Philips 24HFL2829T, 28HFL2829T, 40HFL2829T, 19HFL2829P, 32HFL2829T, 48HFL2829T User manual

Philips 24HFL2829T, 28HFL2829T, 40HFL2829T, 19HFL2829P, 32HFL2829T, 48HFL2829T User manual
19HFL2829P/12
24HFL2829T/12
28HFL2829T/12
32HFL2829T/12
40HFL2829T/12
48HFL2829T/12
EN
User manual
Contents
1RWL¿FDWLRQVIHDWXUHVDQGDFFHVVRULHV ..................4
(QHUJ\HI¿FLHQF\ ....................................................4
79VFUROOEXWWRQ.......................................................4
6ZLWFKLQJRQRII ......................................................4
)LUVWWLPHLQVWDOODWLRQ ...............................................4
3OD\PHGLD¿OHVIURPD86%GULYH ..........................5
0HGLDEURZVHUPHQX ..............................................5
CEC ........................................................................5
&KDQJH79VHWWLQJV ................................................5
'LVSOD\RSWLRQV .......................................................5
6RXQGRSWLRQV.........................................................6
&RQ¿JXULQJSDUHQWDOVHWWLQJV ..................................6
(OHFWURQLFSURJUDPJXLGH(3*.............................6
8SGDWH\RXU79 ......................................................6
7URXEOHVKRRWLQJ7LSV ...........................................6
$9DQG+'0,VLJQDOFRPSDWLELOLW\...........................9
6XSSRUWHG¿OHIRUPDWVIRU86%PRGH ...................10
English - 1 -
Important
µ5HDG DQG XQGHUVWDQG DOO LQIRUPDWLRQ LQ WKH
DFFRPSDQ\LQJ6DIHW\ERRNOHWEHIRUH\RXLQVWDOODQG
XVH\RXU79,IGDPDJHLVFDXVHGE\IDLOXUHWRIROORZ
WKHVHLQVWUXFWLRQVWKHZDUUDQW\GRHVQRWDSSO\¶
Disposal of old Equipment and Batteries
3OHDVHGRQRWGLVSRVHGWKLV79RUEDWWHU\DVJHQHUDO
KRXVHKROGZDVWH,I\RXZDQWWRGLVSRVHWKLVSURGXFW
RUEDWWHU\SOHDVHFRQVLGHUWKHFROOHFWLRQV\VWHPV
RUIDFLOLWLHVIRUDSSURSULDWHUHF\FOLQJ
Notice: The sign Pb below the symbol for batteries indicates
that this battery contains lead.
Battery
Products
English - 2 -
Use Your TV
Remote Control
1.
Standby: 6ZLWFKHV2Q2IIWKH79
2.
Text: 'LVSOD\V WHOHWH[W ZKHUH DYDLODEOH SUHVV DJDLQ
WR VXSHULPSRVH WKH WHOHWH[W RYHU D QRUPDO EURDGFDVW
SLFWXUHPL[
3.
Stop:6WRSVWKHPHGLDEHLQJSOD\HG
4.
Screen: &KDQJHVWKHDVSHFWUDWLRRIWKHVFUHHQ
5.
Source: 6KRZV DOO DYDLODEOH EURDGFDVW DQG FRQWHQW
VRXUFHV
6.
Menu: 'LVSOD\V79PHQX
7.
Swap: 4XLFNO\ F\FOHV EHWZHHQ SUHYLRXV DQG FXUUHQW
FKDQQHOVRUVRXUFHV
,IWKHHotel ModeLVVHWWROnDSUHVVRIWKLVEXWWRQ
VZLWFKHV EHWZHHQ WKH 1HWZRUN &KDQQHO 7\SHV '9%
7$QDORJXHDQG'9%&DEOH$QDORJXH
8.
Navigation buttons: +HOSV QDYLJDWH PHQXV FRQWHQW
HWF DQG GLVSOD\V WKH VXESDJHV LQ 7;7 PRGH ZKHQ
SUHVVHG5LJKWRU/HIW
9.
Programme - / Page +
10. Volume 11. Green button: )ROORZ WKH RQVFUHHQ LQVWUXFWLRQV IRU
FRORXUHGEXWWRQIXQFWLRQV
12. Red button: )ROORZ WKH RQVFUHHQ LQVWUXFWLRQV IRU
FRORXUHGEXWWRQIXQFWLRQV
13. Numeric buttons: 6ZLWFKHV WKH FKDQQHO HQWHUV D
QXPEHURUDOHWWHULQWKHWH[WER[RQWKHVFUHHQ
14. Subtitles:7XUQVVXEWLWOHVRQDQGRIIZKHUHDYDLODEOH
15. Language:6ZLWFKHVEHWZHHQVRXQGPRGHVDQDORJXH
79 GLVSOD\V DQG FKDQJHV DXGLRVXEWLWOH ODQJXDJH
GLJLWDO79ZKHUHDYDLODEOH
16. Blue button: )ROORZ WKH RQVFUHHQ LQVWUXFWLRQV IRU
FRORXUHGEXWWRQIXQFWLRQV
17. Yellow button: )ROORZ WKH RQVFUHHQ LQVWUXFWLRQV IRU
FRORXUHGEXWWRQIXQFWLRQV
18. Volume +
19. Mute:&RPSOHWHO\WXUQVRIIWKHYROXPHRIWKH79
20. Programme + / Page 21. Return/Back:5HWXUQVWRSUHYLRXVVFUHHQRSHQVLQGH[
SDJHLQ7;7PRGH
22. OK: &RQ¿UPVXVHUVHOHFWLRQVKROGVWKHSDJHLQ7;7
PRGHYLHZVFKDQQHOOLVW
23. Info: 'LVSOD\V LQIRUPDWLRQ DERXW RQVFUHHQ FRQWHQW
VKRZVKLGGHQLQIRUPDWLRQUHYHDOLQ7;7PRGH
Teletext
3UHVVTextEXWWRQWRHQWHU3UHVVDJDLQWRDFWLYDWH
PL[ PRGH 3UHVV RQFH PRUH WR H[LW )ROORZ WKH
LQVWUXFWLRQVGLVSOD\HGRQGLJLWDOWHOHWH[WVFUHHQ
Digital teletext
3UHVVTextEXWWRQWRYLHZGLJLWDOWHOHWH[WLQIRUPDWLRQ
2SHUDWHLWZLWKWKHFRORUHGEXWWRQVFXUVRUEXWWRQV
DQG OK EXWWRQ 7KH RSHUDWLRQ PHWKRG PD\ GLIIHU
GHSHQGLQJ RQ WKH FRQWHQWV RI WKH GLJLWDO WHOHWH[W
)ROORZ WKH LQVWUXFWLRQV GLVSOD\HG RQ GLJLWDO WHOHWH[W
VFUHHQ
24. Play:6WDUWVWRSOD\VHOHFWHGPHGLD
25. Pause:3DXVHVWKHPHGLDEHLQJSOD\HG
26. Sleep:6HWV\RXU79WRVKXWGRZQDXWRPDWLFDOO\
27. EPG (Electronic programme guide): 'LVSOD\V WKH
HOHFWURQLFSURJUDPPHJXLGH
Note: The Remote Control range is approximately 7m / 23ft.
English - 3 -
1RWL¿FDWLRQVIHDWXUHVDQGDFFHVVRULHV
(QHUJ\HI¿FLHQF\
7KLV79LVGHVLJQHGZLWKHQHUJ\HI¿FLHQ\IHDWXUHV
‡Power save mode (Eco): <RX FDQ DSSO\ D
FRPELQDWLRQ RI HQHUJ\ VDYLQJ SLFWXUH VHWWLQJV
:KLOH\RXZDWFK79SUHVVWKHMenuEXWWRQDQG
WKHPower Save ModeVHWWLQJVFDQEHIRXQGLQWKH
PictureVHFWLRQRIWKH0DLQ0HQX
‡Picture off mode: ,I\RXRQO\ZDQWWROLVWHQWRDXGLR
IURPWKH79\RXFDQVZLWFKRIIWKHGLVSOD\2WKHU
IXQFWLRQVFRQWLQXHWRRSHUDWHQRUPDOO\:KLOH\RX
ZDWFK79SUHVVMenu EXWWRQDQGVHOHFWPicture
DQGIURPWKHUHVHOHFWWKHPower Save ModeRSWLRQ
3UHVV5LJKWEXWWRQZKLOHEcoLVVHOHFWHG$PHVVDJH
ZLOOEHGLVSOD\HGRQWKHVFUHHQ6HOHFWPROCEED
DQGSUHVVOKWRWXUQWKHVFUHHQRIILPPHGLDWHO\,I
\RXGRQ¶WSUHVVDQ\EXWWRQWKHVFUHHQZLOOEHRIILQ
VHFRQGV3UHVVDQ\EXWWRQRQWKHUHPRWHRURQ
WKH79WRWXUQWKHVFUHHQRQDJDLQ
Note: Disconnect your TV from the mains plug in case your
TV is going to be inactive for a long time.
To switch the TV to standby:3UHVVWKHPLGGOHRI
WKHEXWWRQGRZQDQGKROGLWGRZQIRUDIHZVHFRQGV
WKH79ZLOOWXUQLQWRVWDQGE\PRGH
Switching on/off
To switch the TV on
7RVZLWFKRQWKH79IURPVWDQGE\PRGHHLWKHU
‡3UHVV WKH Standby EXWWRQ Programme +/- RU D
QXPHULFEXWWRQRQWKHUHPRWHFRQWURO
‡3UHVVWKHVLGHIXQFWLRQVZLWFKXQWLOWKH79FRPHV
RQIURPVWDQGE\
Note: If the TV has been left on and not been operated for a
while, the TV will go into standby. When you next switch-on,
the following message will be displayed. “Standby Cause
No Operation”, Press OK to continue.
To switch the TV off
‡3UHVVWKHStandbyEXWWRQRQWKHUHPRWHFRQWURORU
SUHVVWKHVLGHIXQFWLRQVZLWFKXQWLOWKH79VZLWFKHV
LQWRVWDQGE\PRGH
Note: To power down the TV completely, unplug the power
cord from the mains socket.
First time installation
TV scroll button
7KH796FUROOEXWWRQRQWKHVLGHRIWKH79DOORZV\RX
WRFRQWUROWKHYROXPHFKDQJHFKDQQHOVDQGSXWWKH
79LQWRVWDQGE\
<RXZLOOVHHWKHODQJXDJHVHOHFWLRQVFUHHQZKHQ\RX
¿UVWWXUQRQ\RXU796HOHFW\RXUSUHIHUUHGODQJXDJH
DQGSUHVVOK.
Note: If a USB device is connected to the TV, you can press
the GREEN button on the remote before continuing, in order
to load the NVRAM data (service list, preferences, etc.) from
the USB device which is uploaded from another Philips Hotel
TV. Refer to the "Copy To USB" and "Copy From USB"
sections under the Hotel Mode title on the pages at the end
of this manual.
,I WKH FRUUHFW VRIWZDUH XSGDWH ¿OH LV SUHLQVWDOOHG LQ WKH
USB device, you can press the RED button on the remote
before continuing, in order to upgrade your TV’s software.
7KHVRIWZDUHXSGDWH¿OHVKRXOGEHQDPHGDV³9(6+(B
upgrade.bin”.
Software upgrade via an USB device can be done anytime by
using the hidden key combination, “Menu-1-5-0-5”.
To change volume:,QFUHDVHWKHYROXPHE\VFUROOLQJ
XS'HFUHDVHWKHYROXPHE\VFUROOLQJGRZQ
To change channel:
‡3UHVV WKH PLGGOH RI WKH VFUROOEXWWRQ WKH FKDQQHO
LQIRUPDWLRQEDQQHUZLOODSSHDURQVFUHHQ
‡6FUROOWKURXJKWKHVWRUHGFKDQQHOVE\SXVKLQJWKH
EXWWRQXSRUGRZQ
To change source:
‡3UHVVWKHPLGGOHRIWKHEXWWRQWZLFHWKHVRXUFHOLVW
ZLOODSSHDURQVFUHHQ
‡6FUROOWKURXJKWKHDYDLODEOHVRXUFHVE\SXVKLQJWKH
EXWWRQXSRUGRZQ
2QWKHQH[WVFUHHQVHW\RXUSUHIHUHQFHVXVLQJWKH
QDYLJDWLRQ EXWWRQV DQG ZKHQ ¿QLVKHG SUHVV OK
IROORZHGE\WKHVHOHFWLRQHome Mode / Store Mode.
<RXFDQVHWXS\RXU79E\IROORZLQJWKH)LUVW7LPH
,QVWDOODWLRQ)7,VFUHHQZLWKWKHIROORZLQJVHOHFWLRQV
Aerial installation
6HOHFWWKHAerialRSWLRQIURPWKHSearch TypeVFUHHQ
WRVHDUFKIRUWHUUHVWULDOGLJLWDO79EURDGFDVWV
Cable installation
6HOHFW Cable RSWLRQ DQG SUHVV OK RQ WKH UHPRWH
FRQWURO)RUDXWRPDWLFLQVWDOODWLRQLQFDVH\RXU&DEOH
QHWZRUN VXSSOLHU VXSSRUWV D 1HWZRUN,' EDVHG
LQVWDOODWLRQHJ8QLW\PHGLDVHOHFWYesLQIROORZLQJ
VFUHHQDQGSUHVVOK.
English - 4 -
,QFDVH\RXU&DEOHQHWZRUNVXSSOLHUGRHVQRWVXSSRUW
D 1HWZRUN,' EDVHG LQVWDOODWLRQ SOHDVH VHOHFW No
SUHVVOK DQGIROORZWKHLQVWUXFWLRQRQWKHVFUHHQ
<RXFDQDOVRVHOHFWIUHTXHQF\UDQJHVIURPWKLVVFUHHQ
(QWHU WKH IUHTXHQF\ UDQJH PDQXDOO\ E\ XVLQJ WKH
QXPHULFEXWWRQV
Note: Searching duration will change depending on the
selected search step.
:KLOHWKHVHDUFKFRQWLQXHVDPHVVDJHPD\DSSHDU
DVNLQJZKHWKHU\RXZDQWWRVRUWFKDQQHOVDFFRUGLQJ
WRWKH/&1(*)6HOHFWYesDQGSUHVVOK WRFRQ¿UP
(*) LCN is the Logical Channel Number system that organizes
available broadcasts in accordance with a recognizable
channel number sequence (if available).
$IWHU DOO WKH DYDLODEOH VWDWLRQV DUH VWRUHG WKH Edit
Channel ListZLOOEHGLVSOD\HGRQWKHVFUHHQ3UHVV
MenuEXWWRQWRTXLWEdit Channel List DQGZDWFK79
Note: Do not turn off the TV while initializing first time
installation. Note that, some options may not be available
depending on the country selection.
3OD\PHGLD¿OHVIURPD86%GULYH
<RXFDQSOD\SKRWRPXVLFDQGPRYLH¿OHVVWRUHGRQD
86%GLVNE\FRQQHFWLQJLWWR\RXU79&RQQHFWD86%
GLVNWRRQHRIWKH86%LQSXWVORFDWHGRQWKHVLGHRI
WKH793UHVVLQJWKHMenuEXWWRQZKLOHLQWKH0HGLD
%URZVHUPRGHZLOODFFHVVWKHPictureSoundDQG
Settings PHQX RSWLRQV 3UHVVLQJ WKH Menu EXWWRQ
DJDLQZLOOH[LWIURPWKLVVFUHHQ <RXFDQVHW\RXU0HGLD
%URZVHUSUHIHUHQFHVE\XVLQJWKHSettings PHQX
IMPORTANT!%DFNXS\RXU¿OHVEHIRUHPDNLQJDQ\
FRQQHFWLRQVWRWKH797KHPDQXIDFWXUHUZLOOQRWEH
UHVSRQVLEOHIRUDQ\¿OHGDPDJHRUGDWDORVV&HUWDLQ
W\SHV RI 86% GHYLFHV IRU H[DPSOH 03 SOD\HUV
RU86%KDUGGLVNGULYHVPHPRU\VWLFNVPD\QRWEH
FRPSDWLEOHZLWKWKLV79
Media browser menu
/RRS6KXIÀH0RGH2SHUDWLRQ
EXWWRQDQGDFWLYDWH
$OO¿OHVLQWKHOLVWZLOOEH
FRQWLQXRXVO\SOD\HGLQRULJLQDO
RUGHU
6WDUWSOD\EDFNZLWKWKHOK
EXWWRQDQGDFWLYDWH
7KHVDPH¿OHZLOOEHSOD\HG
FRQWLQXRXVO\UHSHDW
6WDUWSOD\EDFNZLWKWKHPlay
EXWWRQDQGDFWLYDWH
$OO¿OHVLQWKHOLVWZLOOEH
SOD\HGRQFHLQUDQGRPRUGHU
6WDUWSOD\EDFNZLWKWKHPlay
EXWWRQDQGDFWLYDWH
$OO¿OHVLQWKHOLVWZLOOEH
FRQWLQXRXVO\SOD\HGLQWKH
VDPHUDQGRPRUGHU
6WDUWSOD\EDFNZLWKWKHPlay
CEC
7KLV IXQFWLRQ DOORZV WR FRQWURO WKH &(&HQDEOHG
GHYLFHVWKDWDUHFRQQHFWHGWKURXJK+'0,SRUWVE\
XVLQJWKHUHPRWHFRQWURORIWKH79
:KHQQHZ&(&VRXUFHGHYLFHLVFRQQHFWHGLWZLOOEH
OLVWHGLQVRXUFHPHQXZLWKLWVRZQQDPHLQVWHDGRI
WKHFRQQHFWHG+'0,SRUWVQDPHVXFKDV'9'3OD\HU
5HFRUGHUHWF
7KH79UHPRWHLVDXWRPDWLFDOO\DEOHWRSHUIRUPWKH
PDLQIXQFWLRQVDIWHUWKHFRQQHFWHG+'0,VRXUFHKDV
EHHQVHOHFWHG
7RWHUPLQDWHWKLVRSHUDWLRQDQGFRQWUROWKH79YLDWKH
UHPRWHDJDLQSUHVVDQGKROGWKH³=HUR´EXWWRQRQ
WKHUHPRWHFRQWUROIRUVHFRQGV7KLVIHDWXUHFDQDOVR
EH HQDEOHG RU GLVDEOHG XQGHU WKH Settings>Other
SettingsPHQX
7KH79 VXSSRUWV DOVR$5&$XGLR 5HWXUQ &KDQQHO
IHDWXUH7KLVIHDWXUHLVDQDXGLROLQNPHDQWWRUHSODFH
RWKHUFDEOHVEHWZHHQWKH79DQGWKHDXGLRV\VWHP
$9UHFHLYHURUVSHDNHUV\VWHP
:KHQ$5&LVDFWLYH79GRHVQRWPXWHLWVRWKHUDXGLR
RXWSXWVDXWRPDWLFDOO\6R\RXQHHGWRGHFUHDVH79
YROXPHWR]HURPDQXDOO\LI\RXZDQWWRKHDUDXGLR
IURP FRQQHFWHG DXGLR GHYLFH RQO\ VDPH DV RWKHU
RSWLFDORUFRD[LDOGLJLWDODXGLRRXWSXWV,I\RXZDQW
WR FKDQJH FRQQHFWHG GHYLFH¶V YROXPH OHYHO \RX
VKRXOGVHOHFWWKDWGHYLFHIURPWKHVRXUFHOLVW,QWKDW
FDVHYROXPHFRQWURONH\VDUHGLUHFWHGWRFRQQHFWHG
DXGLRGHYLFH
System Audio Control
$OORZVDQ$XGLR$PSOL¿HU5HFHLYHUWREHXVHGZLWK
WKH 79 7KH YROXPH FDQ EH FRQWUROOHG XVLQJ WKH
UHPRWHFRQWURORIWKH797RDFWLYDWHWKLVIHDWXUHVHW
WKHSpeakersRSWLRQLQWKHSettings>Other Settings
PHQXDV$PSOL¿HU7KH79VSHDNHUVZLOOEHPXWHG
DQGWKHVRXQGRIWKHZDWFKHGVRXUFHZLOOEHSURYLGHG
IURPWKHFRQQHFWHGVRXQGV\VWHP
Note: The audio device should support System Audio Control
feature and CEC option should be set as Enabled.
Change TV settings
7RDFFHVVWKHRSWLRQVOLVWHGEHORZ
1- 3UHVVWKHMenuEXWWRQ
2- +LJKOLJKW\RXUVHOHFWLRQ
3- 3UHVVOKWRFRQ¿UP
Display options
Mode: &KDQJHV WKH SLFWXUH PRGH WR RQH RI WKH
IROORZLQJ Cinema Game Sports Dynamic DQG
Natural.
Contrast:6HWVWKHOLJKWDQGGDUNYDOXHVRIWKHLPDJH
Brightness:6HWVWKHEULJKWQHVVYDOXHRIWKHLPDJH
Sharpness: 6HWV WKH VKDUSQHVV YDOXH $ KLJK
VKDUSQHVVYDOXHPD\UHVXOWLQDFOHDUHUFULVSHULPDJH
GHSHQGLQJRQWKHFRQWHQW
7KH CEC RSWLRQ LQ WKH Settings>Other Settings Color:6HWVWKHFRORUYDOXH
PHQX VKRXOG EH VHW DV Enabled DW ¿UVW 3UHVV WKH
Source EXWWRQ DQG VHOHFW WKH +'0, LQSXW RI WKH Backlight:&RQWUROVWKHEULJKWQHVVRIWKHEDFNOLJKW
FRQQHFWHG&(&GHYLFHIURPWKHSources listPHQX
English - 5 -
Noise reduction: 5HGXFHV WKH QRLVH OHYHO LQ WKH
LPDJH
Sound options
Volume: $GMXVWVYROXPHOHYHO
OK:'LVSOD\VSURJUDPRSWLRQV
Text button (Search):'LVSOD\VGuide SearchPHQX
Swap button (Now):'LVSOD\V FXUUHQWHYHQWRIWKH
KLJKOLJKWHGFKDQQHO
Program Options
Equalizer:&KDQJHVWKHHTXDOL]HUPRGH
Balance:$GMXVWVZKHWKHUWKHVRXQGLVFRPLQJPDLQO\
IURPWKHULJKWRUOHIWVSHDNHUV
Headphone: 6HWVKHDGSKRQHYROXPH
Sound mode: 6HWVWKHSUHIHUUHGVRXQGPRGH
AVL:6HWVDOLPLWWRPD[LPXPYROXPHRXWSXW
Dynamic bass: (QDEOHV RU GLVDEOHV WKH '\QDPLF
%DVV,QFUHDVHVWKHUDQJHRIEDVV
Surround sound: 6XUURXQG VRXQG PRGH FDQ EH
FKDQJHGDVOnRUOff.
Digital Out: 6HWVGLJLWDORXWDXGLRW\SH
&RQ¿JXULQJSDUHQWDOVHWWLQJV
7KLV IHDWXUH LV IRU UHVWULFWLQJ DFFHVV WR VHOHFWHG
FRQWHQW,WLVFRQWUROOHGE\DSLQQXPEHUGH¿QHGE\
\RX
Note: Default PIN can be set to 0000 or 1234. If you have
defined the PIN(is requested depending on the country
selection) during the First Time Installation use the PIN that
\RXKDYHGH¿QHG
Menu lock (optional):0HQXORFNVHWWLQJHQDEOHVRU
GLVDEOHVWKHPHQXDFFHVV
Maturity lock (optional): ,I WKLV RSWLRQ LV VHW 79
JHWVWKHPDWXULW\LQIRUPDWLRQIURPWKHEURDGFDVWDQG
LI WKLV PDWXULW\ OHYHO LV GLVDEOHG GLVDEOHV DFFHVV WR
WKHEURDGFDVW
Child lock (optional)::KHQ&KLOG/RFNLVVHWWKH79
FDQRQO\EHFRQWUROOHGE\WKHUHPRWHFRQWURO,QWKLV
FDVHWKHFRQWUROSDQHOEXWWRQVZLOOQRWZRUN
Set PIN:'H¿QHVDQHZ3,1QXPEHU
Electronic program guide (EPG)
6RPH FKDQQHOV VHQG LQIRUPDWLRQ DERXW WKHLU
EURDGFDVWVFKHGXOHV3UHVVWKHEpgEXWWRQWRYLHZ
WKH(3*PHQX
Red button (Prev Day): 'LVSOD\V WKH SURJUDPV RI
SUHYLRXVGD\
Green button (Next day):'LVSOD\VWKHSURJUDPVRI
WKHQH[WGD\
Yellow button (Zoom):3UHVVWKHYellowEXWWRQWR
VHHHYHQWVLQDZLGHUWLPHLQWHUYDO
Blue button (Filter): 9LHZV¿OWHULQJRSWLRQV
SUBTTL: 3UHVV Subtitles EXWWRQ WR YLHZ 6HOHFW
*HQUHPHQX8VLQJWKLVIHDWXUH\RXFDQVHDUFKWKH
SURJUDPJXLGHGDWDEDVHLQDFFRUGDQFHZLWKWKHJHQUH
,QIRDYDLODEOHLQWKHSURJUDPJXLGHZLOOEHVHDUFKHG
DQGUHVXOWVPDWFKLQJ\RXUFULWHULDZLOOEHKLJKOLJKWHG
Info button: 'LVSOD\V GHWDLOHG LQIRUPDWLRQ DERXW
VHOHFWHGSURJUDPV
Numeric Buttons (Jump): -XPSV WR WKH SUHIHUUHG
FKDQQHOGLUHFWO\YLDQXPHULFEXWWRQV
,Q(3*PHQXSUHVVWKHOKEXWWRQWRRSHQWKHEvent
OptionsPHQX
Select Channel: ,Q(3*PHQXXVLQJWKLVRSWLRQ\RX
FDQVZLWFKWRWKHVHOHFWHGFKDQQHO
Set Timer / Delete Timer: $IWHU\RXKDYHVHOHFWHGD
SURJUDPLQWKH(3*PHQXSUHVVWKHOKEXWWRQ6HOHFW
WKHSet Timer on EventRSWLRQDQGSUHVVWKHOKEXWWRQ
<RXFDQVHWDWLPHUIRUIXWXUHSURJUDPV7RFDQFHODQ
DOUHDG\VHWWLPHUKLJKOLJKWWKDWSURJUDPDQGSUHVVWKH
OKEXWWRQ7KHQVHOHFWDelete TimerRSWLRQ7KHWLPHU
ZLOOEHFDQFHOOHG
Update your TV
1DYLJDWH RQ \RXU PDLQ PHQX FKRRVH VHWWLQJV WKH
YHUVLRQRIWKHFXUUHQWVRIWZDUHLVGLVSOD\HG
CAUTION: Do not install a lower version of software than the
current version installed on your product. TP Vision cannot
be held liable or be made responsible for problems caused
by a software downgrade.
Update with USB
%HIRUH\RXXSGDWHWKHVRIWZDUHPDNHVXUHWKDW\RX
KDYH
‡$ 86% VWRUDJH GHYLFH WKDW KDV DW OHDVW PHJDE\WHV RI VWRUDJH VSDFH LV )$7 RU '26
IRUPDWWHGDQGKDVLWVZULWHSURWHFWLRQGLVDEOHG
‡$FFHVV WR D FRPSXWHU ZLWK D 86% FRQQHFWRU DQG
,QWHUQHWDFFHVV
1 D Y L J D W H W R Z Z Z S K L O L S V F R P V X S S R U W D Q G
IROORZWKHVRIWZDUHXSGDWHLQVWUXFWLRQV
Automatic update from digital broadcast
:KLOH WKH 79 LV FRQQHFWHG WR DQ DHULDO VLJQDO ,I
Automatic scanning LQWKHUpgrade OptionsPHQX
LVEnabledWKH79ZDNHVXSDWDQGVHDUFKHV
EURDGFDVW FKDQQHOV IRU QHZ VRIWZDUH XSJUDGHV ,I
QHZVRIWZDUHLVIRXQGDQGGRZQORDGHGVXFFHVVIXOO\
WKHQH[WWLPHWKH79SRZHUVXSLWZLOOKDYHWKHQHZ
VRIWZDUHYHUVLRQ
Note: Do not unplug the power cord while led is blinking
during the reboot process. If the TV fails to come on after
the upgrade unplug the TV for 2 minutes and plug in again.
Troubleshooting & Tips
Tv will not turn on
0DNHVXUHWKHSRZHUFRUGLVSOXJJHGLQVHFXUHO\WR
ZDOORXWOHW&KHFNLIEDWWHULHVDUHH[KDXVWHG3UHVV
WKH3RZHUEXWWRQRQWKH79
Poor picture
‡&KHFNLI\RXKDYHVHOHFWHGWKHFRUUHFW79V\VWHP
English - 6 -
‡/RZVLJQDOOHYHOFDQFDXVHSLFWXUHGLVWRUWLRQ3OHDVH
FKHFNDQWHQQDDFFHVV
‡&KHFN LI \RX KDYH HQWHUHG WKH FRUUHFW FKDQQHO
IUHTXHQF\LI\RXKDYHGRQHPDQXDOWXQLQJ
‡7KHSLFWXUHTXDOLW\PD\GHJUDGHZKHQWZRGHYLFHV
DUHFRQQHFWHGWRWKH79DWWKHVDPHWLPH,QVXFK
DFDVHGLVFRQQHFWRQHRIWKHGHYLFHV
No picture
‡7KLVPHDQV\RXU79LVQRWUHFHLYLQJDQ\WUDQVPLVVLRQ
0DNHVXUHWKHFRUUHFWVRXUFHKDVEHHQVHOHFWHG
‡,VWKHDQWHQQDFRQQHFWHGSURSHUO\"
‡,VWKHDQWHQQDFDEOHGDPDJHG"
‡$UHVXLWDEOHSOXJVXVHGWRFRQQHFWWKHDQWHQQD"
‡,I\RXDUHLQGRXEWFRQVXOW\RXUGHDOHU
No sound
‡&KHFNLIWKH79LVPXWHG3UHVVWKHMuteEXWWRQRU
LQFUHDVHWKHYROXPHWRFKHFN
‡6RXQGPD\EHFRPLQJIURPRQO\RQHVSHDNHU&KHFN
WKHEDODQFHVHWWLQJVIURPVRXQGPHQX
Remote control - no operation
‡7KH EDWWHULHV PD\ EH H[KDXVWHG 5HSODFH WKH
EDWWHULHV
Input sources - can not be selected
‡,I\RXFDQQRWVHOHFWDQLQSXWVRXUFHLWLVSRVVLEOH
WKDWQRGHYLFHLVFRQQHFWHG,IQRW
‡&KHFNWKH$9FDEOHVDQGFRQQHFWLRQVLI\RXKDYH
WULHGWRFRQQHFWDGHYLFH
English - 7 -
6SHFL¿FDWLRQV
TV Broadcasting
PAL SECAM BG/DK/II’/LL’
Receiving
Channels
VHF (BAND I/III) - UHF (BAND U) - HYPERBAND
Digital Reception
Fully integrated digital terrestrial-cable TV(DVB-T-C)
(DVB-T2 compliant)
Number of Preset
Channels
1000
Channel Indicator
On Screen Display
RF Aerial Input
75 Ohm (unbalanced)
Operating Voltage
220-240V AC, 50Hz.
Audio
German+Nicam Stereo
Display
19”
24”
28”
32”
40”
48”
Audio Output
Power (WRMS.)
(10% THD)
2x2,5W
2x2,5W
2x6W
2x6W
2x8W
2x8 W
Power
Consumption (W)
45W
50W
50W
65W
75W
75 W
Weight (kg)
2,8 kg
3,45 kg
5,1 kg
5,65 kg
8,85 kg
12,45 kg
TV Dimensions
DxLxH (with foot)
(mm)
134x451x331 mm
134x554x370 mm
185x640x427 mm
185x735x478 mm
220x923x588 mm
220x1093x681 mm
TV Dimensions
DxLxH (without
foot) (mm)
35x451x296 mm
35(min)/61(max)
x554 x339 mm
38(min)/65(max)
x640x387 mm
77(min)/97(max)
x735x438 mm
79(min)/98(max)
x923x544 mm
81(min)/99(max)
x1093x642 mm
Operation
temperature
and operation
humidity:
5ºC up to 45ºC, 85% humidity max
English - 8 -
PC input typical display modes
AV and HDMI signal compatibility
7KH IROORZLQJ WDEOH LV DQ LOOXVWUDWLRQ RI VRPH RI WKH
W\SLFDOYLGHRGLVSOD\PRGHV
Index
Resolution
Frequency
1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
21
22
23
24
25
26
27
28
29
30
31
32
33
34
35
36
37
38
39
40
41
42
43
44
45
[
[
[
[
[
[
[
[
[
[
[
[
[
[
[
[
[
[
[
[
[
[
[
[
[
[
[
[
[
[
[
[
[
[
[
[
[
[
[
[
[
[
[
[
[
+]
+]
+]
+]
+]
+]
+]
+]
+]
+]
+]
+]
+]
+]
+]
+]
+]
+]
+]
+]
+]
+]
+]
+]
+]
+]
+]
+]
+]
+]
+]
+]
+]
+]
+]
+]
+]
+]
+]
+]
+]
+]
+]
+]
+]
Source
Supported Signals
Available
3$/
O
EXT
NTSC 60
O
(SCART)
5*%
O
SECAM
O
3$/
O
NTSC 60
O
SECAM
O
Side AV
PC/YPbPr
HDMI
English - 9 -
LS
+]
O
LS
+]
O
S
+]+]
O
1080i
+]+]
O
480i
+]
O
S
+]
O
LS
+]
O
S
+]+]
O
1080i
+]+]
O
S
+]
+]
+]
+]
+]
O
6XSSRUWHG¿OHIRUPDWVIRU86%PRGH
Media
Extension
Video
GDWPSJ 0SHJ
PSHJ
3#ISV0ELWVHF
WVWUS
WSPWV
03(*+
9&$9609&
+3[#ISV3#ISV09&3#ISV2WKHU3#ISV
0ELWVHF
YRE
03(*
3#ISV0ELWVHF
PNY
03(*
+
+3[#ISV3#ISV3#ISV0ELWVHF
PS
PRY
03(*;YL'
+
+3[#ISV3#ISV3#ISV0ELWVHF
DYL
03(*;YLG
+
+3[#ISV3#ISV3#ISV0ELWVHF
ÀDÀY
+6RUHQVRQ
+
+3[#ISV3#ISV3#ISV0ELWVHF
JS
03(*+
[#30ELWVHF
DVIZPY
VC1
3#ISV0ELWVHF
PS
03(*/D\HU
03
/D\HU.ESVa.ESV%LWUDWH.+]a.+]6DPSOLQJUDWH
Audio
Format
Notes
/D\HU.ESVa.ESV%LWUDWH.+]a.+]6DPSOLQJUDWH
/D\HU.ESVa.ESV%LWUDWH.+]a.+]6DPSOLQJUDWH
Picture
ZDY
/3&0
:0$
ASF
:0$:0$3UR
PDDDF
$$&+($$&
)UHH)RUPDW%LWUDWH.+]a.+]6DPSOLQJUDWH
SFP
PCM
.ESVa.ESV%LWUDWH.+]a.+]6DPSOLQJUDWH
ZRUNV
RQO\ZLWK
YLGHR
¿OHV
AC3
.ESVa.ESV%LWUDWH.+].+].+]6DPSOLQJUDWH
EAC3
.ESVa0ESV%LWUDWH.+].+].+]6DPSOLQJUDWH
/3&0
.ESVa0ESV%LWUDWH.+]a.K]6DPSOLQJUDWH
,0$$'3&0
MS-ADPCM
.ESV%LWUDWH.+]a.K]6DPSOLQJUDWH
*$PXODZ
a.ESV%LWUDWH.+]6DPSOLQJUDWH
%DVHOLQH
5HVROXWLRQ:[+[E\WHV
3URJUHVVLYH
5HVROXWLRQ:[+[E\WHV
QRQLQWHUODFH
5HVROXWLRQ:[+[E\WHV
LQWHUODFH
5HVROXWLRQ:[+[E\WHV
MSHJMSJ
SQJ
5HVROXWLRQ:[+[E\WHV
EPS
Subtitle
:0$ESVa.ESV%LWUDWH.+]a.K]6DPSOLQJUDWH
:0$3URNESV%LWUDWHa.+]6DPSOLQJUDWH
VXE
-
VUW
-
6XE6XE6XE
English - 10 -
HOTEL MODE
7KHKRWHOPRGHLVDVSHFLDOPRGHZKLFKUHVWULFWVVRPHRSHUDWLRQVRI797KLVDOORZVWKHFXVWRPHUWRXVH
WKH79LQVSHFLDOSODFHVVXFKDVKRWHOVSULVRQVRUKRVSLWDOV7KHVHUHVWULFWLRQVDUHEDVLFDOO\JLYHQEHORZ
‡7KHXVHUFDQQRWLQFUHDVHWKHYROXPHDERYHDVSHFL¿HGOLPLW$QGFDQVHW¿[HGYROXPHYDOXH
‡7KHXVHUFDQHQDEOHKHDGSKRQHGLUHFWYROXPHFRQWURO
‡7KHXVHUFDQQRWUHDFKVRPHPHQXV
‡7KHXVHUFDQQRWXVHWKHEXWWRQVRQWKH79
‡7KHXVHUFDQOLPLWWKHVWDUWXSVRXUFHSRVLWLRQ
‡/DVWVWDWXVFDQFDQQRWEHXVHG
‡7HOHWH[WFDQEHGLVDEOHGRUHQDEOHG
‡195$0GDWDOLNHVHUYLFHOLVWDQGXVHUSUHIHUHQFHVHWFFDQEHFRSLHGWRRUIURPD86%GHYLFH
‡3LQFDQFDQQRWEHXVHG
7RHQWHUKRWHOPHQXSUHVVMenu-3-1-9-7-5-3-MuteEXWWRQVFRQVHFXWLYHO\
HOTEL MENU ITEMS
Hotel Mode
6HWDVµOn¶WRDFWLYDWHKRWHOPRGH,QKRWHOPRGHFKDQQHOOLVWDQGLQVWDOOPHQXDUHEORFNHG
Pin 8
6HWDVµOn¶WRHQDEOHSLFWXUHPRGHFKDQJHVDFFURGLQJWR3LQGDWD
Last Status
6HWDVµOn¶WRHQDEOHWKH79WRUHRSHQZLWKWKHFORVLQJVWDWXV
Panel Lock
6HWDVAllWRSURKLELWWKHXVHRIWKHEXWWRQVRQWKH79PartialRSWLRQGRHVQRWSURKLELWWKHVFUROOEXWWRQIXQFWLRQV
,IWKH79KDVPXOWLSOHFRQWUROEXWWRQVRQO\WKHSourceEXWWRQZLOOEHIXQFWLRQDOLIWKHRSWLRQLVVHWDs Partial.
RCU Inhibit
6HWDVµOn¶WRLQKLELWWKHXVHRIWKHUHPRWH7RWXUQWKLVRSWLRQRIIUHSHDWWKHVWHSVWRRSHQKRWHOPHQX5HPRWH
FRQWUROZLOOIXQFWLRQLQ6WDQG%\PRGHLQGHSHQGHQWO\IURPWKHVHWWLQJRIWKLVRSWLRQ,IWKLVRSWLRQLVVHWDV
‘Limited¶RQO\WKH9ROXPH8S'RZQ3URJUDPPH8S'RZQ1XPHULF%XWWRQVDQGWKH6WDQGE\EXWWRQRQWKH
UHPRWHZLOOEHIXQFWLRQDO
Startup Position
<RXFDQVSHFLI\WKHRSHQLQJVHWWLQJVRIWKH79&KRRVHWKHFKDQQHODQGRUVRXUFHWREHRSHQHGZKHQWKH
79LVVZLWFKHGRQQH[WWLPH7KHDYDLODEOHRSWLRQVDUHDVWKHIROORZLQJ
Auto: 7KH79ZLOORSHQZLWKWKHODVWFKDQQHOLI79ZDVWKHODVWVRXUFHRUODVWVRXUFH
TV: 7KH79ZLOORSHQZLWKWKHFKDQQHOWKDWLVVSHFL¿HGLQ³Startup Channel´PHQXLWHP
Other:7KH79ZLOORSHQZLWKWKHVSHFL¿HGVRXUFH(;76,'($9+'0,HWF
Startup Channel
<RXFDQVSHFLI\DFKDQQHOWREHGLVSOD\HGZKHQWKH79LVWXUQHGRQQH[WWLPHLI ‘Startup Position’LVVHWDV‘TV’.
Volume Limit
6HWWKHPD[LPXPYDOXHRIWKHYROXPH
Fixed Volume Enable
6HWDVµOn¶WRHQDEOHWKHXVHRI¿[HGYROXPHYDOXHZKLFKLVVHWLQ³Fixed Volume Value´PHQXLWHP
Fixed Volume Value
6HWWKHYDOXHRIWKHYROXPHWREH¿[HG
OSD Disable
7KHGHIDXOWYDOXHLVVHWDVµDisable Setup Menus¶IRUKRWHOPRGH<RXFDQEORFNDOOPHQXVE\VHWWLQJWKLV
LWHPDVµDisable All Menus¶,QYLVDEOH6HWXS0HQXVDUH
Main menu:,QVWDOODQG5HWXQH&KDQQHOOLVW
Settings menu:3DUHQWDO6RXUFHV6DWHOOLWH6HWWLQJV1HWZRUN6HWWLQJV2WKHUVHWWLQJV
English - 11 -
Teletext
<RXFDQHQDEOHRUSURKLELWWKHWHOHWH[WVHUYLFHVRU0+(*LIDYDLODEOHE\VHWWLQJWKLVLWHPDVµOn¶RUµOff¶
Copy To USB (USB cloning)
<RXFDQFRS\WKH195$0GDWDVHUYLFHOLVWSUHIHUHQFHVHWFDQGWKHZHOFRPHLPDJHDV³KRWHOBZHOSQJ´WR
D86%GHYLFHXVLQJWKLVRSWLRQ3UHVVOKWRFRS\WKRVH¿OHVIURP79WR86%
Copy From USB (USB cloning)
<RXFDQFRS\WKH195$0GDWDVHUYLFHOLVWSUHIHUHQFHVHWFDQGWKHZHOFRPHLPDJHIURPD86%GHYLFH
XVLQJWKLVRSWLRQ7KHZHOFRPHLPDJHVKRXOGEHQDPHGDV³KRWHOBZHOSQJ´DQGFRSLHGLQWRDGLUHFWRU\QDPHG
³ZHOFRPHBLPDJH´3UHVVOKWRFRS\WKRVH¿OHVIURP86%WR79
Note: USB device, which will be used for USB cloning functions, must be FAT32 formatted. You can use the hidden key
combination, “Menu-0-6-2-5-9-6-Info”, for quick USB Cloning.
Wakeup Time Channel
6HW WKH FKDQQHO ZKRVH WLPH LQIRUPDWLRQ LV WR EH XVHG IRU ZDNHXS WLPHU ,I WKLV RSWLRQ LV VHW DV ³´ WLPH
LQIRUPDWLRQRIWKHFKDQQHOZKLFKLVEHLQJZDWFKHGZLOOEHXVHG
Note: If hotel mode is active, ‘Add wake up timer’ function will be available in ‘Settings/Timers’ menu. After the new timer
is saved, the TV will wake up automatically on desired time.
Wakeup Time Volume
6HWWKHZDNHXSYROXPHYDOXHRIWKH797KLVYDOXHFDQ¶WEHVHWDVJUHDWHUWKDQWKHYDOXHLQµVolume Limit¶
PHQXLWHP
USB Option
6HWDVµOff¶WRGLVDEOHWKH86%SRUWVRQWKH79<RXFDQDOVRVHWWKLVRSWLRQDV5VWRSURYLGHYROWVSRZHURYHU
86%,QWKLVFDVHLWZLOOVWLOOQRWEHDYDLODEOHWREURZVHWKH86%FRQWHQWYLD0HGLD%URZVHUIHDWXUHRIWKH79
Fixed Pic. Mode
6HWDVµOn¶WRGLVDEOHSLFWXUHVHWWLQJPHQXV
Boot Up Picture Mode
<RXFDQFKRRVHRQHRIWKHSLFWXUHPRGHVWKDWWKH79ZLOOERRWXSZLWKRUVHWDVOff7KLVRSWLRQLVVHWDVOff
E\GHIDXOW3LFWXUHPRGHFDQEHFKDQJHGODWHUXVLQJWKHModeRSWLRQLQWKHPicture SettingsPHQX3UHVVWKH
MenuEXWWRQ6HOHFWPicture DQGSUHVVOK+LJKOLJKWMode DQGVHWXVLQJWKH/HIW5LJKWEXWWRQVRQWKHUHPRWH
Digital Tuner
6HWDVµOff¶WRGLVDEOHGLJLWDOFKDQQHOV:KHQDGLJLWDOFKDQQHOLVRSHQHGIURPWKHFKDQQHOOLVW³QRVLJQDO´
PHVVDJHZLOOEHGLVSOD\HGDQGGLJLWDOFKDQQHOVZLOOQRWEHOLVWHGZKHQPDQXDORUDXWRVHDUFKHVDUHSHUIRUPHG
Multiple RC Support (up to 4)
<RXFDQFKRRVHRQHRIWKHSUHGH¿QHGUHPRWHVRUVHWDVµOff¶<RXFDQVHWWKH5&8W\SHIURPµ5&8SURJUDP
PHQX¶7KHVKRUWFXWRIWKLVPHQXLVRETURN-1-2-3-4.
Note:)RUDQ\0+(*VXSSRUWLQJVHUYLFHV\RXVKRXOGSUHVVWKHINFO-RETURN-1-2-3-4 buttons buttons consecutively. The
PXOWLSOH5&VXSSRUWLVZRUNVRQ5&W\SHRIUHPRWHFRQWUROOHUV
NIT Update
,IWKLVRSWLRQLVHQDEOHG1,71HUWZRUN,QIRUPDWLRQ7DEOHGDWDZLOOEHXSGDWHGDXWRPDWLFDOO\
High Security
,I\RXVHWWKLVRSWLRQDV21WKH+RWHO79PHQXZLOOEHDFFHVVLEOHRQO\YLDWKH3KLOLSV+RVSLWDOLW\6HWXSUHPRWH
$9
Note: Only the “ RC setup+ Home/Menu” key combination can be used to open the Hotel Mode menu. Other keys are not
recognized by the TV.
EPG Enable/Disable
,I\RXHQDEOHWKLVRSWLRQWKH(3*PHQXZLOOEHDFFHVVDEOHZKLOHWKH79LVLQ+RWHOPRGH
CEC Enabled
<RXFDQVHWWKH79WRGHWHFWFRQQHFWHG&(&GHYLFHVDQGVZLWFKWRUHODWHGVRXUFHDXWRPDWLFDOO\E\VHWWLQJ
WKLVRSWLRQDVON - Auto Switch2WKHURSWLRQVDUHON - Manual SwitchDQGOff.
Reset to Default Values
+LJKOLJKWWKLVRSWLRQDQGSUHVVWKHOKEXWWRQRQWKHUHPRWHWRUHWXUQWKH79WRGHIDXOWVHWWLQJV
English - 12 -
Specifications are subject to change without notice.
Philips and the Philips’ shield emblem are registered trademarks of Koninklijke Philips N.V.
and are used under license from Koninklijke Philips N.V.
2015 © TP Vision Europe B.V. All rights reserved.
www.philips.com
Was this manual useful for you? yes no
Thank you for your participation!

* Your assessment is very important for improving the work of artificial intelligence, which forms the content of this project

Download PDF

advertisement