Whirlpool MAGICOOL User manual

Whirlpool MAGICOOL User manual
HOME APPLIANCES
3D Cool Climate Control
HOME APPLIANCES
® Registered trademark/TM Trademark of Whirlpool, U.S.A.
© 2009 Whirlpool of India Ltd. All rights reserved.
Due to advancement of technology and constant R&D the specifications, models and designs are subject to change without prior notice.
4000188-01
Vipul Sabharwal
Vice President - (Sales & Marketing)
6SOLW7\SH5RRP$LU&RQGLWLRQHU-R22
8VHDQG&DUH0DQXDO
8QGHU3UHSDUDWLRQEHIRUHXVH
6DIHW\3UHFDXWLRQV
,GHQWLILFDWLRQRISDUWV
'LVSOD\LQWURGXFWLRQ
5HPRWHFRQWUROOHU
5&EDWWHULHVORDGLQJ
2SHUDWLQJ,QVWUXFWLRQVIRU5&
$LUIORZ'LUHFWLRQ&RQWURO
WK6HQVH0RGH
7LPHU0RGH
&OLPDWH&RQWURO)HDWXUH
)XQFWLRQVDYDLODEOHLQGLIIHUHQWPRGHV
0DLQWHQDQFH
3URWHFWLRQ
7URXEOHVKRRWLQJ
7URXEOHVKRRWLQJFKDUW
,QVWDOODWLRQLQVWUXFWLRQV
,QVWDOODWLRQLQVWUXFWLRQIRU,'8
,QVWDOODWLRQLQVWUXFWLRQIRUSLSLQJFRQQHFWLRQ
&DEOHFRQQHFWLRQ,QVWUXFWLRQ
:LULQJGLDJUDP
,QVWDOODWLRQLQVWUXFWLRQIRU2'8
+RZWRSXUJH
:DUUDQW\WHUPV
a
6HUYLFHFRXSRQV
,QVWDOODWLRQGHPRVKHHWFXVWRPHUFRS\
a
,QVWDOODWLRQGHPRVKHHWFRPSDQ\FRS\
a
:KLUOSRRO6HUYLFH
7KDQN\RXYHU\PXFKIRUSXUFKDVLQJ a:KLUOSRRO$LU&RQGLWLRQHUSOHDVHUHDGWKLV8VH
&DUH0DQXDOFDUHIXOO\EHIRUHLQVWDOOLQJDQGXVLQJWKLVDSSOLDQFHDQGNHHSWKLVPDQXDO
IRUIXWXUHUHIHUHQFHV
,PSRUWHG%\:KLUOSRRORI,QGLD/LPLWHG
$0,'&5DQMDQJDRQ7DOXND6KLUXU'LVWW3XQH0DKDUDVKWUDVWDWH,QGLD3,1
:KLUOSRROLVDUHJLVWHUHGWUDGHPDUNRIWKH:KLUOSRRO&RUSRUDWLRQ86$8VHXQGHUOLFHQVH
Under Preparation before use
Before using the air conditioner, be sure to check and preset as the following.
Remote Controller (RC)
7KHUHPRWHFRQWUROOHUFDQFRYHUDOOWKHIXQFWLRQVRIFRROLQJPRGHOV+HDWLQJPRGHLVQRWDSSOLFDEOHIRU
FRROLQJPRGHOV
Auto-Restart Function
,I\RXZDQWWRXVHDXWRUHVWDUWVZLWFKRQWKHSRZHUVXSSO\EXWWRQSUHVVWKH212))EXWWRQRQWKH,QGRRU
8QLWKROGIRURYHUVHFRQGV$XWR5HVWDUWLVQRZVHWZLWKEX]]VRXQG
,IWKHDXWRUHVWDUWKDVEHHQVHWKROGGRZQWKH212))EXWWRQRQWKHLQGRRUXQLWIRURYHU6HFRQGVDXWR
UHVWDUWIXQFWLRQLVQRZFDQFHOOHGZLWKDEX]]VRXQGDLUFRQGLWLRQHULVQRZRQVWDQGE\
Auto Turbo Mode
Turbo mode is used to start or stop fast cooling.
)DVWFRROLQJFKDQJHVWKHWHPSHUDWXUHWRKLJKIDQVSHHGDQGRSHUDWHVDXWRPDWLFDOO\WLOOWHPSHUDWXUHUHGXFHV
WR6GHJUHHV&HOVLXVIRUPLQXWHVWKHQVZLWFKHVWRSUHVHWPRGH
In case of power resume, auto turbo mode work for 10 min.
x
x
7XUERPRGHFDQEHVHWZKHQWKHDSSOLDQFHLVLQRSHUDWLRQRU powered on
,QWXUERPRGH\RXFDQVHWDLUIORZGLUHFWLRQRUWLPHU,I\RXZDQWWRUHWXUQWRWKHRULJLQDOPRGHSUHVV 32:(502'()$1212))RU7(03(5$785(6(77,1*%87721
1RWH
x
x
x
6OHHSDQGWKVHQVHEXWWRQVDUHQRWDYDLODEOHLQWXUERPRGH
7XUEREXWWRQLVLQHIIHFWLYHLQKHDWLQJPRGH
7KHDSSOLDQFHZLOOFRQWLQXHZRUNLQJLQWXUERPRGHZLWKVHWWHPSHUDWXUHRI6GHJUHH&HOVLXVWLOORWKHU
EXWWRQVPHQWLRQHGDERYHDUHSUHVVHG
Safety precautions
6\PEROVLQWKLV8VHDQG&DUH0DQXDODUHLQWHUSUHWHGDVVKRZQEHORZ
%HVXUHQRWWRGR
3D\DWWHQWLRQWRVXFKDVLWXDWLRQ
8VHFRUUHFWSRZHUVXSSO\LQ
DFFRUGDQFHZLWKWKHUDWLQJSODWH
UHTXLUHPHQW2WKHUZLVHVHULRXV
IDXOWVRUKD]DUGPD\RFFXURUD
ILUHPD\EHEUHDNRXW
'RQRWbendSXOORUSUHVVWKHSRZHUVXSSO\
FRUGOHVWWKHSRZHUVXSSO\FRUGEHEURNHQ
$QHOHFWULFVKRFNRUILUHmay beFDXVHG
E\DEURNHQSRZHUVXSSO\FRUG
*URXQGLQJLVHVVHQWLDO
:DUQLQJ,QFRUUHFWKDQGOLQJFRXOG
FDXVHDVHULRXVKD]DUGVXFKDVGHDWK
VHULRXVLQMXU\HWF
21
21
2))
.HHSWKHSRZHUVXSSO\FLUFXLWEUHDNHU
RUSOXJ awayIURPGLUW&RQQHFWWKHSRZHU
VXSSO\FRUGWRLWILUPO\DQGFRUUHFWO\
OHVWDQHOHFWULFVKRFNRUDILUHEUHDNRXW
GXHWRLQVXIILFLHQWFRQWDFW
1HYHULQVHUWDVWLFNRUVLPLODUREVWDFOH
WRWKHXQLW6LQFHWKHIDQURWDWHVDWKLJK
VSHHGWKLVPD\FDXVHDQLQMXU\
2))
'RQRWXVHWKHSRZHUVXSSO\FLUFXLW
EUHDNHURUSXOORIIWKHSOXJWRWXUQLWRII
GXULQJRSHUDWLRQ7KLVPD\FDXVHDILUH
GXHWRVSDUNHWF
,WLVKDUPIXOWR\RXUKHDOWKLIWKHFRRODLU
UHDFKHV\RXIRUDORQJWLPH,WLVDGYLVDEOH
WROHWWKHDLUIORZEHGHIOHFWHGWRaroundWKHURRP
&
7XUQRIIWKHDSSOLDQFHE\UHPRWHFRQWURO
ILUVWEHIRUHFXWWLQJRIISRZHUVXSSO\LI any
PDOIXQFWLRQRFFXUV
'RQRWWRXFKWKHRSHUDWLRQEXWWRQV
ZKHQ\RXUKDQGVDUHZHW
'RQRWUHSDLUWKHDSSOLDQFHE\\RXUVHOI
,IWKLVLVGRQHLQFRUUHFWO\LWPD\FDXVHD
HOHFWULFVKRFNHWF
'RQRWSXWDQ\REMHFWVRQWKHRXWGRRU
XQLW
2
3UHYHQWWKHDLUIORZIURPUHDFKLQJWKHJDV
EXUQHUVDQGVWRYH
,WLVWKHXVHU
VUHVSRQVLELOLW\WRJHWWKH
$SSOLDQFHHDUWKHGDFFRUGLQJWRORFDO requirements
E\DOLFHQVHGWHFKQLFLDQ
Identification of parts
Indoor unit
Air Intake
Front Panel
Display Box
Air Outlet
Emergency Box
Vertical Adjustment
Louver
Horizontal Adjustment
Louver
Air Filter
Remote Controller
Air Intake
Outdoor unit
Pipes and Power
Connection Cord
Drain Hose
Note: Condensate water drains
at COOLING or DRY operation.
Air Outlet
The figures in this manual are based on the external view of a standard model.
Consequently, the shape may differ fromthat of the air conditioner you have selected.
3
Timer
Turbo
Temperature
4
On
Sleep
Remote controller
Remote controller
The remote controller transmits signals to the system.
1 ON/OFF BUTTON
The appliance will be switched on or
Off on pressing this button
2
ON
OFF
MODE BUTTON
Press this button to select the operation mode.
3 FAN BUTTON
Used to select fan speed in sequence
auto, high, medium or low.
4 55
ROOM TEMPERATURE
SETTING BUTTONS
Used to adjust the room temperature and
the timer, also real time.
6
SENSE BUTTON
Used to enter fuzzy logic operation directly,
regardless of the unit is on or off.
7
SWING UP/DOWN
Used to stop or start vertical adjustment
louver swinging and set the desired up/down
airflow direction.
8
SILENT SLEEP
Used to set or cancel Sleep Mode operation.
9
AROUND U BUTTON
Used to set or cancel AROUND U Mode operation.
10 POWER SAVER BUTTON
Used to enter or quit POWER SAVER mode
11 TIMER OFF BUTTON
Used to cancel the timer operation.
13 SUMMER CHILL
11 12 TIMER ON/CLOCK BUTTON
Used to set timer operation and clock.
14
DIM BUTTON
When you press this button, all the display of
indoor unit will be switched off. Press any button to
resume display.
Used to start or stop the fast cooling.
15 SWING L/R
Used to stop or start Horizontal adjustment louver swinging and set the desired
left/right airflow direction.
16 SPRING COOL
SPRING COOL is suitable for non-peak summer when the indoor room temperature
is neither too hot nor too humid.
17 MONSOON FRESH
MONSOON FRESH is suitable for high humid condition, when the moisture content
in the air inside the room creates major discomfort.
*"Swing L/R" button in the remote control shall not function for 1.0 T 3D Cool Climate
Control. For horizontal air flow, adjust manually.
Note: Each mode and relevant function will be further specified in following pages.
5
Remote controller
Remote controller
Indication symbols on LCD:
Cooling indicator
Auto fan speed
6th sense indicator
Dry indicator
High fan speed
Sleep indicator
Fan only indicator
Medium fan speed
Around U
Heating indicator
Low fan speed
Turbo indicator
Climate Control
Super silense
Power saver indicator
Signal transmit
ON
Display set timer
OFF
Display current time
Display set temperature
Note: Each mode and relevant function will be further specified in following pages.
7RLQVHUWDSLQDQG3XVK'RZQ
WKHQIROORZLQJWKHGLUHFWLRQDV
WKHDUURZVKRZVWRUHPRYHWKH
EDWWHU\FRYHU
5HPRWHFRQWUROOHU
How to Insert the Batteries
5HPRYHWKHEDWWHU\FRYHUDFFRUGLQJWRWKHDUURZGLUHFWLRQ
,QVHUWQHZEDWWHULHVPDNLQJVXUHWKDWWKHDQGRI
EDWWHU\DUHPDWFKHGFRUUHFWO\
5HDWWDFKWKHFRYHUE\VOLGLQJLWEDFNLQWRSRVLWLRQ
Note:
Use 2 LR03 AAA(1.5volt) batteries. Do not use rechargeable batteries.
Replace batteries with new ones of
becomes dim.
2
6
ON
OFF
16~30
4
2
1
16
30
7
3
Operation instructions
Airflow direction control
ON
OFF
Airflow direction control
Vertical & Horizontal airflow is automatically adjusted to a certain angle
in accordance with the operation mode after turning on the unit.
Operation mode Direction of airflow
COOLING, DRY Vertical & Horizontal
The direction of airflow can be
also adjusted to your own
requirement by pressing the
"Swing - Up/Down & L/R"
button of the remote controller.
6
6
7
*Heating mode is only available for heat pump models.
7
Vertical airflow control (with the remote controller)
Using remote controller to set various angles of flow or specific angle
as you like.
Swinging airflow
Pressing “Swing - Up/Down “ button once, Horizontal
louver will swing up and down automatically.
6
Desired direction airflow
Pressing the “Swing - Up/Down “ button again when the louvers swing
to a suitable angle as desired.Default position is applicable after power resume.
Horizontal airflow control (with the remote controller)
Using remote controller to set various angles of flow or specific angle
as you like.
Swinging airflow
Pressing “Swing L/R“ button once, Vertical
louver will swing up and down automatically.
7
Desired direction airflow
Pressing the “Swing L/R“ button again when the louvers swing
to a suitable angle as desired.Default position is applicable after power resume.
Swing L/R" button in the remote control shall not function for 1.0 T 3D Cool
Climate Control. For horizontal air flow, adjust manually
Do not turn the vertical adjustment louvers manually, otherwise malfunction may occur. If that happens, turn off the unit
first and cut off the power supply, then restore power supply again.
It is better not to let the vertical adjustment louver tilt downward for a long time at COOLING or DRY mode to prevent
condensed water from dripping.
8
ON
OFF
Room temperature
decrease by 1.5℃ after
operate for 3 minutes
1
2
3
Note: Temperature, airflow and direction are controlled automatically in 6th sense mode.
However, For the on/off, you can choose from -2 to 2, for the inverter you can choose from -7 to 7. if you
still feel uncomfortable.
Around U button
9
Operating Instructions
7LPHUPRGH 7LPHU0RGH7KLVPRGHDOORZV\RXWRVZLWFKDLUFRQGLWLRQHURQRIIDIWHUDFHUWDLQDPRXQW RIWLPHWKDWKDVEHHQVHW
+RZWRVHW7,0(521
7,0(521EXWWRQFDQEHXVHGWRVHWWKHWLPHUSURJUDPPLQJDVZLVKHGLQRUGHUWR
VZLWFKRQWKHDSSOLDQFHDW\RXUGHVLUHGWLPH
L3UHVV7,0(521EXWWRQ21IODVKHVRQWKH/&'WKHQ\RX
FDQSUHVVWKH
DSSOLDQFHRQ
RU
EXWWRQVWRVHOHFW\RXUGHVLUHGWLPHIRU
,QFUHDVH
1
'HFUHDVH
3UHVVWKH
EXWWRQRQFHWRLQFUHDVHRUGHFUHDVHWKHWLPHVHWWLQJE\PLQXWH
EXWWRQRQHDQGDKDOIVHFRQGVWRLQFUHDVHRUGHFUHDVHWKHWLPH
3UHVVWKH
VHWWLQJE\PLQXWH
3UHVVWKH
EXWWRQIRUDORQJHUWLPHWRLQFUHDVHRUGHFUHDVHWKHWLPHE\KRXU
Note: If you don't set the time in 10 seconds after you press TIMER ON button, the remote controller
will exit the TIMER ON mode automatically.
LL:KHQ\RXUGHVLUHGWLPHGLVSOD\HGRQ/&'SUHVVWKH7,0(521EXWWRQDQGFRQILUPLW
A "beep" can be heard.
"ON" stops flashing.
The TIMER indicator on the indoor unit lights up.
LL,$IWHUWKHVHWWLPHUGLVSOD\HGIRUVHFRQGVWKHFORFNZLOOEHGLVSOD\HGRQWKH/&'
RIWKHUHPRWHFRQWUROOHULQVWHDGRIVHWWLPHU
+RZWRFDQFHO7,0(521
7,0(52))FDQEHXVHGWRVZLWFKRIIWKHDSSOLDQFHDXWRPDWLFDOO\DW\RXUGHVLUHGWLPH
Note: 3UHVVWKH7,0(521EXWWRQDJDLQD³EHHS´FDQEHKHDUGDQGWKHLQGLFDWRUGLVDSSHDUV
the TIMER ON mode has been canceled.
10
Climate Control Feature
6XPPHUFKLOO
Usage: SUMMER CHILL is best suited for peak summer conditions.
SUMMER CHILL operation sets the Air Conditioner automatically at lowest set temperature that
resultsin fastest temperature pull down. The indoor room temperature starts reducing immediately
as the machine operates at the highest fan speed.
Operation:
Enable: To engage this function press the SUMMER CHILL button on the remote. You can only
change the air flow direction and the timer settings in this mode.
Disable: To disengage press SUMMER CHILL , the display will automatically return to the
original settings.
Note: *The Air Conditioner will continue working in Summer Chill mode, if you do not disable the
mode using the above step.
** Under SUMMER CHILL mode preset parameters cannot be change.
0RQVRRQIUHVK
Usage: MONSOON FRESH is suitable for high humid condition, when the moisture content in the
air inside the room creates major discomfort.
MONSOON FRESH operation sets the Air Conditioner automatically at preset suitable set temperature
and fan speed that helps to remove the excess moisture content from the indoor atmosphere at a
faster rate, to bring in quick comfort inside the room.
Operation:
Enable: To engage this function press the MONSOON FRESH button on the remote. You can
only change the air flow direction and the timer settings in this mode.
Disable: To disengage press MONSOON FRESH , the display will automatically return
to the original settings.
Note: *The Air Conditioner will continue working in MONSOON FRESH mode,
if you do not disable the mode using the above step.
ON
** Under MONSOON FRESH mode preset parameters cannot be change.
OFF
6SULQJFRRO
Usage: SPRING COOL is suitable for non-peak summer when
the indoor room temperature is neither too hot nor too humid.
SPRING COOL operation sets the Air Conditioner automatically
at preset suitable set temperature and fan speed that provides
immediate mild cooling for best comfort.
Operation:
Enable: To engage this function press the SPRING COOL
button on the remote. You can only change the air flow
direction and the timer settings in this mode.
Disable: To disengage press SPRING COOL, the
display will automatically return to the original settings.
Note: *The Air Conditioner will continue working in
SPRING COOL mode, if you do not disable the mode using
the above step.
** Under SPRING COOL mode preset parameters cannot be change.
11
4
1
2
3
Climate Control Feature
6LOHQWVOHHS
4
Usage: SILENT SLEEP can be operated in COOLING or DRYING mode operation.
SILENT SLEEP operation provides a comfortable indoor room condition with lowest noise for
comfortable sleep.
Operation:
Enable: To engage this function press the SILENT SLEEP button on the remote.
Fan speed automatically sets at a low speed.
Set temperature will rise by 1 degree C, If the Air Conditioner operates continuously in cooling
mode for 1 hours constantly, then remains steady.
The Air Conditioner will stop operation automatically after 8 hours of running.
Disable: To disengage press SILENT SLEEP
The Air Conditioner will stop operation automatically after 8 hours of running.
Note:
In cooling mode, if room temperature is 26 degree C or above, set temperature will not change.
Functions available in different modes
Cool Mode
Dry Mode
Fan Mode
th
6 Sense
Summer Chill
Power Saver
Monsoon Fresh
Spring Cool
Temp.
Control
Fan Speed
√
√
x
√
x
x
x
x
√
x
√
x
x
x
x
x
Timer
√
√
√
√
√
√
√
√
12
Silent Sleep
√
√
x
√
x
√
x
x
Swing
√
√
√
√
√
√
√
√
Maintenance
)URQWSDQHOPDLQWHQDQFH
$LUILOWHUPDLQWHQDQFH
&XWRIIWKHSRZHUVXSSO\
,WLVQHFHVVDU\WRFOHDQWKHDLUILOWHU
DIWHUXVLQJLWIRUDERXWKRXUV
7XUQRIIWKHDSSOLDQFH
ILUVWEHIRUHGLVFRQQHFWLQJ
IURPSRZHUVXSSO\
&OHDQLWDVIROORZV
D
+ROGSRVLWLRQDDQG
SXOORXWZDUGWRUHPRYHWKH
IURQWSDQHO
6ZLWFKRIIWKHDSSOLDQFHDQGUHPRYH
WKHDLUILOWHU
D
2SHQWKHIURQWSDQHO
3UHVVWKHKDQGOHRIWKHILOWHUJHQWO\
IURPWKHIURQW
*UDVSWKHKDQGOHDQGVOLGHRXWWKHILOWHU
8VHOXNHZDUPZDWHU
EHORZćWRFOHDQ
LIWKHDSSOLDQFH
LVYHU\GLUW\
:LSHZLWKDVRIW
DQGGU\FORWK
8VHDGU\DQG
VRIWFORWKWR
FOHDQLW
1HYHUXVHYRODWLOHVXEVWDQFH
VXFKDVJDVROLQHRUSROLVKLQJ
SRZGHUWRFOHDQWKHDSSOLDQFH
&OHDQDQGUHLQVWDOOWKHDLUILOWHU
,IWKHILOWHULVGLUW\
ZDVKLWZLWKDVROXWLRQRI
GHWHUJHQWLQOXNHZDUPZDWHU
$IWHUFOHDQLQJGU\ZHOOLQ
VKDGH
1HYHUVSULQNOHZDWHURQWRWKH
LQGRRUXQLW
'DQJHURXV
(OHFWULF
VKRFN
&ORVHWKHIURQWSDQHODJDLQ
5HLQVWDOODQGVKXWWKHIURQWSDQHO
5HLQVWDOODQGVKXWWKHIURQWSDQHOE\
SUHVVLQJSRVLWLRQEGRZQZDUG
E
E
Clean the air filter every two weeks
if the air conditioner operates in an
extremely dusty environment.
13
16
14
Troubleshooting
The following cases may not always be a malfunction, please check it before asking for service.
7URXEOH
$QDO\VLV
,sWKHSURWHFWRUWULSRUIXVHLVEORZQ?
3OHDVHZDLWIRUPLQXWHVDQGVWDUWDJDLQ
SURWHFWRUGHYLFHPD\EHSUHYHQWLQJXQLWfromZRUNing?
'RHVQRWUXQ
Are theEDWWHULHVLQWKHUHPRWHFRQWUROOHUH[KDXVWHG?
,s WKHSOXJLVQRWSURSHUO\SOXJJHG?
,VWKHLQWHUQDOXQLWDLUILOWHUGLUW\"
1RFRROLQJRU
KHDWLQJDLU
$UHWKHYHQWVRIWKHH[WHUQDOXQLWEORFNHG"
,VWKHLQSXWYROWDJHOHVVWKDQ9"
,VWKHWHPSHUDWXUHVHWSURSHUO\"
,QHIIHFWLYHFRQWURO
/DJLQWKH
FRPSUHVVRUZRUNLQJ
GRQ
WUXQ
3HFXOLDURGRU
$VRXQGRI
IORZLQJZDWHU
&UDFNLQJVRXQGLV
KHDUG
6SUD\PLVWIURP
WKHRXWOHW
&KHFNLIWKHEDWWHULHVLQWKHUHPRWHFRQWUROOHUDUH
QRWH[KDXVWHG
&KHFNLIWKHEDWWHULHVLQWKHUHPRWHFRQWUROOHUDUH
QRWH[KDXVWHG
&KDQJLQJPRGHGXULQJRSHUDWLRQZLOOOHDGWR
PLQXWHVGHOD\
7KLVRGRUPD\FRPHIURPDQRWKHUVRXUFH
VXFKDVIXUQLWXUHFLJDUHWWHHWFZKLFKLV
VXFNHGLQWKHXQLWDQGEORZnRXWZLWKWKHDLU
&DXVHGE\WKHIORZRIUHIULJHUDQWLQWKH
DLUFRQGLWLRQHUQRWDLVVXH
15
7KHVRXQGPD\EHJHQHUDWHGE\WKHH[SDQVLRQ
RUFRQWUDFWLRQRIWKHIURQWSDQHOGXHWRFKDQJH
RIWHPSHUDWXUH
0LVWDSSHDUVZKHQWKHURRPDLUEHFRPHV
YHU\FROGEHFDXVHRIFRRODLUGLVFKDUJHG
IURPLQGRRUXQLWGXULQJ&22/,1*RU'5<
RSHUDWLRQPRGH
Troubleshooting chart
)DXOW
6\PSWRPV
6XSSO\$LULVFROGEXW
URRPLVQRWFRROHG
3UREDEOHFDXVH
7URXEOH3RLQW
([FHVVLYH&RROLQJORDG
5HPHG\
5RRPLVWRRODUJHIRUFKRRVHQFDSDFLW\
5HFDOFXODWHWKHFRROLQJORDG
'LUHFW6XQOLJKWHQWHUVWKHURRPEHLQJ
'RQRWLQVDWDOODLUFRQGLWLRQHUQHDUKHDWHU
FRROHG
DQGRWKHUVRXUFHV
'RRUVDUHRSHQHGDQGFORVHGIUHTXHQWO\RU
URRPFRQWDLQWRRPDQ\SHUVRQV
+HDWVRXUFHVVXFKDVKHDWHUVDQGFRRNLQJ
VWRYHVHWFDUHSUHVHQWV
8QVXLWDEOHLQVWDOODWLRQORFDWLRQ
&KHFNLIURRPDLUFRQGLWLRQHULVLQVWDOOHGLQ
&KDQJHLQVWDOODWLRQORFDWLRQ
5HPRYHDQ\REVWUXFWLQJREMHFW
FRUQHU
&KHFNIRUDQ\REVWUXFWLQJREMHFWLQIURQWRI
URRPDLUFRQGLWLRQHU
/(66&22/,1*
,QVXIILFLHQWDLUIORZ
'XVWDFFXPXODWHVLQWKHDLUILOWHU
:DVKRXWWKHGXVWRQWKHDLUILOWHU
'XVWDGKHUHVWRILQVZKLFKFDXVHVOHVVDLU
&OHDQWKHILQVZLWKEUXVDQGZDWHU
&KHFNHDFKVHFWLRQZLWKKDORJHQJDVOHDN
IORZ
&RPSUHVVRULVRSHUDWLQJ
'HIHFWLYHUHIULJHUDWLQJF\FOH
EXWVXSSO\DLULVQRW
5HIULJHUDQWOHDNDJHIURPWKHEUD]HG
VHFWLRQLQSLSLQJ
GHWHFWRUDQGUHSDLULWLPPHGLDWHO\ZKHQD
FRROHGVXIILFLHQWO\
OHDNLQJVHFWLRQLVGHWHFWHG
DPELHQWFRQGLWLRQ
FRPSUHVVRUEHFRPHVRYHUORDGHGDQG
FKHFNIRUGLUHFWVXQOLJKWRQDLUFRQGLWLRQHU
XVHVWDELOL]HUVIRUUHJXODWHGSRZHUVXSSO\
FKHFNIRUDQ\VXQOLJKWRQDLUFRQGLWLRQHU
UHSODFHWKHGHIHFWLYHFDSDFLWRU
UHSDLUUHIULJHUDWLQJF\FOHDQGRYHUORDG
VWRSVZLWKWKHDFWXDWLRQRIRYHUORDGUHOD\
FRPSUHVVRUVWRSVVRRQ
DIWHUVWDUWLQJ
YDULDWLRQRISRZHUVRXUVHYROWDJHDQG
SRZHUVRXUVHFDSDFLW\
VXSSO\YROWDJHLVQRWLQUDQJHRIRI
UDWHG
DPELHQWFRQGLWLRQ
FRPSUHVVRUUXQQLQJFDSDFLWRUEHFRPHV
FRPSUHVVRUEHFRPHVRYHUORDGHGDQG
VWRSVZLWKWKHDFWXDWLRQRIRYHUORDGUHOD\
SRRURUGLVFRQQHFWHG
FKHFNHOHFWULFDOZLUHDQGFRPSUHVVRU
UXQQLQJFDSDFLWRUZLWKFDSDFLWRU
GHIHFWLYHUHIULJHUDWLQJF\FOHDQGRYHUORDG
PHDVXUHWKHYROWDJHDQGFXUUHQW
DERQRUPDOLW\
GHIHFWLYHFRPSUHVVRU
FKHFNFRPSUHVVRUZLQGLQJUHVLVWDQFHDQG
UHOD\
UHSODFHDQ\GHIHFWLYHFRPSUHVVRU
UHSODFHDQ\SOXJRUSDUWZLWKSRRUFRQWDFW
FRPSDUHZLWKVSHFLILFDWLRQ
)DQPRWRUGRHVQRWUXQ
SRRUFRQWDFWRISOXJEURNHQZLUH
VZLWFKHVWKHUPLVWRU
PHDVXUHWKHFRQWLQXLW\RIFRUGRUYROWDJH
ZLWKDWHVWHU
IDQPRWRUIDLOXUH
FKHFNWKHEURNHQFRQQHFWLRQLQIDQPRWRU
RUFRUGZLWKEURNHQDULYH
LWVHOIEXUQWDQGHIIHFW
IDQPRWRULVUXQQLQJEXW
FRPSUHVVRUGRHVQRW
YDULDWLRQRISRZHUVRXUVHYROWDJHDQG
SRZHUVRXUVHFDSDFLWRU
VXSSO\YROWDJHLVQRWLQUDQJHRIaRI
FKHFNZLWK'&PRWRUWHVWLQJMLJLIIDXOW\
UHSODFHWKH
XVHVWDELOL]HUVIRUUHJXODWHGSRZHUVXSSO\
FKHFNIRUDQ\GLUHFWVXQOLJKWRQDLU
UDWHG
'2(6127&22/$7$//
RSHUDWH
DPELHQWFRQGLWLRQ
FRPSUHVVRUEHFRPHVRYHUORDGHGDQG
VWRSVZLWKWKHDFWXDWLRQRIRYHUORDGUHOD\
FRPSUHVVRUUXQQLQJFDSDFLWRUEHFRPHV
SRRURUGLVFRQQHFWHG
FRQGLWLRQHU
UHSODFHWKHGHIHFWLYHFDSDFLWRU
UHSDLUUHIULJHUDWLQJF\FOHDQGRYHUORDG
UXQQLQJFDSDFLWRUZLWKFDSDFLWRU
GHIHFWLYHUHIULJHUDQWF\FOHRURYHUORDG
UHOD\
FKHFNHOHFWULFDOZLUHDQGFRPSUHVVRU
PHDVXUHWKHYROWDJHDQGFXUUHQW
DERQRUPDOLW\
GHIHFWLYHFRPSUHVVRU
FKHFNFRPSUHVVRUZLQGLQJUHVLVWDQFHDQG
UHOD\
UHSODFHDQ\GHIHFWLYHFRPSUHVVRU
&KHFNHDFKVHFWLRQZLWKKDORJHQJDVOHDN
FRPSDUHZLWKVSHFLILFDWLRQ
FRPSUHVVRULVRSHUDWLQJ
JDVOHDNDJH
EXWDLULVQRWFRROHGDWDOO
PHDVXUHWKHYROWDJHDQGFXUUHQW
DERQRUPDOLW\
GHWHFWRUDQGUHSDLULWLPPHGLDWHO\ZKHQD
OHDNLQJVHFWLRQLVGHWHFWHG
FRPSUHVVRUZLWKGHIHFWLYHYDOYH
FRPSUHVVRUZLWKGDPDJHGSLSLQJ
FRPSUHVVRUQRLVH
.QRFNLQJQRLVH
UHSODFHDQ\GHIHFWLYHFRPSRQHQW
REVHUYHIRUDQ\QRUPDOQRLVH
UHSODFHWKHFRPSUHVVRU
FKHFNIRUDQ\REMHFWDURXQGIDQ
UHPRYHDQ\IRUHLJQPDWHULDOIURPWKH
&KHFNWKHGHJUHHRIYLEUDWLRQDQG
WDNHSURSHUPHDVXUHWRFRUUHFW
12,6(
9,%5$7,21
VXVSHQVLRQVSULQJ
EORZHUIDQRUSURIDQKLWWLQJZLWKIRUHLJQ
PDWHULDO
5HDVRQLQJQRLVHGXHWR
YLEUDWLRQ
,QVWDOODWLRQLVQRWSURSHUDQGSDUWVRIDLU
V\VWHP
FRQGLWLRQHUDUHORRVHRULQWHUQDOSDUWVRI
LQVWDOODWLRQZLWKDFFXUDF\
WKHFRPSUHVVRUDUHGDPDJHG
:$7(5
'5,33,1*
:DWHUGULSSLQJLQVLGH
7LOWHGXQLWLQVWDOODWLRQ
&KHFNXQLWLQVWDOODWLRQ
LIQHFHVVDU\UHLQVWDOOWKHXQLW
$LUILOWHUPD\EHGLUW\RUFORJJHG
&KHFNDLUILOWHU
FOHDQGLUW\ILOWHU
URRP
16
Installation instructions
Installation diagram
Distance from ceiling
should be over 150 mm
Distance from wall
should be over 150mm
Distance from the wall
should be over 150mm
Distance from floor
should be over 6.56 feet
Recommendations:
I) Ensure to install ODU on sheet Metal ODU stand,
tightened up with proper Nut and bolts.
II) Rubber Pad shall be there below Outdoor unit legs
in order to absorb the vibration of running unit.
Air intake distance from the wall
should be over 250mm
Air intake distance from
the wall should be
over 250mm
air
sh outl
ou et
ld
d
be ista
ov nce
er
50 from
0m th
m ew
Above figure is only a simple presentation
all
of the unit, it may not match the external
appearance of the unit you purchased.
Installation must be performed in accordance with
the national wiring standards by authorized personnel only.
17
over 250mm
Installation instructions
Select the installation location
Location for Installing Indoor Unit
Where there is no obstacle near the air outlet and air can be
easily blown to every corner.
Where piping and wall hole can be easily arranged.
Keep the required space from the unit to the ceiling and wall
according to the installation diagram on previous page.
Where the air filter can be easily removed.
Keep the unit and remote controller 1m or more apart from
television, radio etc.
To prevent the effects of a fluorescent lamps, keep as far as
possible.
Do not put anything near the air inlet to obstruct it from air
absorption.
Where there is strong enough to bear the weight
and is not tend to increase operation noise and vibration.
Do not install above the enterance i.e. Door or in front of the door.
installation area should have sufficient strength and durability.
IDU should not install far away from desired cooling area.
Do not place any electronic equipment below the IDU unit. Ex:
LCD, Computer etc.
Indoor unit
Pipe length is
15 meters Max.
be less than 5m
Height should
Outdoor unit
X
X
Location for Installing Outdoor Unit
Outdoor unit
Where it is convenient to install and well ventilated.
Do not install ODU face to face.Avoid the installation
in South and West direction.
Avoid installing it where flammable gas could leak.
Keep the required distance apart from the wall.
The distance between Indoor and outdoor unit should
be same as per provided connecting pipe
and can go up to maximum 15 meters
with additional refrigerant charge.
Pipe length is
15 meters Max.
Keep the outdoor unit away from a place of greasy dirt,
vulcanization gas exit.
Avoid installing it at the roadside where there is a risk of
muddy water.
Indoor unit
A fixed base where is not subject to increasing operation
noise.
Where there is not any blockage for air outlet.(Don’t install in shaft)
Installation area should have sufficient strength and durability.
To get optimize efficiency, install under shed.
Model
5K~30K
Limit of Tubing
Length (m)
15
Limit of Elevation
Required amount of
Difference H (m) additional refrigerant (g/m)
5
20
18
Installation instructions
Below declared Connecting pipe length to be referred as standard length
for Model Sold without Connecting Pipe.
,QGRRUXQLWLQVWDOODWLRQ
Model
1.0T
1.5T
2.0T
Pipe length
4 Meter
3.2Meter
4 Meter
1. Installing the Mounting Plate
'HFLGHDQLQVWDOOLQJORFDWLRQIRUWKHPRXQWLQJSODWHDFFRUGLQJWRWKHLQGRRUXQLWORFDWLRQDQGSLSLQJGLUHFWLRQ
.HHSWKHPRXQWLQJSODWHKRUL]RQWDOO\ZLWKDKRUL]RQWDOUXOHURUGURSSLQJOLQH
'ULOOKROHVRIPPLQGHSWKRQWKHZDOOIRUIL[LQJWKHSODWH
,QVHUWWKHSODVWLFSOXJVWRWKHKROHIL[WKHPRXQWLQJSODWHZLWKWDSSLQJVFUHZV
,QVSHFWLIWKHPRXQWLQJSODWHLVZHOOIL[HG7KHQGULOODKROHIRUSLSLQJ
/LQHGURSVIURPKHUH
+RRNWKHOLQHKHUH
0RXQWLQJSODWH
'URSSLQJOLQH
KROHVIRUIL[LQJ
Note: The shape of your mounting plate may be different from the one above, but installation method is similar.
2. Drill a Hole for Piping
'HFLGHWKHSRVLWLRQRIKROHIRUSLSLQJDFFRUGLQJWRWKH
ORFDWLRQRIPRXQWLQJSODWH
'ULOODKROHRQWKHZDOOZLWKWKHKHOSRIGULOOPDFKLQH
7KHKROHVKRXOGWLOWDOLWWOHGRZQZDUGWRZDUGRXWVLGH
:DOOKROHVOHHYH
KDUGSRO\WKHQHWXEH
SUHSDUHGE\XVHU
PP
PP
WLOWGRZQZDUG
,QVWDOODVOHHYHWKURXJKWKHZDOOKROHWRNHHSWKHZDOO
WLG\DQGFOHDQ
3. Indoor Unit Piping Installation
3XWWKHSLSLQJOLTXLGDQGJDVSLSHDQGFDEOHVWKURXJKWKHZDOOKROHIURPRXWVLGHRUSXWWKHPWKURXJK
IURPLQVLGHDIWHULQGRRUSLSLQJDQGFDEOHVFRQQHFWLRQFRPSOHWHVRDVWRFRQQHFWWRRXWGRRUXQLW
&KHFNXQORDGLQJSLHFHRIILQDFFRUGDQFHZLWKWKHSLSLQJGLUHFWLRQDVVKRZQEHORZ
DQGXVHWXEHEHQGHUWKHFRSSHUSLSH
3LSLQJGLUHFWLRQ
WURXJK
8QORDGLQJ
SLHFH
6DZWKHXQORDGLQJSLHFH
RIIDORQJWKHWURXJK
Note: When installing the pipe at the directions
1,2 or 4, saw the corresponding unloading piece
off the indoor unit base.
$IWHUFRQQHFWLQJSLSLQJDVUHTXLUHGLQVWDOOWKHGUDLQKRVH7KHQFRQQHFWWKHSRZHUFRUGV$IWHUFRQQHFWLQJ
ZUDSWKHSLSLQJFRUGVDQGGUDLQKRVHWRJHWKHUZLWKWKHUPDOLQVXODWLRQPDWHULDOV
,'8VKRXOGEHPRXQWHGSHUIHFWO\RQPRXQWLQJSODWH/RFNVKRXOGEHSURSHUO\LQVHUWHG
19
Installation instructions
Piping Joints Thermal Insulation:
:UDSWKHSLSLQJMRLQWVZLWKWKHUPDO
LQVXODWLRQPDWHULDOVDQGWKHQZUDS
ZLWKDYLQ\OWDSH
ZUDSSHGZLWKYLQ\OW\SH
7KHUPDOLQVXODWLRQ
Piping Thermal Insulation:
/DUJHSLSH
D3ODFHWKHGUDLQKRVHXQGHUWKHSLSLQJ
E,QVXODWLRQPDWHULDOXVHVSRO\WKHQHIRDPRYHUPPLQWKLFNQHVV
7KHUPDOLQVXODWLRQ
WXEH
3RZHUFRUG
Note: Drain hose is prepared by user.
'UDLQSLSHVKRXOGSRLQWGRZQZDUGIRUHDV\GUDLQIORZ
'RQRWDUUDQJHWKHGUDLQSLSHWZLVWHGVWLFNLQJRXWRUZDYH
DURXQGGRQRWLPPHUVHWKHHQGRILWLQZDWHU
3RZHUFRUG
IRUKHDWSXPS
,IDQH[WHQVLRQGUDLQKRVHLVFRQQHFWHGWRWKHGUDLQSLSHPDNH
VXUHWRWKHUPDOLQVXODWHGZKHQSDVVLQJDORQJWKHLQGRRUXQLW
6PDOO
SLSH
'UDLQKRVH
SUHSDUHGE\XVHU
'HIURVWFDEOHIRUKHDWSXPS
:KHQWKHSLSLQJLVGLUHFWHGWRWKHULJKWSLSLQJSRZHU
&RUGDQGGUDLQSLSHVKRXOGEHWKHUPDOLQVXODWHGDQG
IL[HGRQWRWKHEDFNRIWKHXQLWZLWKDSLSLQJIL[HU
,QVHUWKHUH
ODUJH
SLSH
GUDLQ
KRVH
%DVH
3LSLQJIL[HU
$,QVHUWWKHSLSHIL[HUWRWKHVORW
ODUJH
SLSH
GUDLQ
KRVH
VPDOO
SLSH
3LSLQJIL[HU
%DVH
VPDOO
SLSH
%DVH
+RRNKHUH
%3UHVVWRKRRNWKHSLSHIL[HURQWRWKHEDVH
Piping Connection:
D&RQQHFWLQGRRUXQLWSLSHVZLWKWZRIL[VSDQQHUV3D\VSHFLDODWWHQWLRQ
WRWKHDOORZHGWRUTXHDVVKRZQEHORZWRSUHYHQWWKHSLSHVFRQQHFWRUV
DQGIODUHQXWVIURPEHLQJGHIRUPHGDQGGDPDJHG'RQRWXVHDGMXVWDEOHZUHQFKHV
E3UHWLJKWHQWKHPZLWKILQJHUVDWILUVWWKHQXVHWKHVSDQQHUV
Model
Pipe size
Torque Nut width
Min.thickness
1.0TR-2*, 3*&5*
Liquid Side (1/4″)
1.8kg·m
17mm
0.6mm
1.5TR-2*, 3*&5*
Liquid Side (1/4″)
1.8kg·m
17mm
0.6mm
2.0TR-4*
Liquid Side (3/8″)
Gas Side (1/2″)
3.5kg·m
22mm
0.6mm
5.5kg·m
24mm
0.6mm
Gas Side (1/2″)
5.5kg·m
24mm
0.6mm
Gas Side (5/8″)
7.5kg·m
27mm
0.6mm
1.0TR-2*, 3*&5*
1.5TR-2*, 3*&5*
2.0TR-4*
'RQRWFXWWKHSLSHLIFRQQHFWLQJSLSHUHTXLUHGLVOHVVWKDQPHWHU
5ROOIL[WKHSLSHZLWK2'8LQRUGHUWRJHWRSWLPXPSHUIRUPDQFHLQKRWVXPPHUFRQGLWLRQ
20
Installation instructions
4. Connecting of the Cable
)URQWSDQHO
Indoor Unit
&RQQHFWWKHSRZHUFRQQHFWLQJFRUGWRWKHLQGRRUXQLW
E\FRQQHFWLQJWKHZLUHVWRWKHWHUPLQDOVRQWKHFRQWURO
ERDUGLQGLYLGXDOO\LQDFFRUGDQFHZLWKWKHRXWGRRUXQLW
FRQQHFWLRQ
Indoor unit
Note: For some models, it is necessary to remove the cabinet to
7HUPLQDOLQVLGH
&DELQHW
&KDVVLV
connect to indoor unit terminal.
Outdoor Unit
5HPRYHWKHDFFHVVGRRUIURPWKHXQLWE\ORRVHQLQJ
WKHVFUHZ&RQQHFWWKHZLUHVWRWKHWHUPLQDOVRQWKH
FRQWUROERDUGLQGLYLGXDOO\DVWKHIROORZLQJ
6HFXUHWKHSRZHUFRQQHFWLQJFRUGRQWRWKHFRQWURO
ERDUGZLWKFDEOHFODPS
5HLQVWDOOWKHDFFHVVGRRUWRWKHRULJLQDOSRVLWLRQ
$FFHVVGRRU
7HUPLQDOLQVLGH
Outdoor unit
ZLWKWKHVFUHZ
4) 8VHDUHFRJQL]HGFLUFXLWEUHDNHUIRU.PRGHOEHWZHHQ
7KHSRZHUVRXUFHDQGWKHXQLW$GLVFRQQHFWLRQGHYLFHWR $GHTXDWHO\GLVFRQQHFWDOOVXSSO\OLQHPXVWEHILWWHG
The figures in this manual are based on the external
view of a standard model. Consequently, the shape
may differ from that of the air conditioner you have
selected.
Caution:
1. Never fail to have an individual power circuit specifically for the air conditioner. As for the method of
wiring, refer to the circuit diagram posted on the inside of the access door .
2.Comfirm that the cable thickness is as specified in the power source specification.
3.Check the wires and make sure that they are all tightly fastened after cable connection.
4. Be sure to install an earth leakage circuit breaker in wet or moist area.
Cable Specifications
Capacity
(Btu/h)
Power Cord
Normal
Type
cross-sectional
area
N
+99)
PP;
N
+99)
PP;
N
+99)599
PP;
Power connecting cord
Normal
Type
cross-sectional
area
7RLQGRRU
7RLQGRRU
7RLQGRRU
H05RN-F
PP;
+51)
PP;
+51)
PP;
21
Main power
supply(Note)
Installation instructions
Wiring Diagram
Make sure that the color of wires of the outdoor unit and the terminal No. are the same as those
of the indoor unit.
12K,18K,24K Model
For above models, the power supply are connected from indoor unit.
COOLING ONLY
Indoor unit
Outdoor unit
Terminal
1L
N
Terminal
Brown
Brown
Blue
Blue
1L
N
Power connecting cord
Yellow/Green
Yellow/Green
22
Installation instructions
Outdoor unit installation
1.Install Drain Port and Drain Hose (for heat-pump model only)
The condensate drains from the outdoor unit when the unit operates
in heating mode. In order not to disturb your neighbor and protect
the environment, install a drain port and a drain hose to direct the
condensate water. Just install the drain port and rubber washer to
the chassis of the outdoor unit, then connect a drain hose to the
port as the right figure shown.
Washer
Drain port
2. Install and Fix Outdoor Unit
Drain hose
(prepare by user)
Use rubber pad to fix with bolts and nuts tightly on a flat and strong
floor.If installed on the wall or roof, make sure to fix the mounting stand and rubber
pad well to prevent it from shaking due to serious vibration or strong wind.
3. Outdoor Unit Piping Connection
Remove the valve caps from the 2-way and 3-way valve.
Connect the pipes to the 2-way and 3-way valves separately according to the required torque.
4. Outdoor Unit Cable Connection (see previous page)
Leak Test/Evacuation/Gas Charging
The air which contains moisture remaining in the refrigeration cycle may cause a malfunction on the
compressor. After connecting the indoor and outdoor units, evacuate air and moisture from refrigerant
cycle using a vacuum pump, as shown below.
Note: To protect the environment, be sure not to discharge the refrigerant to the air directly.
See next page for air purging steps.
Vacuum pump
indoor unit
Refrigerant flow direction
2-way valve
3-way valve diagram
3-way valve
connect to indoor unit
(6) Open 1/4 turn
Service
port
(7) Turn to fully open the
valve
open position
spindle
(1) Turn
(8) Tighten
(1) Turn
(2) Turn
(8) Tighten
(7) Turn to fully open the valve
valve cap
needle
Valve cap
(8) Tighten
Connect to outdoor unit
Valve core
23
service port cap
Installation instructions
How to Purge Air Tubes:
1. Connect IDU & ODU connecting piping.
2. Connect the Manifold Gauge & Vaccum Pump to the charging valve.
3. Do the system evacuate atleast for 30 minutes with two stage vaccum pump when reaching a vaccum
of 10mm Hg absolutes, switch off the pump & hold the vaccum for 5 minutes and check
if the vaccume is breaking or not.
4. If vaccum breaks, then there is a leakage in system.
5. Rectify the leakage and do the vaccum again(Follow repeat of process)
6.If no vaccum breakage, open the spindles of 2-way & 3-way valves.
Then again check leakage with soap suds
Notes
To guarantee the unit working normally, please read the manual carefully before installation,
and try to install strictly according to this manual.
Do not let air enter the refrigeration system or discharge refrigerant when moving the air conditioner.
Earth the air conditioner properly.
Check the connecting cables and pipes carefully, make sure they are correct and firm before
connecting the power of the air conditioner.
There must be an air-break switch.
After installing, the consumer must operate the air conditioner correctly according to this manual,
keep a suitable storage for maintenance and move of the air conditioner in the future.
Type of fuse used on indoor unit controller is Φ5×20, with rating 2.5A/250V or 3.15A/250V. .
Caution: Mount with the lowest moving parts of indoor unit at Least 2.4m above floor or grade Level.
Warning: Risk of electric shock can cause injury or death: Disconnect all Remote electric power
supplies before servicing .
The maximum length of the connecting pipe between the indoor unit and outdoor unit should be less
than 5 meters. It will affect the efficiency of the air conditioner if the distance longer than that length.
If the supply cord is damaged, it must be replaced by the manufacturer, its service agent or
similarly qualified persons in order to avoid a hazard.
The appliance shall be installed in accordance with national wiring .
24
Warranty term
A RELATIONSHIP FOR LIFE
WITH 5 YEARS WARRANTY
:KLUOSRRORI,QGLD/WG:2,/RIIHUVWKHRULJLQDOSXUFKDVHU
KHUHLQDIWHU UHIHUUHG WR DV ³WKH FXVWRPHU´ RI WKH
Whirlpool Air ConditionerWKHEHQHILWRID
<HDUV:DUUDQW\DVGHWDLOHG EHORZ SURYLGHG WKH DLU
FRQGLWLRQHU LV LQ WKHSRVVHVVLRQ RI DQG XVHG E\ WKH
&XVWRPHUGXULQJ \HDUWHUP RI WKH ZDUUDQW\ IURP WKH
GDWH RISXUFKDVHDVSURYLGHGLQRULJLQDOLQYRLFH
L2QH<HDU:DUUDQW\
8QGHU WKH ZDUUDQW\ WKH FXVWRPHU LV ZDUUDQWHG WKDW WKH DLU FRQGLWLRQHU DQG DOO SDUWV
WKHUHRI H[FHSW WKH IURQW JULOO NQREV DQG SODVWLF SDUWV DUH IUHH IURP GHIHFWV LQ
PDWHULDODQGZRUNPDQVKLSXQGHUQRUPDOXVHDQGVHUYLFH:2,/
VREOLJDWLRQVXQGHU
WKLV:DUUDQW\VKDOOEHOLPLWHGWRUHSDLULQJRUSURYLGLQJWKHUHSODFHPHQWRIDQ\GHIHFWLYH
SDUW H[FHSW WKH IURQW JULOO NQREV DQG SODVWLF SDUWV RI DLU FRQGLWLRQHU ZKLFK SURYHV
GHIHFWLYH ZLWKLQ RQH \HDU IURP WKH GDWH RI RULJLQDO SXUFKDVH DQG ZKLFK RQ:2,/
V
H[DPLQDWLRQGLVFORVHVWRLWVVDWLVIDFWLRQWREHGHIHFWLYH
LL)RXU<HDU$GGLWLRQDO:DUUDQW\RQ&RPSUHVVRU
8QGHU WKH ZDUUDQW\ WKH FXVWRPHU LV ZDUUDQWHG WKDW WKH FRPSUHVVRU WR EH IUHH IURP
GHIHFWV LQ PDWHULDO DQG ZRUNPDQVKLS XQGHU QRUPDO XVH DQG VHUYLFH :2,/
V
REOLJDWLRQ XQGHU WKLV ZDUUDQW\ VKDOO EH OLPLWHG WR UHSDLULQJ RU SURYLGLQJ WKH
UHSODFHPHQWRIFRPSUHVVRUZLWKDQRWKHULQZRUNLQJFRQGLWLRQZKLFKSURYHVGHIHFWLYH
ZLWKLQ )RXU<HDUVFRPPHQFLQJLPPHGLDWHO\DIWHUWKHH[SLU\RIWKHGDWHRISXUFKDVH
DQGZKLFKRQ:2,/
VH[DPLQDWLRQGLVFORVHVWRLWVVDWLVIDFWLRQWREHGHIHFWLYH7KLV
ZDUUDQW\ FRYHUV WKH FRPSUHVVRU RQO\ ,W GRHV QRW FRYHU DQ\ RWKHU SDUW VXFK DV
UXQQLQJ FDSDFLWRU WKHUPRVWDW UHIULJHUDQW FRQVXPDEOHV VXFK DV *DV FKDUJLQJ 7KH
FRVWRIUHSODFHGSDUWVDQGFRQVXPDEOHVVKDOOEHERUQHE\WKHFXVWRPHU1RQRWLFHRI
H[SLU\SHULRGRIZDUUDQW\ZLOOEHJLYHQE\:2,/
/LPLWDWLRQVRI:DUUDQW\
7KLV:DUUDQW\VKDOOQRWDSSO\WRGHIHFWVDULVLQJLQ:2,/
VRSLQLRQE\UHDVRQVRI
DFFLGHQW DOWHUDWLRQ DEXVH PLVXVH QHJOHFW LPSURSHU LQVWDOODWLRQ XQDXWKRUL]HG
UHSDLUVRUUHSODFHPHQWRIRULJLQDOSDUWVILUHIORRGRURWKHU DFWVRI*RG&KDUJHV
IRUUHSDLURIWKLVQDWXUHLIFDUULHGRXWZLOOKDYHWREHERUQHE\WKHFXVWRPHU
25
Warranty term
7KLV:DUUDQW\KROGVJRRGRQO\VRORQJDVWKHUHLVFRUUHFWXVHDQGPDLQWHQDQFHRI
WKHDLUFRQGLWLRQHUDVGHWDLOHGLQWKH8VHUDQG&DUHJXLGH
7KLV:DUUDQW\ZLOOFRQWLQXHWREHLQIRUFHIRUWKHWHUPKHUHLQVSHFLILHGLUUHVSHFWLYH
RIZKDWUHSODFHPHQWVPD\EHSURYLGHGXQGHULWDQG6XFKUHSODFHPHQWLQFOXGLQJRQ
FRPSUHVVRUVKDOOQRWDWWUDFWDQ\IUHVK:DUUDQW\
7KLV :DUUDQW\ LV YDOLG DQG ELQGLQJ SURYLGHG WKDW QR VHUYLFH RU UHSDLU KDV EHHQ
DWWHPSWHG RU HIIHFWHG E\ DQ\RQH RWKHU WKDQ WKH $XWKRUL]HG 6HUYLFH )UDQFKLVHH DQG
WKDWLPPHGLDWHQRWLILFDWLRQRIDQ\DOOHJHGGHIHFW LVJLYHQWR:2,/RUWKH$XWKRUL]HG
6HUYLFH)UDQFKLVHH
7KLV:DUUDQW\ZLOOFHDVHWREHDSSOLFDEOHWRGHIHFWVDULVLQJRXWRISXOOHGRXWSRZHU
FDUGEORZQIXVHRULPSURSHUHOHFWULFDOFLUFXLWZKLFKUHVXOWLQQRQRSHUDWLRQRIWKHDLU
FRQGLWLRQHU
:2,/
V HPSOR\HHV RU GHDOHUV DQG RU $XWKRUL]HG 6HUYLFH )UDQFKLVHH KDYH QR
DXWKRULW\WRYDU\WKHWHUPVRIWKLV:DUUDQW\
D7KH2QH<HDU:DUUDQW\ZLOODXWRPDWLFDOO\WHUPLQDWHRQWKHH[SLU\RIWKH:DUUDQW\
SHULRG RI WZHOYH PRQWKV IURP GDWH RI SXUFKDVH DV SHU LQYRLFH HYHQ LI WKH DLU
FRQGLWLRQHUPD\QRWEHLQXVHIRUDQ\WLPHGXULQJWKH:DUUDQW\SHULRGIRUDQ\UHDVRQ
ZKDWVRHYHU LQFOXGLQJ DQ\ WHFKQLFDO EUHDNGRZQV DQG WKH WLPH WRNHQ IRU VXFK
UHSDLUVUHSODFHPHQWV RI SDUWV DQG WUDQVLW ZKHWKHU XQGHU WKLV :DUUDQW\ RU RWKHUZLVH
VKDOOQRWEHH[FOXGHGIURPWKH:DUUDQW\SHULRG
E 7KH :DUUDQW\ RQ FRPSUHVVRU ZLOO DXWRPDWLFDOO\ WHUPLQDWH RQ WKH H[SLU\ RI )RXU
<HDUVHYHQLIWKHDLUFRQGLWLRQHUPD\QRWEHLQXVHIRUDQ\UHDVRQZKDWVRHYHU
D :KLOH :2,/ ZLOO PDNH HYHU\ HIIRUW WR FDUU\ RXW UHSDLUVUHSODFHPHQWV RI SDUWV
XQGHUWKLV:DUUDQW\DVVRRQDVSRVVLEOHLWLVH[SUHVVO\PDGHFOHDUWKDW:2,/VKDOO
QRWEHOLDEOHWRGRVRZLWKLQDQ\VSHFLILHGSHULRGRIWLPH
E,QWKHHYHQWRIDWUHSDLUVUHSODFHPHQWVRIDQ\SDUWVWKLV:DUUDQW\ZLOOWKHUHDIWHU
FRQWLQXHWRUHPDLQLQIRUFHRQO\IRUWKHXQH[SLUHGSHULRGRIWKH:DUUDQW\
,WLVHQWLUHO\OHIWWR:2,/
VGLVFUHWLRQWRHIIHFWUHSDLUVUHSODFHPHQWVRISDUWVDWWKLV
VLWHRILQVWDOODWLRQRUDWDQ\VHUYLFHVWDWLRQRILWV%UDQFKHVRURILWV$XWKRUL]HG6HUYLFH
)UDQFKLVHH
7KH :DUUDQW\ ZLOO VWDQG YRLG LI DLU FRQGLWLRQHU LV LQVWDOOHG VHUYLFHG RSHQHG
WDPSHUHGUHSDLUHGHWFE\DQ\XQDXWKRUL]HGSHUVRQ
26
Warranty term
:2,/ZLOOQRWEHUHVSRQVLEOHIRUFRROLQJDQGFRQGHQVHUFRLOLIWKHDLUFRQGLWLRQHU
LV LQVWDOOHG QHDU WKH PXGG\ VHZDJHVDV WR[LF JDVHV DUH KDUPIXO IRU WKH $LU
&RQGLWLRQHU :2,/DEVROYHVDOOOLDELOLW\LQFDVHZKHUHWKHIROORZLQJVLWXDWLRQVDUHIRXQGE\WKH
VHUYLFHHQJLQHHUGXULQJWKHLUYLVLWVWRFXVWRPHUSUHPLVHVRQVHUYLFHFDOO
D)DXOW\6XEVWDQGDUGZLULQJXVHG
E'HIHFWLYH6WDELOL]HU
F'LUW\)LOWHU
G3DUWVGDPDJHGGXHWR5DWELWLQJ
,QFDVHVWKHDERYHFRQGLWLRQVDUHREVHUYHGDWWKHWLPHRIYLVLWE\WKH(QJLQHHUWKHQ
WKHFXVWRPHUVKDOOEHOLDEOHWREHDUWKHYLVLWFKDUJHVRI56RYHUDQGDERYHWKH
RWKHUUHSDLUFKDUJHVLQFXUUHGGXULQJWKHSURFHVV
7KH&RPSDQ\UHVHUYHVWKHULJKWWRUHYLVHWKHYLVLWFKDUJHVDWLWVRZQGLVFUHWLRQDQG
WKHFXVWRPHUZLOOEHOLDEOHWRSD\WKHUHYLVHGYLVLWFKDUJHVDVPD\EHDSSOLFDEOHRQ
WKHGDWHRIYLVLW
7KH FXVWRPHU DW DOO WLPHV VKDOO SUHVHUYH WKH RULJLQDO LQYRLFH IRU QHFHVVDU\
YHULILFDWLRQDQGSURGXFHDVDQGZKHQUHTXLUHGE\:2,/
:2,/UHVHUYHVWKHULJKWWRDOWHUWKHWHUPVDQGFRQGLWLRQVRIWKHSUHVHQWZDUUDQW\DW
DQ\WLPHZLWKLWVVROHGLVFUHWLRQZLWKRXWDQ\SULRUQRWLFH
15.
"Whirlpool Products without barcode label affixed on the product will not be
covered under warranty."
27
28
:KLUOSRRORI,QGLD/WG
&XVWRPHU&RS\
,QVWDOODWLRQ'HPR&KHFN6KHHW$LUFRQGLWLRQHU
&XVWRPHU0DFKLQHGHWDLOV
'DWHRI,QVSHFWLRQ
%UDQFK
&XVWRPHU1DPH$GGUHVV
631DPH
0RGHO1R
'DWHRI3XUFKDVH'23
0DFKLQH6UQR
3KRQHQR
,'86U1R
0RELOH1R
2'86U1R
3XUFKDVHGIURP'HDOHU1DPH
,QVWDOOHG%\,QVWDOOHU
V1DPH
66'730RGHUQ7UDGH,QVWLWXWLRQDOVDOH2WKHUV
66'7363/RFDO
,'8/RFDWLRQ
2N1RW2N
2'8ORFDWLRQ
,'8OHYHO&KHFNZLWK6SULWOHYHO
2N1RW2N
/HQJWKRI&RSSHUSLSH
'UDLQ3LSHVORSH
2N1RW2N
'LVWDQFH%HWZHHQ,'82'8
,QVWDOODWLRQ&RQGLWLRQV6$&
2N1RW2N
(OHFWULFDO2WKHUGHWDLO
&RQGLWLRQRI+RXVH:LULQJ
$PS6WDELOL]HU
0&%5DWLQJ
<HV1R
0DNH
(DUWKLQJFRQGLWLRQV
,I9ROWDJHEHWZHHQ(1LV9$GYLVH
&XVWRPHUWRFRQVXOWDQHOHFWULFLDQ
6WDELOL]HU,QSXW
9ROWV
6WDELOL]HU2XWSXW
9ROWV
$PSHUV'UDZQ
3(5)250$1&(5810$&+,1()250,187(6 &+(&.7+()2//2:,1*
$PELHQW7HPSR&
'HOWD7 77VKRXOGEHDSSUR[7RR&
$LU,QOHW7HPSR&7
*ULOO7HPSR&7
)HDWXUHV([SODQDWLRQV
&RROPRGH
<HV1R
'LPIXQFWLRQ
<HV1R
'U\0RGH
<HV1R
$URXQG8
<HV1R
)DQ0RGH
<HV1R
<HV1R
7XUER4XLFN&RRO
<HV1R
)LOWHU&OHDQLQJPHWKRG
5HVHWWLQJ)LOWHU
FOHDQLQJ/('
6OHHSPRGH
<HV1R
3RZHU6DYHU
<HV1R
6ZLQJ
<HV1R
WK6HQVH
<HV1R
7LPHUVHWWLQJ
<HV1R
7HPSHUDWXUHVHWWLQJ
<HV1R
<HV1R
*ULOODQG3ODVWLFSDUWVEH\RQGGD\VIURPWKH'DWHRI3XUFKDVHDUHQRWFRYHUGXQGHUZDUUDQW\
1RWH0DQXIDFWXUHUDEVROYHDOOOLDELOLW\LIIROORZLQJVLWXDWLRQVDUHREVHUYHGE\6HUYLFH(QJLQHHU
$)DXOW\6XE6WDQGDUG:LULQJ
&6WDELOL]HU1:3/'HIHFWLYH
%)LOWHUFOHDQLQJ
'5H'HPR
,QFDVHDERYHVLWXDWLRQVDUHQRWLFHGE\6HUYLFH(QJLQHHU:LWKLQ<UIURP'239LVLWFKDUJHVRI5VZLOOEHSD\DEOHE\
WKHFXVWRPHURYHUDQGDERYHWKHWKHRWKHUUHSDLULQJFKDUJHVLIDSSOLFDEOHLQFXUUHGGXULQJWKHSURFHVV
1DPH6LJQRI(QJLQHHU
29
&XVWRPHUV6LJQDWXUH
,KDYHXQGHUVWRRGDOOWKHZDUUDQW\WHUPV
Installation commissioning
813$&.,1*
6UQR &KHFNSRLQWV
0DFKLQHFKHFNHGIRUGDPDJHV'DPDJHVREVHUYHG
2EVHUYDWLRQV
<HV1R
5HPDUNV
,I\HVSURYLGHGHWDLOV
5HPRYHKDQGXQLWIURP,'8
<HV1R
5HPRYH)LEUHWDSHVIURPWKHIURQWFRYHU
<HV1R
,VWKHVWUHQJWKRILQVWDOODWLRQHQRXJKERWK,'82'8
'LUHFWLRQRIFRQGHQVRURIPDFKLQHLVWRZDUGV
7KHXQLWLVVHFXUHGIL[HGZLWKKDQJHUSODWH
<HV1R
1RUWK6RXWK:HVW(DVW
<HV1R
<HV1R
<HV1R
<HV1R
<HV1R
%UHGWKZLVHOHYHO'HSWKZLVHLQFOLQDWLRQRIURRPDLUFRQGLWLRQHUDUHQRUPDO
DQGQRDLUORFNVLVLQWKHGUDLQSLSH
7KHKHDWLQVXODWLYHPDWHULDOLVVHFXUHO\DWWDFKHGRQWKHFRQQHFWLRQVRIWKH
SLSLQJVRIWKH,'8
3XWSXWW\WRFORVHSLSLQJKROHLQVLGHRXWVLGHRIWKHZDOOWRDYRLGDLUOHDNDJH
LQVWDOODWLRQ
7KHUHLVQRREVWDFOHVDERXWWKHDLURXWOHWV
*DV/HDNDJHLVFKHFNHGDWHDFKRIWKHSLSHFRQQHFWLRQV
7KHYROWDJHDWWKHH[FOXVLYHSRZHURXWOHWLVZLWKLQWKHUDQJHRIUDWHGYROWDJH
<HV1R
,VWKHIXVHDQGZLUHJDXJHXVHGDUHWKHRIIROORZLQJVSHFLILFDWLRQ
$OZD\VXVHYROWDJHVWDEOLVHU
<HV1R
30
:KLUOSRRORI,QGLD/WG
&RPSDQ\&RS\
,QVWDOODWLRQ'HPR&KHFN6KHHW$LUFRQGLWLRQHU
&XVWRPHU0DFKLQHGHWDLOV
'DWHRI,QVSHFWLRQ
%UDQFK
&XVWRPHU1DPH$GGUHVV
631DPH
0RGHO1R
'DWHRI3XUFKDVH'23
0DFKLQH6UQR
3KRQHQR
,'86U1R
0RELOH1R
2'86U1R
3XUFKDVHGIURP'HDOHU1DPH
,QVWDOOHG%\,QVWDOOHU
V1DPH
66'730RGHUQ7UDGH,QVWLWXWLRQDOVDOH2WKHUV
66'7363/RFDO
,'8/RFDWLRQ
2N1RW2N
2'8ORFDWLRQ
,'8OHYHO&KHFNZLWK6SULWOHYHO
2N1RW2N
/HQJWKRI&RSSHUSLSH
'UDLQ3LSHVORSH
2N1RW2N
'LVWDQFH%HWZHHQ,'82'8
,QVWDOODWLRQ&RQGLWLRQV6$&
2N1RW2N
(OHFWULFDO2WKHUGHWDLO
&RQGLWLRQRI+RXVH:LULQJ
$PS6WDELOL]HU
0&%5DWLQJ
<HV1R
0DNH
(DUWKLQJFRQGLWLRQV
,I9ROWDJHEHWZHHQ(1LV9$GYLVH
&XVWRPHUWRFRQVXOWDQHOHFWULFLDQ
6WDELOL]HU,QSXW
9ROWV
6WDELOL]HU2XWSXW
9ROWV
$PSHUV'UDZQ
3(5)250$1&(5810$&+,1()250,187(6 &+(&.7+()2//2:,1*
$PELHQW7HPSR&
'HOWD7 77VKRXOGEHDSSUR[7RR&
$LU,QOHW7HPSR&7
*ULOO7HPSR&7
)HDWXUHV([SODQDWLRQV
&RROPRGH
<HV1R
'LPIXQFWLRQ
<HV1R
'U\0RGH
<HV1R
$URXQG8
<HV1R
)DQ0RGH
<HV1R
<HV1R
7XUER4XLFN&RRO
<HV1R
)LOWHU&OHDQLQJPHWKRG
5HVHWWLQJ)LOWHU
FOHDQLQJ/('
6OHHSPRGH
<HV1R
3RZHU6DYHU
<HV1R
6ZLQJ
<HV1R
WK6HQVH
<HV1R
7LPHUVHWWLQJ
<HV1R
7HPSHUDWXUHVHWWLQJ
<HV1R
<HV1R
*ULOODQG3ODVWLFSDUWVEH\RQGGD\VIURPWKH'DWHRI3XUFKDVHDUHQRWFRYHUGXQGHUZDUUDQW\
1RWH0DQXIDFWXUHUDEVROYHDOOOLDELOLW\LIIROORZLQJVLWXDWLRQVDUHREVHUYHGE\6HUYLFH(QJLQHHU
$)DXOW\6XE6WDQGDUG:LULQJ
&6WDELOL]HU1:3/'HIHFWLYH
%)LOWHUFOHDQLQJ
'5H'HPR
,QFDVHDERYHVLWXDWLRQVDUHQRWLFHGE\6HUYLFH(QJLQHHU:LWKLQ<UIURP'239LVLWFKDUJHVRI5VZLOOEHSD\DEOHE\
WKHFXVWRPHURYHUDQGDERYHWKHWKHRWKHUUHSDLULQJFKDUJHVLIDSSOLFDEOHLQFXUUHGGXULQJWKHSURFHVV
1DPH6LJQRI(QJLQHHU
31
&XVWRPHUV6LJQDWXUH
,KDYHXQGHUVWRRGDOOWKHZDUUDQW\WHUPV
Installation commissioning
813$&.,1*
6UQR &KHFNSRLQWV
0DFKLQHFKHFNHGIRUGDPDJHV'DPDJHVREVHUYHG
2EVHUYDWLRQV
<HV1R
5HPDUNV
,I\HVSURYLGHGHWDLOV
5HPRYHKDQGXQLWIURP,'8
<HV1R
5HPRYH)LEUHWDSHVIURPWKHIURQWFRYHU
<HV1R
,VWKHVWUHQJWKRILQVWDOODWLRQHQRXJKERWK,'82'8
'LUHFWLRQRIFRQGHQVRURIPDFKLQHLVWRZDUGV
7KHXQLWLVVHFXUHGIL[HGZLWKKDQJHUSODWH
<HV1R
1RUWK6RXWK:HVW(DVW
<HV1R
<HV1R
<HV1R
<HV1R
<HV1R
%UHGWKZLVHOHYHO'HSWKZLVHLQFOLQDWLRQRIURRPDLUFRQGLWLRQHUDUHQRUPDO
DQGQRDLUORFNVLVLQWKHGUDLQSLSH
7KHKHDWLQVXODWLYHPDWHULDOLVVHFXUHO\DWWDFKHGRQWKHFRQQHFWLRQVRIWKH
SLSLQJVRIWKH,'8
3XWSXWW\WRFORVHSLSLQJKROHLQVLGHRXWVLGHRIWKHZDOOWRDYRLGDLUOHDNDJH
LQVWDOODWLRQ
7KHUHLVQRREVWDFOHVDERXWWKHDLURXWOHWV
*DV/HDNDJHLVFKHFNHGDWHDFKRIWKHSLSHFRQQHFWLRQV
7KHYROWDJHDWWKHH[FOXVLYHSRZHURXWOHWLVZLWKLQWKHUDQJHRIUDWHGYROWDJH
<HV1R
,VWKHIXVHDQGZLUHJDXJHXVHGDUHWKHRIIROORZLQJVSHFLILFDWLRQ
$OZD\VXVHYROWDJHVWDEOLVHU
<HV1R
32
33
Declaration on Hazardous Substances : EWaste Rules
Some components used in manufacturing this Air Conditioner contain low content of some
substances classified as hazardous, according to EWaste Rules published by the
Government of India. These do not pose any risk to the conditioning of air inside the room.
Nor does physical contact with the Air Conditioner during the life of the product
endanger health or safety to humans or any living creature. However, if the Air Conditioner
is not disposed safely at the end of its life, inappropriate handling of waste may pose risks
to health and environment. Hence, it is our advice that you contact Whirlpool when you
are ready to discard the product so that we can channelize the appliance and its
components for safe disposal.
Was this manual useful for you? yes no
Thank you for your participation!

* Your assessment is very important for improving the work of artificial intelligence, which forms the content of this project

Download PDF

advertisement