Portable Room Air Conditioner and Heat Pump

Portable Room Air Conditioner and Heat Pump
Installation, Operation
& Maintenance Manual
INSTALLATION,
OPERATION
& MAINTENANCE MANUAL
Portable Room Air Conditioner
and Heat Pump
PS-121B
PSH-141A
French version of this manual is available on our website
Heat Controller • 1900 Wellworth Ave. • Jackson, MI 49203 • (517)787-2100 • www.heatcontroller.com
517.787.2100 • www.marsdelivers.com • www.heatcontroller.com
Installation, Operation & Maintenance Manual - PS-121B / PSH-141A
Installation, Operation & Maintenance Manual - PS-121B / PSH-141A
PSH-141A
Installation, Operation & Maintenance
Heat Controller
TABLE OF CONTENTS
SAFETYPRECAUTIONS
PRECAUTIONS
SAFETY
Safety
.......................................................................................................................................3
Safetyrules
rules.......................................................................................................................3
Operating
Operatingconditions
condition.........................................................................................................................3
and suggested tools...........................................................................3
Electrical information..........................................................................................................................4
Electrical information ........................................................................................................4
IDENTIFICATION
IDENTIFICATIONOF
OFPARTS
PARTS
Accessories .......................................................................................................................................4
Accessories ......................................................................................................................4
Identification of parts..........................................................................................................................5
Identification of parts ........................................................................................................5
AIR
AIR CONDITIONER
CONDITIONERFEATURES
FEATURES
Electronic control operating instructions ...........................................................................................6
Electronic control operating instructions ...........................................................................6
OPERATING
OPERATINGINSTRUCTIONS
INSTRUCTIONS
Operating instructions .......................................................................................................................8
Operating instructions.......................................................................................................8
INSTALLATION
INSTALLATIONINSTRUCTIONS
INSTRUCTIONS
Location
Location............................................................................................................................................9
............................................................................................................................9
Window slider kit installation ............................................................................................................9
Window
slider
kit installation.............................................................................................9
Exhaust hose installation
................................................................................................................12
Condensate
drainage
......................................................................................................................13
Exhaust hose
installation
................................................................................................12
Condensate drainage .....................................................................................................13
CARE AND MAINTENANCE
CARE
MAINTENANCE
Care
andAND
maintenance
....................................................................................................................14
Care and maintenance ...................................................................................................14
TROUBLESHOOTING TIPS
TROUBLESHOOTING
TIPS
Trouble
shooting ..............................................................................................................................15
Trouble shooting .............................................................................................................15
2
Installation, Operation & Maintenance Manual - PS-121B / PSH-141A
PSH-141A
Heat Controller
Installation, Operation & Maintenance
SAFETY PRECAUTIONS
Safety rules
To prevent injury to the user or other people and property damage, the following instructions must be
followed. Incorrect operation due to ignoring the instructions may cause harm or damage.
!
Always do this
Never do this
Do not operate your air conditioner in a damp/
humid room such as a bathroom or laundry room.
Do not touch the unit with wet or damp hands or
to avoid electrical shock.
Do not remove any cover panels.
Never use this appliance if it is not working properly,
or if it has been dropped or damaged.
Never use the plug to start and stop the unit. Always
use the switch on the control panel.
Do not cover or obstruct the inlet or outlet grilles.
Do not use hazardous chemicals to clean or allow
them to come into contact with the unit.
Do not use the unit in the presence of inflammable
substances or vapors such as alcohol, insecticides,
gasoline, etc.
Do not use this product for functions other than
those described in this instruction manual.
Your air conditioner should be used in such a way
that it is protected from moisture. e.g. condensation,
splashed water, etc. Do not place or store your air
conditioner where it can fall or be pulled into water
or any other liquid. Unplug immediately if water
enters unit.
Always transport use and store your air conditioner
in a vertical, upright position on a stable, level
surface.
Turn off the product when not in use.
Always contact a qualified servicer to make
repairs. If the supply cord is damaged it must be
repaired by an authorized servicer.
Keep a clearance of at least 1 ft. (30cm) around
the unit, away from walls, furniture and curtains.
If the air conditioner is knocked over during use,
turn off the unit and unplug from the main power
supply immediately.
Save Energy
Use the unit in the recommended room size - see carton.
Locate the unit where furniture or other objects cannot obstruct the air flow.
Keep blinds/curtains closed during the sunniest part of the day.
Keep the filters clean.
Keep doors and windows closed to keep cool air in and warm air out.
Operating conditions
The air conditioner must be operated within the temperature range indicated below:
MODE
ROOM TEMPERATURE
COOL
62-95OF (17-35OC)
DRY
55-95OF (13-35OC)
HEAT
41-88OF (5-30OC)
Suggested tools for window kit installation
1. Screwdriver(medium size Phillips)
2. Tape measure or ruler
3. Knife or scissors
4. Saw(In the event that the window kit needs to be cut down in size because
the window is too narrow for direct installation)
3
3
Installation, Operation & Maintenance Manual - PS-121B / PSH-141A
PSH-141A
Installation, Operation & Maintenance
Heat Controller
IDENTIFICATION OF PARTS
WARNING
For your safety
Do not store or use gasoline or other flammable substances/vapors in the vicinity of this or any other
appliance.
To avoid fire hazard or electric shock, do not use an extension cord or an adaptor plug. Do not remove
any prong from the power cord.
WARNING
Electrical Infor mation
Be sure the electrical service is adequate for the model you have chosen. This information can be found
on the name/rating plate, which is located on the side of the cabinet and behind the grille.
To minimize shock and fire hazards, proper grounding is important. Your air conditioner must be used
in a properly grounded wall receptacle. If the wall receptacle you intend to use is not adequately
grounded or protected by a time delay fuse or circuit breaker, have a qualified electrician install the
proper receptacle.
Accessories
PARTS :
PARTS NAME :
Exhaust hose and Apaptor
Window Slider Kit and bolt
Foam seal
FAN
HIGH
MED
LOW
TIMER ON
TIMER OFF
SET TEMPERATURE( C)
AUTO
COOL
DRY
HEAT
TEMP
ECONOMY
ON/OFF FAN SPEED
RESET LOCK
MODE
FOLLOW
LED
ME
DISPLAY TURBO
ION
SWING
Remote Controller and Batteries
Drain hose and drain hose adaptor
Check all the accessories are included in the package and please refer to the installation instructions for
their usage.
NOTE: All the illustrations in this manual are for explanation purposes only. Your air conditioner
may be slightly different. The actual shape of parts, accessories, unit, etc. shall prevail.
4
4
Installation, Operation & Maintenance Manual - PS-121B / PSH-141A
PSH-141A
Heat Controller
Installation, Operation & Maintenance
IDENTIFICATION OF PARTS
2
1
Front
4
1
Control panel
2
Horizontal louver blade
(swings automatically)
3
Casters
4
Carrying handles
(both sides)
3
Fig.1
Rear
5
6
15
7
14
8
13
9
10
5
Upper air filter
(Behind the grille)
6
Upper air intake
7
Air outlet
8
Drain outlet
9
Power cord outlet
10 Power cord buckle*
11
12
11 Bottom tray drain outlet
Fig.2
12
Power plug socket*
13
Lower air filter
(Behind the grille)
14
Lower air intake
15
Drain outlet
*Notes: Items 10 and 12 are used to wrap up and store the power cord and plug when the unit is not in use.
5
Installation, Operation & Maintenance Manual - PS-121B / PSH-141A
PSH-141A
Installation, Operation & Maintenance
Heat Controller
AIR CONDITIONER FEATURES
ELECTRONIC CONTROL OPERATING INSTRUCTIONS
Before you begin, thoroughly familiarize yourself with the functions of the control panel and
remote controller.
The unit can be controlled by the unit control panel alone or with the remote controller .
NOTE: This manual does not include Remote Controller Operations, see the <<Remote
Controller Instruction>> packed with the unit for details.
OPERATION PANEL OF THE AIR CONDITIONER
8
7
6
5
4
4
3
2
1
Fig.3
5 MODE select button
Selects the appropriate operating mode.
Each time you press the button, a mode
is selected in a sequence that goes from
AUTO, COOL, DRY, FAN and HEAT. The
mode indicator light illuminates under the
selected mode setting.
1 POWER button
Power switch on/off.
2 SLEEP button
Used to initiate the SLEEP operation.
3 FAN button
Controls the fan speed. Each time you press the
button, a different fan speed is selected in a
sequence as follows: LOW, MED, HI and AUTO.
The fan speed indicator light illuminates under
the selected fan settings except AUTO speed.
When Auto fan speed is selected, all of the fan
indicator lights turn off.
NOTE: On some models the fan speed may
not be adjustable when the unit is in Heat, Dry
or Auto modes, as the fan is automatically
controlled.
+
6 TIMER button
Used to initiate the AUTO ON start time and
AUTO OFF stop time program, in conjuction
with the
and
buttons. The timer on/off
indicator light illuminates under the timer
on/off settings.
+
-
7 SWING button
Used to initiate the Auto swing feature.
When the swing mode is ON, press the
SWING button to stop the louver at
the desired angle. Pressing and holding
the swing button will restart the auto
swing function.
-
4 UP(
) and DOWN( ) buttons
Used to adjust (increase/decrease)
temperature settings(2OF/1OC increments)
O
O
O
O
in a range of 62 F(17 C) to 88 F(30 C) or
the TIMER setting in a range of 0~24hrs.
8 LED Display
Shows the set temperature in " O C " or
" OF" and the Auto-timer settings.
While in DRY or FAN mode, it displays
the room temperature.
NOTE: The control is capable of displaying
temperature in degrees Fahrenheit or degrees
Celsius. To convert from one to the other, press
and hold the Up and Down buttons at the same
time, for 3 seconds.
NOTE: The control is capable of displaying
temperature in degrees Fahrenheit or degrees
Celsius. To convert from one to the other, press
and hold the Up and Down buttons at the same
time, for 3 seconds.
6
6
Installation, Operation & Maintenance Manual - PS-121B / PSH-141A
Heat Controller
PSH-141A
Installation, Operation & Maintenance
OPERATING INSTRUCTIONS
Error codes and protection code:
E1- Room temperature sensor errorUnplug the unit and plug it back in.
If error repeats, call for service.
E2- Evaporator temperature sensor errorUnplug the unit and plug it back in.
If error repeats, call for service.
E3- Condenser temperature sensor errorUnplug the unit and plug it back in. If error
repeats, call for service.
E4- Display panel communication errorUnplug the unit and plug it back in.
If error repeats, call for service.
P1- Bottom tray is full - Connect the
drain hose and drain the collected
water away. If error repeats, call
for service.
AUTO operation
- When you set the air conditioner in AUTO
mode, it will automatically select cooling,
heating or fan only operation depending
on what temperature you have selected
in relation to the actual room’s temperature.
- The air conditioner will cool / heat
automatically around the
temperature point set by you.
- Under AUTO mode, you can not
change the fan speed.
FAN operation
- Press the "MODE" button until the
"FAN " indicator light comes on.
- Press the "FAN SPEED" button to
choose the desired fan speed. The
temperature cannot be adjusted.
- Do not connect the duct to window.
Operating Instructions
COOL operation
- Press the "MODE" button until the "COOL"
indicator light comes on.
- Press the ADJUST buttons "+" or " - " buttons to
select the desired room temperature.
- Press the "FAN SPEED" button to select the
desired fan speed.
HEAT operation(cooling only models without)
- Press the "MODE" button until the "HEAT"
indicator light comes on.
- Press the "+" or " - " buttons to select the desired
room temperature.
- Press the "FAN SPEED" button to select the
desired fan speed. For some models, the fan speed
can not be adjusted while the unit is in HEAT mode.
DRY operation
- Press the "MODE" button until the "DRY"
indicator light comes on.
- Under this mode, you cannot select a fan
speed or adjust the temperature. The fan
motor operates at LOW speed automatically.
- Keep windows and doors closed for the
best dehumidifying effect.
- Do not connect the duct to window.
77
TIMER operation
- When the unit is on, press the
Timer button to initiate the Auto-off
program, the TIMER OFF
indicator light illuminates. Press the
(+) or (-) buttons to select the desired
time within 5 seconds. Press the TIMER
button again to initiate the Auto
on timer program, the TIMER
ON indicator light illuminates. Press
the (+) or (-) buttons to select the
desired Auto-on start time.
- When the unit is off, press the Timer
button to initiate the Auto-on start
program, press it again within five
seconds to initiate the Auto-off stop
program.
- Press or hold the (+) or (-) buttons to
change the Auto time by 0.5 hour
increments, up to 10 hours, then
at 1 hour increments up to 24
hours. The control will count down
the time remaining until start.
- The system will automatically revert
back to display the previous temperature setting if there is no operation
in a five second period.
Installation, Operation & Maintenance Manual - PS-121B / PSH-141A
Installation, Operation & Maintenance
PSH-141A
Heat Controller
OPERATING INSTRUCTIONS
- Turning the unit ON or OFF at any
time or adjusting the timer setting
to 0.0 will cancel the Auto On/Off timer
program.
- When an error/malfunction (E1,E2,E3
or E4) occurs, the Auto On/Off
timed program will also be cancelled.
SLEEP operation
By pressing the sleep button, the set temperature will
O
O
increase(cooling) or decrease(heating) by 2 F/1 C
30 minutes. The temperature will then increase
O
O
(cooling) or decrease (heating) by another 2 F/1 C
after an additional 30 minutes. This new temperature will be maintained for 7 hours before it returns
to the originally selected temperature. This ends
the Sleep mode and the unit will continue to operate
as originally programmed.
NOTE: This feature is unavailable under FAN or
DRY mode.
Auto-Restart
If there is a loss of power, once power is restored,
the unit will automatically restart in the last mode
it was operating in prior to the power failure.
Swing automatically
Compressor Time Delay
After the unit has stopped operating, it can not
be restarted for 3 minutes. This is to protect the
unit’s compressor. Operation will automatically
start after 3 minutes has passed.
Air flow direction adjustment
When the Power is ON, the louver opens fully
(Fig.4).
Press the SWING button on the panel or
remote controller to initiate the Auto swing
feature.
The louver will swing up and down
automatically.
Please do not adjust the louver manually.
To stop the louver in a desired angle, press
the swing button again while the louver is in
the location you wish it to stay in.
If the louver is placed in a position/angle
that affects the cooling or heating operation,
the unit will automatically adjust the louver
angle.
Fig.4
8
8
Installation, Operation & Maintenance Manual - PS-121B / PSH-141A
PSH-141A
Heat Controller
Installation, Operation & Maintenance
INSTALLATION INSTRUCTIONS
INSTALLATION INSTRUCTIONS
Location
B
The air conditioner should be placed on a firm
foundation to minimize noise and vibration. For safe
and secure positioning, place the unit on a smooth,
level floor strong enough to support the unit. The unit
has casters to aid placement, but it should only be
rolled on smooth, flat surfaces. Use caution when
rolling on carpet surfaces. Do not attempt to roll the
unit over objects.
The unit must be placed within reach of a properly
rated grounded socket.
Never place any obstacles around the air inlet or
outlet of the unit.
Allow 1ft.-3ft.(30cm to 100cm) of space from the wall
for efficient air-conditioning. (Fig.5)
A
Fig.5
A:1ft.-3ft.(30cm-100cm) B: 1ft.( 30cm)
Horizontal
window
Window slider kit Installation
Window Slider Kit
Minimum: A
Maximum: B
Fig.6
Horizontal
window
Your window slider kit has been designed to fit most
standard "Vertical" and "horizontal"window
applications. However, it may be necessary for you to
improvise/modify some aspects of the installation
procedures for certain types of windows. Please refer
to Fig. 6 & Fig.7 for minimum and maximum window
openings. Window slider kit can be fixed with a bolt
(see Fig.7a).
Note: If the window opening is less than the mentioned
minimum length of the window slider kit, cut the one
with a hole in it to fit the window opening.
Never cut out the hole in window slider kit.
Window Slider Kit
Minimum: A
Maximum: B
Fig.7
A
Minimum
cm
in.
26-9/16 67.5
bolt
Window slider kit
Fig.7a
9
9
B
Maximum
cm
in.
48-1/2 123
Installation, Operation & Maintenance Manual - PS-121B / PSH-141A
Installation, Operation & Maintenance
PSH-141A
Heat Controller
INSTALLATION INSTRUCTIONS
Installation in a double-hung sash
window
Foam seal A
(adhesive type)
Fig.8
1. Cut the foam seal (adhesive type) to the proper length and
attach it to the window stool. Fig.8
2. Attach the window slider kit to the window stool. Adjust the
length of the window slider kit according to the width of
window, shorten the adjustable window kit if the width of
window is less than 26.5” (67.5 cm). Open the window sash
and place the window slider kit on the window stool. Fig.9
Window kit
3. Cut the foam seal (adhesive type) to the proper length
and attach it on the top of the window. Shown as in Fig.10
C
4. Close the window sash securely against the window.
Window stool
Fig.9
5. Cut the foam seal to an appropriate length and seal the
open gap between the top window sash and outer window
sash. Shown as in Fig.11.
Window kit
C
Window stool
Min-max.
Fig.10
Foam seal
Fig.11
10
10
26.5”~ 48.5” (67.5-123 cm)
Installation, Operation & Maintenance Manual - PS-121B / PSH-141A
PSH-141A
Heat Controller
Installation, Operation & Maintenance
INSTALLATION INSTRUCTIONS
Installation in a sliding sash window
Foam seal A
(adhesive type)
Fig.12
1. Cut the foam seal (adhesive type) to the proper length and
attach it to the window frame. See Fig.12.
2. Attach the window slider kit to the window stool. Adjust the
length of the window slider kit according to the width of
window, shorten the adjustable window kit if the width of
window is less than 26.5” (67.5 cm). Open the window sash
and place the window slider kit on the window stool. See Fig.13.
Window
panel
C
3. Cut the foam seal (adhesive type) to the proper length
and attach it on the top of the window. Shown as in Fig.14.
4. Close the sliding sash securely against the window.
Fig.13
5. Cut the foam seal to an appropriate length and seal the
open gap between the top window sash and outer window
sash. Shown as in Fig.15.
C
Fig.14
Min-max.
Foam seal
Fig.15
11
11
26.5”~ 48.5” (67.5-123 cm)
Installation, Operation & Maintenance Manual - PS-121B / PSH-141A
Installation, Operation & Maintenance
PSH-141A
Heat Controller
INSTALLATION INSTRUCTIONS
Exhaust hose installation:
The exhaust hose and adaptor must be installed or removed
in accordance with the usage mode.
COOL,HEAT or AUTO mode
Fig.16
FAN, OR DEHUMIDIIFY or mode
Install
Remove
Hole seat
Hook
Fig.17
1. Install the adaptor onto the exhaust hose as shown in Fig.16.
Refer to the previous pages for window kit installation.
2. Insert the hook of the Exhaust hose into the hole seat of the
air outlet and slide down the Exhaust hose along the arrow
direction (See Fig.17) for installation.
IMPORTANT:
DO NOT OVER EXTEND OR BEND THE EXHAUST HOSE
CAUTION:
Make sure that there are no obstacles around the air outlet of
the exhaust hose provide at least 1.5ft.(500mm) clearance
in order for the exhaust system to work properly.
12
12
Installation, Operation & Maintenance Manual - PS-121B / PSH-141A
PSH-141A
Heat Controller
Installation, Operation & Maintenance
INSTALLATION INSTRUCTIONS
Condensate drainage:
Continuous
drain hose
-
While operating in dry (dehumidify) mode, remove the
upper drain plug from the back of the unit, install the
drain connector (5/8 universal female mender) with 3 4
hose(locally purchased). For the models
without drain connector, just attach the drain
Remove the
upper drain plug
hose to the hole. Place the open end of the
drain hose
adaptor
hose adaptor directly over the drain area in your
basement floor. Please refer to Fig.18a.
Fig.18a
Continuous
drain hose
-
While operating in heat pump mode, remove the lower
drain plug from the back of the unit, install the drain
connector (5/8 universal female mender) with
3/4 hose(locally purchased). For the models
Remove the
lower drain plug
drain hose
adaptor
without drain connector, just attach the drain
hose to the hole. Place the open end of the
Fig.18b
hose adaptor directly over the drain area in your
basement floor. Please refer to Fig.18b.
NOTE: Make sure the hose is secure so there are
no leaks. Direct the hose toward the drain, making sure
that there are no kinks that will stop the water from
flowing. Place the end of the hose into the drain and
make sure the end of the hose is down to let the water
flow smoothly.(See Fig.18a,18b,19a). Do
not let it up.(See Fig.19b).
Fig.19a
Fig.19b
-
When the water level of the bottom tray reaches
a predetermined level, the unit beeps 8 times,
the digital display area shows "P1" . At this time
the air conditioning/dehumidification process will
immediately stop. However, the fan motor will continue
to operate(this is normal).
Carefully move the unit near a drain location,
remove the bottom drain plug and let the
water drain away (Fig.20). Reinstall the bottom
drain plug and restart the machine until the "P1" symbol
Fig.20
disappears. If the error repeats, call for service.
NOTE: Be sure to reinstall the bottom drain plug
before using the unit.
13
13
Installation, Operation & Maintenance Manual - PS-121B / PSH-141A
PSH-141A
Installation, Operation & Maintenance
Heat Controller
CARE AND MAINTENANCE
CARE AND MAINTENANCE
Upper filter
(take out)
Remove the
screw ,then
take the lower
filter out.
Fig.21
Upper filter
(install)
IMPORTANT:
1) Be sure to unplug the unit before cleaning or servicing.
2) Do not use gasoline, paint thinner or other chemicals to clean
the unit.
3) Do not wash the unit directly under a tap or using a hose.
It may cause electrical danger.
4) If the power cord is damaged, it should be repaired by
an authorized servicer.
1. Air filter
-
Install the lower
filter by using
the screw.
Fig.22
-
-
2. Unit Cabinet
- Use a lint-free damp cloth with neutral detergent to clean the
cabinet. Finished by drying with a clean, dry cloth.
Buckle
Power
cord
Power plug
Clean the air filter at least once every two weeks.
Removal
This unit has two filters. Take the upper filter out along the
the arrow direction (Fig.21),then take the filter down.
Remove the lower filter by loosening the screw, taking out
the filter as shown in Fig.21.
Cleaning
Wash the air filter by immersing it gently in warm water
(about 104OF/40OC) with a neutral detergent. Rinse the filter
and dry it in a shady place.
Installation
Insert the upper air filter after cleaning, and reinstall the lower
filter by using the screw (see Fig.22).
3. Unit storage when not in use
Power plug
socket
Fig.23
-
-
Fig.24
Remove the rubber plug at the back of the unit and attach a
hose to the drain outlet. Place the open end of the hose
directly over the drain area in your basement floor
(See Fig.18 & 19).
Remove the plug from the bottom drain outlet, all the water in
the bottom tray will drain out (See Fig.21).
Keep the appliance running in FAN mode for half a day in
a warm room to dry the appliance inside and prevent mold
from forming.
Stop the appliance and unplug it, wrap the cord and bundle it
with the buckle and plug the power plug into the socket on the
back of the unit. (Fig.23). Remove the batteries from the
remote controller.
Clean the air filter and reinstall it.
Unscrew the exhaust hose from the unit and pull out when
uninstallating (Fig.24).
14
14
Installation, Operation & Maintenance Manual - PS-121B / PSH-141A
PSH-141A
Heat Controller
Installation, Operation & Maintenance
TROUBLESHOOTING TIPS
TROUBLESHOOTING
PROBLEM
POSSIBLE CAUSES
SUGGESTED REMEDIES
1. Unit does not
- P1 appears in the display window
Drain the water in the bottom tray.
Start when
Pressing on/off
Button
- Room temperature is lower than
the set temperature.(Cooling mode)
- The windows or doors in the room
are not closed.
2. Not cool enough
- There are heat sources inside the
Remove the heat sources if possible.
room.
blocked.
Connect the duct and make
sure it can function properly.
- Temperature setting is too high.
Decrease the set temperature.
- Air filter is blocked by dust.
Clean the air filter.
- The ground is not level or not flat
Place the unit on a flat, level
enough.
5. Gurgling sound
Make sure all the windows and
doors are closed.
- Exhaust air duct is not connected or
4. Noisy or vibration
Reset the temperature.
ground if possible.
- The sound comes from the flowing
This is normal operation.
of the refrigerant inside the
air-conditioner.
6. Power shut off at
Heating mode
- The automatic over heat
protection function. When the
temperature at the air outlet
exceed 158 OF/70 OC,th e de vice
will st op.
15
15
Switch on again after the unit
cools down.
Installation, Operation & Maintenance Manual - PS-121B / PSH-141A
16
'XHWRRQJRLQJSURGXFWLPSURYHPHQWVVSHFLILFDWLRQVDQGGLPHQVLRQVDUH
VXEMHFWWRFKDQJHDQGFRUUHFWLRQZLWKRXWQRWLFHRULQFXUULQJREOLJDWLRQV'HWHUPLQLQJWKH
DSSOLFDWLRQDQGVXLWDELOLW\IRUXVHRIDQ\SURGXFWLVWKHUHVSRQVLELOLW\RIWKHLQVWDOOHU
$GGLWLRQDOO\WKHLQVWDOOHULVUHVSRQVLEOHIRUYHULI\LQJGLPHQVLRQDOGDWDRQWKHDFWXDOSURGXFW
SULRUWREHJLQQLQJDQ\LQVWDOODWLRQSUHSDUDWLRQV
,QFHQWLYHDQGUHEDWHSURJUDPVKDYHSUHFLVHUHTXLUHPHQWVDVWRSURGXFWSHUIRUPDQFH
DQGFHUWLILFDWLRQ$OOSURGXFWVPHHWDSSOLFDEOHUHJXODWLRQVLQHIIHFWRQGDWHRIPDQXIDFWXUH
KRZHYHUFHUWLILFDWLRQVDUHQRWQHFHVVDULO\JUDQWHGIRUWKHOLIHRIDSURGXFW
7KHUHIRUHLWLVWKHUHVSRQVLELOLW\RIWKHDSSOLFDQWWRGHWHUPLQHZKHWKHUDVSHFLILF
PRGHOTXDOLILHVIRUWKHVHLQFHQWLYHUHEDWHSURJUDPV
:HOOZRUWK$YH-DFNVRQ0,‡3K‡ZZZKHDWFRQWUROOHUFRP
1900 Wellworth Ave. • Jackson, MI 49203
517.787.2100 • www.marsdelivers.com • www.heatcontroller.com
11/2015
Was this manual useful for you? yes no
Thank you for your participation!

* Your assessment is very important for improving the work of artificial intelligence, which forms the content of this project

Download PDF

advertising