3-Device Universal Remote Control
3-Device
Universal
Remote Control
Control Remoto Universal
de 3 Dispositivos
/!2.3 5SERS 'UIDE s 'UÓA DEL 5SUARIO
Contents
Step 1: Install your batteries ...................... 2
Step 2: Program your remote .................... 2
Auto Code Search .................................... 3
Brand Code Search .................................. 4
Direct Code Entry .................................... 5
Manual Code Search ............................... 6
Tour of the Remote .................................... 8
Advanced Functions ................................... 9
2EASSIGNINGTHE$6$s6#2+EYTO
Control a VCR ....................................... 9
Volume Punch-Through .......................... 9
4RANSPORT+EY0UNCH4HROUGH ................ 9
Code Retrieval ....................................... 10
Channel Lock ......................................... 10
Troubleshooting ....................................... 11
Limited Lifetime Warranty ...................... 24
Contenido
Paso 1: Instale las baterías ....................... 13
Paso 2: Programe el control remoto ....... 13
Búsqueda Automática de Códigos ....... 14
Búsqueda de Códigos por Marca.......... 15
Entrada Directa de Códigos .................. 16
Búsqueda Manual de Códigos .............. 17
Recorrido del control remoto .................. 19
Funciones Avanzadas ............................... 20
#ØMO2EASIGNARLA4ECLA$6$s6#2
para Manejar una VCR ....................... 20
Irrupción de Volumen ........................... 20
Irrupción de Teclas de Transporte ........ 20
Bloqueo de Canales ............................... 21
Recuperación de Códigos ..................... 21
Resolución de Problema .......................... 22
Garantía Limitada
Durante la Vida Útil del Producto ........ 24
4HE/!2.35NIVERSAL2EMOTE#ONTROLBY/NE&OR!LLISA
PERFECTWAYTOSIMPLIFYHOMEENTERTAINMENT)TLETSYOUCONTROL
UPTOTHREEOFYOURHOMEENTERTAINMENTDEVICESFROMASINGLE
easy-to-use remote.
Step 1: Install your batteries
9OURUNIVERSALREMOTEREQUIRESTWO!!!ALKALINEBATTERIESNOT
included).
To install the batteries:
1. Press and push the battery compartment cover to remove
it.
2. )NSERTTHEBATTERIESMATCHINGTHEBATTERIESTOTHEAND
nMARKSINSIDETHEBATTERYCOMPARTMENT
3. 0USHTHEBATTERYCOVERBACKINTOPLACE
Battery Precautions:
s $ONOTMIXOLDANDNEWBATTERIES
s $ONOTMIXALKALINESTANDARDCARBONZINCORRECHARGEABLE
NICKELCADMIUMBATTERIES
s !LWAYSREMOVEOLDWEAKORWORNOUTBATTERIESPROMPTLY
ANDRECYCLEORDISPOSEOFTHEMINACCORDANCEWITH,OCAL
and National Regulations.
Step 2: Program your remote
4OUSETHISUNIVERSALREMOTEWITHYOURHOMEENTERTAINMENT
SYSTEMlRSTYOUNEEDTOPROGRAMITTOCONTROLYOURDEVICES
4HEREAREFOURWAYSYOUCANPROGRAMTHEUNIVERSALREMOTETO
operate your devices:
s
4HEAuto Code Search goes automatically through all the
CODESFORTHEDEVICEYOURETRYINGTOCONTROL)TSTHEEASIEST
METHODBUTITCANSOMETIMESTAKELONGERTHANSOMEOFTHE
other programming methods.
s 4HEBrand Code Search searches through the codes for
SELECTBRANDSOFDEVICES)TSNOTASEASYASTHEAUTOCODE
SEARCHBUTITCANBEFASTER
s 4HEDirect Code Entry lets you enter a code from the
ACCOMPANYINGCODELISTFORYOURBRANDOFDEVICE)TSNOTAS
EASYASTHEOTHERMETHODSBUTITSPOTENTIALLYTHEFASTEST
method.
s 4HEManual Code Search lets you manually go through all
THECODESFORTHEDEVICEYOURETRYINGTOCONTROL
Care and Maintenance
s
s
s
s
s
+EEPTHEREMOTEDRY)FITGETSWETWIPEITDRYIMMEDIATELY
5SEANDSTORETHEREMOTEONLYINNORMALTEMPERATUREENVIRONMENTS
(ANDLETHEREMOTEGENTLYANDCAREFULLY$ONTDROPIT
+EEPTHEREMOTEAWAYFROMDUSTANDDIRT
7IPETHEREMOTEWITHADAMPCLOTHOCCASIONALLYTOKEEPITLOOKING
NEW
s -ODIFYINGORTAMPERINGWITHTHEREMOTESINTERNALCOMPONENTSCAN
CAUSEMALFUNCTIONANDINVALIDATEITSWARRANTY
2
4HE!UTO#ODE3EARCHGOESAUTOMATICALLYTHROUGHALLTHECODES
FORTHEDEVICEYOURETRYINGTOCONTROL7HENYOUlNDTHEONE
THATOPERATESYOURDEVICEYOUCANSTOPTHESEARCHANDSTORE
that code.
TIPS: Each device key is associated with a type of device—the
46ISPRESETTOSEARCHFOR46S3!4s#",s$4#FORSATELLITE
RECEIVERSCABLEBOXESORDIGITAL46CONVERTERSAND$6$s6#2
FOR$6$PLAYERS4OPROGRAMTHE$6$s6#2KEYTOCONTROLA062
OR6#2SEETHE2EASSIGNINGTHE$6$s6#2+EYTO#ONTROLA6#2
section.
To exit without saving a new code at any point in the Auto
Code Search, press the EXIT key.
1. -ANUALLYTURNONTHEDEVICEYOUWANTTOCONTROL
2. 0RESSANDHOLDTHEDEVICEKEYYOUWANTTOPROGRAM4HE
0/7%2KEYILLUMINATES
7HILEYOUREHOLDINGDOWNTHEDEVICEKEYUSEYOUROTHER
HANDTOPRESSANDHOLDTHEREMOTES0/7%2KEYATTHE
SAMETIME4HE0/7%2KEYTURNSOFF
3. 7AITUNTILTHE0/7%2KEYCOMESONANDSTAYSON4HEN
RELEASEBOTHKEYS
4. Point the remote directly at the front panel of the device
YOUWANTTOCONTROL0RESS0,!9ONTHEREMOTEANDWAIT
seconds. The remote is testing a batch of 10 codes on your
device.
Did your device turn off?
YES:'OTOSTEP
NO:0RESS0,!9AGAIN4HEREMOTETESTSTHENEXTBATCHOF
10 codes.
+EEPPRESSING0,!9EVERYSECONDSUNTILYOURDEVICETURNS
off.
5. 7HENYOURDEVICETURNSOFFPRESSTHE2%6%23%KEYONTHE
REMOTEANDWAITATLEASTSECONDS4HEREMOTETRIESTHE
last of the previous ten codes.
Did your device turn on?
YES:0RESSTHE34/0KEY9OUREDONE9OUVEPROGRAMMED
THISDEVICEKEY
NO:0RESS2%6%23%AGAIN4HEREMOTETESTSTHENEXTCODEIN
the batch.
+EEPPRESSING2%6%23%EVERYSECONDSUNTILYOURDEVICE
TURNSBACKON7HENITDOESPRESS34/0
Note: If you accidentally press the REVERSE key after your
device turns on, press the FORWARD key. Then, wait two
seconds to see if your device turns off again.
NOTES
Throughout the programming of each key, be sure to keep the
remote pointed at the IR sensor of the device you are currently
programming the remote to control.
Test the remote with the device to make sure the device key is
programmed with the correct code for maximum functionality.
If some features don’t work, try a different code. See the
“Testing the Code for Maximum Functionality” section on the
next page for more information.
continues on next page...
3
English
Auto Code Search
During the Auto Code Search, the remote ignores keypresses
that aren’t part of the search.
The search times out after two minutes (the POWER key blinks
four times and turns off, and the last programmed code under
that device key is retained).
The POWER key blinks four times and turns off when the
remote has gone through all the codes. The remote exits the
Auto Code Search. If your device hasn’t turned off yet, try a
different search method.
Testing the Code for Maximum Functionality
1. 4RYAVARIETYOFTHEDEVICESFUNCTIONSWITHTHEREMOTE)F
SOMEDEVICEFEATURESDONTWORKGOTOTHENEXTSTEPTOTRY
a different code.
2. 2EPEATTHE!UTO#ODE3EARCH-ETHODFROMTHEBEGINNING
7HENYOURDEVICETURNSOFFDONOTSTOPSEARCHING)NSTEAD
WITHTHEUNITNOWOFFCONTINUETOPRESSTHE0,!9KEYEVERY
SECONDSUNTILTHEUNITTURNSBACKON
3. /NCETHEUNITTURNSBACKONPRESSTHE2%6%23%KEYONTHE
remote every 2 seconds until your device turns off again.
7HENYOURDEVICETURNSOFFAGAINPRESSTHE34/0KEY
4. 4ESTTHEKEYSFUNCTIONALITYAGAINBYATTEMPTINGTOCONTROL
AVARIETYOFTHEDEVICESFUNCTIONS)FTHECODETHATHAS
BEENSTOREDCONTROLSTHEMAJORITYOFTHEDEVICESFUNCTIONS
programming is complete. If the code stored does not give
MAXIMUMFUNCTIONALITYTRYANOTHERCODE
Brand Code Search
4HE"RAND#ODE3EARCHGOESTHROUGHONLYTHECODESFORONEOF
the select brands listed in the accompanying code list. If your
BRANDOFDEVICEISLISTEDTHISSEARCHCANBEVERYQUICKANDEASY
TIPS: Each device key is associated with a type of device—the
46ISPRESETTOSEARCHFOR46S3!4s#",s$4#FORSATELLITE
RECEIVERSCABLEBOXESORDIGITAL46CONVERTERSAND$6$s6#2
FOR$6$PLAYERS4OPROGRAMTHE$6$s6#2KEYTOCONTROLA062
OR6#2SEETHE2EASSIGNINGTHE$6$s6#2+EYTO#ONTROLA6#2
section.
To exit without saving a new code at any point in the Brand
Code Search, press the EXIT key.
1. -ANUALLYTURNONTHEDEVICEYOUWANTTOCONTROL
2. &INDYOURDEVICESBRANDINTHE"RAND#ODELISTSECTIONOF
THEACCOMPANYINGCODELIST#IRCLETHENUMBERFORYOUR
BRANDANDKEEPTHELISTHANDY
3. 0RESSANDHOLDTHEDEVICEKEYYOUWANTTOPROGRAM4HE
0/7%2KEYILLUMINATES
7HILEYOUREHOLDINGDOWNTHEDEVICEKEYUSEYOUROTHER
HANDTOPRESSANDHOLDTHEREMOTES0/7%2KEYATTHE
SAMETIME4HE0/7%2KEYTURNSOFF
4. 7AITUNTILTHE0/7%2KEYCOMESONANDSTAYSON4HEN
RELEASEBOTHKEYS
5. ,OOKATTHENUMBERSYOUCIRCLEDFORYOURDEVICESBRAND
CODENUMBER0RESSTHOSENUMBERSONTHEREMOTEKEYPAD
Note: For single-digit brand codes, press the 0 key first (for
example, 0-5 for 5).
4
YOUWANTTOCONTROL0RESS0/7%2ONTHEREMOTEANDWAIT
2 seconds. The remote is testing a single code for your
DEVICESBRAND
Did your device turn off?
YES:0RESSTHE34/0KEYTOSTORETHECODE9OUREDONE
9OUVEPROGRAMMEDTHISDEVICEKEY
NO:0RESS0/7%2AGAIN4HEREMOTETESTSTHENEXTCODEFOR
your brand.
+EEPPRESSING0/7%2EVERYSECONDSUNTILYOURDEVICE
TURNSOFF7HENITDOESPRESS34/0
NOTES
Throughout the programming of each key, be sure to keep the
remote pointed at the IR sensor of the device you are currently
programming the remote to control.
Test the remote with the device to make sure the device key is
programmed with the correct code for maximum functionality.
If some features don’t work, try a different code. See the
“Testing the Code for Maximum Functionality” section below
for more information.
During the Brand Code Search, the remote ignores keypresses
that aren’t part of the search.
The search times out after two minutes (the POWER key blinks
four times and turns off, and the last programmed code under
that device key is retained).
The POWER key blinks four times and turns off when the
remote has gone through all the codes. The remote exits the
Brand Code Search. If your device hasn’t turned off yet, try a
different search method.
Testing the Code for Maximum Functionality
1. 4RYAVARIETYOFTHEDEVICESFUNCTIONSWITHTHEREMOTE)F
SOMEDEVICEFEATURESDONTWORKGOTOTHENEXTSTEPTOTRY
a different code.
2. 2EPEATTHE"RAND#ODE3EARCHFROMTHEBEGINNING7HEN
THEDEVICETURNSOFFFORTHElRSTTIMEDONTPRESSTHE34/0
KEYWHICHWOULDSTORETHESAMECODE)NSTEADWITHTHE
UNITNOWOFFCONTINUETOPRESSTHE0/7%2KEYREPEATEDLY
UNTILTHEUNITTURNSBACKON
3. /NCETHEUNITTURNSBACKONYOUHAVEFOUNDANOTHERCODE
THATOPERATESTHEDEVICE0RESSTHE34/0KEY
4. 4ESTTHEKEYSFUNCTIONALITYAGAINBYATTEMPTINGTOCONTROL
AVARIETYOFTHEDEVICESFUNCTIONS)FTHECODETHATHAS
BEENSTOREDCONTROLSTHEMAJORITYOFTHEDEVICESFUNCTIONS
programming is complete. If the code stored does not give
MAXIMUMFUNCTIONALITYTRYANOTHERCODE
Direct Code Entry
$IRECT#ODE%NTRYLETSYOUENTERACODEFROMTHEACCOMPANYING
CODELISTFORYOURBRANDOFDEVICE)TSNOTASEASYASTHEOTHER
METHODSBUTITSPOTENTIALLYTHEFASTESTMETHOD
TIP: Each device key is associated with a type of device—the TV
ISPRESETTOSEARCHFOR46S3!4s#",s$4#FORSATELLITERECEIVERS
CABLEBOXESORDIGITAL46CONVERTERSAND$6$s6#2FOR$6$
PLAYERS4OPROGRAMTHE$6$s6#2KEYTOCONTROLA062OR6#2
SEETHE2EASSIGNINGTHE$6$s6#2+EYTO#ONTROLA6#2SECTION
1. -ANUALLYTURNONTHEDEVICEYOUWANTTOCONTROL
2. &INDTHE#ODE,ISTTHATCAMEWITHTHEREMOTE,OCATETHE
SECTIONFORTHETYPEOFDEVICEYOURETRYINGTOPROGRAMAND
lNDYOURBRANDINTHATSECTION#IRCLETHECODESFORYOUR
BRANDANDKEEPTHEMHANDY
continues on next page...
5
English
6. Point the remote directly at the front panel of the device
3. 0RESSANDHOLDTHEDEVICEKEYYOUWANTTOPROGRAMTHE
0/7%2KEYILLUMINATES
7HILEYOUREHOLDINGDOWNTHEDEVICEKEYUSEYOUROTHER
HANDENTERTHElRSTlVEDIGITCODEFORYOURBRANDINTHE
CODELISTTHE0/7%2KEYTURNSOFFAFTERTHElRSTDIGIT
4. 7HENYOUVElNISHEDENTERINGTHElVEDIGITCODEKEEP
HOLDINGDOWNTHEDEVICEKEYANDLOOKATTHE0/7%2KEY
Is the POWER key illuminated?
YES:9OUREDONE9OUVEPROGRAMMEDTHISDEVICEKEY
NO, it blinked four times and turned off: You have
either entered a code number that is not in the code lists or
missed a step in the code entry procedure. Try step 3 again.
NOTES
Test the remote with the device to make sure the device key is
programmed with the correct code for maximum functionality.
If some features don’t work, try a different code in the list.
Remember to enter the code for future reference in the box
provided in the Code Retrieval section of this manual.
If your brand isn’t listed in the code list, use one of the Code
Search methods to program the remote control. (Refer to the
Auto and Manual Code Search methods.)
If you release the device key any time during the Direct Code
Entry procedure, the POWER key blinks four times, and the
process is exited. The last programmed code under the device
key is retained.
Manual Code Search
4HE-ANUAL#ODE3EARCHLETSYOUGOONEBYONETHROUGHALL
THECODESFORTHEDEVICEYOURETRYINGTOCONTROL7HENYOUlND
THEONETHATOPERATESYOURDEVICEYOUCANSTOPTHESEARCHAND
store that code.
TIPS: The Manual Code Search method may take a long time
because the remote searches through all of the codes in its
memory one-by-one. If your brand is listed in the Brand Codes
or the Code Lists, first try the Brand Code Search or the Direct
Code Entry method.
Each device key is associated with a type of device—the TV is
PRESETTOSEARCHFOR46S3!4s#",s$4#FORSATELLITERECEIVERS
CABLEBOXESORDIGITAL46CONVERTERSAND$6$s6#2FOR$6$
PLAYERS4OPROGRAMTHE$6$s6#2KEYTOCONTROLA062OR6#2
SEETHE2EASSIGNINGTHE$6$s6#2+EYTO#ONTROLA6#2SECTION
To exit without saving a new code at any point in the Manual
Code Search, press the EXIT key.
1. -ANUALLYTURNONTHEDEVICEYOUWANTTOCONTROL
2. 0RESSANDHOLDTHEDEVICEKEYYOUWANTTOPROGRAM4HE
0/7%2KEYILLUMINATES
6
7HILEYOUREHOLDINGDOWNTHEDEVICEKEYUSEYOUROTHER
HANDTOPRESSANDHOLDTHEREMOTES0/7%2KEYATTHE
SAMETIME4HE0/7%2KEYTURNSOFF
3. 7AITUNTILTHEREMOTES0/7%2KEYCOMESONANDSTAYSON
YOUWANTTOCONTROL0RESS0/7%2ONTHEREMOTEANDWAIT
2 seconds. The remote is testing a single code for your
device.
Did your device turn off?
YES:0RESSTHE34/0KEYTOSTORETHECODE9OUREDONE
9OUVEPROGRAMMEDTHISDEVICEKEY
NO:0RESS0/7%2AGAIN4HEREMOTETESTSTHENEXTCODEFOR
your device.
+EEPPRESSING0/7%2EVERYSECONDSUNTILYOURDEVICE
TURNSOFF7HENITDOESPRESS34/0
TIP: Because there are so many codes, you may have to
press the POWER key many times—possibly hundreds of
times.
NOTES
Throughout the programming of each key, keep the remote
pointed at the IR sensor of the device you are programming the
remote to control.
Test the remote with the device to make sure the device key is
programmed with the correct code for maximum functionality.
If some features don’t work, try a different code. See the
“Testing the Code for Maximum Functionality” section below
for more information.
During the Manual Code Search, the remote ignores keypresses
that aren’t part of the search.
The search times out after two minutes (the POWER key blinks
four times and turns off, and the last programmed code under
that device key is retained).
The POWER key blinks four times and turns off when the
remote has gone through all the codes. The remote exits the
Brand Code Search. If your device hasn’t turned off yet, try a
different search method.
Testing the Code for Maximum Functionality
1. 4RYAVARIETYOFTHEDEVICESFUNCTIONSWITHTHEREMOTE)F
SOMEFEATURESOFYOURDEVICESDONTWORKGOTOTHENEXT
step to try a different code.
2. 2EPEATTHE-ANUAL#ODE3EARCHAND%NTRY-ETHODFROM
THEBEGINNING7HENTHEDEVICETURNSOFFFORTHElRSTTIME
DONTPRESSTHE34/0KEYWHICHWOULDSTORETHESAME
CODE)NSTEADWITHTHEUNITNOWOFFCONTINUETOPRESSTHE
0/7%2KEYREPEATEDLYUNTILTHEUNITTURNSBACKON
3. /NCETHEUNITTURNSBACKONYOUHAVEFOUNDANOTHERCODE
THATOPERATESTHEDEVICE0RESSTHE34/0KEY
4. 4ESTTHEKEYSFUNCTIONALITYAGAINBYTRYINGAVARIETYOF
FUNCTIONS)FTHECODECONTROLSTHEMAJORITYOFTHEDEVICES
FUNCTIONSPROGRAMMINGISCOMPLETE)FTHECODESTORED
DOESNOTGIVEMAXIMUMFUNCTIONALITYTRYANOTHERCODE
7
English
4HENRELEASEBOTHKEYS
4. Point the remote directly at the front panel of the device
Tour of the Remote
)NMOSTCASESTHEKEYSONTHISREMOTEPERFORMTHESAME
FUNCTIONSASTHEKEYSONYOURORIGINALREMOTESONCEYOUVE
PROGRAMMEDTHISREMOTETOOPERATEYOURCOMPONENTS-ANY
KEYSONTHISREMOTEHAVEOTHERFUNCTIONSASWELL
Illuminated POWERKEY
serves as an indicator light to
PROVIDEFEEDBACK
$EVICEKEYSTV
3!4s#",s$4#$6$s6#2)
put the remote in the right
mode to control your device.
GUIDE and MENU put the
remote in menu/guide mode;
they also access the same
FEATURESASTHEKEYSONYOUR
original remotes.
EXITEXITSREMOTE
programming; it also
performs the same functions
as on your original remotes.
Arrow keys act as navigation
KEYSINDEVICEGUIDESAND
menu systems.
The ).054s$)')4!, and
—DASHKEYHASTHREE
FUNCTIONSITTOGGLES
through all the video sources
CONNECTEDTOYOUR46
WHENTHEREMOTEISIN6#2
MODETHISBUTTONTOGGLES
BETWEEN6#2ANDTHE46
INPUTWHENYOURE
entering digital channel
NUMBERSDIRECTLYTHISBUTTON
lets you separate the main
channel number from the
SUBCHANNELNUMBERSUCHAS
IMPORTANT
Because this remote controls more than one device, you must
first “tell” the remote which device you wish to operate. That
means, if you wish to operate your TV, you must first press the
TV key to put the remote in the TV Mode. The remote stays
in that device mode until you press a different device key. For
example, if your remote is in TV Mode and you want to operate
THE$6$PLAYERYOUMUSTPRESSTHE$6$s6#2KEYTOCHANGE
device modes.
8
English
Advanced Functions
2EASSIGNINGTHE$6$s6#2+EYTO
Control a VCR
4HE$6$s6#2KEYDEFAULTSTOCONTROLA$6$PLAYER)FYOUWANT
THE$6$s6#2KEYTOCONTROLA6#2YOUMUSTREASSIGNIT
1. 0RESSANDHOLDTHE$6$s6#2KEY4HE0/7%2KEY
ILLUMINATES+EEPHOLDINGDOWNTHE$6$s6#2KEY
2. 7HILEHOLDINGDOWNTHE$6$s6#2KEYPRESSANDRELEASE
THENUMBERKEYONTHEKEYPAD4HE0/7%2KEYTURNSOFF
3. 2ELEASETHE$6$s6#2KEY4HE0/7%2KEYBLINKSFOURTIMES
ANDTHENTURNSOFF4HE$6$s6#2KEYISNOWSETTOCONTROL
A6#2
4. &OLLOWTHEDIRECTIONSINTHEAUTOBRANDDIRECTENTRYOR
MANUALCODESEARCHTOPROGRAMTHE$6$s6#2KEYFORYOUR
6#2
Volume Punch-Through
6OLUMEPUNCHTHROUGHALLOWSTHE6/,AND-54%KEYSWHEN
PRESSEDIN3!4s#",s$4#OR$6$s6#2MODESTOhPUNCH
through” to TV. Volume punch-through occurs automatically
ANDALLOWSYOUTOCONTROLTHEVOLUMEWITHOUTEXITINGTHE
current mode.
Note: Volume punch-through does not occur in cases where
the component code has its own volume/mute controls, such as
some satellite receivers.
4RANSPORT+EY0UNCH4HROUGH
4RANSPORTKEYPUNCHTHROUGHALLOWSTHETRANSPORTKEYS
2%6%23%0,!9&/27!2$2%#/2$34/00!53%3+)0"!#+
3,/7AND3+)0&7$WHENPRESSEDIN46OR3!4s#",s$4#
MODESTOhPUNCHTHROUGHvTO$6$s6#2MODE4RANSPORTKEY
PUNCHTHROUGHOCCURSAUTOMATICALLYANDALLOWSYOUTOUSETHE
TRANSPORTKEYSWITHOUTEXITINGTHECURRENTMODE&OREXAMPLE
IFTHETRANSPORTKEYSWERELASTUSEDIN$6$MODEANDACCESSED
AGAINAFTERPRESSINGTHE46KEYTHEYWILLPUNCHTHROUGHTOTHE
DVD.
Note: Transport key punch-through does not occur in cases
where the device code has its own transport key data, such as a
satellite receiver with a built-in DVR.
9
#HANNEL,OCK
#HANNELLOCKAUTOMATICALLYSENDSCHANNELCOMMANDSLIKETHE
#(,!34ANDnNUMBERKEYSTOYOURSATELLITERECEIVERCABLE
BOXORDIGITAL46CONVERTERWHENYOUREIN46MODE4HISCAN
SAVEYOUKEYPRESSESIFYOUUSEADEVICEOTHERTHANYOUR46TO
change channels.
To turn channel lock on:
1. 0RESSANDHOLDTHEDEVICEKEYFORTHEDEVICEYOUUSETO
CHANGECHANNELS7HILEYOUREHOLDINGDOWNTHISDEVICE
KEYUSEYOUROTHERHANDTOPRESSANDHOLDTHEREMOTES#(
UPKEYATTHESAMETIME
2. 7AITUNTILTHEREMOTES0/7%2KEYCOMESONANDSTAYSON
4HENRELEASEBOTHKEYS
3. 0RESS%.4%2TOLOCKCHANNELCOMMANDSTOTHISDEVICE
To turn channel lock off:
1. 0RESSANDHOLDTHE46KEY7HILEYOUREHOLDINGDOWNTHE
46KEYUSEYOUROTHERHANDTOPRESSANDHOLDTHEREMOTES
#(DOWNKEYATTHESAMETIME
2. 7AITUNTILTHEREMOTES0/7%2KEYCOMESONANDSTAYSON
4HENRELEASEBOTHKEYS
3. 0RESS%.4%2TOSTARTCHANGINGCHANNELSWITHYOUR46
Code Retrieval
/NCEYOUVEPROGRAMMEDTHEREMOTETOCONTROLYOURDEVICES
YOUMAYWANTTORECORDTHECODESFORFUTUREREFERENCE)F
YOUUSEDTHE$IRECT#ODE%NTRYMETHODTHISISEASY*USTlND
THECODESYOUENTEREDANDMAKEANOTEOFTHEMINTHEBOXES
BELOW)FYOUUSEDONEOFTHE#ODE3EARCHMETHODSTOPROGRAM
YOURREMOTEORIFYOUUSEDTHE$IRECT%NTRYMETHODBUTDONT
REMEMBERTHECODEYOUWILLNEEDTORETRIEVEEACHDEVICESlVE
DIGITCODE2ETRIEVINGTHEACTUALCODEANDWRITINGITDOWNWILL
save you time if you ever need to program the remote again. If
THECODESARERECORDEDYOUCANUSETHE$IRECT%NTRYMETHODTO
REPROGRAMYOURREMOTETOCONTROLYOURDEVICESWHICHISQUICK
and easy.
1. 0RESSANDHOLDTHEDEVICEKEY463!4s#",s$4#$6$s6#2
WHOSECODEYOUWISHTORETRIEVE4HE0/7%2KEY
ILLUMINATES+EEPPRESSINGTHEDEVICEKEY
2. 7HILEHOLDINGTHEDEVICEKEYDOWNPRESSANDHOLDTHE
).&/KEY4HE0/7%2KEYTURNSOFF!FTERHOLDINGDOWN
BOTHKEYSFORTHREESECONDSTHE0/7%2KEYTURNSBACKON
3. 2ELEASEBOTHKEYS4HE0/7%2KEYREMAINSON
4. 3TARTINGWITHTHENUMBERKEYPRESSANDRELEASEEACH
NUMBERKEYONTHEKEYPADINTHEFOLLOWINGORDERTHEN
4HENUMBERTHATCAUSESTHE0/7%2KEYTOBLINKISTHE
lRSTNUMBEROFTHECODE!SYOUlNDEACHNUMBEROFTHE
CODEWRITEITDOWNFORFUTUREREFERENCE
Note: All TV codes begin with the number 1; all VCR
and DVR codes begin with the number 2; all DVDs, the
number 3; and all satellite receivers, cable boxes and DTV
converters, the number 5.
5. 2EPEATSTEPUNTILYOUHAVERETRIEVEDALLlVENUMBERSIN
THECODE!FTERTHElFTHNUMBERISRETRIEVEDTHE0/7%2
KEYBLINKSBRIEmYTHENTURNSOFF
TIP: To exit the Code Retrieval Mode at any time, press the
EXIT key.
10
Quick Code Reference
Device Type
Code
Troubleshooting
Problem: The remote does not operate your device.
s -AKESURETHEREMOTEISINTHECORRECTMODEBYPRESSINGTHE
CORRESPONDINGDEVICEKEY463!4s#",s$4#$6$s6#24HIS
TELLSTHEREMOTEWHICHDEVICETOOPERATE
s 2EMOVEANYOBSTACLESBETWEENTHEREMOTEANDTHEDEVICE
-AKESUREYOUREAIMINGTHEREMOTEATTHEDEVICES)2SENSOR
s -AKESURETHEBATTERIESAREFRESHANDAREPROPERLYINSTALLED
2EPLACETHEBATTERIESWITHTWONEW!!!BATTERIESIF
NECESSARYSEETHE"ATTERY)NSTALLATIONSECTION
Problem: The remote can’t be programmed to operate
your device.
s )FYOUARETESTINGTHEREMOTEWHILEPROGRAMMINGITYOUMAY
BETOOFARAWAYFROMTHEDEVICEORATAWRONGANGLE4HERE
MUSTBEANUNOBSTRUCTEDPATHBETWEENTHEREMOTEANDTHE
)2SENSORONTHEDEVICE-OVECLOSERANDMAKESUREYOUPOINT
THEREMOTEATTHEDEVICEYOURETRYINGTOCONTROL
s )FYOUREUSINGTHE$IRECT%NTRYPROGRAMMINGMETHODTO
enter the codes for your brand and the unit is still not
FUNCTIONINGPROPERLYTRYTHEAUTOBRANDORMANUALSEARCH
method.
s 4OCONTROLCOMBOUNITSLIKE466#2SOR46$6$SYOUMUST
PROGRAMTHEINDIVIDUALCORRESPONDINGDEVICEKEYSTOCONTROL
EACHPARTOFTHECOMBOUNIT/NCEPROGRAMMEDSUCCESSFULLY
THE46KEYCONTROLSTHE46FUNCTIONSANDTHE$6$s6#2KEY
CONTROLSTHE6#2OR$6$FUNCTIONS
s -AKESURETHEBATTERIESAREFRESHANDAREPROPERLYINSTALLED
Problem: The remote doesn’t perform commands
properly.
s -AKESURETHEREMOTEISINTHECORRECTMODEBYPRESSINGTHE
CORRESPONDINGDEVICEKEY463!4s#",s$4#$6$s6#24HIS
TELLSTHEREMOTEWHICHDEVICETOOPERATE
s -AKESUREDEVICEISREADYFOREXAMPLETHE$6$PLAYERHASA
disc loaded).
s 9OUMAYHAVEPRESSEDANINVALIDKEYFORTHEMODETHE
remote is in.
s )FYOURETRYINGTOENTERACHANNELNUMBERDIRECTLYTRY
PRESSINGTHE%.4%2KEYAFTERENTERINGTHECHANNELNUMBERAS
this is a requirement of certain models and brands.
s 4HEREISAPOSSIBILITYTHATAPROGRAMMEDCODEMAYONLYBE
ABLETOCONTROLSOMEOFYOURDEVICEFEATURESFOREXAMPLE
ONLYTURNSADEVICEONANDOFF4OCONlRMTHATTHEDEVICE
KEYISPROGRAMMEDWITHTHECORRECTCODEFORMAXIMUM
FUNCTIONALITYTESTTHEDEVICE!TTEMPTTOCONTROLAVARIETY
OFTHEDEVICESFUNCTIONSWITHTHEREMOTE)FSOMEOFTHE
11
English
Note: If you press an invalid key during the Code Retrieval
process, the remote will not respond. If you do not press a valid
#ODE2ETRIEVALKEY463!4s#",s$4#$6$s6#2).&/%8)4
Code Retrieval times out after 15 seconds. The POWER key
blinks four times, and then turns off.
FEATURESOFYOURDEVICESDONTWORKTRYPROGRAMMINGTHE
REMOTEWITHADIFFERENTCODEINTHELISTUSINGTHE$IRECT#ODE
%NTRY-ETHODUNTILYOUlNDTHECODETHATALLOWSTHEREMOTE
TOCONTROLTHEMAJORITYOFYOURDEVICESFUNCTIONS$IFFERENT
codes can provide different levels of functionality.
Problem: The POWER key does not light when you press
a key.
s 9OUMAYHAVEPRESSEDANINVALIDKEYFORTHEMODETHE
remote is in.
s -AKESURETHEREMOTEISINTHECORRECTMODEBYPRESSINGTHE
CORRESPONDINGDEVICEKEY463!4s#",s$4#$6$s6#24HIS
TELLSTHEREMOTEWHICHDEVICETOOPERATE
s -AKESURETHEBATTERIESAREFRESHANDAREPROPERLYINSTALLED
2EPLACETHEBATTERIESWITHTWONEW!!!BATTERIESIF
NECESSARYSEETHE"ATTERY)NSTALLATIONSECTION
Problem: The remote will not change channels on device.
s -AKESURETHEREMOTEISINTHECORRECTMODEBYPRESSINGTHE
CORRESPONDINGDEVICEKEY463!4s#",s$4#$6$s6#24HIS
TELLSTHEREMOTEWHICHDEVICETOOPERATE
s 0RESSTHE%.4%2KEYAFTERYOUENTERACHANNELNUMBER
s 2EMOVEANYOBSTACLESBETWEENTHEREMOTEANDTHEDEVICE
-AKESURETOAIMTHEREMOTEATTHE)2SENSORONTHEDEVICE
Problem: The device’s menu does not appear on the TV
screen.
s -AKESUREYOUHAVECONNECTEDTHEDEVICETOYOUR46
PROPERLYANDSELECTEDTHECORRECTINPUT3EEYOURDEVICES
/WNERS-ANUALSFORPROPERCONNECTIONPROCEDURES
s -AKESURETHEREMOTEISINTHECORRECTMODEBYPRESSINGTHE
CORRESPONDINGDEVICEKEY463!4s#",s$4#$6$s6#24HIS
TELLSTHEREMOTEWHICHDEVICETOOPERATE
s -ENUACCESSISNTSUPPORTEDFORALLBRANDS9OUMAYNEEDTO
use your original remote control to access menu functions for
some devices.
&ORMOREINFORMATIONPLEASEVISITWWWONEFORALLCOM
#ONSUMER(ELP,INE
Additional Information
/.%&/2!,,šISTHEREGISTEREDTRADEMARKOF5NIVERSAL%LECTRONICS)NC
!UDIOVOX!CCESSORIES#ORPORATIONISTHE,ICENSEEOFTHE/.%&/2!,,šBRAND
for North America.
¥BY5NIVERSAL%LECTRONICS)NC.OPARTOFTHISPUBLICATIONMAYBE
REPRODUCEDTRANSMITTEDTRANSCRIBEDSTOREDINANYRETRIEVALSYSTEMOR
TRANSLATEDTOANYLANGUAGEINANYFORMORBYANYMEANSELECTRONIC
MECHANICALMAGNETICOPTICALMANUALOROTHERWISEWITHOUTTHEPRIOR
WRITTENPERMISSIONOF5NIVERSAL%LECTRONICS)NC
4HE/NE&OR!LLš$EVICE5NIVERSAL2EMOTE#ONTROLISCOMPATIBLEFORUSEIN
.ORTH!MERICAEXCLUDING-EXICO
4HIS/NE&OR!LLš$EVICE5NIVERSAL2EMOTE#ONTROLISCOVEREDBYONEOR
MOREOFTHEFOLLOWING530ATENTS
OARN03S 1/10
12
%L#ONTROL2EMOTO5NIVERSAL/!2.3DE/NE&OR!LLESUNAMANERA
PERFECTADESIMPLIlCARELENTRETENIMIENTOENELHOGAR%STAUNIDADLE
permite manejar hasta 3 dispositivos de entretenimiento en el hogar
desde un solo control remoto fácil de usar.
0ASO)NSTALELASBATERÓAS
Español
%LCONTROLREMOTONECESITADOSBATERÓASALCALINAS!!!NO
suministradas).
0ARAINSTALARLASBATERÓAS
1. Oprima y empuje la tapa del compartimiento de las baterías
para removerla.
2. )NSERTELASBATERÓASCERCIORÉNDOSEDEQUELASPOLARIDADES
YnCORRESPONDANCONELDIAGRAMAQUEAPARECEENEL
compartimiento de las baterías.
3. Vuelva a colocar la tapa del compartimiento de las baterías en
su posición.
0RECAUCIONESSOBRELAS"ATERÓAS
s
.OCOMBINEBATERÓASNUEVASYVIEJAS
s
.OCOMBINEDIFERENTESTIPOSDEBATERÓASALCALINASESTÉNDAR
CARBØNZINCORECARGABLESNÓQUELCADMIO
s
3IEMPREREMUEVADEINMEDIATOBATERÓASVIEJASDÏBILESO
DESGASTADASYRECÓCLELASODESÏCHELASSEGÞNLODISPONENLAS
normas locales y nacionales.
Paso 2: Programe el control remoto
Para utilizar este control remoto universal con su sistema de
ENTRETENIMIENTOENELHOGARNECESITARÉPRIMEROPROGRAMARLOPARA
manejar sus dispositivos. Para programar el control remoto universal
PARAMANEJARSUSDISPOSITIVOSUTILICEUNODELOSCUATROMÏTODOSA
continuación.
s
,A"ÞSQUEDA!UTOMÉTICADE#ØDIGOS recorre
automáticamente todos los códigos del dispositivo que desea
MANEJAR³STEESELMÏTODOMÉSFÉCILPEROAVECESTOMAMÉS
TIEMPOQUEALGUNOSDELOSDEMÉSMÏTODOSDEPROGRAMACIØN
s
,A"ÞSQUEDADE#ØDIGOSPOR-ARCABUSCAATRAVÏSDELOS
CØDIGOSSEGÞNLAMARCADEDISPOSITIVOSSELECCIONADA.OESTAN
FÉCILCOMOLABÞSQUEDADECØDIGOSAUTOMÉTICAPEROMUCHAS
veces puede ser más rápida.
s
,A%NTRADA$IRECTADE#ØDIGOS le permite ingresar un
código de la lista de códigos suministrada para la marca de
SUDISPOSITIVO.OESTANFÉCILCOMOLOSOTROSMÏTODOSPEROES
posiblemente el más rápido.
s
,A"ÞSQUEDA-ANUALDE#ØDIGOS le permite recorrer
manualmente todos los códigos del dispositivo que desea
manejar.
Cuidado y Mantenimiento
s -ANTENGAELCONTROLREMOTOSECO3ISEMOJASÏQUELO
inmediatamente.
s 5TILICEYALMACENEELCONTROLREMOTOÞNICAMENTEENENTORNOSDE
temperatura normal.
s -ANEJEELCONTROLREMOTODEFORMACUIDADOSA
No lo deje caer.
s -ANTENGAELCONTROLREMOTORESGUARDADODELPOLVOYLASUCIEDAD
s ,IMPIEELCONTROLREMOTOCONUNPA×OHÞMEDODEVEZENCUANDO
para mantenerlo en buenas condiciones de operación.
s -ODIlCAROSABOTEARLOSCOMPONENTESINTERNOSDELCONTROLREMOTO
podría ocasionar desperfectos y anular la garantía.
13
"ÞSQUEDA!UTOMÉTICADE#ØDIGOS
,A"ÞSQUEDA!UTOMÉTICADE#ØDIGOSRECORREAUTOMÉTICAMENTETODOS
LOSCØDIGOSDELDISPOSITIVOQUEDESEAMANEJAR#UANDOENCUENTREEL
QUEMANEJASUDISPOSITIVOPUEDEDETENERLABÞSQUEDAYGUARDAREL
código.
CONSEJOS: Cada tecla de dispositivo está asociada a un tipo de
DISPOSITIVOˆ46ESTÉCONlGURADAPARABUSCAR463!4s#",s$4#PARA
receptores de satélite, aparatos de cable o convertidores de TV
DIGITALY$6$s6#2PARALECTORESDE$6$0ARAPROGRAMARLATECLA
$6$s6#2PARAMANEJARUN062O6#2CONSULTELASECCIØN#ØMO
2EASIGNARLA4ECLA$6$s6#2PARA-ANEJARUNA6#2
Para salir en cualquier momento de la Búsqueda Automática de
Códigos sin guardar un código nuevo, oprima la tecla EXIT.
1. Encienda manualmente el dispositivo que desea manejar.
2. Oprima y sostenga la tecla de dispositivo que desea programar.
La tecla POWER se ilumina.
!LAVEZQUESOSTIENELATECLADEDISPOSITIVOUTILICELAOTRAMANO
para oprimir y sostener simultáneamente la tecla POWER del
control remoto. La tecla POWER se apaga.
3. Espere hasta que la tecla POWER se ilumine y permanezca
ILUMINADA,UEGOSUELTEAMBASTECLAS
4. -ANTENGAELCONTROLREMOTOAPUNTADODIRECTAMENTEALPANEL
frontal del dispositivo que desea manejar. Oprima la tecla PLAY
DELCONTROLREMOTOYESPERESEGUNDOS%LCONTROLREMOTOESTÉ
probando un grupo de 10 códigos para el dispositivo.
z3EAPAGØELDISPOSITIVO
SÍ:6AYAAL0ASO
NO: Oprima PLAY nuevamente. El control remoto prueba el
PRØXIMOGRUPODECØDIGOS
#ONTINÞEOPRIMIENDO0,!9CADASEGUNDOSHASTAQUEEL
dispositivo se apague.
5. #UANDOELDISPOSITIVOSEAPAGUEOPRIMALATECLA2%6%23%DEL
control remoto y espere por lo menos 2 segundos. El control
REMOTOPRUEBAELÞLTIMOCØDIGODELGRUPOANTERIORDE
códigos.
z3EENCENDIØELDISPOSITIVO
SÍ:/PRIMALATECLA34/0_,ISTO,ATECLADEDISPOSITIVOESTÉ
programada.
NO: Oprima REVERSE nuevamente. El control remoto prueba el
PRØXIMOCØDIGOENELGRUPODECØDIGOS
#ONTINÞEOPRIMIENDO2%6%23%CADASEGUNDOSHASTAQUEEL
DISPOSITIVOSEENCIENDA#UANDOSEENCIENDAOPRIMA34/0
Aviso: Si oprime accidentalmente la tecla REVERSE luego de
que el dispositivo se encienda, oprima la tecla FORWARD.
Luego, espere dos segundos para ver si su dispositivo se vuelve
a apagar.
NOTAS
A través de la programación de cada tecla, asegúrese de mantener
el control remoto apuntado directamente al sensor infrarrojo del
dispositivo que está actualmente programando con el control
remoto.
Pruebe el control remoto con el dispositivo para asegurarse que
la tecla de dispositivo esté programada con el código correcto y
garantizar así su máxima funcionalidad. Si no puede utilizar alguna
de las funciones, intente con otro código. Para obtener mayor
información, consulte la sección “Cómo Probar el Código para
Obtener Máxima Funcionalidad” a continuación.
14
Durante la Búsqueda Automática de Códigos, el control remoto
ignora la opresión de teclas que no son parte de la búsqueda.
La búsqueda se detendrá luego de dos minutos (la tecla POWER
parpadea cuatro veces y se apaga, y se retiene el último código
programado bajo la tecla de dispositivo).
La tecla POWER parpadea cuatro veces y se apaga cuando el control
remoto ha recorrido todos los códigos. El control remoto sale del
método de Búsqueda Automática de Códigos. Si su dispositivo aún
no se ha apagado, intente un método de búsqueda diferente.
1. Pruebe una variedad de funciones del dispositivo con el control
remoto. Si no puede utilizar alguna de las funciones del
DISPOSITIVOVAYAALPRØXIMOPASOEINTENTEUNCØDIGODIFERENTE
2. 2EPITALA"ÞSQUEDA!UTOMÉTICADE#ØDIGOSDESDEELCOMIENZO
#UANDOSUDISPOSITIVOSEAPAGUENODETENGALABÞSQUEDA%N
VEZCONLAUNIDADAPAGADACONTINÞEOPRIMIENDOLATECLA0,!9
CADASEGUNDOSHASTAQUELAUNIDADSEVUELVAAENCENDER
3. #UANDOSEVUELVAAENCENDERLAUNIDADOPRIMALATECLA2%6%23%
en el control remoto cada 2 segundos hasta que el dispositivo
SEVUELVAAAPAGAR#UANDOELDISPOSITIVOSEVUELVAAAPAGAR
oprima la tecla STOP.
4. .UEVAMENTEPRUEBELAFUNCIONALIDADDELATECLAINTENTANDO
controlar una variedad de funciones del dispositivo. Si el código
que se ha almacenado controla la mayoría de las funciones del
DISPOSITIVOENTONCESHABRÉCONCLUIDOLAPROGRAMACIØN3IEL
CØDIGOGUARDADONOBRINDAUNAMÉXIMAFUNCIONALIDADINTENTE
otro código.
"ÞSQUEDADE#ØDIGOSPOR-ARCA
,A"ÞSQUEDADE#ØDIGOSPOR-ARCARECORRESØLOLOSCØDIGOSDEUNA
de las marcas seleccionadas que aparecen en la lista de códigos
SUMINISTRADA3ILAMARCADELDISPOSITIVOAPARECEENLALISTA
POSIBLEMENTELABÞSQUEDASELLEVARÉACABODEMANERAFÉCILYRÉPIDA
CONSEJOS: Cada tecla de dispositivo está asociada a un tipo de
DISPOSITIVOˆ46ESTÉCONlGURADAPARABUSCAR463!4s#",s$4#PARA
receptores de satélite, aparatos de cable o convertidores de TV
DIGITALY$6$s6#2PARALECTORESDE$6$0ARAPROGRAMARLATECLA
$6$s6#2PARAMANEJARUN062O6#2CONSULTELASECCIØN#ØMO
2EASIGNARLA4ECLA$6$s6#2PARA-ANEJARUNA6#2
Para salir en cualquier momento de la Búsqueda de Códigos por
Marca sin guardar un código nuevo, oprima la tecla EXIT.
1. Encienda manualmente el dispositivo que desea manejar.
2. %NCUENTRELAMARCADELDISPOSITIVOENLASECCIØNDE#ØDIGOSPOR
-ARCADELALISTADECØDIGOSSUMINISTRADA-ARQUECONUNCÓRCULO
ELNÞMERODELAMARCAYMANTENGALALISTAAMANO
3. Oprima y sostenga la tecla de dispositivo que desea programar.
La tecla POWER se ilumina.
!LAVEZQUESOSTIENELATECLADEDISPOSITIVOUTILICELAOTRAMANO
para oprimir y sostener simultáneamente la tecla POWER del
control remoto. La tecla POWER se apaga.
4. Espere hasta que la tecla POWER del control remoto se ilumine
YPERMANEZCAILUMINADA,UEGOSUELTEAMBASTECLAS
5. &ÓJESEENLOSNÞMEROSQUEMARCØPARAELNÞMERODECØDIGODELA
MARCADELDISPOSITIVO/PRIMADICHOSNÞMEROSENELTECLADODEL
control remoto.
Aviso: Para los códigos de marca de un solo dígito, oprima la
tecla 0 primero (por ejemplo, 0-5 para 5).
continúa en la página siguiente...
15
Español
#ØMO0ROBAREL#ØDIGOPARA/BTENER-ÉXIMA&UNCIONALIDAD
6. -ANTENGAELCONTROLREMOTOAPUNTADODIRECTAMENTEALPANEL
frontal del dispositivo que desea manejar. Oprima la tecla
POWER del control remoto y espere 2 segundos. El control
remoto está probando un código para la marca del dispositivo.
z3EAPAGØELDISPOSITIVO
SÍ:/PRIMALATECLA34/0PARAGUARDARELCØDIGO_,ISTO,ATECLA
de dispositivo está programada.
NO: Oprima POWER nuevamente. El control remoto prueba el
PRØXIMOCØDIGOPARASUMARCA
#ONTINÞEOPRIMIENDO0/7%2CADASEGUNDOSHASTAQUEEL
DISPOSITIVOSEAPAGUE#UANDOSEAPAGUEOPRIMA34/0
NOTAS
A través de la programación de cada tecla, asegúrese de mantener
el control remoto apuntado directamente al sensor infrarrojo del
dispositivo que está actualmente programando con el control remoto.
Pruebe el control remoto con el dispositivo para asegurarse que
la tecla de dispositivo esté programada con el código correcto y
garantizar así su máxima funcionalidad. Si no puede utilizar alguna
de las funciones, intente con otro código. Para obtener mayor
información, consulte la sección “Cómo Probar el Código para
Obtener Máxima Funcionalidad” a continuación.
Durante la Búsqueda de Códigos por Marca, el control remoto ignora
la opresión de teclas que no son parte de la búsqueda.
La búsqueda se detendrá luego de dos minutos (la tecla POWER
parpadea cuatro veces y se apaga, y se retiene el último código
programado bajo la tecla de dispositivo).
La tecla POWER parpadea cuatro veces y se apaga cuando el control
remoto ha recorrido todos los códigos. El control remoto sale del
método de Búsqueda de Códigos por Marca. Si su dispositivo aún no
se ha apagado, intente un método de búsqueda diferente.
Testing the Code for Maximum Functionality
1. Pruebe una variedad de funciones del dispositivo con el control
remoto. Si no puede utilizar alguna de las funciones de sus
DISPOSITIVOSVAYAALPRØXIMOPASOEINTENTEUNCØDIGODIFERENTE
2. 2EPITALA"ÞSQUEDADE#ØDIGOSPOR-ARCADESDEELCOMIENZO
#UANDOELDISPOSITIVOSEAPAGUEPORPRIMERAVEZNOOPRIMA
LATECLA34/0CONLACUALQUEDARÓAGUARDADOELMISMOCØDIGO
%NVEZCONLAUNIDADAPAGADACONTINÞEOPRIMIENDOLA
tecla POWER repetidamente hasta que la unidad se vuelva a
encender.
3. 3ISEVUELVEAENCENDERLAUNIDADHABRÉENCONTRADOOTROCØDIGO
que puede manejar ese dispositivo. Oprima STOP.
4. Pruebe la funcionalidad de la tecla nuevamente intentando
una variedad de funciones. Si el código controla la mayoría
DELASFUNCIONESDELDISPOSITIVOENTONCESHABRÉCONCLUIDOLA
PROGRAMACIØN3IELCØDIGOGUARDADONOBRINDAUNAMÉXIMA
FUNCIONALIDADINTENTEOTROCØDIGO
%NTRADA$IRECTADE#ØDIGOS
,A%NTRADA$IRECTADE#ØDIGOSLEPERMITEINGRESARUNCØDIGODELALISTA
de códigos suministrada para la marca de su dispositivo. No es tan fácil
COMOLOSOTROSMÏTODOSPEROESPOSIBLEMENTEELMÉSRÉPIDO
CONSEJO: Cada tecla de dispositivo está asociada a un tipo de
DISPOSITIVOˆ46ESTÉCONlGURADAPARABUSCAR463!4s#",s$4#PARA
receptores de satélite, aparatos de cable o convertidores de TV
DIGITALY$6$s6#2PARALECTORESDE$6$0ARAPROGRAMARLATECLA
$6$s6#2PARAMANEJARUN062O6#2CONSULTELASECCIØN#ØMO
2EASIGNARLA4ECLA$6$s6#2PARA-ANEJARUNA6#2
1. Encienda manualmente el dispositivo que desea manejar.
2. %NCUENTRELA,ISTADE#ØDIGOSSUMINISTRADACONELCONTROL
remoto. Encuentre la sección para el tipo de dispositivo que
DESEAPROGRAMARYLOCALICELAMARCAENESASECCIØN-ARQUECON
UNCÓRCULOLOSCØDIGOSPARALAMARCAYMANTÏNGALOSAMANO
16
3. Oprima y sostenga la tecla de dispositivo que desea programar
-IENTRASOPRIMELATECLADEDISPOSITIVOINGRESECONLAOTRA
mano el primer código de cinco dígitos para la marca de la lista
DECØDIGOSLATECLA0/7%2SEAPAGALUEGODELPRIMERDÓGITO
4. #UANDOHAYAINGRESADOELCØDIGODECINCODÓGITOSCONTINÞE
oprimiendo la tecla de dispositivo y observe la tecla POWER.
z3EILUMINØLATECLA0/7%2
SÍ: _,ISTO,ATECLADEDISPOSITIVOESTÉPROGRAMADA
.OPARPADEØCUATROVECESYSEAPAGØ(AINGRESADOUN
NÞMERODECØDIGOQUENOSEENCUENTRAENLASLISTASDECØDIGOS
u omitió un paso en el procedimiento de entrada de códigos.
Intente el paso 3 nuevamente.
NOTAS
Pruebe el control remoto con el dispositivo para asegurarse que
la tecla de dispositivo esté programada con el código correcto y
garantizar así su máxima funcionalidad. Si no puede utilizar alguna
de las funciones, intente con otro código de la lista.
Recuerde ingresar el código para referencia futura en el recuadro
provisto en la sección Recuperación de Códigos de este manual.
Si la marca de su dispositivo no aparece en la lista de códigos, utilice
uno de los métodos de Búsqueda de Códigos para programar el
control remoto. (Consulte los métodos de Búsqueda Automática y
Manual de Códigos)
Si suelta la tecla de dispositivo en cualquier momento durante el
proceso de Entrada Directa de Códigos, la tecla POWER parpadea
cuatro veces, y se sale del proceso. Se retendrá el último código
programado bajo la tecla de dispositivo.
"ÞSQUEDA-ANUALDE#ØDIGOS
,A"ÞSQUEDA-ANUALDE#ØDIGOSLEPERMITERECORRERUNOPOR
UNOTODOSLOSCØDIGOSDELDISPOSITIVOQUEDESEAMANEJAR#UANDO
ENCUENTREELQUEMANEJASUDISPOSITIVOPUEDEDETENERLABÞSQUEDA
y guardar el código.
CONSEJOS: El método de Búsqueda Manual de Códigos podría
tomar más tiempo porque el control remoto busca a través de todos
los códigos en su memoria uno por uno. Si su marca aparece en las
Listas de Códigos por Marca o Listas de Códigos, intente primero la
Búsqueda de Códigos por Marca o el método de Entrada Directa de
Códigos.
Cada tecla de dispositivo está asociada a un tipo de dispositivo—TV
ESTÉCONlGURADAPARABUSCAR463!4s#",s$4#PARARECEPTORESDE
SATÏLITEAPARATOSDECABLEOCONVERTIDORESDE46DIGITALY$6$s6#2
PARALECTORESDE$6$0ARAPROGRAMARLATECLA$6$s6#2PARA
manejar un PVR o VCR, consulte la sección Cómo Reasignar la Tecla
$6$s6#2PARA-ANEJARUNA6#2
Para salir en cualquier momento de la Búsqueda Manual de Códigos
sin guardar un código nuevo, oprima la tecla EXIT.
1. Encienda manualmente el dispositivo que desea manejar.
continúa en la página siguiente...
17
Español
LATECLA0/7%2SEILUMINA
2. Oprima y sostenga la tecla de dispositivo que desea programar.
La tecla POWER se ilumina.
!LAVEZQUESOSTIENELATECLADEDISPOSITIVOUTILICELAOTRAMANO
para oprimir y sostener simultáneamente la tecla POWER del
control remoto. La tecla POWER se apaga.
3. Espere hasta que la tecla POWER del control remoto se ilumine
YPERMANEZCAILUMINADA,UEGOSUELTEAMBASTECLAS
4. -ANTENGAELCONTROLREMOTOAPUNTADODIRECTAMENTEALPANEL
frontal del dispositivo que desea manejar. Oprima la tecla
POWER del control remoto y espere 2 segundos.
z3EAPAGØELDISPOSITIVO
SÍ:/PRIMALATECLA34/0PARAGUARDARELCØDIGO_,ISTO,ATECLA
de dispositivo está programada.
NO: Oprima POWER nuevamente. El control remoto prueba el
PRØXIMOCØDIGOPARASUDISPOSITIVO
#ONTINÞEOPRIMIENDO0/7%2CADASEGUNDOSHASTAQUEEL
DISPOSITIVOSEAPAGUE#UANDOSEAPAGUEOPRIMA34/0
CONSEJO: Debido a la gran cantidad de códigos, quizás
necesite oprimir la tecla POWER varias veces-posiblemente
cientos de veces.
NOTAS
A través de la programación de cada tecla, mantenga el control
remoto apuntado directamente al sensor infrarrojo del dispositivo
que está programando con el control remoto.
Pruebe el control remoto con el dispositivo para asegurarse que
la tecla de dispositivo esté programada con el código correcto y
garantizar así su máxima funcionalidad. Si no puede utilizar alguna
de las funciones, intente con otro código. Para obtener mayor
información, consulte la sección “Cómo Probar el Código para
Obtener Máxima Funcionalidad” a continuación.
Durante la Búsqueda Manual de Códigos, el control remoto ignora la
opresión de teclas que no son parte de la búsqueda.
La búsqueda se detendrá luego de dos minutos (la tecla POWER
parpadea cuatro veces y se apaga, y se retiene el último código
programado bajo la tecla de dispositivo).
La tecla POWER parpadea cuatro veces y se apaga cuando el control
remoto ha recorrido todos los códigos. El control remoto sale del
método de Búsqueda Manual de Códigos. Si su dispositivo aún no se
ha apagado, intente un método de búsqueda diferente.
#ØMO0ROBAREL#ØDIGOPARA/BTENER-ÉXIMA&UNCIONALIDAD
1. Pruebe una variedad de funciones del dispositivo con el control
remoto. Si no puede utilizar alguna de las funciones del
DISPOSITIVOVAYAALPRØXIMOPASOEINTENTEUNCØDIGODIFERENTE
2. 2EPITAEL-ÏTODODE"ÞSQUEDA-ANUALDE#ØDIGOSDESDEEL
COMIENZO#UANDOHAYAENCONTRADOELCØDIGOQUEVUELVAA
ENCENDERELDISPOSITIVONOOPRIMALATECLA34/0CONLACUAL
QUEDARÓAGUARDADOELMISMOCØDIGO%NVEZCONLAUNIDAD
APAGADACONTINÞEOPRIMIENDOLATECLA0/7%2REPETIDAMENTE
hasta que la unidad se vuelva a encender.
3. 3ISEVUELVEAENCENDERLAUNIDADHABRÉENCONTRADOOTROCØDIGO
que puede manejar ese dispositivo. Oprima la tecla STOP.
4. .UEVAMENTEPRUEBELAFUNCIONALIDADDELATECLAINTENTANDO
controlar una variedad de funciones del dispositivo. Si el código
que se ha almacenado controla la mayoría de las funciones del
DISPOSITIVOENTONCESHABRÉCONCLUIDOLAPROGRAMACIØN3IEL
CØDIGOGUARDADONOBRINDAUNAMÉXIMAFUNCIONALIDADINTENTE
otro código.
18
Recorrido del control remoto
La tecla POWER iluminada sirve
de luz indicadora para ofrecer
retroalimentación.
,ASTECLASDEDISPOSITIVOTV
3!4s#",s$4#$6$s6#2)
ponen el control remoto en el
modo correcto para manejar el
dispositivo.
GUIDE y MENU ponen el
control remoto en el modo
MENÞGUÓAADEMÉSLOGRAN
acceso a las mismas funciones
que las teclas de los controles
remotos originales.
EXIT sale de la programación
DELCONTROLREMOTOADEMÉS
DESEMPE×ALASMISMAS
funciones que en los controles
remotos originales.
,ASTECLASDEmECHASSEUTILIZAN
PARANAVEGARATRAVÏSDELOS
SISTEMASDEMENÞSYGUÓASDELOS
componentes
La tecla ).054s$)')4!, y —
GUIØNTIENETRESFUNCIONES
alterna entre todas las fuentes
de video conectadas al televisor;
CUANDOELCONTROLREMOTO
SEENCUENTRAENELMODO6#2
este botón alterna entre la
ENTRADA6#2Y46CUANDO
INGRESADIRECTAMENTENÞMEROS
DECANALESDIGITALESESTEBOTØN
LEPERMITESEPARARELNÞMERO
DELCANALPRINCIPALDELNÞMERO
DELCANALSECUNDARIOTALCOMO
IMPORTANTE
Dado que este control remoto maneja más de un dispositivo, deberá
primero “indicarle” al control remoto cuál dispositivo desea manejar.
En otras palabras, si desea manejar el televisor, deberá primero
oprimir la tecla TV para poner el control remoto en el Modo TV. El
control remoto permanece en ese modo de dispositivo hasta que
oprima una tecla de dispositivo diferente. Por ejemplo, si el control
remoto se encuentra en el Modo TV y desea manejar el Lector de
$6$DEBERÉOPRIMIRLATECLA$6$s6#2PARACAMBIARLOSMODOSDE
dispositivo.
19
Español
%NLAMAYORÓADELOSCASOSLASTECLASDELCONTROLREMOTODESEMPE×AN
las mismas funciones que las teclas de los controles remotos originales
una vez programa este control remoto para manejar los componentes.
La mayoría de las teclas de este control remoto tienen otras funciones.
Funciones Avanzadas
#ØMO2EASIGNARLA4ECLA$6$s6#2PARA
Manejar una VCR
,ATECLA$6$s6#2VIENEPREESTABLECIDADEFÉBRICAPARAMANEJARUN
,ECTORDE$6$3IDESEAQUELATECLA$6$s6#2MANEJEUNA6#2
deberá reasignarla.
1. /PRIMAYSOSTENGALATECLA$6$s6#2,ATECLA0/7%2SE
ENCENDERÉ#ONTINÞESOSTENIENDOLATECLADE$6$s6#2
2. -IENTRASSOSTIENELATECLA$6$s6#2OPRIMAYSUELTELATECLA
NUMÏRICAENELTECLADO,ATECLA0/7%2SEAPAGARÉ
3. 3UELTELATECLA$6$s6#2,ATECLA0/7%2PARPADEACUATROVECES
YLUEGOSEAPAGA,ATECLA$6$s6#2ESTÉAHORACONlGURADA
PARAMANEJARUNA6#2
4. /BSERVELASINSTRUCCIONESDELABÞSQUEDADECØDIGOSAUTOMÉTICA
PORMARCAMANUALOENTRADADIRECTAPARAPROGRAMARLATECLA
$6$s6#2PARASU6#2
)RRUPCIØNDE6OLUMEN
)RRUPCIØNDEVOLUMENLEPERMITEALASTECLAS6/,Y-54%CUANDOSE
OPRIMENENLOSMODOS3!4s#",s$4#O$6$s6#2hIRRUMPIRvAL46
Irrupción de volumen ocurre automáticamente y le permite controlar
el volumen sin tener que salir del modo actual.
Aviso: Irrupción de Volumen no ocurre en casos donde el código
del componente tiene sus propios controles de volumen/silencio, tal
como algunos receptores de satélite.
)RRUPCIØNDE4ECLASDE4RANSPORTE
La irrupción de teclas de transporte les permite a las teclas de
TRANSPORTE2%6%23%0,!9&/27!2$2%#/2$34/00!53%3+)0
"!#+3,/7Y3+)0&7$CUANDOSEOPRIMENENLOSMODOS46O
3!4s#",s$4#hIRRUMPIRvALMODOS$6$s6#2,AIRRUPCIØNDETECLAS
de transporte ocurre automáticamente y le permite utilizar las teclas
DETRANSPORTESINTENERQUESALIRDELMODOACTUAL0OREJEMPLOSILA
ÞLTIMAVEZQUESEUTILIZARONLASTECLASDETRANSPORTEFUEENELMODO
$6$YSEACCESARONNUEVAMENTELUEGODEOPRIMIRLATECLA46ÏSTAS
irrumpirán al DVD.
Aviso: La Irrupción de Teclas de Transporte no ocurre donde el
código del componente tenga su propia información de tecla de
transporte, tal como un receptor de satélite con un DVR integrado.
20
"LOQUEODE#ANALES
"LOQUEODE#ANALESENVÓAAUTOMÉTICAMENTECOMANDOSDECANAL
TALESCOMO#(,!34YLASTECLASNUMÏRICASASURECEPTORDE
SATÏLITEAPARATODECABLEOCONVERTIDORDE46DIGITALCUANDOSE
encuentra en el modo TV. Esto puede ahorrarle opresiones de teclas
si utiliza un dispositivo diferente a su televisor para cambiar canales.
0ARAACTIVARELBLOQUEODECANALES
que utiliza para cambiar canales. A la vez que sostiene esta
TECLADEDISPOSITIVOUTILICELAOTRAMANOPARAOPRIMIRYSOSTENER
SIMULTÉNEAMENTELATECLA#(ARRIBADELCONTROLREMOTO
2. Espere hasta que la tecla POWER del control remoto se ilumine
YPERMANEZCAILUMINADA,UEGOSUELTEAMBASTECLAS
3. Oprima ENTER para bloquear los comandos de canal para este
dispositivo.
0ARADESACTIVARELBLOQUEODECANALES
1. /PRIMAYSOSTENGALATECLA46!LAVEZQUESOSTIENELATECLA46
utilice la otra mano para oprimir y sostener simultáneamente la
TECLA#(ABAJODELCONTROLREMOTO
2. Espere hasta que la tecla POWER del control remoto se ilumine
YPERMANEZCAILUMINADA,UEGOSUELTEAMBASTECLAS
3. Oprima ENTER para comenzar a cambiar canales con su
televisor.
2ECUPERACIØNDE#ØDIGOS
5NAVEZHAYAPROGRAMADOELCONTROLREMOTOPARAMANEJARSUS
DISPOSITIVOSSERECOMIENDAANOTARLOSCØDIGOSPARAFUTURAREFERENCIA
3IUTILIZØELMÏTODODE%NTRADA$IRECTADE#ØDIGOSESMUYSENCILLO
Simplemente encuentre los códigos que ingresó y anótelos en los
RECUADROSACONTINUACIØN3IUTILIZØUNODELOSMÏTODOSDE"ÞSQUEDA
DE#ØDIGOSPARAPROGRAMARELCONTROLREMOTOOSIUTILIZØELMÏTODO
DE%NTRADA$IRECTAPERONORECUERDAELCØDIGONECESITARÉRECUPERAR
el código de cinco dígitos de cada uno de los dispositivos. Recuperar
y anotar el código real le ahorrará tiempo si alguna vez necesita
VOLVERAPROGRAMARELCONTROLREMOTO3IANOTALOSCØDIGOSPUEDE
UTILIZARELMÏTODODE%NTRADA$IRECTAPARAVOLVERAPROGRAMAREL
CONTROLREMOTOAlNDEMANEJAROTROSDISPOSITIVOSUNPROCESORÉPIDO
y sencillo.
1. /PRIMAYSOSTENGALATECLADEDISPOSITIVO463!4s#",s$4#
$6$s6#2CUYOCØDIGODESEARECUPERAR,ATECLA0/7%2SE
ENCENDERÉ#ONTINÞEOPRIMIENDOLATECLADEDISPOSITIVO
2. -IENTRASSOSTIENELATECLADEDISPOSITIVOOPRIMAYSOSTENGA
la tecla INFO. La tecla POWER se apagará. Luego de sostener
AMBASTECLASDURANTETRESSEGUNDOSLATECLA0/7%2SE
encenderá nuevamente.
3. Suelte ambas teclas. La tecla POWER permanece encendida.
4. #OMENZANDOCONLATECLANUMÏRICAOPRIMAYSUELTECADATECLA
NUMÏRICAENELTECLADOENELSIGUIENTEORDENLUEGO%L
NÞMEROQUEHACEQUELATECLA0/7%2PARPADEEESELPRIMER
NÞMERODELCØDIGO-IENTRASENCUENTRALOSNÞMEROSDELCØDIGO
anótelos para referencia futura.
Aviso: Todos los códigos de TV comienzan con el número 1;
todos los códigos de VCR y DVR comienzan con el número
2; todos los códigos de lectores de DVD, con el número 3; y
todos los códigos de receptores de satélite, aparatos de cable y
convertidores de TV digital, con el número 5.
5. 2EPITAELPASOHASTAHABERRECUPERADOLOSCINCONÞMEROSDEL
CØDIGO,UEGODERECUPERARELQUINTONÞMEROLATECLA0/7%2
PARPADEABREVEMENTEYLUEGOSEAPAGA
CONSEJO: Para salir del Modo de Recuperación de Códigos en
cualquier momento, oprima la tecla EXIT.
continúa en la página siguiente...
21
Español
1. Oprima y sostenga la tecla de dispositivo para el dispositivo
Aviso: Si oprime una tecla inválida durante el proceso de
Recuperación de Códigos, el control remoto no responderá. Si
no oprime una tecla de Recuperación de Códigos válida, (TV,
3!4s#",s$4#$6$s6#2).&/%8)4LA2ECUPERACIØNDE#ØDIGOSSE
detendrá al cabo de 15 segundos. La tecla POWER parpadea cuatro
veces y luego se apaga.
2EFERENCIA2ÉPIDADE#ØDIGOS
4IPODE$ISPOSITIVO #ØDIGO
2ESOLUCIØNDE0ROBLEMA
Problema: El control remoto no maneja su dispositivo.
s !SEGÞRESEQUEELCONTROLREMOTOSEENCUENTREENELMODO
CORRECTOOPRIMIENDOLATECLADEDISPOSITIVOCORRESPONDIENTE46
3!4s#",s$4#$6$s6#2%STOLEINDICAALCONTROLREMOTOEL
dispositivo que debe manejar.
s 2ETIRELOSOBSTÉCULOSUBICADOSENTREELCONTROLREMOTOYEL
DISPOSITIVO!SEGÞRESEDEAPUNTARELCONTROLREMOTODIRECTAMENTE
al sensor infrarrojo del dispositivo.
s !SEGÞRESEQUELASBATERÓASESTÏNCARGADASYDEBIDAMENTE
INSTALADAS2EEMPLACELASBATERÓASCONDOSBATERÓAS!!!NUEVAS
DESERNECESARIOCONSULTELASECCIØN)NSTALACIØNDELAS"ATERÓAS
Problema: El control remoto no puede programarse para
manejar su dispositivo.
s 3IESTÉPROBANDOELCONTROLREMOTOMIENTRASLOESTÉPROGRAMANDO
podría estar demasiado alejado del dispositivo o en un ángulo
incorrecto. Deberá haber una trayectoria sin obstáculos entre el
CONTROLREMOTOYELSENSORINFRARROJODELDISPOSITIVO!CÏRQUESE
MÉSYASEGÞRESEDEAPUNTARDIRECTAMENTEALDISPOSITIVOQUEESTÉ
intentando manejar.
s 3IESTÉUTILIZANDOELMÏTODODEPROGRAMACIØNDE%NTRADA
Directa para ingresar los códigos para su marca y la unidad
AÞNNOFUNCIONADEBIDAMENTEINTENTEELMÏTODODEBÞSQUEDA
AUTOMÉTICAPORMARCAOMANUAL
s 0ARAMANEJARUNIDADESDECOMBINACIØNTALESCOMO466#2O46
$6$DEBERÉPROGRAMARLASTECLASDEDISPOSITIVOCORRESPONDIENTES
individuales para manejar cada parte de la unidad de
COMBINACIØN5NAVEZPROGRAMADASDEMANERAEXITOSALATECLA46
MANEJALASFUNCIONESDELTELEVISORYLATECLA$6$s6#2MANEJALAS
FUNCIONESDEL,ECTORDE$6$Y6#2
s !SEGÞRESEQUELASBATERÓASESTÏNCARGADASYDEBIDAMENTE
instaladas.
Problema: El control remoto no ejecuta los comandos
debidamente.
s !SEGÞRESEQUEELCONTROLREMOTOSEENCUENTREENELMODO
CORRECTOOPRIMIENDOLATECLADEDISPOSITIVOCORRESPONDIENTE46
3!4s#",s$4#$6$s6#2%STOLEINDICAALCONTROLREMOTOEL
dispositivo que debe manejar.
s !SEGÞRESEQUEELDISPOSITIVOSEENCUENTRELISTOPOREJEMPLOEL
Lector de DVD tenga un disco cargado).
s 0UEDEHABEROPRIMIDOUNATECLAINVÉLIDAPARAELMODOENQUESE
encuentra el control remoto.
s 3IESTÉTRATANDODEINGRESARDIRECTAMENTEUNNÞMERODECANAL
INTENTEOPRIMIRLATECLA%.4%2LUEGODEINGRESARELNÞMERODEL
canal ya que algunas marcas y modelos requieren esta acción.
s %XISTELAPOSIBILIDADDEQUEUNCØDIGOPROGRAMADOPUEDA
MANEJARÞNICAMENTEALGUNASDELASFUNCIONESDELDISPOSITIVO
POREJEMPLOSØLOENCIENDEYAPAGAUNDISPOSITIVO0ARA
CONlRMARQUELATECLADEDISPOSITIVOHASIDOPROGRAMADACON
ELCØDIGOCORRECTOPARAOBTENERMÉXIMAFUNCIONALIDADPRUEBE
el dispositivo. Intente manejar una variedad de funciones del
dispositivo con el control remoto. Si algunas de las funciones
DESUSDISPOSITIVOSNOTRABAJANINTENTEPROGRAMARELCONTROL
REMOTOCONUNCØDIGODIFERENTEENLALISTAATRAVÏSDEL-ÏTODODE
%NTRADA$IRECTADE#ØDIGOSHASTAQUEENCUENTREELCØDIGOQUELE
22
Problema: La tecla POWER no se ilumina cuando oprime una
tecla.
s 0UEDEHABEROPRIMIDOUNATECLAINVÉLIDAPARAELMODOENQUESE
encuentra el control remoto.
s !SEGÞRESEQUEELCONTROLREMOTOSEENCUENTREENELMODO
CORRECTOOPRIMIENDOLATECLADEDISPOSITIVOCORRESPONDIENTE46
3!4s#",s$4#$6$s6#2%STOLEINDICAALCONTROLREMOTOEL
dispositivo que debe manejar.
s !SEGÞRESEQUELASBATERÓASESTÏNCARGADASYDEBIDAMENTE
INSTALADAS2EEMPLACELASBATERÓASCONDOSBATERÓAS!!!NUEVAS
DESERNECESARIOCONSULTELASECCIØN)NSTALACIØNDELAS"ATERÓAS
Problema: El control remoto no cambia canales en el
dispositivo.
s !SEGÞRESEQUEELCONTROLREMOTOSEENCUENTREENELMODO
CORRECTOOPRIMIENDOLATECLADEDISPOSITIVOCORRESPONDIENTE46
3!4s#",s$4#$6$s6#2%STOLEINDICAALCONTROLREMOTOEL
dispositivo que debe manejar.
s /PRIMALATECLA%.4%2LUEGODEHABERINGRESADOUNNÞMERODE
canal.
s 2ETIRELOSOBSTÉCULOSUBICADOSENTREELCONTROLREMOTOYEL
DISPOSITIVO!SEGÞRESEDEAPUNTARELCONTROLREMOTODIRECTAMENTE
al sensor IR del dispositivo.
Problema: El menú del dispositivo no aparece en la pantalla
del televisor.
s !SEGÞRESEDEHABERCONECTADODEBIDAMENTEELDISPOSITIVOAL
TELEVISORYHABERSELECCIONADOLAENTRADACORRECTA#ONSULTEEL
-ANUALDEL0ROPIETARIODELOSDISPOSITIVOSPARAINFORMARSESOBRE
LOSPROCEDIMIENTOSDECONEXIØNCORRECTOS
s !SEGÞRESEQUEELCONTROLREMOTOSEENCUENTREENELMODO
CORRECTOOPRIMIENDOLATECLADEDISPOSITIVOCORRESPONDIENTE46
3!4s#",s$4#$6$s6#2%STOLEINDICAALCONTROLREMOTOEL
dispositivo que debe manejar.
s %LACCESOALOSMENÞSNOESRESPALDADOPORTODASLASMARCAS
Posiblemente sea necesario utilizar el control remoto original para
LOGRARACCESOALASFUNCIONESDEMENÞDEALGUNOSDISPOSITIVOS
0ARAOBTENERMAYORINFORMACIØNVISITEWWWONEFORALLCOM
,ÓNEADE!YUDAPARAEL#LIENTE
)NFORMACIØN!DICIONAL
/.%&/2!,,šESLAMARCACOMERCIALREGISTRADADE5NIVERSAL%LECTRONICS
)NC!UDIOVOX!CCESSORIES#ORPORATIONESLACONCESIONARIADELAMARCA/.%
&/2!,,šPARA%%55Y#ANADÉ
#OPYRIGHTPOR5NIVERSAL%LECTRONICS)NC.INGUNAPARTEDEESTA
PUBLICACIØNPUEDESERREPRODUCIDATRANSMITIDATRANSCRITAALMACENADA
ENNINGÞNSISTEMADERECUPERACIØNOTRADUCIDAACUALQUIERIDIOMA
ENNINGUNAFORMAOMEDIOYASEAELECTRØNICOMECÉNICOMAGNÏTICO
ØPTICOMANUALODEOTROTIPOSINELCONSENTIMIENTOPREVIOPORESCRITODE
5NIVERSAL%LECTRONICS)NC
%L#ONTROL2EMOTO5NIVERSAL/NE&OR!LLšPARADISPOSITIVOSES
COMPATIBLEPARASUUSOEN!MÏRICADEL.ORTEEXCEPTO-ÏXICO
%STE#ONTROL2EMOTO5NIVERSAL/NE&OR!LLšPARADISPOSITIVOSESTÉ
cubierto por una o más de las siguientes patentes estadounidenses:
OARN03S 1/10
23
Español
permita al control remoto manejar la mayoría de las funciones del
dispositivo. Diferentes códigos pueden proporcionar diferentes
niveles de funcionalidad.
,IMITED,IFETIME7ARRANTY
!UDIOVOX%LECTRONICS#ORPORATIONTHEh#OMPANYvWARRANTSTOYOUTHE
ORIGINALRETAILPURCHASEROFTHISPRODUCTTHATSHOULDITUNDERNORMALUSE
ANDCONDITIONSBEPROVENDEFECTIVEINMATERIALORWORKMANSHIPDURING
ITSLIFETIMEWHILEYOUOWNITSUCHDEFECTSWILLBEREPAIREDORREPLACED
ATTHE#OMPANYSOPTIONWITHOUTCHARGEFORPARTSANDREPAIRLABOR
4OOBTAINREPAIRORREPLACEMENTWITHINTHETERMSOFTHIS7ARRANTYTHE
PRODUCTISTOBEDELIVEREDWITHPROOFOFWARRANTYCOVERAGEEGDATEDBILL
OFSALESPECIlCATIONOFDEFECTSTRANSPORTATIONPREPAIDTOTHE#OMPANY
ATTHEADDRESSSHOWNBELOW$ONOTRETURNTHISPRODUCTTOTHERETAILER
4HIS7ARRANTYDOESNOTCOVERPRODUCTPURCHASEDSERVICEDORUSEDOUTSIDE
THE5NITED3TATESOR#ANADA4HIS7ARRANTYISNOTTRANSFERABLEANDDOES
NOTEXTENDTOCOSTSINCURREDFORINSTALLATIONREMOVALORREINSTALLATIONOF
THEPRODUCT4HIS7ARRANTYDOESNOTAPPLYIFINTHE#OMPANYSOPINION
THEPRODUCTHASBEENDAMAGEDTHROUGHALTERATIONIMPROPERINSTALLATION
MISHANDLINGMISUSENEGLECTACCIDENTORTHESIMULTANEOUSUSEOF
DIFFERENTBATTERYTYPESEGALKALINESTANDARDORRECHARGEABLE
4(%%84%.4/&4(%#/-0!.93,)!"),)495.$%24()37!22!.49)3
,)-)4%$4/4(%2%0!)2/22%0,!#%-%.402/6)$%$!"/6%!.$)../
%6%.43(!,,4(%#/-0!.93,)!"),)49%8#%%$4(%052#(!3%02)#%
0!)$"9052#(!3%2&/24(%02/$5#4
4HIS7ARRANTYISINLIEUOFALLOTHEREXPRESSWARRANTIESORLIABILITIES
!.9)-0,)%$7!22!.4)%3).#,5$).'!.9)-0,)%$7!22!.49/&
-%2#(!.4!"),)49/2&)4.%33&/2!0!24)#5,!20520/3%3(!,,
"%,)-)4%$4/$52!4)/./&4()37!22!.49)../#!3%3(!,,
4(%#/-0!.9"%,)!",%&/2!.9#/.3%15%.4)!,/2).#)$%.4!,
$!-!'%37(!43/%6%2.OPERSONORREPRESENTATIVEISAUTHORIZEDTO
ASSUMEFORTHE#OMPANYANYLIABILITYOTHERTHANEXPRESSEDHEREININ
CONNECTIONWITHTHESALEOFTHISPRODUCT
3OMESTATESPROVINCESDONOTALLOWLIMITATIONSONHOWLONGANIMPLIED
WARRANTYLASTSORTHEEXCLUSIONORLIMITATIONOFINCIDENTALORCONSEQUENTIAL
DAMAGESOTHEABOVELIMITATIONSOREXCLUSIONSMAYNOTAPPLYTOYOU
4HIS7ARRANTYGIVESYOUSPECIlCLEGALRIGHTSANDYOUMAYALSOHAVEOTHER
RIGHTSWHICHVARYFROMSTATEPROVINCETOSTATEPROVINCE
U.S.A.: !UDIOVOX%LECTRONICS#ORPORATION-ARCUS"LVD(AUPPAUGE
.EW9ORK
CANADA: !UDIOVOX2ETURN#ENTERCO'ENCO+ENNEDY2OAD5NIT
$OOR-ISSISSAUGA/NTARIO,4!
'ARANTÓA,IMITADA$URANTELA6IDAÂTILDEL0RODUCTO
!UDIOVOX%LECTRONICS#ORPORATIONLAh#OMPA×ÓAvLEGARANTIZAAUSTED
ELCOMPRADORORIGINALDEESTEPRODUCTOQUESIBAJOCONDICIONESYUSO
NORMALESSEENCONTRARAQUEPRESENTADEFECTOSMATERIALESODEMANODE
OBRADURANTESUVIDAÞTILMIENTRASSEADESUPROPIEDADTALESDEFECTOS
SERÉNREPARADOSOREEMPLAZADOSAOPCIØNDELA#OMPA×ÓASINCARGO
alguno por las piezas y labores de reparación. Para obtener los servicios
DEREPARACIØNOREEMPLAZODENTRODELOSTÏRMINOSDEESTA'ARANTÓAEL
PRODUCTOSEENTREGARÉCONPRUEBADECUBIERTADEGARANTÓAPOREJEMPLO
FACTURAFECHADADEVENTAESPECIlCACIØNDELOSDEFECTOSTRANSPORTE
PREPAGADOALA#OMPA×ÓAALADIRECCIØNINDICADAABAJO
%STA'ARANTÓANOCUBREUNPRODUCTOADQUIRIDOMANTENIDOOUTILIZADO
FUERADELOS%STADOS5NIDOSO#ANADÉ%STA'ARANTÓANOESTRANSFERIBLEY
NOINCLUYELOSCOSTOSINCURRIDOSENLAINSTALACIØNREMOCIØNOREINSTALACIØN
DEESTEPRODUCTO%STA'ARANTÓANOAPLICASIESOPINIØNDELA#OMPA×ÓA
QUEESTEPRODUCTOHASUFRIDODA×OSDEBIDOAALTERACIONESINSTALACIØN
INADECUADAABUSOUSOINDEBIDONEGLIGENCIAACCIDENTEOELUSO
SIMULTÉNEODEDIFERENTESTIPOSDEBATERÓASPOREJEMPLOALCALINAS
TÓPICASORECARGABLES%,!,#!.#%$%,!2%30/.3!"),)$!$$%,!
#/-0!»·!"!*/%34!'!2!.4·!%34­,)-)4!$/!,!2%0!2!#)¼.
/%,2%%-0,!:/02/6)34/!22)"!9%..).'Â.#!3/$%"%2­,!
2%30/.3!"),)$!$$%,!#/-0!»·!%8#%$%2%,02%#)/$%#/-02!
0!'!$/0/2%,#/-02!$/2$%%34%02/$5#4/
Esta Garantía reemplaza cualesquiera otras responsabilidades
OGARANTÓASEXPRESAS#5!,%315)%2!'!2!.4·!3)-0,·#)4!3
).#,59%.$/#5!,15)%2'!2!.4·!)-0,·#)4!$%#/-%2#)!"),)$!$
/!$!04!"),)$!$0!2!5.02/0¼3)4/%.0!24)#5,!2%34!2­.
,)-)4!$!3!,!$52!#)¼.$%%34!'!2!.4·!%..).'Â.#!3/
,!#/-0!»·!3%2­2%30/.3!",%0/2$!»/3%-%2'%.4%3/
).#)$%.4!,%3.INGUNAPERSONANIREPRESENTANTEESTÉAUTORIZADOA
ASUMIRANOMBREDELA#OMPA×ÓANINGUNARESPONSABILIDADSALVOLA
EXPRESADAAQUÓENCONEXIØNCONLAVENTADEESTEPRODUCTO!LGUNOS
estados/provincias no permiten limitaciones sobre la duración de una
GARANTÓAIMPLÓCITAOLAEXCLUSIØNOLALIMITACIØNDEDA×OSINCIDENTALESO
EMERGENTESDEMODOQUEESPOSIBLEQUELASLIMITACIONESOEXCLUSIONES
ANTERIORESNOAPLIQUENENSUCASO%STA'ARANTÓALECONlEREDERECHOS
LEGALESESPECÓlCOSSEGÞNELESTADOPROVINCIAPUEDEDISFRUTARADEMÉSDE
otros derechos.
%%55!UDIOVOX%LECTRONICS#ORPORATION-ARCUS"LVD(AUPPAUGE
.EW9ORK
#!.!$­!UDIOVOX2ETURN#ENTERCO'ENCO+ENNEDY2OAD
5NIT$OOR-ISSISSAUGA/NTARIO,4!
Was this manual useful for you? yes no
Thank you for your participation!

* Your assessment is very important for improving the work of artificial intelligence, which forms the content of this project

Download PDF

advertisement