Functions and characteristics
Power Meter functions
Micrologic A/E/P control unit
with COM option (BCM ULP)
and COM Ethernet gateway
In addition to protection functions, Micrologic A/E/P
control units offer all the functions of Power Meter
products as well as operating-assistance for the circuit
breaker.
Micrologic A/E/P measurement functions are made possible by Micrologic
intelligence and the accuracy of the sensors. They are handled by a microprocessor
that operates independent of protection functions.
DB125911.eps
Display ...................................................................
DB417640.eps
Main Menu
Quick view
Metering
Control
Alarms
20.12.2011
12:00:05
S1-1 - Lighting/Level1
Quick view
Open
Auto
Measures
Alarm history
Services
ESC
Control
OK
Ir 000 A
Maintenance
ESC
FDM128 display: navigation.
The FDM121 switchboard display unit can be connected to a COM option (BCM
ULP) using a breaker ULP cord to display all measurements on a screen (1). The
result is a veritable 96 x 96 mm Power Meter.
The FMD121 display unit requires a 24 V DC power supply. The COM option (BCM
ULP) unit is supplied by the same power supply via the breaker ULP cord connecting
it to the FDM121.
(1) See page D-10.
FDM128 display unit (one to eight)
I
I1
310
%
I3 302
A
I2
315
%
IN 23
A
DB414400.eps
DB112131.eps
FDM121 display: navigation.
I1 000 A
1/7
FDM121 display unit (one to one)
A
A
Using an IFE Ethernet interface for LV breakers.
20.12.2011
S1-1 - Lighting/Level1
Quick view
Measures
Alarm history
%
ESC
%
12:00:05
Control
Maintenance
I
U-V
PQS
E
I Current
431
385
426
2
I1
I2
I3
IN
ESC
A
A
A
A
For all FDM, in addition to the information displayed on the Micrologic LCD, the FDM
screen shows demand, power quality and maximeter/minimeter values along with
histories and maintenance indicators.
1/10
Measurements ......................................................
V
4/7
402 V
%
100
120
398 V
%
100
120
401 V
%
100
120
U1
U2
FDM128 display: current.
DB414401.eps
DB112132.eps
FDM121 display: current.
20.12.2011
Quick view
Measures
U3
Alarm history
Control
ESC
12:00:05
S1-1 - Lighting/Level1
I
V
V
V
64
kW
Q
38
kVar
51
kVA
1/10
FDM128 display: voltage.
DB414402.eps
DB112133.eps
PQS
P
S
20.12.2011
Quick view
Alarm history
Control
ESC
12:00:05
I
U-V
PQS
E
PQS
127 kW
13 kVAr
129 kVA
Ptot
Qtot
Stot
Maintenance
ESC
E
Ep
14397
kWh
Eq
8325
kVarh
13035
kVAh
20.12.2011
Quick view
Alarm history
Control
I
U-V
E cumul
EpIn
EpOut
Maintenance
ESC
FDM121 display:
consumption.
Examples of measurement
screens on the FDM121
display unit.
12:00:05
S1-1 - Lighting/Level1
Measures
ESC
1/12
FDM128 display: power.
DB414403.eps
FDM121 display: power.
The Micrologic continuously display the RMS value of the highest current of the three
phases and neutral (Imax). The navigation buttons can be used to scroll through the
main measurements.
In the event of a fault trip, the trip cause is displayed.
The Micrologic A measures phase, neutral, ground fault currents.
The Micrologic E offers voltage, power, Power Factor, measurements in addition to
the measurements provided by Micrologic A.
The Micrologic P offer frequency, cos.M in addition to the measurements provided by
Micrologic E.
Maximeters / minimeters
Every instantaneous measurement provided by Micrologic A or E can be associated
with a maximeter/minimeter. The maximeters for the highest current of the 3 phases
and neutral, the demand current and power can be reset via the FDM display unit or
the communication system.
S1-1 - Lighting/Level1
Measures
DB112134.eps
E
Maintenance
FDM121 display: voltage.
A-18
PQS
406
415
409
V12
V23
V31
ESC
Es
U-V
VL L
VL-L
Instantaneous rms measurements
1/3
FDM128 display:
consumption.
PQS
E
Reset
165 kWh
45 kWh
Energy metering
The Micrologic E/P also measures the energy consumed since the last reset of the
meter. The active energy meter can be reset via Micrologic keypad or the FDM
display unit or the communication system.
Demand and maximum demand values
Micrologic E/P also calculates demand current and power values. These calculations
can be made using a block or sliding interval that can be set from 5 to 60 minutes in
steps of 1 minute. The window can be synchronised with a signal sent via the
communication system. Whatever the calculation method, the calculated values can
be recovered on a PC via Modbus communication.
Ordinary spreadsheet software can be used to provide trend curves and forecasts
based on this data. They will provide a basis for load shedding and reconnection
operations used to adjust consumption to the subscribed power.
PB106351A13.eps
PB111801-32_r.eps
PB103360_r.eps
PB104842_24.eps
Micrologic A/E/P integrated Power Meter functions
Type
Display
A/E
P
Micrologic
LCD
FDM display
A/E
P
b
-
Display of protection settings
Pick-ups (A) and
delays
All settings can be displayed
Ir, tr, Isd, tsd, Ii, Ig, tg
Measurements
Instantaneous rms measurements
Currents (A)
Phases and neutral
I1, I2, I3, IN
A/E
P
b
b
Average of phases
Iavg = (I1 + I2 + I3) / 3
A/E
P
-
b
A/E
P
b
b
Highest current of the 3 phases and Imax of I1, I2, I3, IN
neutral
Ground fault (Micrologic 6)
% Ig (pick-up setting)
Current unbalance between phases % Iavg
Voltages (V)
A/E
P
b
b
- /E
P
-
b
Phase-to-phase
V12, V23, V31
- /E
P
b
b
Phase-to-neutral
V1N, V2N, V3N
- /E
P
b
b
Average of phase-to-phase voltages Vavg = (V12 + V23 + V31) / 3
- /E
P
-
b
Average of phase-to-neutral
voltages
- /E
P
-
b
Vavg = (V1N + V2N + V3N) / 3
Ph-Ph and Ph-N voltage unbalance % Vavg and % Vavg
- /E
P
-
b
Phase sequence
-/-
P
b
b (3)
1-2-3, 1-3-2
Frequency (Hz)
Power system
f
-/-
P
b
b
Power
Active (kW)
P, total
- /E
P
b
b
P, per phase
- /E
P
b (2)
b
Reactive (kVAR)
Q, total
- /E
P
b
b
Q, per phase
-/-
P
b
b
Apparent (kVA)
S, total
- /E
P
b
b
S, per phase
-/-
P
b
b
Power Factor
PF, total
- /E
P
b
b
Cos.M
PF, per phase
Cos.M, total
-/-
P
b
b
Cos.M, per phase
-/-
P
b
b
-/-
P
b
b
Maximeters / minimeters
Associated with instantaneous rms
measurements
Reset via FDM display unit and
Micrologic keypad
A/E
P
b
b
Active (kW), reactive (kVARh),
apparent (kVAh)
Total since last reset
- /E
P
b
b
Present value on the selected
window
- /E
P
b
b
Maximum demand since last
reset
- /E
P
b (2)
b
Present value on the selected
window
- /E
P
b
b
Maximum demand since last
reset
- /E
P
b (2)
b
Adjustable from 5 to 60 minutes
in 1 minute steps (1)
- /E
P
-
-
Energy metering
Energy
Demand and maximum demand values
Demand current (A)
Demand power
Calculation window
Phases and neutral
Active (kWh), reactive (kVAR),
apparent (kVA)
6OLGLQJ¿[HGRUFRPV\QFKURQLVHG
(1) Available via the communication system only.
(2) Available for Micrologic P only.
(3) FDM121 only.
A-19
Functions and characteristics
Operating-assistance functions
Micrologic A/E/P control unit
with COM option (BCM ULP)
Histories ................................................................
b Trip indications in clear text in a number of user-selectable languages.
b Time-stamping: date and time of trip.
Maintenance indicators ........................................
Micrologic control unit have indicators for, among others, the number of operating
F\FOHVFRQWDFWZHDU3ORDGSUR¿OHDQGRSHUDWLQJWLPHVRSHUDWLQJKRXUVFRXQWHURI
the Masterpact circuit breaker.
It is possible to assign an alarm to the operating cycle counter to plan maintenance.
The various indicators can be used together with the trip histories to analyse the
level of stresses the device has been subjected to.
Management of installed devices
(DFKFLUFXLWEUHDNHUHTXLSSHGZLWKD&20RSWLRQ%&08/3FDQEHLGHQWL¿HGYLD
the communication system:
b serial number
b ¿UPZDUHYHUVLRQ
b hardware version
b device name assigned by the user.
This information together with the previously described indications provides a clear
view of the installed devices.
Micrologic A/E/P operating assistance functions
Type
Display
A/E
P
Micrologic
LCD
FDM121
display
- /E
P
b
b
Operating assistance
Trip history
Trips
Cause of tripping
Ir, Isd, Ii, Ig, I'n
Maintenance indicators
Counter
Indicator
Mechanical cycles
Assignable to an alarm
A/E
P
-
b
Electrical cycles
Assignable to an alarm
A/E
P
-
b
Hours
Total operating time (hours) (1)
A/E
P
-
-
Contact wear
%
-/-
P
-
b
A /E
P
-
b
/RDGSUR¿OH Hours at different load levels % of hours in four current ranges: 0-49 % In, 50-79 %
In, 80-89 % In and u 90 % In
(1) Also available via the communication system.
Additional technical characteristics
Contact wear
Each time Compact opens, the Micrologic P trip unit measures the interrupted current and increments the contact-wear indicator as a
function of the interrupted current, according to test results stored in memory. Breaking under normal load conditions results in a very
slight increment. The indicator value may be read on the FDM121 display. It provides an estimation of contact wear calculated on the
basis of the cumulative forces affecting the circuit breaker. When the indicator reaches 100 %, it is advised to inspect the circuit breaker to
ensure the availability of the protected equipment.
&LUFXLWEUHDNHUORDGSUR¿OH
0LFURORJLF$(3FDOFXODWHVWKHORDGSUR¿OHRIWKHFLUFXLWEUHDNHUSURWHFWLQJDORDGFLUFXLW7KHSUR¿OHLQGLFDWHVWKHSHUFHQWDJHRIWKHWRWDO
operating time at four current levels (% of breaker In):
b 0 to 49 % In
b 50 to 79 % In
b 80 to 89 % In
b u 90 % In.
This information can be used to optimise use of the protected equipment or to plan ahead for extensions.
A-20
Switchboard-display functions
Micrologic A/E/P control unit
with COM option (BCM ULP)
Micrologic measurement capabilities come into full play
with the FDM121 switchboard display. It connects to
COM option (BCM ULP) via a breaker ULP cord and
displays Micrologic information. The result is a true
integrated unit combining a circuit breaker and a Power
Meter. Additional operating assistance functions can
also be displayed.
FDM121 switchboard display
An FDM121 switchboard display unit can be connected to a ULP IMU using a
prefabricated cord to display all measurements, alarms, histories and event tables,
maintenance indicators, management of installed devices on a screen. The result is
a veritable 96 x 96 mm Power Meter.
The FMD121 display unit requires a 24 V DC power supply.
The FDM121 is a switchboard display unit that can be integrated in the Compact
NSX100 to 630 A, Powerpact H/J/L/P/R, Compact NS or Masterpact systems. It
uses the sensors and processing capacity of the Micrologic trip unit. It is easy to use
and requires no special software or settings. It is immediately operational when
connected to the Compact NSX by a simple cord.
Also, it provides monitoring and control with the use of the I/O application module,
the motor mecanism module, or the Breaker Status module.
The FDM121 is a large display, but requires very little depth. The anti-glare graphic
screen is backlit for very easy reading even under poor ambient lighting and at sharp
angles.
Display of Micrologic measurements and alarms
The FDM121 is intended to display Micrologic 5 / 6 measurements, alarms and
operating information. It cannot be used to modify the protection settings.
0HDVXUHPHQWVPD\EHHDVLO\DFFHVVHGYLDDPHQX$OOXVHUGH¿QHGDODUPVDUH
automatically displayed. The display mode depends on the priority level selected
during alarm set-up:
b high priority: a pop-up window displays the time-stamped description of the alarm
DQGWKHRUDQJH/('ÀDVKHV
b medium priority: the orange "Alarm" LED goes steady on
b low priority: no display on the screen.
All faults resulting in a trip automatically produce a high-priority alarm, without any
special settings required. In all cases, the alarm history is updated. Micrologic saves
the information in its non-volatile memory in the event of an FDM121 power failure.
When the circuit breaker is equipped with the Breaker Status Module, the FDM121
display can also be used to view circuit breaker status conditions:
b O/F: ON/OFF
b SD: trip indication
b SDE: Fault-trip indication (overload, short-circuit, ground fault).
When the circuit breaker system is equipped with the I/O application module, the
FDM121 can monitor and control:
b craddle management
b circuit breaker operation
b light and load control
b custom application.
When the circuit breaker system is equipped with the motor mechanism module, the
FDM121 offers remote closing and opening control.
PB103807-32.eps
PB103582-32.eps
Status indications and remote control
Main characteristics
Surface mount accessory.
PB103581-31.eps
FDM121 display.
b 96 x 96 x 30 mm screen requiring 10 mm behind the door (or 20 mm when the
24 V power supply connector is used).
b White backlighting.
b Wide viewing angle: vertical ±60°, horizontal ±30°.
b High resolution: excellent reading of graphic symbols.
b $ODUP/('ÀDVKLQJRUDQJHIRUDODUPSLFNXSVWHDG\RUDQJHDIWHURSHUDWRUUHVHWLI
alarm condition persists.
b Operating temperature range -10 °C to +55 °C.
b CE / UL / CSA marking (pending).
b 24 V DC power supply, with tolerances 24 V -20 % (19.2 V) to 24 V +10 % (26.4 V).
When the FDM121 is connected to the communication network, the 24 V DC can be
supplied by the communication system wiring system.
b Consumption 40 mA.
Mounting
The FDM121 is easily installed in a switchboard.
b Standard door cut-out 92 x 92 mm.
b Attached using clips.
To avoid a cut-out in the door, an accessory is available for surface mounting by
drilling only two 22 mm diameter holes.
The FDM121 degree of protection is IP54 in front. IP54 is maintained after
switchboard mounting by using the supplied gasket during installation.
Connection
Connection with FDM121 display unit.
The FDM121 is equipped with:
b a 24 V DC terminal block:
v plug-in type with 2 wire inputs per point for easy daisy-chaining
v power supply range of 24 V DC -20 % (19.2 V) to 24 V DC +10 % (26.4 V).
A 24 V DC type auxiliary power supply must be connected to a single point on the
ULP system. The FDM121 display unit has a 2-point screw connector on the rear
panel of the module for this purpose. The ULP module to which the auxiliary power
supply is connected distributes the supply via the ULP cable to all the ULP modules
connected to the system and therefore also to Micrologic.
A-21
Functions and characteristics
Switchboard-display functions
310
A
I2
%
I3 302
A
%
IN 23
2 Down
A
4 Up
A
5 Context
%
6 Alarm LED
2 3 4
5 6
Produit Id
Micrologic 5.3A
Serial number:
Part number:
P07451
Metering
PQS
E
1.02
ESC
3URGXFWLGHQWL¿FDWLRQ
EpIN
5111947
kWh
EpOut
12345678
kWh
F - PF - cos Φ
OK
Alarms
Metering
Services.
Control
Load Profile
2/3
0..49%
610 H
50...79%
15 H
80..89%
360 H
90..100%
ESC
Metering: meter.
Quick view
Metering: sub-menu.
DB125912.eps
1/3
Main menu
When powered up, the FDM121 screen automatically displays the ON/OFF status of
the device.
U-V
ESC
NonResettableEnergy
Screens
I
LU432091
Firmware:
Navigation
Five buttons are used for intuitive and fast navigation.
The “Context” button may be used to select the type of display (digital, bargraph,
analogue).
The user can select the display language (Chinese, English, French, German,
Italian, Portuguese, Spanish, etc.).
DB112138.eps
1
When not in use, the screen is not backlit. Backlighting can be activated by pressing
one of the buttons. It goes off after 3 minutes.
Fast access to essential information
b ³4XLFNYLHZ´SURYLGHVDFFHVVWR¿YHVFUHHQVWKDWGLVSOD\DVXPPDU\RIHVVHQWLDO
operating information (I, U, f, P, E, THD, circuit breaker On / Off).
Access to detailed information
b "Metering" can be used to display the measurement data (I, U-V, f, P, Q, S, E,
THD, PF) with the corresponding min/max values.
b Alarms displays active alarms and the alarm history.
b Services provides access to the operation counters, energy and maximeter reset
b IXQFWLRQPDLQWHQDQFHLQGLFDWRUVLGHQWL¿FDWLRQRIPRGXOHVFRQQHFWHGWRWKH
internal bus and FDM121 internal settings (language, contrast, etc.).
3H
ESC
Services.
DB416695.eps
Communication components and FDM121 connections
Ethernet
Modbus-SL
External power supply
24 V DC
External power supply
24 V DC
A
- +
DB112136.eps
315
3 OK
%
ESC
DB112140.eps
b two RJ45 jacks.
The Micrologic connects to the internal communication terminal block on the
Masterpact via the breaker ULP cord. Connection to one of the RJ45 connectors on
the FDM121 automatically establishes communication between the Micrologic and
the FDM121 and supplies power to the Micrologic measurement functions.
:KHQWKHVHFRQGFRQQHFWRULVQRWXVHGLWPXVWEH¿WWHGZLWKDOLQHWHUPLQDWRU
1 Escape
I
I1
- +
DB112135.eps
Micrologic A/E/P control unit
with COM option (BCM ULP)
B
D0 = A’ / Rx-, A / TxD1 = B’ / Rx+, B / Tx+
24VDC
ETH1
D
IFM
ETH2
D
IFE
OR
E
F
C
Red Black
White Blue
E1 E2 E3 E4 E5 E6
E1 E2 E3 E4 E5 E6
B’ / Rx+ D1
B / Tx+ D1
A’ / Rx- D0
0V
A-22
A Modbus network
B Ethernet network
C Breaker ULP cord
White Blue
Red Black
A / Tx- D0
Connections
b Compact NS is connected to the ULP
devices (FDM121 display, IFM, IFE or
I/O application module) unit via the
breaker ULP cord.
v cord available in three lengths:
0.35 m, 1.3 m and 3 m.
v lengths up to 10 m possible using
extensions.
F
C
24 V
B’ / Rx+ D1
B / Tx+ D1
A’ / Rx- D0
0V
A / Tx- D0
24 V
Customer terminal block
E
Customer terminal block
D FDM121 display
E ULP termination
F ULP cable
Switchboard-display functions
Micrologic A/E/P control unit
with COM Ethernet gateway
Micrologic measurement capabilities come into full play
with the FDM128 switchboard display. It connects to
Ethernet communication via RJ45 port and displays
Micrologic information. The result is a true integrated
unit combining a circuit breaker and a Power Meter.
Additional operating assistance functions can also be
displayed.
FDM128 switchboard display
The FDM128 switchboard display unit can be connected to a Micrologic COM option
(BCM ULP via IFE). It uses the sensors and processing capacity of the Micrologic
control unit. It is easy to use and requires no special software or settings.
The FDM128 is a large display, but requires very little depth. The anti-glare graphic
screen is backlit for very easy reading even under poor ambient lighting and at sharp
angles.
Display of Micrologic measurements and trips
The FDM128 is intended to display Micrologic A/E/P measurements, trips and
operating information. It cannot be used to modify the protection settings.
Measurements may be easily accessed via a menu.
Trips are automatically displayed.
A pop-up window displays the time-stamped description of the trip.
Status indications
When the circuit breaker is equipped with the COM option (BCM ULP) (including its
set of sensors) the FDM128 display can also be used to view circuit breaker status
conditions:
b O/F: ON/OFF
b SDE: Fault-trip indication (overload, short-circuit, ground fault)
b PF: ready to close
b CH: charged (spring loaded).
b CE, CD, CT cradle management with I/O application module.
Remote control
Main characteristics
PB111802-32_r.eps
PB111801-32_r.eps
When the circuit breaker is equipped with the COM option (BCM ULP) (including its
kit for connection to XF and MX1 communication voltage releases), the FDM128
display can also be used to control (open/close) the circuit breaker.
Two operating mode are available:
b local mode : open/close commands are enabled from FDM128 while disable from
communication network
b remote mode : open/close commands are disabled from FDM128 while, enabled
from communication network.
FDM128 display.
Surface mount accessory.
b
b
b
b
b
b
b
b
115.2 x 86.4 mm with 5.7" QVGA display 320 x 240 pixels.
Color TFT LCD, LED backlight.
Wide viewing angle: vertical ±80°, horizontal ±70°.
High resolution: excellent reading of graphic symbols.
Operating temperature range -10 °C to +55 °C.
CE / UL / CSA marking (pending).
24 V DC power supply, with tolerances 24 V (limit 20.4 - 28.8 V DC).
Consumption y 6.8 W.
Mounting
PB111805-32_r.eps
The FDM128 is easily installed in a switchboard.
b Standard door hole Ø 22 mm.
The FDM128 degree of protection is IP65 in front and IP54.
Connection
The FDM128 is equipped with:
b a 24 V DC terminal block:
v power supply range of 24 V DC (limit 20.4 - 28.8 V DC). The FDM128 display unit
has a 2-point screw connector on the rear panel of the module for this purpose.
b One RJ45 Ethernet jacks.
The Micrologic connects to the internal communication terminal block on the
Masterpact via the breaker ULP cord and Ethernet connection through IFE.
A-23
Functions and characteristics
Switchboard-display functions
20.12.2011
12:00:05
S1-1 - Lighting/Level1
Quick view
Measures
Alarm history
Control
Product ID
Information
Reset all
Counter
Operation
xxx
Trip SDE
xxx
Close command
xxx
Navigation
20.12.2011
12:00:05
S1-1 - Lighting/Level1
Quick view
Energy
Measures
Ep
Eq
Es
Alarm history
Control
Maintenance
ESC
DB414407.eps
DB414405.eps
Micrologic A/E/P control unit
with COM Ethernet gateway
11 318 kWh
257 kVArh
13 815 kVAh
Maintenance
ESC
3/3
6/7
Touch screen is used for intuitive and fast navigation.
The user can select the display language (Chinese, English, French, German,
Italian, Portuguese, Spanish, etc.).
Screens
Main menu
DB414408.eps
3URGXFWLGHQWL¿FDWLRQ
20.12.2011
Metering: meter.
S1-1 - Lighting/Level1
Quick view
Measures
Alarm history
Control
Maintenance
ESC
Quick view
Alarms
Metering
Maintenance.
12:00:05
Product ID
Information
Reset all
Load profile
0 to 49%
50 to 79%
80 to 89%
Control
90 to 100%
2/3
When not in use, the screen is automatically shifted to low back-lighting.
Services.
Fast access to essential information
b ³4XLFNYLHZ´SURYLGHVDFFHVVWR¿YHVFUHHQVWKDWGLVSOD\DVXPPDU\RIHVVHQWLDO
operating information (I, U, f, P, E, THD, circuit breaker On / Off).
Access to detailed information
b "Metering" can be used to display the measurement data (I, U-V, f, P, Q, S, E,
THD, PF) with the corresponding min/max values.
b Alarms displays the trip history.
b Services provides access to the operation counters, energy and maximeter reset
IXQFWLRQPDLQWHQDQFHLQGLFDWRUVLGHQWL¿FDWLRQRIPRGXOHVFRQQHFWHGWRWKHLQWHUQDO
bus and FDM128 internal settings (language, contrast, etc.).
A-24
Protection of distribution
systems
Micrologic control units
for Compact NS630b to 3200
DB128050.eps
External sensors
06133779A.eps
External sensor (CT).
External sensor for earth-fault and neutral protection
The sensors, used with the 3P circuit breakers, are installed on the neutral conductor for:
b neutral protection (with Micrologic P)
b residual type earth-fault protection (with Micrologic A, E and P).
The rating of the sensor (CT) must be compatible with the rating of the circuit breaker:
b NS630b to 1600 A - 400/1600 CT
b NS1600b to 3200 A - 1000/4000 CT.
Rectangular sensor for earth-leakage protection
The sensor is installed around the busbars (phases + neutral) to detect the zerophase sequence current required for the earth-leakage protection. Rectangular
sensors are available in two sizes.
Inside dimensions (mm)
b 280 x 115 up to 1600 A for Compact NS630b to 1600 A
b 470 x 160 up to 3200 A for Compact NS1600b to 3200 A.
External sensor for source ground return protection
The sensor is installed around the connection of the transformer neutral point to earth
and connects to the Micrologic 6.0 control unit via an MDGF module to provide the
source ground return (SGR) protection.
External sensor for source ground return protection.
Long-time rating plug
PB100773-32.eps
Four interchangeable plugs may be used to limit the long-time threshold setting
range for higher accuracy.
The time delay settings indicated on the plugs are for an overload of 6 Ir (for further
details, see the characteristics on page A-13 and page A-17).
As standard, control units are equipped with the 0.4 to 1 plug.
Setting ranges
Long-time rating plug.
Standard
Ir = In x… 0.4
0.5
0.6
0.7
0.8
0.9
0.95 0.98 1
Low-setting option Ir = In x… 0.4
0.45 0.50 0.55 0.60 0.65 0.70 0.75 0.8
High-setting option Ir = In x… 0.80 0.82 0.85 0.88 0.90 0.92 0.95 0.98 1
Off plug
No long-time protection (Ir = In for Isd setting)
Important: long-time rating plugs must always be removed before carrying out insulation or
dielectric withstand tests.
PB101026_SE-32A.eps
External 24 V DC power-supply module
External 24 V DC power power supply module.
The external power-supply module makes it possible to use the display even if the
circuit breaker is open or not supplied (for the exact conditions of use, see the
“electrical diagrams” part of this catalogue).
This module powers both the control unit (100 mA) and M6C programmable contacts
(100 mA).
If the COM communication option is used, the communication bus requires 24 V DC
power supply. With the Micrologic A/E control unit, this module makes it possible to
display currents of less than 20 % of In.
With the Micrologic P, it can be used to display fault currents after tripping.
Characteristics
b Power supply:
v 110/130, 200/240, 380/415 V AC (+10 % -15 %)
v 24/30, 48/60, 100/125 V DC (+20 % -20 %).
b Output voltage: 24 V DC ±5 %, 1 A.
b Ripple < 1 %.
b Dielectric withstand : 3.5 kV rms between input/output, for 1 minute.
b Overvoltage category: as per IEC 60947-1 cat. 4.
A-25
Functions and characteristics
Protection of distribution
systems
Micrologic control units
for Compact NS630b to 3200
PB100771-24.eps
Battery module
The battery module maintains display operation and communication with the
supervisor if the power supply to the Micrologic control unit is interrupted.
It is installed in series between the Micrologic control unit and the AD module.
Characteristics
b Battery run-time: 4 hours (approximately).
b Mounted on vertical backplate or symmetrical rail.
Battery module.
M6C programmable contacts
PB100781-32_SE.eps
These contacts are optional equipment for the Micrologic P control units.
They are described with the indication contacts for the circuit breakers.
Micrologic
Type P
Characteristics
Minimum load
Breaking capacity (A)
p.f.: 0.7
M6C.
M6C
V AC 240
380
V DC 24
48
125
250
100 mA/24 V
5
3
1.8
1.5
0.4
0.15
M6C: external 24 V DC power supply required (consumption 100 mA).
PB100775-32.eps
Spare parts
Lead-seal covers
A lead-seal cover controls access to the adjustment dials.
When the cover is closed:
b it is impossible to modify settings using the keypad unless the settings lockout pin
on the cover is removed
b the test connector remains accessible
b the test button for the earth-fault and earth-leakage protection function remains
accessible.
Lead-seal cover.
Characteristics
b Transparent cover for basic Micrologic and Micrologic A, E control units.
b Non-transparent cover for Micrologic P control units.
Spare battery
A battery supplies power to the LEDs identifying the tripping causes. Battery service
life is approximately ten years.
A test button on the front of the control unit is used to check the battery condition.
The battery may be replaced on site when discharged.
A-26
PB100837-68.eps
Test equipment
Hand-held test kit
The hand-held mini test kit may be used to:
b check operation of the control unit and the tripping and pole-opening system by
sending a signal simulating a short-circuit
b supply power to the control units for settings via the keypad when the circuit
breaker is open (Micrologic P control units).
Power source: standard LR6-AA battery.
Full function test kit
The test kit can be used alone or with a supporting personal computer.
The test kit without PC may be used to check:
b the mechanical operation of the circuit breaker
b the electrical continuity of the connection between the circuit breaker and
the control unit
b operation of the control unit:
v display of settings
v automatic and manual tests on protection functions
v test on the zone-selective interlocking (ZSI) function
v inhibition of the earth-fault protection
v inhibition of the thermal memory.
The test kit with PC offers in addition:
b the test report (software available on request).
Portable test kit.
A-27
Enerlin’X communication system
Functions and characteristics
Products overview
Enerlin'X communication system provides access
to status, electrical values and devices control using
Ethernet and Modbus SL communication protocols.
Ethernet has become the universal link between switchboards, computers and
communication devices inside the building. The large amount of information which
can be transferred makes the connection of Enerlin'X digital system to hosted web
services of Schneider Electric a reality. More advantages are offered to integrators
WKDQNVWRFRQ¿JXUDWLRQZHESDJHVDYDLODEOHUHPRWHO\RURQWKHORFDO(WKHUQHWQHWZRUN
Modbus SL is the most widely used communication protocol in industrial networks.
It operates in master-slave mode. The devices (slaves) communicate one after
the other with a gateway (master).
H
G
D
G
G
G
H
C
F
B
A
E
4
E
F
Ethernet
Modbus SL
ULP
A-28
ULP is a fast communication link dedicated
to circuit breaker monitoring and control.
Enerlin'X communication devices and displays
Name
Function
Port
(to device)
Bin.
Input
Analog. Bin.
Input
Output
Cial. Ref.
(to server)
Com'X 200
Modbus
Energy Server
Master
with Ethernet
(1)
Gateway function
Ethernet cable 6
+ WiFi
2
-
EBX200
FDM128
Ethernet LCD
colour touch screen
Ethernet
-
-
-
LV434128
FDM121
LCD display for
circuit breaker
ULP
-
-
-
-
TRV00121
Ethernet interface
Modbus
Ethernet
Master & ULP
-
-
-
LV434011
A
B
C
IFE
interface +
gateway
(2) & Gateway
IFE
interface
Ethernet interface
for circuit breakers
ULP
Ethernet
-
-
-
LV434010
Ethernet interface
with Input/Output
functions &
Gateway
Modbus
Master
Ethernet
14
2
7
A9XMEA08
E
Acti 9
Smartlink
Ethernet
F
Acti 9
Smartlink
Modbus
Modbus interface
with Input/Output
functions
-
Modbus Slave
22
-
11
A9XMSB11
IFM
Modbus interface
for circuit breaker
ULP
Modbus Slave
-
-
-
TRV00210
I/O
Input/Output
application module
for circuit breaker
ULP
ULP
6
-
3
LV434063
D
G
H
(1) Gateway: transfers data from a network to another (ie.: Modbus to Ethernet).
(2) Interface: transfers data from an equipment to a network.(ie.: ULP to Modbus).
Commissioning / maintenance tools
Web pages embedded into Com’X 200 and
Acti 9 Smartlink Ethernet gateways
Access with a standard PC and common browser:
b commissioning,
b communication diagnosis,
b functional tests…
Electrical Asset Manager
Plug and play commissioning tools give a real peace of mind
to panel builders as their panels can be functionally checked
before delivery.
Loaded into a standard PC Error free commissioning. Time saving, easier
management and maintenance thanks to the advanced services:
b project management,
b FRQ¿JXUDWLRQRIFRQWUROOHUVJDWHZD\V«
b test of communication networks, diagnostic report…
A-29
Functions and characteristics
Communication
Communication wiring system
PB113438.eps
Wiring system ULP
The wiring system is designed for low-voltage power switchboards. Installation
requires no tools or special skills.
The prefabricated wiring ensures both data transmission (Modbus protocol)
and 24 V DC power distribution for the communications modules on the Micrologic
control units.
G
O
G
A
E
A
B
F
C
K
J
Q
H
I
P
L
M
K
P
L N
D
A BCM ULP: Breaker Communication Module with ULP port
B Micrologic control unit
C Breaker ULP cord
0.35 m
1.3 m
3m
LV434195
LV434196
LV434197
LV434010 or LV434011
L IFE: Ethernet interface
M External 24 V DC power supply module
N IFM: Modbus-SL interface
O Com'X 200
P ULP cable
0.3 m
0.6 m
1m
2m
3m
5m
TRV00803
TRV00806
TRV00810
TRV00820
TRV00830
TRV00850
Q NSX cord
0.35 m
1.3 m
3m
LV434200
LV434201
LV434202
D Modbus cable
E Ethernet cable
F FDM121: Front Display Module
TRV00121
G FDM128: Front Display Module
LV434128
H Smart Link
A9XMSB11
I Acti9
J ULP line terminators
TRV00880
K I/O (Input/Output) application module
LV434063
A-30
TRV00210
Ethernet
Modbus
ULP
24 V DC
Overview of functions
PB104863.eps
Four functional levels
The Compact can be integrated into a Modbus communication environment. There
are four possible functional levels that can be combined.
Switchdisconnectors
Circuit breaker
b
b
b
b
b
S
S
S
S
S
S
A
A
A
A
A
A
E
E
E
E
E
E
P
P
P
P
P
P
b
b
S
S
A
A
E
E
P
P
A
E
E
E
E
E
P
P
P
P
P
Status indications
ON/OFF (O/F)
Spring charged CH
Ready to close
Fault-trip SDE
Connected / disconnected / test position
CE/CD/CT (CCM only)
Controls
MX1 open
XF close
Measurements
Instantaneous measurement information
Averaged measurement information
Maximeter / minimeter
Energy metering
Demand for current and power
Power quality
b
b
b
b
b
b
A
Operating assistance
Protection and alarm settings
Histories
Time stamped event tables
Maintenance indicators
E
A
E
P
P
P
P
Communication Modbus bus
S: Micrologic without measurement.
A: Micrologic with ammeter
E: Micrologic “Energy”
P: Micrologic “Power”
Note: see the description of the Micrologic control units for
further details on protection and alarms, measurements,
waveform capture, histories, logs and maintenance indicators.
The Modbus RS 485 (RTU protocol) system is an open bus on which communicating
Modbus devices (Compact NS with Modbus COM, Power Meter PM700, PM800,
Sepam, Vigilohm, Compact NSX, etc.) are installed. All types of PLCs and
microcomputers may be connected to the bus.
Addresses
The Modbus communication parameters (address, baud rate, parity) are entered
using the keypad on the Micrologic A, E, P. For a switch-disconnector, it is necessary
to use the RSU (Remote Setting Utility) Micrologic utility.
Modbus addresses
@xx
@xx + 50
@xx + 200
@xx + 100
Circuit breaker manager
Chassis manager
Measurement manager
Protection manager
(1 to 47)
(51 to 97)
(201 to 247)
(101 to 147)
The manager addresses are automatically derived from the circuit breaker address
@xx entered via the Micrologic control unit (the default address is 47).
Number of devices
The maximum number of devices that may be connected to the Modbus bus
depends on the type of device (Compact with Modbus COM, PM700, PM800,
Sepam, Vigilohm, Compact NSX, etc.), the baud rate (19200 is recommended),
the volume of data exchanged and the desired response time. The RS 485 physical
layer offers up to 32 connection points on the bus (1 master, 31 slaves).
$¿[HGGHYLFHUHTXLUHVRQO\RQHFRQQHFWLRQSRLQWFRPPXQLFDWLRQPRGXOHRQWKH
device). A drawout device uses two connection points (communication modules on
the device and on the chassis).
7KHQXPEHUPXVWQHYHUH[FHHG¿[HGGHYLFHVRUGUDZRXWGHYLFHV.
Length of bus
The maximum recommended length for the Modbus bus is 1200 meters.
Bus power source
A 24 V DC power supply is required (less than 20 % ripple, insulation class II).
A-31
Functions and characteristics
Communication
COM option in Compact
$OOWKH&RPSDFWGHYLFHVFDQEH¿WWHGZLWKWKH
communication function thanks to the COM option.
Compact uses the Ethernet or Modbus
communications protocol for full compatibility with the
supervision management systems.
Eco COM is limited to the transmission of metering
data. It is not used to communicate status and controls.
)RU¿[HGGHYLFHVWKH&20RSWLRQLVPDGHXSRI
b a BCM ULP module, installed behind the Micrologic control unit and supplied with
its set of sensors (OF, SDE, PF and CH micro switches) its kit for connection to XF
and MX1 communicating voltage releases and its COM terminal block (inputs E1 to
E6)
b IFM, this module required for connection to the network, contains the Modbus
address (1 to 99) declared by the user via the two dials in front. It automatically
adapts (baud rate, parity) to the Modbus network in which it is installed.
Or
b IFE, the Ethernet interface for LV circuit breaker enables an intelligent modular
unit (IMU), for example a Compact NS circuit breaker to be connected to an Ethernet
network. Each circuit breaker has its own IFE and a corresponding IP address.
PB106674-20.eps
)RUGUDZRXWGHYLFHVWKH&20RSWLRQLVPDGHXSRI
b a BCM ULP module, installed behind the Micrologic control unit and supplied with
its set of sensors (OF, SDE, PF and CH micro switches) its kit for connection to XF
and MX1 communicating voltage releases and its COM terminal block (inputs E1 to
E6).
b IFM, this module required for connection to the network, contains the Modbus
address (1 to 99) declared by the user via the two dials in front. It automatically
adapts (baud rate, parity) to the Modbus network in which it is installed.
BCM ULP.
Or
b IFE, the Ethernet interface for LV circuit breaker enables an intelligent modular
unit (IMU), for example a Compact NS circuit breaker to be connected to an Ethernet
network. Each circuit breaker has its own IFE and a corresponding IP address.
b I/O (Input/Output) application module for LV breaker, the I/O application module is
delivered with withdrawable devices ordered with the COM option, for cradle
management. It must be installed on a DIN rail near the device. It must be connected
to the ULP system and to the position contacts (CD, CT, CE) that transmit the
position of the device in the cradle.
DB416829.eps
BCM ULP module
This module is independent of the control unit. It receives and transmits information
on the communication network. An infra-red link transmits data between the control
unit and the communication module.
Consumption: 30 mA, 24 V.
XF and MX1 communicating voltage releases
The XF and MX1 communicating voltage releases are equipped for connection to
the “device” communication module.
The remote-tripping function (MX2 or MN) are independent of the communication
option. They are not equipped for connection to the “device” communication module.
I/O application module.
A-32
Communication architecture
Electrical operated
)L[HGGHYLFH
Drawout devices
C
24VD
Modbus
Ethernet
DB417123.eps
Modbus
DB417122.eps
DB417121.eps
Ethernet
C
24VD
24VD
C
ETH2
ETH2
ETH2
2
ETH
ETH1
1
ETH1
ETH
I
Y.ZZ
(factory
ETH1
2
ETH
1
ETH
J
Y.ZZ
CT
00/A
10-1
1 LK/
ETH
CT
00/A
10-1
2 LK/
us
ETH
ule Stat
Mod
us
k Stat
Networ
(factory
set)
XX.Y
IFE
Mod
bus-SL
11
LV4340
CT
00/A
10-1
1 LK/
ETH
CT
00/A
10-1
2 LK/
us
ETH
ule Stat
Mod
us
k Stat
Networ
IFE
Mod
(factory
set)
bus-SL
CT
00/A
10-1
1 LK/
ETH
CT
00/A
10-1
2 LK/
us
ETH
ule Stat
Mod
us
k Stat
Networ
11
LV4340
11
LV4340
or
or
Y.ZZ
IFE_
XX.Y
IFE_
Mod
J
I
set)
XX.Y
bus-SL
2
ETH
1
ETH
J
I
IFE_
IFE
Modbus
Ethernet
or
ULP system
I6
C
I5
I4
C
I3
I2
C
I1
C
I6
C
I5
I4
C
I3
I2
C
I1
I6
C
I6
C
I5
I5
C
I2
I4
C
I4
I3
C
I2
I3
I1
I1
+
C
24VD
+
C
24VD
A1
A1
O1
O2
O3
I1
O1
O2
O3
I1
I2
I3
I4
I5
I6
APP
I2
I3
I4
I5
I6
APP
dule
dule
IO Mo
IO Mo
H
T1
O3
33
O2
23
O1
A1
T2
T1
O3
H
34
24
14
33
O2
23
O1
A1
T2
34
24
14
13
13
F
G
G
F
F
B
E
E
C
C
A
B
B
A
0DQXDOO\RSHUDWHG¿[HGGHYLFH
Manually operated withdrawable device
A
B
C
D
F
G
H
I
J
BCM ULP
OF, SDE ... microswitches
COM terminal block (E1 to E6)
MX1 and XF communicating voltage
releases
E CE, CD and CT contacts
A
D
Electrically operated withdrawable device
Breaker ULP cord
I/O application module
ULP cable
IFE module
IFM module
A-33
Functions and characteristics
IFE Ethernet interface
PB112059-55.eps
,)(LQWHUIDFH,)(LQWHUIDFHJDWHZD\GHVFULSWLRQ
Introduction
The IFE interface and IFE interface + gateway enable LV circuit breakers
as Masterpact NT/NW, Compact NSX or Powerpact to be connected to an Ethernet
network.
,)(LQWHUIDFHUHI/9
Provides an Ethernet access to a single LV circuit breaker.
Function
Interface - one circuit breaker is connected to the IFE interface via its ULP port.
,)(LQWHUIDFHJDWHZD\UHI/9
Provides an Ethernet access to one or several LV circuit breakers.
Functions
b Interface - one circuit breaker is connected to the IFE interface via its ULP port.
b Gateway: several circuit breakers on a Modbus network are connected via
the IFE interface + gateway master Modbus port.
IFE interface, ref.: LV434010
,)(LQWHUIDFH,)(LQWHUIDFHJDWHZD\IHDWXUHV
DB416830.eps
b Dual 10/100 Mbps Ethernet port for simple daisy chain connection.
b 'HYLFHSUR¿OHZHEVHUYLFHIRUGLVFRYHU\RIWKH,)(LQWHUIDFH,)(LQWHUIDFH
gateway on the LAN.
b ULP compliant for localization of the IFE interface in the switchboard.
b Ethernet interface for Compact, Masterpact and Powerpact circuit breakers.
b Gateway for Modbus-SL connected devices (IFE interface + gateway only).
b Embedded set-up web pages.
b Embedded monitoring web pages.
b Embedded control web pages.
b %XLOWLQHPDLODODUPQRWL¿FDWLRQ
Mounting
The IFE interface, IFE interface + gateway are DIN rail mounting devices. A stacking
accessory enables the user to connect several IFMs (ULP to Modbus interfaces) to
an IFE interface + gateway without additional wiring.
24 V DC power supply
IFE interface + gateway, ref.: LV434011
The IFE interface, IFE interface + gateway must always be supplied with 24 V DC.
The IFMs stacked to an IFE interface + gateway are supplied by the IFE interface +
gateway, thus it is not necessary to supply them separately. It is recommended to
use an UL listed and recognized limited voltage/limited current or a class 2 power
supply with a 24 V DC, 3 A maximum.
DB406743.eps
,)(LQWHUIDFH,)(LQWHUIDFHJDWHZD\¿UPZDUHXSGDWH
7KH¿UPZDUHFDQEHXSGDWHGXVLQJ
b FTP
b customer engineering tool.
Required circuit breaker communication modules
The connection to IFE interface or IFE interface + gateway requires a
communication module embedded into the circuit breaker:
b Compact NS: BCM ULP communication module.
b Withdrawable Compact NS: BCM ULP and its respective I/O (Input/Output)
DSSOLFDWLRQPRGXOH$OOFRQQHFWLRQFRQ¿JXUDWLRQVIRU&RPSDFW16UHTXLUHWKH
breaker ULP cord. The insulated NSX cord is mandatory for system voltages greater
than 480 V AC. When the second ULP RJ45 connector is not used, it must be closed
with an ULP terminator (TRV00880).
Characteristic
Network communication interface
Value
Type of interface module
Transmission
Modbus RS485
Ethernet
Structure
Device type
Turnaround time
Maximum length of cable
Type of bus connector
A-34
Type
Method
Modbus
Ethernet
Modbus
Ethernet
Modbus
Ethernet
Modbus
Ethernet
Modbus RTU, RS485 serial connection
Modbus TCP/IP Ethernet
Transfer rate: 9,600...19,200 Baud
Medium Double shielded twisted pair
,PSHGDQFHŸ
Transfer rate : 10/100 Mbps
Medium STP, Cat5e, straight cable
Modbus, Ethernet
Master/Slave
Master
Server
10 ms
1 ms
1000 m
100 m
4-pin connector
RJ45 (Shielded)
DB417466.eps
General characteristics
Environmental characteristics
Conforming to standards
&HUWL¿FDWLRQ
Ambient temperature
Relative humidity
Level of pollution
Flame resistance
24VDC
ETH1
ETH2
UL 508, UL 60950, IEC 60950, 60947-6-2
cUIUs, GOST, FCC, CE
-20 to +70 °C (-4 to +158 °F)
5–85 %
Level 3
ULV0
Mechanical characteristics
Shock resistance
Resistance to sinusoidal vibrations
A
I
J
Electrical characteristics
B
Resistance to electromagnetic discharge
,PPXQLW\WRUDGLDWHG¿HOGV
Immunity to surges
Consumption
K
ETH1
1000 m/s2
-5 Hz < f < 8.4 Hz
ETH2
Conforming to IEC/EN 61000-4-3
10 V/m
Conforming to IEC/EN 61000-4-5
120 mA at 24 V input
Physical characteristics
IFE
IFE-XX.YY.ZZ (factory set)
ETH1 LK/10-100/ACT
ETH2 LK/10-100/ACT
Module Status
Modbus-SL
Network Status
C
D
E
Connections
T
LV434011
F
R
H
Dimensions
Mounting
Weight
Degree of protection of the installed IO
G
72 x 105 x 71 mm (2.83 x 4.13 x 2.79 in.)
DIN rail
182.5 g (0.41 lb)
b On the front panel (wall mounted enclosure): IP4x
b Connectors: IP2x
b Other parts: IP3x
Screw type terminal blocks
Technical characteristics - 24 V DC power supply
Power supply type
Rated power
Input voltage
Regulated switch type
72 W
100–120 V AC for single phase
200–500 V AC phase-to-phase
3)&¿OWHU
With IEC 61000-3-2
Output voltage
24 V DC
Power supply out current
3A
Note: it is recommended to use an UL listed/UL listed recognized limited voltage/Limited current
RUDFODVVSRZHUVXSSO\ZLWKD9'&$PD[LPXP
IFE web page description
Monitoring web page
Real time data 67
Device logging
b
b
Control web page
Single device control
b
Diagnostics web page
L
A Ethernet 1 and Ethernet 2 communication port.
B 24 V DC power supply terminal block.
C Ethernet communication LEDs:
b yellow: 10 Mb
b green: 100 Mb.
D Module status LED:
b steady off: no power
b steady green: device operational
b steady red: major fault
b ÀDVKLQJJUHHQVWDQGE\
b ÀDVKLQJUHGPLQRUIDXOW
b ÀDVKLQJJUHHQUHGVHOIWHVW
E Network status LED:
b steady off: not power/no valid IP address
b steady green: connected, valid IP address
b steady orange: default IP address
b steady red: duplicated IP address
b ÀDVKLQJJUHHQUHG6HOIWHVW
F Sealable transparent cover.
G ULP status LED.
H Test button (accessible closed cover).
I Locking pad.
J 0RGEXVWUDI¿FVWDWXV/('/9RQO\
K Device name label.
L ULP ports.
Statistics
Device information
IMU information
Read device registers
Communication check
b
b
b
b
b
Maitenance web page
Maintenance log
Maintenance counters
b
b
Setup web page
Device localization/name
(WKHUQHWFRQ¿JXUDWLRQGXDOSRUW
,3FRQ¿JXUDWLRQ
0RGEXV7&3,3¿OWHULQJ
Serial port
Date and time
(PDLOVHUYHUFRQ¿JXUDWLRQ
Alarms to be e-mailed
Device list
Device logging
Device log export
SNMP parameters
Documentation links
Preferences
Advanced services control
User accounts
Web page access
b
b
b
b
b
b
b
b
b
b
b
b
b
b
b
b
b
A-35
Functions
and characteristics
IFM Modbus communication
interface
PB103798-50.eps
Function
A IFM - Modbus communication interface - is required for connection of a Masterpact
or Compact to a Modbus network as long as this circuit breaker is provided with
a ULP (Universal Logic Plug) port. The port is available on respectively a BCM ULP
or BSCM embedded module.
7KH,)0LVGH¿QHGDVDQ,08,QWHOOLJHQW0RGXODU8QLWLQWKH8/3FRQQHFWLRQ6\VWHP
documentation.
Once connected, the circuit breaker is considered as a slave by the Modbus master.
Its electrical values, alarm status, open/close signals car be monitored or controlled
by a Programmable Logic Controller or any other system.
Characteristics
ULP port
2 RJ45 sockets, internal parallel wiring.
b Connection of a single circuit breaker (eventually via its I/O application module).
b A ULP line terminator or an FDM121 display unit must be connected to the second
RJ45 ULP socket.
The RJ45 sockets deliver a 24 VDC supply fed from the Modbus socket.
Built-in test function, for checking the correct connection to the circuit breaker
and FDM121 display unit.
IFM Modbus communication interface.
Ref.: TRV00210.
Modbus slave port
DB417545.eps
b Top socket for screw-clamp connector, providing terminals for:
v 24 VDC input supply (0 V, +24 V)
v Modbus line (D1, D2, Gnd).
b Lateral socket, for Din-rail stackable connector.
Both top and lateral sockets are internally parallel wired.
b Multiple IFM can be stacked, thus sharing a common power supply and Modbus
line without individual wiring.
b On the front face:
v Modbus address setting (1 to 99): 2 coded rotary switches
v Modbus locking pad: enables or disables the circuit breaker remote control
DQGPRGL¿FDWLRQRI,)0SDUDPHWHUV
b Self adjusting communication format (Baud rate, parity).
A
5
3
9
0
5
6
7
4
3
8
2
1
B
8
2
1
6
7
4
9
0
C
D
Test
E
F
I
H
E ULP activity LED.
B Modbus address
switches.
G Mechanical lock.
C 0RGEXVWUDI¿F/('
D Modbus locking pad.
A-36
G
A Modbus screw clamp
connector.
F Test button.
H ULP RJ45 connectors.
I Stacking accessory
connection.
Technical characteristics
IFM Modbus communication interface
Dimensions
Maximum number of stacked IFM
Degree of protection Part projecting beyond
the escutcheon
of the installed
module
Other module parts
Connectors
Operating temperature
Power supply voltage
Consumption
Typical
Maximum
18 x 72 x 96 mm
12
IP4x
IP3x
IP2x
-25...+70 °C
24 V DC -20 %/+10 % (19.2...26.4 V DC)
21 mA/24 V DC at 20 °C
30 mA/19.2 V DC at 60 °C
&HUWL¿FDWLRQ
CE
UL
CSA
IEC/EN 60947-1
UL 508 - Industrial Control Equipment
No. 142-M1987 - Process Control
Equipment
b CAN/CSA C22.2 No. 0-M91 General requirements - Canadian Electrical
Code Part
b CAN/CSA C22.2 No. 14-05 Industrial Control Equipment
6LPSOL¿HG,)0LQVWDOODWLRQ
DB417491.eps
DB406714.eps
Staking IFM
Stacking accessories
Up to 12 stacked IFM
HRB49218-01_p49.eps
6WDFNLQJDQ,)(LQWHUIDFHJDWHZD\ZLWK,)0
A-37
Connection of the IFE to a fixed
or drawout Compact NS
Functions and characteristics
&RQQHFWWKH,)(WRD¿[HGPDQXDORSHUDWHG
Compact NS or circuit breaker using the breaker
ULP cord
Ethernet
DB417259.eps
DB417258.eps
Ethernet
Connect the IFE to a drawout Compact NS or circuit breaker using the
breaker ULP cord
24 Vdc
24 Vdc
24VDC
24VDC
ETH2
ETH2
ETH2
ETH1
ETH2
ETH1
ETH1
ETH1
I6
C
I5
I4
C
I3
I2
C
I1
I6
C
I5
C
C
I2
I4
I3
I1
+
C
24VD
A1
O1
O2
O3
K
dule
IO Mo
A
T1
O3
33
O2
23
O1
A1
T2
34
24
14
13
A
B
B
C
J
I
H
D
C
D
E
F
E
G
A
B
C
D
E
IFE Ethernet interface for LV circuit breaker
Breaker ULP cord
Fixed terminal block
BCM ULP communication module
Fixed electrically operated circuit breaker
A-38
A
B
C
D
E
F
G
H
I
J
K
IFE Ethernet interface for LV circuit breaker
ULP cable
Breaker ULP cord
Circuit breaker disconnected position contact (CD)
Circuit breaker cradle
BCM ULP communication module
Drawout circuit breaker
Drawout terminal block
Circuit breaker connected position contact (CE)
Circuit breaker test position contact (CT)
I/O (Input/Output) application module for LV circuit breaker
Connection of the IFM to a fixed
or drawout Compact NS
DB416893.eps
Modbus interface module IFM
Functions
This module, required for connection to the network, contains the Modbus address
(1 to 99) declared by the user via the two dials in front. It automatically adapts (baud
rate, parity) to the Modbus network in which it is installed.
It is equipped with a lock-out switch to enable or disable operations involving writing
WR0LFURORJLFLHUHVHWFRXQWHUUHVHWVHWWLQJPRGL¿FDWLRQVGHYLFHRSHQLQJDQG
closing commands, etc.
There is a built-in test function to check the connections of the Modbus interface
module with the Micrologic and FDM121 display unit.
A
B
C
D
E
F
Mounting
The module is mounted on a DIN rail. A number of modules may be clipped one next
to the other. For this, a stacking accessory is available for fast clip-connection of
both the Modbus link and the 24 V DC supply.
The Modbus interface module supplies 24 V DC to the corresponding Micrologic,
FDM121 display and BSCM module. Module consumption is 60 mA / 24 V DC.
Five-point Modbus and 24 V DC connector
Two Modbus address dials (1 to 99)
0RGEXVWUDI¿F/('
Lock-out to disable writing to the NSX
Test LED
Test button
Two connectors for RJ45 cable
DB112084.eps
G
A
B
C
D
E
F
G
Mounting with stacking accessory.
DB417256.eps
Modbus
Connect the IFM to a drawout Compact NS or circuit breaker using the
breaker ULP cord
Modbus
DB417257.eps
&RQQHFWWKH,)0WRD¿[HGPDQXDORSHUDWHG
Compact NS or circuit breaker using the breaker
ULP cord
I6
C
I5
I4
C
I3
I2
C
I1
I6
C
I5
I4
C
C
I2
I3
I1
+
C
24VD
A1
O1
O2
O3
K
e
dul
IO Mo
T1
O3
33
O2
23
O1
A1
T2
34
24
14
13
A
A
B
B
C
J
I
H
D
C
E
D
F
G
E
A IFM Ethernet interface for LV circuit
A
B
C
D
E
IFM Ethernet interface for LV circuit breaker
Breaker ULP cord
Fixed terminal block
BCM ULP communication module
Fixed electrically operated circuit breaker
B
C
D
E
breaker
ULP cable
Breaker ULP cord
Circuit breaker disconnected position
contact (CD)
Circuit breaker cradle
F
G
H
I
BCM ULP communication module
Drawout circuit breaker
Drawout terminal block
Circuit breaker connected position
contact (CE)
J Circuit breaker test position contact (CT)
K I/O (Input/Output) application module
for LV circuit breaker
A-39
Functions and characteristics
I/O application module
DB416829.eps
Description
The I/O (Input/Output) application module for LV breaker is part of an ULP system
with built-in functionalities and applications to enhance the application needs. The
ULP system architecture can be built without any restrictions using the wide range of
circuit breakers.
7KH,2DSSOLFDWLRQPRGXOHLVFRPSOLDQWZLWKWKH8/3V\VWHPVSHFL¿FDWLRQV
Two I/O application module can be connected in the same ULP network.
The ranges of LV circuit breakers enhanced by the I/O application module are:
b Masterpact NW
b Masterpact NT
b Compact NS1600b-3200
b Compact NS630b-1600
b Compact NSX100-630 A.
I/O (Input/Output) application module for LV breaker resources
The I/O application module module ressources are:
b 6 digital inputs that are self powered for either NO and NC dry contact or pulse
counter
b 3 digital outputs that are bistable relay (5 A maximum)
b 1 analog input for Pt100 temperature sensor.
3UHGH¿QHGDSSOLFDWLRQV
3UHGH¿QHGDSSOLFDWLRQDGGVQHZIXQFWLRQVWRWKH,08LQDVLPSOHZD\
b VHOHFWLRQE\WKHDSSOLFDWLRQURWDU\VZLWFKRQWKH,2DSSOLFDWLRQPRGXOHGH¿QLQJ
WKHDSSOLFDWLRQZLWKSUHGH¿QHGLQSXWRXWSXWDVVLJQPHQWDQGZLULQJGLDJUDP
b no additional setting with the customer engineering tool required.
7KHUHVRXUFHVQRWDVVLJQHGWRWKHSUHGH¿QHGDSSOLFDWLRQDUHIUHHIRUDGGLWLRQDO
XVHUGH¿QHGDSSOLFDWLRQV
b cradle management
b breaker operation
b cradle management and Energy Reduction Maintenance Setting (ERMS)
b light and load control
b custom.
8VHUGH¿QHGDSSOLFDWLRQV
8VHUGH¿QHGDSSOLFDWLRQVDUHSURFHVVHGE\WKH,2DSSOLFDWLRQPRGXOHLQDGGLWLRQWR
WKHSUHGH¿QHGDSSOLFDWLRQVHOHFWHG
7KHXVHUGH¿QHGDSSOLFDWLRQVDUHDYDLODEOHGHSHQGLQJRQ
b WKHSUHGH¿QHGDSSOLFDWLRQVHOHFWHG
b the I/O application module resources (inputs and outputs) not used by the
application.
7KHUHVRXUFHVUHTXLUHGE\XVHUGH¿QHGDSSOLFDWLRQVDUHDVVLJQHGXVLQJWKH
customer engineering tool:
b protection
b control
b energy management
b monitoring.
Mounting
DB416827.eps
The I/O application module is a DIN rail mounting device.
4
5
6
3
2
Application rotary switch
7
8
9
DB416828.eps
DB416828.eps
1
7KHDSSOLFDWLRQURWDU\VZLWFKHQDEOHVWKHVHOHFWLRQRIWKHSUHGH¿QHGDSSOLFDWLRQ
,WKDVSRVLWLRQVDQGHDFKSRVLWLRQLVDVVLJQHGWRDSUHGH¿QHGDSSOLFDWLRQ
7KHIDFWRU\VHWSRVLWLRQRIWKHVZLWFKLVSUHGH¿QHGDSSOLFDWLRQ
A-40
Setting locking pad
The setting locking pad on the front panel of the I/O application module enables
the setting of the I/O application module by the customer engineering tool.
DB417467.eps
General characteristics
Environmental characteristics
I1
C
I2
I3
C
I4
I5
C
Conforming to standards
&HUWL¿FDWLRQ
Ambient temperature
Relative humidity
Level of pollution
Flame resistance
I6
UL 508, UL 60950, IED 60950, 60947-6-2
cUIUs, GOST, FCC, CE
-20 to +70 °C (-4 to +158 °F)
5–85 %
Level 3
ULV0
Mechanical characteristics
Shock resistance
Resistance to sinusoidal
vibrations
1000 m/s2
-5 Hz < f < 8.4 Hz
Electrical characteristics
A
B
I1
24VDC
C
I2
I3
Resistance to electromagnetic
discharge
,PPXQLW\WRUDGLDWHG¿HOGV
Immunity to surges
Consumption
C
I4
I5
C
Conforming to IEC/EN 61000-4-3
10 V/m
Conforming to IEC/EN 61000-4-5
165 mA
I6
Physical characteristics
C
5
4
M
6
3
2
7
8
I1
AI
D
I2
9
1
APP
L
I3
O1
I4
O2
I5
K
E
O3
F
I6
T
G
J
IO
LV434063
O1
13
O2
14
23
O3
24
33
34
T1
I
13
14
23
A1
T2
H
24
33
34
T1
Dimensions
Mounting
Weight
Degree of protection of the
installed I/O application module
T2
Connections
71.7 x 116 x 70.6 mm (2.83 x 4.56 x 2.78 in.)
DIN rail
229.5 g (0.51 lb)
b On the front panel (wall mounted enclosure): IP4x
b IO parts: IP3x
b Connectors: IP2x
Screw type terminal blocks
Technical characteristics - 24 V DC power supply
Power supply type
Rated power
Input voltage
Regulated switch type
72 W
100–120 V AC for single phase
200–500 V AC phase-to-phase
3)&¿OWHU
With IEC 61000-3-2
Output voltage
24 V DC
Power supply out current
3A
Note: it is recommended to use an UL listed/UL listed recognized limited voltage/Limited current
RUDFODVVSRZHUVXSSO\ZLWKD9'&$PD[LPXP
Digital inputs
Digital input type
Self powered digital input with current limitations as per
IEC 61131-2 type 2 standards (7 mA)
Input limit values at state 1
(close)
19.8–25.2 V DC, 6.1–8.8 mA
Input limit values at state 0
(open)
0–19.8 V DC, 0 mA
Maximum cable length
10 m (33 ft)
Note: for a length greater than 10 m (33 ft) and up to 300 m (1,000 ft), it is mandatory to use a
shielded twisted cable. The shield cable is connected to the I/O functional ground of the I/O
application module.
1
2
Digital outputs
O
N
A 24 V DC power supply terminal block.
B Digital input terminal block: 6 inputs, 3 commons and 1 shield.
C 6 input status LEDs.
D Analog input status LED.
E 3 output status LEDs.
F ,2DSSOLFDWLRQPRGXOHLGHQWL¿FDWLRQODEHOV
G Sealable transparent cover.
H Analog input terminal block.
I Digital output terminal blocks.
J ULP status LED.
K Test/reset button (accessible with cover closed).
L Setting locking pad.
M Application rotary switch: 1 to 9.
N Switch for I/O addressing (I/O 1 or I/O 2).
O ULP connectors.
Digital output type
Bistable relay
Rated load
5 A at 250 V AC
Rated carry current
5A
Maximum switching voltage
380 V AC, 125 V DC
Maximum switch current
5A
Maximum switching power
1250 VA, 150 W
Minimum permissible load
10 mA at 5 V DC
Contact resistance
Pȍ
Maximum operating frequency
b 18000 operations/hr (Mechanical)
b 1800 operations/hr (Electrical)
Digital output relay protection
by an external fuse
External fuse of 5 A or less
Maximum cable length
10 m (33 ft)
Analog inputs
The I/O application module analog input can be connected to a Pt100 temperature sensor
Range
-30 to 200 °C
-22 to 392 °F
Accuracy
±2 °C from -30 to 20 °C
±1 °C from 20 to 140 °C
±2 °C from 140 to 200 °C
±3.6 °F from -22 to 68 °F
±1.8 °F from 68 to 284 °F
±3.6 °F from 284 to 392 °F
Refresh interval
5s
5s
A-41
Functions and characteristics
Electrical Asset Manager
Configuration Engineering tool
Capture1b.eps
Introduction
Electrical Asset Manager is a software application that helps the user to manage a
project as part of designing, testing, site commissioning, and maintenance of the
project life cycle.
,WHQDEOHVWKHXVHUWRSUHSDUHWKHVHWWLQJVRIWKHGHYLFHVRIÀLQHZLWKRXWFRQQHFWLQJ
WRWKHGHYLFHDQGFRQ¿JXUHWKHPZKHQFRQQHFWHGZLWKWKHGHYLFHV
Also it provides lot of other value added features for the user to manage the project
such as, safe repository in cloud, attach artifacts to each device or at the project
level, organize devices in switchboard wise, manage a hierarchical structure of the
installation etc.
&RPSDWLEOHGHYLFHVFRQ¿JXUDWLRQDQGGHYLFHPDQDJHPHQW
Capture2b.eps
Electrical Asset Manager is compatible with the following devices:
b Compact NSX100-630 (IEC)
b PowerPactTM (UL) circuit breaker
b Compact NS630b-3200 (IEC)
b Masterpact NT/NW (IEC and UL) circuit breaker
b Acti9 Smartlink.
b Compatible devices (Device Management in the project)
b Switch disconnectors (Compact NSX, Masterpact & PowerPact Family)
b Third party devices.
Capture3b.eps
5HIHUHQFHV
Electrical Asset Manager software package can be downloaded from our website
www.schneider-electric.com.
Features
Electrical Asset Manager supersedes the Schneider Electric customer engineering
tools such as Remote setting Utility (RSU) and Remote Control Utility (RCU) with
additional features.
Capture4b.eps
Electrical Asset Manager supports the connection of Schneider Electric
communicable devices to:
b create projects by device discovery, selection of devices, and import Bill of
Material (BOM)
b monitor the status of protection and IO status
b read information (alarms, measurements, parameters)
b check protection discrimination between two devices
b XSORDGDQGGRZQORDGRIFRQ¿JXUDWLRQRUVHWWLQJVLQEDWFKPRGHWRPXOWLSOH
devices.
b carry out commands and tests
b generate and print device settings report and communication test report
b manage multiple devices with electrical and communication hierarchy model
b manage artifacts (project documents)
b check consistency in settings between devices on a communication network
b FRPSDUHFRQ¿JXUDWLRQVHWWLQJVEHWZHHQ3&DQGGHYLFHRQOLQH
b GRZQORDGODWHVW¿UPZDUH
Electrical Asset Manager enables the user to avail the advanced features of the
software once the project is saved in Schneider Electric cloud.
A-42
Download PDF