ambient lighting kit installation

ambient lighting kit installation
Proper Wire Splicing Techniques
1
GENERAL PROCEDURES
Proper Splicing
Techniques
NOTE: Follow this procedure when a wire can be
spliced without cutting the wire in half.
1.
Strip approximately two inches of insulation
from the wire to be installed in the vehicle.
4.
2.
Insert the new wire between the parted strands.
If more than one wire is being spliced, wrap
them in opposite directions.
On the vehicle wire to be spliced into, strip one
inch of insulation form the wire.
NOTE: Use Rosin Core Mildly-Activated (RMA)
Solder. Do not use Acid Core Solder.
5.
Wrap the new wire around one side of the split
stands, then wrap it around the other side.
•
3.
Solder the connection.
On the vehicle wire to be spliced into, separate
the strands to allow the new wire to be placed
between the parted strands of wire.
Page 1 of 2
© Copyright Ford 2010 FoMoCo
Proper Wire Splicing Techniques
2
GENERAL PROCEDURES (Continued)
6.
Wrap the connection with electrical tape so the
tape covers the wires approximately two inches
on either side of the connection.
•
Tape the wires together as shown in the
illustration.
NOTE: Use Rosin Core Mildly-Activated (RMA)
Solder. Do not use Acid Core Solder.
3.
Splicing End to End Connections
Lay the upper strand of wire to one side, then
lay the lower strand of wire to the other side as
shown in the illustration.
•
Solder the wires together.
NOTE: When both ends of the wire are cut, use
the end to end wire splicing procedure.
NOTE: Follow the steps below for end to end wire
splicing.
1.
To make an end to end connection, start by
stripping one inch of insulation from each of
the wires. Part each wire into equal strands as
shown in the illustration.
4.
2.
Wrap the connection with electrical tape so the
tape covers the wires approximately two inches
on either side of the connection.
Place the wires next to each other and twist the
upper and lower strands together as shown.
Page 2 of 2
© Copyright Ford 2010 FoMoCo
2011 Mustang
Ambient Lighting Kit
Manual Table of Contents
AMBIENT LIGHTING KIT INSTALLATION
CONTENTS
INSTALLATION
Ambient Lighting Kit
GENERAL PROCEDURES
Wire Splicing Techniques
Contents
SK9A8J-13E700-AA
© Copyright Ford 2010 FoMoCo
2011 Mustang
Ambient Lighting Kit
Page 1
INSTALLATION
Superseded by:SGML_id=‘‘n1192769’’
Effect:Frozen: ‘‘N’’ ‘‘2010’’ ‘‘MIKETEST2’’ ‘‘19’’
‘‘020’’
Lighting
Ambient Lighting Kit Contents
1.
Review the Ambient Lighting Kit Contents.
Ambient Lighting Kit
QUANTITY
DESCRIPTION
1
DISTRIBUTION BOX
HARNESS ASSEMBLY
1
CML MODULE
2
LIGHT ROD
1
SWITCH
1
HARDWARE KIT
Vehicles With Manual Transmission
3.
Place the gearshift lever in the NEUTRAL
position.
4.
Remove the gearshift lever knob.
•
Turn the gearshift lever knob in a
counterclockwise direction.
Prepare Vehicle
2.
Apply the parking brake.
Page 1 of 6
SK9A8J-13E700-AA
© Copyright Ford 2010 FoMoCo
2011 Mustang
Ambient Lighting Kit
Page 2
INSTALLATION (Continued)
Vehicles With Automatic Transmission
Install Modules
5.
NOTE: Do not touch the adhesive, reduced
adhesion may result.
Turn the ignition key to the ‘‘ON’’ position and
move the shift lever to the ‘‘NEUTRAL’’
position.
•
6.
Turn the ignition key to the ‘‘OFF’’
position.
NOTICE: When prying on a component, a
non-marring tool must be used or damage to
the component may occur.
Remove the selector lever trim ring.
•
With a non-marring tool, lift the selector
lever trim ring upward.
All Vehicles
7.
Open the storage compartment door.
8.
Remove the floor console finish panel.
•
•
9.
NOTE: Do not remove the clear protective film
from the back of the CML module.
12. Identify the distribution box with the double
sided adhesive pad attached to the back.
13. Identify the CML module with the clear
protective film attached to the back.
14. Apply the adhesive pad supplied in the
hardware kit, directly to the clear protective
film of the CML module.
15. Remove the protective backing from the
adhesive pad of both modules and secure both
of the modules into the center console as shown
below.
Lift the floor console finish panel upward to
release the retaining clips.
NOTE: Wiring not shown for clarity.
Disconnect the traction/hazard/trunk switch
electrical connector.
Remove the 2 center finish panel screws.
10. Remove the center finish panel.
•
Pull outward on the panel to disengage the
clips.
•
Disconnect the electrical connectors.
11. Remove the RH kick panel.
•
Remove the door scuff plate.
•
Remove the kick panel.
Page 2 of 6
SK9A8J-13E700-AA
© Copyright Ford 2010 FoMoCo
2011 Mustang
Ambient Lighting Kit
Page 3
INSTALLATION (Continued)
Route Harness
NOTE: Avoid routing ambient lighting wires near
sharp edges and moving components.
NOTE: Ensure the ambient lighting wires are
secure and do not interfere with vehicle operation.
16. Route the 2-wire power harness to the
passenger footwell area.
17. Route the light engine LED harness to the
driver footwell area.
Install LED
NOTE: If this vehicle uses a liner in the cup
holder, carefully mark the LED location onto the
liner. Then remove the liner and use a 1/2’’ hollow
punch to punch a hole in the liner to allow the LED
light to pass through the liner. Re-install the liner
when complete. One source of the hollow punch set
is Harbor Freight, item # 03838 or use an
equivalent 1/2’’ hollow punch from another source.
20. Route the Exposed LED housing with the single
harness wire to the 5/16’’ (8mm) hole above
the utility panel.
NOTE: Avoid driver distraction by locating the cup
holder LED in the 7 o’clock position out of the
driver line of sight.
NOTE: The LED will be mounted to the console
cup holder later in this procedure.
18. Locate and drill 5/16’’ (8mm) hole in the Rear
cup holder as shown below.
21. Attach the LED lens to the exposed LED
housing.
19. Working from inside the console storage box
locate and drill 5/16’’ (8mm) hole above the
utility panel as shown below.
Page 3 of 6
SK9A8J-13E700-AA
© Copyright Ford 2010 FoMoCo
2011 Mustang
Ambient Lighting Kit
Page 4
INSTALLATION (Continued)
Install Light Rods
NOTE: One end of the light rod is silver the other
end is printed with the part number. The light
engine LED housing is attached to the part number
end of the light rod.
24. Connect the light engine LED housing
containing (2) wires to the light rod.
•
Attach to the part number end of the light
rod.
22. Assemble (4) light rod retainer clips using parts
from the hardware kit as shown below.
•
Attach saddle clip to J-nut using supplied
hardware.
•
Attach tie strap to saddle clip.
25. Route the remaining light engine LED housing
to the passenger footwell area.
26. Using the assembled hardware attach the 9’’
light rod to the passenger lower dash support as
shown below.
23. Using the assembled hardware attach the 12’’
light rod to the lower dash in the driver
footwell as shown below.
•
The silver end of the light rod is placed
outboard, closest to the vehicle door.
•
Locate clips
•
Secure tie straps.
Page 4 of 6
•
The silver end of the 9’’ light rod is placed
outboard, closest to the vehicle door.
•
Locate clips
•
Secure tie straps.
SK9A8J-13E700-AA
© Copyright Ford 2010 FoMoCo
2011 Mustang
Ambient Lighting Kit
Page 5
INSTALLATION (Continued)
NOTE: Glove compartment shown open for clarity.
Power and Ground Connections
NOTE: For proper wire splicing techniques click
here.
31. Connect the Black ground wire from the
ambient lighting harness to the chassis ground
point at the driver kick panel or in a suitable
grounding location.
27. Connect the light engine LED housing to the
light rod.
•
Attach to the part number end of the light
rod.
Install Switch
28. Locate and drill 11/16’’ (17.5mm) hole In the
floor console compartment as shown below.
32. NOTE: A DVOM connected to the correct wire
will show 0V when the park lamps switch in
the off position , then show 12V when the
when the park lamps switch in the on position.
A logic probe will show ground on the correct
wire when the park lamps switch in the off
position, then show power when the park lamps
switch is in the on position
Identify the Violet/White parking light circuit
wire at the Smart Junction Box (SJB)
Connector C2280E Pin 6.
29. File (2) Switch locating notches in the 11/16’’
(17.5mm) hole as shown above.
33. Connect the White wire from the ambient
lighting harness to the violet/white park lamp
circuit wire at the SJB Connector C2280E Pin
6.
30. Install the ambient lighting switch into the floor
console.
•
Connect the ambient lighting switch.
Page 5 of 6
SK9A8J-13E700-AA
© Copyright Ford 2010 FoMoCo
2011 Mustang
Ambient Lighting Kit
Page 6
INSTALLATION (Continued)
39. Install the LED housing and lens to the console
cup holder.
Install Trim
34. NOTE: Ensure the ambient lighting wires are
secure and do not interfere with vehicle
operation.
Use the supplied 4’’ tie straps to secure the
ambient lighting harness wires.
41. Install the floor console finish panel.
35. Install the RH kick panel.
•
Install the RH kick panel.
•
Install the door scuff plate.
40. Use the supplied 4’’ tie straps to secure the
unused LED housing and ambient lighting
harness wires.
36. Install the center finish panel.
•
Connect the electrical connector.
•
Push the floor console finish panel
downward to engage the retaining clips.
42. Close the storage compartment lid.
•
Connect the electrical connectors.
•
Push inward on the panel to engage the
retaining clips.
Vehicles With Manual Transmission
43. Install the gearshift lever knob.
37. Install the 2 center finish panel screws.
38. Identify the LED housing with the single
harness wire.
•
Turn the gearshift lever knob in a clockwise
direction.
Vehicles With Automatic Transmission
44. Install the floor shifter trim ring.
Page 6 of 6
•
Push the floor shifter trim ring downward.
•
Place the gearshift lever in the PARK
position.
•
Release the parking brake.
SK9A8J-13E700-AA
© Copyright Ford 2010 FoMoCo
2011 Fusion/Milan/MKZ
Ambient Lighting Kit
Manual Table of Contents
AMBIENT LIGHTING KIT INSTALLATION
CONTENTS
INSTALLATION
Ambient Lighting Kit
GENERAL PROCEDURES
Wire Splicing Techniques
Contents
SK9A8J-13E700-AA
© Copyright Ford 2010 FoMoCo
2011 Fusion/Milan/MKZ
Ambient Lighting Kit
Page 1
INSTALLATION
Superseded by:SGML_id=‘‘n1192769’’
Effect:Frozen: ‘‘N’’ ‘‘2010’’ ‘‘MIKETEST2’’ ‘‘19’’
‘‘020’’
Lighting — Fusion(id=n1192780)
Ambient Lighting Kit Contents
1.
Review the Ambient Lighting Kit Contents.
Ambient Lighting Kit
QUANTITY
DESCRIPTION
1
DISTRIBUTION BOX
HARNESS ASSEMBLY
1
CML MODULE
2
LIGHT ROD
1
SWITCH
1
HARDWARE KIT
Vehicles With Manual Transmission
3.
Place the gearshift lever in the NEUTRAL
position.
4.
Remove the gearshift lever knob.
•
Turn the gearshift lever knob in a
counterclockwise direction.
Vehicles With Automatic Transmission
5.
Prepare Vehicle
Turn the ignition key to the ‘‘ON’’ position and
move the shift lever to the ‘‘NEUTRAL’’
position.
2.
•
Apply the parking brake.
Page 1 of 6
SK9A8J-13E700-AA
Turn the ignition key to the ‘‘OFF’’
position.
© Copyright Ford 2010 FoMoCo
2011 Fusion/Milan/MKZ
Ambient Lighting Kit
Page 2
INSTALLATION (Continued)
6.
NOTICE: When prying on a component, a
non-marring tool must be used or damage to
the component may occur.
14. Remove the driver sill plate.
•
Pull the front inboard section of the scuff
plate trim panel outward to release the 1
retaining clip.
•
NOTE: NOTE: The 3 retaining clips must
stay attached to the door weather strip and
pinch weld.
Remove the selector lever trim ring.
•
With a non-marring tool, lift the selector
lever trim ring upward.
All Vehicles
7.
Open the storage compartment door.
8.
Remove the floor console finish panel.
•
•
9.
Lift the scuff plate trim panel straight up to
release the scuff plate trim panel from the 3
retaining clips.
Install Modules
Lift the floor console finish panel upward to
release the retaining clips.
Disconnect the electrical connectors, if
equipped.
Remove the front utility tray.
•
Using a non-marring tool, pry upward to
release the retaining clips.
•
Disconnect the electrical connectors.
10. Remove the upper storage compartment mat
and the 2 upper storage compartment screws.
11. Remove the upper storage compartment.
•
•
Pull the upper storage compartment toward
the rear of the vehicle to release the 5
retaining clips.
Disconnect the electrical connector, if
equipped.
NOTE: Do not touch the adhesive, reduced
adhesion may result.
NOTE: Do not remove the clear protective film
from the back of the CML module.
15. Identify the distribution box with the double
sided adhesive pad attached to the back.
16. Identify the CML module with the clear
protective film attached to the back.
17. Apply the adhesive pad supplied in the
hardware kit, directly to the clear protective
film of the CML module.
18. Remove the protective backing from the
adhesive pad of both modules and secure both
of the modules inside the center console as
Shown below.
12. Remove the 2 center finish panel screws.
13. Remove the center finish panel.
•
Pull outward on the panel to disengage the
clips.
•
Disconnect the electrical connectors.
Page 2 of 6
SK9A8J-13E700-AA
© Copyright Ford 2010 FoMoCo
2011 Fusion/Milan/MKZ
Ambient Lighting Kit
Page 3
INSTALLATION (Continued)
Route Harness
NOTE: Avoid routing ambient lighting wires near
sharp edges and moving components.
NOTE: Ensure the ambient lighting wires are
secure and do not interfere with vehicle operation.
19. Route the light engine LED harness and the
2-wire power harness to the driver footwell
area.
20. Route the switch harness and the harness
containing the exposed LED ends to the console
box area.
Install LED
23. Route the Exposed LED housing with the single
harness wire to the 5/16’’ (8mm) hole in the
front of the console box.
NOTE: If this vehicle uses a liner in the cup
holder, carefully mark the LED location onto the
liner. Then remove the liner and use a 1/2’’ hollow
punch to punch a hole in the liner to allow the LED
light to pass through the liner. Re-install the liner
when complete. One source of the hollow punch set
is Harbor Freight, item # 03838 or use an
equivalent 1/2’’ hollow punch from another source.
NOTE: Avoid driver distraction by locating the cup
holder LED in the 6 o’clock position out of the
driver line of sight.
21. Locate and drill 5/16’’ (8mm) hole in the Rear
cup holder as shown below.
24. Attach the LED lens to the exposed LED
housing.
22. Working from inside the console storage box
locate and drill 5/16’’ (8mm) hole in the front
of the console box as shown below.
Page 3 of 6
SK9A8J-13E700-AA
© Copyright Ford 2010 FoMoCo
2011 Fusion/Milan/MKZ
Ambient Lighting Kit
Page 4
INSTALLATION (Continued)
Install Light Rods
NOTE: One end of the light rod is silver the other
end is printed with the part number. The light
engine LED housing is attached to the part number
end of the light rod.
27. Connect the light engine LED housing
containing (2) wires to the light rod.
•
Attach to the part number end of the light
rod.
25. Assemble (2) light rod retainer clips using parts
from the hardware kit as shown below.
•
Attach saddle clip to J-nut using supplied
hardware.
•
Attach tie strap to saddle clip.
28. Route the remaining light engine LED housing
to the passenger footwell area.
29. Using included wire ties, secure the 9’’ light
rod to the wire harness below the passenger
lower dash, as shown below.
26. Using the assembled hardware attach the 12’’
light rod to the lower dash in the driver
footwell as shown below.
•
The silver end of the 12’’ light rod is placed
outboard, closest to the vehicle door.
•
Locate clips
•
Secure tie straps.
Page 4 of 6
•
The silver end of the 9’’ light rod is placed
outboard, closest to the vehicle door.
•
Secure the tie straps.
SK9A8J-13E700-AA
© Copyright Ford 2010 FoMoCo
2011 Fusion/Milan/MKZ
Ambient Lighting Kit
Page 5
INSTALLATION (Continued)
NOTE: View looking up from passenger footwell.
Power and Ground Connections
NOTE: For proper wire splicing techniques click
here.
34. Connect the Black ground wire from the
ambient lighting harness to the chassis ground
point at the driver kick panel or in a suitable
grounding location.
30. Connect the light engine LED housing to the
light rod.
•
Attach to the part number end of the light
rod.
Install Switch
31. Locate and drill 11/16’’ (17.5mm) hole In the
floor console finish panel as shown below.
35. NOTE: A DVOM connected to the correct wire
will show 0V with the park lamp switch in the
OFF position , then show 12V with the park
lamp switch in the ON position.
A logic probe will show ground on the correct
wire with the park lamp switch in the OFF
position, then show power with the park lamp
switch in the ON position.
Identify the Violet/White parking light circuit
wire at the Smart Junction Box (SJB)
Connector C2280E Pin 30.
32. File (2) Switch locating notches in the 11/16’’
(17.5mm) hole as shown above.
33. Install the ambient lighting switch into the floor
console finish panel.
36. Connect the White wire from the ambient
lighting harness to the Violet/White parking
light circuit wire at the Smart Junction Box
(SJB) Connector C2280E Pin 30
Install Trim
37. NOTE: Ensure the ambient lighting wires are
secure and do not interfere with vehicle
operation.
Use the supplied 4’’ tie straps to secure the
ambient lighting harness wires.
38. Install the driver sill plate.
Page 5 of 6
SK9A8J-13E700-AA
© Copyright Ford 2010 FoMoCo
2011 Fusion/Milan/MKZ
Ambient Lighting Kit
Page 6
INSTALLATION (Continued)
39. Install the center finish panel.
•
Connect the electrical connectors.
•
Push inward on the panel to engage the
retaining clips.
40. Install the 2 center finish panel screws.
44. Use the supplied 4’’ tie straps to secure the
unused LED housing and ambient lighting
harness wires.
45. Install the floor console finish panel.
•
Connect the electrical connector.
•
Push the floor console finish panel
downward to engage the retaining clips.
41. Install the upper storage compartment.
•
Connect the electrical connector, if
equipped.
•
Push the upper storage compartment toward
the front of the vehicle to engage the 5
retaining clips.
•
Install the 2 screws and mat.
46. Close the storage compartment lid.
Vehicles With Manual Transmission
47. Install the gearshift lever knob.
•
42. Install the utility tray.
•
Connect the electrical connector and audio
jack connector, if equipped.
43. Install the LED housing and lens to the console
cup holder.
Page 6 of 6
Turn the gearshift lever knob in a clockwise
direction.
Vehicles With Automatic Transmission
48. Install the floor shifter trim ring.
•
Push the floor shifter trim ring downward.
•
Place the gearshift lever in the PARK
position.
•
Release the parking brake.
SK9A8J-13E700-AA
© Copyright Ford 2010 FoMoCo
2011 MKS
Ambient Lighting Kit
Manual Table of Contents
AMBIENT LIGHTING KIT INSTALLATION
CONTENTS
INSTALLATION
Ambient Lighting Kit
GENERAL PROCEDURES
Wire Splicing Techniques
Contents
SK8S4J-13E700-AB
© Copyright Ford 2010 FoMoCo
2011 MKS
Ambient Lighting Kit
Page 1
INSTALLATION
Superseded by:SGML_id=‘‘n1139003’’
Effect:Frozen: ‘‘N’’ ‘‘2009’’ ‘‘MIKETEST2’’ ‘‘19’’
‘‘020’’
Lighting — MKS(id=n1144734)
Ambient Lighting Kit Contents
1.
Review the Ambient Lighting Kit Contents.
Ambient Lighting Kit
QUANTITY
DESCRIPTION
1
DISTRIBUTION BOX
HARNESS ASSEMBLY
1
CML MODULE
2
LIGHT ROD
1
SWITCH
1
HARDWARE KIT
Page 1 of 9
Prepare Vehicle
2.
Apply the parking brake.
3.
Turn the ignition key to the ‘‘ON’’ position and
move the shift lever to ‘‘NEUTRAL’’.
•
4.
Turn the ignition key to the ‘‘OFF’’
position.
Remove the instrument panel finish panel
applique.
SK8S4J-13E700-AB
© Copyright Ford 2010 FoMoCo
2011 MKS
Ambient Lighting Kit
Page 2
INSTALLATION (Continued)
5.
NOTE: LH floor console lower trim panel
shown, RH floor console lower trim panel
similar.
8.
•
Pull the middle and rear of the LH and RH
floor console lower trim panels outward to
release the retaining clips.
9.
6.
Lift upward and open the storage compartment
lid.
7.
Remove the LH and RH floor console finish
mouldings.
•
Remove the floor console finish panel.
With a non-marring tool, pry upward on the
floor console finish panel to release the
retaining clips.
Remove the 4 floor console cup holder screws.
Lift upward on the floor console finish
mouldings to release the retaining clips.
10. Remove the floor console cup holder.
Page 2 of 9
SK8S4J-13E700-AB
© Copyright Ford 2010 FoMoCo
2011 MKS
Ambient Lighting Kit
Page 3
INSTALLATION (Continued)
11. NOTICE: To avoid damaging the selector
lever trim panel while performing this step,
place a piece of cardboard onto the selector
lever trim panel.
Detach the selector lever knob bezel.
•
With a non-marring tool, pry downward on
the selector lever knob bezel.
Without Navigation
14. Remove the 6 HVAC module screws.
12. NOTE: LH side shown, RH side similar.
Remove the selector lever knob.
•
Remove the 2 selector lever knob screws.
15. Remove the HVAC module.
•
Disconnect the electrical connectors.
With Navigation
16. Remove the floor console front finish panel.
•
Remove the 4 floor console front finish
panel screws.
13. Pull the selector lever trim panel toward the
rear of the vehicle to release the retaining clips.
Page 3 of 9
SK8S4J-13E700-AB
© Copyright Ford 2010 FoMoCo
2011 MKS
Ambient Lighting Kit
Page 4
INSTALLATION (Continued)
17. Remove the HVAC module.
•
Remove the 2 HVAC module screws.
•
Disconnect the electrical connectors.
20. Remove the storage box trim ring.
•
Remove 2 screws.
•
Release the tabs.
NOTE: LH shown RH similar.
All
18. Remove the floor console rear panel.
•
Pull straight rearward to disengage the clips.
•
Disconnect the electrical connectors.
21. Remove the 2 screws and the floor console
stowage bin.
•
Disconnect the electrical connectors.
19. Remove the 5 screws and the floor console
stowage bin door.
Page 4 of 9
SK8S4J-13E700-AB
© Copyright Ford 2010 FoMoCo
2011 MKS
Ambient Lighting Kit
Page 5
INSTALLATION (Continued)
22. Remove the RH lower instrument panel
insulator.
•
Remove three screws.
•
Disconnect interior lamp and electrical
connectors.
•
Remove the panel.
25. Using the supplied adhesive pad and three tie
straps mount the CML module to the wire
harness below the center stack as shown below.
Route Harness
NOTE: Avoid routing ambient lighting wires near
sharp edges and moving components.
Install Modules
NOTE: Ensure the ambient lighting wires are
secure and do not interfere with vehicle operation.
NOTE: Do not touch the adhesive, reduced
adhesion may result.
NOTE: Do not remove the clear protective film
from the back of the CML module.
23. Identify the distribution box, module with the
double sided adhesive pad attached to the back.
24. Remove the protective backing from the
adhesive pad and secure the distribution box to
the LH side of the console as shown below.
Page 5 of 9
26. Route the 2-wire power harness and the light
rod LED harness to the driver footwell area.
27. Route the switch harness and the harness
containing the exposed LED ends to the console
box area.
Install Switch
28. Locate and drill 11/16'' (17.5mm) hole In the
front of the console box below the USB port as
shown below.
SK8S4J-13E700-AB
© Copyright Ford 2010 FoMoCo
2011 MKS
Ambient Lighting Kit
Page 6
INSTALLATION (Continued)
29. File (2) Switch locating notches in the 11/16''
(17.5mm) hole as shown below.
30. Install the ambient lighting switch into the
console box.
32. Locate and drill 5/16'' (8mm) hole in the front
of the console box below the audio port as
shown below.
33. Identify the exposed LED housing with the
single lead.
Install LED
NOTE: If this vehicle uses a liner in the cup
holder, carefully mark the LED location onto the
liner. Then remove the liner and use a 1/2'' hollow
punch to punch a hole in the liner to allow the LED
light to pass through the liner. Re-install the liner
when complete. One source of the hollow punch set
is Harbor Freight, item # 03838 or use an
equivalent 1/2'' hollow punch from another source.
NOTE: Avoid driver distraction by locating the cup
holder LED in the 7 o’clock position out of the
driver line of sight.
31. Locate and drill 5/16'' (8mm) hole in the Rear
cup holder as shown below.
Page 6 of 9
34. Install the LED lens to the console box and the
assemble to the exposed LED housing with the
single lead.
SK8S4J-13E700-AB
© Copyright Ford 2010 FoMoCo
2011 MKS
Ambient Lighting Kit
Page 7
INSTALLATION (Continued)
35. Install the floor console stowage bin.
•
Connect the USB port and cable
•
Connect the ambient lighting switch
•
Install the 2 screws
37. Using the assembled hardware attach the 12''
light rod to the lower dash in the driver
footwell as shown below.
Install Light Rods
•
The silver end of the light rod is placed
outboard, closest to the vehicle door.
•
Locate clips
•
secure tie straps.
NOTE: One end of the light rod is silver the other
end is printed with the part number. The light
engine LED housing is attached to the part number
end of the light rod.
38. Connect the light engine LED housing
containing (2) wires to the light rod.
•
36. Assemble (2) light rod retainer clips using parts
from the hardware kit as shown below.
•
Attach saddle clip to J-nut using supplied
hardware.
•
Attach tie strap to saddle clip
Attach light engine to the part number end
of the light rod.
39. Route the remaining Light engine LED housing
to the passenger footwell area.
40. Locate and drill (2) 11/64'' (4.5mm) in the RH
lower instrument panel insulator as shown
below.
Page 7 of 9
SK8S4J-13E700-AB
© Copyright Ford 2010 FoMoCo
2011 MKS
Ambient Lighting Kit
Page 8
INSTALLATION (Continued)
43. Install the RH lower instrument panel insulator.
•
Connect the light engine LED housing to
the part number end of the light rod.
•
Connect interior lamp and electrical
connector.
•
Install the 3 screws.
Power and Ground Connections
NOTE: For proper wire splicing techniques click
here.
41. Assemble rod clips to the RH lower instrument
panel insulator as shown below.
42. Using assembled hardware attach 12'' light rod
to the passenger hush panel as shown below.
•
Silver end of the rod is placed outboard
closest to the door.
44. Connect the Black ground wire from the
ambient lighting harness to the chassis ground
point at the driver kick panel.
45. NOTE: A DVOM connected to the correct wire
will show 0V when the park lamps switch in
the OFF position , then show 12V when the
when the park lamps switch in the ON position.
A logic probe will show ground on the correct
wire when the park lamps switch in the OFF
position, then show power when the park lamps
switch in the ON position
Identify the Violet/White parking light circuit
wire at the Smart Junction Box (SJB)
Connector C2280E Pin 6.
46. Connect the White wire from the ambient
lighting harness to the violet/white park lamp
circuit wire at the SJB Connector C2280E Pin
6.
Page 8 of 9
SK8S4J-13E700-AB
© Copyright Ford 2010 FoMoCo
2011 MKS
Ambient Lighting Kit
Page 9
INSTALLATION (Continued)
53. NOTICE: Make sure to align the selector
lever holes in the selector lever trim panel to
the selector lever. Otherwise, damage to the
selector lever trim panel may occur.
Install the selector lever trim panel.
•
Connect the electrical connectors.
54. Install the selector lever knob bezel over the
shift lever.
55. Install the selector lever knob.
Install Trim
47. NOTE: Insure the ambient lighting wires are
secure and do not interfere with vehicle
operation.
•
Install the 2 selector lever knob screws.
•
Attach the selector lever knob bezel.
56. Install LED lens to cup holder.
Use the supplied 4'' tie straps to secure the
ambient lighting harness wires.
Without Navigation
48. Install the HVAC module.
•
Connect the electrical connectors.
•
Install the 6 HVAC module screws.
With Navigation
49. Install the HVAC module.
•
Connect the electrical connectors.
•
Install the 2 HVAC module screws.
57. Install the floor console cup holder.
•
50. Install the floor console front finish panel.
•
58. Install the floor console finish panel.
Install the 4 floor console front finish panel
screws.
All
Install the 4 floor console cup holder
screws.
59. Install the LH and RH floor console finish
mouldings.
•
Push downward on the floor console finish
mouldings to secure the retaining clips.
51. Install the floor console stowage bin door.
•
Install the 5 screws
52. Install the floor console rear panel.
•
Push inward to engage the clips.
60. Close the storage compartment lid.
61. Install the instrument panel finish panel
applique.
62. Place the gearshift lever in the PARK position
and release the parking brake.
Page 9 of 9
SK8S4J-13E700-AB
© Copyright Ford 2010 FoMoCo
2011 Taurus
Ambient Lighting Kit
Manual Table of Contents
AMBIENT LIGHTING KIT INSTALLATION
CONTENTS
INSTALLATION
Ambient Lighting Kit
GENERAL PROCEDURES
Wire Splicing Techniques
Contents
SK8S4J-13E700-AB
© Copyright Ford 2010 FoMoCo
2011 Taurus
Page 1
Ambient Lighting Kit
INSTALLATION
Superseded by:SGML_id=‘‘n1173104’’
Effect:Frozen: ‘‘N’’ ‘‘2010’’ ‘‘MIKETEST2’’ ‘‘19’’
‘‘020’’
Lighting — Taurus(id=n1192773)
Ambient Lighting Kit Contents
1.
Review the Ambient Lighting Kit Contents.
3.
Ambient Lighting Kit
Turn the ignition key to the ‘‘ON’’ position and
move the shift lever to ‘‘NEUTRAL’’.
•
QUANTITY
DESCRIPTION
1
DISTRIBUTION BOX
HARNESS ASSEMBLY
1
CML MODULE
2
LIGHT ROD
1
SWITCH
1
HARDWARE KIT
Turn the ignition key to the ‘‘OFF’’
position.
4.
Position the front seats to the full rearward and
downward positions.
5.
Pull the middle and rear of the floor console
LH and RH lower trim panels outward to
release the retaining clips.
Prepare Vehicle
2.
Apply the parking brake.
Page 1 of 9
SK8S4J-13E700-AB
© Copyright Ford 2010 FoMoCo
2011 Taurus
Ambient Lighting Kit
Page 2
INSTALLATION (Continued)
6.
NOTICE: Damage to the floor console upper
trim panels may occur if cardboard is not
used to remove the floor console lower trim
panels.
8.
Remove the floor console RH lower trim panel.
•
NOTE: Floor console LH lower trim panel
shown, floor console RH lower trim panel
similar.
Pull the floor console RH lower trim panel
down toward the floor of the vehicle to
detach the trim panel from the pin-type
retainer.
Position a piece of cardboard between the floor
console LH and RH lower trim panels and floor
console.
9.
7.
Remove the floor console LH lower trim panel.
•
Push the floor console LH lower trim panel
toward the front of the vehicle to detach the
trim panel from the pin-type retainer.
Page 2 of 9
Remove the steering column knee bolster in the
following sequence.
•
Remove the 2 steering column knee bolster
screws.
•
Pull the steering column knee bolster down
toward the floor of the vehicle to release the
retaining clips.
10. Remove the floor console LH and RH finish
mouldings in the following sequence.
•
Lift up the rear of the floor console finish
mouldings to release the retaining clips from
the floor console.
•
Pull the floor console finish mouldings
toward the rear of the vehicle to release the
retaining clips from the center instrument
finish panel.
•
Disconnect the trunk release switch and
start/stop button electrical connector, if
equipped.
SK8S4J-13E700-AB
© Copyright Ford 2010 FoMoCo
2011 Taurus
Ambient Lighting Kit
Page 3
INSTALLATION (Continued)
12. Remove the 4 screws and remove the storage
compartment from the center console.
NOTICE: Damage to the floor console may occur
if cardboard is not used to remove the floor
console upper trim panel.
NOTE: Floor console LH upper trim panel shown,
floor console RH upper trim panel similar.
11. Remove the floor console LH upper trim panel
in the following sequence.
•
Pull the rear of the floor console LH upper
trim panel away from the floor console,
releasing the retaining clips.
•
Position a piece of cardboard between the
floor console LH upper trim panel and floor
console.
•
Pull the floor console LH upper trim panel
toward the rear of the vehicle to release the
retaining clips from the instrument panel.
Page 3 of 9
SK8S4J-13E700-AB
© Copyright Ford 2010 FoMoCo
2011 Taurus
Ambient Lighting Kit
Page 4
INSTALLATION (Continued)
13. Slide the selector lever knob bezel down to
access the 2 selector lever knob screws.
17. Remove the media bin/storage compartment in
the following sequence.
14. Remove the 2 selector lever knob screws.
•
Remove the 4 screws and lift up the media
bin/storage compartment.
•
Disconnect the electrical connector(s).
18. Remove the floor console rear panel.
•
Pull straight rearward to disengage the clips.
•
Disconnect the electrical connectors.
15. Remove the 4 selector lever bezel screws.
19. Remove the 4 top screws in rear of the floor
console stowage bin.
16. Position the selector lever bezel and the selector
lever knob off of the selector lever and the
center console. Disconnect the electrical
connectors, and remove the selector lever knob
and bezel.
Page 4 of 9
SK8S4J-13E700-AB
© Copyright Ford 2010 FoMoCo
2011 Taurus
Ambient Lighting Kit
Page 5
INSTALLATION (Continued)
24. Remove the protective backing from the
adhesive pad and secure the distribution box
below the center stack as shown below.
20. Disengage the LH and RH console side trim
panels to pull out the inner console bin.
21. Remove the inner console bin.
•
Pull out the auxiliary point.
•
Disconnect the power point and USB
implement.
25. Using the supplied adhesive pad mount the
CML module behind the shift control as shown
below.
22. Remove the RH lower instrument panel
insulator.
•
Remove the 3 screws.
Route Harness
NOTE: Avoid routing ambient lighting wires near
sharp edges and moving components.
Install Modules
NOTE: Ensure the ambient lighting wires are
secure and do not interfere with vehicle operation.
NOTE: Do not touch the adhesive, reduced
adhesion may result.
NOTE: Do not remove the clear protective film
from the back of the CML module.
23. Identify the distribution box, module with the
double sided adhesive pad attached to the back.
Page 5 of 9
26. Route the 2-wire power harness and the light
rod LED harness to the driver footwell area.
27. Route the switch harness and the harness
containing the exposed LED ends to the console
box area.
SK8S4J-13E700-AB
© Copyright Ford 2010 FoMoCo
2011 Taurus
Ambient Lighting Kit
Page 6
INSTALLATION (Continued)
Install Switch
28. Locate and drill 11/16’’ (17.5mm) hole in side
console trim as shown below.
32. Locate and drill 5/16’’ (8mm) hole in the front
of the inner console bin below the audio port as
shown below.
29. File (2) Switch locating notches in the 11/16’’
(17.5mm) hole.
30. Install the ambient lighting switch into the side
console trim.
Install LED
NOTE: If this vehicle uses a liner in the cup
holder, carefully mark the LED location onto the
liner. Then remove the liner and use a 1/2’’ hollow
punch to punch a hole in the liner to allow the LED
light to pass through the liner. Re-install the liner
when complete. One source of the hollow punch set
is Harbor Freight, item # 03838 or use an
equivalent 1/2’’ hollow punch from another source.
33. Identify the exposed LED housing with the
single lead.
NOTE: Avoid driver distraction by locating the cup
holder LED in a position out of the driver line of
sight.
31. Locate and drill 5/16’’ (8mm) hole in the rear
of the RH front cup holder as shown below.
34. Install the LED lens to the RH front cup holder
and assemble the exposed LED housing with
the single lead.
Page 6 of 9
SK8S4J-13E700-AB
© Copyright Ford 2010 FoMoCo
2011 Taurus
Ambient Lighting Kit
Page 7
INSTALLATION (Continued)
35. Install the inner console bin.
•
•
Connect the auxiliary point, power point and
USB implement.
37. Connect the light engine LED housing
containing (2) wires to the light rod.
•
Connect the ambient lighting switch.
Attach light engine to the part number end
of the light rod.
Install Light Rods
NOTE: One end of the light rod is silver the other
end is printed with the part number. The light
engine LED housing is attached to the part number
end of the light rod.
38. Route the remaining Light engine LED housing
to the passenger footwell area.
39. Locate and drill (2) 11/64’’ (4.5mm) in the RH
lower instrument panel insulator as shown
below.
36. Using tie straps attach the 12’’ light rod to the
lower dash wire harness in the driver footwell
as shown below.
•
The silver end of the light rod is placed
outboard, closest to the vehicle door.
•
secure tie straps.
Page 7 of 9
SK8S4J-13E700-AB
© Copyright Ford 2010 FoMoCo
2011 Taurus
Ambient Lighting Kit
Page 8
INSTALLATION (Continued)
40. Assemble rod clips to the RH lower instrument
panel insulator as shown below.
44. NOTE: A DVOM connected to the correct wire
will show 0V when the park lamps switch in
the OFF position , then show 12V when the
when the park lamps switch in the ON position.
41. Using assembled hardware attach 12’’ light rod
to the passenger hush panel as shown below.
•
Silver end of the rod is placed outboard
closest to the door.
A logic probe will show ground on the correct
wire when the park lamps switch in the OFF
position, then show power when the park lamps
switch in the ON position
Identify the Violet/White parking light circuit
wire at the Smart Junction Box (SJB)
Connector C2280E Pin 6.
45. Connect the White wire from the ambient
lighting harness to the violet/white park lamp
circuit wire at the SJB Connector C2280E Pin
6.
42. Install the RH lower instrument panel insulator.
•
Connect the light engine LED housing to
the part number end of the light rod.
•
Connect interior lamp and electrical
connector.
•
Install the 3 screws.
Power and Ground Connections
Install Trim
NOTE: For proper wire splicing techniques click
here.
43. Connect the Black ground wire from the
ambient lighting harness to the chassis ground
point at the driver kick panel.
Page 8 of 9
46. NOTE: Insure the ambient lighting wires are
secure and do not interfere with vehicle
operation.
Use the supplied 4’’ tie straps to secure the
ambient lighting harness wires.
SK8S4J-13E700-AB
© Copyright Ford 2010 FoMoCo
2011 Taurus
Ambient Lighting Kit
Page 9
INSTALLATION (Continued)
47. Install the floor console stowage bin door.
•
Install the 4 rear console screws
48. Install the floor console rear panel.
•
Push inward to engage the clips.
49. Install the 4 selector lever bezel screws.
52. Install the floor console cup holder.
•
Install the 4 rear console cup holder screws.
53. Install the media bin/storage compartment.
54. Install the LH and RH floor console upper trim
panels.
50. Install the selector lever knob.
•
Install the 2 selector lever knob screws.
•
Attach the selector lever knob bezel.
51. Install LED lens to RH front cup holder.
55. Install the LH and RH floor console finish
mouldings.
•
Push downward on the floor console finish
mouldings to secure the retaining clips.
56. Close the storage compartment lid.
57. Install the steering column knee bolster.
58. Install the LH and RH floor console lower trim
panels.
59. Place the gearshift lever in the PARK position
and release the parking brake.
Page 9 of 9
SK8S4J-13E700-AB
© Copyright Ford 2010 FoMoCo
US
U
S
INSTALLATION INSTRUCTIONS - INTERIOR LED LIGHTING KIT
E
E
INSTRUCCIONESS DE INSTALACION- EL INTERIOR DEL KIT LA LUZ LED
F
F
INSTRUCTIONS D’INSTALLATION - LED KIT DE LUMIÈRE EN INTERIEUR
ACCESSORIZE YOUR VEHICLE AT:
FORDACCESSORIES.COM
Subject to alteration without notice
FOCUS 2010
PERSONAL INJURY
LESIONES PERSONALES
RISQUE DE BLESSURE
VEHICLE DAMAGE
DANO DE VEHICULO
DOMMAGE AU VÉHICULE
INCORRECT
INCORRECTO
INCORRECT
CORRECT
CORRECTO
CORRECT
SEE MANUAL
VER MANUAL
VOIR LE MANUEL
A
B
C
E
QUICK REFERENCE CARD
TARJETA RÁPIDE DE LA REFERENCIA
CARTE RAPIDE DE RÉFÉRENCE
K
L
4X
O
4X
P
4X
PG 1/17
G
F
2X
M
D
H
4X
4X
N
2X
SK8S4J-13E700-AB
SK8S4J-13E700-AA
4X
I
J
TOOLS REQUIRED
HERRAMIENTAS NECESARIAS
OUTILS NÉCESARAIRES
3/4” 5/16”
7mm 8mm 18.5mm 8 mm
© Copyright Ford 2007
NOTE: READ THIS NOTICE BEFORE STARTING INSTALLATION
NOTA: LEA ESTE AVISO ANTES DE COMENZAR LA INSTALACIÓN
REMARQUE : LIRE CET AVIS AVANT DE COMMENCER L’INSTALLATION
NOTE
NOTE: TO INSURE PROPER INSTALLATION, USE THE FOLLOWING GUIDELINES:
APPLY FLOCK TAPE TO SHARP OR JAGGED AREAS DURING INSTALLATION OF WIRE HARNESS
APPLY FLOCK TAPE TO WIRE HARNESS IN AREAS WHERE SQUEAK AND RATTLE CONDITIONS MAY OCCUR, I.E CONNECTORS
SECURE WIRE HARNESS AT LEAST 6MM FROM EXISTING SENSORS OR MODULES
SECURE WIRE HARNESS AT LEAST 19MM FROM MOVING PARTS, I.E. VACUUM MOTORS, ETC.
NOTA: PARA ASEGURAR LA INSTALACIÓN CORRECTA DEL EQUIPO, SIGA ESTAS INSTRUCCIONES:
NOTA
APLIQUE CINTA DE FIELTRO EN LAS ÁREAS FILOSAS O DENTADAS DURANTE LA INSTALACIÓN DEL MAZO DE CABLES
APLIQUE CINTA AFIELTRADA (FLOC) AL MAZO DE CABLES EN EL ÁREA DONDE PODRÍAN PRODUCIRSE CHIRRIDOS O TRAQUETEOS, ES DECIR
CONECTADORES
FIJE EL MAZO DE CABLES A UNA DISTANCIA DE AL MENOS 6 MM RESPECTO DE LOS SENSORES O MÓDULOS INSTALADOS
ASEGURE EL ARNÉS POR LO MENOS 19M M DEL ALAMBRE DE LAS PIEZAS MÓVILES, ES DECIR MOTORES DE VACÍO, ETC.
REMARQUE : POUR ASSURER UNE INSTALLATION CORRECTE, UTILISER LES DIRECTIVES SUIVANTES :
REMARQUE
APPLIQUER DU RUBAN FLOQUÉ SUR LES PIÈCES TRANCHANTES OU ACÉRÉES PENDANT L’INSTALLATION DU FAISCEAU DE FILS.
APPLIQUER DU RUBAN FLOQUÉ SUR LES PARTIES DU FAISCEAU DE FIL RISQUANT DE PRODUIRE DES GRINCEMENTS OU DES VIBRATIONS, C.-\-D..
DES CONNECTEURS.
ASSUJETTIR LE FAISCEAU DE FILS À AU MOINS 6 MM DES MODULES ET CAPTEURS PRÉSENTS.
FIXEZ LE HARNAIS DE FIL AU MOINS 19MM DES PIÈCES MOBILES, C.-\-D.. MOTEURS À DÉPRESSION, ETC..
NOTE: IF AN UNRELIABLE METHOD OF WIRE SPLICING IS USED WHEN INSTALLING ELECTRICAL ADD-ON EQUIPMENT, IT MAY CAUSE ELECTRICAL
NOTE
SYSTEMS TO MALFUNCTION BY CREATING VARIABLE RESISTANCE OR A SHORT CIRCUIT. VARIABLE RESISTANCE CAN RESULT FROM
OXIDATION/CORROSION CAUSED BY AIR WITHIN THE JOINT AND A SHORT CIRCUIT CAN RESULT FROM MOISTURE ON THE JOINT.
HEAT SHRINK TUBING MUST CONTAIN HOT MELT WAX. THIS WILL CREATE A WATERPROOF AND AIR TIGHT JOINT.
SOLDER MUST BE ROSIN CORE MILDLY ACTIVATED (RMA). DO NOT USE ACID CORE SOLDER.
DO NOT USE CRIMP-CONNECTORS OF ANY KIND. THEY ARE NOT A ROBUST METHOD FOR SPLICING IN NEW WIRES.
NOTA
NOTA: SI SE UTILIZA UN MÉTODO DE EMPALME DE CABLES POCO CONFIABLE AL INSTALAR UN EQUIPO ELÉCTRICO ADICIONAL, ES
POSIBLE QUE LOS SISTEMASELÉCTRICOS FUNCIONEN INCORRECTAMENTE AL GENERAR UNA RESISTENCIA VARIABLE O UN CORTOCIRCUITO.
LA RESISTENCIA VARIABLE PUEDE SER OCASIONADA PORLA OXIDACIÓN O CORROSIÓN CAUSADA POR AIRE DENTRO DE LA JUNTA. EL CORTOCIRCUITO
PUEDE SER OCASIONADO POR HUMEDAD EN LA JUNTA.
EL TUBO TERMOENCOGIBLE DEBE CONTENER PARAFINA CALIENTE DERRETIDA. ESTO DARÁ COMO RESULTADO UNA JUNTA HERMÉTICA Y A PRUEBA
DE AGUA.
LA SOLDADURA DEBE SER DE N^CLEO DE RESINA DE FLUJO MODERADO (RMA). NO UTILICE SOLDADURA DE N^CLEO ÁCIDO.
NO UTILICE CONECTORES DE ENGARCE DE NING^N TIPO. NO SON UN MÉTODO ADECUADO PARA EMPALMAR A CABLES NUEVOS.
REMARQUE : SI UNE MÉTHODE INCERTAINE D’ÉPISSAGE DE FIL EST UTILISÉE PENDANT L’INSTALLATION D’ÉQUIPEMENT ÉLECTRIQUE
REMARQUE
COMPLÉMENTAIRE, ELLE PEUT ENTRA_NER DES VARIATIONS DE RÉSISTANCE ET DES COURT-CIRCUITS POUVANT RÉSULTER EN DES
PANNES DE SYSTÈME. LES VARIATIONS DE RÉSISTANCE PEUVENT `TRE CAUSÉES PAR L’OXYDATION ET LA CORROSION RÉSULTANT
DE LA PRÉSENCE D’AIR DANS LES JOINTS, ET LES COURTS-CIRCUITS, DE LA PRÉSENCE D’HUMIDITÉ.
LE TUBE THERMORÉTRÉCISSABLE DOIT DOIT CONTENIR DE L’ADHÉSIF THERMOFUSIBLE. CECI PERMETTRA DE CRÉERT UN JOINT ÉTANCHE
À L’EAU ET HERMÉTIQUE.
LA SOUDURE DOIT `TRE NOYÉE DANS LA RÉSINE LÉGÈREMENT ACTIVÉE (RMA). N’UTILISEZ PAS DE SOUDURE À L’ACIDE.
N’UTILISEZ PAS DE RACCORD À SERTIR. ILS NE CONSTITUENT PAS UN MOYEN SOLIDE D’ÉPISSAGE DES NOUVEAUX FILS.
PG 2/17
SK8S4J-13E700-AB
SK8S4J-13E700-AA
© Copyright Ford 2007
1
2
3
4
NOTE: SET PARKING BRAKE.
NOTA: PONGA EL FRENO .
REMARQUÉ: METTEZ LE FREIN À MAIN.
NOTE: IF VEHICLE IS EQUIPPED WITH AUTOMATIC
TRANSMISSION SHIFT INTO NEUTRAL TO REMOVE
CONSOLE.
NOTA: SI TIENE EL VEHICULO EN TRANSMISION
AUTOMATICA PONGA ESTE EN NEUTRO PARA REMOVER LA CONSOLA.
REMARQUÉ: SI LA VOITURE EST EQUIPÉ AVEC UNE
TRANSMISSION AUTOMATIQUE, CHANGEZ AU POINT
MORT POUR ENVELER LE CONSOLE.
5
PG 3/17
6
SK8S4J-13E700-AB
© Copyright Ford 2007
7
9
8
NOTE: POWER LEAD IS ROUTED UNDER CARPET STARTING AT CENTER CONSOLE. LIFT CARPET AT DOOR SILL TO REACH POWER LEAD.
NOTA: PONGA EL CABLE ELECTRICO DEBAJO DE LA ALFOMBRA COMENZANDO EN EL CENTRO DE
LA CONSOLA. LEVANTE LA ALFOMBRA EN LA ESQUINA PARA ALCANZAR EL CABLE ELECTRICO.
REMARQUÉ: LE CABLE ÉLÉCTRIQUE EST SOUS LE TAPIS QUI COMMENCE AUPRES DE LA CONSOLE. LEVEZ LA CÔTÉ DU TAPIS QUI EST PRÈS DE LA PORTE POUR PRENRE LE CABLE.
D
C
D
C
SWITCH CONNECTOR
BOTON DE CONECCION
BOUTON CONNECTEUR
DB
B
D
D
POWER LEAD
CABLE ELECTRICO
CABLE ÉLECTRONIQUE
B
D
D
C
PG 4/17
SK8S4J-13E700-AA
SK8S4J-13E700-AB
© Copyright Ford 2007
11
10
D
C
D
C
NOTE: ROUTE BEHIND AND OVER CARPET.
NOTA: PASE POR ATRAS Y ENCIMA DE LA ALFOMBRA.
REMARQUÉ: FAIRE PASSAR EN ARIERRE ET DESSUS LE
TAPIS.
NOTE: ROUTE BEHIND AND OVER CARPET.
NOTA: PASE POR ATRAS Y ENCIMA DE LA ALFOMBRA.
REMARQUÉ: FAIRE PASSAR EN ARIERRE ET DESSUS LE
TAPIS.
12
D
B
13
NOTE: ROUTE BEHIND AND OVER CARPET.
NOTA: PASE POR ATRAS Y ENCIMA DE LA ALFOMBRA.
REMARQUÉ: FAIRE PASSAR EN ARIERRE ET DESSUS LE
TAPIS.
NOTE: VERIFY LOCATION AND COLOR CODE OF POWER
NOTA: VERIFICA LOCALIZACION Y EL COLOR DE CODIGO DE LA CONECION ELECTRICA.
REMARQUÉ: VÉRIFIÉ LA LOCATION ET LA COULER DE LA PUISSANCE.
POWER SOURCE
FUENTE DE ENERGÍA
SOURCE D’ÉNERGIE
COMPONENT
COMPONENTE
COMPOSANT
CONNECTOR
CONECION
CONNECTEUR
SMART JUNCTION BOX C2280D
PG 5/17
SK8S4J-13E700-AB
SK8S4J-13E700-AA
PIN
AGUJA
GOUPILLE
20
CIRCUIT
CIRCUITO
CIRCUIT
COLOR
COLOR
COULEUR
CLS30
VIOLET/WHITE
VIOLETA/BLANCO
VIOLETBLANC
© Copyright Ford 2007
14
NOTE: TO LOCATE VIOLET/WHITE
WIRE, FOLLOW HARNESS
TO GENERAL LOCATION
SHOWN IN CELL 13.
VERIFY WITH PIN 20 CONNECTOR C2280D
NOTA: PARA UBICAR EL CABLE
ANARANJADO/BLANCO ENCUENTRE LA LOCALIZACION
GENERAL EN LA CELULA NUMERO 13. VERIFIQUE CON LA
AGUJA 20 CONECION C2280D
REMARQUE : POUR LOCALISER LE FIL ORANGE/BLANC
SUIVEZ JUSQU’ ÀU LOCATION
GÉNÉRALE. VOYEZ CELLLULE 13. VÉRIFIEZ AVEC LA
GOUPILLE 20 CONNECTEUR
C2280D
WHITE
BLANCO
BLANC
B
3
1
PG 6/17
WHITE
BLANCO
BLANC
VIOLET/WHITE
VIOLETA/BLANCO
VIOLET/BLANC
VIOLET/WHITE
VIOLETA/BLANCO
VIOLET/BLANC
4
B
WHITE
BLANCO
BLANC
VIOLET/
WHITE
VIOLETA/
BLANCO
VIOLET/
BLANC
2
VIOLET/WHITE
VIOLETA/BLANCO
VIOLET/BLANC
5
VIOLET/WHITE
VIOLETA/BLANCO
VIOLET/BLANC
15
B
NOTE: VERIFY ELECTRICAL CONNECTIONS.
NOTE: VERIFIQUE LAS CONNECCIONES ELECTRICAS.
REMARQUÉ: VERIFIÉ LES CONNECTIONS ÉLECTRIQUES.
SK8S4J-13E700-AA
SK8S4J-13E700-AB
© Copyright Ford 2007
B
8mm
16
D
J
C
D
B
A
A
17
A
D
A
D
B
D
B
PG 7/17
SK8S4J-13E700-AA
SK8S4J-13E700-AB
© Copyright Ford 2007
19
18
NOTE: CONNECT GRAY CONNECTOR TO GRAY PLUG,
BLACK CONNECTOR TO BLACK PLUG. CONNECTOR TO
(A) CAN BE DISCONNECTED TO AID INSTALLATION.
D
B
SWITCH CONNECTOR
BOTON CONECTOR
BOUTON CONNECTEUR
NOTA: CONECTA EL CONECTOR GRIS A LA ENTRADA
GRIS , EL CONECTOR NEGRO A LA ENTRADA NEGRA. EL
CONECTOR PUEDE SER DESCONECTADO PARA AYUDAR LA INSTALACION.
REMARQUÉ : BRANCHEZ LE CONNECTEUR GRIS À LA
PRISE GRISE, CONNECTEUR NOIR À LA PRISE NOIRE.
LE CONNECTEUR À (A) PEUT ÊTRE DÉBRANCHÉ POUR
FACILITER L’INSTALLATION.
POWER LEAD
CABLE ELECTRICO
CABLE ÉLECTRONIQUE
D
A
20
NOTE: LOOSELY ASSEMBLED BEFORE SLIPPING ONTO EDGE.
NOTA: LIGERAMENTE MONTE ANTE DE PONER EN LA ESQUINA.
REMARQUÉ: ASSEMBLÉ LÂCHEMENT AVANT DE PASSER SUR LE BEC.
L
D
K
D
O
D
22
21
NOTE: CLIPS MOUNTED ON HOOD RELEASE BRACKET
NOTA: ‘U” CLIP MONTADO EN LA APERTURA DEL MOTOR
REMARQUÉ: METTEZ LES “U-CLIPS” SUR LE CAPOT,
RELACHEZ LE SUPPORT
PG 8/17
SK8S4J-13E700-AA
SK8S4J-13E700-AB
© Copyright Ford 2007
23
NOTE:CRADLE SHOULD BE AT TOP.
NOTA: LA CUNA DEBE ESTAR ARRIBA
REMARQUÉ: LE BNERCEAU DOIT ÊTRE.
24
25
NOTE: PLACE ROD ON CRADLE AND CENTER.
NOTA: PONGA TUBO EN LA CUNA Y EL MEDIO.
REMARQUÉ: PLACEZ LA TIGE AU MILIEU DU BERCEAU.
26
NOTE:TIGHTEN SCREW.
NOTA: APRIETE EL TORNILLO
REMARQUÉ: TENDRE LE VIS.
D
H
NOTE: SECURE ROD WITH CABLE TIE AND TRIM.
NOTA: ASEGURE EL TUBO CON EL CABLE Y CORTE.
REMARQUÉ: ASSURÉ LA TIGE AVEC LE CABLE, ATTACHÉ
L’HABILLAGE.
D
G
27
28
8S4J
-13C
SILVER REFLECTOR
REFLECTOR PLATEADO
RÉFLECTEUR EN ARGENT
D
NOTE: DO NOT INSTALL REFLECTOR END INTO LIGHT
MODULE.
NOTA: NO INSTALE EL EXTREMO DEL REFLECTOR EN
EL MODULO DE LA LUZ.
REMARQUÉ: N’INSTALLEZ PAS LE RÉFLECTEUR DANS
LE MODULE DE LUMIÈRE.
PG 9/17
A
SK8S4J-13E700-AB
D
G
700-A
C
NOTE: INSTALL MODULE ON END WITH PART NUMBER
NOTA: INSTALE EL MODULO EN EL EXTREMO DE LA
PARTE
REMARQUÉ: INSTALLEZ LE MODULE AVEC LE NUMERO
DE PIÈCE.
© Copyright Ford 2007
29
NOTE: ORIENT ROD WITH WHITE STRIPE ORIENTED AS ILLUSTRATED IN FRAME 30. REFLECTOR
END TOWARDS OUTSIDE OF VEHICLE.
30
NOTE: WHEN INSTALLATION IS COMPLETE ORIENT
ROD SO LIGHT SHINES IN FOOT AREA.
NOTA: CUANDO LA INSTALACION ESTE COMPLETA
ORIENTE LA LUZ PARA QUE ALUMBRE EN EL AREA
DEL PIE.
NOTA: ORIENTE EL TUBO CON EL LINEA BLANCA
ILUSTRADA EN LA CELULA 30. PONGA EL EXTREMO
DEL REFLECTOR HACIA FUERA DEL VEHICULO.
REMARQUÉ: QUAND L’INSTALLATION EST COMPLÈTE METTEZ LA TIGE DANS UNE FAÇON QUI VA
LAISSER LA LUMIERE ÉCLAT DANS L’ESPACE POUR
LES PIEDS.
REMARQUÉ: METTEZ LA TIGE AVEC LA RAYURE
BLANCHE COMME DANS LE DESSIN DANS LA 30. AVEC
LE BOUT DU RÉFLECTEUR VERS L’EXTÉRIEUR DU.
VOITURE.
WHITE REFLECTOR
REFLECTOR BLANCO
RÉFLECTEUR BLANC
WHITE REFLECTOR
REFLECTOR END
REFLECTOR BLANCO
EXTREMO DEL REFLECTOR
RÉFLECTEUR BLANC
LE BOUT DU RÉFLECTEUR
31
7 mm
NOTE: LOCATE INDENTATIONS IN METAL SUBFRAME
BEHIND FACIA.
33
NOTE: PLACE ROD ON METAL FRAME, FACIA NOT
SHOWN.
NOTA: LOCALIZE LAS PARTE CORTADA EN EL
MARCO SECUNDARIO DETRAS DE LA FACIA
NOTA: PONGA EL TUBO EN EL MARCO DE METAL,
FACIA NO SE MUESTRA
REMARQUÉ: LOCALIZEZ LES INDENTATIONS EN
MÉTAL EN ARRIÈRE DU PANNEAU
NOTE: METTEZ LA TIGE SUR LE MÉTAL, LE PANNEAU N’EST PAS DANSN L’IIUSTRATION
D
32
G
PG 10/17
SK8S4J-13E700-AB
SK8S4J-13E700-AA
© Copyright Ford 2007
34
35
NOTE: SECURE ROD TO SUBFRAME
NOTA: ASEGURE EL MARCO SECUNDARIO
NOTE: SECURÉ LA TIGE SURE LE CADRE
D
D
G
H
SILVER REFLECTOR
REFLECTOR PLATEADO
RÉFLECTEUR EN ARGENT
NOTE: DO NOT INSTALL REFLECTOR END INTO LIGHT
MODULE.
NOTA: NO INSTALE EL EXTREMO DEL REFLECTOR EN
EL MODULO DE LA LUZ.
REMARQUÉ: N’INSTALLEZ PAS LE RÉFLECTEUR DANS
LE MODULE DE LUMIÈRE.
36
37
8S4J
-13C
NOTA: ORIENTE EL TUBO CON EL LINEA BLANCA
ILUSTRADA EN LA CELULA 38. PONGA EL EXTREMO
DEL REFLECTOR HACIA FUERA DEL VEHICULO.
700-A
A
REMARQUÉ: METTEZ LA TIGE AVEC LA RAYURE
BLANCHE COMME DANS LE DESSIN DANS LA 38. AVEC
LE BOUT DU RÉFLECTEUR VERS L’EXTÉRIEUR DU.
VOITURE.
WHITE REFLECTOR
REFLECTOR BLANCO
RÉFLECTEUR BLANC
D
C
NOTE: INSTALL MODULE ON END WITH PART NUMBER
NOTA: INSTALE EL MODULO EN EL EXTREMO DE LA
PARTE
REFLECTOR END
EXTREMO DEL REFLECTOR
LE BOUT DU RÉFLECTEUR
REMARQUÉ: INSTALLEZ LE MODULE AVEC LE NUMERO
DE PIÈCE.
38
NOTE: ORIENT ROD WITH WHITE STRIPE ORIENTED AS ILLUSTRATED IN FRAME 38. REFLECTOR
END TOWARDS OUTSIDE OF VEHICLE.
NOTE: WHEN INSTALLATION IS COMPLETE ORIENT
ROD SO LIGHT SHINES IN FOOT AREA.
39
NOTA: CUANDO LA INSTALACION ESTE COMPLETA
ORIENTE LA LUZ PARA QUE ALUMBRE EN EL AREA
DEL PIE.
REMARQUÉ: QUAND L’INSTALLATION EST COMPLÈTE METTEZ LA TIGE DANS UNE FAÇON QUI VA
LAISSER LA LUMIERE ÉCLAT DANS L’ESPACE POUR
LES PIEDS.
WHITE REFLECTOR
REFLECTOR BLANCO
RÉFLECTEUR BLANC
PG 11/17
SK8S4J-13E700-AB
© Copyright Ford 2007
40
7 mm
41
NOTE: TEMPLATES ON PAGE 16
NOTA: MOLDE EN LA PAGINA 16
REMARQUÉ: LES MODÉLE SONT SUR LA PAGE 16
NOTE: ALIGN WITH RIB IN CASTING
NOTE: ALINIE CON LAS COSTILLAS DE
PLASTICO
REMARQUE:: ALIGNEZ AVEC LA NERVURE EN PLASTIQUE
42
NOTE: TEMPLATES ON PAGE 16
NOTA: MOLDE EN LA PAGINA 16
REMARQUÉ: LES MODÉLE SONT SUR LA PAGE 16
PG 12/17
SK8S4J-13E700-AB
SK8S4J-13E700-AA
© Copyright Ford 2007
43
NOTE: TEMPLATES ON PAGE 16
NOTA: MOLDE EN LA PAGINA 16
REMARQUÉ: LES MODÉLE SONT SUR LA PAGE 16
NOTE: FILE NOTCH
2X2MM
NOTE: LIGE CORTE
2X2MM
REMARQUÉ: CLASSEZ
ENTAILLE 2X2MM
44
45
46
B
LED INSTALLATION
INSTALACION LED
LED INSTALLATION
A. REMOVE TAPE LINER FROM LENS
REMUEVALA CINTA DEL LENTE
ENLEVEZ LE RUBAN QUI EST SUR LA LENTILLE
B. INSERT LENS
INSERTE EL LENTE
INSEREZ LA LENTILE
I
PG 13/17
SK8S4J-13E700-AA
SK8S4J-13E700-AB
C. SECURE LED WHILE HOLDING LENS
ASEGURE EL LED MIENTRAS AGUANTA EL LENTE
SECUREZ “LED” EN TRANT LA LENTILLE
© Copyright Ford 2007
47
48
D
D
M
49
M
50
D
51
NOTE: SECURE LOOSE WIRES USING FOAM PADS
AND CABLE TIES. PROTECT ROUGH EDGES WITH
FLOCK TAPE.
NOTA: ASEGURE LOS CABLE USANDO “FOAM” Y
CABLES. PROTEJA LAS ESQUINAS CON LA CINTA
AFIELTRADA “FLOC”
REMARQUÉ: INSTALLÉ SOLIDEMENT LES FILS DÉTACHÉ. FAIT ATTENTION AUX BORDS, GARGEZ AVEC DU
“FLOC”
NOTE: REINSTALL CONSOLE CAREFULLY
NOTA: REINSTALA LA CONSOLA CUIDADOSAMENTE
REMARQUÉ: RE-INSTALLEZ SOIGNEUSEMENT
PG 14/17
SK8S4J-13E700-AB
SK8S4J-13E700-AA
© Copyright Ford 2007
52
53
NOTE: TURN ON PARKING LIGHTS
NOTA: PRENDE LAS LUCES DE ESTACIONAMIENTO
REMARQUÉ: ALUMEZ LES LUMIÈRE DE STATIONNEMENT
54
55
E
NOTE: LEAVE CUSTOMER QUICK REFERENCE CARD (E).
NOTE: CYCLE THROUGH 7 COLORS THEN “OFF”
NOTA: CICLE POR 7 COLORES Y LUEGO APAGE
NOTA: DEJE AL CLIENTE LA TARJETA DE LA REFERENCIA RAPIDA(E).
REMARQUE: CYCLE LES 7 COULEURS JUSQU’Á LA POSITION “ARRÊT”
REMARQUÉ: LAISSEZ À CLIENT LS CARTE RAPIDE DE
RÉFERÉNCE (E).
PG 15/17
SK8S4J-13E700-AA
SK8S4J-13E700-AB
© Copyright Ford 2007
NOTE: ALIGN WITH RIB IN CASTING
NOTE: ALINIE CON LAS COSTILLAS DE
PLASTICO
REMARQUE:: ALIGNEZ AVEC LA NERVURE EN
PLASTIQUE
CUPHOLDER TEMPLATE
MOLDE SOSTENEDOR DE TAZA
PORTE-TASSE GABARIT
NOTE: VERIFY TEMPLATES ARE PRINTED TO SCALE
NOTA: VERIFIQUE QUE ELMOLDE ESTE IMPRIMIDO A
ESCALA
REMARQUE: VERITAGZ QUE LES MODÈLE SONT IMPRIMER
À L’ECHELLE
SWITCH TEMPLATE
MOLDE INTERRUPTOR
BOUTON ELECTRIQUE GABARIT
NOTE: FILE NOTCH 2X2MM
NOTE: LIGE CORTE 2X2MM
REMARQUÉ: CLASSEZ ENTAILLE
2X2MM
3/4” 18.5mm
STORAGE TEMPLATE
MOLDE ALMACENAJE
ENTREPOSAGE GABARIT
NOTE: DO NOT SCALE WHEN PRINTING
NOTA: NO ESCALE AL IMPRIMIR
REMARQUE: NE MESUREZ PAS EN IMPRIMANT
PG 16/17
SK8S4J-13E700-AB
SK8S4J-13E700-AA
© Copyright Ford 2007
Congratulations!
You’ve purchased a Genuine Ford Brand Accessory designed, engineered, and built
At Ford Customer Service Division,
¡Felicidades!
Acaba de comprar un Accesorio marca Ford Genuino, diseñado y construido
Félicitations !
Ford Customer Service Division
ACCESSORIZE YOUR VEHICLE AT:
FORDACCESSORIES.COM
PG 17/17
SK8S4J-13E700-AB
SK8S4J-13E700-AA
© Copyright Ford 2007
-
2011 Fiesta
Ambient Lighting Kit
Manual Table of Contents
AMBIENT LIGHTING KIT INSTALLATION
CONTENTS
INSTALLATION
Ambient Lighting Kit
GENERAL PROCEDURES
Wire Splicing Techniques
Contents
SK9A8J-13E700-AA
© Copyright Ford 2010 FoMoCo
!"11 Fiesta
Ambient lighting kit
1
Ambient Lighting Kit
5HYLHZWKH$PELHQW/LJKWLQJ.LW&RQWHQWV
48$17,7<
'(6&5,37,21
',675,%87,21%2;+$51(66$66(0%/<
&0/02'8/(
/,*+752'
6:,7&+
+$5':$5(.,7
$SSO\WKHSDUNLQJEUDNH
3ODFHWKHJHDUVKLIWOHYHULQWKH1(875$/SRVLWLRQ
5HPRYHWKHJHDUVKLIWOHYHUNQRE
‡ 7XUQWKHJHDUVKLIWOHYHUNQRELQDFRXQWHUFORFNZLVHGLUHFWLRQ
Page 1 of 11
SK9A8J-13E700-AA
© Copyright Ford 2010 FoMoCo
2011 Fiesta
Ambient Lighting Kit
2
INSTALLATION (Continued)
7XUQWKHLJQLWLRQNH\WRWKH21SRVLWLRQDQGPRYHWKHVKLIWOHYHUWRWKH1(875$/SRVLWLRQ
‡ 7XUQWKHLJQLWLRQNH\WRWKH2))SRVLWLRQ
127,&(
:KHQSU\LQJRQDFRPSRQHQWDQRQPDUULQJWRROPXVWEHXVHGRUGDPDJHWRWKHFRPSRQHQW
PD\RFFXU
5HPRYHWKHVHOHFWRUOHYHUWULPULQJ
‡ :LWKDQRQPDUULQJWRROOLIWWKHVHOHFWRUOHYHUWULPULQJXSZDUG
,IHTXLSSHGUHPRYHWKHFXSKROGHULQVHUWV
5HPRYHWKHSDVVHQJHUVLGHORZHULQVWUXPHQWSDQHOLQVXODWRU
2SHQWKHgloveFRPSDUWPHQWGRRU
5HPRYHWKH/+DQG5+IORRUFRQVROHVLGHWULPILQLVKSDQHOV
127(
/+VKRZQ5+VLPLODU
5HPRYHWKH/+DQG5+KHDWHUGXFWV
5HPRYHWKHLQVWUXPHQWSDQHOFHQWHUILQLVKSDQHO
‡ 3XOORXWZDUGRQWKHSDQHOWRGLVHQJDJHWKHFOLSV
‡ 'LVFRQQHFWWKHHOHFWULFDOFRQQHFWRUV
5HPRYHWKHIORRUFRQVROHILQLVKSDQHO
‡ /LIWWKHIORRUFRQVROHILQLVKSDQHOXSZDUGWRUHOHDVHWKHUHWDLQLQJFOLSV
‡ 'LVFRQQHFWWKHHOHFWULFDOFRQQHFWRUVLIHTXLSSHG
5HPRYHWKHpassengerVLOOSODWH
Page 2 of 11
SK9A8J-13E700-AA
© Copyright Ford 2010 FoMoCo
2011 Fiesta
Ambient Lighting Kit
3
INSTALLATION (Continued)
‡ 3XOOWKHIURQWLQERDUGVHFWLRQRIWKHVFXIISODWHWULPSDQHORXWZDUGWRUHOHDVHWKHUHWDLQLQJFOLS
‡ 127(
7KHUHWDLQLQJFOLSVPXVWVWD\DWWDFKHGWRWKHGRRUZHDWKHUVWULSDQGSLQFKZHOG
/LIWWKHVFXIISODWHWULPSDQHOVWUDLJKWXSWRUHOHDVHWKHVFXIISODWHWULPSDQHOIURPWKHUHWDLQLQJ
FOLSV
#
127(
'RQRWWRXFKWKHDGKHVLYHUHGXFHGDGKHVLRQPD\UHVXOW
127(
'RQRWUHPRYHWKHFOHDUSURWHFWLYHILOPIURPWKHEDFNRIWKH&0/PRGXOH
,GHQWLI\WKHGLVWULEXWLRQER[ZLWKWKHGRXEOHVLGHGDGKHVLYHSDGDWWDFKHGWRWKHEDFN
,GHQWLI\WKH&0/PRGXOHZLWKWKHFOHDUSURWHFWLYHILOPDWWDFKHGWRWKHEDFN
$SSO\WKHDGKHVLYHSDGVXSSOLHGLQWKHKDUGZDUHNLWGLUHFWO\WRWKHFOHDUSURWHFWLYHILOPRIWKH
&0/PRGXOH
)RUDXWRPDWLFWUDQVPLVVLRQHTXLSSHGYHKLFOHVUHPRYHWKHSURWHFWLYHEDFNLQJIURPWKHDGKHVLYHSDG
RIERWKPRGXOHVDQGVHFXUHERWKRIWKHPRGXOHVLQVLGHWKHFHQWHUFRQVROHDVVKRZQEHORZ
)RUPDQXDOWUDQVPLVVLRQHTXLSSHGYHKLFOHVUHPRYHWKHSURWHFWLYHEDFNLQJIURPWKHDGKHVLYHSDGRI
ERWKPRGXOHVDQGVHFXUHERWKRIWKHPRGXOHVLQVLGHWKHFHQWHUFRQVROHDVVKRZQEHORZ
Page 3 of 11
SK9A8J-13E700-AA
© Copyright Ford 2010 FoMoCo
2011 Fiesta
Ambient Lighting Kit
4
INSTALLATION (Continued)
$%
127(
$YRLGURXWLQJDPELHQWOLJKWLQJZLUHVQHDUVKDUSHGJHVDQGPRYLQJFRPSRQHQWV
127(
(QVXUHWKHDPELHQWOLJKWLQJZLUHVDUHVHFXUHDQGGRQRWLQWHUIHUHZLWKYHKLFOHRSHUDWLRQ
5RXWHWKHOLJKWHQJLQH/('KDUQHVVDQGWKHZLUHSRZHUKDUQHVVWRWKHGULYHUIRRWZHOODUHD
5RXWHWKHVZLWFKKDUQHVVDQGWKHKDUQHVVFRQWDLQLQJWKHH[SRVHG/('HQGVWRWKHFRQVROHER[DUHD
&'
127(
,IWKLVYHKLFOHXVHVDOLQHULQWKHFXSKROGHUFDUHIXOO\PDUNWKH/('ORFDWLRQRQWRWKHOLQHU7KHQ
UHPRYHWKHOLQHUDQGXVHD
KROORZSXQFKWRSXQFKDKROHLQWKHOLQHUWRDOORZWKH/('OLJKWWRSDVV
WKURXJKWKHOLQHU5HLQVWDOOWKHOLQHUZKHQFRPSOHWH2QHVRXUFHRIWKHKROORZSXQFKVHWLV+DUERU
)UHLJKWLWHPRUXVHDQHTXLYDOHQW
KROORZSXQFKIURPDQRWKHUVRXUFH
127(
$YRLGGULYHUGLVWUDFWLRQE\ORFDWLQJWKHFXSKROGHU/('LQWKHR
FORFNSRVLWLRQRXWRIWKHGULYHUOLQHRI
VLJKW
:RUNLQJIURPWKHXQGHUVLGHRIWKHIORRUFRQVROHILQLVKSDQHOORFDWHDQGGULOO
PPKROHVLQ
WKHIURQWDQGUHDUFXSKROGHUDVVKRZQEHORZ
Page 4 of 11
SK9A8J-13E700-AA
© Copyright Ford 2010 FoMoCo
2011 Fiesta
Ambient Lighting Kit
5
INSTALLATION (Continued)
5RXWHERWKRIWKH([SRVHG/('KRXVLQJVWRWKH
PPKROHVLQWKHIURQWRIWKHIORRUFRQVROH
ER[
$WWDFKWKH/('OHQVWRERWKRIWKHH[SRVHG/('KRXVLQJV
Page 5 of 11
SK9A8J-13E700-AA
© Copyright Ford 2010 FoMoCo
2011 Fiesta
Ambient Lighting Kit
6
*#+
$#
$VVHPEOHOLJKWURGUHWDLQHUFOLSVXVLQJSDUWVIURPWKHKDUGZDUHNLWDVVKRZQEHORZ
‡ $WWDFKVDGGOHFOLSWR-QXWXVLQJVXSSOLHGKDUGZDUH
‡ $WWDFKWLHVWUDSWRVDGGOHFOLS
127(
2QHHQGRIWKHOLJKWURGLVVLOYHUWKHRWKHUHQGLVSULQWHGZLWKWKHSDUWQXPEHU7KHOLJKWHQJLQH/('
KRXVLQJLVDWWDFKHGWRWKHSDUWQXPEHUHQGRIWKHOLJKWURG
8VLQJWKHDVVHPEOHGKDUGZDUHDWWDFKWKH
OLJKWURGWRWKHORZHUGDVKLQWKHGULYHUIRRWZHOODV
VKRZQEHORZ
‡ 7KHVLOYHUHQGRIWKH
OLJKWURGLVSODFHGRXWERDUGFORVHVWWRWKHYHKLFOHGRRU
‡ /RFDWHFOLSV
‡ 6HFXUHWLHVWUDSV
Page 6 of 11
SK9A8J-13E700-AA
© Copyright Ford 2010 FoMoCo
2011 Fiesta
Ambient Lighting Kit
7
INSTALLATION (Continued)
127(
9LHZORRNLQJXSIURPSDVVHQJHUIRRWZHOO
8VLQJLQFOXGHGZLUHWLHVVHFXUHWKH
OLJKWURGWRWKHZLUHKDUQHVVEHORZWKHSDVVHQJHUORZHUGDVK
DVVKRZQEHORZ
‡ 7KHVLOYHUHQGRIWKH
OLJKWURGLVSODFHGRXWERDUGIDUWKHVWIURPWKHSDVVHQJHUVHDW
‡ 6HFXUHERWKHQGVRIWKHOLJKWURGZLWKWKHWLHVWUDSV
5RXWHWKHOLJKWHQJLQH/('KRXVLQJVWRWKHGULYHUVDQGSDVVHQJHUVIRRWZHOODUHD
127(
2QHHQGRIWKHOLJKWURGLVVLOYHUWKHRWKHUHQGLVSULQWHGZLWKWKHSDUWQXPEHU7KHOLJKWHQJLQH
/('KRXVLQJLVDWWDFKHGWRWKHSDUWQXPEHUHQGRIWKHOLJKWURG
&RQQHFWWKHOLJKWHQJLQH/('KRXVLQJFRQWDLQLQJZLUHVWRWKHOLJKWURGV
‡ $WWDFKWRWKHSDUWQXPEHUHQGRIWKHOLJKWURG
Page 7 of 11
SK9A8J-13E700-AA
© Copyright Ford 2010 FoMoCo
2011 Fiesta
Ambient Lighting Kit
8
INSTALLATION (Continued)
,
127,&(
%HIRUHGULOOLQJPDNHVXUHWKHORFDWLRQZLOOQRWLQWHUIHUHZLWKWKHIORRUFRQVROHWRIORRUFRQVROH
VLGHILQLVKSDQHOPRXQWLQJ
)RU9HKLFOHVHTXLSSHGZLWKKHDWHGVHDWVORFDWHDQGGULOO
PPKROH,QWKHIORRUFRQVROH
VLGHILQLVKSDQHODVVKRZQEHORZ
‡ )LOHVZLWFKORFDWLQJQRWFKHVLQWKHPPKROH
127,&(
%HIRUHGULOOLQJPDNHVXUHWKHORFDWLRQZLOOQRWLQWHUIHUHZLWKWKHLQVWUXPHQWSDQHOFHQWHU
ILQLVKSDQHOPRXQWLQJ
)RUYHKLFOHVHTXLSSHGZLWKUHJXODUVHDWVORFDWHDQGGULOO
PPKROH,QWKHLQVWUXPHQW
SDQHOFHQWHUILQLVKSDQHODVVKRZQEHORZ
‡ )LOHVZLWFKORFDWLQJQRWFKHVLQWKHPPKROH
Page 8 of 11
SK9A8J-13E700-AA
© Copyright Ford 2010 FoMoCo
2011 Fiesta
Ambient Lighting Kit
9
INSTALLATION (Continued)
,QVWDOOWKHDPELHQWOLJKWLQJVZLWFKWRWKHORFDWLRQGHVFULEHGLQWKHSUHYLRXVVWHSV
,#-#
127(
)RUSURSHUZLUHVSOLFLQJWHFKQLTXHVFOLFNKHUH
&RQQHFWWKH%ODFNJURXQGZLUHIURPWKHDPELHQWOLJKWLQJKDUQHVVWRWKHFKDVVLVJURXQGSRLQWDWWKH
passenger sill plateRULQDVXLWDEOHJURXQGLQJORFDWLRQ
127(
$'920FRQQHFWHGWRWKHFRUUHFWZLUHZLOOVKRZ9ZLWKWKHSDUNODPSVZLWFKLQWKH2))
SRVLWLRQWKHQVKRZ9ZLWKWKHSDUNODPSVZLWFKLQWKH21SRVLWLRQ
$ORJLFSUREHZLOOVKRZJURXQGRQWKHFRUUHFWZLUHZLWKWKHSDUNODPSVZLWFKLQWKH2))SRVLWLRQ
WKHQVKRZSRZHUZLWKWKHSDUNODPSVZLWFKLQWKH21SRVLWLRQ
,GHQWLI\WKH:KLWH9LROHWSDUNLQJOLJKWFLUFXLWZLUHDWWKH%RG\&RQWURO0RGXOH%&0FRQQHFWRU
&&3LQ
Page 9 of 11
SK9A8J-13E700-AA
© Copyright Ford 2010 FoMoCo
2011 Fiesta
Ambient Lighting Kit
10
INSTALLATION (Continued)
35. Connect the White wire from the ambient lighting harness to the White/Violet parking light circuit
wire at the Body Control Module (BCM) Connector C2280C Pin 14.
Install Trim
36. NOTE:
Ensure the ambient lighting wires are secure and do not interfere with vehicle operation.
Use the supplied 4'' tie straps to secure the ambient lighting harness wires.
37. Install the passenger sill plate.
38. Install the LED housing and lens to the floor console cup holders.
39. Use the supplied 4'' tie straps to secure any unused LED housing and ambient lighting harness wires.
40. Install the floor console finish panel.
• Connect the electrical connectors.
• Push downward on the panel to engage the retaining clips.
41. Install the instrument panel center finish panel.
• Connect the electrical connectors.
42. Install the LH and RH heater ducts.
43. Install the LH and RH floor console side trim finish panels.
44. Close the glove compartment door.
45. Install the passenger side lower instrument panel insulator.
46. If equipped, install the cup holder inserts.
Vehicles With Manual Transmission
47. Install the gearshift lever knob.
• Turn the gearshift lever knob in a clockwise direction.
Vehicles With Automatic Transmission
Page 10 of 11
SK9A8J-13E700-AA
©CopyrightFord2010FoMoCo
2011 Fiesta
Ambient Lighting Kit
11
INSTALLATION (Continued)
48. Install the floor shifter trim ring.
• Push the floor shifter trim ring downward.
• Place the gearshift lever in the PARK position.
• Release the parking brake.
Page 11 of 11
SK9A8J-13E700-AA
©CopyrightFord2010FoMoCo
Was this manual useful for you? yes no
Thank you for your participation!

* Your assessment is very important for improving the work of artificial intelligence, which forms the content of this project

Download PDF

advertising