mVF˜›^F˜z^©’a4"d˜paFm›"›apm˜pO˜›^F˜„¤"=¤zpdF˜h"’’˜Oad›F˜
^F˜O¤’F=_„¤"›«˜„¤"=¤zpdF˜a’˜O"VadF˜"m=˜§add˜*F"c˜aO˜=pzzF=˜p˜^"m=dF=˜p¤V^d©˜˜
^F˜h"›Fa"d˜am˜›^F˜4¤’z’˜pO˜›^F˜„¤"=¤zpdF˜a’˜¦F©˜^©Vp’4pza4˜˜O˜F¨zp’F=˜›p˜§"›F:˜›^F˜
„¤"=¤zpdF˜h¤’›˜*F˜=aF=˜¦F©˜’dp§d©˜›p˜zF¦Fm›˜="h"VF˜
311
s¬˜˜˜˜m"d©«F
F›F4›p
Detector
The detector in the MSD analyzer is a high energy conversion dynode (HED) coupled to an electron multiplier (EM). The detector is located at the exit end of the
quadrupole mass filter. It receives the ions that have passed through the mass filter. The detector generates an electronic signal proportional to the number of ions
striking it. The detector has three main components: the detector focus lens, the
high energy dynode, and the electron multiplier horn.
Detector focus lens
The detector focus lens directs the ion beam into the HED, which is located off
axis. The voltage on the detector focus lens is fixed at -354 V.
High energy dynode
The high energy dynode (HED) operates at -10,000 volts for EI and PCI, and
+10,000 volts for NCI. The HED is located off-axis from the center of the quadrupole mass filter to minimize signals due to photons, hot neutrals, and electrons
coming from the ion source. When the ion beam hits the HED, electrons are emitted. These electrons are attracted to the more positive electron multiplier horn.
Do not touch the ceramic insulator.
Electron multiplier horn
The electron multiplier horn carries a voltage of up to -3000 volts at its opening
and 0 volts at the other end. The electrons emitted by the HED strike the EM horn
and cascade through the horn, liberating more electrons as they go. At the far end
of the horn, the current generated by the electrons is carried through a shielded
cable outside the analyzer to the signal amplifier board.
The voltage applied to the electron multiplier horn determines the gain. The voltage is adjustable from 0 to -3000 V dc. Use the electron multiplier voltage found
in autotune as a baseline for the electron multiplier voltage setting.
• To increase signal strength, increase the electron multiplier voltage.
• For concentrated samples where less signal strength is needed, decrease the
electron multiplier voltage.
312
s¬˜˜˜˜m"d©«F
F›F4›p
As the EM horn ages, the voltage (pd›’) required by the electron multiplier
increases over time. If the electron multiplier voltage must always be set at or near
-3000 V dc to complete Autotune, with no other probable cause, it may need to be
replaced. Check your tune charts for gradual degradation, which indicates wearing
out. Select aF§˜¤mF’ from the Qualify menu in the Instrument Control view to
see the tune charts. Sudden changes usually indicate a different type of problem.
˜FF˜d’p
Troubleshooting (5973N MSD) in the online help for more information about
symptoms that may indicate electron multiplier problems.
aVm"d˜§aF
p¤m›amV˜*"4cF›
p¤m›amV˜’4F§
˜4F"ha4
|=pmŒ›˜›p¤4^M}
˜|^aV^˜FmFV©˜
=©mp=F}˜
aV^˜¦pd›"VF˜˜§aF
dF4›pm˜h¤d›azdaF˜^pm
˜|FdF4›pm˜h¤d›azdaF˜
¦pd›"VF}˜§aF
F›F4›p˜Op4¤’˜§aF
˜OFF=›^p¤V^
F"˜’a=F˜zd"›F˜
›^¤h*’4F§
313
s¬˜˜˜˜m"d©«F
m"d©«F˜^F"›F’˜"m=˜"=a"›p’
Analyzer heaters and radiators
The ion source and mass filter are housed in cylindrical aluminum tubes called
radiators. The radiators control the distribution of heat in the analyzer. They also
provide electrical shielding for analyzer components. The source heater and temperature sensor are mounted in the source heater block. The mass filter (quad)
heater and temperature sensor are mounted on the mass filter radiator. Analyzer
temperatures can be set and monitored from the MSD ChemStation.
In selecting the temperatures to use, consider the following:
• Higher temperatures help keep the analyzer clean longer.
• Higher ion source temperatures result in more fragmentation and therefore
lower high-mass sensitivity.
After pumpdown, it takes at least 2 hours for the analyzer to reach thermal equilibrium. Data acquired sooner may not be reproducible.
Recommended settings (for EI operation):
• Ion source 230°C
• Quadrupole 150°C
p˜mp›˜F¨4FF=˜¢¬¬@˜pm˜›^F˜„¤"=¤zpdF˜p˜¢Q¬@˜pm˜›^F˜apm˜’p¤4F
The GC/MSD interface, ion source, and mass filter (quad) heated zones interact.
The analyzer heaters may not be able to accurately control temperatures if the setpoint for one zone is much lower than that of an adjacent zone.
314
s¬˜˜˜˜m"d©«F
m"d©«F˜^F"›F’˜"m=˜"=a"›p’
F›F4›p˜Fm=˜hp¤m›amV˜
*"4cF›
"’’˜Oad›F˜"=a"›p
"’’˜Oad›F˜^F"›F˜
"’’Fh*d©
pm˜’p¤4F˜"=a"›p
a=F˜zd"›F
FF=›^p¤V^˜*p"=
p¤4F˜^F"›F˜"’’Fh*d©
p¤4F˜Fm=˜hp¤m›amV˜
*"4cF›
315
316
11
Control panel and power switch, 320
Side board, 322
Electronics module, 323
Main board, 324
Signal amplifier board, 325
AC board, 326
Turbo pump control, 326
Diffusion pump control, 328
Pumpdown failure shutdown, 328
LAN/MSD control card, 330
Power supplies, 331
Toroid transformer, 331
Back panel and connectors, 332
Interfacing to external devices, 334
Electronics
This chapter describes the MSD electronics
Electronics
The following assemblies make up the MSD electronics:
• Control panel and power switch
• Electronics module
• Main board
• Signal amplifier board
• LAN/MS control card
• AC board
• Turbo pump controller
• Low voltage (ac-dc) power supply
• High voltage (HED) power supply
• Toroid transformer assembly
• Back panel connectors
• Side board
Each is discussed in this chapter. Except for the Back panel and connectors, Status display and power switch, and Interfacing to other devices
sections, most of this material is not essential for day-to-day operation of the
MSD. It may be of interest to persons responsible for servicing the MSD.
"mVFp¤’˜¦pd›"VF’˜"F˜zF’Fm›˜¤m=F˜›^F˜’"OF›©˜4p¦F’˜p˜mp›˜Fhp¦F˜’"OF›©˜
4p¦F’˜FOF˜’F¦a4amV˜›p˜©p¤˜VadFm›˜F4^mpdpVaF’˜’F¦a4F˜FzF’Fm›"›a¦F
318
ss˜˜˜˜dF4›pma4’
p¤4F˜zp§F˜4"*dF
a=F˜*p"=˜4pm›pd˜4"*dF
a=F˜*p"=˜|Opm›}
aVm"d˜4"*dF
aVm"d˜"hzdaOaF˜*p"=
˜4pm›pd˜4"=
"am˜*p"=
˜zp§F˜4"*dF
F›F4›p˜Op4¤’˜4"*dF
a=F˜*p"=˜|F"}
aV^˜¦pd›"VF˜|}˜zp§F˜’¤zzd©
˜*p"=
p§˜¦pd›"VF˜zp§F˜’¤zzd©
ppa=˜›"m’OphF
319
ss˜˜˜˜dF4›pma4’
pm›pd˜z"mFd˜"m=˜zp§F˜’§a›4^
Control panel and power switch
Control panel
The MSD has a control panel on the front of the instrument.
You can view MSD system status, and perform some control functions from the
control panel.
Functions available through the control panel include
•
•
•
•
•
•
FF˜"d’p
Prepare to vent (cool analyzer and turn off high vacuum pump)
Monitor MSD status
Run autotune
Run method
Run sequence
View and set analyzer temperatures
The 5973N MSD Control Panel Quick Reference
Power switch
The power switch is part of the electronics module, and is located on the lower left
of the front of the MSD. It is used to switch the MSD and foreline pump on and off.
p˜mp›˜’§a›4^˜›^F˜˜pOO˜¤mdF’’˜a›˜^"’˜4phzdF›F=˜›^F˜¦Fm›˜zpV"h˜m4pF4›˜’^¤›=p§m˜
4"m˜’Fap¤’d©˜="h"VF˜›^F˜
320
ss˜˜˜˜dF4›pma4’
pm›pd˜z"mFd˜"m=˜zp§F˜’§a›4^
Qn•˜4pm›pd˜z"mFd
p§F˜’§a›4^
321
ss˜˜˜˜dF4›pma4’
a=F˜*p"=
Side board
The side board is mounted on the side plate. It performs the following functions:
• Provides the 1 MHz reference clock for the RF amplifier.
• Generates the RF component of the voltage applied to the quadrupole mass filter
according to a signal from the main board. The amplitude of this voltage is
proportional to the mass selected.
• Generates the dc component of the voltage applied to the quadrupole mass
filter. The magnitude of this voltage is proportional to the RF voltage.
• Passes voltages generated on the main board, and the detector focus voltage
from the HED power supply, to elements in the ion source and the detector.
• Generates and adjusts filament emission current and electron energy as
controlled by the main board.
• Switches the filament power from one filament to the other.
• Monitors for RF faults and shuts down the analyzer one is detected.
322
ss˜˜˜˜dF4›pma4’
dF4›pma4’˜hp=¤dF
Electronics module
Most of the electronics in the MSD are contained in the electronics module. The
whole electronics module can be replaced, if necessary, by your Agilent Technologies service representative.
The electronics module contains:
•
•
•
•
•
•
•
Main board
Signal amplifier board
LAN/MS control card
AC board (power distribution / vacuum control board)
Low voltage (ac-dc) power supply
High voltage (HED) power supply
Toroid transformer assembly
323
ss˜˜˜˜dF4›pma4’
"am˜*p"=
Main board
The main board is mounted on the outer side of the electronics module. The main
board performs the following functions:
• Receives and decodes digital instructions from the LAN/MS control card.
• Sends digital information to the LAN/MS control card.
• Generates voltages for the ion source lenses.
• Generates control signals for alternate filament selection, filament emission
current, and electron energy. Generates control signals for quadrupole RF drive,
dc/RF ratio adjustment, dc polarity selection, and all detector voltages.
• Performs analog-to-digital conversion for the coil DIP signal, ion source and
mass filter temperature signals, and foreline pressure or turbo pump speed
signal.
• Monitors the signals from the vacuum system and fans; and monitors the
filament status, HV fault and RF fault signals from the side board. Activates the
shutdown line when the analyzer electronics must be disabled.
• Generates the control signals (on and off) used by the ac board for the high
vacuum pump and calibration valve.
• Generates ± 280 V dc (nominal) power for main board lens amplifiers and side
board dc amplifiers.
• Supplies and controls the power for the ion source and quadrupole (mass filter)
heaters.
• Provides 24 V dc power for the cooling fans.
324
ss˜˜˜˜dF4›pma4’
aVm"d˜"hzdaOaF˜*p"=
Signal amplifier board
The signal amplifier board amplifies the output of the detector. The signal amplifier circuit produces an output voltage of 0 to 10 volts dc, proportional to the logarithm of the input current of 3 picoamps to 50 microamps.
An analog-to-digital converter converts the amplifier output voltage to digital
information. The LAN/MS control card “unlogs” the data into abundance counts
proportional to the detector signal current.
325
ss˜˜˜˜dF4›pma4’
˜*p"=
AC board
The ac board is mounted on the opposite side of the electronics panel from the
LAN/MSD control card. The ac board is also sometimes called the power distribution / vacuum control board. The ac board performs the following functions:
• Provides input voltage transparency for the MSD.
• Distributes ac line power to the ac/dc power supply, the foreline pump, and the
turbo pump controller.
• Turns the calibration valve on or off as directed to by the main board.
• Provides the voltage for the calibration valve.
• Provides logic interface to turbo controller.
• Controls the diffusion pump:
— Controls the foreline gauge.
— Turns on the diffusion pump once the foreline pressure is low enough, as
directed by the main board.
— Regulates the ac power to the diffusion pump heater.
— Turns off the diffusion pump if the foreline pressure is too high or if the
diffusion pump is too hot.
• Passes the foreline pressure signal from the foreline gauge or turbo pump speed
and other vacuum status information to the main board.
• Turns off the foreline pump in case of a problem with pumpdown.
Turbo pump control
The ac board sends control signals to, and receives turbo pump status information
from, the turbo pump controller. The turbo pump controller provides power to the
turbomolecular pump and regulates pump speed. If the pump fails to reach 80%
speed within 7 minutes after beginning pumpdown, or if the speed drops below
50% during operation, the controller shuts off the turbo pump and the ac board
shuts off the foreline pump.
Your MSD is equipped with one of two types of turbo controller.
• Integrated power supply and controller
• Power supply and separate EXDC mini-controller
326
ss˜˜˜˜dF4›pma4’
˜*p"=
a˜¦"4˜zp§F˜4"*dF
pm›pddF˜4"*dF
HI VAC Power
Pwr Supply / Ctlr
Fan
MSD electronics
module (ac board)
Turbo
pump
Harness
Cal
valve
pm›pddF˜^"mF’’
¤*p˜z¤hz˜4pm›pd˜§a›^˜am›FV"›F=˜zp§F˜’¤zzd©˜—˜4pm›pddF
a˜¦"4˜zp§F˜4"*dF
˜4"*dF
Turbo power supply
Turbo
pump
MSD electronics
module (ac board)
EXDC
mini
ctlr
Bracket
Fan
HI VAC Power
Harness
Cal
valve
˜4pm›pddF˜^"mF’’
¤*p˜z¤hz˜4pm›pd˜§a›^˜’Fz""›F˜zp§F˜’¤zzd©˜"m=˜˜hama˜4pm›pddF
327
ss˜˜˜˜dF4›pma4’
˜*p"=
Diffusion pump control
The power regulator ensures that the diffusion pump heater receives constant
power, even if there are fluctuations in the ac line voltage. It measures the voltage
across the heater and the current through it, multiplies them together, and compares the result with a standard value. Any discrepancy is applied as an error signal to adjust the power.
If the power distribution board senses a malfunction in the diffusion pump power
regulator, it shuts off power to the diffusion pump.
Pumpdown failure shutdown
The ac board will shut down both the high vacuum and the foreline pump if the
system fails to pump down correctly. The conditions that trigger shutdown are:
• Diffusion pump MSD: foreline pressure still above 300 mTorr after 7 minutes
• Turbo pump MSD: turbo pump speed below 80% after 7 minutes
This is usually because of a large air leak: either the sideplate has not sealed correctly or the vent valve is still open. This feature helps prevent the foreline pump
from sucking air through the system, which can damage the analyzer and pump.
To correct the problem, power cycle the MSD, and troubleshoot. You have seven
minutes to find and correct the air leak before the system shuts down again. Be
sure to press on the sideplate when turning on the MSD power to ensure a good
seal.
328
ss˜˜˜˜dF4›pma4’
˜*p"=
a˜¦"4˜zp§F˜4"*dF
aOO¤’apm˜z¤hz˜^F"›F˜4"*dF
Diffusion
pump
MSD electronics
module (ac board)
HI VAC Power
heater
Harness
Fan
Foreline
gauge
sensors
Cal
valve
aOO¤’apm˜z¤hz˜^"mF’’
aOO¤’apm˜z¤hz˜4pm›pd
329
ss˜˜˜˜dF4›pma4’
—˜4pm›pd˜4"=
LAN/MSD control card
The LAN/MS control card is located to the left of the main board on the electronics
panel. The LAN/MS control card has two main functions:
• Providing a communication interface between the MSD and the data system.
• Providing real-time control of the MSD, freeing the data system for other tasks.
Functional areas of the LAN/MS control card include:
•
•
•
•
•
•
•
•
•
Instrument controller
Data processor
Main processor
Serial communication processor
Network communication controller
Remote start processor
Random access memory (RAM)
Status LEDs
Control panel firmware
LEDs on the LAN/MSD control card are visible on the rear panel. The upper two
LEDs indicate network communication.
The two bottom LEDs are the power (good, digital 5V) and the “heartbeat” indicator. The flashing heartbeat LED indicates that the operating system of the MSD is
functioning. In case of catastrophic loss of flash memory, the heartbeat flashes in
an “SOS” pattern.
330
ss˜˜˜˜dF4›pma4’
p§F˜’¤zzdaF’
Power supplies
Low voltage (ac-dc) power supply
The low voltage power supply is mounted next to the toroid transformer in the
electronics module. A universal input power supply, it converts ac line voltage into
the dc voltages used by the rest of the electronics. The power supply generates the
following dc voltages:
•
•
•
•
+24 V (nominal)
+15 V (nominal)
-15 V (nominal)
+5 V (nominal)
High voltage (HED) power supply
The high voltage power supply provides the -10,000 volts dc for the high energy
dynode (HED) in the detector for EI and EI/PCI MSDs. The EI/PCI/NCI MSD
requires a bipolar power supply that can also provide +10,000 volts for NCI operation. The HED power supply also provides the 350 volts dc for the detector focus
lens. Due to the high impedance of this circuit, measuring the detector focus voltage (350 volts) with a handheld voltmeter will give a typical reading of 90 to 100
volts where the polarity matches that of the HED voltage.
Toroid transformer
The toroid transformer is mounted next to the ac board. It provides 24 V ac for the
mass filter and source heater circuits. The input wires take 120 V ac or
200 – 260 V ac from the ac board. The AC board samples the line voltage and uses
a relay to appropriately strap the toroid primary. The output wires connect to the
main board.
331
ss˜˜˜˜dF4›pma4’
"4c˜z"mFd˜"m=˜4pmmF4›p’
Back panel and connectors
The back panel contains several connectors, the primary fuses, several status
LEDs. Most of these components are part of the ac board or the LAN/MS control
card, and extend through the back panel.
High vacuum control (˜
) connector
The high vacuum signal connector is on the ac board. See Turbo pump control, 326
and Diffusion pump control, 328.
High vacuum power (˜) connector
The high vacuum power connector carries power for the diffusion pump heater or
the turbo controller from the ac board.
Primary fuses
The primary fuses limit current into the MSD in case of a short circuit in the foreline pump. The primary fuses are on the ac board.
Power cord receptacle
The ac power cord brings in all electrical power for the MSD. The power cord can
be detached from the MSD.
Foreline pump power cord receptacle
The foreline pump power cord receptacle provides ac power for the foreline pump.
If the power switch is off, no power is supplied to the foreline pump.
Remote start connector
The remote start connector is the external connector for the remote start circuitry
on the LAN/MS control card. It receives remote start signals from the GC.
LAN (I/O) connector
The LAN cable from the data system is connected to the I/O LAN connector.
This cable carries all data communication between the PC and the MSD.
LAN/MSD control card LEDs
The upper two LEDs indicate network communication. The two bottom LEDs are
the power and the “heartbeat” indicator.
332
ss˜˜˜˜dF4›pma4’
"4c˜z"mFd˜"m=˜4pmmF4›p’
"m’ha›˜|¨}˜"m=˜F4Fa¦F˜|¨}˜’
Fhp›F˜’›"›˜4"*dF
aV^˜¦"4¤¤h˜4pm›pd˜4"*dF
aV^˜¦"4¤¤h˜zp§F˜4"*dF
ah"©˜O¤’F’
p§F˜4p=˜F4Fz›"4dF
pFdamF˜z¤hz˜zp§F˜4p=
˜4"*dF
p§F˜|}˜"m=˜F"›*F"›˜|F"›}˜’
333
ss˜˜˜˜dF4›pma4’
m›FO"4amV˜›p˜F¨›Fm"d˜=F¦a4F’
Interfacing to external devices
Remote control processor
The remote control processor on the LAN/MS control card synchronizes start-run
signals with GCs and other devices. The functions of the remote control processor
are extended to the remote start (Fhp›F} connector on the back panel of the
MSD. The remote start cable connects the GC and the MSD.
Remote start signals
It is often necessary to communicate with external devices (for example, a purgeand-trap) during a run. Typically, these communications are:
• Requests to send a system ready signal
• Receive a start run signal from an external device
• Program the timing of events during a run
334
F"=©
›"›
p¤m=
˜Fhp›F˜’›"›˜
4pmmF4›p
ss˜˜˜˜dF4›pma4’
m›FO"4amV˜›p˜F¨›Fm"d˜=F¦a4F’
System ready
When interfacing to an external device, it is often desirable to send a system ready
signal to the device. In the case of a multi-sample Tekmar purge-and-trap, each
sample is purged onto a trap where it waits for a ready signal. On receipt of the
ready signal, the desorbtion cycle begins. When a specific temperature has been
reached, the purge-and-trap closes a contact to indicate the run has started.
The ready pin on the remote start connector on the GC is held low at all times
except when the GC, MSD, and data system are all ready. On system ready, a logic
high of 5 V dc is present between that pin and any ground. This same high can be
detected between the ready and ground pins on the remote start connector on
the MSD.
Start run input
The best way to generate a start run signal is to use the remote start connector on
the GC. Since remote start cables are made for most common devices, this is often
the simplest way. A general-purpose remote start cable (05890-61080), which is
also available, terminates in spade lugs. Care must be taken to ensure that the system is actually ready before the start run signal is sent.
If necessary, the remote start connector on the back of the MSD can be used to
send the start run signal. A contact closure between the start and ground pins will
start the run if the system is ready.
335
336
12
Electronics, 339
Vacuum system, 344
Analyzer, 352
EI GC/MSD interface, 358
Consumables and maintenance supplies, 360
Ferrules, 362
CI Parts, 364
Parts
This chapter lists parts that can be ordered for your MSD
General Parts
This chapter lists parts that can be ordered for use in maintaining your
5973N MSD. It includes most of the parts or assemblies in the MSDs. This
chapter is organized so that related parts are grouped together.
Some of the parts listed are not user-replaceable. They are listed here for
the convenience of Agilent Technologies service representatives.
To order parts
To order parts for your MSD, address the order or inquiry to your local
Agilent Technologies office. Supply them with the following information:
• Model and serial number of your MSD, located on a label on the lower left
side near the front of the instrument. See page 9.
• Part number(s) of the part(s) needed
• Quantity of each part needed
Some parts are available as rebuilt assemblies
Rebuilt assemblies pass all the same tests and meet all the same specifications as new parts. Rebuilt assemblies can be identified by
their part numbers. The first two digits of the last five digits of the part
number are 69 or 89 (i.e., XXXXX-69XXX). Rebuilt assemblies are available
on an exchange-only basis. When you return the original part to
Agilent Technologies (after you receive the rebuilt assembly) you will
receive a credit.
If you cannot find a part you need
If you need a part that is not listed in this chapter, check the Agilent
Technologies Analytical Supplies Catalog or the on-line catalogue on the
worldwide web at e^››z9——§§§"VadFm›4phY. If you still cannot find it, contact
your Agilent Technologies service representative or your Agilent
Technologies office.
338
s¢˜˜˜˜"›’
dF4›pma4’
Electronics
The printed circuit boards in the MSD are available only as complete assemblies.
Individual electronic components are not available. This section contains the
following parts: cables, fuses, printed circuit boards (electronic assemblies).
"*dF˜G
¨›Fm"d˜4"*dF’
F’4az›apm
"›˜m¤h*F
Fhp›F˜’›"›˜4"*dF
˜4"*dF˜|’^aFd=F=}
p§F˜4p=:˜¤’›"da":˜^am"
p§F˜4p=:˜Fmh"c
p§F˜4p=:˜¤pzF
p§F˜4p=:˜m=a"˜—˜p¤›^˜Oa4"
p§F˜4p=:˜"z"m˜|¢¬¬˜}
p§F˜4p=:˜§a›«Fd"m=
p§F˜4p=:˜:˜pmV˜pmV:˜amV"zpF
p§F˜4p=:˜
ap=F˜V"¤VF˜4"*dF˜|›ap=F˜V"¤VF˜›¤*F˜›p˜V"¤VF˜4pm›pddF}
"*dF˜n
sQ¬_–¬n¬
Gs¢s_¬¬¬G
Gs¢¬_s–n
Gs¢¬_¢nQ–
Gs¢¬_s–Gn
Gs¢¬_T¢spmŒ›˜a›s
¢¬¢Q_–¬sGn
Gs¢¬_¢s¬T
Gs¢¬_sQs
Gs¢¬_s•G
Gs¢¬_–Q•
¤’F’˜"m=˜zp§F˜’§a›4^
F’4az›apm
"›˜m¤h*F
s
¤’F˜˜T:˜¢Q¬:˜O"’›_"4›amV:˜dp§˜*F"camV˜|"4˜*p"=˜"m=˜h"am˜*p"=} ˜
¤’F:˜G:˜¢Q¬:˜›ahF_d"V:˜˜^aV^˜*F"camV˜4"z"4a›©˜˜|zah"©˜O¤’F’}
p§F˜*¤››pms˜
p§F˜’§a›4^˜F¨›Fm=F˜p=s˜
§a›4^˜"="z›Fs˜
¢ss¬_¬•T
¢ss¬_¬n–n
Q¬Ts_s¢¬
s¬nn_T¬¬¬•
s¬nn_¢¬¬¢–
s p›˜"˜¤’F_Fzd"4F"*dF˜z"›˜FOF˜’F¦a4F˜›p˜©p¤˜VadFm›˜F4^mpdpVaF’˜
’F¦a4F˜FzF’Fm›"›a¦F
339
s¢˜˜˜˜"›’
dF4›pma4’
"*dF˜s¬
m›Fm"d˜"*dF’
F’4az›apm
˜*p"=˜4pm›pd˜4"*dF˜|˜*p"=˜›p˜h"am˜*p"=}s˜
^"’’a’˜Vp¤m=˜§aFs˜
pm›pd˜z"mFd˜a**pm˜4"*dF
aOO¤’apm˜z¤hz˜4pm›pd˜4"*dF˜˜
dF4›pma4’˜hp=¤dF˜O"m˜4"*dFs˜
"m˜|^aV^˜¦"4¤¤h}˜4"*dF
FF=›^p¤V^˜*p"=˜|am’a=F˜"m"d©«F˜4^"h*F}
˜4pm›pd˜4"*dF˜
˜zp§F˜4"*dF˜
aV^˜¦"4¤¤h˜zp§F˜F¨›Fm=F˜4"*dF˜|˜*p"=˜›p˜*"4c˜z"mFd}s˜
p§˜¦pd›"VF˜zp§F˜’¤zzd©˜amz¤›˜4"*dF˜|˜*p"=˜›p˜˜}s˜
p§˜¦pd›"VF˜zp§F˜’¤zzd©˜p¤›z¤›˜4"*dF˜|˜˜›p˜h"am˜*p"=}s˜
"’’˜Oad›F˜4pm›"4›˜4"*dF˜ca›˜|am’a=F˜"m"d©«F˜4^"h*F}˜
a=F˜*p"=˜4pm›pd˜|a**pm}˜4"*dF˜|h"am˜*p"=˜›p˜’a=F˜*p"=}s˜
aVm"d˜4"*dF˜|’aVm"d˜OFF=›^p¤V^˜pm˜’a=F˜zd"›F˜›p˜’aVm"d˜"hzdaOaF˜*p"=}s˜
p¤4F˜zp§F˜4"*dF˜|h"am˜*p"=˜›p˜’a=F˜*p"=}s˜
¤*p˜z¤hz˜4pm›pd˜4"*dF˜|*"4c˜z"mFd˜›p˜›¤*p˜4pm›pddF}
¤*p˜z¤hz˜zp§F˜4"*dF˜|*"4c˜z"mFd˜›p˜›¤*p˜4pm›pddF}
s p›˜"˜¤’F_Fzd"4F"*dF˜z"›˜FOF˜’F¦a4F˜›p˜©p¤˜VadFm›˜F4^mpdpVaF’˜
’F¦a4F˜FzF’Fm›"›a¦F
340
˜z"›˜m¤h*F
s¬nn_–¬T¢¢
s¬nn_–¬T
¢QGn_–¬¬¬
s¬nn_–¬T•
s¬nn_–¬Q–¬
s¬nn_–¬Q–s
s¬nn_–¬T¢Q
s¬nn_–¬T¬
s¬nn_–¬Ts
s¬nn_–¬T–
s¬nn_–¬T¢–
s¬nn_–¬T¢•
s¬nn_–¬s¬
s¬nn_–¬Ts¬
s¬nn_–¬Ts–
s¬nn_–¬T¢G
s¬nn_–¬TG
s¬nn_–¬TQ
s¢˜˜˜˜"›’
dF4›pma4’
p¤4F˜zp§F˜4"*dF
s¬nn_–¬T¢G
a=F˜*p"=˜4pm›pd˜4"*dF
s¬nn_–¬Ts¬
˜zp§F˜’¤zzd©˜p¤›z¤›˜
4"*dF˜
s¬nn_–¬Ts
Fhp›F˜’›"›˜4"*dF
sQ¬_–¬n¬
˜4"*dF:˜’^aFd=F=
Gs¢s_¬¬¬G
aVm"d˜4"*dF
s¬nn_–¬Ts–
˜*p"=˜4pm›pd˜4"*dF
s¬nn_–¬T¢¢
˜4pm›pd˜4"*dF
s¬nn_–¬T¬
p§˜¦pd›"VF˜˜amz¤›˜4"*dF
s¬nn_–¬T¢–
p§˜¦pd›"VF˜˜p¤›z¤›˜4"*dF
s¬nn_–¬T¢•
341
s¢˜˜˜˜"›’
dF4›pma4’
"*dF˜ss
am›F=˜4a4¤a›˜*p"=’s
F’4az›apm˜
"4˜*p"=
O"m˜Op˜FdF4›pma4’˜hp=¤dFs˜
˜zp§F˜’¤zzd©˜
*azpd"˜˜zp§F˜’¤zzd©˜|——˜’˜pmd©}
—˜4pm›pd˜4"=
¬_zam˜˜|¢˜F„¤aF=}
•¢_zam˜˜|s˜F„¤aF=}
dp§˜¦pd›"VF˜|"4_=4}˜zp§F˜’¤zzd©˜
h"am˜*p"=
’aVm"d˜"hzdaOaF˜*p"=
›ppa=˜›"m’OphF˜
pm›pd˜z"mFd˜"’’Fh*d©
a=F˜*p"=
s pmF˜pO˜›^F˜z"›’˜am˜›^a’˜›"*dF˜"F˜¤’F_Fzd"4F"*dF˜z"›’˜FOF˜’F¦a4F˜
›p˜©p¤˜VadFm›˜F4^mpdpVaF’˜’F¦a4F˜FzF’Fm›"›a¦F
342
"›˜m¤h*F
¢QGn_–n¬¬Q
s–¬_s¬G
s¬nn_G¬¬s•
s¬nn_G¬¬sG
¬Qnn¬_–nT¢¬
sGsG_T¢•s
sGsG_Q•¬n
¬nQ¬_¬–•
s¬nn_–n¬s¬
s¬nn_–n¬¬s
s¬nn_–¬¢¢n
¢QGn_–¬QGT
s¬nn_–n¬sQ
s¢˜˜˜˜"›’
dF4›pma4’
"am˜*p"=
s¬nn_–n¬s¬
a=F˜*p"=
s¬nn_–n¬sQ
aVm"d˜"hzdaOaF˜*p"=
s¬nn_–n¬¬s
—˜4pm›pd˜4"=
¬Qnn¬_–nTs¬
˜*p"=
¢QGn_–n¬¬Q
aV^˜¦pd›"VF˜|}˜zp§F˜
’¤zzd©
"m˜Op˜FdF4›pma4’˜hp=¤dF˜
s–¬_s¬G
pm›pd˜z"mFd˜"’’Fh*d©
¢QGn_–¬QGT
p§˜¦pd›"VF˜|"4_=4}˜zp§F˜’¤zzd©
¬nQ¬_¬–•
ppa=˜›"m’OphF
s¬nn_–¬¢¢n
343
s¢˜˜˜˜"›’
"4¤¤h˜’©’›Fh
Vacuum system
This section lists replacement parts available for the vacuum system. It includes:
clamps, O-rings and seals, foreline pump and related components, diffusion pump
vacuum system components, and turbomolecular pump vacuum system
components.
"*dF˜s¢
_amV’˜"m=˜’F"d’
F’4az›apm
"da*"›apm˜¦"d¦F˜_amV˜|s—T_am4^}
m=˜zd"›F˜_amV˜|Op˜Opm›˜"m=˜F"˜Fm=˜zd"›F’}
—˜am›FO"4F˜_amV
˜OFF=›^p¤V^
˜OFF=›^p¤V^˜_amV
s¬—s–˜’F"d˜|OpFdamF˜z¤hz˜amdF›˜"m=˜=aOO¤’apm˜z¤hz˜p¤›dF›}
¢Q˜_amV˜"’’Fh*d©˜˜|›¤*p˜z¤hz˜p¤›dF›}
˜Fd*p§˜"="z›F˜Op˜’›"m="=˜›¤*p˜z¤hz˜p¤›dF›
Q¬˜’F"d˜|=aOO¤’apm˜z¤hz˜amdF›}
_amV:˜Op˜=aOO¤’apm˜z¤hz˜*"OOdF˜"="z›F˜"m=˜’›"m="=˜›¤*p˜z¤hz˜amdF›s
F"d:˜zFOph"m4F˜›¤*p˜z¤hz˜amdF›s
a=F˜zd"›F˜_amV
ap=F˜V"¤VF˜›¤*F˜_amV
Fm›˜¦"d¦F˜_amV˜|s—T_am4^}
"am˜zd¤V˜Op˜›^F˜OpFdamF˜z¤hz
_amV˜Op˜›^F˜OpFdamF˜z¤hz˜="am˜zd¤V
s ^F˜›¤*p˜z¤hz˜"m=˜a›’˜’F"d˜"F˜mp›˜¤’F_Fzd"4F"*dF˜z"›’˜FOF˜
’F¦a4F˜›p˜©p¤˜VadFm›˜F4^mpdpVaF’˜’F¦a4F˜FzF’Fm›"›a¦F
344
"›˜m¤h*F
¬n¬Q_s¢s•
¬n¬Q_sTTs
¬n¬Q_sT¬Q
s¬nn_G¬¬s¢
¬n¬Q_¬Tn¬
¬n¬Q_sT–
¬s¬¬_sQQs
¢QGn_¢¬¬Ts
¬s¬¬_sGGT
¬n¬Q_sTT
¬s¬¬_sG•n
¬n¬Q_sTT¢
¬n¬Q_s¬•¬
¬n¬Q_s¢s•
¬s¬¬_¢¬Ts
¬n¬Q_sQsQ
s¢˜˜˜˜"›’
"4¤¤h˜’©’›Fh
"4F˜’F"d
˜’F"d˜§a›^˜am›Fm"d˜
4Fm›FamV˜amV
˜’F"d˜§a›^˜F¨›Fm"d˜
4Fm›FamV˜amV
phzF’’apm˜’F"d
345
s¢˜˜˜˜"›’
"4¤¤h˜’©’›Fh
"*dF˜s
pFdamF˜z¤hz˜"m=˜Fd"›F=˜z"›’
F’4az›apm
pFdamF˜^p’F˜"’’Fh*d©˜|^p’F˜"m=˜am›Fm"d˜’zamV}
pFdamF˜z¤hz
s¢¬˜
¢¬˜
pFdamF˜z¤hz˜amdF›˜’F"d˜|s¬—s–}
p’F˜4d"hz
s¬—s–˜4d"hz˜|OpFdamF˜amdF›}
s–˜^p’F˜"="z›F
¢Q˜4d"hz˜|›¤*p˜z¤hz˜Fm=˜pO˜OpFdamF˜^p’F˜J˜mp›˜’^p§m}
¢Q˜^p’F˜"="z›F˜|›¤*p˜z¤hz˜Fm=˜pO˜OpFdamF˜^p’F˜J˜mp›˜’^p§m}
¨^"¤’›˜pad˜ha’›˜›"z˜|mp›˜’^p§m}s
ad˜=az˜›"©
s˜
p˜mp›˜¤’F˜"m˜F¨^"¤’›˜pad˜ha’›˜›"z˜aO˜©p¤˜"F˜"m"d©«amV˜^"«"=p¤’˜
’"hzdF’:˜p˜aO˜©p¤˜"F˜¤’amV˜^"«"=p¤’˜4"aF˜V"’:˜p˜aO˜©p¤˜"F˜¤mmamV˜˜
d¤h*˜›^F˜z¤hz˜F¨^"¤’›˜›p˜"˜O¤hF˜|F¨^"¤’›}˜^pp=
346
"›˜m¤h*F
¬Qn•s_–¬ssn
s¬nn_Gn¬¢
s¬nn_Gn¬¢T
¬n¬Q_sT–
sT¬¬_s¢T
¬s¬¬_sn•
s¬nn_¢¬Qs
¬s¬¬_¬QTn
s¬nn_¢¬Q¢
s¬nn_G¬¬•
s¬nn_¬¬¬sQ˜
s¢˜˜˜˜"›’
"4¤¤h˜’©’›Fh
pFdamF˜^p’F
¬Qn•s_–¬ssn
p’F˜4d"hz
sT¬¬_s¢T
s–˜^p’F˜"="z›F
s¬nn_¢¬Qs
˜s¬—s–˜4d"hz
¬s¬¬_sn•
s¬—s–˜’F"d
¬n¬Q_sT–
pFdamF˜z¤hz
s¢¬˜˜"4˜
s¬nn_Gn¬¢
¢¬˜˜"4˜
s¬nn_Gn¬¢T
¨^"¤’›˜p¤›dF›
|¤’F˜ss_hh˜a=˜^p’F
ad˜=az˜›"©
s¬nn_¬¬¬sQ
347
s¢˜˜˜˜"›’
"4¤¤h˜’©’›Fh
"*dF˜sT
aOO¤’apm˜z¤hz˜˜¦"4¤¤h˜’©’›Fh˜4phzpmFm›’
F’4az›apm
"OOdF˜|am’a=F˜’›Fh˜pO˜›ap=F˜V"¤VF˜›¤*F˜J˜mp›˜’^p§m}
"da*"›apm˜¦"d¦F˜"’’Fh*d©
4"da*"›apm˜¦a"d
d"§˜4d"hz’˜Op˜*"OOdF˜"="z›F
pdd"˜Op˜›ap=F˜V"¤VF˜›¤*F˜|mp›˜’^p§m}
aOO¤’apm˜z¤hz
s¢¬
¢¢¬—¢T¬
aOO¤’apm˜z¤hz˜*"OOdF˜"="z›F
aOO¤’apm˜z¤hz˜*"OOdF˜"="z›F˜_amV˜˜
aOO¤’apm˜z¤hz˜4pm›pd˜4"*dF
m=˜zd"›F
Opm›
F"
"m˜|Op˜^aV^˜¦"4¤¤h˜z¤hz}
pFdamF˜V"¤VF˜"’’Fh*d©
pFdamF˜V"¤VF˜’F"d
s¬—s–˜4d"hz˜|=aOO¤’apm˜z¤hz˜p¤›dF›}
s¬—s–˜’F"d˜|=aOO¤’apm˜z¤hz˜p¤›dF›}
Q¬˜4d"hz
Q¬˜’F"d˜|OpFdamF˜z¤hz˜›p˜*"OOdF˜"="z›F}
^aFd=˜Op˜›ap=F˜V"¤VF˜›¤*F˜zp›˜|mp›˜’^p§m}
a=F˜zd"›F˜|am4d¤=F’˜OFF=›^p¤V^’˜"m=˜›^¤h*’4F§’}
ap=F˜V"¤VF˜›¤*F
m"d©«F˜4^"h*F
Fm›˜¦"d¦F˜cmp*
348
"›˜m¤h*F
¬Qn•¢_¬¬¬sQ
s¬nn_–¬¢¬s
¬QnG¬_¢¬¬sG
¬s¬¬_sGGs
¬Qn•¢_–¬¢s¬
s¬nn_G¬Q¬¬
s¬nn_G¬Q¬s
s¬nn_¢¬¬¢s
¬n¬Q_sTT˜
s¬nn_–¬T•
s¬nn_¢¬QQ¢
s¬nn_¢¬QQ
s–¬_s¬•
s¬nn_–¬QTQ
¬n¬Q_sT–
¬s¬¬_sn•
¬n¬Q_sT–
¬s¬¬_snQ
¬s¬¬_sGGT
s¬nn_¬¬¬¬
s¬nn_–¬¬¢s
¬n–¬_¬Gn•
s¬nn_¢¬QTn
s¬nn_¢¬QQT
s¢˜˜˜˜"›’
"4¤¤h˜’©’›Fh
"da*"›apm˜¦"d¦F˜"’’Fh*d©
|=aOO¤’apm˜z¤hz˜¦F’apm}
s¬nn_–¬¢¬s
Fm›˜¦"d¦F˜cmp*
s¬nn_¢¬QQT
m"d©«F˜4^"h*F
|=aOO¤’apm˜z¤hz˜¦F’apm}
s¬nn_¢¬QTn
a=F˜zd"›F
s¬nn_–¬¬¢s
ap=F˜V"¤VF˜›¤*F
¬n–¬_¬Gn•
aOO¤’apm˜z¤hz˜*"OOdF˜"="z›F
s¬nn_¢¬¬¢s
Q¬˜4d"hz
¬s¬¬_snQ
aOO¤’apm˜z¤hz
s¢¬˜
s¬nn_G¬Q¬¬
¢¢¬˜
s¬nn_G¬Q¬s
pFdamF˜V"¤VF˜"’’Fh*d©
s¬nn_–¬QTQ
"m˜|=aOO¤’apm˜z¤hz˜zp’a›apm}
s–¬_s¬•
349
s¢˜˜˜˜"›’
"4¤¤h˜’©’›Fh
"*dF˜sQ
¤*phpdF4¤d"˜z¤hz˜˜¦"4¤¤h˜’©’›Fh˜4phzpmFm›’
F’4az›apm
"›˜m¤h*F
"OOdF˜|am’a=F˜’›Fh˜pO˜›ap=F˜V"¤VF˜›¤*F˜J˜mp›˜’^p§m}
"da*"›apm˜¦"d¦F˜"’’Fh*d©˜Op˜zFOph"m4F˜›¤*p˜
"da*"›apm˜¦"d¦F˜"’’Fh*d©˜Op˜’›"m="=˜›¤*p˜|"m=˜=aOO¤’apm˜z¤hz}˜’
"da*"m›˜¦a"d
d"§˜4d"hz’˜Op˜›¤*p˜z¤hz
pdd"˜Op˜›ap=F˜V"¤VF˜›¤*F
"m
¢Q˜4d"hz˜|Op˜›¤*p˜z¤hz˜p¤›dF›}
¢Q˜_amV˜"’’Fh*d©˜|Op˜›¤*p˜z¤hz˜p¤›dF›}
"maOpd=˜Fm=˜zd"›F’
Opm›
F"
^aFd=˜Op˜›ap=F˜V"¤VF˜›¤*F˜zp›
a=F˜zd"›F˜|am4d¤=F’˜›^¤h*’4F§’}
ap=F˜V"¤VF˜›¤*F
FOph"m4F˜›¤*phpdF4¤d"˜z¤hzs
›"m="=˜›¤*phpdF4¤d"˜z¤hz
d*p§:˜OpFdamF:˜Op˜›^F˜’›"m="=˜›¤*p˜z¤hz
¤*p˜z¤hz˜’F"d:˜d"VF˜z¤hzs
¤*p˜z¤hz˜’F"d:˜’h"dd˜z¤hzs
m"d©«F˜4^"h*F
Fm›˜¦"d¦F˜cmp*
s¬nn_¢¬QQ¢
s¬nn_¢¬QQ
s¬nn_¬¬¬¬
s¬nn_–¬¬¢s
¬n–¬_¬Gn•
¢QGn_Gn¬–¢
¢QGn_Gn¬–s
¢QGn_¢¬¬Ts
¬s¬¬_sG•n
¬s¬¬_sG•n
s¬nn_¢¬QQ¬
s¬nn_¢¬¬T¢
¤*p˜z¤hz˜zp§F˜’¤zzd©—˜4pm›pddF˜
¤*p˜z¤hz˜^"mF’’˜Op˜am›FV"›F=˜—4pm›pddF
s¬nn_Gn¬¬¢
s¬nn_–¬TG
¤*p˜z¤hz˜zp§F˜’¤zzd©˜Op˜¤’F˜§a›^˜˜hama˜›¤*p˜4pm›pddF
˜hama˜›¤*p˜z¤hz˜4pm›pddF˜
¤*p˜^"mF’’˜Op˜˜hama˜4pm›pddF
¢QGn_G¬¬–
snT–_G¬¬Q
¢QGn_–¬¬T
s ^F˜›¤*p˜z¤hz’˜"m=˜›^Fa˜’F"d’˜"F˜mp›˜¤’F_Fzd"4F"*dF˜z"›’˜FOF˜
’F¦a4F˜›p˜©p¤˜VadFm›˜F4^mpdpVaF’˜’F¦a4F˜FzF’Fm›"›a¦F
350
¬Qn•¢_¬¬¬sQ
s¬nn_–¬¢¬T
s¬nn_–¬¢¬s
¬QnG¬_¢¬¬sG
¬s¬¬_sGGs
¬Qn•¢_–¬¢s¬
s–¬_s¬•
¬s¬¬_¬QTn
¬s¬¬_sQQs
s¢˜˜˜˜"›’
"4¤¤h˜’©’›Fh
"da*"›apm˜¦"d¦F˜"’’Fh*d©˜
s¬nn_–¬¢¬s˜|’›"m="=˜›¤*p˜}
s¬nn_–¬¢¬T˜|zFOph"m4F˜›¤*p˜}
Fm›˜¦"d¦F˜cmp*
s¬nn_¢¬QQT
m"d©«F˜4^"h*F
|›¤*p˜z¤hz˜¦F’apm}
¬snn_¢¬QQ¬
a=F˜zd"›F
s¬nn_–¬¬¢s
ap=F˜V"¤VF˜›¤*F
¬n–¬_¬Gn•
¤*p˜z¤hz˜zp§F˜’¤zzd©—4pm›pddF
s¬nn_Gn¬¬¢˜p˜
snT–_G¬¬¢˜Op˜¤’F˜§a›^˜
snT–_G¬¬Q˜hama˜4pm›pddF
¢QGn_Gn¬–¢˜|zFOph"m4F˜›¤*p˜z¤hz}
¢QGn_Gn¬–s˜|’›"m="=˜›¤*p˜z¤hz}
"m˜|›¤*p˜z¤hz˜zp’a›apm}
s–¬_s¬•
351
s¢˜˜˜˜"›’
m"d©«F
Analyzer
This table lists the replacement parts for the analyzer. Analyzer screws and the
individual ion source parts are listed the next tables.
"*dF˜s–
m"d©«F˜z"›’
F’4az›apm
m"d©«F˜|4phzdF›F:˜›F’›F=:˜§a›^˜’a=F˜*p"=}
=F›F4›p˜|4phzdF›F}
FdF4›pm˜h¤d›azdaF˜^pm
OFF=›^p¤V^˜*p"=
˜OFF=›^p¤V^
_amV:˜¦a›pm˜Op˜˜OFF=›^p¤V^
apm˜’p¤4F:˜4phzdF›F
h"VmF›˜"’’Fh*d©
h"’’˜Oad›F˜4"*dF˜ca›˜
h"’’˜Oad›F˜4pm›"4›’˜|T˜F„¤aF=}
h"’’˜Oad›F˜4F"ha4˜’¤zzp›:˜=F›F4›p˜Fm=
h"’’˜Oad›F˜4F"ha4˜’¤zzp›:˜’p¤4F˜Fm=
h"’’˜Oad›F˜^F"›F˜"’’Fh*d©
h"’’˜Oad›F˜"=a"›p
hp¤m›amV˜*"4cF›:˜=F›F4›p˜Fm=
hp¤m›amV˜*"4cF›:˜’p¤4F˜Fm=
zam’˜Op˜’p¤4F˜"m=˜=F›F4›p˜Fm=˜hp¤m›amV˜*"4cF›’
’a=F˜zd"›F˜|am4d¤=F’˜›^¤h*’4F§’}
’p¤4F˜"=a"›p
352
"›˜m¤h*F
s¬nn_–n¢¢G
s¬nn_G¬¬¬s
¬Qn•s_G¬s¬
s¬nn_–¬T¢Q
s¬nn_G¬¬s¢
¬n¬Q_¬Tn¬
s¬nn_–ns¬–
¬Qn•s_–¬s–¬
s¬nn_–¬s¬
s¬nn_–¬sT¢
s¬nn_¢¬s¢T
s¬nn_¢¬s¢
s¬nn_–¬s•¢
s¬nn_¢¬s¢s
s¬nn_¬¬¬¬¢
s¬nn_¬¬¬¬s
s¬nn_¢¬s•
s¬nn_–¬¬¢s
s¬nn_¢¬s¢¢
s¢˜˜˜˜"›’
m"d©«F
"*dF˜s•
m"d©«F˜’4F§’
F’4az›apm
F"›F—’Fm’p˜|„¤"=¤zpdF}˜’F›˜’4F§
pm˜’p¤4F˜›^¤h*’4F§
"VmF›˜hp¤m›amV˜’4F§’
4F§˜›p˜"››"4^˜h"VmF›˜*"4cF›˜›p˜’p¤4F˜"=a"›p
4F§’˜›p˜"››"4^˜’p¤4F˜"=a"›p˜"m=˜=F›F4›p˜›p˜„¤"=¤zpdF˜"=a"›p
4F§’˜Op˜h"’’˜Oad›F˜4pm›"4›˜"’’Fh*d©˜"m=˜^F"›F˜*dp4c˜
4F§’˜Op˜"=a"›p˜hp¤m›amV˜*"4cF›’˜"m=˜Op˜’a=F˜*p"=˜
p¤4F˜"=a"›p˜’4F§’
"›˜m¤h*F
¬QsQ_sTT–
s¬nn_¢¬sG
¬QsQ_s¬T–
¬QsQ_s–¬¢
¬QsQ_s¬Q¢
¬QsQ_¬sn
¬QsQ_¬T¬
¬QsQ_s¬Q¢
"’’˜Oad›F˜4pm›"4›˜
|T˜F„¤aF=}
"’’˜Oad›F˜4"*dF˜ca›
s¬nn_–¬s¬
"’’˜Oad›F˜^F"›F˜
"’’Fh*d©
pm˜’p¤4F˜|am’a=F˜"=a"›p}
s¬nn_–ns¬–
p¤4F˜^F"›F˜"’’Fh*d©
s¬nn_–¬s••
"VmF›˜"’’Fh*d©
¬Qn•s_–¬s–¬
FzFddF
s¬nn_¢¬s¢
FF=›^p¤V^˜*p"=
s¬nn_–¬T¢Q
353
s¢˜˜˜˜"›’
m"d©«F
"*dF˜sG
˜pm˜’p¤4F˜z"›’
F’4az›apm
pm˜’p¤4F˜|4phzdF›F}
="§p¤›˜4©dam=F
="§p¤›˜zd"›F
Fm›"m4F˜dFm’
Oad"hFm›
am›FO"4F˜’p4cF›
apm˜Op4¤’˜dFm’
dFm’˜am’¤d"›p˜|z"a}
FzFddF˜"’’Fh*d©˜|4phzdF›F}
’4F§’
Op˜Oad"hFm›’˜"m=˜^pd=amV˜FzFddF˜"’’Fh*d©˜pm˜’p¤4F
’F›’4F§˜Op˜dFm’˜’›"4c
’p¤4F˜*p=©
354
"›˜m¤h*F
s¬nn_–ns¬–
s¬•¢_¢¬¬¬G
¬Qn•s_¢¬sT
¬Qn•s_¢¬s¢–
¬Qn•¢_–¬¬Q
s¬nn_¢¬s–
¬Qn•s_¢¬sT
¬Qn•s_¢¬s¬
s¬nn_–¬s•¬
¬QsQ_s¬T–
¬QsQ_sTT–
s¬nn_¢¬s¬
s¢˜˜˜˜"›’
m"d©«F
p¤4F˜*p=©
s¬nn_¢¬s¬
F›’4F§˜
¬QsQ_sTT–
ad"hFm›˜
¬Qn•¢_–¬¬Q
—˜am›FO"4F˜’p4cF›
s¬nn_¢¬s–
FzFddF˜"’’Fh*d©
s¬nn_–¬s•¬
4F§’˜
¬QsQ_s¬T–˜
4F§’
¬QsQ_s¬T–˜
Fm’˜am’¤d"›p˜|’F›}
¬Qn•s_¢¬s¬
m›"m4F˜dFm’
¬Qn•s_¢¬s¢–
pm˜Op4¤’˜dFm’
¬Qn•s_¢¬sT
"§p¤›˜4©dam=F
s¬•¢_¢¬¬¬G
"§p¤›˜zd"›F
¬Qn•s_¢¬sT
355
s¢˜˜˜˜"›’
m"d©«F
"*dF˜sn
FzFddF˜"’’Fh*d©˜z"›’
F’4az›apm
FzFddF˜"’’Fh*d©
am’¤d"›p˜|¢˜F„¤aF=}
m¤›:˜QQ_hh
FzFddF
’F›’4F§
’p¤4F˜^F"›F˜"’’Fh*d©˜|am4d¤=F’˜^F"›F:˜’Fm’p:˜"m=˜^F"›F˜*dp4c}
§"’^F
356
"›˜m¤h*F
s¬nn_–¬s•¬
s¬nn_¢¬s
¬QQ_¬¬•s
s¬nn_¢¬s¢
¬QsQ_sTT–
s¬nn_–¬s••
¬Q¬_¬Gns
s¢˜˜˜˜"›’
m"d©«F
FzFddF
s¬nn_¢¬s¢
m’¤d"›p˜
s¬nn_¢¬s
F›’4F§˜
¬QsQ_sTT–
m’¤d"›p˜
s¬nn_¢¬s
"’^F
¬Q¬_¬Gns
¤›:˜QQ_hh
¬QQ_¬¬•s
p¤4F˜^F"›F˜"’’Fh*d©
s¬nn_–¬s••
357
s¢˜˜˜˜"›’
˜
—˜am›FO"4F
EI GC/MSD interface
This table lists the replacement parts related to the GC/MSD interface.
"*dF˜¢¬
—˜am›FO"4F
F’4az›apm
—˜am›FO"4F˜|4phzdF›F}
am›FO"4F˜4pd¤hm˜m¤›˜|mp›˜’^p§m}
^F"›F˜’dFF¦F
^F"›F—’Fm’p˜"’’Fh*d©
am’¤d"›apm˜
’F›’4F§˜Op˜^F"›F—’Fm’p˜"’’Fh*d©˜|mp›˜’^p§m}
’4F§’:˜T˜¨˜¬•˜z"m^F"=:˜Op˜^F"›F˜’dFF¦F
§Fd=F=˜am›FO"4F˜"’’Fh*d©
—˜am›FO"4F˜_amV
m›FO"4F˜4p¦F
4F§’˜Op˜hp¤m›amV˜am›FO"4F˜"m=˜4p¦F˜›p˜"m"d©«F˜4^"h*F
358
"›˜m¤h*F
s¬nn_–¬¬¬
¬QnGG_¢¬¬––
s¬nn_¢¬¢s¬
s¬nn_–¬s¬•
s¬nn_¢¬¬s
¬QsQ_¬¢–
¬QsQ_¬G
s¬nn_–¬¬s
¬n¬Q_sT¬Q
s¬nn_¬¬¬¬Q
¬QsQ_¬G¬
s¢˜˜˜˜"›’
˜
—˜am›FO"4F
F"›F˜’dFF¦F
s¬nn_¢¬¢s¬
4F§’˜Op˜^F"›F˜’dFF¦F
¬QsQ_¬G
Fd=F=˜am›FO"4F˜"’’Fh*d©
s¬nn_–¬¬s
m›FO"4F˜’p4cF›
pm˜’p¤4F˜*p=©
_amV
¬n¬Q_sT¬Q
m"d©«F˜4^"h*F
4F§
¬QsQ_¬G¬
F"›F—’Fm’p˜"’’Fh*d©
s¬nn_–¬s¬•
m›FO"4F˜4p¦F
s¬nn_¬¬¬¬Q
m’¤d"›apm
s¬nn_¢¬¬s
359
s¢˜˜˜˜"›’
pm’¤h"*dF’˜"m=˜h"am›Fm"m4F˜’¤zzdaF’
Consumables and maintenance supplies
This section lists parts available for cleaning and maintaining your MSD.
"*dF˜¢s
"am›Fm"m4F˜’¤zzdaF’
F’4az›apm
*"’a¦F˜z"zF:˜¬˜µh
d¤ham"˜zp§=F
dp›^’:˜4dF"m˜|z"4c"VF˜pO˜¬¬}
dp›^’:˜4dF"mamV˜|z"4c"VF˜pO˜¬¬}
p››pm˜’§"*’˜|z"4c"VF˜pO˜s¬¬}
aOO¤’apm˜z¤hz˜Od¤a=˜|¢˜F„¤aF=}
pFdamF˜z¤hz˜pad:˜md"m=˜TQ:˜s˜da›F
dp¦F’:˜4dF"m
d"VF
’h"dd
F"’F:˜zaF«pm˜:˜^aV^˜¦"4¤¤h
"am›:˜›p¤4^_¤z:˜
d"4aF˜
"©
mF_©F"˜h"am›Fm"m4F˜ca›
360
"›˜m¤h*F
Q¬–s_QGn–
G––¬_¬•ns
¬QnG¬_–¬¬Qs
ns¬_TG¢G
Q¬G¬_QT¬¬
–¬T¬_¬G¬n
–¬T¬_¬GT
G–Q¬_¬¬¬
G–Q¬_¬¬¢n
–¬T¬_¬¢Gn
–¬s¬_sTn•
QsG_¬¢n–
s¢˜˜˜˜"›’
pm’¤h"*dF’˜"m=˜h"am›Fm"m4F˜’¤zzdaF’
"*dF˜¢¢
ppd’
F’4az›apm
pd¤hm˜am’›"dd"›apm˜›ppd
ppd˜ca›
"dd˜=a¦F’
sQ_hh
¢¬_hh
¢Q_hh
F¨˜m¤›˜=a¦F:˜QQ_hh
daF’:˜dpmV_mp’F˜|sQ_am4^˜mp’F}
4F§=a¦F’
Od"›_*d"=F:˜d"VF
:˜_s¬
:˜_sQ
:˜_¢¬
^azzamV˜ca›’
Qn•˜
–Gn¬˜FaF’˜
§FF«F’:˜mpm_h"VmF›a4
Fm4^F’:˜pzFm_Fm=˜
s—T_am4^˜¨˜Q—s–_am4^
s¬_hh
a’›˜’›"z:˜"m›a_’›"›a4
’h"dd
hF=a¤h
d"VF
"›˜m¤h*F
s¬nn_¢¬¬¬
s¬nn_–¬Q––
G•s¬_sQ•¬
G•s¬_sG¬T
G•s¬_s–Gs
G•s¬_s¢¢¬
G•s¬_s¬nT
G•¬_¬¬¬¢
G•s¬_s–¢
G•s¬_s–¢¢
G•s¬_s–sQ
¢QGn_–¬¬T
sQ¬_–¬G–¬
G•s¬_¬n¬•
G•s¬_¬Qs¬
G•s¬_¢Q
n¬¬_¬n–n
n¬¬_s¢Q•
n¬¬_¬n•¬
361
s¢˜˜˜˜"›’
pm’¤h"*dF’˜"m=˜h"am›Fm"m4F˜’¤zzdaF’
"*dF˜¢
F¤dF’
F’4az›apm
d"mc:˜V"z^a›F_¦F’zFd
—˜am›FO"4F
¬_hh˜a=:˜GQ~˜F’zFd˜sQ~˜V"z^a›F:˜Op˜¬s¬_hh˜a=˜4pd¤hm’
¬T_hh˜a=:˜GQ~˜F’zFd˜sQ~˜V"z^a›F:˜Op˜¬¢¬_hh˜a=˜"m=
¬¢Q_hh˜a=˜4pd¤hm’
¬Q_hh˜a=:˜GQ~˜F’zFd˜sQ~˜V"z^a›F:˜Op˜¬¢_hh˜a=˜4pd¤hm’
¬G_hh˜a=:˜GQ~˜F’zFd˜sQ~˜V"z^a›F:˜Op˜¬Q_hh˜a=˜4pd¤hm’
mbF4›apm˜zp›˜
¬¢•_hh˜a=:˜n¬~˜F’zFd˜s¬~˜V"z^a›F:˜Op˜¬s¬_hh˜a=˜4pd¤hm’
¬•_hh˜a=:˜n¬~˜F’zFd˜s¬~˜V"z^a›F:˜Op˜¬¢¬_hh˜a=˜4pd¤hm’
¬T¬_hh˜a=:˜n¬~˜F’zFd˜s¬~˜V"z^a›F:˜Op˜¬¢Q_hh˜a=˜4pd¤hm’
¬T•_hh˜a=:˜n¬~˜F’zFd˜s¬~˜V"z^a›F:˜Op˜¬¢_hh˜a=˜4pd¤hm’
¬•T_hh˜a=:˜n¬~˜F’zFd˜s¬~˜V"z^a›F:˜Op˜¬Q_hh˜a=˜4pd¤hm’
362
"›˜m¤h*F
QsGs_¬G
Q¬–¢_Q¬•
Q¬–¢_Q¬G
Q¬–¢_Q¬–
Q¬–¢_QG
Q¬–¢_QsG
Q¬–¢_Qs–
QsGs_¢
Q¬–¢_QsT
Q¬–¢_Qs¢
s¢˜˜˜˜"›’
pm’¤h"*dF’˜"m=˜h"am›Fm"m4F˜’¤zzdaF’
"*dF˜¢T
a’4Fdd"mFp¤’˜z"›’˜"m=˜’"hzdF’
F’4az›apm
aOO¤’apm˜z¤hz˜Od¤a=˜|¢˜F„¤aF=}
dF4›pm˜h¤d›azdaF˜^pm
ad"hFm›˜"’’Fh*d©˜|}
ad"hFm›˜"’’Fh*©˜|}
pFdamF˜z¤hz˜pad˜|s˜da›F}
pFdamF˜F¨^"¤’›˜pad˜ha’›˜›"zs
F"›F—’Fm’p˜"’’Fh*daF’
—˜am›FO"4F
apm˜’p¤4F
h"’’˜Oad›F
4›"Od¤ppm"z›^"dFmF˜|}:˜s˜zV—¤d
FOd¤pp›a*¤›©d"hamF˜|}:˜4F›aOaF=˜|s¬˜V"h}˜
FOd¤pp›a*¤›©d"hamF˜|}˜’"hzdF˜ca›
"hzdF:˜F¦"d¤"›apm˜:˜^©=p4"*pm’
"4¤¤h˜V"¤VF’
OpFdamF˜V"¤VF˜"’’Fh*d©
›ap=F˜V"¤VF˜›¤*F
s˜
p˜mp›˜¤’F˜"m˜F¨^"¤’›˜pad˜ha’›˜›"z˜aO˜©p¤˜"F˜"m"d©«amV˜^"«"=p¤’˜
’"hzdF’:˜p˜aO˜©p¤˜"F˜¤’amV˜^"«"=p¤’˜4"aF˜V"’:˜p˜aO˜©p¤˜"F˜¤mmamV˜˜
d¤h*˜›^F˜z¤hz˜F¨^"¤’›˜›p˜"˜O¤hF˜^pp=
"›˜m¤h*F
–¬T¬_¬G¬n
¬Qn•s_G¬s¬
¬Qn•¢_–¬¬Q
s¬nn_G¬¬Q
–¬T¬_¬GT
s¬nn_G¬¬•
¬Qn•¢_–¬s¬–
s¬nn_–¬s••
s¬nn_–¬s•¢
GQ¬¬_QTTs
GQ¬¬_¬–Q–
¬Qn•s_–¬Q•s
¬Qn•¬_–¬¬TQ
s¬nn_–¬QTQ
¬n–¬_¬Gn•
363
CI Parts
This section lists parts that may be required to maintain the 5973N MSD with CI.
The parts listed in this section are related directly to the accessory; other parts for
the MSD can be found in the previous section of this chapter.
364
s¢˜˜˜˜"›’
˜"›’
"*dF˜¢Q
a’4Fdd"mFp¤’˜z"›’˜Op˜˜
F’4az›apm
"›˜m¤h*F
Fm«pz^FmpmF:˜s¬¬˜zV—µd
azpd"˜˜zp§F˜’¤zzd©˜|——˜’˜pmd©}
pFdamF˜z¤hz˜’F4pm="©˜4pm›"amhFm›˜›"©
F›^"mF—a’p*¤›"mF˜V"’˜z¤aOaF˜
˜4"da*"m›
F"VFm›˜V"’˜damF:˜¢¬_O›˜s—GŠ˜˜’›"amdF’’˜’›FFd:˜4dF"mF=˜
azF’:˜am=¤’›a"d:˜¬¬—z"4c"VF
§"VFdpc˜Oa››amV’˜Op˜V"’˜z¤aOaF˜"m=˜amdF›˜›p˜Odp§˜hp=¤dF
F¤dF:˜Opm›:˜Op˜s—G_am4^˜›¤*amV:˜¢¬—z"4c"VF
F¤dF:˜F":˜Op˜s—G_am4^˜›¤*amV:˜¢¬—z"4c"VF
¤›:˜Op˜s—G_am4^˜›¤*amV:˜¢¬—z"4c"VF
¤›˜"m=˜*p›^˜Opm›˜"m=˜F"˜OF¤dF’:˜¢¬˜’F›’—z"4c"VF
¤*amV˜4¤››F˜Op˜’›"amdF’’˜’›FFd˜›¤*amV
¤*amV˜4¤››F˜Fzd"4FhFm›˜*d"=F’
GQ¬¬_QTT¬
s¬nn_G¬¬sG
s¬nn_¬¬¬sQ
˜ snnn_G¬Ts¬
GQ¬¬_Gs¬
•sQ•_¬¢s¬
˜ ns¬_TG¢G
QsG¬_Tss¬
QsG¬_Tss–
Q¬G¬_G•Qs
Q¬G¬_G•Qs
G•s¬_s•¬n
G•s¬_s•s¬
365
s¢˜˜˜˜"›’
˜"›’
"*dF˜¢–
˜dp§˜4pm›pd˜hp=¤dF˜z"›’
F’4az›apm
˜Odp§˜4pm›pd˜hp=¤dF˜|4phzdF›F}
"da*"›apm˜¦"d¦F˜"’’Fh*d©
˜4"da*"m›
"hzdF˜¦a"d
"hzdF˜¦a"d˜_amV:˜s—T_am4^˜a›pm
pdFmpa=˜¦"d¦F˜"m=˜4"*dF
˜h"am˜zp§F˜^"mF’’˜4"*dF
a’zd"©˜hp=¤dF
dp§˜4pm›pd˜cmp*
dp§˜4pm›pd˜
"’’˜Odp§˜4pm›pddF
’pd"›apm˜¦"d¦F
"’’˜Odp§˜4pm›pddF˜4"*dF
F"VFm›˜V"’˜’FdF4›˜¦"d¦F
˜V"’cF›:˜s—T_am4^:˜§a›^˜F›"amF:˜pmF˜¤’F˜pmd©
˜V"’cF›:˜s—G_am4^:˜pmF˜¤’F˜pmd©
˜"m"d©«F˜4p¦F
pm›˜Odp§˜hp=¤dF˜4p¦F
F›^"mF—a’p*¤›"mF˜V"’˜z¤aOaF
F"VFm›˜V"’˜’¤zzd©˜›¤*amV:˜’›"amdF’’˜’›FFd:˜s—G_am4^
F"˜Odp§˜hp=¤dF˜4p¦F
§"VFdpc˜Oa››amV’˜Op˜V"’˜z¤aOaF˜"m=˜amdF›˜›p˜Odp§˜hp=¤dF
F¤dF:˜Opm›:˜Op˜s—G_am4^˜›¤*amV:˜¢¬—z"4c"VF
F¤dF:˜F":˜Op˜s—G_am4^˜›¤*amV:˜¢¬—z"4c"VF
¤›:˜Op˜s—G_am4^˜›¤*amV:˜¢¬—z"4c"VF
¤›˜"m=˜*p›^˜Opm›˜"m=˜F"˜OF¤dF’:˜¢¬˜’F›’—z"4c"VF
366
"›˜m¤h*F
snnn_–QTQ¬
snnn_–¬TQ–
GQ¬¬_Gs¬
¬QnG¬_¢¬¬sG
¬n¬Q_s¢s•
snnn_G¬T¬Q
snnn_–¬T–¢
snnn_–QT–s
¬•¬_T¬s
snnn_–Q¬¬Q
¬s¬s_s¬¬–
snnn_G¬T¬¢
snnn_–¬T–T
snnn_G¬T¬s
¬s¬¬_sT–
¬s¬¬_¬T–G
snnn_–¬TT¬
snnn_¢¬T¢¢
snnn_G¬Ts¬
•sQ•_¬¢s¬
snnn_¬¬Tss
QsG¬_Tss¬
QsG¬_Tss–
Q¬G¬_G•Qs
Q¬G¬_G•Qs
s¢˜˜˜˜"›’
˜"›’
F"˜Odp§˜hp=¤dF˜4p¦F
snnn_¬¬Tss
˜"m"d©«F˜4p¦F
snnn_–¬TT¬
pm›˜Odp§˜hp=¤dF˜4p¦F
snnn_¢¬T¢¢
a’zd"©˜hp=¤dF
snnn_–QT–s
’pd"›apm˜¦"d¦F
snnn_G¬T¬¢
˜4"da*"›apm˜¦"d¦F˜"’’Fh*d©
snnn_–¬TQ–
"’’˜Odp§˜4pm›pddF
¬s¬s_s¬¬–
F"VFm›˜V"’˜’FdF4›˜¦"d¦F
snnn_G¬T¬s
F"VFm›˜V"’˜’¤zzd©˜›¤*amV
•sQ•_¬¢s¬
367
"*dF˜¢•
˜apm˜’p¤4F˜z"›’
F’4az›apm
p¨˜Op˜apm˜’p¤4F˜’^azzamV˜"m=˜’›p"VF
˜apm˜’p¤4F˜|›F’›F=}
˜="§p¤›˜4©dam=F
˜="§p¤›˜zd"›F
˜Oad"hFm›
˜^F"›F˜*dp4c
˜am›FO"4F˜›az˜’F"d
˜apm˜Op4¤’˜dFm’
˜dFm’˜am’¤d"›p’˜|’F›}
˜FzFddF
˜FzFddF˜am’¤d"›p
˜’p¤4F˜*p=©
˜’p¤4F˜^F"›F˜"’’Fh*d©
¤hh©˜Oad"hFm›
m›"m4F˜dFm’
4F§:˜’p4cF›_^F"=˜4"z˜Op˜hp¤m›amV˜Oad"hFm›’
F›’4F§˜Op˜hp¤m›amV˜^F"›F˜"m=˜dFm’˜’›"4c
4F§:˜˜˜T˜’p4cF›˜^F"=˜Op˜hp¤m›amV˜
4F§:˜¢˜×˜G˜hp¤m›’˜’p¤4F˜›p˜"=a"›p
368
"›˜m¤h*F
snnn_–Q¬¬s
snnn_–QT¬¢
snnn_¢¬TTT
snnn_¢¬TT–
s¬nn_G¬¬Q
snnn_¢¬Ts
snnn_–¬Ts¢
snnn_¢¬TT
snnn_¢¬TTQ
snnn_¢¬T¢
snnn_¢¬T
snnn_¢¬T¬
snnn_–¬TsT
snnn_–¬TQT
¬Qn•s_¢¬s¢–
snnn_¢¬¬¢s
snnn_¢¬¬¢s
¬QsQ_¢n¬
¬QsQ_s¬T–
s¢˜˜˜˜"›’
˜"›’
˜apm˜’p¤4F˜*p=©
snnn_¢¬T¬
F›’4F§
¬QsQ_sTT–
˜FzFddF
snnn_¢¬T¢
˜FzFddF˜am’¤d"›p
snnn_¢¬T
˜Oad"hFm›
s¬nn_G¬¬Q
˜’p¤4F˜^F"›F˜"’’Fh*d©
snnn_–¬TsT
¤hh©˜Oad"hFm›
snnn_¢¬TQT
˜dFm’˜am’¤d"›p˜|’F›}
snnn_¢¬TTQ
˜apm˜Op4¤’˜dFm’
snnn_¢¬TT
˜="§_p¤›˜4©dam=F
snnn_¢¬TTT
˜="§_p¤›˜zd"›F
snnn_¢¬TT–
˜dFm’˜am’¤d"›p˜|’F›}
snnn_¢¬TTQ
m›"m4F˜dFm’
¬Qn•s_¢¬s¢–
˜am›FO"4F˜›az˜’F"d
snnn_–¬Ts¢
369
s¢˜˜˜˜"›’
˜"›’
"*dF˜¢G
—˜
—˜am›FO"4F˜z"›’
F’4az›apm
—˜
—˜am›FO"4F˜"’’Fh*d©
F"›F˜4d"hz
F"›F—’Fm’p˜"’’Fh*d©
m›FO"4F˜4p¦F
m›FO"4F˜am’¤d"›apm˜|›§p˜zaF4F’}
4F§’˜Op˜^F"›F˜4d"hz
4F§’˜›p˜"››"4^˜am›FO"4F˜›p˜h"maOpd=
Fd=F=˜am›FO"4F
m›FO"4F˜›az˜’F"d
F’zFd˜*d"mc
370
"›˜m¤h*F
snnn_–QT¬¬
snnn_¢¬Ts¬
s¬nn_–¬s¬•
snnn_¬¬T¬Q
snnn_¢¬T¬s
¬QsQ_¬G
¬QsQ_¬G¬
snnn_–¬T¬s
snnn_–¬Ts¢
QsGs_¬G
s¢˜˜˜˜"›’
˜"›’
˜am›FO"4F˜4p¦F
snnn_¬¬T¬Q
˜am›FO"4F˜am’¤d"›apm
snnn_¢¬T¬s
˜^F"›F˜4d"hz
snnn_¢¬Ts¬
˜§Fd=F=˜am›FO"4F
snnn_–¬T¬s
m›FO"4F˜_amV
¬n¬Q_sT¬Q
˜apma«"›apm˜4^"h*F
˜am›FO"4F˜›az˜’F"d
snnn_–¬Ts¢
"4¤¤h˜h"maOpd=
F"›F—’Fm’p˜"’’Fh*d©˜
s¬nn_–¬s¬•
4F§’˜›p˜"››"4^˜am›FO"4F˜›p˜h"maOpd=˜
¬QsQ_¬G¬
4F§’˜Op˜^F"›F˜4d"hz
¬QsQ_¬G
371
372
Appendix A
Chemical ionization overview, 374
References on chemical ionization, 375
Positive CI theory, 376
Proton transfer, 378
Hydride abstraction, 380
Addition, 380
Charge exchange, 381
Negative CI theory, 382
Electron capture, 384
Dissociative electron capture, 385
Ion pair formation, 385
Ion-molecule reactions, 386
Chemical Ionization Theory
zzFm=a¨˜˜˜˜˜^Fha4"d˜pma«"›apm˜^Fp©
^Fha4"d˜apma«"›apm˜p¦F¦aF§
Chemical ionization overview
Chemical ionization (CI) is a technique for creating ions used in mass spectrometric analyses. There are significant differences between CI and electron ionization
(EI). This section describes the most common chemical ionization mechanisms.
In EI, relatively high-energy electrons (70 eV) collide with molecules of the sample
that is to be analyzed. These collisions produce (primarily) positive ions. Upon
ionization, the molecules of a given substance fragment in fairly predictable patterns. EI is a direct process: energy is transferred collisionally from electrons to
the sample molecules.
For CI, in addition to the sample and carrier gas, large amounts of reagent gas are
introduced into the ionization chamber. Since there is so much more reagent gas
than sample, most of the emitted electrons collide with reagent gas molecules,
forming reagent ions. These reagent-gas ions react with each other, in primary and
secondary reaction processes that establish an equilibrium. They also react in various ways with sample molecules to form sample ions. CI ion formation involves
much lower energy, and is much more “gentle”, than electron ionization. Since CI
results in much less fragmentation, CI spectra usually show high abundance of the
molecular ion. For this reason, CI is often used to determine the molecular weights
of sample compounds.
Methane is the most common CI reagent gas. It yields certain characteristic ionization patterns. Other reagent gases yield different patterns and may result in better
sensitivity for some samples. Common alternative reagent gases are isobutane and
ammonia. Carbon dioxide is often used in negative CI. Less common reagent gases
are carbon dioxide, hydrogen, freon, trimethylsilane, nitric oxide, and methylamine. Different ionization reactions occur with each reagent gas.
hhpma"˜a’˜›p¨a4˜"m=˜4pp’a¦F˜’F˜pO˜"hhpma"˜F„¤aF’˜’zF4a"d˜h"am›Fm"m4F˜"m=˜
’"OF›©˜zF4"¤›apm’
Water contamination in reagent gases may decrease CI sensitivity dramatically. A
large peak at m/z 19 (H30+) in positive CI is a diagnostic symptom of water contamination. In high enough concentrations, especially when combined with calibrant, water contamination will result in a heavily contaminated ion source. Water
contamination is most common immediately after new reagent gas tubing or
reagent gas cylinders are connected. This contamination will often decrease if the
reagent gas is allowed to flow for a few hours, purging the system.
374
zzFm=a¨˜˜˜˜˜^Fha4"d˜pma«"›apm˜^Fp©
^Fha4"d˜apma«"›apm˜p¦F¦aF§
References on chemical ionization
A. G. Harrison, Chemical Ionization Mass Spectrometry, 2nd Edition, CRC
Press, INC. Boca Raton, FL (1992) ISBN 0-8493-4254-6.
W. B. Knighton, L. J. Sears, E. P. Grimsrud, “High Pressure Electron Capture Mass
Spectrometry”, Mass Spectrometry Reviews (1996), 14, 327-343.
E. A. Stemmler, R. A. Hites, Electron Capture Negative Ion Mass Spectra of
Environmental Contaminants and Related Compounds, VCH Publishers, New
York, NY (1988) ISBN 0-89573-708-6.
375
zzFm=a¨˜˜˜˜˜^Fha4"d˜pma«"›apm˜^Fp©
p’a›a¦F˜˜›^Fp©
Positive CI theory
Positive CI occurs with the same analyzer voltage polarities as EI. For PCI, the
reagent gas is ionized by collision with emitted electrons. The reagent gas ions
react chemically with sample molecules (as proton donors) to form sample ions.
PCI ion formation is more “gentle” than electron ionization, producing less fragmentation. This reaction usually yields high abundance of the molecular ion, and is
therefore often used for determining molecular weights of samples.
The most common reagent gas is methane. Methane PCI produces ions with
almost any sample molecule. Other reagent gases, such as isobutane or ammonia,
are more selective, and cause even less fragmentation. Because of the high background from the reagent gas ions, PCI is not especially sensitive, and detection
limits are generally high.
There are four fundamental ionization processes that take place during positive
chemical ionization at ion source pressures in the 0.8 – 2.0 Torr range. These are:
•
•
•
•
Proton transfer
Hydride abstraction
Addition
Charge exchange
Depending on the reagent gas used, one or more of these four processes can be
used to explain the ionization products observed in the resulting mass spectra.
EI, methane PCI, and ammonia PCI spectra of methyl stearate are shown opposite.
The simple fragmentation pattern, large abundance of the [MH]+ ion, and the presence of the two adduct ions are characteristic of positive chemical ionization using
methane as a reagent gas.
The presence of air or water in the system, especially in the presence of PFDTD
calibrant, quickly contaminates the ion source.
376
zzFm=a¨˜˜˜˜˜^Fha4"d˜pma«"›apm˜^Fp©
p’a›a¦F˜˜›^Fp©
377
zzFm=a¨˜˜˜˜˜^Fha4"d˜pma«"›apm˜^Fp©
p’a›a¦F˜˜›^Fp©
Proton transfer
Proton transfer can be expressed as
BH+ + M → MH+ + B
where the reagent gas B has undergone ionization resulting in protonation. If the
proton affinity of the analyte (sample) M is greater than that of the reagent gas,
then the protonated reagent gas will transfer its proton to the analyte, forming a
positively charged analyte ion.
The most frequently used example is the proton transfer from CH + to the molec5
ular analyte, which results in the protonated molecular ion MH+.
The relative proton affinities of the reagent gas and the analyte govern the proton
transfer reaction. If the analyte has a greater proton affinity than the reagent gas,
then proton transfer can take place. Methane (CH ) is the most common reagent
4
gas because its proton affinity is very low.
Proton affinities can be defined according to the reaction:
B + H+ → BH+
where the proton affinities are expressed in kcal/mole. Methane’s proton affinity is
127 kcal/mole. The following tables list the proton affinities of several possible
reagent gases and of several small organic compounds with various functional
groups.
The mass spectrum generated by a proton-transfer reaction depends on several
criteria. If the difference in proton affinities is large (as with methane), substantial
excess energy may be present in the protonated molecular ion. This can result in
subsequent fragmentation. For this reason, isobutane, with a proton affinity of
195 kcal/mole, may be preferred to methane for some analyses. Ammonia has a
proton affinity of 207 kcal/mole, making it less likely to protonate most analytes.
Proton-transfer chemical ionization is usually considered to be “soft” ionization,
but the extent of the softness is dependent on the proton affinities of both the analyte and the reagent gas, as well as on other factors, including ion source temperature.
378
zzFm=a¨˜˜˜˜˜^Fha4"d˜pma«"›apm˜^Fp©
p’a›a¦F˜˜›^Fp©
F"VFm›˜V"’˜zp›pm˜"OOama›aF’
zF4aF’ p›pm˜"OOama›©
c4"d—hpdF
¢˜
s¬¬
s¢•
T
¢T
s–¬
s–Q
¢
¢
s•¬
sG¢

snQ
›_Ts¬

¢¬•
F"4›"m›˜apm˜OphF=
‚˜|h—«˜}
Q‚˜|h—«˜s•}
¢Q‚˜|h—«˜¢n}
‚˜|h—«˜sn}
‚˜|h—«˜Q}
¢‚˜|h—«˜}
›_Tn‚˜|h—«˜Q•}
T‚˜|h—«˜sG}
˜p›pm˜"OOama›aF’˜pO˜’FdF4›F=˜pV"ma4˜4phzp¤m=’˜Op˜
˜pdF4¤dF
˜4F›"d=F^©=F
˜4F›a4˜"4a=
˜4F›pmF
˜Fm«FmF
˜¢_¤›"mpd
˜©4dpzpz"mF
˜ahF›^©d˜F›^F
˜›^"mF
˜›^©d˜Oph"›F
˜pha4˜"4a=
˜©=p*pha4˜"4a=
˜©=p4^dpa4˜"4a=
˜’pzpz©d˜"d4p^pd
˜F›^"mpd
˜p›pm˜"OOama›©˜
|c4"d—hpdF}
˜
˜sGQ
˜
˜sGG
˜
˜¢¬¢
˜
˜s•G
˜
˜sn•
˜
˜s•n
˜
˜sn¬
˜
˜s¢s
˜
˜snG
˜
˜s•Q
˜
˜sT¬
˜
˜sTs
˜
˜sn¬
˜
˜sG¢
˜pdF4¤dF
p›pm˜"OOama›©˜
|c4"d—hpdF}
˜ F›^©d˜"hamF
˜
˜¢ss
˜ F›^©d˜4^dpa=F
˜
˜s–Q
˜ F›^©d˜4©"ma=F
˜
˜sG–
˜ F›^©d˜’¤dOa=F
˜
˜sGQ
˜ F›^©d˜4©4dpzpz"mF ˜
dG¬
˜ a›pF›^"mF
˜
˜sGQ
˜ a›phF›^"mF
˜
˜sG¬
˜ m_pz©d˜"4F›"›F
˜
˜¢¬•
˜ pz©dFmF
˜
˜s•n
˜ pd¤FmF
˜
˜sG•
˜ ›"m’_¢_¤›FmF
˜
˜sG¬
˜ aOd¤pp"4F›a4˜"4a= ˜
˜s–•
˜ ©dFmF
˜
˜sG•
˜
˜
379
zzFm=a¨˜˜˜˜˜^Fha4"d˜pma«"›apm˜^Fp©
p’a›a¦F˜˜›^Fp©
Hydride abstraction
In the formation of reagent ions, various reactant ions can be formed that have
high hydride-ion (H–) affinities. If the hydride-ion affinity of a reactant ion is
higher than the hydride-ion affinity of the ion formed by the analyte's loss of H–,
then the thermodynamics are favorable for this chemical ionization process.
Examples include the hydride abstraction of alkanes in methane chemical ionization. In methane CI, both CH5+ and C2H5+ are capable of hydride abstraction.
These species have large hydride-ion affinities, which results in the loss of H– for
long-chain alkanes, according to the general reaction
R+ + M → [M-H]+ + RH
For methane, R+ is CH5+ and C2H5+, and M is a long-chain alkane. In the case of
CH5+, the reaction proceeds to form [M-H]+ + CH 4+ H2. The spectra resulting
J
from hydride abstraction will show an M-1 amu peak resulting from the loss of H .
‚
This reaction is exothermic so fragmentation of the [M-H] ion is often observed.
Often, both hydride-abstraction and proton-transfer ionization can be evident in
the sample spectrum. One example is the methane CI spectrum of long-chain
methyl esters, where both hydride abstraction from the hydrocarbon chain and
proton transfer to the ester function occur. In the methane PCI spectrum of
methyl stearate, for example, the MH‚ peak at m/z = 299 is created by proton
transfer, and the [M-1]‚ peak at m/z 297 is created by hydride abstraction.
Addition
For many analytes, proton-transfer and hydride-abstraction chemical ionization
reactions are not thermodynamically favorable. In these cases, reagent gas ions are
often reactive enough to combine with the analyte molecules by condensation or
association (addition reactions). The resulting ions are called adduct ions. Adduct
ions are observed in methane chemical ionization by the presence of [M+C2H5]+
and [M+C3H5]+ ions, which result in M+29 and M+41 amu mass peaks.
Addition reactions are particularly important in ammonia CI. Because the NH3 has
a high proton affinity, few organic compounds will undergo proton transfer with
ammonia reagent gas. In ammonia CI, a series of ion-molecule reactions takes
place, resulting in the formation of NH 4+, [NH4NH3]+, and [NH4(NH3)2]+. In particular, the ammonium ion, NH4+, will give rise to an intense [M+NH4]+ ion
observed at M+18 amu, either through condensation or association. If this resulting ion is unstable, subsequent fragmentation may be observed. The neutral loss of
H2O or NH3, observed as a subsequent loss of 18 or 17 amu, respectively, is also
common.
380
zzFm=a¨˜˜˜˜˜^Fha4"d˜pma«"›apm˜^Fp©
p’a›a¦F˜˜›^Fp©
Charge exchange
Charge-exchange ionization can be described by the reaction:
·
·
X+ + M → M+ + X
where X+ is the ionized reagent gas, and M is the analyte of interest. Examples of
reagent gases used for charge exchange ionization include the noble gases
(helium, neon, argon, krypton, xenon, and radon), nitrogen, carbon dioxide, carbon monoxide, hydrogen, and other gases that do not react “chemically” with the
analyte. Each of these reagent gases, once ionized, has a recombination energy
expressed as:
·
X + + e– → X
or simply the recombination of the ionized reagent with an electron to form a neutral species. If this energy is greater than the energy required to remove an electron from the analyte, then the first reaction above is exothermic and
thermodynamically allowed.
Charge-exchange chemical ionization is not widely used for general analytical
applications. It can, however, be used in some cases when other chemical ionization processes are not thermodynamically favored.
381
zzFm=a¨˜˜˜˜˜^Fha4"d˜pma«"›apm˜^Fp©
FV"›a¦F˜˜›^Fp©
Negative CI theory
Negative chemical ionization (NCI) is performed with analyzer voltage polarities
reversed to select negative ions. There are several chemical mechanisms for negative chemical ionization. Not all mechanisms provide the dramatic increases in
sensitivity often associated with negative chemical ionization. The four most common mechanisms (reactions) are:
•
•
•
•
Electron capture
Dissociative electron capture
Ion pair formation
Ion-molecule reactions
In all of the cases except the ion-molecule reactions, the reagent gas serves a function different from the function it serves in positive chemical ionization. In negative CI, the reagent gas is often referred to as the buffer gas. When the reagent gas
is bombarded with high energy electrons from the filament, the following reaction
occurs:
Reagent gas + e- (230eV) → Reagent ions + e- (thermal)
If the reagent gas is methane, the reaction is:
CH4 + e- (230eV) → CH4+ + 2e-(thermal)
The thermal electrons have lower energy levels than the electrons from the filament. It is these thermal electrons that react with the sample molecules.
There are no negative reagent gas ions formed. This prevents the kind of background that is seen in PCI mode, and is the reason for the much lower detection
limits of NCI. The products of negative chemical ionization can only be detected
when the MSD is operating in negative ion mode. This operating mode reverses
the polarity of all the analyzer voltages.
Carbon dioxide is often used as a buffer gas in negative CI. It has obvious cost,
availability, and safety advantages over other gases.
382
zzFm=a¨˜˜˜˜˜^Fha4"d˜pma«"›apm˜^Fp©
FV"›a¦F˜˜›^Fp©
383
zzFm=a¨˜˜˜˜˜^Fha4"d˜pma«"›apm˜^Fp©
FV"›a¦F˜˜›^Fp©
Electron capture
Electron capture, is the primary mechanism of interest in negative CI. Electron
capture (often referred to as high-pressure electron capture mass spectrometry,
or HPECMS) provides the high sensitivity for which NCI is known. For some samples, and under ideal conditions, electron capture can provide sensitivity as much
as 10 to 1000 times higher than positive ionization.
Note that all the reactions associated with positive CI will also occur in NCI mode,
usually with contaminants. The positive ions formed do not leave the ion source
because of the reversed lens voltages, and their presence can quench the electron
capture reaction.
The electron capture reaction is described by:
MX + e-
(thermal)
→ MX¯
·
where MX is the sample molecule and the electron is a thermal (slow) electron
generated by the interaction between high energy electrons and the reagent gas.
In some cases, the MX¯… radical anion is not stable. In those cases the reverse reaction can occur:
·
MX- → MX + eThe reverse reaction is sometimes called autodetachment. This reverse reaction
generally occurs very quickly. Thus, there is little time for the unstable anion to be
stabilized through collisions or other reactions.
Electron capture is most favorable for molecules that have hetero-atoms. For
example: nitrogen, oxygen, phosphorus, sulfur, silicon, and especially the halogens: fluorine, chlorine, bromine, and iodine.
The presence of oxygen, water, or almost any other contaminant interferes with
the electron-attachment reaction. Contaminants cause the negative ion to be
formed by the slower ion-molecule reaction. This generally results in less sensitivity. All potential contamination sources, especially oxygen (air) and water sources,
must be minimized.
384
zzFm=a¨˜˜˜˜˜^Fha4"d˜pma«"›apm˜^Fp©
FV"›a¦F˜˜›^Fp©
Dissociative electron capture
Dissociative electron capture is also known as dissociative resonance capture. It is
a process similar to electron capture. The difference is that during the reaction,
the sample molecule fragments or dissociates. The result is typically an anion and
a neutral radical. Dissociative electron capture is illustrated by the reaction equation:
MX + e-
(thermal)
·
→ M + X¯
This reaction does not yield the same sensitivity as electron capture, and the mass
spectra generated typically have lower abundance of the molecular ion.
As with electron capture, the products of dissociative electron capture are not
always stable. The reverse reaction sometimes occurs. This reverse reaction is
sometimes called an associative detachment reaction. The equation for the reverse
reaction is:
·
M + X¯ → MX + e-
Ion pair formation
Ion pair formation is superficially similar to dissociative electron capture. The ion
pair formation reaction is represented by the equation:
MX + e-
(thermal)
→ M‚ + X¯ + e-
As with dissociative electron capture, the sample molecule fragments. Unlike dissociative electron capture, however, the electron is not captured by the fragments.
Instead, the sample molecule fragments in such a way that the electrons are distributed unevenly and positive and negative ions are generated.
385
zzFm=a¨˜˜˜˜˜^Fha4"d˜pma«"›apm˜^Fp©
FV"›a¦F˜˜›^Fp©
Ion-molecule reactions
Ion-molecule reactions occur when oxygen, water, and other contaminants are
present in the CI ion source. Ion-molecule reactions are 2 – 4 times slower than
electron-attachment reactions and do not provide the high sensitivity associated
with electron capture reactions. Ion-molecule reactions can be described by the
general equation:
M + X¯ → MX¯
where X¯ is most often a halogen or hydroxyl group that has been created by ionization of contaminants by electrons from the filament. Ion-molecule reactions
compete with electron capture reactions. The more ion-molecule reactions that
occur, the fewer electron capture reactions occur.
386
m=F¨
Numerics
19, large peak at m/z, in CI MSD, 141
219 width, 309
32, visible peak at, in CI MSD, 71, 76, 142
59864B Gauge Controller, 287
59864B gauge controller, 63
5986B Gauge controller, 7
A
Abrasively cleaning ion source parts, 212
parts to be cleaned, 210
Abundance
absolute, 105
low for m/z 502, 105
relative, 105
AC board, 326
Adduct ion, 380
Adjusting the RF coils, 240
Air leaks, 118
as a source of contamination, 119
detecting in CI, 77
finding in CI, 126
small enough to cause no problems in PCI can
destroy NCI sensitivity, 122
visible peak at m/z 32 in CI MSD, 142
Alignment, analyzer and CI interface, checking,
250
Ammonia
ballasting of the foreline pump required due to,
254
maintenance caution, 374
PCI spectrum of methyl stearate, 376
Ammonia reagent gas
increased maintenance required, 246
AMU gain, 308
AMU offset, 309
Analyzer, 297 – 315
accessing, 56
basic components of, 298
heaters, 314
ion source, 300
maintaining, 204
mass filter, 308
part numbers, 352
parts that should not be disturbed, 205
radiators, 314
Analyzer chamber
closing, 58
opening, 56
Analyzer chamber pressure
effect of column flow on, 47
too high, 107
too low, 108
typical, 47
Analyzer chamber, diffusion pump, 266
Analyzer chamber, turbo pump, 267
Analyzer temperatures, 36
recommended, 314
setting, 42
Autotune, 50
CI, 78
CI, negativemode, 82
CI, positive mode, 80
column flow and temperatures for, 50
relative abundances of m/z 502 produced by
different autotunes, 105
report generated by, 50
viewing tune history, 50
Auxiliary heated zones, 36
387
m=F¨
B
Back panel and connectors, 332
Background, air and water
checking for at CI startup, 77
checking for at startup, 76
effect on NCI sensitivity, 384
effect on PCI, 376
troubleshooting in CI, 124
Background, air and water, in CI, 77
Background, chemical
minimizing by avoiding unnecessary tuning, 80,
82, 294
Background, high, 103, 119
Ballast control, on foreline pump, 272
Ballast, foreline pump, 254
Baseline, chromatographic
falling, 100
high, 100
rising, 100
wandering, 101
BFB tune, 50
Bleed. See Column bleed or Septum bleed
C
Cables
part numbers for external, 339
part numbers for internal, 340
Calibrant
CI calibrant ions not visible, 138
Calibrant vial, 283
Calibrant vial, CI
refilling, 257
Calibrant vial, CI, refilling
Calibration valve, 283
O-ring, 270
Calibration valve, CI, 283, 294
Calibration valve, EI
reinstalling, 192
removing, 190
388
Calibration vial, EI
refilling and reinstalling, 183
removing, 181
Carrier gas
contaminated, 119
flow, 36
purity requirement, 21, 34
See also Column flow
Cautions, inside front cover
Charge exchange, PCI, 381
Checklist, pre-operation, 34
Chemical background
effect on NCI, 382
Chemical ionization
hardware overview, 8
methane reagent gas, 374
molecular ion, 374
overview, 374
references, 375
water contamination, 374
Chemical residue, hazardous, 157
ChemStation
controlling temperatures with, 36
monitoring temperatures and vacuum, 38
setting monitors, 40
setting the GC/MSD interface temperature, 44
using to pump down the CI MSD, 62
using to pump down the MSD, 60
using to set up methane reagent gas flow, 76
using to tune the MSD, 50
using to vent the MSD, 54, 68
Chromatography, abnormal results, 98
CI autotune, 78
Methane PCI only, 80
CI calibrant vial
refilling, 257
CI calibration valve, 283, 294
CI filament, 306
m=F¨
CI interface
heater clamp, 233, 292
CI interface tip seal, 306
installing, 250
CI ion source
cleaning, 252
installing, 248
repeller, 306
CI maintenance, 245 – 258
CI MSD maintenance, 245
installing the CI interface tip seal, 250
CI operating mode, switching to, 72
CI operation, 69
CI autotune, 78
general guidelines, 70, 72, 247
installing the CI ion source, 248
NCI autotune, 82
PCI autotune, 80
setting up methane gas flow, 76
setting up the software for, 73
start up in methane PCI first, 71
typical pressure readings, 87
using other reagent gases, 88
using the reagent gas flow control module, 74
CI reagent gas flow control module
see Reagent gas flow control module
CI spectra
classical, 8
endosulfan methane NCI, 383
methyl stearate methane and ammonia PCI,
377
Cleanliness, importance during maintenance, 204
Closing the analyzer chamber, 58
Column bleed, 21
as a source of contamination, 119
Column conditioning
assisted by solvent injection, 26
Column flow, 36
calculating average linear velocity, 48
effect on Analyzer chamber pressure, 47
for optimum sensitivity, 37
maximum for diffusion pump MSD, 20
maximum for turbo pump MSDs, 20
measuring with the MSD, 36, 48
Column installation tool, 30
Column nut
leaking, 118
part numbers, 22, 30
Column, capillary
preparing for installation, 22
Columns
conditioning, 21, 26
installing, 19 – 31
installing in a split/splitless inlet, 24
installing in the GC/MSD interface, 28, 30
table of size, pressure, and flow, 20
tips and hints, 21
types that can be used with the MSD, 20
See also Column flow
Communication failure, venting the MSD in case
of, 68
Compression seals, 270
Conditioning capillary columns
importance of, 21
procedure for, 26
Conditioning column
assisted by solvent injection, 26
Conditioning ferrules, 21
Connectors, 332
foreline pump cord receptacle, 332
high vacuum power (HIVAC POWER), 332
high vacuum signal (HIVAC SIGNAL), 332
power cord receptacle, 332
remote start, 332, 334
Consumables, part numbers of, 360
389
m=F¨
Contamination, 119
avoiding after cleaning the ion source, 204
table of common contaminants, 120
Control panel, 6, 34
Control panel, reagent gas flow control module,
293
Controller, high vacuum gauge, 63
D
Data system
control over pumpdown, 35
controlling temperatures with, 36
using to ensure correct venting, 36
DC polarity, 310
Detection limits
high in PCI, 376
lower in NCI, 382
Detector, 312
difficulty with the EM supply, 112
electron multiplier horn, 312
electron multiplier voltage, 312
replacing the horn, 230
steadily increasing EM voltage, 313
Detector focus lens, 312
DFTPP tune, 50
Diffusion pump, 276
automatic control of, 276, 277
effect of low fluid level in, 107
error messages related to, 113
part numbers, 348
reinstalling, 177
removing, 173
thermal switches, 277
See also Diffusion pump fluid
Diffusion pump fluid, 276
as a source of contamination, 119
checking, 168
replace once a year, 152
replacing, 175
390
Disassembling the ion source, 208
Drawout plate and cylinder, 304
Drying cleaned ion source parts, 204
Dummy filament, 306
E
EI overview, 374
EI/CI GC/MSD interface. See CI interface
EI/CI GC/MSD interface. See CI interface
Electronics, 317 – 335
ac board, 326
ac-dc board. See low voltage power supply
danger to from electrostatic discharge, 158,
238
high voltage (HED) power supply, 331
LAN/MS control card, 330
locations of major components, 319
low voltage power supply, 331
main board, 324
maintaining, 238
part numbers, 339
power supplies, 331
signal amplifier board, 325
status display, 320
toroid transformer, 331
turbo pump controller, 328
Electrostatic discharge
danger to the electronics from, 158, 238
precautions to take against, 205, 238
EM
See also Detector
See Electron multiplier
EM voltage, 313
Emergency
venting the MSD in case of, 68
Emission current, 302
if there is none, 117
EMVolts at or above 2600V in NCI autotune, 82
End plate O-rings, 270
m=F¨
Endosulfan, EI and NCI spectra, 382
Entrance lens, 304
Error messages
difficulty in mass filter electronics, 112
difficulty with the EM supply, 112
difficulty with the fan, 113
difficulty with the HED supply, 113
difficulty with the high vacuum pump, 113
foreline pressure has exceeded 300 mTorr, 114
internal MS communication fault, 114
latched, 112
lens supply fault, 114
log amplifier ADC error, 114
no peaks found, 114
temperature control disabled, 115
temperature control fault, 115
the high vacuum pump is not ready, 116
the system is in standby, 116
the system is in vent state, 117
there is no emission current, 117
there is not enough signal to begin tune, 117
translating error numbers into messages, 112
ESD. See Electrostatic discharge
Excessive noise or low signal-to-noise ratio in CI
MSD, 140
Exhaust
oil trap for foreline pump, 166, 272
venting the foreline pump, 34
F
Face seals, 270
Fan, for high vacuum pump, 276, 280
cleaning, 177
incorrect operation of, 113
replacing, 194
Ferrules
conditioning, 21
part numbers, 362
Ferrules, inlet
part numbers, 22
Ferrules, interface
part numbers, 30
Filaments, 302
care, 303
electron energy, 302
emission current, 302
parameters affecting, 302
reinstalling, 220
removing, 218
selection, 302
Flow control display, reagent gas flow control
module, 293
Flow control module, 293
schematic, 295
state diagram, 74, 296
Flow rate. See Column flow
Foreline gauge, 274
reinstalling, 188
removing, 186
See also Foreline pressure
Foreline pressure
exceeding 300 mTorr, 114
monitoring, 35, 38, 40
too high, 107
too low, 108
typical, 38
391
m=F¨
Foreline pump, 272
ammonia use requires frequent oil changes,
254
ballast control, 272
ballasting in ammonia CI MSD, 254
effect of low oil level, 107
failure to turn on, 97
incorrect operation, 97
minimizing damage from ammonia reagent gas,
254
oil trap, replacing, 166
part numbers, 346
power cord receptacle, 332
turned off during pumpdown, 97
venting the exhaust, 34, 157, 272
vibration, 272
See also Foreline pump oil
Foreline pump oil
adding and checking, 160
as a source of contamination, 119
draining, 162
refilling the pump with, 164
replace every 6 months, 152
Foreline pump power cord receptacle, 332
Foreline trap. See Oil trap
Foreline vacuum gauge. See Foreline gauge
Front panel. See Status Display
Fuses
on the back panel, 332
part numbers, 339
replacing the primary fuses, 242
392
G
Gas purifier, methane/isobutane
replacing, 255
Gauge controller, 287
abnormal or blank display, 46, 86, 108
indicated vs. actual pressure, 46, 86, 287
monitoring pressure with, 35, 46, 86
overpressure shutdown, 47
power indicator does not light, 109
pressure range, 46, 86
relative sensitivity to different gases, 86
Gauge Controller, 59864B, 287
Gauge controller, connecting, 63
Gauge controller, required for CI, 7
Gauge tube. See Triode gauge tube
GC
components responsible for air leaks, 118
does not turn on, 96
sources of contamination in, 119
GC interface. See GC/MSD interface
GC keypad, setting GC/MSD interface temperature
from, 67
GC/MSD interface, 289 – 296
failure to heat up, 111
heated zone controlling, 290
heater, 36, 290
maintaining, 232
part numbers, 358
reinstalling a heater and sensor, 236
removing the heater and sensor, 234
See also GC/MSD interface temperature
sensor (thermocouple), 290
GC/MSD interface temperature, 36
range, 290
setting from the ChemStation, 44
setting from the GC, 67
GC/MSD interface, CI, 292
tip seal, 292
GC/MSD interface, CI. See CI interface
Grounded wrist strap, 158
m=F¨
H
I
Half-splitting, to find air leaks in CI MSD, 126
Heater clamp, CI interface, 233, 292
Heaters
GC/MSD interface, reinstalling, 236
GC/MSD interface, removing, 234
heated zone used to power the GC/MSD interface heater, 36
ion source, reinstalling, 224
ion source, removing, 222
mass filter, reinstalling, 228
mass filter, removing, 226
setting temperature monitors, 40
viewing temperature and vacuum status, 38
HED, 312
difficulty with the HED power supply, 113
HED feedthrough
seal, 271
HED power supply, 331
High electron multiplier voltage in CI MSD, 147
High pressure electron-capture mass spectrometry. See Negative CI
High vacuum gauge
installing, 198
relative sensitivity to different gases, 86
removing, 196
High vacuum pump
difficulty with, 113
diffusion pump, 276
not ready, 116
High vacuum. See Vacuum manifold pressure
High voltage feedthrough. See HED feedthrough
History, Autotune, 50
Horn, electron multiplier, 312
HPECMS.See Negative CI
Hydride abstraction, 380
Hydrogen carrier gas
danger of ignition by triode gauge tube, 46, 86
flow turned off while MSD is vented, 34
hazards during pumpdown, 35, 60
Indicated pressure, 287
Installing GC columns, 19 – 31
Interface socket
reinstalling, 214
removing, 208
Interface tip seal, CI
installing, 250
Interface. See CI interface
Interface. See GC/MSD interface
Interfacing to external devices, 334
start run input, 335
system ready signal, 335
Ion focus, 304
Ion source, 300
body, 300
cleaning, 210 – 213
disassembling, 208
drawout plate and cylinder, 304
drying cleaned parts, 212
entrance lens, 304
filament care, 303
filament, reinstalling, 220
filament, removing, 218
filaments, 302
heater, 314
heater and sensor, reinstalling, 224
heater and sensor, removing, 222
ion focus lens, 304
magnet, 303
part numbers, 354
parts that should not be cleaned, 210
reassembling, 214
reinstalling, 216
removing, 206
repeller, 303
393
m=F¨
Ion source temperature, 36
setting, 42
setting a monitor for, 40
viewing, 38
Ion source, CI
cleaning, 252
installing, 248
Ion source, CI. See CI ion source
Isolation valve, 294
K
KF seals, 270
part numbers, 344
L
LAN (I/O) connector, 332
LAN/MS control card, 330
interfacing to external devices, 334
RAM on, 330
remote control processor, 334
Line voltage
symptoms of incorrect or missing, 96, 108
Log amplifier. See Signal amplifier
Low sensitivity
at high masses, 106
general, 102
Low signal-to-noise ratio in CI MSD, 140
Low voltage (ac-dc) power supply, 331
Lubricating
side plate O-ring, 200
vent valve O-ring, 202
394
M
m/z, 308
m/z 14 and 16, symptoms of a large air leak, 104
m/z 18, 28, 32, and 44, symptoms of an air leak, 104
m/z 502, low or decreasing abundance of, 105
Maintenance, 151 – 244
analyzer, 204
analyzer chamber, opening, 56
avoiding dangerous voltages during, 155
calibration vial, removing, 181
CI calibrant vial refilling, 257
CI gas purifier replacing, 255
CI interface tip seal installing, 250
CI ion source cleaning, 252
CI ion source installing, 248
CI MSD, 245
cleaning reagent gas supply tubing, 256
dangerous voltages, 155
dangerously hot parts, 156
diffusion pump fluid, checking, 168
diffusion pump fluid, replacing, 175
diffusion pump, reinstalling, 177
diffusion pump, removing, 173
EI calibration valve, refilling, 192
EI calibration valve, removing, 190
EI calibration vial, refilling, 183
EI calibration vial, reinstalling, 183
electron multiplier horn, replacing, 230
electronics, 238
fan, high vacuum pump, replacing, 194
filament, reinstalling, 220
filament, removing, 218
foreline gauge, reinstalling, 188
foreline gauge, removing, 186
foreline pump in CI, 254
foreline pump oil, draining, 162
foreline pump, refilling, 164
GC/MSD interface, 232
GC/MSD interface heater and sensor, reinstalling, 236
m=F¨
GC/MSD interface heater and sensor, removing, 234
increased need for ion source cleaning in CI
MSD, 246
ion source heater and sensor, reinstalling, 224
ion source heater and sensor, removing, 222
ion source, disassembling, 208
ion source, reassembling, 214
ion source, reinstalling, 216
ion source, removing, 206
mass filter (quadrupole), 311
mass filter heater and sensor, reinstalling, 228
mass filter heater and sensor, removing, 226
methane/isobutane gas purifier, 255
primary fuses, replacing, 242
purging thecalibration valve after refilling the
calibrant vial, 185
reconnecting the MSD to the GC, 179
refilling the CI calibrant vial, 257
RF coils, adjusting, 240
safety during, 155 – 158
schedule, 152
separating the MSD from the GC, 171
side plate O-ring, lubricating, 200
supplies for, 154
tools for, 153, 361
triode gauge tube, reinstalling, 198
triode gauge tube, removing, 196
vacuum system, 159
vent valve O-ring, lubricating, 202
Maintenancem CI, ?? – 258
Malfunctions. See Symptoms of malfunctions
Manual tune, 50
Mass assignments, incorrect, 104
Mass filter
219 width, 309
amu gain, 308
amu offset, 309
dc polarity, 310
dc voltage, 308
difficulty with the mass filter electronics, 112
heater, 314
heater and sensor, reinstalling, 228
heater and sensor, removing, 226
maintenance, 311
mass (axis) offset, 310
parameters, 308
radiator, 314
RF voltage, 308
Mass filter temperature
monitor, 40
setting, 42
viewing, 38
Mass gain, 310
Mass offset, 310
Mass spectra
high abundances at m/z 18, 28, 32, and 44 or at
m/z 14 and 16, 104
high background, 103
inconsistent peak widths, 104
incorrect mass assignments, 104
isotopes missing or ratios are incorrect, 103
precursors, 104
Mass-to-charge ratio, 308
Methane
PCI methyl stearate spectrum, 376
setting up gas flow, 76
Methane/isobutane gas purifier, 8
replacing, 255
Methyl stearate, spectra for methane and ammonia
PCI, 376
Mist filter, for foreline exhaust, 272
395
m=F¨
Monitoring
foreline pressure, 38
turbo pump speed, 38
vacuum manifold pressure, 46
MonitoringAnalyzer chamber pressure, 86
Monitors, 40
Moving the MSD, 65
MS error numbers, 112
MSD
dangerous voltages in, 155
dangerously hot parts in the, 156
does not turn on, 96
electronics, 317 – 335
hazards from chemical residue, 157
interfacing to external devices, 334
maintaining, 151 – 244
measuring column flow with the, 48
moving or storing, 65
operating, 33 – 68
troubleshooting, 93 – 119
N
NCI. See Negative CI
Negative CI
analyzer voltage polarities reversed, 382
autotune, 82
buffer gas, 382
dissociative electron capture, 385
effect of contamination, 384
electron capture, 384
ion pair formation, 385
ion-molecule reactions, 386
sensitivity, 384
theory, 382
thermal electrons, 382
NH3, preventing damage to the foreline pump due
to, 254
No peaks in CI MSD, 133
Noise declaration, inside front cover
396
O
Oil drip tray, for foreline pump, 272
Oil trap, 272
replacing, 166
Oil tray, for foreline pump, 272
On/off switch. See Power switch
Opening the analyzer chamber, 56
Operating the MSD, 33 – 67
Operation
switching from EI to CI, 72
Ordering parts, 338
O-rings and O-ring assemblies, 270
part numbers, 344
Oxygen, effect of on column bleed, 21
P
Part numbers, inside front cover
See also Parts
Parts, 337 – 372
analyzer, 352
CI interface, 370
consumables, 360
diffusion pump vacuum system, 348
electronic, 339
external cables, 339
ferrules, 362
foreline pump, 346
GC/MSD interface, 358, 370
if you cannot find a part you need, 338
ion source, 354
maintenance supplies, 361
miscellaneous, 363, 365, 366, 368, 370
ordering, 338
O-rings and O-ring assemblies, 344
printed circuit boards, 342
rebuilt assemblies, 338
samples, 363, 365, 366, 368, 370
seals, 344
turbomolecular pump vacuum system, 350
vacuum system, 344
m=F¨
Parts, replacement, 337
PCI. See Positive CI
Peak widths, inconsistent, 104
Peaks
at m/z 18, 28, 32, and 44 or at m/z 14 and 16,
104
flat tops, 100
fronting, 99
inconsistent widths, 104
missing, 98, 114
precursors, 104
split tops, 100
tailing, 99
PFDTD
avoiding persistent background of, 80, 82, 294
not visible, but reagent ions are present, 138
PFDTD (perfluoro-5,8-dimethyl-3,6,9-trioxidodecane), 283
PFTBA (perfluorotributylamine), 283
Physical description of MSD, 6
Polarity (dc), of the mass filter, 310
Positive CI
addition, 380
charge exchange, 381
hydride abstraction, 380
reagent ion background, 376
theory, 376
Power cord
ac, 332
foreline pump, 332
receptacle, 332
Power supplies
high voltage (HED), 331
low voltage (ac-dc), 331
Power switch, 320
Pressure
analyzer chamber pressure too high, 107
analyzer chamber pressure too low, 108
CI ion source, 306, 376
does not change when reagent gas flow is
changed, 131
foreline pressure too high, 107
foreline pressure too low, 108
indicated vs. absolute, 46, 86
Ion source, for CI, 8
monitoring, 35
analyzer chamber, 86
monitoring analyzer chamber, 46, 86
monitoring foreline, 38
monitoring vacuum manifold, 46
symptoms indicating malfunctions, 107
too high in analyzer chamber with reagent gas
flow, 130
too high in analyzer chamber without reagent
gas flow, 129
typical analyzer chamber pressure for various
carrier gas flows, 47
typical vacuum manifold pressure for various
carrier gas flows, 274, 277
Pressure gauge
See Triode gauge tube
Printed circuit boards, part numbers, 342
Proton affinity
importance in PCI, 378
organic compound table, 379
reagent gas table, 379
Proton transfer, 378
Pump
exhaust, venting, 157
Pump oil drip tray, 272
Pump, foreline
failure to turn on, 97
turned off during pumpdown, 97
397
m=F¨
Pumpdown
failure, 328
procedure, 60, 62
procedure for CI MSD, 62
safety shutdown, 261
waiting for thermal equilibrium after, 61
Pumpdown safety shutdown, 328
Pumping problem, 328
Pumps turned off, 261, 328
Reagent gas ions
not visible, 135
Relative abundance, 105
Remote start connector, 332, 334
Repeatability, poor, 102
Repeller
parts for, 356
Repeller, CI, 306
Replacing parts. See Maintenance
Q
S
Quad temperature, 36
See also Mass filter temperature
Quadrupole. See Mass filter
Quick Tune, 50
Safety
covers, 155
during maintenance, 155 – 158
Samples, 363, 366, 368, 370
part numbers, 363, 365, 366, 368, 370
Seals
vacuum, 270, 344
See also O-rings and O-ring assemblies
Sensitity of high vacuum gauge to different gases,
86
Sensitivity
poor, 102
poor at high masses, 106
verifying NCI performance, 85
verifying PCI performance, 84
Septum bleed, as a source of contamination, 119
Septum, leaking, 118
Sequencing, not appropriate for CI methods using
different reagent gases or gas flows, 70
Service agreements, inside back cover
Shutdown. See Venting
Side plate
lubricating the O-ring, 200
O-ring, 270
thumbscrews, 268
Signal amplifier board, 325
Signal, not enough to begin tune, 117
R
Radiators, 314
Reagent gas
ammonia, using, 90
carbon dioxide, using for NCI buffer gas, 91
CI theory overview, 374
cleaning supply tubing, 256
delay in turning on, 295
isobutane, using, 90
no negative ions, 382
plumb methane to Gas A, 293
plumbing into the CI interface, 292
using other reagent gases, 88
Reagent gas flow control module, 293
Gas A, always methane, 293
Gas Off, 293
isolation valve, 294
mass flow controller, 293
operating, 74
schematic, 295
state diagram, 74, 296
VCR fittings, 293
398
m=F¨
Smartcard III. SeeLAN/MS control card
Software
using to pump down the MSD, 60
Solvent peak
effect if analyzer is on, 112, 113
effect on triode gauge, 108
Specifications, sensitivity, 84, 85
Standard Tune, 50
Startup
failure of the MSD to, 96
methane pre-tune showing acceptable levels of
air and water, 77
See also Pumpdown
setting up methane flow, 76
setting up the software for CI operation, 73
too much air and water, 77
State diagram, reagent gas flow control module,
74, 296
Static discharge. See Electrostatic discharge
Status display, 320
Storing the MSD, 65
Supplies
for maintaining the MSD, 154
Switch, power. See Power switch
Switching
from CI to EI operating mode, 92
from EI to CI operating mode, 72
Switching, between EI and CI, 8
Symptoms of malfunctions
analyzer chamber pressure is too high, 107
baseline is falling, 100
baseline is high, 100
baseline is rising, 100
baseline wanders, 101
can not complete CI autotune, 148
chromatographic symptoms, 98 – 102
difficulty in mass filter electronics, 112
difficulty with the EM supply, 112
difficulty with the fan, 113
difficulty with the HED supply, 113
difficulty with the high vacuum pump, 113
error messages, 112 – 117
excessive noise or low signal-to-noise ratio in
CI MSD, 140
foreline pressure has exceeded 300 mTorr, 114
foreline pressure is too high, 107
foreline pressure is too low, 108
foreline pump is not operating, 97
gauge controller displays 9.9+9 and then goes
blank, 108
GC does not turn on, 96
GC/MSD interface will not heat up, 111
general symptoms, 96 – 97
high abundances at m/z 18, 28, 32, 44 or at m/
z 14 and 16, 104
high analyzer chamber pressure with reagent
gas flow, 130
high background, 103
high electron multiplier voltage in CI MSD, 147
high mass sensitivity is poor, 106
internal MS communication fault, 114
ion source will not heat up, 110
isotopes missing or ratios are incorrect, 103
large peak at m/z 19 in CI MSD, 141
lens supply fault, 114
log amplifier ADC error, 114
mass filter (quad) heater will not heat up, 111
mass spectral symptoms, 103 – 106
MSD does not turn on, 96
MSD is on but foreline pump is not running, 97
no or low PFDTD signal, but reagent ions are
normal, 138
no or low reagent gas signal, 135
no peaks, 98, 114
no peaks in CI MSD, 133
peak at m/z 32 in CI MSD, 142
peak widths are inconsistent, 104
peak widths are unstable in CI MSD, 149
peaks are fronting, 99
peaks are tailing, 99
399
m=F¨
peaks have flat tops, 100
peaks have precursors, 104
peaks have split tops, 100
poor repeatability, 102
poor sensitivity, 102
poor vacuum without reagent gas flow, 129
power indicator on the gauge controller does
not light, 109
pressure does not change when reagent gas
flow is changed, 131
pressure symptoms, 107 – 109
pressure-related symptoms, overview (CI), 128
reagent gas ion ratio is difficult to adjust or unstable, 145
relative abundance of m/z 502 less than 3%,
105
retention time drifts (all peaks), 101
signal-related symptoms, overview, 132
temperature control disabled, 115
temperature control fault, 115
temperature symptoms, 110 – 111
the high vacuum pump is not ready, 116
the system is in standby, 116
the system is in vent state, 117
there is no emission current, 117
tuning-related symptoms overview for CI MSD,
144
System ready signal, 335
400
T
Target tune, 50
Temperature sensors
GC/MSD interface, reinstalling, 236
GC/MSD interface, removing, 234
in the MSD analyzer, 36
ion source, reinstalling, 224
ion source, removing, 222
mass filter, reinstalling, 228
mass filter, removing, 226
Temperatures, controlled through the MSD ChemStation, 36
Thermal Aux #2, 290
Thermal electrons, in NCI, 382
Thermal equilibrium, time to reach, 314
Tipping the MSD, caution against, 66
To, 68, 72, 248, 254
Tools, for maintaining the MSD, 361
Toroid transformer, 331
Transfer line. See GC/MSD interface
Transformer, toroid, 331
Trap. See Oil trap
Triode gauge tube, 285
baffle in stem, 285
connecting a gauge controller to, 63
ignition of hydrogen by, 46, 86, 285, 287
implosion hazard, 46, 86
monitoring high vacuum pressure, 46, 86
reinstalling, 198
removing, 196
shield, 285
turning on, 46, 86
Troubleshooting, 93 – 119, 121
air leaks, determining presence of leak, 124
air leaks, finding location of leak, 126
common CI-specific problems, 122
See also Symptoms of malfunctions
tips and tricks, 95, 123
Tube, triode gauge, 285
Tune report, 50
m=F¨
Tuning, 50
cannot begin, 117
compound, 283
See also Autotune
See also the online help in the software
Turbo pump controller, 328
Turbomolecular (turbo) pump
monitoring the speed of, 38, 40
part numbers, 350
Turn on
failure of the MSD to, 96
See also Pumpdown
See Pumpdown
U
Ultrasonic cleaning of ion source parts, 212
V
Vacuum gauge
See Foreline gauge
See Triode gauge
Vacuum gauge controller
monitoring pressure with, 86
Vacuum manifold
diffusion pump version, 266
turbo pump version, 267
Vacuum manifold pressure
monitoring, 46
typical, 274, 280
Vacuum seals, 270
part numbers, 344
Vacuum system, 259 – 288
determining type, 20
diffusion pump system overview, 264
maintaining, 159
maintenance schedule, 152, 159
overview, 260
part numbers, 344
status, monitoring, 38, 40
turbo pump system overview, 265
Valve
calibration, 283
CI calibration, 283, 294
gas select valves, 293
isolation, 294
purge, 293
vent, 283
vent, proper operation of, 55
VCR fittings, 293
causing leaks by loosening, 126
Vent cycle
See Venting
Vent cycle. See Venting
Vent program. See Venting
Vent valve, 283
lubricating the O-ring, 202
Venting
ChemStation control of, 34
damage to MSD from incorrect, 36
if ChemStation is not working, 68
normal, 54
preparing the MSD for, 55
proper use of the vent valve, 55
Top view turns on interface heater, 55
Vial
calibrant, 283
See also Calibrant vial
Vial, calibrant
caution against solvent use, 257
Vial, Calibrant, CI
caution to purge calibration valve after refilling,
257
Voltages, dangerous, 155
401
m=F¨
W
Warnings, inside front cover
Warranty claims, inside back cover
Warranty, inside back cover
Water
contamination of CI systems by, 374
detecting in CI, 77, 141
Wid219 parameter, 309
Wiring, dangerous voltages on, 155
402
Warranty
Agilent Technologies warrants
its Analytical products against
defects in materials and
workmanship for the warranty
period. During the warranty
period, Agilent Technologies
will, at its option, repair or
replace products which prove
to be defective. Products that
are installed by Agilent
Technologies are warranted
from the installation date, all
others from the date of
delivery.
If Buyer schedules or delays
installation more than 30 days
after delivery, then warranty
period starts on 31st day from
the date of shipment. For
international orders, the grace
period is 60 days and the
warranty period starts on the
61st day from the date of
shipment.
Agilent Technologies software
and firmware products which
are designated for use with a
hardware product, when
properly installed on that
hardware product, are
warranted not to fail to execute
their programming instructions
due to defects in materials and
workmanship. If Agilent
Technologies receives notice of
such defects during the
warranty period, it shall repair
or replace software media and
firmware which do not execute
their programming instructions
due to such defects. Agilent
Technologies does not warrant
that the operation of the
software, firmware or hardware
shall be uninterrupted or error
free.
Within Agilent Technologies
service travel areas, warranty
and installation services for
products installed by Agilent
Technologies and certain other
products designated by Agilent
Technologies will be performed
at Buyer’s facility at no charge.
For installation and warranty
services outside of Agilent
Technologies’s service travel
area, Agilent Technologies will
provide a quotation for the
applicable additional services.
The foregoing warranty shall
not apply to defects resulting
from:
1. Improper or inadequate
maintenance, adjustment,
calibration or operation by
Buyer.
2. Buyer-supplied software,
hardware, interfacing or
consumables.
3. Unauthorized modifications
or misuse.
4. Operation outside of the
environmental and electrical
specifications for the product.
5. Improper site preparation
and maintenance.
6. Customer-induced
contamination or leaks.
This warranty may be modified
in accordance with the laws of
your country. Please consult
your local Agilent Technologies
office for the period of the
warranty, for shipping
instructions and for the
applicable wording of the local
warranty.
Warranty Claims
Power Specifications
If physical damage is found, or
if operation is not as specified
when the instrument is first
received, notify the carrier and
the nearest Agilent
Technologies office
immediately. The Agilent
Technologies office will arrange
for repair or replacement of the
instrument without waiting for
settlement of a claim with the
carrier. For other than initial
inspection warranty claims,
contact your local Agilent
Technologies office.
• 120 V ac 60 Hz or
220/240 V ac 50 Hz,
single-phase, nominal
• 850 VA (diffusion pump) or
700 VA (turbomolecular
pump)
• Main supply voltage not to
exceed ± 10% of the
nominal voltage
• IEC Transient Overvoltage
Category (Overvoltage
Category) II
• IEC pollution Degree 2
Environmental
Specifications
Service Agreements
Several service agreements are
available, each designed to
meet a specific need. In
addition to a preventive
maintenance agreement,
others cover specific repair/
maintenance services for the
5973 Mass Selective Detector,
and can provide for the
extension of warranty beyond
the initial warranty period.
Details of these agreements,
together with prices applicable
to the particular installation,
can be obtained from your local
Agilent Technologies office.
• Indoor use
• Altitude up to 4000 meters
• Operating environment: 15°
to 35°C at constant
temperature (constant
temperature = ±2°C per
hour)
• Operating humidity: 25 to
50% relative humidity
Non-operating humidity:
10 to 95% relative humidity,
non-condensing
Manual Part Number
G2589-90001
Copyright  1999
Agilent Technologies
Printed in USA 11/99