HOME APPLIANCES 3D Cool Climate Control HOME APPLIANCES ® Registered trademark/TM Trademark of Whirlpool, U.S.A. © 2009 Whirlpool of India Ltd. All rights reserved. Due to advancement of technology and constant R&D the specifications, models and designs are subject to change without prior notice. 4000188-01 Vipul Sabharwal Vice President - (Sales & Marketing) 6SOLW7\SH5RRP$LU&RQGLWLRQHU-R22 8VHDQG&DUH0DQXDO 8QGHU3UHSDUDWLRQEHIRUHXVH 6DIHW\3UHFDXWLRQV ,GHQWLILFDWLRQRISDUWV 'LVSOD\LQWURGXFWLRQ 5HPRWHFRQWUROOHU 5&EDWWHULHVORDGLQJ 2SHUDWLQJ,QVWUXFWLRQVIRU5& $LUIORZ'LUHFWLRQ&RQWURO WK6HQVH0RGH 7LPHU0RGH &OLPDWH&RQWURO)HDWXUH )XQFWLRQVDYDLODEOHLQGLIIHUHQWPRGHV 0DLQWHQDQFH 3URWHFWLRQ 7URXEOHVKRRWLQJ 7URXEOHVKRRWLQJFKDUW ,QVWDOODWLRQLQVWUXFWLRQV ,QVWDOODWLRQLQVWUXFWLRQIRU,'8 ,QVWDOODWLRQLQVWUXFWLRQIRUSLSLQJFRQQHFWLRQ &DEOHFRQQHFWLRQ,QVWUXFWLRQ :LULQJGLDJUDP ,QVWDOODWLRQLQVWUXFWLRQIRU2'8 +RZWRSXUJH :DUUDQW\WHUPV a 6HUYLFHFRXSRQV ,QVWDOODWLRQGHPRVKHHWFXVWRPHUFRS\ a ,QVWDOODWLRQGHPRVKHHWFRPSDQ\FRS\ a :KLUOSRRO6HUYLFH 7KDQN\RXYHU\PXFKIRUSXUFKDVLQJ a:KLUOSRRO$LU&RQGLWLRQHUSOHDVHUHDGWKLV8VH &DUH0DQXDOFDUHIXOO\EHIRUHLQVWDOOLQJDQGXVLQJWKLVDSSOLDQFHDQGNHHSWKLVPDQXDO IRUIXWXUHUHIHUHQFHV ,PSRUWHG%\:KLUOSRRORI,QGLD/LPLWHG $0,'&5DQMDQJDRQ7DOXND6KLUXU'LVWW3XQH0DKDUDVKWUDVWDWH,QGLD3,1 :KLUOSRROLVDUHJLVWHUHGWUDGHPDUNRIWKH:KLUOSRRO&RUSRUDWLRQ86$8VHXQGHUOLFHQVH Under Preparation before use Before using the air conditioner, be sure to check and preset as the following. Remote Controller (RC) 7KHUHPRWHFRQWUROOHUFDQFRYHUDOOWKHIXQFWLRQVRIFRROLQJPRGHOV+HDWLQJPRGHLVQRWDSSOLFDEOHIRU FRROLQJPRGHOV Auto-Restart Function ,I\RXZDQWWRXVHDXWRUHVWDUWVZLWFKRQWKHSRZHUVXSSO\EXWWRQSUHVVWKH212))EXWWRQRQWKH,QGRRU 8QLWKROGIRURYHUVHFRQGV$XWR5HVWDUWLVQRZVHWZLWKEX]]VRXQG ,IWKHDXWRUHVWDUWKDVEHHQVHWKROGGRZQWKH212))EXWWRQRQWKHLQGRRUXQLWIRURYHU6HFRQGVDXWR UHVWDUWIXQFWLRQLVQRZFDQFHOOHGZLWKDEX]]VRXQGDLUFRQGLWLRQHULVQRZRQVWDQGE\ Auto Turbo Mode Turbo mode is used to start or stop fast cooling. )DVWFRROLQJFKDQJHVWKHWHPSHUDWXUHWRKLJKIDQVSHHGDQGRSHUDWHVDXWRPDWLFDOO\WLOOWHPSHUDWXUHUHGXFHV WR6GHJUHHV&HOVLXVIRUPLQXWHVWKHQVZLWFKHVWRSUHVHWPRGH In case of power resume, auto turbo mode work for 10 min. x x 7XUERPRGHFDQEHVHWZKHQWKHDSSOLDQFHLVLQRSHUDWLRQRU powered on ,QWXUERPRGH\RXFDQVHWDLUIORZGLUHFWLRQRUWLPHU,I\RXZDQWWRUHWXUQWRWKHRULJLQDOPRGHSUHVV 32:(502'()$1212))RU7(03(5$785(6(77,1*%87721 1RWH x x x 6OHHSDQGWKVHQVHEXWWRQVDUHQRWDYDLODEOHLQWXUERPRGH 7XUEREXWWRQLVLQHIIHFWLYHLQKHDWLQJPRGH 7KHDSSOLDQFHZLOOFRQWLQXHZRUNLQJLQWXUERPRGHZLWKVHWWHPSHUDWXUHRI6GHJUHH&HOVLXVWLOORWKHU EXWWRQVPHQWLRQHGDERYHDUHSUHVVHG Safety precautions 6\PEROVLQWKLV8VHDQG&DUH0DQXDODUHLQWHUSUHWHGDVVKRZQEHORZ %HVXUHQRWWRGR 3D\DWWHQWLRQWRVXFKDVLWXDWLRQ 8VHFRUUHFWSRZHUVXSSO\LQ DFFRUGDQFHZLWKWKHUDWLQJSODWH UHTXLUHPHQW2WKHUZLVHVHULRXV IDXOWVRUKD]DUGPD\RFFXURUD ILUHPD\EHEUHDNRXW 'RQRWbendSXOORUSUHVVWKHSRZHUVXSSO\ FRUGOHVWWKHSRZHUVXSSO\FRUGEHEURNHQ $QHOHFWULFVKRFNRUILUHmay beFDXVHG E\DEURNHQSRZHUVXSSO\FRUG *URXQGLQJLVHVVHQWLDO :DUQLQJ,QFRUUHFWKDQGOLQJFRXOG FDXVHDVHULRXVKD]DUGVXFKDVGHDWK VHULRXVLQMXU\HWF 21 21 2)) .HHSWKHSRZHUVXSSO\FLUFXLWEUHDNHU RUSOXJ awayIURPGLUW&RQQHFWWKHSRZHU VXSSO\FRUGWRLWILUPO\DQGFRUUHFWO\ OHVWDQHOHFWULFVKRFNRUDILUHEUHDNRXW GXHWRLQVXIILFLHQWFRQWDFW 1HYHULQVHUWDVWLFNRUVLPLODUREVWDFOH WRWKHXQLW6LQFHWKHIDQURWDWHVDWKLJK VSHHGWKLVPD\FDXVHDQLQMXU\ 2)) 'RQRWXVHWKHSRZHUVXSSO\FLUFXLW EUHDNHURUSXOORIIWKHSOXJWRWXUQLWRII GXULQJRSHUDWLRQ7KLVPD\FDXVHDILUH GXHWRVSDUNHWF ,WLVKDUPIXOWR\RXUKHDOWKLIWKHFRRODLU UHDFKHV\RXIRUDORQJWLPH,WLVDGYLVDEOH WROHWWKHDLUIORZEHGHIOHFWHGWRaroundWKHURRP & 7XUQRIIWKHDSSOLDQFHE\UHPRWHFRQWURO ILUVWEHIRUHFXWWLQJRIISRZHUVXSSO\LI any PDOIXQFWLRQRFFXUV 'RQRWWRXFKWKHRSHUDWLRQEXWWRQV ZKHQ\RXUKDQGVDUHZHW 'RQRWUHSDLUWKHDSSOLDQFHE\\RXUVHOI ,IWKLVLVGRQHLQFRUUHFWO\LWPD\FDXVHD HOHFWULFVKRFNHWF 'RQRWSXWDQ\REMHFWVRQWKHRXWGRRU XQLW 2 3UHYHQWWKHDLUIORZIURPUHDFKLQJWKHJDV EXUQHUVDQGVWRYH ,WLVWKHXVHU VUHVSRQVLELOLW\WRJHWWKH $SSOLDQFHHDUWKHGDFFRUGLQJWRORFDO requirements E\DOLFHQVHGWHFKQLFLDQ Identification of parts Indoor unit Air Intake Front Panel Display Box Air Outlet Emergency Box Vertical Adjustment Louver Horizontal Adjustment Louver Air Filter Remote Controller Air Intake Outdoor unit Pipes and Power Connection Cord Drain Hose Note: Condensate water drains at COOLING or DRY operation. Air Outlet The figures in this manual are based on the external view of a standard model. Consequently, the shape may differ fromthat of the air conditioner you have selected. 3 Timer Turbo Temperature 4 On Sleep Remote controller Remote controller The remote controller transmits signals to the system. 1 ON/OFF BUTTON The appliance will be switched on or Off on pressing this button 2 ON OFF MODE BUTTON Press this button to select the operation mode. 3 FAN BUTTON Used to select fan speed in sequence auto, high, medium or low. 4 55 ROOM TEMPERATURE SETTING BUTTONS Used to adjust the room temperature and the timer, also real time. 6 SENSE BUTTON Used to enter fuzzy logic operation directly, regardless of the unit is on or off. 7 SWING UP/DOWN Used to stop or start vertical adjustment louver swinging and set the desired up/down airflow direction. 8 SILENT SLEEP Used to set or cancel Sleep Mode operation. 9 AROUND U BUTTON Used to set or cancel AROUND U Mode operation. 10 POWER SAVER BUTTON Used to enter or quit POWER SAVER mode 11 TIMER OFF BUTTON Used to cancel the timer operation. 13 SUMMER CHILL 11 12 TIMER ON/CLOCK BUTTON Used to set timer operation and clock. 14 DIM BUTTON When you press this button, all the display of indoor unit will be switched off. Press any button to resume display. Used to start or stop the fast cooling. 15 SWING L/R Used to stop or start Horizontal adjustment louver swinging and set the desired left/right airflow direction. 16 SPRING COOL SPRING COOL is suitable for non-peak summer when the indoor room temperature is neither too hot nor too humid. 17 MONSOON FRESH MONSOON FRESH is suitable for high humid condition, when the moisture content in the air inside the room creates major discomfort. *"Swing L/R" button in the remote control shall not function for 1.0 T 3D Cool Climate Control. For horizontal air flow, adjust manually. Note: Each mode and relevant function will be further specified in following pages. 5 Remote controller Remote controller Indication symbols on LCD: Cooling indicator Auto fan speed 6th sense indicator Dry indicator High fan speed Sleep indicator Fan only indicator Medium fan speed Around U Heating indicator Low fan speed Turbo indicator Climate Control Super silense Power saver indicator Signal transmit ON Display set timer OFF Display current time Display set temperature Note: Each mode and relevant function will be further specified in following pages. 7RLQVHUWDSLQDQG3XVK'RZQ WKHQIROORZLQJWKHGLUHFWLRQDV WKHDUURZVKRZVWRUHPRYHWKH EDWWHU\FRYHU 5HPRWHFRQWUROOHU How to Insert the Batteries 5HPRYHWKHEDWWHU\FRYHUDFFRUGLQJWRWKHDUURZGLUHFWLRQ ,QVHUWQHZEDWWHULHVPDNLQJVXUHWKDWWKHDQGRI EDWWHU\DUHPDWFKHGFRUUHFWO\ 5HDWWDFKWKHFRYHUE\VOLGLQJLWEDFNLQWRSRVLWLRQ Note: Use 2 LR03 AAA(1.5volt) batteries. Do not use rechargeable batteries. Replace batteries with new ones of becomes dim. 2 6 ON OFF 16~30 4 2 1 16 30 7 3 Operation instructions Airflow direction control ON OFF Airflow direction control Vertical & Horizontal airflow is automatically adjusted to a certain angle in accordance with the operation mode after turning on the unit. Operation mode Direction of airflow COOLING, DRY Vertical & Horizontal The direction of airflow can be also adjusted to your own requirement by pressing the "Swing - Up/Down & L/R" button of the remote controller. 6 6 7 *Heating mode is only available for heat pump models. 7 Vertical airflow control (with the remote controller) Using remote controller to set various angles of flow or specific angle as you like. Swinging airflow Pressing “Swing - Up/Down “ button once, Horizontal louver will swing up and down automatically. 6 Desired direction airflow Pressing the “Swing - Up/Down “ button again when the louvers swing to a suitable angle as desired.Default position is applicable after power resume. Horizontal airflow control (with the remote controller) Using remote controller to set various angles of flow or specific angle as you like. Swinging airflow Pressing “Swing L/R“ button once, Vertical louver will swing up and down automatically. 7 Desired direction airflow Pressing the “Swing L/R“ button again when the louvers swing to a suitable angle as desired.Default position is applicable after power resume. Swing L/R" button in the remote control shall not function for 1.0 T 3D Cool Climate Control. For horizontal air flow, adjust manually Do not turn the vertical adjustment louvers manually, otherwise malfunction may occur. If that happens, turn off the unit first and cut off the power supply, then restore power supply again. It is better not to let the vertical adjustment louver tilt downward for a long time at COOLING or DRY mode to prevent condensed water from dripping. 8 ON OFF Room temperature decrease by 1.5℃ after operate for 3 minutes 1 2 3 Note: Temperature, airflow and direction are controlled automatically in 6th sense mode. However, For the on/off, you can choose from -2 to 2, for the inverter you can choose from -7 to 7. if you still feel uncomfortable. Around U button 9 Operating Instructions 7LPHUPRGH 7LPHU0RGH7KLVPRGHDOORZV\RXWRVZLWFKDLUFRQGLWLRQHURQRIIDIWHUDFHUWDLQDPRXQW RIWLPHWKDWKDVEHHQVHW +RZWRVHW7,0(521 7,0(521EXWWRQFDQEHXVHGWRVHWWKHWLPHUSURJUDPPLQJDVZLVKHGLQRUGHUWR VZLWFKRQWKHDSSOLDQFHDW\RXUGHVLUHGWLPH L3UHVV7,0(521EXWWRQ21IODVKHVRQWKH/&'WKHQ\RX FDQSUHVVWKH DSSOLDQFHRQ RU EXWWRQVWRVHOHFW\RXUGHVLUHGWLPHIRU ,QFUHDVH 1 'HFUHDVH 3UHVVWKH EXWWRQRQFHWRLQFUHDVHRUGHFUHDVHWKHWLPHVHWWLQJE\PLQXWH EXWWRQRQHDQGDKDOIVHFRQGVWRLQFUHDVHRUGHFUHDVHWKHWLPH 3UHVVWKH VHWWLQJE\PLQXWH 3UHVVWKH EXWWRQIRUDORQJHUWLPHWRLQFUHDVHRUGHFUHDVHWKHWLPHE\KRXU Note: If you don't set the time in 10 seconds after you press TIMER ON button, the remote controller will exit the TIMER ON mode automatically. LL:KHQ\RXUGHVLUHGWLPHGLVSOD\HGRQ/&'SUHVVWKH7,0(521EXWWRQDQGFRQILUPLW A "beep" can be heard. "ON" stops flashing. The TIMER indicator on the indoor unit lights up. LL,$IWHUWKHVHWWLPHUGLVSOD\HGIRUVHFRQGVWKHFORFNZLOOEHGLVSOD\HGRQWKH/&' RIWKHUHPRWHFRQWUROOHULQVWHDGRIVHWWLPHU +RZWRFDQFHO7,0(521 7,0(52))FDQEHXVHGWRVZLWFKRIIWKHDSSOLDQFHDXWRPDWLFDOO\DW\RXUGHVLUHGWLPH Note: 3UHVVWKH7,0(521EXWWRQDJDLQD³EHHS´FDQEHKHDUGDQGWKHLQGLFDWRUGLVDSSHDUV the TIMER ON mode has been canceled. 10 Climate Control Feature 6XPPHUFKLOO Usage: SUMMER CHILL is best suited for peak summer conditions. SUMMER CHILL operation sets the Air Conditioner automatically at lowest set temperature that resultsin fastest temperature pull down. The indoor room temperature starts reducing immediately as the machine operates at the highest fan speed. Operation: Enable: To engage this function press the SUMMER CHILL button on the remote. You can only change the air flow direction and the timer settings in this mode. Disable: To disengage press SUMMER CHILL , the display will automatically return to the original settings. Note: *The Air Conditioner will continue working in Summer Chill mode, if you do not disable the mode using the above step. ** Under SUMMER CHILL mode preset parameters cannot be change. 0RQVRRQIUHVK Usage: MONSOON FRESH is suitable for high humid condition, when the moisture content in the air inside the room creates major discomfort. MONSOON FRESH operation sets the Air Conditioner automatically at preset suitable set temperature and fan speed that helps to remove the excess moisture content from the indoor atmosphere at a faster rate, to bring in quick comfort inside the room. Operation: Enable: To engage this function press the MONSOON FRESH button on the remote. You can only change the air flow direction and the timer settings in this mode. Disable: To disengage press MONSOON FRESH , the display will automatically return to the original settings. Note: *The Air Conditioner will continue working in MONSOON FRESH mode, if you do not disable the mode using the above step. ON ** Under MONSOON FRESH mode preset parameters cannot be change. OFF 6SULQJFRRO Usage: SPRING COOL is suitable for non-peak summer when the indoor room temperature is neither too hot nor too humid. SPRING COOL operation sets the Air Conditioner automatically at preset suitable set temperature and fan speed that provides immediate mild cooling for best comfort. Operation: Enable: To engage this function press the SPRING COOL button on the remote. You can only change the air flow direction and the timer settings in this mode. Disable: To disengage press SPRING COOL, the display will automatically return to the original settings. Note: *The Air Conditioner will continue working in SPRING COOL mode, if you do not disable the mode using the above step. ** Under SPRING COOL mode preset parameters cannot be change. 11 4 1 2 3 Climate Control Feature 6LOHQWVOHHS 4 Usage: SILENT SLEEP can be operated in COOLING or DRYING mode operation. SILENT SLEEP operation provides a comfortable indoor room condition with lowest noise for comfortable sleep. Operation: Enable: To engage this function press the SILENT SLEEP button on the remote. Fan speed automatically sets at a low speed. Set temperature will rise by 1 degree C, If the Air Conditioner operates continuously in cooling mode for 1 hours constantly, then remains steady. The Air Conditioner will stop operation automatically after 8 hours of running. Disable: To disengage press SILENT SLEEP The Air Conditioner will stop operation automatically after 8 hours of running. Note: In cooling mode, if room temperature is 26 degree C or above, set temperature will not change. Functions available in different modes Cool Mode Dry Mode Fan Mode th 6 Sense Summer Chill Power Saver Monsoon Fresh Spring Cool Temp. Control Fan Speed √ √ x √ x x x x √ x √ x x x x x Timer √ √ √ √ √ √ √ √ 12 Silent Sleep √ √ x √ x √ x x Swing √ √ √ √ √ √ √ √ Maintenance )URQWSDQHOPDLQWHQDQFH $LUILOWHUPDLQWHQDQFH &XWRIIWKHSRZHUVXSSO\ ,WLVQHFHVVDU\WRFOHDQWKHDLUILOWHU DIWHUXVLQJLWIRUDERXWKRXUV 7XUQRIIWKHDSSOLDQFH ILUVWEHIRUHGLVFRQQHFWLQJ IURPSRZHUVXSSO\ &OHDQLWDVIROORZV D +ROGSRVLWLRQDDQG SXOORXWZDUGWRUHPRYHWKH IURQWSDQHO 6ZLWFKRIIWKHDSSOLDQFHDQGUHPRYH WKHDLUILOWHU D 2SHQWKHIURQWSDQHO 3UHVVWKHKDQGOHRIWKHILOWHUJHQWO\ IURPWKHIURQW *UDVSWKHKDQGOHDQGVOLGHRXWWKHILOWHU 8VHOXNHZDUPZDWHU EHORZćWRFOHDQ LIWKHDSSOLDQFH LVYHU\GLUW\ :LSHZLWKDVRIW DQGGU\FORWK 8VHDGU\DQG VRIWFORWKWR FOHDQLW 1HYHUXVHYRODWLOHVXEVWDQFH VXFKDVJDVROLQHRUSROLVKLQJ SRZGHUWRFOHDQWKHDSSOLDQFH &OHDQDQGUHLQVWDOOWKHDLUILOWHU ,IWKHILOWHULVGLUW\ ZDVKLWZLWKDVROXWLRQRI GHWHUJHQWLQOXNHZDUPZDWHU $IWHUFOHDQLQJGU\ZHOOLQ VKDGH 1HYHUVSULQNOHZDWHURQWRWKH LQGRRUXQLW 'DQJHURXV (OHFWULF VKRFN &ORVHWKHIURQWSDQHODJDLQ 5HLQVWDOODQGVKXWWKHIURQWSDQHO 5HLQVWDOODQGVKXWWKHIURQWSDQHOE\ SUHVVLQJSRVLWLRQEGRZQZDUG E E Clean the air filter every two weeks if the air conditioner operates in an extremely dusty environment. 13 16 14 Troubleshooting The following cases may not always be a malfunction, please check it before asking for service. 7URXEOH $QDO\VLV ,sWKHSURWHFWRUWULSRUIXVHLVEORZQ? 3OHDVHZDLWIRUPLQXWHVDQGVWDUWDJDLQ SURWHFWRUGHYLFHPD\EHSUHYHQWLQJXQLWfromZRUNing? 'RHVQRWUXQ Are theEDWWHULHVLQWKHUHPRWHFRQWUROOHUH[KDXVWHG? ,s WKHSOXJLVQRWSURSHUO\SOXJJHG? ,VWKHLQWHUQDOXQLWDLUILOWHUGLUW\" 1RFRROLQJRU KHDWLQJDLU $UHWKHYHQWVRIWKHH[WHUQDOXQLWEORFNHG" ,VWKHLQSXWYROWDJHOHVVWKDQ9" ,VWKHWHPSHUDWXUHVHWSURSHUO\" ,QHIIHFWLYHFRQWURO /DJLQWKH FRPSUHVVRUZRUNLQJ GRQ WUXQ 3HFXOLDURGRU $VRXQGRI IORZLQJZDWHU &UDFNLQJVRXQGLV KHDUG 6SUD\PLVWIURP WKHRXWOHW &KHFNLIWKHEDWWHULHVLQWKHUHPRWHFRQWUROOHUDUH QRWH[KDXVWHG &KHFNLIWKHEDWWHULHVLQWKHUHPRWHFRQWUROOHUDUH QRWH[KDXVWHG &KDQJLQJPRGHGXULQJRSHUDWLRQZLOOOHDGWR PLQXWHVGHOD\ 7KLVRGRUPD\FRPHIURPDQRWKHUVRXUFH VXFKDVIXUQLWXUHFLJDUHWWHHWFZKLFKLV VXFNHGLQWKHXQLWDQGEORZnRXWZLWKWKHDLU &DXVHGE\WKHIORZRIUHIULJHUDQWLQWKH DLUFRQGLWLRQHUQRWDLVVXH 15 7KHVRXQGPD\EHJHQHUDWHGE\WKHH[SDQVLRQ RUFRQWUDFWLRQRIWKHIURQWSDQHOGXHWRFKDQJH RIWHPSHUDWXUH 0LVWDSSHDUVZKHQWKHURRPDLUEHFRPHV YHU\FROGEHFDXVHRIFRRODLUGLVFKDUJHG IURPLQGRRUXQLWGXULQJ&22/,1*RU'5< RSHUDWLRQPRGH Troubleshooting chart )DXOW 6\PSWRPV 6XSSO\$LULVFROGEXW URRPLVQRWFRROHG 3UREDEOHFDXVH 7URXEOH3RLQW ([FHVVLYH&RROLQJORDG 5HPHG\ 5RRPLVWRRODUJHIRUFKRRVHQFDSDFLW\ 5HFDOFXODWHWKHFRROLQJORDG 'LUHFW6XQOLJKWHQWHUVWKHURRPEHLQJ 'RQRWLQVDWDOODLUFRQGLWLRQHUQHDUKHDWHU FRROHG DQGRWKHUVRXUFHV 'RRUVDUHRSHQHGDQGFORVHGIUHTXHQWO\RU URRPFRQWDLQWRRPDQ\SHUVRQV +HDWVRXUFHVVXFKDVKHDWHUVDQGFRRNLQJ VWRYHVHWFDUHSUHVHQWV 8QVXLWDEOHLQVWDOODWLRQORFDWLRQ &KHFNLIURRPDLUFRQGLWLRQHULVLQVWDOOHGLQ &KDQJHLQVWDOODWLRQORFDWLRQ 5HPRYHDQ\REVWUXFWLQJREMHFW FRUQHU &KHFNIRUDQ\REVWUXFWLQJREMHFWLQIURQWRI URRPDLUFRQGLWLRQHU /(66&22/,1* ,QVXIILFLHQWDLUIORZ 'XVWDFFXPXODWHVLQWKHDLUILOWHU :DVKRXWWKHGXVWRQWKHDLUILOWHU 'XVWDGKHUHVWRILQVZKLFKFDXVHVOHVVDLU &OHDQWKHILQVZLWKEUXVDQGZDWHU &KHFNHDFKVHFWLRQZLWKKDORJHQJDVOHDN IORZ &RPSUHVVRULVRSHUDWLQJ 'HIHFWLYHUHIULJHUDWLQJF\FOH EXWVXSSO\DLULVQRW 5HIULJHUDQWOHDNDJHIURPWKHEUD]HG VHFWLRQLQSLSLQJ GHWHFWRUDQGUHSDLULWLPPHGLDWHO\ZKHQD FRROHGVXIILFLHQWO\ OHDNLQJVHFWLRQLVGHWHFWHG DPELHQWFRQGLWLRQ FRPSUHVVRUEHFRPHVRYHUORDGHGDQG FKHFNIRUGLUHFWVXQOLJKWRQDLUFRQGLWLRQHU XVHVWDELOL]HUVIRUUHJXODWHGSRZHUVXSSO\ FKHFNIRUDQ\VXQOLJKWRQDLUFRQGLWLRQHU UHSODFHWKHGHIHFWLYHFDSDFLWRU UHSDLUUHIULJHUDWLQJF\FOHDQGRYHUORDG VWRSVZLWKWKHDFWXDWLRQRIRYHUORDGUHOD\ FRPSUHVVRUVWRSVVRRQ DIWHUVWDUWLQJ YDULDWLRQRISRZHUVRXUVHYROWDJHDQG SRZHUVRXUVHFDSDFLW\ VXSSO\YROWDJHLVQRWLQUDQJHRIRI UDWHG DPELHQWFRQGLWLRQ FRPSUHVVRUUXQQLQJFDSDFLWRUEHFRPHV FRPSUHVVRUEHFRPHVRYHUORDGHGDQG VWRSVZLWKWKHDFWXDWLRQRIRYHUORDGUHOD\ SRRURUGLVFRQQHFWHG FKHFNHOHFWULFDOZLUHDQGFRPSUHVVRU UXQQLQJFDSDFLWRUZLWKFDSDFLWRU GHIHFWLYHUHIULJHUDWLQJF\FOHDQGRYHUORDG PHDVXUHWKHYROWDJHDQGFXUUHQW DERQRUPDOLW\ GHIHFWLYHFRPSUHVVRU FKHFNFRPSUHVVRUZLQGLQJUHVLVWDQFHDQG UHOD\ UHSODFHDQ\GHIHFWLYHFRPSUHVVRU UHSODFHDQ\SOXJRUSDUWZLWKSRRUFRQWDFW FRPSDUHZLWKVSHFLILFDWLRQ )DQPRWRUGRHVQRWUXQ SRRUFRQWDFWRISOXJEURNHQZLUH VZLWFKHVWKHUPLVWRU PHDVXUHWKHFRQWLQXLW\RIFRUGRUYROWDJH ZLWKDWHVWHU IDQPRWRUIDLOXUH FKHFNWKHEURNHQFRQQHFWLRQLQIDQPRWRU RUFRUGZLWKEURNHQDULYH LWVHOIEXUQWDQGHIIHFW IDQPRWRULVUXQQLQJEXW FRPSUHVVRUGRHVQRW YDULDWLRQRISRZHUVRXUVHYROWDJHDQG SRZHUVRXUVHFDSDFLWRU VXSSO\YROWDJHLVQRWLQUDQJHRIaRI FKHFNZLWK'&PRWRUWHVWLQJMLJLIIDXOW\ UHSODFHWKH XVHVWDELOL]HUVIRUUHJXODWHGSRZHUVXSSO\ FKHFNIRUDQ\GLUHFWVXQOLJKWRQDLU UDWHG '2(6127&22/$7$// RSHUDWH DPELHQWFRQGLWLRQ FRPSUHVVRUEHFRPHVRYHUORDGHGDQG VWRSVZLWKWKHDFWXDWLRQRIRYHUORDGUHOD\ FRPSUHVVRUUXQQLQJFDSDFLWRUEHFRPHV SRRURUGLVFRQQHFWHG FRQGLWLRQHU UHSODFHWKHGHIHFWLYHFDSDFLWRU UHSDLUUHIULJHUDWLQJF\FOHDQGRYHUORDG UXQQLQJFDSDFLWRUZLWKFDSDFLWRU GHIHFWLYHUHIULJHUDQWF\FOHRURYHUORDG UHOD\ FKHFNHOHFWULFDOZLUHDQGFRPSUHVVRU PHDVXUHWKHYROWDJHDQGFXUUHQW DERQRUPDOLW\ GHIHFWLYHFRPSUHVVRU FKHFNFRPSUHVVRUZLQGLQJUHVLVWDQFHDQG UHOD\ UHSODFHDQ\GHIHFWLYHFRPSUHVVRU &KHFNHDFKVHFWLRQZLWKKDORJHQJDVOHDN FRPSDUHZLWKVSHFLILFDWLRQ FRPSUHVVRULVRSHUDWLQJ JDVOHDNDJH EXWDLULVQRWFRROHGDWDOO PHDVXUHWKHYROWDJHDQGFXUUHQW DERQRUPDOLW\ GHWHFWRUDQGUHSDLULWLPPHGLDWHO\ZKHQD OHDNLQJVHFWLRQLVGHWHFWHG FRPSUHVVRUZLWKGHIHFWLYHYDOYH FRPSUHVVRUZLWKGDPDJHGSLSLQJ FRPSUHVVRUQRLVH .QRFNLQJQRLVH UHSODFHDQ\GHIHFWLYHFRPSRQHQW REVHUYHIRUDQ\QRUPDOQRLVH UHSODFHWKHFRPSUHVVRU FKHFNIRUDQ\REMHFWDURXQGIDQ UHPRYHDQ\IRUHLJQPDWHULDOIURPWKH &KHFNWKHGHJUHHRIYLEUDWLRQDQG WDNHSURSHUPHDVXUHWRFRUUHFW 12,6( 9,%5$7,21 VXVSHQVLRQVSULQJ EORZHUIDQRUSURIDQKLWWLQJZLWKIRUHLJQ PDWHULDO 5HDVRQLQJQRLVHGXHWR YLEUDWLRQ ,QVWDOODWLRQLVQRWSURSHUDQGSDUWVRIDLU V\VWHP FRQGLWLRQHUDUHORRVHRULQWHUQDOSDUWVRI LQVWDOODWLRQZLWKDFFXUDF\ WKHFRPSUHVVRUDUHGDPDJHG :$7(5 '5,33,1* :DWHUGULSSLQJLQVLGH 7LOWHGXQLWLQVWDOODWLRQ &KHFNXQLWLQVWDOODWLRQ LIQHFHVVDU\UHLQVWDOOWKHXQLW $LUILOWHUPD\EHGLUW\RUFORJJHG &KHFNDLUILOWHU FOHDQGLUW\ILOWHU URRP 16 Installation instructions Installation diagram Distance from ceiling should be over 150 mm Distance from wall should be over 150mm Distance from the wall should be over 150mm Distance from floor should be over 6.56 feet Recommendations: I) Ensure to install ODU on sheet Metal ODU stand, tightened up with proper Nut and bolts. II) Rubber Pad shall be there below Outdoor unit legs in order to absorb the vibration of running unit. Air intake distance from the wall should be over 250mm Air intake distance from the wall should be over 250mm air sh outl ou et ld d be ista ov nce er 50 from 0m th m ew Above figure is only a simple presentation all of the unit, it may not match the external appearance of the unit you purchased. Installation must be performed in accordance with the national wiring standards by authorized personnel only. 17 over 250mm Installation instructions Select the installation location Location for Installing Indoor Unit Where there is no obstacle near the air outlet and air can be easily blown to every corner. Where piping and wall hole can be easily arranged. Keep the required space from the unit to the ceiling and wall according to the installation diagram on previous page. Where the air filter can be easily removed. Keep the unit and remote controller 1m or more apart from television, radio etc. To prevent the effects of a fluorescent lamps, keep as far as possible. Do not put anything near the air inlet to obstruct it from air absorption. Where there is strong enough to bear the weight and is not tend to increase operation noise and vibration. Do not install above the enterance i.e. Door or in front of the door. installation area should have sufficient strength and durability. IDU should not install far away from desired cooling area. Do not place any electronic equipment below the IDU unit. Ex: LCD, Computer etc. Indoor unit Pipe length is 15 meters Max. be less than 5m Height should Outdoor unit X X Location for Installing Outdoor Unit Outdoor unit Where it is convenient to install and well ventilated. Do not install ODU face to face.Avoid the installation in South and West direction. Avoid installing it where flammable gas could leak. Keep the required distance apart from the wall. The distance between Indoor and outdoor unit should be same as per provided connecting pipe and can go up to maximum 15 meters with additional refrigerant charge. Pipe length is 15 meters Max. Keep the outdoor unit away from a place of greasy dirt, vulcanization gas exit. Avoid installing it at the roadside where there is a risk of muddy water. Indoor unit A fixed base where is not subject to increasing operation noise. Where there is not any blockage for air outlet.(Don’t install in shaft) Installation area should have sufficient strength and durability. To get optimize efficiency, install under shed. Model 5K~30K Limit of Tubing Length (m) 15 Limit of Elevation Required amount of Difference H (m) additional refrigerant (g/m) 5 20 18 Installation instructions Below declared Connecting pipe length to be referred as standard length for Model Sold without Connecting Pipe. ,QGRRUXQLWLQVWDOODWLRQ Model 1.0T 1.5T 2.0T Pipe length 4 Meter 3.2Meter 4 Meter 1. Installing the Mounting Plate 'HFLGHDQLQVWDOOLQJORFDWLRQIRUWKHPRXQWLQJSODWHDFFRUGLQJWRWKHLQGRRUXQLWORFDWLRQDQGSLSLQJGLUHFWLRQ .HHSWKHPRXQWLQJSODWHKRUL]RQWDOO\ZLWKDKRUL]RQWDOUXOHURUGURSSLQJOLQH 'ULOOKROHVRIPPLQGHSWKRQWKHZDOOIRUIL[LQJWKHSODWH ,QVHUWWKHSODVWLFSOXJVWRWKHKROHIL[WKHPRXQWLQJSODWHZLWKWDSSLQJVFUHZV ,QVSHFWLIWKHPRXQWLQJSODWHLVZHOOIL[HG7KHQGULOODKROHIRUSLSLQJ /LQHGURSVIURPKHUH +RRNWKHOLQHKHUH 0RXQWLQJSODWH 'URSSLQJOLQH KROHVIRUIL[LQJ Note: The shape of your mounting plate may be different from the one above, but installation method is similar. 2. Drill a Hole for Piping 'HFLGHWKHSRVLWLRQRIKROHIRUSLSLQJDFFRUGLQJWRWKH ORFDWLRQRIPRXQWLQJSODWH 'ULOODKROHRQWKHZDOOZLWKWKHKHOSRIGULOOPDFKLQH 7KHKROHVKRXOGWLOWDOLWWOHGRZQZDUGWRZDUGRXWVLGH :DOOKROHVOHHYH KDUGSRO\WKHQHWXEH SUHSDUHGE\XVHU PP PP WLOWGRZQZDUG ,QVWDOODVOHHYHWKURXJKWKHZDOOKROHWRNHHSWKHZDOO WLG\DQGFOHDQ 3. Indoor Unit Piping Installation 3XWWKHSLSLQJOLTXLGDQGJDVSLSHDQGFDEOHVWKURXJKWKHZDOOKROHIURPRXWVLGHRUSXWWKHPWKURXJK IURPLQVLGHDIWHULQGRRUSLSLQJDQGFDEOHVFRQQHFWLRQFRPSOHWHVRDVWRFRQQHFWWRRXWGRRUXQLW &KHFNXQORDGLQJSLHFHRIILQDFFRUGDQFHZLWKWKHSLSLQJGLUHFWLRQDVVKRZQEHORZ DQGXVHWXEHEHQGHUWKHFRSSHUSLSH 3LSLQJGLUHFWLRQ WURXJK 8QORDGLQJ SLHFH 6DZWKHXQORDGLQJSLHFH RIIDORQJWKHWURXJK Note: When installing the pipe at the directions 1,2 or 4, saw the corresponding unloading piece off the indoor unit base. $IWHUFRQQHFWLQJSLSLQJDVUHTXLUHGLQVWDOOWKHGUDLQKRVH7KHQFRQQHFWWKHSRZHUFRUGV$IWHUFRQQHFWLQJ ZUDSWKHSLSLQJFRUGVDQGGUDLQKRVHWRJHWKHUZLWKWKHUPDOLQVXODWLRQPDWHULDOV ,'8VKRXOGEHPRXQWHGSHUIHFWO\RQPRXQWLQJSODWH/RFNVKRXOGEHSURSHUO\LQVHUWHG 19 Installation instructions Piping Joints Thermal Insulation: :UDSWKHSLSLQJMRLQWVZLWKWKHUPDO LQVXODWLRQPDWHULDOVDQGWKHQZUDS ZLWKDYLQ\OWDSH ZUDSSHGZLWKYLQ\OW\SH 7KHUPDOLQVXODWLRQ Piping Thermal Insulation: /DUJHSLSH D3ODFHWKHGUDLQKRVHXQGHUWKHSLSLQJ E,QVXODWLRQPDWHULDOXVHVSRO\WKHQHIRDPRYHUPPLQWKLFNQHVV 7KHUPDOLQVXODWLRQ WXEH 3RZHUFRUG Note: Drain hose is prepared by user. 'UDLQSLSHVKRXOGSRLQWGRZQZDUGIRUHDV\GUDLQIORZ 'RQRWDUUDQJHWKHGUDLQSLSHWZLVWHGVWLFNLQJRXWRUZDYH DURXQGGRQRWLPPHUVHWKHHQGRILWLQZDWHU 3RZHUFRUG IRUKHDWSXPS ,IDQH[WHQVLRQGUDLQKRVHLVFRQQHFWHGWRWKHGUDLQSLSHPDNH VXUHWRWKHUPDOLQVXODWHGZKHQSDVVLQJDORQJWKHLQGRRUXQLW 6PDOO SLSH 'UDLQKRVH SUHSDUHGE\XVHU 'HIURVWFDEOHIRUKHDWSXPS :KHQWKHSLSLQJLVGLUHFWHGWRWKHULJKWSLSLQJSRZHU &RUGDQGGUDLQSLSHVKRXOGEHWKHUPDOLQVXODWHGDQG IL[HGRQWRWKHEDFNRIWKHXQLWZLWKDSLSLQJIL[HU ,QVHUWKHUH ODUJH SLSH GUDLQ KRVH %DVH 3LSLQJIL[HU $,QVHUWWKHSLSHIL[HUWRWKHVORW ODUJH SLSH GUDLQ KRVH VPDOO SLSH 3LSLQJIL[HU %DVH VPDOO SLSH %DVH +RRNKHUH %3UHVVWRKRRNWKHSLSHIL[HURQWRWKHEDVH Piping Connection: D&RQQHFWLQGRRUXQLWSLSHVZLWKWZRIL[VSDQQHUV3D\VSHFLDODWWHQWLRQ WRWKHDOORZHGWRUTXHDVVKRZQEHORZWRSUHYHQWWKHSLSHVFRQQHFWRUV DQGIODUHQXWVIURPEHLQJGHIRUPHGDQGGDPDJHG'RQRWXVHDGMXVWDEOHZUHQFKHV E3UHWLJKWHQWKHPZLWKILQJHUVDWILUVWWKHQXVHWKHVSDQQHUV Model Pipe size Torque Nut width Min.thickness 1.0TR-2*, 3*&5* Liquid Side (1/4″) 1.8kg·m 17mm 0.6mm 1.5TR-2*, 3*&5* Liquid Side (1/4″) 1.8kg·m 17mm 0.6mm 2.0TR-4* Liquid Side (3/8″) Gas Side (1/2″) 3.5kg·m 22mm 0.6mm 5.5kg·m 24mm 0.6mm Gas Side (1/2″) 5.5kg·m 24mm 0.6mm Gas Side (5/8″) 7.5kg·m 27mm 0.6mm 1.0TR-2*, 3*&5* 1.5TR-2*, 3*&5* 2.0TR-4* 'RQRWFXWWKHSLSHLIFRQQHFWLQJSLSHUHTXLUHGLVOHVVWKDQPHWHU 5ROOIL[WKHSLSHZLWK2'8LQRUGHUWRJHWRSWLPXPSHUIRUPDQFHLQKRWVXPPHUFRQGLWLRQ 20 Installation instructions 4. Connecting of the Cable )URQWSDQHO Indoor Unit &RQQHFWWKHSRZHUFRQQHFWLQJFRUGWRWKHLQGRRUXQLW E\FRQQHFWLQJWKHZLUHVWRWKHWHUPLQDOVRQWKHFRQWURO ERDUGLQGLYLGXDOO\LQDFFRUGDQFHZLWKWKHRXWGRRUXQLW FRQQHFWLRQ Indoor unit Note: For some models, it is necessary to remove the cabinet to 7HUPLQDOLQVLGH &DELQHW &KDVVLV connect to indoor unit terminal. Outdoor Unit 5HPRYHWKHDFFHVVGRRUIURPWKHXQLWE\ORRVHQLQJ WKHVFUHZ&RQQHFWWKHZLUHVWRWKHWHUPLQDOVRQWKH FRQWUROERDUGLQGLYLGXDOO\DVWKHIROORZLQJ 6HFXUHWKHSRZHUFRQQHFWLQJFRUGRQWRWKHFRQWURO ERDUGZLWKFDEOHFODPS 5HLQVWDOOWKHDFFHVVGRRUWRWKHRULJLQDOSRVLWLRQ $FFHVVGRRU 7HUPLQDOLQVLGH Outdoor unit ZLWKWKHVFUHZ 4) 8VHDUHFRJQL]HGFLUFXLWEUHDNHUIRU.PRGHOEHWZHHQ 7KHSRZHUVRXUFHDQGWKHXQLW$GLVFRQQHFWLRQGHYLFHWR $GHTXDWHO\GLVFRQQHFWDOOVXSSO\OLQHPXVWEHILWWHG The figures in this manual are based on the external view of a standard model. Consequently, the shape may differ from that of the air conditioner you have selected. Caution: 1. Never fail to have an individual power circuit specifically for the air conditioner. As for the method of wiring, refer to the circuit diagram posted on the inside of the access door . 2.Comfirm that the cable thickness is as specified in the power source specification. 3.Check the wires and make sure that they are all tightly fastened after cable connection. 4. Be sure to install an earth leakage circuit breaker in wet or moist area. Cable Specifications Capacity (Btu/h) Power Cord Normal Type cross-sectional area N +99) PP; N +99) PP; N +99)599 PP; Power connecting cord Normal Type cross-sectional area 7RLQGRRU 7RLQGRRU 7RLQGRRU H05RN-F PP; +51) PP; +51) PP; 21 Main power supply(Note) Installation instructions Wiring Diagram Make sure that the color of wires of the outdoor unit and the terminal No. are the same as those of the indoor unit. 12K,18K,24K Model For above models, the power supply are connected from indoor unit. COOLING ONLY Indoor unit Outdoor unit Terminal 1L N Terminal Brown Brown Blue Blue 1L N Power connecting cord Yellow/Green Yellow/Green 22 Installation instructions Outdoor unit installation 1.Install Drain Port and Drain Hose (for heat-pump model only) The condensate drains from the outdoor unit when the unit operates in heating mode. In order not to disturb your neighbor and protect the environment, install a drain port and a drain hose to direct the condensate water. Just install the drain port and rubber washer to the chassis of the outdoor unit, then connect a drain hose to the port as the right figure shown. Washer Drain port 2. Install and Fix Outdoor Unit Drain hose (prepare by user) Use rubber pad to fix with bolts and nuts tightly on a flat and strong floor.If installed on the wall or roof, make sure to fix the mounting stand and rubber pad well to prevent it from shaking due to serious vibration or strong wind. 3. Outdoor Unit Piping Connection Remove the valve caps from the 2-way and 3-way valve. Connect the pipes to the 2-way and 3-way valves separately according to the required torque. 4. Outdoor Unit Cable Connection (see previous page) Leak Test/Evacuation/Gas Charging The air which contains moisture remaining in the refrigeration cycle may cause a malfunction on the compressor. After connecting the indoor and outdoor units, evacuate air and moisture from refrigerant cycle using a vacuum pump, as shown below. Note: To protect the environment, be sure not to discharge the refrigerant to the air directly. See next page for air purging steps. Vacuum pump indoor unit Refrigerant flow direction 2-way valve 3-way valve diagram 3-way valve connect to indoor unit (6) Open 1/4 turn Service port (7) Turn to fully open the valve open position spindle (1) Turn (8) Tighten (1) Turn (2) Turn (8) Tighten (7) Turn to fully open the valve valve cap needle Valve cap (8) Tighten Connect to outdoor unit Valve core 23 service port cap Installation instructions How to Purge Air Tubes: 1. Connect IDU & ODU connecting piping. 2. Connect the Manifold Gauge & Vaccum Pump to the charging valve. 3. Do the system evacuate atleast for 30 minutes with two stage vaccum pump when reaching a vaccum of 10mm Hg absolutes, switch off the pump & hold the vaccum for 5 minutes and check if the vaccume is breaking or not. 4. If vaccum breaks, then there is a leakage in system. 5. Rectify the leakage and do the vaccum again(Follow repeat of process) 6.If no vaccum breakage, open the spindles of 2-way & 3-way valves. Then again check leakage with soap suds Notes To guarantee the unit working normally, please read the manual carefully before installation, and try to install strictly according to this manual. Do not let air enter the refrigeration system or discharge refrigerant when moving the air conditioner. Earth the air conditioner properly. Check the connecting cables and pipes carefully, make sure they are correct and firm before connecting the power of the air conditioner. There must be an air-break switch. After installing, the consumer must operate the air conditioner correctly according to this manual, keep a suitable storage for maintenance and move of the air conditioner in the future. Type of fuse used on indoor unit controller is Φ5×20, with rating 2.5A/250V or 3.15A/250V. . Caution: Mount with the lowest moving parts of indoor unit at Least 2.4m above floor or grade Level. Warning: Risk of electric shock can cause injury or death: Disconnect all Remote electric power supplies before servicing . The maximum length of the connecting pipe between the indoor unit and outdoor unit should be less than 5 meters. It will affect the efficiency of the air conditioner if the distance longer than that length. If the supply cord is damaged, it must be replaced by the manufacturer, its service agent or similarly qualified persons in order to avoid a hazard. The appliance shall be installed in accordance with national wiring . 24 Warranty term A RELATIONSHIP FOR LIFE WITH 5 YEARS WARRANTY :KLUOSRRORI,QGLD/WG:2,/RIIHUVWKHRULJLQDOSXUFKDVHU KHUHLQDIWHU UHIHUUHG WR DV ³WKH FXVWRPHU´ RI WKH Whirlpool Air ConditionerWKHEHQHILWRID <HDUV:DUUDQW\DVGHWDLOHG EHORZ SURYLGHG WKH DLU FRQGLWLRQHU LV LQ WKHSRVVHVVLRQ RI DQG XVHG E\ WKH &XVWRPHUGXULQJ \HDUWHUP RI WKH ZDUUDQW\ IURP WKH GDWH RISXUFKDVHDVSURYLGHGLQRULJLQDOLQYRLFH L2QH<HDU:DUUDQW\ 8QGHU WKH ZDUUDQW\ WKH FXVWRPHU LV ZDUUDQWHG WKDW WKH DLU FRQGLWLRQHU DQG DOO SDUWV WKHUHRI H[FHSW WKH IURQW JULOO NQREV DQG SODVWLF SDUWV DUH IUHH IURP GHIHFWV LQ PDWHULDODQGZRUNPDQVKLSXQGHUQRUPDOXVHDQGVHUYLFH:2,/ VREOLJDWLRQVXQGHU WKLV:DUUDQW\VKDOOEHOLPLWHGWRUHSDLULQJRUSURYLGLQJWKHUHSODFHPHQWRIDQ\GHIHFWLYH SDUW H[FHSW WKH IURQW JULOO NQREV DQG SODVWLF SDUWV RI DLU FRQGLWLRQHU ZKLFK SURYHV GHIHFWLYH ZLWKLQ RQH \HDU IURP WKH GDWH RI RULJLQDO SXUFKDVH DQG ZKLFK RQ:2,/ V H[DPLQDWLRQGLVFORVHVWRLWVVDWLVIDFWLRQWREHGHIHFWLYH LL)RXU<HDU$GGLWLRQDO:DUUDQW\RQ&RPSUHVVRU 8QGHU WKH ZDUUDQW\ WKH FXVWRPHU LV ZDUUDQWHG WKDW WKH FRPSUHVVRU WR EH IUHH IURP GHIHFWV LQ PDWHULDO DQG ZRUNPDQVKLS XQGHU QRUPDO XVH DQG VHUYLFH :2,/ V REOLJDWLRQ XQGHU WKLV ZDUUDQW\ VKDOO EH OLPLWHG WR UHSDLULQJ RU SURYLGLQJ WKH UHSODFHPHQWRIFRPSUHVVRUZLWKDQRWKHULQZRUNLQJFRQGLWLRQZKLFKSURYHVGHIHFWLYH ZLWKLQ )RXU<HDUVFRPPHQFLQJLPPHGLDWHO\DIWHUWKHH[SLU\RIWKHGDWHRISXUFKDVH DQGZKLFKRQ:2,/ VH[DPLQDWLRQGLVFORVHVWRLWVVDWLVIDFWLRQWREHGHIHFWLYH7KLV ZDUUDQW\ FRYHUV WKH FRPSUHVVRU RQO\ ,W GRHV QRW FRYHU DQ\ RWKHU SDUW VXFK DV UXQQLQJ FDSDFLWRU WKHUPRVWDW UHIULJHUDQW FRQVXPDEOHV VXFK DV *DV FKDUJLQJ 7KH FRVWRIUHSODFHGSDUWVDQGFRQVXPDEOHVVKDOOEHERUQHE\WKHFXVWRPHU1RQRWLFHRI H[SLU\SHULRGRIZDUUDQW\ZLOOEHJLYHQE\:2,/ /LPLWDWLRQVRI:DUUDQW\ 7KLV:DUUDQW\VKDOOQRWDSSO\WRGHIHFWVDULVLQJLQ:2,/ VRSLQLRQE\UHDVRQVRI DFFLGHQW DOWHUDWLRQ DEXVH PLVXVH QHJOHFW LPSURSHU LQVWDOODWLRQ XQDXWKRUL]HG UHSDLUVRUUHSODFHPHQWRIRULJLQDOSDUWVILUHIORRGRURWKHU DFWVRI*RG&KDUJHV IRUUHSDLURIWKLVQDWXUHLIFDUULHGRXWZLOOKDYHWREHERUQHE\WKHFXVWRPHU 25 Warranty term 7KLV:DUUDQW\KROGVJRRGRQO\VRORQJDVWKHUHLVFRUUHFWXVHDQGPDLQWHQDQFHRI WKHDLUFRQGLWLRQHUDVGHWDLOHGLQWKH8VHUDQG&DUHJXLGH 7KLV:DUUDQW\ZLOOFRQWLQXHWREHLQIRUFHIRUWKHWHUPKHUHLQVSHFLILHGLUUHVSHFWLYH RIZKDWUHSODFHPHQWVPD\EHSURYLGHGXQGHULWDQG6XFKUHSODFHPHQWLQFOXGLQJRQ FRPSUHVVRUVKDOOQRWDWWUDFWDQ\IUHVK:DUUDQW\ 7KLV :DUUDQW\ LV YDOLG DQG ELQGLQJ SURYLGHG WKDW QR VHUYLFH RU UHSDLU KDV EHHQ DWWHPSWHG RU HIIHFWHG E\ DQ\RQH RWKHU WKDQ WKH $XWKRUL]HG 6HUYLFH )UDQFKLVHH DQG WKDWLPPHGLDWHQRWLILFDWLRQRIDQ\DOOHJHGGHIHFW LVJLYHQWR:2,/RUWKH$XWKRUL]HG 6HUYLFH)UDQFKLVHH 7KLV:DUUDQW\ZLOOFHDVHWREHDSSOLFDEOHWRGHIHFWVDULVLQJRXWRISXOOHGRXWSRZHU FDUGEORZQIXVHRULPSURSHUHOHFWULFDOFLUFXLWZKLFKUHVXOWLQQRQRSHUDWLRQRIWKHDLU FRQGLWLRQHU :2,/ V HPSOR\HHV RU GHDOHUV DQG RU $XWKRUL]HG 6HUYLFH )UDQFKLVHH KDYH QR DXWKRULW\WRYDU\WKHWHUPVRIWKLV:DUUDQW\ D7KH2QH<HDU:DUUDQW\ZLOODXWRPDWLFDOO\WHUPLQDWHRQWKHH[SLU\RIWKH:DUUDQW\ SHULRG RI WZHOYH PRQWKV IURP GDWH RI SXUFKDVH DV SHU LQYRLFH HYHQ LI WKH DLU FRQGLWLRQHUPD\QRWEHLQXVHIRUDQ\WLPHGXULQJWKH:DUUDQW\SHULRGIRUDQ\UHDVRQ ZKDWVRHYHU LQFOXGLQJ DQ\ WHFKQLFDO EUHDNGRZQV DQG WKH WLPH WRNHQ IRU VXFK UHSDLUVUHSODFHPHQWV RI SDUWV DQG WUDQVLW ZKHWKHU XQGHU WKLV :DUUDQW\ RU RWKHUZLVH VKDOOQRWEHH[FOXGHGIURPWKH:DUUDQW\SHULRG E 7KH :DUUDQW\ RQ FRPSUHVVRU ZLOO DXWRPDWLFDOO\ WHUPLQDWH RQ WKH H[SLU\ RI )RXU <HDUVHYHQLIWKHDLUFRQGLWLRQHUPD\QRWEHLQXVHIRUDQ\UHDVRQZKDWVRHYHU D :KLOH :2,/ ZLOO PDNH HYHU\ HIIRUW WR FDUU\ RXW UHSDLUVUHSODFHPHQWV RI SDUWV XQGHUWKLV:DUUDQW\DVVRRQDVSRVVLEOHLWLVH[SUHVVO\PDGHFOHDUWKDW:2,/VKDOO QRWEHOLDEOHWRGRVRZLWKLQDQ\VSHFLILHGSHULRGRIWLPH E,QWKHHYHQWRIDWUHSDLUVUHSODFHPHQWVRIDQ\SDUWVWKLV:DUUDQW\ZLOOWKHUHDIWHU FRQWLQXHWRUHPDLQLQIRUFHRQO\IRUWKHXQH[SLUHGSHULRGRIWKH:DUUDQW\ ,WLVHQWLUHO\OHIWWR:2,/ VGLVFUHWLRQWRHIIHFWUHSDLUVUHSODFHPHQWVRISDUWVDWWKLV VLWHRILQVWDOODWLRQRUDWDQ\VHUYLFHVWDWLRQRILWV%UDQFKHVRURILWV$XWKRUL]HG6HUYLFH )UDQFKLVHH 7KH :DUUDQW\ ZLOO VWDQG YRLG LI DLU FRQGLWLRQHU LV LQVWDOOHG VHUYLFHG RSHQHG WDPSHUHGUHSDLUHGHWFE\DQ\XQDXWKRUL]HGSHUVRQ 26 Warranty term :2,/ZLOOQRWEHUHVSRQVLEOHIRUFRROLQJDQGFRQGHQVHUFRLOLIWKHDLUFRQGLWLRQHU LV LQVWDOOHG QHDU WKH PXGG\ VHZDJHVDV WR[LF JDVHV DUH KDUPIXO IRU WKH $LU &RQGLWLRQHU :2,/DEVROYHVDOOOLDELOLW\LQFDVHZKHUHWKHIROORZLQJVLWXDWLRQVDUHIRXQGE\WKH VHUYLFHHQJLQHHUGXULQJWKHLUYLVLWVWRFXVWRPHUSUHPLVHVRQVHUYLFHFDOO D)DXOW\6XEVWDQGDUGZLULQJXVHG E'HIHFWLYH6WDELOL]HU F'LUW\)LOWHU G3DUWVGDPDJHGGXHWR5DWELWLQJ ,QFDVHVWKHDERYHFRQGLWLRQVDUHREVHUYHGDWWKHWLPHRIYLVLWE\WKH(QJLQHHUWKHQ WKHFXVWRPHUVKDOOEHOLDEOHWREHDUWKHYLVLWFKDUJHVRI56RYHUDQGDERYHWKH RWKHUUHSDLUFKDUJHVLQFXUUHGGXULQJWKHSURFHVV 7KH&RPSDQ\UHVHUYHVWKHULJKWWRUHYLVHWKHYLVLWFKDUJHVDWLWVRZQGLVFUHWLRQDQG WKHFXVWRPHUZLOOEHOLDEOHWRSD\WKHUHYLVHGYLVLWFKDUJHVDVPD\EHDSSOLFDEOHRQ WKHGDWHRIYLVLW 7KH FXVWRPHU DW DOO WLPHV VKDOO SUHVHUYH WKH RULJLQDO LQYRLFH IRU QHFHVVDU\ YHULILFDWLRQDQGSURGXFHDVDQGZKHQUHTXLUHGE\:2,/ :2,/UHVHUYHVWKHULJKWWRDOWHUWKHWHUPVDQGFRQGLWLRQVRIWKHSUHVHQWZDUUDQW\DW DQ\WLPHZLWKLWVVROHGLVFUHWLRQZLWKRXWDQ\SULRUQRWLFH 15. "Whirlpool Products without barcode label affixed on the product will not be covered under warranty." 27 28 :KLUOSRRORI,QGLD/WG &XVWRPHU&RS\ ,QVWDOODWLRQ'HPR&KHFN6KHHW$LUFRQGLWLRQHU &XVWRPHU0DFKLQHGHWDLOV 'DWHRI,QVSHFWLRQ %UDQFK &XVWRPHU1DPH$GGUHVV 631DPH 0RGHO1R 'DWHRI3XUFKDVH'23 0DFKLQH6UQR 3KRQHQR ,'86U1R 0RELOH1R 2'86U1R 3XUFKDVHGIURP'HDOHU1DPH ,QVWDOOHG%\,QVWDOOHU V1DPH 66'730RGHUQ7UDGH,QVWLWXWLRQDOVDOH2WKHUV 66'7363/RFDO ,'8/RFDWLRQ 2N1RW2N 2'8ORFDWLRQ ,'8OHYHO&KHFNZLWK6SULWOHYHO 2N1RW2N /HQJWKRI&RSSHUSLSH 'UDLQ3LSHVORSH 2N1RW2N 'LVWDQFH%HWZHHQ,'82'8 ,QVWDOODWLRQ&RQGLWLRQV6$& 2N1RW2N (OHFWULFDO2WKHUGHWDLO &RQGLWLRQRI+RXVH:LULQJ $PS6WDELOL]HU 0&%5DWLQJ <HV1R 0DNH (DUWKLQJFRQGLWLRQV ,I9ROWDJHEHWZHHQ(1LV9$GYLVH &XVWRPHUWRFRQVXOWDQHOHFWULFLDQ 6WDELOL]HU,QSXW 9ROWV 6WDELOL]HU2XWSXW 9ROWV $PSHUV'UDZQ 3(5)250$1&(5810$&+,1()250,187(6 &+(&.7+()2//2:,1* $PELHQW7HPSR& 'HOWD7 77VKRXOGEHDSSUR[7RR& $LU,QOHW7HPSR&7 *ULOO7HPSR&7 )HDWXUHV([SODQDWLRQV &RROPRGH <HV1R 'LPIXQFWLRQ <HV1R 'U\0RGH <HV1R $URXQG8 <HV1R )DQ0RGH <HV1R <HV1R 7XUER4XLFN&RRO <HV1R )LOWHU&OHDQLQJPHWKRG 5HVHWWLQJ)LOWHU FOHDQLQJ/(' 6OHHSPRGH <HV1R 3RZHU6DYHU <HV1R 6ZLQJ <HV1R WK6HQVH <HV1R 7LPHUVHWWLQJ <HV1R 7HPSHUDWXUHVHWWLQJ <HV1R <HV1R *ULOODQG3ODVWLFSDUWVEH\RQGGD\VIURPWKH'DWHRI3XUFKDVHDUHQRWFRYHUGXQGHUZDUUDQW\ 1RWH0DQXIDFWXUHUDEVROYHDOOOLDELOLW\LIIROORZLQJVLWXDWLRQVDUHREVHUYHGE\6HUYLFH(QJLQHHU $)DXOW\6XE6WDQGDUG:LULQJ &6WDELOL]HU1:3/'HIHFWLYH %)LOWHUFOHDQLQJ '5H'HPR ,QFDVHDERYHVLWXDWLRQVDUHQRWLFHGE\6HUYLFH(QJLQHHU:LWKLQ<UIURP'239LVLWFKDUJHVRI5VZLOOEHSD\DEOHE\ WKHFXVWRPHURYHUDQGDERYHWKHWKHRWKHUUHSDLULQJFKDUJHVLIDSSOLFDEOHLQFXUUHGGXULQJWKHSURFHVV 1DPH6LJQRI(QJLQHHU 29 &XVWRPHUV6LJQDWXUH ,KDYHXQGHUVWRRGDOOWKHZDUUDQW\WHUPV Installation commissioning 813$&.,1* 6UQR &KHFNSRLQWV 0DFKLQHFKHFNHGIRUGDPDJHV'DPDJHVREVHUYHG 2EVHUYDWLRQV <HV1R 5HPDUNV ,I\HVSURYLGHGHWDLOV 5HPRYHKDQGXQLWIURP,'8 <HV1R 5HPRYH)LEUHWDSHVIURPWKHIURQWFRYHU <HV1R ,VWKHVWUHQJWKRILQVWDOODWLRQHQRXJKERWK,'82'8 'LUHFWLRQRIFRQGHQVRURIPDFKLQHLVWRZDUGV 7KHXQLWLVVHFXUHGIL[HGZLWKKDQJHUSODWH <HV1R 1RUWK6RXWK:HVW(DVW <HV1R <HV1R <HV1R <HV1R <HV1R %UHGWKZLVHOHYHO'HSWKZLVHLQFOLQDWLRQRIURRPDLUFRQGLWLRQHUDUHQRUPDO DQGQRDLUORFNVLVLQWKHGUDLQSLSH 7KHKHDWLQVXODWLYHPDWHULDOLVVHFXUHO\DWWDFKHGRQWKHFRQQHFWLRQVRIWKH SLSLQJVRIWKH,'8 3XWSXWW\WRFORVHSLSLQJKROHLQVLGHRXWVLGHRIWKHZDOOWRDYRLGDLUOHDNDJH LQVWDOODWLRQ 7KHUHLVQRREVWDFOHVDERXWWKHDLURXWOHWV *DV/HDNDJHLVFKHFNHGDWHDFKRIWKHSLSHFRQQHFWLRQV 7KHYROWDJHDWWKHH[FOXVLYHSRZHURXWOHWLVZLWKLQWKHUDQJHRIUDWHGYROWDJH <HV1R ,VWKHIXVHDQGZLUHJDXJHXVHGDUHWKHRIIROORZLQJVSHFLILFDWLRQ $OZD\VXVHYROWDJHVWDEOLVHU <HV1R 30 :KLUOSRRORI,QGLD/WG &RPSDQ\&RS\ ,QVWDOODWLRQ'HPR&KHFN6KHHW$LUFRQGLWLRQHU &XVWRPHU0DFKLQHGHWDLOV 'DWHRI,QVSHFWLRQ %UDQFK &XVWRPHU1DPH$GGUHVV 631DPH 0RGHO1R 'DWHRI3XUFKDVH'23 0DFKLQH6UQR 3KRQHQR ,'86U1R 0RELOH1R 2'86U1R 3XUFKDVHGIURP'HDOHU1DPH ,QVWDOOHG%\,QVWDOOHU V1DPH 66'730RGHUQ7UDGH,QVWLWXWLRQDOVDOH2WKHUV 66'7363/RFDO ,'8/RFDWLRQ 2N1RW2N 2'8ORFDWLRQ ,'8OHYHO&KHFNZLWK6SULWOHYHO 2N1RW2N /HQJWKRI&RSSHUSLSH 'UDLQ3LSHVORSH 2N1RW2N 'LVWDQFH%HWZHHQ,'82'8 ,QVWDOODWLRQ&RQGLWLRQV6$& 2N1RW2N (OHFWULFDO2WKHUGHWDLO &RQGLWLRQRI+RXVH:LULQJ $PS6WDELOL]HU 0&%5DWLQJ <HV1R 0DNH (DUWKLQJFRQGLWLRQV ,I9ROWDJHEHWZHHQ(1LV9$GYLVH &XVWRPHUWRFRQVXOWDQHOHFWULFLDQ 6WDELOL]HU,QSXW 9ROWV 6WDELOL]HU2XWSXW 9ROWV $PSHUV'UDZQ 3(5)250$1&(5810$&+,1()250,187(6 &+(&.7+()2//2:,1* $PELHQW7HPSR& 'HOWD7 77VKRXOGEHDSSUR[7RR& $LU,QOHW7HPSR&7 *ULOO7HPSR&7 )HDWXUHV([SODQDWLRQV &RROPRGH <HV1R 'LPIXQFWLRQ <HV1R 'U\0RGH <HV1R $URXQG8 <HV1R )DQ0RGH <HV1R <HV1R 7XUER4XLFN&RRO <HV1R )LOWHU&OHDQLQJPHWKRG 5HVHWWLQJ)LOWHU FOHDQLQJ/(' 6OHHSPRGH <HV1R 3RZHU6DYHU <HV1R 6ZLQJ <HV1R WK6HQVH <HV1R 7LPHUVHWWLQJ <HV1R 7HPSHUDWXUHVHWWLQJ <HV1R <HV1R *ULOODQG3ODVWLFSDUWVEH\RQGGD\VIURPWKH'DWHRI3XUFKDVHDUHQRWFRYHUGXQGHUZDUUDQW\ 1RWH0DQXIDFWXUHUDEVROYHDOOOLDELOLW\LIIROORZLQJVLWXDWLRQVDUHREVHUYHGE\6HUYLFH(QJLQHHU $)DXOW\6XE6WDQGDUG:LULQJ &6WDELOL]HU1:3/'HIHFWLYH %)LOWHUFOHDQLQJ '5H'HPR ,QFDVHDERYHVLWXDWLRQVDUHQRWLFHGE\6HUYLFH(QJLQHHU:LWKLQ<UIURP'239LVLWFKDUJHVRI5VZLOOEHSD\DEOHE\ WKHFXVWRPHURYHUDQGDERYHWKHWKHRWKHUUHSDLULQJFKDUJHVLIDSSOLFDEOHLQFXUUHGGXULQJWKHSURFHVV 1DPH6LJQRI(QJLQHHU 31 &XVWRPHUV6LJQDWXUH ,KDYHXQGHUVWRRGDOOWKHZDUUDQW\WHUPV Installation commissioning 813$&.,1* 6UQR &KHFNSRLQWV 0DFKLQHFKHFNHGIRUGDPDJHV'DPDJHVREVHUYHG 2EVHUYDWLRQV <HV1R 5HPDUNV ,I\HVSURYLGHGHWDLOV 5HPRYHKDQGXQLWIURP,'8 <HV1R 5HPRYH)LEUHWDSHVIURPWKHIURQWFRYHU <HV1R ,VWKHVWUHQJWKRILQVWDOODWLRQHQRXJKERWK,'82'8 'LUHFWLRQRIFRQGHQVRURIPDFKLQHLVWRZDUGV 7KHXQLWLVVHFXUHGIL[HGZLWKKDQJHUSODWH <HV1R 1RUWK6RXWK:HVW(DVW <HV1R <HV1R <HV1R <HV1R <HV1R %UHGWKZLVHOHYHO'HSWKZLVHLQFOLQDWLRQRIURRPDLUFRQGLWLRQHUDUHQRUPDO DQGQRDLUORFNVLVLQWKHGUDLQSLSH 7KHKHDWLQVXODWLYHPDWHULDOLVVHFXUHO\DWWDFKHGRQWKHFRQQHFWLRQVRIWKH SLSLQJVRIWKH,'8 3XWSXWW\WRFORVHSLSLQJKROHLQVLGHRXWVLGHRIWKHZDOOWRDYRLGDLUOHDNDJH LQVWDOODWLRQ 7KHUHLVQRREVWDFOHVDERXWWKHDLURXWOHWV *DV/HDNDJHLVFKHFNHGDWHDFKRIWKHSLSHFRQQHFWLRQV 7KHYROWDJHDWWKHH[FOXVLYHSRZHURXWOHWLVZLWKLQWKHUDQJHRIUDWHGYROWDJH <HV1R ,VWKHIXVHDQGZLUHJDXJHXVHGDUHWKHRIIROORZLQJVSHFLILFDWLRQ $OZD\VXVHYROWDJHVWDEOLVHU <HV1R 32 33 Declaration on Hazardous Substances : EWaste Rules Some components used in manufacturing this Air Conditioner contain low content of some substances classified as hazardous, according to EWaste Rules published by the Government of India. These do not pose any risk to the conditioning of air inside the room. Nor does physical contact with the Air Conditioner during the life of the product endanger health or safety to humans or any living creature. However, if the Air Conditioner is not disposed safely at the end of its life, inappropriate handling of waste may pose risks to health and environment. Hence, it is our advice that you contact Whirlpool when you are ready to discard the product so that we can channelize the appliance and its components for safe disposal.
* Your assessment is very important for improving the work of artificial intelligence, which forms the content of this project
advertisement