25255RE2 - Squarespace
2-Line Intercom
Speakerphone DECT6.0
Corded/Cordless
Handset Telephone
Answering System
User’s Guide
9,
ViSYS
™
Equipment Approval Information
<RXUWHOHSKRQHHTXLSPHQWLVDSSURYHGIRUFRQQHFWLRQWRWKH3XEOLF6ZLWFKHG7HOHSKRQH
1HWZRUNDQGLVLQFRPSOLDQFHZLWKSDUWVDQG)&&5XOHVDQG5HJXODWLRQVDQGWKH
7HFKQLFDO5HTXLUHPHQWVIRU7HOHSKRQH7HUPLQDO(TXLSPHQWSXEOLVKHGE\$&7$
1 Notification to the Local Telephone Company
2QWKHERWWRPRIWKLVHTXLSPHQWLVDODEHOLQGLFDWLQJDPRQJRWKHULQIRUPDWLRQWKH
86QXPEHUDQG5LQJHU(TXLYDOHQFH1XPEHU5(1IRUWKHHTXLSPHQW<RXPXVWXSRQ
UHTXHVWSURYLGHWKLVLQIRUPDWLRQWR\RXUWHOHSKRQHFRPSDQ\
7KH5(1LVXVHIXOLQGHWHUPLQLQJWKHQXPEHURIGHYLFHV\RXPD\FRQQHFWWR\RXU
WHOHSKRQHOLQHDQGVWLOOKDYHDOORIWKHVHGHYLFHVULQJZKHQ\RXUWHOHSKRQHQXPEHULV
FDOOHG,QPRVWEXWQRWDOODUHDVWKHVXPRIWKH5(1VRIDOOGHYLFHVFRQQHFWHGWRRQH
OLQHVKRXOGQRWH[FHHG7REHFHUWDLQRIWKHQXPEHURIGHYLFHV\RXPD\FRQQHFWWR
\RXUOLQHDVGHWHUPLQHGE\WKH5(1\RXVKRXOGFRQWDFW\RXUORFDOWHOHSKRQHFRPSDQ\
$SOXJDQGMDFNXVHGWRFRQQHFWWKLVHTXLSPHQWWRWKHSUHPLVHVZLULQJDQGWHOHSKRQH
QHWZRUNPXVWFRPSO\ZLWKWKHDSSOLFDEOH)&&3DUWUXOHVDQGUHTXLUHPHQWVDGRSWHG
E\WKH$&7$$FRPSOLDQWWHOHSKRQHFRUGDQGPRGXODUSOXJLVSURYLGHGZLWKWKLV
SURGXFW,WLVGHVLJQHGWREHFRQQHFWHGWRDFRPSDWLEOHPRGXODUMDFNWKDWLVDOVR
FRPSOLDQW6HHLQVWDOODWLRQLQVWUXFWLRQVIRUGHWDLOV
Notes f 7KLVHTXLSPHQWPD\QRWEHXVHGRQFRLQVHUYLFHSURYLGHGE\WKHWHOHSKRQHFRPSDQ\
f 3DUW\OLQHVDUHVXEMHFWWRVWDWHWDULIIVDQGWKHUHIRUH\RXPD\QRWEHDEOHWRXVH\RXU
RZQWHOHSKRQHHTXLSPHQWLI\RXDUHRQDSDUW\OLQH&KHFNZLWK\RXUORFDOWHOHSKRQH
FRPSDQ\
f 1RWLFHPXVWEHJLYHQWRWKHWHOHSKRQHFRPSDQ\XSRQSHUPDQHQWGLVFRQQHFWLRQRI
\RXUWHOHSKRQHIURP\RXUOLQH
f ,I\RXUKRPHKDVVSHFLDOO\ZLUHGDODUPHTXLSPHQWFRQQHFWHGWRWKHWHOHSKRQHOLQH
HQVXUHWKHLQVWDOODWLRQRIWKLVSURGXFWGRHVQRWGLVDEOH\RXUDODUPHTXLSPHQW,I\RX
KDYHTXHVWLRQVDERXWZKDWZLOOGLVDEOHDODUPHTXLSPHQWFRQVXOW\RXUWHOHSKRQH
FRPSDQ\RUDTXDOLfiHGLQVWDOOHU
US Number is located on the cabinet bottom
REN number is located on the cabinet bottom
2 Rights of the Telephone Company
2
6KRXOG\RXUHTXLSPHQWFDXVHWURXEOHRQ\RXUOLQHZKLFKPD\KDUPWKHWHOHSKRQH
QHWZRUNWKHWHOHSKRQHFRPSDQ\VKDOOZKHUHSUDFWLFDEOHQRWLI\\RXWKDWWHPSRUDU\
GLVFRQWLQXDQFHRIVHUYLFHPD\EHUHTXLUHG:KHUHSULRUQRWLFHLVQRWSUDFWLFDEOHDQG
WKHFLUFXPVWDQFHVZDUUDQWVXFKDFWLRQWKHWHOHSKRQHFRPSDQ\PD\WHPSRUDULO\
GLVFRQWLQXHVHUYLFHLPPHGLDWHO\,QFDVHRIVXFKWHPSRUDU\GLVFRQWLQXDQFHWKH
WHOHSKRQHFRPSDQ\PXVWSURPSWO\QRWLI\\RXRIVXFKWHPSRUDU\GLVFRQWLQXDQFH
DIIRUG\RXWKHRSSRUWXQLW\WRFRUUHFWWKHVLWXDWLRQDQGLQIRUP\RXRI\RXUULJKWWR
EULQJDFRPSODLQWWRWKH&RPPLVVLRQSXUVXDQWWRSURFHGXUHVVHWIRUWKLQ6XESDUW(RI
3DUW)&&5XOHVDQG5HJXODWLRQV
Privacy of communications may not be ensured when using this phone.
Warning:
FCC RF Radiation Exposure Statement
base unit
cordless handset
Information for DECT Product
4
Table of Contents
Equipment Approval Information
Interference Information
Licensing
Hearing Aid Compatibility
FCC RF Radiation Exposure Statement
Information for DECT Product
Introduction
Parts Checklist
2
3
3
3
4
4
7
7
Installation
8
-Telephone Jack Requirements
-Digital Security System
Important Installation Guidelines
Handset Layout
Base Layout
Installing the Phone
Telephone Operation
-Making calls with the cordless handset
-Making calls with the corded handset (from the base)
-Making calls in the speakerphone mode (from the base)
-Making calls in the speakerphone mode (from the handset)
-Making calls with the optional headset
-Pre-dialing
-Answering a Call
-Switching between the speakerphone, handset & headset
mode
-Mute
-Do not disturb
-Flash
-Inserting a pause in the dialing sequence
-Redial
-Reviewing the Redial Numbers
-Storing a Redial Record in Directory
-Transferring a call to another extension
-Receiving a transferred call from another extension
-Ringer on/off and ringer volume
-Speakerphone, handset and headset volume
-Hold
-Conference calls
8
9
10
11
-Installing the handset battery
11
-Base Station
12-14
Programming the Phone
15
-Standby Screen
15
-Programming Functions
15
-Phone Setting
15
-Date/Time
16
-Auto Answer
16 Intercom Calls
-One-touch /memory log
-Auto Answer Intercom
16
-Answering an intercom call
-Dial Mode
17
-Page
-Area Code
17
-Auto Standby
-Registration
17
-Register
18 Caller ID (CID)
-Remove Handset
18
-Receiving and storing CID records
-De-Register
18
-Reviewing CID records
-Add Headset
18
-Saving a CID record to the phone directory
-2nd Call Alert
19
-Deleting a CID record
-Handset Name
19
-Deleting all call records
-Update Handset List
19
-Dialing back
-Display Setting
19
-Call waiting caller ID
-Contrast
20
-Backlight
20 Directory & One-Touch Memory
-Adding directory entries
-Sound Setting
20
-Storing a record in the one-touch/memory buttons
-VOICE MAIL
21
-Reviewing directory records
-Answering System
21
-On/Off Status
21
-Editing a name or number stored in the one-touch/
memory log
-Outgoing Message (OGA) Playback 22
-Set Office Time
22
-Reviewing record in the one-touch/memory
-Set Work Hours
23
-Editing a directory record
-Set After Hours
23
-Copying a directory record
-Ring Delay
24
-Deleting a directory record
-Message Length
24
-Deleting all directory records
-Call Screening
24
-Deleting a one-touch/memory
-Message Alert
24
-Dialing a directory record
-Remote Password
25
-Dialing a one-touch memory/record
-Restore Setting
25
25
25
25
26
26
26
27
27
27
28
28
28
28
29
29
29
30
30
30
30
31
31
32
32
32
32
32
33
33
33
34
34
34
34
35
36
36
36
37
37
37
37
38
38
38
39
39
39
5
Table of Contents Cont.
Answering System Operation
-Answering system on/off
-Recording incoming messages
-Monitoring incoming calls
-Memo record
-Memo recording
-Message/memo playback
-Erasing messages
-Remote access from remote party
-Memory full
Changing the Battery
Battery Safety Precautions
Display Messages
Handset Sound Signals
-Backup battery operation
Troubleshooting Guide
-Telephone solutions
-Caller ID solutions
-Battery
General Product Care
Causes of Poor Reception
Warranty Assistance
Limited Warranty
6
40
40
40
40
41
41
41
42
42
43
43
43
44
45
45
46
46
47
47
48
48
49
50-51
Introduction
CAUTION: When using telephone equipment, there are basic safety
instructions that should always be followed. Refer to the IMPORTANT
SAFETY INSTRUCTIONS provided with this product and save them for future
reference.
IMPORTANT: Because cordless phones operate on electricity, you should have
at least one phone in your home that isn’t cordless, in case the power in your
home goes out.
Parts Checklist
Coiled Handset
Cord
Corded
Handset
Belt Clip
Telephone
2- Line cords
AC power
adaptor
(for base)
AC power
adaptor
(for charging
cradle)
Handset battery
pack
Telephone Jack Requirements
Charging
Cradle
Short Line Cord
Wall plate
fi
fi
Cordless
Handset
7
Modular
telephone line
jack
7
Installation
Digital Security System
Your cordless phone uses a digital security system to protect against false
ringing, unauthorized access, and charges to your phone line.
INSTALLATION NOTE: Some cordless telephones operate at frequencies that
may cause or receive interference with nearby TVs, microwave ovens, and
VCRs. To minimize or prevent such interference, the base of the cordless
telephone should not be placed near or on top of a TV, microwave ovens, or
VCR. If such interference continues, move the cordless telephone farther away
from these appliances.
Certain other communications devices may also use the 1.9 GHz frequency
for communication, and, if not properly set, these devices may interfere with
each other and/or your new telephone. If you are concerned with interference,
please refer to the owner’s manual for these devices on how to properly set
channels to avoid interference. Typical devices that may use the 1.9 GHz
frequency for communication include wireless audio/video senders, wireless
computer networks, multi-handset cordless telephone systems, and some longrange cordless telephone systems.
Important Installation Guidelines
f $YRLGVRXUFHVRIQRLVHDQGKHDWVXFKDVPRWRUVflXRUHVFHQWOLJKWLQJPLFURZDYH
RYHQVKHDWLQJDSSOLDQFHVDQGGLUHFWVXQOLJKW
f $YRLGDUHDVRIH[FHVVLYHGXVWPRLVWXUHDQGORZWHPSHUDWXUH
f $YRLGRWKHUFRUGOHVVWHOHSKRQHVRUSHUVRQDOFRPSXWHUV
f 1HYHULQVWDOOWHOHSKRQHZLULQJGXULQJDOLJKWQLQJVWRUP
f 1HYHULQVWDOOWHOHSKRQHMDFNVLQZHWORFDWLRQVXQOHVVWKHMDFNLVVSHFLfiFDOO\GHVLJQHGIRU
ZHWORFDWLRQV
f 1HYHUWRXFKQRQLQVXODWHGWHOHSKRQHZLUHVRUWHUPLQDOVXQOHVVWKHWHOHSKRQHOLQHKDV
EHHQGLVFRQQHFWHGDWWKHQHWZRUNLQWHUIDFH
f 8VHFDXWLRQZKHQLQVWDOOLQJRUPRGLI\LQJWHOHSKRQHOLQHV
8
Handset Layout
Visual Indicator
3 Soft keys
Display
DND/ Privacy
(button)
Exit
(button)
Spk
(Speaker button)
Headset Jack
CID
(button)
VOL +/(buttons)
End
(button)
DIR
(button)
Talk
(button)
* Tone
(button)
# Pause
(button)
Redial
(button)
Mute/ Del
(button)
Int/ Hold
(button)
Menu/ Flash
(button)
9
Base Layout
Vol +/(buttons)
Display
DND/ Privacy
(button)
Ans Sys
(button)
CID / Next
(button)
DIR / Prev
(button)
One Touch/
Memory Log (1- 10)
buttons
3 Soft Keys
Exit
(button)
Play/ Stop
(button)
Memo
(button)
Delete
(button)
Headset
Jack
* Tone (button)
Headset
(button)
Speaker
(button)
Redial
(button)
# Pause
(button)
Hold
(button)
Mute
(button)
Flash
(button)
Page
(button)
Intercom
(button)
Line 1 & 2
(buttons)
10
T-T104 (GP, 2.4V, 550mAh),
Base Station
7KHSKRQHPD\EHFRQQHFWHGWRWZROLQH5-&ZDOOMDFNVWRDFFRPPRGDWHDOOWZROLQHV
&KRRVHDQDUHDQHDUDQHOHFWULFDORXWOHWDQGDWHOHSKRQHZDOOMDFN5-&DQGSODFH
\RXUFRUGOHVVWHOHSKRQHRQDOHYHOVXUIDFHVXFKDVDGHVNWRSRUWDEOHWRSRU\RXPD\
PRXQWLWRQWKHZDOO
,QVWDOO$$$VL]HDONDOLQHEDWWHULHVQRWLQFOXGHGIRUEDFNXSSRZHULQWKHHYHQWRID
SRZHUIDLOXUH
f ,QVHUWDflDWKHDGVFUHZGULYHURU VLPLODUREMHFWLQWRWKHEDWWHU\GRRUODWFKDQGJHQWO\
SU\XSZDUGWRUHOHDVHWKHEDWWHU\GRRUIURPWKHEDVH
f ,QVHUWWKHEDWWHULHVLQVLGHWKHEDWWHU\FRPSDUWPHQWDVVKRZQRQWKHGLDJUDP
f 6QDSWKHEDWWHU\FRPSDUWPHQWGRRUEDFNLQWRSODFH
NOTE: If the low battery icon appears in the display, you need to replace the
batteries. It is important that you replace them as soon as possible to maintain
unit operation when electrical power is off. As a precaution, you may want to
write down any stored information you do not want erased.
IMPORTANT: If you are not going to use the telephone for more than 30 days,
remove the batteries because they can leak and damage the unit.
3OXJWKHSRZHUVXSSO\FRUGLQWRWKHSRZHUMDFNRQWKHEDFNRIWKHEDVHDQGWKHRWKHU
HQGLQWRDQHOHFWULFDORXWOHW
CAUTION: To reduce risk of personal injury, fire, or damage use only the
T-2757 (base) power adaptor listed in the user’s guide. This power adaptor
is intended to be correctly orientated in a vertical or floor mount position.
&RQQHFWWKHWHOHSKRQHOLQHFRUGV
,I\RXKDYHVLQJOHOLQHZDOOMDFNVLQVWDOOHGLQ\RXUKRPHRURIfiFH\RXFDQXVH
DGDSWRUVFRXSOHUVQRWLQFOXGHGWRFRPELQHWKHVLQJOHWHOHSKRQHOLQHVLQWRGXDO
OLQHV7KHDGDSWRUFRXSOHUPD\ORRNVLPLODUWRWKHRQHSLFWXUHGKHUHDQGFDQEH
SXUFKDVHGIURP\RXUORFDOWHOHSKRQHSURGXFWVUHWDLOHU
Line 2
12
Line 1
2U\RXFDQXVHWKHVLQJOHWHOHSKRQHOLQHVSOXJLQWRWKHMDFNVRQWKHEDFNRIWKH
WHOHSKRQH
Line 1
Line 2
,I\RXKDYH/LQHDQG/LQHZLUHGLQWRRQHZDOOMDFNLQ\RXUKRPHRURIfiFH\RXFDQ
XVHRQHRIWKHVXSSOLHGWHOHSKRQHOLQHFRUGVWRFRQQHFWIURPWKHZDOOMDFNWRWKH
/LQHMDFNRQWKHEDFNRIWKHSKRQHDVVKRZQEHORZ
Line 1 + 2
,I\RXZDQWWRPRXQWWKHWHOHSKRQHRQWKHZDOO\RXFDQSOXJWKHOLQHVVXFKDVWKH
EHORZGUDZLQJ
Line 2
Line 1
25
13
Line 2
Line 1
25
Line 1 & 2
&RQQHFWWKHKDQGVHWFRUG
14
&RQQHFWRQHHQGRIWKHFRLOHGKDQGVHWFRUGWRWKHMDFNRQWKHVLGHRIWKHEDVHDQGWKH
RWKHUHQGLQWRWKHMDFNLQWKHKDQGVHWDQGSODFHWKHKDQGVHWLQWKHFUDGOH
Programming the Phone
Standby Screen
NOTE: The Soft keys will change according to the status of the unit.
NOTE: The base LCD has a dedicated “SET CLOCK” icon flashing when the clock
is not set. Please go to menu “Phone Setting- Date /Time” to set the clock.
Programming Functions
Answering SYS., Voice Mail and Restore Setting.
NOTE: During programming, you may press the BACK Soft key (left) at any time
to exit the sub-menu and return to the main menu, or press exit key to exit
programming and return to standby screen.
NOTE: If no key is pressed for 30 seconds, the handset or base will automatically
exit programming and return to standby screen.
Phone Setting
OFF
menu
MENU
VOL
SELECT
fi
Add Headset (base only)
15
Date/Time
From the Phone Setting Menu:
VOL
Date/Time
2. Press SELECT Soft key.
3. LCD will display last-set time (or, if the device is new or has been reset to default, the LCD will display
12:00AM 01/01/11)
4. Use the dial-pad to enter digits for the current time and date.
Note: Use DIR/CID button to move the cursor and the AM/PM softkey to set the time AM or PM.
5. Press SAVE softkey to confirm the setting, a confirmation tone will indicate that your selection has been
saved.
NOTE: If you subscribe to Caller ID service, the current Date/Time is set
automatically when you receive your first CID record and will override manually
set Date/Time. However the Year must still be set manually. The Year
information is not in the CID record.
NOTE: The Date/Time setting item only exists in base menu, handset Date/Time
should update automatically after it is set in the base.
Auto Answer (only applicable for cordless handset)
Talk/Spk/L1/L2
From the Phone Setting Menu:
VOL
SELECT
Auto Answer
VOL
SELECT
Auto Answer Intercom
(applicable for base and cordless handset)
From the Phone Setting Menu:
VOL
SELECT
Off
SELECT
16
Auto Answer Int.
VOL
Dial Mode (only applicable for base)
From the Phone Setting Menu:
vol
Dial Mode
SELECT
3. Use the VOL (- or +) button to toggle between L1 and L2 and press Select soft key
to confirm, then use the VOL (- or +) button to scroll to Tone or Pulse.
SELECT
NOTE: The Dial mode only can be set in the base menu.
Area Code (only applicable for base)
From the Phone setting Menu:
vol
Area code
SELECT
SAVE
.
Registration (only applicable to handset)
NOTE: If a handset has not been registered to the base, then the display
will show PRESS REG TO INITIATE REGISTRATION once the handset has been
activated. Press the REG Soft key to start the registration.
NOTE: If an optional cordless headset has been registered to the base ,
up to 9 cordless handset can be registered to one base .
From the Phone Setting Menu:
VOL
Registration
SELECT
17
Register
From the Phone Setting Menu:
VOL
Register
SELECT
Register HS Registering....
page
about 3 seconds
Registering
Registration complete
fi
REGISTRATION FAILED!
Remove Handset
WARNING: It is not recommended that a handset be deregistered unless
absolutely necessary because once a handset is deregistered, that
handset’s telephone features cannot be used until the handset is
re-registered.
From the Phone Setting Menu:
VOL
Remove handset
SELECT
Remove handset?
YES
fi
Press REG to
initiate registration
NOTE: You can press the REG Soft key to enter the registation mode again.
De-Register (only applicable for base)
From the Phone Setting Menu:
vol
vol
Deregistration
SELECT
SELECT
Remove handset?
YES
fi
Press REG to initiate registration
base emit a confirm tone
Add Headset (only applicable for base)
Note: This wireless headset option is only compatible with the RCA 25065RE1.
From the Phone Setting Menu:
Talk On/Off
Note: Only one cordless Headset may pair with a base unit.
18
2nd Call Alert
From the Phone Setting Menu:
VOL
SELECT
On
2ND Call Alert
VOL
SELECT
Handset Name (only applicable for handset)
From the Phone Setting Menu:
VOL
SELECT
Handset name
Handset
NOTE: If you make a mistake, press DIR/CID button to move the cursor forward
or backward, and then use the mute/del button to backspace and delete one
character at a time.
SAVE
Update Handset List (only applicable for base)
From the Phone Setting Menu:
vol
Update HS List
SELECT
Display Setting
OFF
menu
VOL
MENU
Display Setting
SELECT
19
Language
From the Display Setting Menu:
VOL
Language
SELECT
English
VOL
English , Francais
Español
SELECT
Contrast
From the Display Setting Menu:
VOL
Contrast
SELECT
VOL
VOL
SELECT
Backlight (only applicable for base)
From the Display Setting Menu:
vol
Backlight
SELECT
vol
Always On
Automatic
SELECT
Sound Setting
OFF
menu
MENU
VOL
SELECT
Sound Setting
fi
Ring Tone
From the Sound Setting Menu:
VOL
Ring Tone
SELECT
3. Use the VOL (- or +) button to toggle between L1 and L2 and use the VOL (- or +) button to
scroll to your selection.The default setting is Melody 1 for Line1 and Melody 2 for Line 2.
SELECT
20
Ring Volume
From the Sound Settings Menu:
VOL
Ring Volume
SELECT
3. Use the VOL (- or +) button to toggle between L1 and L2 and use the VOL (- or +) button to
scroll to your selection.The default setting is VOL 3.
SELECT
Key Tone
From the Sound Settings Menu:
VOL
SELECT
Key Tone
VOL
On
Off
SELECT
Voice Mail
From the Main Menu:
This feature is used to conveniently access the voicemail feature offered by your telephone service provider.
NOTE: You must subscribe to telephone service provider-offered voicemail on at least one phone
line in order for this feature to operate.
1. Make sure your phone is in idle mode. (not in Talk mode)
2. Press the MENU Soft key (left) to go to the main menu.
3. Press VOL (- or +) button to scroll to Voice Mail.
4. Press SELECT Soft key (right) to confirm and you may program the following items:
Call VM
Settings
Call VM
From the Voice Mail Menu:
1. Press VOL (- or +) button to scroll to Call VM.
2. Press SELECT Soft key
3. Use the VOL (- or +) button to toggle between Line 1 and Line 2 and press SELECT soft key to select.
4. The phone will dial your voicemail access number. You may proceed to access your voicemail per
your service provider’s instructions.
Settings
From the Voice Mail Menu:
1. Press VOL (- or +) button to scroll to Settings.
2. Press SELECT Soft key
3. Use the VOL (- or +) button to toggle between Line 1 and Line 2 and press SELECT soft key to select.
4. Use the dial pad to enter the call-in access number for your voicemail. Press Delete button to
backspace and delete numbers, if necessary.
5. Press SAVE Soft key.
6. A confirmation tone will indicate that your selection has been saved.
Answering System (only applicable for base)
OFF
21
MENU
VOL
SELECT
Answering Sys.
fi
fi
On/Off Status
From the Answering Sys Menu:
VOL
On/Off Status
SELECT
VOL
Line1 or Line2, press select softkey and then use
Vol(- or +) button to select On or Off.
SELECT
Outgoing Message (OGA) Playback
From the Answering Sys Menu:
VOL
OGA Playback
SELECT
Use VOL(- or+) to select Line1 or Line2, press select softkey and then use Vol(- or +)
button to select the direct OGA record.
SELECT
EMPTY
Outgoing Message (OGA) Record
From the Answering Sys Menu:
1.
VOL
2.
OGA Record
SELECT
3. Use VOL(- or+) to select Line1 or Line2, press select softkey and then use Vol(- or +)
button to select the direct OGA.
4.
SELECT
5.
FINISH
6.
Set Outgoing Message (OGA)
From the Answering Sys Menu:
VOL
1.
2.
Set OGA
SELECT
3. Use VOL(- or+) to select Line1 or Line2, press select softkey and then use Vol(- or +) button to
select the direct OGA record.
4.
SELECT
EMPTY
an error tone will be emit.
22
NOTE: If you select the option “TIMED”, the “Work Hours” OGA and “After Hours” OGA MUST
berecorded first. When there is an incoming call, the “Work Hours” OGA or “After Hours”
OGA will be played to the caller according to the office time you set.
Set Office Time
From the Answering Sys Menu:
VOL
Set Office Time
SELECT
Set Work Hours
From the Set Office Time Menu:
VOL
Set Work Hours
SELECT
AM/PM
AM
PM
SAVE
5. Use the Yes or No Soft key for Announce Only.
NOTE: If you select Yes for Announce Only, the “Work Hours” OGA and “After Hours” OGA
The unit will hang up the call after announcing the greeting when
answering the call is in the answering mode.
Set After Hours
From the Set Office Time Menu:
VOL
Set After Hours
SELECT
AM/PM
AM
PM
SAVE
5. Use the Yes or No Soft key for Announce Only.
NOTE: If you select Yes for Announce Only, the “Work Hours” OGA and “After Hours” OGA
. The unit will hang up the call after announcing the greeting when
answering the call is in the answering mode.
23
Ring Delay
From the Answering Sys Menu:
VOL
Ring Delay
SELECT
Use VOL(- or+) to select Line1 or Line2, press select softkey and then use Vol(- or +) button
to select from 2 rings to 6 rings or toll saver.
SELECT
NOTE: When the Toll saver is selected, the unit will answer the incoming call
after 3 rings if there is new message. Otherwise, the unit will answer the
incoming call after 5 rings.
Message Length
From the Answering Sys Menu:
VOL
Message Length
SELECT
Use VOL(- or+) to select Line1 or Line2, press select softkey and then use VOL(- or +) button to
select from 1 to 3 minutes.
SELECT
Call Screening
From the Answering Sys Menu:
VOL
SELECT
Call Screening
VOL
On
Off
On
Off
SELECT
Message Alert
From the Answering Sys Menu:
VOL
SELECT
SELECT
24
Message Alert
VOL
Off
Remote Password
From the Answering Sys Menu:
VOL
Remote Password
SELECT
000.
3. Use the Clear Soft key to delete the current Remode password,then use the touch-tone pad to
enter your desired 3-digit security code.
SAVE
NOTE: Use the Clear soft key or Delete button can delete the exist numbers and then
enter the new password.
Restore Setting
From the Standby or Idle Mode (not in Talk mode) :
menu
MENU
VOL
Restore Setting
SELECT
LOAD TO DEFAULT?
YES
fi
then reset the unit automatically after the base shows " please
wait..." in the display for about 3 seconds.
NO
Telephone Operation
Making Calls with the Cordless Handset
Talk
line 1
fi
line 2
end
fi
Making Calls with the Corded Handset (from the base)
fi
line 1
line 2
fi
25
Making Calls in the Speakerphone Mode (from the base)
speaker
line 1
fi
line 2
One-Touch/Memory Log
speaker
fi
NOTE: After pick the line, the call timer starts to run until all the calls are hung
up. The timer serves for both 2 lines.
Making Call in the Speakerphone Mode (from the handset)
Spk
fi
Press the Line1 or Line2 Softkey to select a specific line. The Handset will activate the ear
piece. Then press the SPK button to switch to the speakerphone mode.
2.
end
3.
fi
Making Calls with the RCA Wireless Headset
Please refer to the Instruction Booklet for your RCA Wireless Headset for instructions
on setup and use.
Making Calls with a Wired Headset
headset
fi
Talk
fi
headset
end
Note: Although this device will accept a variety of standard 2.5mm telephone headsets,
RCA does not guarantee compatibility with 3rd party devices. Performance may vary
depending on the quality of the headset.
26
.
Pre-Dialing
1. With the phone idle, manually enter the telephone number. The maximum pre-dialing
number length is 32 digits, if the number is over 32 digits, it will emit an error tone. The
telephone number shows in the display.
2. Press the DIAL Soft key (on base only), Spk button, Talk button (handset only), or line
1 or line 2 button to take a line, or pick up the corded handset (on the base only) and
then the telephone number will be dialed out.
Answering a Call
For cordless handset:
1. Press the Talk button to answer the call in receiver mode,
-OR2. Press the Spk button to answer the call in speakerphone mode,
-OR3. Press the corresponding LINE Soft key to answer the call in receiver mode.
4. When finished, press end button.
For the base:
1. Pick up the corded handset,
-OR2. Press the speaker button to answer the call in speakerphone mode,
-OR3. Press the corresponding line button to answer the call in speakerphone mode,
-OR4. Press the headset button on base to answer the call in headset mode.
5. Press the Talk On/Off button on the cordless headset (only applicable for RCA 25065RE1).
6. When finished, hang up the corded handset or press Spk button (in speakerphone) or
headset button (in headset mode) or press the Talk On/Off button on the cordless headset
(only applicable for RCA 25065RE1) to end the call.
NOTE: If you have set the Auto Answer as On in the cordless handset, you can
answer the call directly by picking up this handset from the charger, without
pressing any buttons.
NOTE: Adjust the volume by pressing the vol (- or +) button during a call.
Switching Between the Speakerphone, Handset and Headset
Mode
Base
To switch to the speakerphone, press speaker button. The speakerphone indicator
illuminates. Place the corded handset back into the cradle.
To switch to the corded handset, pick up the handset. The speakerphone or corded headset
indicator will turn off .
27
Redial
3UHVVWKHTalk EXWWRQ RQWKHFRUGOHVVKDQGVHWRUSUHVVWKH SpkEXWWRQVSHDNHUSKRQH
PRGHRUSUHVVWKH headset EXWWRQKHDGVHWPRGHRUSLFNXSWKHFRUGHGKDQGVHW
IURPWKHEDVH DQGWKHfiUVWDYDLODEOHOLQHZLOOJRRIIKRRN,IERWKOLQHVDUHDYDLODEOH/LQH
ZLOOEHXVHG
25
3UHVVD line EXWWRQWRVHOHFWDOLQH
3UHVVWKHredialEXWWRQ7KHUHGLDOQXPEHUOLVWODVWSUHYLRXVO\GLDOHGQXPEHUVLV
VKRZQ
8VHWKHVOLRUEXWWRQWRVHOHFWWKHQXPEHU3UHVVWKH DIAL 6RIWNH\WRGLDORXWWKH
QXPEHU
NOTE: If the number you dialed is longer than 32 digitals, It will not be saved in the redial
list and can't be redialed.
Reviewing the Redial Numbers
<RXUSKRQHUHFRUGVXSWRWKUHHSUHYLRXVO\GLDOHGSKRQHQXPEHUV
:KHQWKHSKRQHLVLGOHSUHVVWKH redial EXWWRQ
8VHWKHVOLRUEXWWRQWRYLHZWKHODVWWKUHHSUHYLRXVO\GLDOHGQXPEHUV
:KLOHWKHSUHIHUUHGQXPEHULVGLVSOD\HGSUHVVWKH SpkTalk Dline EXWWRQRUSLFNXS
WKHFRUGHGKDQGVHW WRGLDOWKHSKRQHQXPEHU
NOTE: If you do not select a line button, the line is automatically seized and the
number is dialed accordingly.
Storing a Redial Record in Directory
0DNHVXUHWKHSKRQHLV OFFQRWLQ7DONPRGH
3UHVVWKH redial EXWWRQWKHQXVHWKH VOLRUEXWWRQWRVFUROOWRWKHGHVLUHGUHGLDO
QXPEHU
3UHVVWKHSAVE6RIWNH\
7KHVFUHHQGLVSOD\V Enter Name ,QSXWDQDPHE\SUHVVLQJWKHNH\SDG
NOTE: More than one letter is stored in each of the number keys so it requires
more than one press for some letters. For example, for the letter “B” press the
number 2 key twice. To add a space press the 1 key.
NOTE: A name must be input otherwise the record cannot be stored.
3UHVVWKHSAVE6RIWNH\7KHGHVLUHGUHGLDOQXPEHUVKRZVLQWKHGLVSOD\
<RXFDQHGLWWKHWHOHSKRQHQXPEHU E\XVLQJWKHdelete EXWWRQDQGQXPEHUNH\V 3UHVV SAVE6RIWNH\WRHQWHUWKH9,37RQH0HORG\VHOHFWLRQ
8VH VOLRUEXWWRQWRVFUROOWRWKHGHVLUHGULQJWRQHPHORG\DQGSUHVVSELECT6RIW
NH\WRFRPSOHWH
NOTE: If an incoming call number matches this record the VIP Tone Melody will
ring.
29
Transferring a Call to Another Extension
1. Press XFER Soft key when the phone is in Talk mode. The current call is put on hold.
2. Use VOL (- or +) to select the desired handset or base you want to transfer to, and then
press the SELECT Soft key.
3. The unit will intercom ring the selected handset or base.
Wait until the selected handset or base answers the intercom call and have a
conversation and then hang up to finish the transfer or press Conference to have a 3
way conference call.
4. If the selected unit rejects the intercom call, or the call is not answered within 30 seconds, the
call is transferred back to the original unit and the display will show as below a) or b)
Receiving a Transferred Call from Another Extension
If the unit receives a transfer call paging, Intercom call from base/Handset X shows in the
display. Press the Talk button (handset only) or speaker button (both base and handset) or
leave the corded handset on the base unit to answer the call.
If you press the REJECT Soft key or the call is not answered within 30 seconds , the
intercom paging will be stopped and the call is transferred back to the original unit.
Ringer On/Off and Ringer Volume
1. Make sure the phone is in idle mode.
2. Press the VOL (- or +) button to activate the ringer volume setting. Press Line1 or Line2 button to
select the direct line which you want to set, then use the VOL (- or +) button to scroll to your selection.
The default setting is VOL 3.
3. Press the SELECT Soft key to save your selection.
NOTE: If you choose the ringer OFF, the screen displays L1/L2 RINGER OFF.
Speakerphone, Handset, and Corded Headset Volume
While the phone is in use, during the desired mode, press the VOL (+ or -) buttons until
you reach a comfortable listening level. The phone stores the setting after the last button
pressed.
30
Hold
,Q7DONPRGHSUHVVWKH hold EXWWRQWRKROGWKHOLQH Line X ON HOLD VKRZVLQWKH/&'
GLVSOD\DQGWKHOLQHLFRQZLOOflDVK2QWKHEDVHWKH line EXWWRQLQGLFDWRUZLOOflDVKDOVR
:KHQWKHOLQHLVRQKROGWKHKROGDOHUWWRQHZLOOEHHPLWWHG WRERWKWKHSHUVRQRQKROGDQG
WRWKHXVHUWKDWLQLWLDWHGWKHKROG
3UHVVWKHFRUUHVSRQGLQJ LINE 6RIWNH\RQKDQGVHWRUWKHline EXWWRQRQEDVHWRUHOHDVH
WKHKROGDQGSLFNXSWKHFDOODJDLQ
Conference Calls
7KLVV\VWHPFDQVXSSRUWZD\DQGZD\FRQIHUHQFHFDOOV
Join a call in progress:
:KLOHDFDOOLVLQSURJUHVVDQRWKHUXVHUFDQMRLQWKDWFDOOE\SUHVVLQJWKHFRUUHVSRQGLQJ
line EXWWRQRQWKHEDVHXQLWRU6RIWNH\LQWKHKDQGVHW%RWKSDUWLHVRQWKHRULJLQDOFDOO
ZLOOKHDUDWRQHWRDOHUWWKHPVRPHRQHHOVHKDVMRLQHGWKHFDOO
NOTE: If the privacy feature is On for the original call, the call cannot be joined
by another user.
3-way conference call by an intercom call:
:KLOHRQDFDOOSUHVVWKH intercom EXWWRQZDLWIRUWLPHUWRFOHDUIURPWKHVFUHHQ
SUHVVWKH intercom EXWWRQDJDLQDQGWKHQVHOHFWWKHGHVLUHGKDQGVHWRUEDVHWR
LQWHUFRP
7KHVHOHFWHGKDQGVHWRUEDVHZLOOHPLWDSDJHWRQH7KHXVHUFDQSUHVVWKH Talk EXWWRQ
RQWKHKDQGVHWRUWKH speakerEXWWRQRQWKHEDVHWRDQVZHUWKHLQWHUFRPFDOOSDJH
7KHRULJLQDWLQJFDOOHUFDQWKHQSUHVVWKH CONF 6RIWNH\VKRZQRQWKHGLVSOD\WR
HVWDEOLVKDZD\FRQIHUHQFHEHWZHHQWKHH[WHUQDOFDOOHUDQGWKHLQWHUFRPFDOO
3-way conference call with two lines:
'XULQJDFDOORQ/LQHSUHVVWKHhold EXWWRQWRSXWWKHFDOORQKROG
3UHVVWKHline 2 EXWWRQRU6RIWNH\RQWKHKDQGVHWWRJHWDGLDOWRQH'LDOWKHQXPEHU
DQGWKHQWDONWRWKHRWKHUSHUVRQ
7KHRULJLQDWLQJFDOOHUFDQWKHQSUHVVWKH CONF 6RIWNH\VKRZQRQWKHGLVSOD\WR
HVWDEOLVKDZD\FRQIHUHQFHEHWZHHQWKHWZROLQHV
4-way conference call (Line 1 + Line 2 + 2 extension):
2QFHWKHEDVHXQLWRUKDQGVHWKDVERWK/LQHDQGRQKROGSUHVVWKH intercom
EXWWRQDQGWKHQVHOHFWWKHGHVLUHGKDQGVHWRUEDVHWRLQWHUFRP
7KHVHOHFWHGKDQGVHWRUEDVHZLOOHPLWDSDJHWRQH7KHXVHUFDQSUHVVWKHTalk EXWWRQ
RQWKHKDQGVHWRUWKH speaker EXWWRQRQWKHEDVHWRDQVZHUWKHLQWHUFRPFDOOSDJH
7KHRULJLQDWLQJFDOOHUFDQWKHQSUHVVWKH CONF 6RIWNH\VKRZQRQWKHGLVSOD\WRLQLWLDWH
DFRQIHUHQFH6LQFH/LQHDQGDUHERWKRQKROGWKHXVHUZLOOEHSURPSWHGWRVHOHFW
/LQH/LQHRU%RWKWRFRQIHUHQFHZLWK7KHXVHUFDQWKHQXVHWKH6RIWNH\VWRVHOHFW
WKHGHVLUHGRSWLRQ,IWKH BOTH 6RIWNH\LVVHOHFWHGDZD\FRQIHUHQFHLVHVWDEOLVKHG
EHWZHHQWKHRULJLQDWLQJFDOOHUERWKOLQHVDQGWKHLQWHUFRPFDOO
31
Intercom Calls
One-Touch/Memory Log
One-Touch/Memory Log
One-Touch/Memory Log
intercom
VOL
SELECT
fi
NOTE: To abort intercom call, press the STOP Soft key.
NOTE: If the receiving station does not answer within 30 seconds, the
intercom call is cancelled. You will hear an error tone and the screen displays
Unavailable .
Answering an Intercom Call
REJECT
Page
fl
page
exit
Auto Standby
32
Paging from Base
page
STOP
Caller ID (CID)
IMPORTANT: In order to use this unit’s Caller ID features, you must subscribe
to either the standard Name/Number Caller ID Service or Call Waiting Caller ID
Service. To know who is calling while you are on the phone, you must subscribe
to Call Waiting Caller ID Service.
Base Display
L1
LINE1
LINE2
Handset Display
Receiving and Storing CID Records
NEW
the line1 and line2 phone numbers shows
on the display separately
exit
fi
fi
Reviewing CID Records
CID
VOL
the unit emit a warning tone and then scroll to
the end or the start of the record.
FORMAT
STORE
33
Saving a CID Record to the Phone Directory
NOTE: If you want to change the format of the CID number to 7, 10 or 11 digits
and save it in the directory, press the FORMAT Soft key to format the CID
number fi rst before pressing the STORE Soft key. See the “Dialing Back” section
for more information on formatting a number.
STORE
SAVE
NOTE: The name fi eld cannot be left empty.
SAVE
VOL
SELECT
NOTE: If an incoming call number matches this record the VIP Tone Melody will
ring.
Deleting a CID Record
delete
DELETE?
OK
fi
Deleting All Call Records
Delete All ?
OK
fi
delete
A confirm tone emit and Empty
Dialing Back
headset
Talk
Spk
If You Programmed Your Local Area Code
CID
FORMAT
FORMAT
34
line 1
line 2
Directory and One-Touch Memory
Adding Directory Entries
OFF
DIR
NEW
Enter Name
NOTE: More than one letter is stored in each of the number keys so it requires
more than one press for some letters. For example, for the letter “B” press the
number 2 key twice. To add a space press the 1 key.
NOTE: The name field cannot be left empty.
SAVE
Enter Number
TIP: Press the #pause button twice to insert a pause in a number if necessary.
SAVE
NOTE: If an incoming call number matches this record the VIP Tone Melody will
ring.
VOL
SELECT
NOTE: If Memory full shows in the display, you should delete one or more
unnecessary records and repeat above steps to continue the call record
storage.
Storing a Record in the One-Touch Memory Buttons
(Only applicable for base)
OFF
STORE
Select Button Location
One-Touch/Memory Log
NOTE: If there is a record stored in selected memory location. Press REPLACE
Soft key to confirm overwrite or press the BACK Soft key, then repeat the step 1~3 to
select a new location.
Enter Name
36
NOTE: More than one letter is stored in each of the number keys so it requires
more than one press for some letters. For example, for the letter “B” press the
number 2 key twice. To add a space press the 1 key.
NOTE: The name field cannot be left empty.
SAVE
Enter Number
TIP: Press the #pause button twice to insert a pause in a number if necessary.
SAVE
Reviewing Directory Records
OFF
DIR
VOL
4. Then you can press Menu softkey and then use VOL(- or +) to select View to review the direct
record.
Editing a Name or Number Stored in the
One-Touch /Memory Log
DIR
One-Touch/Memory Log
EDIT
Record in One-Touch Dialing ”
“Storing
NOTE: The left and right (DIR & CID) navigational buttons allow the cursor to be
moved. The delete button can be used to delete character or number to the left
of the cursor.
Reviewing Record in One-Touch Memory
OFF
DIR
One-Touch/Memory Log
Editing a Directory Record
VOL
Press Menu soft key and then use VOL(- or +) to select Edit Entry.
“Handset Name”
SAVE
SAVE
VOL
37
NOTE: If an incoming call number matches this record the VIP Tone Melody will
ring.
SELECT
NOTE: Press the BACK Soft key to keep the previous setting (making no
changes).
Copying a Directory Record
In the extension handset:
COPY
Copy Current Record or Entire Directory?
ENTIRE
CURR
Record Copied to Base Unit!
fi
In the Base Unit:
COPY
Copy Current Record or Entire Directory?
ENTIRE
CURR
vol
SELECT
Record Copied!
fi
Saved
Deleting a Directory Record
VOL
delete
Delete?
OK
fi
Deleting All Directory Records
DIR
delete
OK
Empty.
38
DELETE ALL?
fi
Deleting a One-Touch /Memory
DIR
delete
OK
fi
NOTE: Press the exit button to cancel the “delete” function.
Dialing a Directory Record
Dial a directory record while in Talk (handset only) mode:
ON
line
Talk Spk
DIR
VOL
DIAL
Dial a directory record while reviewing it:
OFF
DIR
VOL
Talk
Spk
speaker line 1/2
Dialing a One-Touch/Memory Record
(Only applicable for base)
while in Talk mode:
ON
Spk
Line
One-Touch/Memory Log
while reviewing it:
OFF
DIR
One-Touch/Memory Log
speaker
line 1/2
39
Answering System Operation
There are two mailboxes in the system. One is for Line 1 and another is for Line 2.
For memo recording, you can select which mailbox is used to record the memo.
Answering System On/Off
Press and hold the base Ans Sys button for 2 seconds, the Base unit will show the On/Off Status
menu, setting the On/off status please refer to the Answering On/Off section.The Answering a
system light illuminates when the function is activated.
If the ans sys button indicator is flashing, pressing it will go to the Play Message display.
Otherwise, pressing the button will display Line 1 and Line 2 On/Off status for 3 seconds.
Recording Incoming Messages
The unit will answer incoming calls or routed calls after X rings (pickup delay set in Menu)
and play the outgoing greeting. After hearing the greeting followed by a long beep, the
caller can leave a message. If there is a new message recorded in the unit, the Answering
system indicator will flash, and the envelope icon shows in the LCD.
NOTE: Your unit will record a message up to the maximum length of time you
set as long as the caller continues speaking. To save recording capacity, your
unit will automatically stop recording after 7 seconds of silence or if there is a
steady dial tone for 7 seconds.
The maximum recording time for each incoming message can be set in Menu.
Monitoring Incoming Calls
Whenever an incoming message is being recorded you can hear it through the speaker
if Call Screening is On. To take the call, press Line button on base or Line softkey on handset
to pick up the available line.
40
Memo Record
memo
memo
Press VOL (- or +) button to toggle between Mailbox 1 or Mailbox 2, press SELECT
button to confirm.
Record memo after beep
Recording
FINISH
NOTE: The maximum duration allowed for memo is the same as the message
length setting in the menu.
Memo Recording (Only applicable for handset )
From the Handset Main Menu:
vol
Memo recording
Press VOL (- or +) button to toggle between Mailbox 1 or Mailbox 2, press SELECT
button to confirm.
Record memo after beep
Recording
FINISH
Message/Memo Playback
ans sys
SELECT
DIR/prev
play
fl
Use VOL(- or +) can select
DIR/prev
CID/next
“You have NO messages”
41
Erasing Messages
To erase a message while it is playing
delete
OK
fi
fi
To erase all previously played messages in a mailbox
delete
messages in line X mailbox?
Delete all
OK
Remote Access From Remote Party
NOTE: The default security code is 000.
NOTE: Only the message being played can be erased in remote access mode.
42
T-T104 (GP, 2.4V, 550mAh),
Display Messages
DELETE ALL?
DELETE?
ENTER NAME
ENTER NUMBER
NEW CALLS
HANDSET NAME
UNAVAILABLE
NO LINE
LINE IN USE
EMPTY
OUT OF RANGE
BLOCKED
UNKNOWN
INCOMPLETE
DATA
HEADSET
CONNECTED
44
Handset Sound Signals
Signal
Meaning
$ORQJZDUEOLQJWRQHZLWKULQJHURQ
6LJQDOVDQLQFRPLQJFDOO
7ZRVKRUWEHHSVVHYHUDOWLPHV
3DJHVLJQDO
2QHEHHSHYHU\VHFRQGV
2QHORQJEHHSDIWHUSUHVVRQHNH\
$VKRUWZDUEOLQJWRQHZLWKULQJHURQ
/RZEDWWHU\ZDUQLQJ
&RQfiUP
(UURU
Backup Battery Operation
,IWKHSRZHUFRUGLVQRWSOXJJHGLQWRWKHXQLWDQGWKHEDWWHU\LVDYDLODEOHWKHXQLWHQWHUV
%DWWHU\2SHUDWLRQ0RGH,QWKLVPRGHWKH EDVHLVIXOO\IXQFWLRQDO 45
Caller ID Solutions
No Display
f &KDUJHWKHEDWWHU\IRUKRXUV2UUHSODFHWKHEDWWHU\
f 0DNHVXUHWKHXQLWLVFRQQHFWHGWRDQRQVZLWFKHGHOHFWULFDORXWOHW'LVFRQQHFWWKH
SRZHUDGDSWRUIURPWKHEDVHDQGUHFRQQHFWLW
No Caller ID
f <RXPXVWEHVXEVFULEHGWRWKHVWDQGDUG1DPH1XPEHU&DOOHU,'VHUYLFHIURP\RXU
ORFDOWHOHSKRQHFRPSDQ\WRUHFHLYH&,'LQIRUPDWLRQ
Battery
,I\RXH[SHULHQFHDQ\RIWKHIROORZLQJSUREOHPVHYHQDIWHUUHFKDUJLQJWKHEDWWHU\\RX
PD\QHHGWRUHSODFHWKHEDWWHU\SDFN
f 6KRUWWDONWLPH
f 3RRUVRXQGTXDOLW\
f /LPLWHGUDQJH
47
1-800-511-3180
1-800-511-3180.
302
49
What your warranty covers:
t%FGFDUTJONBUFSJBMTPSXPSLNBOTIJQ
For how long after your purchase:
t5XPZFBSTGSPNEBUFPGQVSDIBTF
What we will do:
t1SPWJEFZPVXJUIBSFQMBDFNFOUVOJU5IFFYDIBOHFVOJUJTVOEFSXBSSBOUZGPSUIFSFNBJOEFSPGUIF
PSJHJOBMQSPEVDUhTXBSSBOUZQFSJPE
How you get service:
t-PDBUFZPVSQSPPGPGQVSDIBTFJOUIFGPSNPGBCJMMPGTBMFPSSFDFJQUFEJOWPJDFXIJDIJTFWJEFODFUIBUUIF
QSPEVDUJTXJUIJOUIFXBSSBOUZQFSJPE1SPPGPGXBSSBOUZFMJHJCJMJUZJTSFRVJSFEBOENVTUCFQSFTFOUFEUP
PCUBJOXBSSBOUZTFSWJDF
t$POUBDU3$"$VTUPNFS$BSFBU
0VSSFQSFTFOUBUJWFTXJMMIFMQZPVUSPVCMFTIPPUBOE
EJBHOPTFUIFQSPCMFN"TZPVNBZCFBTLFEUPEJTDPOOFDUZPVS3$"UFMFQIPOFGSPNJUhTQPXFSTPVSDFZPV
NVTUDBMMGSPNBOPUIFSUFMFQIPOF*GUIFJTTVFDBOOPUCFSFTPMWFECZPVS$VTUPNFS$BSF5FBNZPVXJMMCF
JTTVFEBO3."3FUVSO.FSDIBOEJTF"VUIPSJ[BUJPO
OVNCFSBOECFHJWFOJOTUSVDUJPOTPOIPXUPTVCNJU
ZPVSQSPPGPGQVSDIBTFQBQFSXPSLBOEXIFSFUPTFOEZPVSEFGFDUJWFNFSDIBOEJTF
t:PVXJMMCFSFTQPOTJCMFGPSTIJQQJOHUIFEFGFDUJWFVOJUCBDLUPPVSXBSSBOUZGVMöMMNFOUDFOUFSBUZPVS
PXOFYQFOTF:PVBSFSFTQPOTJCMFGPSEBNBHFPSMPTTEVSJOHTIJQNFOUTPJOTVSJOHUIFQSPEVDUEVSJOH
SFUVSOTIJQQJOHJTIJHIMZSFDPNNFOEFE
t8FXJMMTIJQBSFQMBDFNFOUUPZPVGSFJHIUQSFQBJE
What your warranty does not cover:
t$VTUPNFSJOTUSVDUJPO:PVS*OTUSVDUJPO#PPLQSPWJEFTJOGPSNBUJPOSFHBSEJOHPQFSBUJOHJOTUSVDUJPOTBOE
VTFSDPOUSPMT"EEJUJPOBMMZPVS$VTUPNFS$BSF$FOUFSJTTUBòFEYXJUIQSPEVDUFYQFSUTUIBUDBOBTTJTU
ZPVXJUIBOZRVFTUJPOTUIBUNBZBSJTFEVSJOHTFUVQBOEVTFPGZPVS3$"UFMFQIPOF
t*OTUBMMBUJPOBOETFUVQTFSWJDFBEKVTUNFOUT
t#BUUFSJFT
t%BNBHFGSPNNJTVTFPSOFHMFDU
t1SPEVDUTUIBUIBWFCFFONPEJöFEPGTFSWJDFEPVUTJEFUIF64"
t1SPEVDUTQVSDIBTFEGSPNOPOBVUIPSJ[FESFUBJMFSTEFBMFSTPSSFTFMMFST
t1SPEVDUTQVSDIBTFEPSTFSWJDFEPVUTJEFUIF64"
t"DUTPGOBUVSFTVDIBTCVUOPUMJNJUFEUPMJHIUOJOHEBNBHF
50
Limitation of Warranty:
THE WARRANTY STATED ABOVE IS THE ONLY WARRANTY APPLICABLE TO THIS PRODUCT .
ALL OTHER WARRANTIES , EXPRESS OR IMPLIED (INCLUDING ALL IMPLIED WARRANTIES OF
MERCHANTABILITY OR FITNESS FOR A PARTICULAR PURPOSE) ARE HEREBY DISCLAIMED . N O
VERBAL OR WRITTEN INFORMATION GIVEN BY TELEFIELD NA INC., ITS AGENTS, OR EMPLOYEES
SHALL CREATE A GUARANTY OR IN ANY WAY INCREASE THE SCOPE OF THIS WARRANTY .
REPAIR OR REPLACEMENT AS PROVIDED UNDER THIS WARRANTY IS THE EXCLUSIVE
REMEDY OF THE CONSUMER . TELEFIELD NA INC. SHALL NOT BE LIABLE FOR INCIDENTAL OR
CONSEQUENTIAL DAMAGES RESULTING FROM THE USE OF THIS PRODUCT OR ARISING OUT OF
ANY BREACH OF ANY EXPRESS OR IMPLIED WARRANTY ON THIS PRODUCT . THIS DISCLAIMER
OF WARRANTIES AND LIMITED WARRANTY ARE GOVERNED BY THE LAWS OF THE STATE OF
OREGON. EXCEPT TO THE EXTENT PROHIBITED BY APPLICABLE LAW, ANY IMPLIED WARRANTY
OF MERCHANTABILITY OR FITNESS FOR A PARTICULAR PURPOSE ON THIS PRODUCT IS LIMITED
TO THE APPLICABLE WARRANTY PERIOD SET FORTH ABOVE.
How state law relates to this warranty:
t4PNFTUBUFTEPOPUBMMPXUIFFYDMVTJPOOPSMJNJUBUJPOPGJODJEFOUBMPSDPOTFRVFOUJBMEBNBHFTPSMJNJUBUJPOT
POIPXMPOHBOJNQMJFEXBSSBOUZMBTUTTPUIFBCPWFMJNJUBUJPOTPSFYDMVTJPOTNBZOPUBQQMZUPZPV
t5IJTXBSSBOUZHJWFTZPVTQFDJöDMFHBMSJHIUTBOEZPVBMTPNBZIBWFPUIFSSJHIUTUIBUWBSZGSPNTUBUFUP
TUBUF
If you purchased your product outside the USA, Mexico or Canada:
5IJTXBSSBOUZEPFTOPUBQQMZ$POUBDUZPVSEFBMFSGPSXBSSBOUZJOGPSNBUJPO
51
302
1
Model 25255RE2
T0008003 (REV 06 E)
12-32
Printed in China
25255RE2
52
Was this manual useful for you? yes no
Thank you for your participation!

* Your assessment is very important for improving the work of artificial intelligence, which forms the content of this project

Download PDF

advertising