Installation, Operation & Maintenance Manual INSTALLATION, OPERATION & MAINTENANCE MANUAL Portable Room Air Conditioner and Heat Pump PS-121B PSH-141A French version of this manual is available on our website Heat Controller • 1900 Wellworth Ave. • Jackson, MI 49203 • (517)787-2100 • www.heatcontroller.com 517.787.2100 • www.marsdelivers.com • www.heatcontroller.com Installation, Operation & Maintenance Manual - PS-121B / PSH-141A Installation, Operation & Maintenance Manual - PS-121B / PSH-141A PSH-141A Installation, Operation & Maintenance Heat Controller TABLE OF CONTENTS SAFETYPRECAUTIONS PRECAUTIONS SAFETY Safety .......................................................................................................................................3 Safetyrules rules.......................................................................................................................3 Operating Operatingconditions condition.........................................................................................................................3 and suggested tools...........................................................................3 Electrical information..........................................................................................................................4 Electrical information ........................................................................................................4 IDENTIFICATION IDENTIFICATIONOF OFPARTS PARTS Accessories .......................................................................................................................................4 Accessories ......................................................................................................................4 Identification of parts..........................................................................................................................5 Identification of parts ........................................................................................................5 AIR AIR CONDITIONER CONDITIONERFEATURES FEATURES Electronic control operating instructions ...........................................................................................6 Electronic control operating instructions ...........................................................................6 OPERATING OPERATINGINSTRUCTIONS INSTRUCTIONS Operating instructions .......................................................................................................................8 Operating instructions.......................................................................................................8 INSTALLATION INSTALLATIONINSTRUCTIONS INSTRUCTIONS Location Location............................................................................................................................................9 ............................................................................................................................9 Window slider kit installation ............................................................................................................9 Window slider kit installation.............................................................................................9 Exhaust hose installation ................................................................................................................12 Condensate drainage ......................................................................................................................13 Exhaust hose installation ................................................................................................12 Condensate drainage .....................................................................................................13 CARE AND MAINTENANCE CARE MAINTENANCE Care andAND maintenance ....................................................................................................................14 Care and maintenance ...................................................................................................14 TROUBLESHOOTING TIPS TROUBLESHOOTING TIPS Trouble shooting ..............................................................................................................................15 Trouble shooting .............................................................................................................15 2 Installation, Operation & Maintenance Manual - PS-121B / PSH-141A PSH-141A Heat Controller Installation, Operation & Maintenance SAFETY PRECAUTIONS Safety rules To prevent injury to the user or other people and property damage, the following instructions must be followed. Incorrect operation due to ignoring the instructions may cause harm or damage. ! Always do this Never do this Do not operate your air conditioner in a damp/ humid room such as a bathroom or laundry room. Do not touch the unit with wet or damp hands or to avoid electrical shock. Do not remove any cover panels. Never use this appliance if it is not working properly, or if it has been dropped or damaged. Never use the plug to start and stop the unit. Always use the switch on the control panel. Do not cover or obstruct the inlet or outlet grilles. Do not use hazardous chemicals to clean or allow them to come into contact with the unit. Do not use the unit in the presence of inflammable substances or vapors such as alcohol, insecticides, gasoline, etc. Do not use this product for functions other than those described in this instruction manual. Your air conditioner should be used in such a way that it is protected from moisture. e.g. condensation, splashed water, etc. Do not place or store your air conditioner where it can fall or be pulled into water or any other liquid. Unplug immediately if water enters unit. Always transport use and store your air conditioner in a vertical, upright position on a stable, level surface. Turn off the product when not in use. Always contact a qualified servicer to make repairs. If the supply cord is damaged it must be repaired by an authorized servicer. Keep a clearance of at least 1 ft. (30cm) around the unit, away from walls, furniture and curtains. If the air conditioner is knocked over during use, turn off the unit and unplug from the main power supply immediately. Save Energy Use the unit in the recommended room size - see carton. Locate the unit where furniture or other objects cannot obstruct the air flow. Keep blinds/curtains closed during the sunniest part of the day. Keep the filters clean. Keep doors and windows closed to keep cool air in and warm air out. Operating conditions The air conditioner must be operated within the temperature range indicated below: MODE ROOM TEMPERATURE COOL 62-95OF (17-35OC) DRY 55-95OF (13-35OC) HEAT 41-88OF (5-30OC) Suggested tools for window kit installation 1. Screwdriver(medium size Phillips) 2. Tape measure or ruler 3. Knife or scissors 4. Saw(In the event that the window kit needs to be cut down in size because the window is too narrow for direct installation) 3 3 Installation, Operation & Maintenance Manual - PS-121B / PSH-141A PSH-141A Installation, Operation & Maintenance Heat Controller IDENTIFICATION OF PARTS WARNING For your safety Do not store or use gasoline or other flammable substances/vapors in the vicinity of this or any other appliance. To avoid fire hazard or electric shock, do not use an extension cord or an adaptor plug. Do not remove any prong from the power cord. WARNING Electrical Infor mation Be sure the electrical service is adequate for the model you have chosen. This information can be found on the name/rating plate, which is located on the side of the cabinet and behind the grille. To minimize shock and fire hazards, proper grounding is important. Your air conditioner must be used in a properly grounded wall receptacle. If the wall receptacle you intend to use is not adequately grounded or protected by a time delay fuse or circuit breaker, have a qualified electrician install the proper receptacle. Accessories PARTS : PARTS NAME : Exhaust hose and Apaptor Window Slider Kit and bolt Foam seal FAN HIGH MED LOW TIMER ON TIMER OFF SET TEMPERATURE( C) AUTO COOL DRY HEAT TEMP ECONOMY ON/OFF FAN SPEED RESET LOCK MODE FOLLOW LED ME DISPLAY TURBO ION SWING Remote Controller and Batteries Drain hose and drain hose adaptor Check all the accessories are included in the package and please refer to the installation instructions for their usage. NOTE: All the illustrations in this manual are for explanation purposes only. Your air conditioner may be slightly different. The actual shape of parts, accessories, unit, etc. shall prevail. 4 4 Installation, Operation & Maintenance Manual - PS-121B / PSH-141A PSH-141A Heat Controller Installation, Operation & Maintenance IDENTIFICATION OF PARTS 2 1 Front 4 1 Control panel 2 Horizontal louver blade (swings automatically) 3 Casters 4 Carrying handles (both sides) 3 Fig.1 Rear 5 6 15 7 14 8 13 9 10 5 Upper air filter (Behind the grille) 6 Upper air intake 7 Air outlet 8 Drain outlet 9 Power cord outlet 10 Power cord buckle* 11 12 11 Bottom tray drain outlet Fig.2 12 Power plug socket* 13 Lower air filter (Behind the grille) 14 Lower air intake 15 Drain outlet *Notes: Items 10 and 12 are used to wrap up and store the power cord and plug when the unit is not in use. 5 Installation, Operation & Maintenance Manual - PS-121B / PSH-141A PSH-141A Installation, Operation & Maintenance Heat Controller AIR CONDITIONER FEATURES ELECTRONIC CONTROL OPERATING INSTRUCTIONS Before you begin, thoroughly familiarize yourself with the functions of the control panel and remote controller. The unit can be controlled by the unit control panel alone or with the remote controller . NOTE: This manual does not include Remote Controller Operations, see the <<Remote Controller Instruction>> packed with the unit for details. OPERATION PANEL OF THE AIR CONDITIONER 8 7 6 5 4 4 3 2 1 Fig.3 5 MODE select button Selects the appropriate operating mode. Each time you press the button, a mode is selected in a sequence that goes from AUTO, COOL, DRY, FAN and HEAT. The mode indicator light illuminates under the selected mode setting. 1 POWER button Power switch on/off. 2 SLEEP button Used to initiate the SLEEP operation. 3 FAN button Controls the fan speed. Each time you press the button, a different fan speed is selected in a sequence as follows: LOW, MED, HI and AUTO. The fan speed indicator light illuminates under the selected fan settings except AUTO speed. When Auto fan speed is selected, all of the fan indicator lights turn off. NOTE: On some models the fan speed may not be adjustable when the unit is in Heat, Dry or Auto modes, as the fan is automatically controlled. + 6 TIMER button Used to initiate the AUTO ON start time and AUTO OFF stop time program, in conjuction with the and buttons. The timer on/off indicator light illuminates under the timer on/off settings. + - 7 SWING button Used to initiate the Auto swing feature. When the swing mode is ON, press the SWING button to stop the louver at the desired angle. Pressing and holding the swing button will restart the auto swing function. - 4 UP( ) and DOWN( ) buttons Used to adjust (increase/decrease) temperature settings(2OF/1OC increments) O O O O in a range of 62 F(17 C) to 88 F(30 C) or the TIMER setting in a range of 0~24hrs. 8 LED Display Shows the set temperature in " O C " or " OF" and the Auto-timer settings. While in DRY or FAN mode, it displays the room temperature. NOTE: The control is capable of displaying temperature in degrees Fahrenheit or degrees Celsius. To convert from one to the other, press and hold the Up and Down buttons at the same time, for 3 seconds. NOTE: The control is capable of displaying temperature in degrees Fahrenheit or degrees Celsius. To convert from one to the other, press and hold the Up and Down buttons at the same time, for 3 seconds. 6 6 Installation, Operation & Maintenance Manual - PS-121B / PSH-141A Heat Controller PSH-141A Installation, Operation & Maintenance OPERATING INSTRUCTIONS Error codes and protection code: E1- Room temperature sensor errorUnplug the unit and plug it back in. If error repeats, call for service. E2- Evaporator temperature sensor errorUnplug the unit and plug it back in. If error repeats, call for service. E3- Condenser temperature sensor errorUnplug the unit and plug it back in. If error repeats, call for service. E4- Display panel communication errorUnplug the unit and plug it back in. If error repeats, call for service. P1- Bottom tray is full - Connect the drain hose and drain the collected water away. If error repeats, call for service. AUTO operation - When you set the air conditioner in AUTO mode, it will automatically select cooling, heating or fan only operation depending on what temperature you have selected in relation to the actual room’s temperature. - The air conditioner will cool / heat automatically around the temperature point set by you. - Under AUTO mode, you can not change the fan speed. FAN operation - Press the "MODE" button until the "FAN " indicator light comes on. - Press the "FAN SPEED" button to choose the desired fan speed. The temperature cannot be adjusted. - Do not connect the duct to window. Operating Instructions COOL operation - Press the "MODE" button until the "COOL" indicator light comes on. - Press the ADJUST buttons "+" or " - " buttons to select the desired room temperature. - Press the "FAN SPEED" button to select the desired fan speed. HEAT operation(cooling only models without) - Press the "MODE" button until the "HEAT" indicator light comes on. - Press the "+" or " - " buttons to select the desired room temperature. - Press the "FAN SPEED" button to select the desired fan speed. For some models, the fan speed can not be adjusted while the unit is in HEAT mode. DRY operation - Press the "MODE" button until the "DRY" indicator light comes on. - Under this mode, you cannot select a fan speed or adjust the temperature. The fan motor operates at LOW speed automatically. - Keep windows and doors closed for the best dehumidifying effect. - Do not connect the duct to window. 77 TIMER operation - When the unit is on, press the Timer button to initiate the Auto-off program, the TIMER OFF indicator light illuminates. Press the (+) or (-) buttons to select the desired time within 5 seconds. Press the TIMER button again to initiate the Auto on timer program, the TIMER ON indicator light illuminates. Press the (+) or (-) buttons to select the desired Auto-on start time. - When the unit is off, press the Timer button to initiate the Auto-on start program, press it again within five seconds to initiate the Auto-off stop program. - Press or hold the (+) or (-) buttons to change the Auto time by 0.5 hour increments, up to 10 hours, then at 1 hour increments up to 24 hours. The control will count down the time remaining until start. - The system will automatically revert back to display the previous temperature setting if there is no operation in a five second period. Installation, Operation & Maintenance Manual - PS-121B / PSH-141A Installation, Operation & Maintenance PSH-141A Heat Controller OPERATING INSTRUCTIONS - Turning the unit ON or OFF at any time or adjusting the timer setting to 0.0 will cancel the Auto On/Off timer program. - When an error/malfunction (E1,E2,E3 or E4) occurs, the Auto On/Off timed program will also be cancelled. SLEEP operation By pressing the sleep button, the set temperature will O O increase(cooling) or decrease(heating) by 2 F/1 C 30 minutes. The temperature will then increase O O (cooling) or decrease (heating) by another 2 F/1 C after an additional 30 minutes. This new temperature will be maintained for 7 hours before it returns to the originally selected temperature. This ends the Sleep mode and the unit will continue to operate as originally programmed. NOTE: This feature is unavailable under FAN or DRY mode. Auto-Restart If there is a loss of power, once power is restored, the unit will automatically restart in the last mode it was operating in prior to the power failure. Swing automatically Compressor Time Delay After the unit has stopped operating, it can not be restarted for 3 minutes. This is to protect the unit’s compressor. Operation will automatically start after 3 minutes has passed. Air flow direction adjustment When the Power is ON, the louver opens fully (Fig.4). Press the SWING button on the panel or remote controller to initiate the Auto swing feature. The louver will swing up and down automatically. Please do not adjust the louver manually. To stop the louver in a desired angle, press the swing button again while the louver is in the location you wish it to stay in. If the louver is placed in a position/angle that affects the cooling or heating operation, the unit will automatically adjust the louver angle. Fig.4 8 8 Installation, Operation & Maintenance Manual - PS-121B / PSH-141A PSH-141A Heat Controller Installation, Operation & Maintenance INSTALLATION INSTRUCTIONS INSTALLATION INSTRUCTIONS Location B The air conditioner should be placed on a firm foundation to minimize noise and vibration. For safe and secure positioning, place the unit on a smooth, level floor strong enough to support the unit. The unit has casters to aid placement, but it should only be rolled on smooth, flat surfaces. Use caution when rolling on carpet surfaces. Do not attempt to roll the unit over objects. The unit must be placed within reach of a properly rated grounded socket. Never place any obstacles around the air inlet or outlet of the unit. Allow 1ft.-3ft.(30cm to 100cm) of space from the wall for efficient air-conditioning. (Fig.5) A Fig.5 A:1ft.-3ft.(30cm-100cm) B: 1ft.( 30cm) Horizontal window Window slider kit Installation Window Slider Kit Minimum: A Maximum: B Fig.6 Horizontal window Your window slider kit has been designed to fit most standard "Vertical" and "horizontal"window applications. However, it may be necessary for you to improvise/modify some aspects of the installation procedures for certain types of windows. Please refer to Fig. 6 & Fig.7 for minimum and maximum window openings. Window slider kit can be fixed with a bolt (see Fig.7a). Note: If the window opening is less than the mentioned minimum length of the window slider kit, cut the one with a hole in it to fit the window opening. Never cut out the hole in window slider kit. Window Slider Kit Minimum: A Maximum: B Fig.7 A Minimum cm in. 26-9/16 67.5 bolt Window slider kit Fig.7a 9 9 B Maximum cm in. 48-1/2 123 Installation, Operation & Maintenance Manual - PS-121B / PSH-141A Installation, Operation & Maintenance PSH-141A Heat Controller INSTALLATION INSTRUCTIONS Installation in a double-hung sash window Foam seal A (adhesive type) Fig.8 1. Cut the foam seal (adhesive type) to the proper length and attach it to the window stool. Fig.8 2. Attach the window slider kit to the window stool. Adjust the length of the window slider kit according to the width of window, shorten the adjustable window kit if the width of window is less than 26.5” (67.5 cm). Open the window sash and place the window slider kit on the window stool. Fig.9 Window kit 3. Cut the foam seal (adhesive type) to the proper length and attach it on the top of the window. Shown as in Fig.10 C 4. Close the window sash securely against the window. Window stool Fig.9 5. Cut the foam seal to an appropriate length and seal the open gap between the top window sash and outer window sash. Shown as in Fig.11. Window kit C Window stool Min-max. Fig.10 Foam seal Fig.11 10 10 26.5”~ 48.5” (67.5-123 cm) Installation, Operation & Maintenance Manual - PS-121B / PSH-141A PSH-141A Heat Controller Installation, Operation & Maintenance INSTALLATION INSTRUCTIONS Installation in a sliding sash window Foam seal A (adhesive type) Fig.12 1. Cut the foam seal (adhesive type) to the proper length and attach it to the window frame. See Fig.12. 2. Attach the window slider kit to the window stool. Adjust the length of the window slider kit according to the width of window, shorten the adjustable window kit if the width of window is less than 26.5” (67.5 cm). Open the window sash and place the window slider kit on the window stool. See Fig.13. Window panel C 3. Cut the foam seal (adhesive type) to the proper length and attach it on the top of the window. Shown as in Fig.14. 4. Close the sliding sash securely against the window. Fig.13 5. Cut the foam seal to an appropriate length and seal the open gap between the top window sash and outer window sash. Shown as in Fig.15. C Fig.14 Min-max. Foam seal Fig.15 11 11 26.5”~ 48.5” (67.5-123 cm) Installation, Operation & Maintenance Manual - PS-121B / PSH-141A Installation, Operation & Maintenance PSH-141A Heat Controller INSTALLATION INSTRUCTIONS Exhaust hose installation: The exhaust hose and adaptor must be installed or removed in accordance with the usage mode. COOL,HEAT or AUTO mode Fig.16 FAN, OR DEHUMIDIIFY or mode Install Remove Hole seat Hook Fig.17 1. Install the adaptor onto the exhaust hose as shown in Fig.16. Refer to the previous pages for window kit installation. 2. Insert the hook of the Exhaust hose into the hole seat of the air outlet and slide down the Exhaust hose along the arrow direction (See Fig.17) for installation. IMPORTANT: DO NOT OVER EXTEND OR BEND THE EXHAUST HOSE CAUTION: Make sure that there are no obstacles around the air outlet of the exhaust hose provide at least 1.5ft.(500mm) clearance in order for the exhaust system to work properly. 12 12 Installation, Operation & Maintenance Manual - PS-121B / PSH-141A PSH-141A Heat Controller Installation, Operation & Maintenance INSTALLATION INSTRUCTIONS Condensate drainage: Continuous drain hose - While operating in dry (dehumidify) mode, remove the upper drain plug from the back of the unit, install the drain connector (5/8 universal female mender) with 3 4 hose(locally purchased). For the models without drain connector, just attach the drain Remove the upper drain plug hose to the hole. Place the open end of the drain hose adaptor hose adaptor directly over the drain area in your basement floor. Please refer to Fig.18a. Fig.18a Continuous drain hose - While operating in heat pump mode, remove the lower drain plug from the back of the unit, install the drain connector (5/8 universal female mender) with 3/4 hose(locally purchased). For the models Remove the lower drain plug drain hose adaptor without drain connector, just attach the drain hose to the hole. Place the open end of the Fig.18b hose adaptor directly over the drain area in your basement floor. Please refer to Fig.18b. NOTE: Make sure the hose is secure so there are no leaks. Direct the hose toward the drain, making sure that there are no kinks that will stop the water from flowing. Place the end of the hose into the drain and make sure the end of the hose is down to let the water flow smoothly.(See Fig.18a,18b,19a). Do not let it up.(See Fig.19b). Fig.19a Fig.19b - When the water level of the bottom tray reaches a predetermined level, the unit beeps 8 times, the digital display area shows "P1" . At this time the air conditioning/dehumidification process will immediately stop. However, the fan motor will continue to operate(this is normal). Carefully move the unit near a drain location, remove the bottom drain plug and let the water drain away (Fig.20). Reinstall the bottom drain plug and restart the machine until the "P1" symbol Fig.20 disappears. If the error repeats, call for service. NOTE: Be sure to reinstall the bottom drain plug before using the unit. 13 13 Installation, Operation & Maintenance Manual - PS-121B / PSH-141A PSH-141A Installation, Operation & Maintenance Heat Controller CARE AND MAINTENANCE CARE AND MAINTENANCE Upper filter (take out) Remove the screw ,then take the lower filter out. Fig.21 Upper filter (install) IMPORTANT: 1) Be sure to unplug the unit before cleaning or servicing. 2) Do not use gasoline, paint thinner or other chemicals to clean the unit. 3) Do not wash the unit directly under a tap or using a hose. It may cause electrical danger. 4) If the power cord is damaged, it should be repaired by an authorized servicer. 1. Air filter - Install the lower filter by using the screw. Fig.22 - - 2. Unit Cabinet - Use a lint-free damp cloth with neutral detergent to clean the cabinet. Finished by drying with a clean, dry cloth. Buckle Power cord Power plug Clean the air filter at least once every two weeks. Removal This unit has two filters. Take the upper filter out along the the arrow direction (Fig.21),then take the filter down. Remove the lower filter by loosening the screw, taking out the filter as shown in Fig.21. Cleaning Wash the air filter by immersing it gently in warm water (about 104OF/40OC) with a neutral detergent. Rinse the filter and dry it in a shady place. Installation Insert the upper air filter after cleaning, and reinstall the lower filter by using the screw (see Fig.22). 3. Unit storage when not in use Power plug socket Fig.23 - - Fig.24 Remove the rubber plug at the back of the unit and attach a hose to the drain outlet. Place the open end of the hose directly over the drain area in your basement floor (See Fig.18 & 19). Remove the plug from the bottom drain outlet, all the water in the bottom tray will drain out (See Fig.21). Keep the appliance running in FAN mode for half a day in a warm room to dry the appliance inside and prevent mold from forming. Stop the appliance and unplug it, wrap the cord and bundle it with the buckle and plug the power plug into the socket on the back of the unit. (Fig.23). Remove the batteries from the remote controller. Clean the air filter and reinstall it. Unscrew the exhaust hose from the unit and pull out when uninstallating (Fig.24). 14 14 Installation, Operation & Maintenance Manual - PS-121B / PSH-141A PSH-141A Heat Controller Installation, Operation & Maintenance TROUBLESHOOTING TIPS TROUBLESHOOTING PROBLEM POSSIBLE CAUSES SUGGESTED REMEDIES 1. Unit does not - P1 appears in the display window Drain the water in the bottom tray. Start when Pressing on/off Button - Room temperature is lower than the set temperature.(Cooling mode) - The windows or doors in the room are not closed. 2. Not cool enough - There are heat sources inside the Remove the heat sources if possible. room. blocked. Connect the duct and make sure it can function properly. - Temperature setting is too high. Decrease the set temperature. - Air filter is blocked by dust. Clean the air filter. - The ground is not level or not flat Place the unit on a flat, level enough. 5. Gurgling sound Make sure all the windows and doors are closed. - Exhaust air duct is not connected or 4. Noisy or vibration Reset the temperature. ground if possible. - The sound comes from the flowing This is normal operation. of the refrigerant inside the air-conditioner. 6. Power shut off at Heating mode - The automatic over heat protection function. When the temperature at the air outlet exceed 158 OF/70 OC,th e de vice will st op. 15 15 Switch on again after the unit cools down. Installation, Operation & Maintenance Manual - PS-121B / PSH-141A 16 'XHWRRQJRLQJSURGXFWLPSURYHPHQWVVSHFLILFDWLRQVDQGGLPHQVLRQVDUH VXEMHFWWRFKDQJHDQGFRUUHFWLRQZLWKRXWQRWLFHRULQFXUULQJREOLJDWLRQV'HWHUPLQLQJWKH DSSOLFDWLRQDQGVXLWDELOLW\IRUXVHRIDQ\SURGXFWLVWKHUHVSRQVLELOLW\RIWKHLQVWDOOHU $GGLWLRQDOO\WKHLQVWDOOHULVUHVSRQVLEOHIRUYHULI\LQJGLPHQVLRQDOGDWDRQWKHDFWXDOSURGXFW SULRUWREHJLQQLQJDQ\LQVWDOODWLRQSUHSDUDWLRQV ,QFHQWLYHDQGUHEDWHSURJUDPVKDYHSUHFLVHUHTXLUHPHQWVDVWRSURGXFWSHUIRUPDQFH DQGFHUWLILFDWLRQ$OOSURGXFWVPHHWDSSOLFDEOHUHJXODWLRQVLQHIIHFWRQGDWHRIPDQXIDFWXUH KRZHYHUFHUWLILFDWLRQVDUHQRWQHFHVVDULO\JUDQWHGIRUWKHOLIHRIDSURGXFW 7KHUHIRUHLWLVWKHUHVSRQVLELOLW\RIWKHDSSOLFDQWWRGHWHUPLQHZKHWKHUDVSHFLILF PRGHOTXDOLILHVIRUWKHVHLQFHQWLYHUHEDWHSURJUDPV :HOOZRUWK$YH-DFNVRQ0,3KZZZKHDWFRQWUROOHUFRP 1900 Wellworth Ave. • Jackson, MI 49203 517.787.2100 • www.marsdelivers.com • www.heatcontroller.com 11/2015
* Your assessment is very important for improving the work of artificial intelligence, which forms the content of this project
advertising