Owner`s Manual - Hearth & Home Technologies

Owner`s Manual - Hearth & Home Technologies
Owner’s Manual
Care and Operation
INSTALLER: Leave this manual with party responsible for use and operation.
Owner: Retain this manual for future reference.
Contact your local dealer with questions on installation, operation or service.
WARNING
NOTICE: SAVE THESE INSTRUCTIONS
Please read this entire manual before
installation and use of this pellet fuelburning room heater.
Failure to follow these instructions could
result in property damage, bodily injury
or even death.
Model(s):
Absolute43 Freestanding Pellet Stove
• Do not store or use gasoline or other flammable vapors
and liquids in the vicinity of this or any other appliance.
• Do not overfire - If any external part starts to glow, you
are overfiring. Reduce feed rate. Overfiring will void
your warranty.
• Comply with all minimum clearances to combustibles
as specified. Failure to comply may cause house fire.
WARNING
Absolute43
Use & Care Video
HOT SURFACES!
Glass and other surfaces are hot
during operation AND cool down.
Hot glass will cause burns.
• Do not touch glass until it is cooled
• NEVER allow children to touch glass
• Keep children away
• CAREFULLY SUPERVISE children in same room as
stove.
!
CAUTION
Tested and approved for wood pellet and/or 50/50 mixture
of pellet/corn fuel only. Burning of any other type of fuel
voids your warranty.
!
High temperatures may ignite clothing or other
flammable materials.
• Keep clothing, furniture, draperies and other flammable
materials away.
NOTE
CAUTION
Check building codes prior to installation.
• Installation MUST comply with local, regional, state and
national codes and regulations.
• Contact local building or fire officials about restrictions
and installation inspection requirements in your area.
1
• Alert children and adults to hazards of high temperatures.
To obtain a French translation of this manual, please
contact your dealer or visit www.harmanstoves.com
Pour obtenir une traduction française de ce manuel, s’il
vous plaît contacter votre revendeur ou visitez www.
harmanstoves.com
Harman® • Absolute43 Owner’s Manual_R1 • 2015 -___ • 03/15
3-90-777000c
Read this manual before operating this appliance.
Please retain this Owner’s Manual for future reference.
Read the Installation Manual before making any installation or finishing changes.
Congratulations, The Harman® Absolute43 pellet stove you
have selected is designed to provide the utmost in safety,
reliability, and efficiency.
This owner’s manual should be retained for future reference.
We suggest that you keep it with your other important
documents and product manuals.
As the owner of a new pellet stove, you’ll want to read and
carefully follow all of the instructions contained in this owner’s
manual. Pay special attention to all cautions and warnings.
Your new Harman® Absolute43 Freestanding Pellet Stove will
give you years of durable use and trouble-free enjoyment.
Welcome to the Harman® family!
Listing Label Information/Location
The model information regarding your specific stove can be found on the
rating plate usually located in the control area of the stove.
Serial Number
Model Name
Model: ABSOLUTE43
Report #/Rapport #135-S-32-2
MINIMUM CLEARANCES TO
COMBUSTIBLES
Back Wall to Appliance
2”
Side Wall to Appliance
6"
Corner Installation
Walls to Appliance
6.25”
Use a non-combustible floor protector
extending under and to the sides, front
and back of the unit as shown in floor
protection diagram. Measure front
distance from the surface of the glass
door.
Recommended:
Non-combustible
floor protection extended beneath
the flue pipe when installed with
horizontal venting.
Floor Protection*
USA
CANADA
Sides (A) 6”
152 mm
Back (B) 1”
25 mm
Front* (C) 6”
450 mm
*Measured From Glass in the USA
ONLY
Alcove Installation
Min. Alcove Height 42” (1067mm)
Max. Alcove Depth 24” (610mm)
Appareil de chauffage à granulés de bois
CONçU POUR MAISONS MOBILES
2"
6"
6.25"
This area musT be
kepT blank
6.25"
Test to/testé à ASTM E 1509-12, ULC-S627-00
Test date: April 2014
Room Heater, Pellet Fuel-Burning Type, Also
For Use In Mobile Homes. (UM) 84-HUD
“PREVENT HOUSE FIRES” Install and
use only in accordance with manufactures
installation and operation instructions.
Contact local building or fire officials about
restrictions and installation inspection in your
area.
WARNING: FOR MANUFACTURED HOMES:
Do not install appliance in a sleeping room. An
outside combustion air inlet must be provided.
The structural integrity of the manufactured
home floor, ceiling and walls must be
maintained.
Refer to manufacturer’s instructions and local
codes for precautions required for passing
chimney through a combustible wall or ceiling.
Inspect and clean exhaust venting system
frequently in accordance with manufacturer’s
instructions.
Use a 3” or 4” diameter type “L” or “PL” venting
system.
Do not connect this unit to a chimney flue
servicing another appliance.
Do not obstruct the space beneath the heater.
FOR USE WITH PELLETIZED WOOD FUEL
OR CORN/PELLET MIXTURE ONLY.
Input Rating Max: 5.0 lb. fuel/hr
Electrical Rating: 240 VAC, 50 Hz, Start 1.75
AMPS, Run 1.25 AMPS
U.S. Electrical Rating: 115 VAC, 60 Hz, Start
3.5 AMPS, Run 2.5 AMPS
Fuel Type: Wood Pellet, 50/50 Pellet/Corn
Mixture.
Route power cord away from unit.
OPERATE ONLY WITH DOORS CLOSED
B
A
USA
C
A
CAN
US ENVIRONMENTAL PROTECTION AGENCY
Certified to comply with July 1990 particulate emission standards.
This appliance complies with Canadian Standards Association (CSA) B415.1 and
Title 40 of the U.S. Code of Federal Regulations, Part 60, SubPart AAA.
352 Mountain House Road, Halifax, PA 17032 (é.-U.)
DANGER: Risk of electrical shock. Disconnect power supply before servicing.
Replace glass only with 5mm ceramic available from your dealer.
For further instruction refer to owner’s manual.
Keep viewing and ash removal doors tightly closed during operation.
2
Modèle: ABSOLUTE43
Room Heater Pellet Fuel-Burning Type
SUITABLE FOR MOBILE-HOME INSTALLATION
This pellet burning appliance has been tested and listed for use In
Manufactured Homes In accordance with OAR 814-23-900 through 814-23-909
ample
x
E
Test pour / tested à la norme ASTM E 1509-12, la norme
ULC- S627-00
Date du test: Avril 2014
Appareil de chauffage à granulés de type combustion de
carburant (UM ) 84 - HUD
"PRéVENIR LES FEUX DE MAISON" Installer et utiliser
uniquement en conformité avec installation et d'utilisation
les instructions du fabricant.
Contactez les responsables de feu ou de construction
locales sur les restrictions et l'inspection dans votre région.
AVERTISSEMENT: POUR maisons préfabriquées: Ne
pas installer l'appareil dans une salle de repos. Une entrée
d'air de combustion à l'extérieur doit être fournie. L' intégrité
de la structure du plancher de la maison, le plafond et les
murs fabriqué doit être maintenue.
Reportez-vous aux instructions du fabricant et les codes
locaux pour connaître les précautions nécessaires pour
faire passer la cheminée à travers un mur ou un plafond
combustible. Inspectez et nettoyez système d'évacuation
des gaz d'échappement souvent en conformité avec les
instructions du fabricant.
Utilisez un type de diamètre "L" 3 "ou 4" ou "PL" du système
de ventilation.
Ne pas connecter cet appareil à un conduit de cheminée
servant un autre appareil.
Ne pas obstruer l’espace sous le chauffe-eau.
POUR UTILISATION AVEC GRANULE DE BOIS.
Entrée Puissance Max: £ 5,0 combustible / h
Puissance électrique: 240 V, 50 Hz, Lancer 1.75 AMPS,
Exécuter 1.25 AMPS
États-Unis électrique Note: 115 VAC, 60 Hz, Lancer 3.5
AMPS, Run 2.5 AMPS
Type de carburant: granulés de bois, 5 mm de diamètre.
Route cordon électrique de l'appareil.
FAIRE FUNCTIONNER UNIQUEMENT LORSQUE LES
PORTES SONT FERMÉES
Serial No.
No de série:
008
BARCODE LABEL
DANGER: Risque d’électrocution. Coupez l’alimentation
électrique avant l’entretien.
Remplacer le verre avec 5 mm miroir verre céramique de
la même qualité disponible auprès de votre revendeur.
En tenant la porte d’entrée et le couvercle de la trémie
hermétiquement fermé pendant le fonctionnement de
l’appareil
DISTANCES DE SECURITE PAR RAPPORT AUX
MATERIAUX COMBUSTIBLES
Paroi arrière à l’appareil
51 mm
paroi latérale de l’appareil
152 mm
Installation en angle
Entre murs et apparell
159 mm
Installation en alcôve
Hauter minimale de l’alcôve
153 mm
Parois latérales de l’alcôve
915 mm
Profondeur maximale de l’alcôve
915 mm
PROTECTION DU SOL*
Côtés (A) 200 mm
Arrière (B) 25 mm
Avant (C) 450 mm
Utiliser une protection de sol non combustible sous
l’appereil qui s’étend sur les côtes, l’avant et l’arrière du
poêle (voir schéma). Pour la distance à l’avant, mesurer
à partir de la surface de la porte en verre.
ll est recommendé que la protection s’étende jusque sous
le conduit en cas d’installation d’un conduit horizontal ou
sous le té en cas conduit vertical.
Do not remove this label/Ne pas enlever cette
étiquette.Made in the USA/Fabriqué aux é.-U.
US Environmental Protection Agency
Certifié conforme aux normes Juillet 1990 d’émission de particules.
Cet appareil est conforme avec l’Association canadienne de normalisation (CSA) et B415.1
Titre 40 du Code of Federal Regulations, partie 60, section AAA.
Date of Manufacture / Date de fabrication
2015 2016 2017 JAN FEB MAR APR MAY JUN JUL AUG SEP OCT NOV DEC
3-90-777
Harman® • Absolute43 Owner’s Manual_R1 • 2015 -___ • 03/15
Manufactured by/Fabriqué par: Hearth and Home Technologies
Rev A
3-90-777000c
Table of Contents
1 Product Specifications and Important Safety Information
3 Reference Materials
A. Appliance Certification / Specifications . . . . . . . . . . . . . . . .
B. Mobile Home Approval. . . . . . . . . . . . . . . . . . . . . . . . . . . . .
C. BTU & Efficiency Specifications. . . . . . . . . . . . . . . . . . . . . .
D. Appliance Safety . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
E. Clear Space. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
F. Helpful Hints. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
G. Fuel Specification. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
H. Quick Start Guide. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
I. Frequently Asked Questions . . . . . . . . . . . . . . . . . . . . . . . .
A. Service Parts . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
B. Limited Lifetime Warranty. . . . . . . . . . . . . . . . . . . . . . . . . .
C. Loss of Power Addendum . . . . . . . . . . . . . . . . . . . . . . . . .
D. Emergency Manual Ignition. . . . . . . . . . . . . . . . . . . . . . . .
E. Troubleshooting. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
F. Contact Information . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
4
4
4
5
5
6
7
8
9
13
18
20
20
21
22
 = Contains updated information
2 Maintenance and Service
A. Proper Shutdown Procedure . . . . . . . . . . . . . . . . . . . . . . .
B. Quick Reference Maintenance Chart. . . . . . . . . . . . . . . . .
C. Burnpot Maintenance. . . . . . . . . . . . . . . . . . . . . . . . . . . . .
D. Combustion Fan Chamber. . . . . . . . . . . . . . . . . . . . . . . . .
E. Glass Maintenance. . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
F. Firebox. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
10
10
11
12
12
13
! Safety Alert Key:
• DANGER! Indicates a hazardous situation which, if not avoided will result in death or serious injury.
• WARNING! Indicates a hazardous situation which, if not avoided could result in death or serious injury.
• CAUTION! Indicates a hazardous situation which, if not avoided, could result in minor or moderate injury.
• NOTICE: Used to address practices not related to personal injury.
3
Harman® • Absolute43 Owner’s Manual_R1 • 2015 -___ • 03/15
3-90-777000c
1
Product Specific and Important Safety Information
A. Appliance Certification / Specifications
C. BTU & Efficiency Specifications
MODEL:
Absolute43 Pellet Stove
EPA Certification Number:
967-14
LABORATORY:
OMNI Test Laboratories, Inc
EPA Certified Emissions:
1.8 g/hr
REPORT NO.
135-S-32-2
*EPA Default Efficiency:
78%
Pellet Fueled/Supplementary For
Residential Use
**Actual Tested Efficiency:
69.3%
STANDARD(s):
ASTM E 1509-12, ULC-S627-00
***EPA BTU Output:
33,900
ELECTRICAL
RATING:
115 VAC, 60 Hz, Start 4.0 Amps, Run
3.0 Amps
****BTU Input
43,000
Vent Size:
3 Inch
Hopper Capacity:
52 lbs
Fuel
Wood Pellet, 50/50
Pellet/Corn Mixture
TYPE:
GLASS
5mm mirrored ceramic glass
SPECIFICATION:
NOTE: This installation must conform with local codes.
In the absence of local codes you must comply with the
ASTM E 1509-04, ULC-S627-00, (UM) 84-HUD
The Absolute43 is EPA certified to comply with July 1990
particulate emission standards.
B. Mobile Home Approval
This appliance is approved for mobile and manufactured
home installations when not installed in a sleeping room and
when an outside combustion air inlet is provided.
The structural integrity of the mobile home floor, ceiling, and
walls must be maintained. The appliance must be properly
grounded to the frame of the mobile home and use only listed
pellet vent, Class “PL” or “L” connector pipe.
A Harman® Outside Air Kit must be installed in a mobile home
installation.
!
WARNING
T he S tructural I ntegrity O f T he
Manufactured Home Floor, Wall, and
Ceiling/Roof Must Be Maintained.
Do not install in sleeping room.
!
WARNING
Risk of Fire! Hearth & Home Technologies disclaims any
responsibility for, and the warranty and agency listing will
be voided by the below actions.
*An efficiency based on EPA historical data of 78%
**Actual tested efficiency and data collected during EPA
emissions test
***A range of BTU outputs based on EPA default efficiency
and the burn rates from the low and high EPA tests
****Based on the maximum feed rate per hour multiplied by
approximately 8600 BTU’s which is the average BTU’s from
a pound of pellets.
DO NOT:
• Install or operate damaged appliance
• Modify appliance
• Install other than as instructed by Hearth & Home
Technologies
• Operate the appliance without fully assembling all
components
• Overfire
• Install any component not approved by Hearth &
Home Technologies
• Install parts or components not Listed or approved.
• Disable safety switches
Improper installation, adjustment, alteration, service or
maintenance can cause injury or property damage.
For assistance or additional information, consult a qualified
installer, service agency or your dealer.
NOTE: Hearth & Home Technologies, manufacturer of
this appliance, reserves the right to alter its products, their
specifications and/or price without notice.
Harman® is a registered trademark of Hearth & Home
Technologies.
4
Harman® • Absolute43 Owner’s Manual_R1 • 2015 -___ • 03/15
3-90-777000c
D. Appliance Safety (Cont.)
!
E. Clear Space
WARNING
If you expect that small children or vulnerable adults
may come into contact with this appliance, the following
precautions are recommended:
• Install a physical barrier such as:
WARNING
RISK OF FIRE! Do NOT place combustible objects
in front or to the sides of the appliance. High
temperatures may ignite clothing, furniture or draperies.
Mantel: Avoid placing candles and other heat-sensitive
objects on mantel or hearth. Heat may damage these objects.
- A decorative fire screen.
- Adjustable safety gate.
• Install a switch lock or a wall/remote control with child
protection lockout feature.
• Keep remote controls out of reach of children.
• Never leave children alone near a hot stove, whether
operating or cooling down.
• Teach children to NEVER touch the stove.
• Consider not using the stove when children will be
present.
• Use only specified components as replacement parts.
Other components may not allow your stove to operate
as it was intended.
Contact your dealer for more information, or visit: www.
hpba.org/safety-information.
To prevent unintended operation when not using your
stove for an extended period of time (summer months,
vacations, trips, etc):
• Unplug stove from receptacle.
Due to high temperatures, this stove should be placed
away from traffic, furniture and draperies.
Children and adults should be alerted to the hazards of
high surface temperatures and should stay away to avoid
burns to the skin and/or clothing.
Young children should be carefully supervised when they
are in the same room as the stove.
Clothing and other flammable materials should not be
placed on or near this stove.
Installation and repair of this stove should be done by
a qualified service person. The appliance should be
inspected before use and at least annually by a qualified
service person. More frequent cleaning will be required.
It is imperative that control compartments and circulating
air passageways of this stove be kept clean.
5
!
NOTICE: Clearances may only be reduced by means
approved by the regulatory authority having jurisdiction.
!
WARNING
RISK OF FIRE! Keep combustible materials, gasoline
and other flammable vapors and liquids clear of
appliance.
• Do NOT store flammable materials in the appliance’s
vicinity.
• Do NOT use gasoline, lantern fuel, kerosene, charcoal
lighter fluid or similar liquids to start or “freshen up” a
fire in this heater.
Keep all such liquids well away from the heater while it is
in use as combustible materials may ignite.
!
WARNING
Mobile/manufactured home guidelines: do
not allow installation in a sleeping room.
!
WARNING
Use of improper fuels, fire starters or
altering the stove for higher heat output
may cause damage to the stove and could
result in a House fire. Use only approved
fuels and operation guidelines
!
CAUTION
The stove is hot while in operation.
Keep children, clothing and furniture away.
Contact may cause skin burns.
Harman® • Absolute43 Owner’s Manual_R1 • 2015 -___ • 03/15
3-90-777000c
F. Helpful Hints
When operating your Harman® Absolute43 Pellet Stove,
follow basic safety standards. Read these instructions
carefully before you attempt to operate the Absolute43 Pellet
Stove. Failure to do so may result in damage to property or
personal injury and may void the product warranty.
Cleaning Burn Pot: Whenever your stove is not burning, take
the opportunity to scrape the burn pot to remove carbon buildup.
A vacuum cleaner is handy to remove the residue. Be sure the
stove is cold if you use a vacuum.
Carbon buildup can be scraped loose with the fire burning using the
special tool provided with your stove. Scrape the floor and sides of
the burn pot. The carbon will be pushed out by the incoming fuel.
Always wear gloves when scraping the burnpot.
Disposal of Ashes: Ashes should be placed in a steel
container with a tight fitting lid. The closed container of
ashes should be placed on a non-combustible floor or on the
ground, well away from all combustible materials, pending
final disposal. If the ashes are disposed of by burial in soil or
otherwise locally dispersed, they should be retained in the
closed container until all cinders have thoroughly cooled.
Other waste shall not be placed in this container.
Soot and Flyash Formation and Need for Removal: The
products of combustion will contain small particles of flyash.
The flyash will collect in the exhaust venting system and
restrict the flow of the flue gases. Incomplete combustion,
such as occurs during startup, shutdown, or incorrect
operation of the room heater will lead to some soot formation
which will collect in the exhaust venting system. The exhaust
venting system should be inspected at least once every year
to determine if cleaning is necessary.
When burning wood slowly, the potential exists for creosote
to form. The venting system should be inspected periodically
throughout the heating season to determine if creosote
buildup has occurred. If a significant layer of creosote
has accumulated (1/8” or more), it should be removed to
reduce the risk of a chimney fire. If a fire occurs, call the
fire department, shut down the stove, and evacuate the
residence. Before using the appliance, have the venting
system thoroughly inspected and replace any damaged
components.
With any hearth appliance, installation of smoke detectors
is recommended on every level of the home.
Possible causes of smoke detector activation:
Paint curing process - Open a window near the appliance
for the first few hours of burning.
Exhaust being drawn back inside the dwelling - Outside air
connection to the appliance is necessary.
Vent leakage - All interior seams and joints should be sealed
with silicone where applicable. Follow vent manufacturers
instructions for proper sealing.
!
G. Fuel Specifications
The Absolute43 Pellet Stove is approved for burning any
grade of pelletized bio-mass fuel. It is approved for burning
wood pellet fuel only.
It should be noted, however, that higher ash content will
require more frequent cleaning.
The moisture content of pellets must not exceed 8%. Higher
moisture will rob BTU’s and may not burn properly.
Fuel should not be stored within the stove installation
clearances or within the space required for cleaning and
ash removal.
Fuel and Fuel Storage
Pellet fuel quality can fluctuate from manufacturer to
manufacturer, and even from bag to bag.
Hearth & Home Technologies recommends using only fuel
that is certified by the Pellet Fuels Institute (PFI).
Fuel Material
• Made from sawdust and/or other wood by-products
• Shelled field corn (50/50 mixture with wood pellets)
• Source material typically determines ash content
Higher Ash Content Material
• Hardwoods with high mineral content
• Bark and leaves as source material
• “Standard” grade pellets, corn and other biomass
Lower Ash Content Material
• Softwood; pine, fir, etc.
• Materials with lower mineral content
• “Premium” grade pellets
Performance
• Higher ash content requires more frequent maintenance.
• “Premium” grade pellets will produce the highest heat
output.
• Burning pellets longer than 1-1/2 inches (38mm) can
cause inconsistent feeding and/or ignition.
Clinkers
• Minerals and other non-combustible materials, like sand,
will turn into a hard glass-like substance when heated.
• Trees from different areas will vary in mineral content.
For this reason, some fuels will produce more clinkers
than others.
Moisture
• Always burn dry fuel. Burning fuel with high moisture
content takes energy to dry and tends to cool the
appliance thus, robbing heat from your home.
• Damp pellet fuel could turn back into sawdust which
does not flow properly through the feed system.
CAUTION
This appliance must be vented to the outside
6
Harman® • Absolute43 Owner’s Manual_R1 • 2015 -___ • 03/15
3-90-777000c
G. Fuel Specifications (Cont.)
Shelled Field Corn
• Must be 15% moisture content or less
• Must be clean and free of debris
• Must be mixed with wood pellets. (Up to 50%)
• Stalk parts, excessive fines and cob remnants may
cause feed system jams or blockage
When changing from wood pellets to a corn/pellet mixture,
the feed limit will likely need adjusted to a lower setting.
When under maximum demand, ensure there is no
unburned fuel being pushed into the ash pan.
Storage
• Wood pellets should be left in their original sealed bag
until ready to use, to prevent moisture.
• Shelled corn should be stored in a tightly sealed container
to prevent moisture and to deter pests
• Do not store fuel within the specified clearance areas, or
in a location that will interfere with routine cleaning and
maintenance procedures.
NOTICE
Hearth & Home Technologies is not responsible for stove
performance or extra maintenance required as a result of
using fuel with higher ash or mineral content.
!
WARNING
Tested and approved for use with wood pellets and a
mixture of shelled field corn and wood pellets ONLY.
Burning of any other fuel will void your warranty.
!
WARNING
Risk of Chemical Poisoning!
Do NOT burn treated seed corn
• Chemical pesticides are harmful or fatal if swallowed
• Burning treated seed corn will void the product
warranty.
!
CAUTION
!
CAUTION
Do not burn fuel that contains an additive.
• May cause hopper fire
• Damage to product may result
Read the list of ingredients on the packaging. If you are
buying field corn, the only ingredient listed should be
field corn.
Tested and approved for use with wood pellets and a
mixture of shelled field corn and wood pellets ONLY.
Burning of any other fuel will void your warranty.
7
Harman® • Absolute43 Owner’s Manual_R1 • 2015 -___ • 03/15
3-90-777000c
H. Quick Start Guide
Initial start-up Only
1. Select Language
2. Fill hopper with pellets
3. Adjust arrows to set room desired temperature.
4. Touch the On/Off Power Icon.
Refer to Touch Manual for all other operations.
8
Harman® • Absolute43 Owner’s Manual_R1 • 2015 -___ • 03/15
3-90-777000c
I. Frequently Asked Questions
With proper installation, operation, and maintenance your appliance will provide years of trouble-free service. If you do
experience a problem, this troubleshooting guide will assist a qualified service person in the diagnosis of a problem and the
corrective action to be taken.
Contact your dealer for additional information regarding operation and troubleshooting. Visit www.harmanstoves.
com to find a dealer.
ISSUES
SOLUTIONS
Metallic noise.
Noise is caused by metal expanding and contracting as it
heats up and cools down, similar to the sound produced
by a furnace or heating duct. This noise does not affect the
operation or longevity of your appliance.
White ash buildup on glass.
This is normal. Clean the glass using any non-abrasive glass
cleaner.
Glass has buildup of black soot
Excessive build-up of ash. The lower burn settings will
produce more ash, the higher burn settings produce less.
The more it burns on low the more frequent cleaning of the
glass is required.
Glass has turned dirty.
Excessive build up of ash. The lower burn settings will
produce more ash, the higher burn settings produce less.
The more it burns on low the more frequent cleaning of the
glass is required.
Fire has tall flames with black tails and is lazy.
The feed rate needs to be reduced or the burnpot needs
cleaning. Heat exchanger or exhaust blower needs cleaning.
Smoky start-up or puffs of smoke from the airwash.
Either the burnpot is dirty or there is too much fuel at start-up
and not enough air.
Large flame at start-up.
This is normal. Flame will settle down once the fire is
established.
Missed Ignition
Ensure pellets in burnpot
Ensure holes in burnpot are clear of obstructions above the
igniter. See Burnpot Maintenance.
Check to see if the ignitor is getting hot, if not replace
ignitor. *See addendum for manual ignition instructions for
emergency heating needs.
9
Harman® • Absolute43 Owner’s Manual_R1 • 2015 -___ • 03/15
3-90-777000c
2
Maintenance & Service
When properly maintained, your stove will give you many
years of trouble-free service. Contact your dealer to answer
questions regarding proper operation, trouble-shooting and
service for your appliance. Visit www.harmanstoves.com to
find a dealer. We recommend annual service by a qualified
service technician.
A. Proper Shutdown Procedure
!
NOTICE
The type of fuel you are burning will dictate how often you
have to clean your burnpot. Clean more frequently if you
encounter heavy build-up of ash at the recommended
interval or you see soot coming from the vent. Not
properly cleaning your appliance on a regular basis
will void your warranty.
CAUTION
Shock and Smoke Hazard
• Turn unit to the off position, let appliance
completely cool and combustion fan must be off.
Now you can unplug appliance before servicing.
• Smoke spillage into room can occur if appliance
is not cool before unplugging.
• Risk of shock if appliance not unplugged before
servicing appliance.
Follow the detailed instructions found in this section
for each step listed in the chart below.
B. Quick Reference Maintenance Chart
Frequency
Cleaning or Inspection
Daily Weekly Monthly
Yearly
Ash Pan
Every 5 bags of fuel depending OR
on the fuel type or ash build-up
X
Ash Removal from Firebox
Every 5 bags or more
frequently depending on the
fuel type or ash build-up
OR
X
Heat Exchanger
Every 1 ton of fuel
OR
Fan, Combustion (Exhaust)
More frequently depending on
the fuel type
OR
Fan, Distribution
Every 25 bags or more
frequently depending on the
fuel type
OR
Door Gasket Inspection
Prior to heating season
OR
X
Exhaust Path
More frequently depending on
ash build-up
OR
X
Firebox - Prepare for Non-Burn Season
At end of heating season
OR
X
Burnpot - Burning pellets - hardwood
Every 3 bags
OR
X
Burnpot - Burning pellets - softwood
Every 5 bags
OR
X
Glass
When clear view of burnpot
becomes obscure
OR
Hopper / Hopper Lid Gasket
Every 50 bags of fuel or when
changing fuel types
OR
Venting System
More frequently depending on
the fuel type
OR
10
X
X
X
Harman® • Absolute43 Owner’s Manual_R1 • 2015 -___ • 03/15
X
X
X
3-90-777000c
C. Burnpot Maintenance
Weekly or when adding fuel, take the opportunity to clean
the burn pot. (Weekly at minimum)
• Pull the flame enhancer forward to access the grate
surface and pull any ashes from in front of the fire using
the burn pot scraper allowing it into the ash pan.
• Scrape the grate surface downward, toward the auger.
Figure 2.1. Any carbon deposits loosened at this time will
be pushed out as new fuel is fed in.
Flame Enhancer
Monthly, or after each ton of fuel burned:
After burning approximately 1 ton of pellets, a more thorough
cleaning is required to keep your stove running efficiently.
When the stove has completely cooled and stopped running,
it’s now safe to clean.
• Shut down the stove.
• Unplug the power cord from the outlet.
• Pull up on cover handle to gain access to igniter element
and cradle. Figure 2.2.
• Using the brush supplied, brush the igniter element free
of any ash or debris. Figure 2.2.
Figure 2.1
Pull up on the cover handle to
gain access to the igniter
The burnpot grate can be removed if needed. Figure 2.3.
• Remove the flame Enhancer by pulling straight up
removing tabs from burn pot sides.
• Remove the (2) 1/2” allen head bolts from each side of
the burn pot.
• Slide the grate toward you to remove.
Figure 2.2
Igniter Cradle
Viewed from below through the ash pan opening.
Remove Flame Enhancer
NOTE: the grate does not need to be removed to
properly clean the igniter. This part is removable for part(s)
replacement only.
!
Danger
!
CAUTION
Disconnect the power to the unit before removing
cover.
When cleaning burn pot clean-out chamber. Do not
damage the high temperature igniter wires.
(2) 1/2” Allen head bolts
Brush ash and debris from
Igniter Element.
Figure 2.3
11
Igniter Cradle and Element
Harman® • Absolute43 Owner’s Manual_R1 • 2015 -___ • 03/15
3-90-777000c
D. Combustion Fan Chamber
Glass - Replacement (Cont.)
Monthly Cleaning- continued:
Carefully remove damaged glass, gasket material, and hold
down clips (set aside).
The combustion inlet cover is located behind the ash pan
that must be removed to properly clean the combustion fan
blade. Figure 2.4.
• Remove combustion inlet cover by pulling up on cover.
This allows access to the combustion fan blade and
exhaust path. Figure 2.4.
• Remove any flyash or debris that has collected around
combustion fan blade with the provided paint brush.
Install the self adhesive 1/4” gasket material around the front
face of the glass. Set the glass panel and gasket gently onto
the door. Install the hold down clips and tighten with bolts.
Be sure to keep firing and de-ashing doors closed and insure
all seals are maintained and are in good condition
Replace glass only with high temperature mirrored ceramic glass.
• Clean exhaust passage.
NOTE: The ESP Sensor is located just inside the exhaust
passage. Be sure not to damage the ESP Sensor while
cleaning the exhaust passage.
• Once cleaned replace combustion inlet cover and ashpan.
Combustion Inlet Cover
Glass Gasket
Inspect door gasket during cleaning
and inspection
F. Firebox
Combustion Fan Blade
Exhaust Passage
Figure 2.4
Yearly Cleaning:
Remove flyash and carbon buildup from the smooth surfaces
of the heat exchanger as well as other surfaces inside the
firebox. Figure 2.7.
E. Glass Maintenance
The glass used in your stove is manufactured to exact standards
to withstand the high heat of the fire, but like all glass, it must be
treated with common sense and care. Never abuse the glass by
slamming the door shut or striking the glass with a heavy object.
If the glass is broken or damaged, do not operate the stove until
it has been replaced.
Glass - Cleaning
It will be necessary to clean accumulated ash from the glass
surface; allowing this ash to remain on the glass for long periods
can result in “etching” due to the acidity of the ash. Never clean the
glass while it is hot, and do not use abrasive substances. Wash
the surface with cool water, and rinse thoroughly. You may wish to
use a non-abrasive cleaner specifically designed for use on stove
glass. In any case, dry thoroughly before relighting your stove.
Glass - Replacement
If the stove’s glass is cracked or broken, you must replace it before
operating your stove. Remove pieces carefully. Replace glass only
with Harman® replacement glass; do not use substitutes.
12
Figure 2.7
Harman® • Absolute43 Owner’s Manual_R1 • 2015 -___ • 03/15
Scrape these areas free of flyash or
carbon buildup
3-90-777000c
3
Reference Material
A. Service Parts
Absolute 43
Service Parts
Beginning Manufacturing Date: March 2015
Ending Manufacturing Date: Active
Pellet Stove
1-90-777000-1 (Black)
1-90-777000-14 (Majolica Brown)
3
4
5
2
29
30
1
31
6
7
8
28
25
24
27
9
23
22
26
21
10
20
11
12
19
13
17
18
14
16
15
Part number list on following page.
13
Harman® • Absolute43 Owner’s Manual_R1 • 2015 -___ • 03/15
03/15
3-90-777000c
Absolute 43
Service Parts
Beginning Manufacturing Date: March 2015
Ending Manufacturing Date: Active
IMPORTANT:THISISDATEDINFORMATION.Partsmustbeorderedfromadealer
or distributor. Hearth and Home Technologies does not sell directly to consumers.Providemodelnumberandserialnumberwhenrequestingservicepartsfromyour
dealer or distributor.
ITEM
DESCRIPTION
1
Touch Control
2
16X8HopperLidGlass
PART NUMBER
1-00-777552
Y
3-40-777770
Y
Screwposts/Washers
Pkgof20Sets
1-00-129004
Y
Gasket3/8X1/2
20Feet
1-00-375501
Y
2Sets
1-00-0669697
5/16X1/2BallPlunger
Pkgof3
3-31-5500-3
Bulk5/16PushRetainer
Pkgof100
3
BlackPlatedKnobw/Screw
4
CompleteLatch
5
COMMENTS
Stocked at
Depot
1-00-02000-1
3-31-94807-100
HopperLidHingew/Hardware
HopperLidHingePinPlatesw/Hardware
6
Cast Top
7
HopperAssembly
Y
1-00-777771
1Set
1-00-777560
Black
4-00-247236S
MajolicaBrown
1-00-247236-14
Y
3-44-677185
Y
20Feet
1-00-375501
Y
Black
4-00-777645P
GasketHopperThroat
Gasket3/8X1/2
1-10-777611A
8
LeftSideCast
9
CombustionBlowerCapacitor
3-20-00276
10
SmokeShield
1-00-777593
MajolicaBrown
#11 Load Door
11.2
1-00-777645-14
11.4
11.5
11.6
11.3
11.1
Y
11.8
11.7
11
11.1
LoadDoor
CastLatch,Knob&Screw
1-00-0119
WoodHandle
3-40-00247
Black
Y
11.2
LoadDoorRope
MajolicaBrown
1-00-777565-14
Y
11.3
LatchBracketw/Hardware
1Set
1-00-777665
Y
Rollers&Hardware
1Set
1-00-77753
Y
15Feet
11.4
Gasket1/4RDPSA
11.5
10.031X12.313MirrorGlass
11.6
GlassClipsw/Hardware
11.7
LoadDoorHingew/Hardware
11.8
Gasket3/84Strand
1Set
30Feet
Additional service parts on following page.
14
4-00-777565P
Y
Harman® • Absolute43 Owner’s Manual_R1 • 2015 -___ • 03/15
1-00-2312
Y
3-40-777000
Y
1-00-777619
Y
1-00-777610
Y
1-00-00888
Y
3/15
3-90-777000c
Absolute 43
Service Parts
Beginning Manufacturing Date: March 2015
Ending Manufacturing Date: Active
IMPORTANT:THISISDATEDINFORMATION.Partsmustbeorderedfromadealer
or distributor. Hearth and Home Technologies does not sell directly to consumers.Providemodelnumberandserialnumberwhenrequestingservicepartsfromyour
dealer or distributor.
ITEM
DESCRIPTION
COMMENTS
PART NUMBER
12
BurnPotScraper
13
Ashlip
14
AshDoor,Complete
Gasket3/84Strand
30Feet
1-00-00888
Y
15
AshDoorHandleAssembly
1Set
1-00-777149
Y
Rollers&Hardware
1Set
1-00-77723
Y
1-10-777604A
Y
16
Pkgof10
Stocked at
Depot
2-00-777692-10
Black
3-00-777644P
MajolicaBrown
1-00-777644-14
1-10-777570A
AshPan
#17 Burn Pot Assembly
17.2
17.3
17.4
17.1
17.5
17.6
17
BurnPotAssembly
17.1
BurnPotWeldment
1-10-777801A
Y
Gasket
3-44-724114
Y
1-00-777818
Y
1-00-777200
Y
17.2
SwingPlate&FlameGuide
17.3
Igniterw/Bracket
17.4
IgniterBracketFront
17.5
BurnPotGrate
17.6
BurnPotCleanOutw/Hardware
18
19
1Set
Pkgof5
1-00-777815
1-00-777800
Y
1-00-777824
Y
5/16-18WingScrew
Pkgof25
3-30-8012-25
Y
LegLevelingKit
1Set
1-00-12302
Black
1-00-249100
Y
Y
Legw/Hardware
MajolicaBrown
1-00-249100-14
Black
4-00-777646P
MajolicaBrown
1-00-777646-14
20
RightSideCast
21
CombustionBlower
1-00-02275
Y
FanBlade
1-10-574500A
Y
22
PoundInStud6-32X11/4
Pkgof30
1-00-53463220
Gasket,BurnPot/Tailpipe
Pkgof5
1-00-07381
Y
23
PelletTailpipe,Cast
3-00-247237
Y
24
PowerCord
3-20-51578
Y
25
Gasket,BurnPot/Tailpipe
1-00-07381
Y
Pkgof5
Additional service parts on following page.
15
Harman® • Absolute43 Owner’s Manual_R1 • 2015 -___ • 03/15
3-90-777000c
Absolute 43
Service Parts
Beginning Manufacturing Date: March 2015
Ending Manufacturing Date: Active
IMPORTANT:THISISDATEDINFORMATION.Partsmustbeorderedfromadealer
or distributor. Hearth and Home Technologies does not sell directly to consumers.Providemodelnumberandserialnumberwhenrequestingservicepartsfromyour
dealer or distributor.
ITEM
DESCRIPTION
26
ESPProbe-Red/Red
27
Blower,100CFMTransflow120V
28
RearCover,Left
29
DifferentialSwitch
COMMENTS
PART NUMBER
Qty2req
Tubing,1/8Silicone
30
Stocked at
Depot
5Feet
RearCover,Right
#31 Feeder Assembly
3-20-00844
Y
3-21-07775
Y
1-00-777615
Y
3-20-6866
Y
1-00-5113574
Y
1-00-777613
Y
31.13
31.12
31.1
31.2
31.11
31.10
31.3
31.9
31.5
31.6
31.4
31.7
31.8
31
31.1
FeederAssembly
FeederBody
31.2
SlidePlateAssembly
31.3
FeedCover&Gasket
31.4
PusherArm
2Sets
1-10-777513A
Y
1-10-777690A
Y
1-00-677122
Y
1-10-677187W
Y
3-31-3614087-4
Y
31.5
Auger
3-50-00565
Y
31.6
BearingRetainerw/Hardware
1-00-04035
Y
Cam Bearing
3-31-3014
Y
31.7
CamBlockAssembly
1-10-777620A
Y
31.8
4RPMCWOutboardMotor,120V
3-20-00677
Y
31.9
MotorMountw/Hardware
1-00-777598
Y
PillowBlock
Pkgof4
31.10
FeederCrossoverTubeKit
31.11
Gasket,Snout
31.12
AirIntake
31.13
Gasket,AirIntake
Pkgof10
1-00-67900
Y
3-44-677160-10
Y
1-10-06810A
Pgkof6
3-44-72224-6
Y
Additional service parts on following page.
16
Harman® • Absolute43 Owner’s Manual_R1 • 2015 -___ • 03/15
3-90-777000c
Absolute 43
Service Parts
Beginning Manufacturing Date: March 2015
Ending Manufacturing Date: Active
IMPORTANT:THISISDATEDINFORMATION.Partsmustbeorderedfromadealer
or distributor. Hearth and Home Technologies does not sell directly to consumers.Providemodelnumberandserialnumberwhenrequestingservicepartsfromyour
dealer or distributor.
ITEM
DESCRIPTION
COMMENTS
PART NUMBER
CommunicationCable
3-20-72662
DraftMeterAssembly
1-00-00637
DraftMeterBolt&Tube
1-00-04004
ExternalTempExtension
3-20-70607
Y
HeatShield
1-00-777686
Y
InletCover
1-00-777607
PowerEntryModule
3-20-803744
Y
PowerBoard
1-00-05372
Y
ReturnAirSensor
3-20-08780
Y
ThermostatExtension
3-20-00607
Y
Black
TouchUpPaint
MajolicaBrown
WiringHarness,120V/60HZ
17
Stocked at
Depot
Harman® • Absolute43 Owner’s Manual_R1 • 2015 -___ • 03/15
Y
3-42-19905
1-00-0014
3-20-08777
Y
3-90-777000c
B. Limited Lifetime Warranty
Hearth & Home Technologies
LIMITED LIFETIME wARRANTY
Hearth&HomeTechnologies,onbehalfofitshearthbrands(”HHT”),extendsthefollowingwarrantyforHHT
gas,wood,pellet,coalandelectrichearthappliancesthatarepurchasedfromanHHTauthorizeddealer.
wARRANTY COVERAGE:
HHTwarrantstotheoriginalowneroftheHHTapplianceatthesiteofinstallation,andtoanytransfereetakingownership
oftheapplianceatthesiteofinstallationwithintwoyearsfollowingthedateoforiginalpurchase,thattheHHTappliance
willbefreefromdefectsinmaterialsandworkmanshipatthetimeofmanufacture.Afterinstallation,ifcoveredcomponentsmanufacturedbyHHTarefoundtobedefectiveinmaterialsorworkmanshipduringtheapplicablewarrantyperiod,
HHTwill,atitsoption,repairorreplacethecoveredcomponents.HHT,atitsowndiscretion,mayfullydischargeallofits
obligations under such warranties by replacing the product itself or refunding the verified purchase price of the product
itself. The maximum amount recoverable under this warranty is limited to the purchase price of the product. This warranty
issubjecttoconditions,exclusionsandlimitationsasdescribedbelow.
wARRANTY PERIOD:
Warrantycoveragebeginsonthedateoforiginalpurchase.Inthecaseofnewhomeconstruction,warrantycoverage
beginsonthedateoffirstoccupancyofthedwellingorsixmonthsafterthesaleoftheproductbyanindependent,
authorizedHHTdealer/distributor,whicheveroccursearlier.Thewarrantyshallcommencenolaterthan24months
followingthedateofproductshipmentfromHHT,regardlessoftheinstallationoroccupancydate.Thewarrantyperiodfor
parts and labor for covered components is produced in the following table.
Theterm“LimitedLifetime”inthetablebelowisdefinedas:20yearsfromthebeginningdateofwarrantycoveragefor
gasappliances,and10yearsfromthebeginningdateofwarrantycoverageforwood,pellet,andcoalappliances.These
time periods reflect the minimum expected useful lives of the designated components under normal operating conditions.
WarrantyPeriod
Parts
Labor
1Year
2 years
HHTManufacturedAppliancesandVenting
Gas
X
X
Wood
X
X
X
3 years
Pellet
EPA
Wood
Coal
X
X
X
X
X
X
X
X
X
Components Covered
Electric Venting
X
X
All parts and material except as
coveredbyConditions,
Exclusions,andLimitations
listed
Igniters,electroniccomponents,
and glass
Factory-installedblowers
Moldedrefractorypanels
X
Firepotsandburnpots
5 years
1 year
7 years
3 years
10
years
1year
X
Limited
3years
Lifetime
X
X
X
X
X
90Days
X
X
X
X
X
X
X
X
Castings and baffles
X
X
Manifoldtubes,
HHTchimneyandtermination
Burners,logsandrefractory
Fireboxandheatexchanger
X
X
All replacement parts
beyond warranty period
Seeconditions,exclusions,andlimitationsonnextpage.
4021-645F02-18-13
18
Page1of2
Harman® • Absolute43 Owner’s Manual_R1 • 2015 -___ • 03/15
3-90-777000c
B. Limited Lifetime Warranty (continued)
wARRANTY CONDITIONS:
•
ThiswarrantyonlycoversHHTappliancesthatarepurchasedthroughanHHTauthorizeddealerordistributor.Alistof
HHTauthorizeddealersisavailableontheHHTbrandedwebsites.
• ThiswarrantyisonlyvalidwhiletheHHTapplianceremainsatthesiteoforiginalinstallation.
•ThiswarrantyisonlyvalidinthecountryinwhichtheHHTauthorizeddealerordistributorthatsoldtheappliance
resides.
• Contactyourinstallingdealerforwarrantyservice.Iftheinstallingdealerisunabletoprovidenecessaryparts,contact
thenearestHHTauthorizeddealerorsupplier.Additionalservicefeesmayapplyifyouareseekingwarrantyservice
from a dealer other than the dealer from whom you originally purchased the product.
• Checkwithyourdealerinadvanceforanycoststoyouwhenarrangingawarrantycall.Travelandshippingcharges
for parts are not covered by this warranty.
wARRANTY ExCLUSIONS:
This warranty does not cover the following:
• Changesinsurfacefinishesasaresultofnormaluse.Asaheatingappliance,somechangesincolorofinteriorand
exterior surface finishes may occur. This is not a flaw and is not covered under warranty.
• Damagetoprinted,plated,orenameledsurfacescausedbyfingerprints,accidents,misuse,scratches,melteditems,
or other external sources and residues left on the plated surfaces from the use of abrasive cleaners or polishes.
• Repairorreplacementofpartsthataresubjecttonormalwearandtearduringthewarrantyperiod.Theseparts
include:paint,wood,pelletandcoalgaskets,firebricks,grates,flameguides,batteriesandthediscolorationofglass.
• Minorexpansion,contraction,ormovementofcertainpartscausingnoise.Theseconditionsarenormalandcomplaints related to this noise are not covered by this warranty.
• Damagesresultingfrom:(1)failuretoinstall,operate,ormaintaintheapplianceinaccordancewiththeinstallation
instructions,operatinginstructions,andlistingagentidentificationlabelfurnishedwiththeappliance;(2)failureto
installtheapplianceinaccordancewithlocalbuildingcodes;(3)shippingorimproperhandling;(4)improperoperation,abuse,misuse,continuedoperationwithdamaged,corrodedorfailedcomponents,accident,orimproperly/
incorrectlyperformedrepairs;(5)environmentalconditions,inadequateventilation,negativepressure,ordrafting
causedbytightlysealedconstructions,insufficientmake-upairsupply,orhandlingdevicessuchasexhaustfansor
forcedairfurnacesorothersuchcauses;(6)useoffuelsotherthanthosespecifiedintheoperatinginstructions;(7)
installationoruseofcomponentsnotsuppliedwiththeapplianceoranyothercomponentsnotexpresslyauthorized
andapprovedbyHHT;(8)modificationoftheappliancenotexpresslyauthorizedandapprovedbyHHTinwriting;
and/or(9)interruptionsorfluctuationsofelectricalpowersupplytotheappliance.
• Non-HHTventingcomponents,hearthcomponentsorotheraccessoriesusedinconjunctionwiththeappliance.
• Anypartofapre-existingfireplacesysteminwhichaninsertoradecorativegasapplianceisinstalled.
• HHT’sobligationunderthiswarrantydoesnotextendtotheappliance’scapabilitytoheatthedesiredspace.Informationisprovidedtoassisttheconsumerandthedealerinselectingtheproperappliancefortheapplication.Considerationmustbegiventoappliancelocationandconfiguration,environmentalconditions,insulationandairtightnessof
the structure.
This warranty is void if:
•
•
•
Theappliancehasbeenover-firedoroperatedinatmospherescontaminatedbychlorine,fluorine,orotherdamaging
chemicals.Over-firingcanbeidentifiedby,butnotlimitedto,warpedplatesortubes,rustcoloredcastiron,bubbling,
cracking and discoloration of steel or enamel finishes.
Theapplianceissubjectedtoprolongedperiodsofdampnessorcondensation.
Thereisanydamagetotheapplianceorothercomponentsduetowaterorweatherdamagewhichistheresultof,but
notlimitedto,improperchimneyorventinginstallation.
LIMITATIONS OF LIABILITY:
•
Theowner’sexclusiveremedyandHHT’ssoleobligationunderthiswarranty,underanyotherwarranty,expressor
implied,orincontract,tortorotherwise,shallbelimitedtoreplacement,repair,orrefund,asspecifiedabove.Inno
eventwillHHTbeliableforanyincidentalorconsequentialdamagescausedbydefectsintheappliance.Somestates
donotallowexclusionsorlimitationofincidentalorconsequentialdamages,sotheselimitationsmaynotapplytoyou.
Thiswarrantygivesyouspecificrights;youmayalsohaveotherrights,whichvaryfromstatetostate.EXCEPTTO
THEEXTENTPROVIDEDBYLAW,HHTMAKESNOEXPRESSWARRANTIESOTHERTHANTHEWARRANTY
SPECIFIEDHEREIN.THEDURATIONOFANYIMPLIEDWARRANTYISLIMITEDTODURATIONOFTHE
EXPRESSEDWARRANTYSPECIFIEDABOVE.
4021-645F02-18-13
19
Page2of2
Harman® • Absolute43 Owner’s Manual_R1 • 2015 -___ • 03/15
3-90-777000c
C. Loss of Power
Minimizing Smoke During Loss of Power Using Battery
Back-up
Harman strongly recommends installing battery backup to minimize entry of smoke into the room in the
event of power loss.
®
Your pellet/biomass burning appliance relies on a
combustion blower to remove exhaust. A power failure will
cause the combustion blower to stop. This may lead to
exhaust seeping into the room. Vertical rise in the venting
may provide natural draft. It is, however, no guarantee
against leakage.
There are two Harman® approved battery back-up
options for your appliance:
Uninterruptible Power Supply UPS battery back-ups are
available online or at computer and office equipment stores.
Your Harman® appliance with Rev E or later software
available beginning in November 2010 may be plugged
directly into a Harman® approved UPS:
• The APC (American Power Conversion) model
#BE750G and the TrippLite model INTERNET750U are
tested and approved. Other brands or models may not
be compatible.
When power is lost, a fully charged UPS will power a safe,
combustion blower only shut-down. Your appliance will
pulse the blower every few seconds to clear exhaust until
the fire is out. NOTE: The UPS provides safe shut-down
only. It is not intended for continued operation.
Your appliance will recognize when power is restored. What
happens depends on ESP temperature and whether it is
equipped with automatic ignition:
• In “Automatic” Mode, units equipped with automatic
ignition will respond to the set point and ESP temperature
and resume normal operation.
• In “Idle” Mode, or for units without automatic ignition:
• If the ESP is cool, the appliance will remain shut
down.
• If the fire is out and the ESP is still warm, the feeder
may restart. Since the fire is out, the ESP temperature
will not rise. The unit will then shut-down, and may
flash a six-blink status error. (See ESP error codes)
• If the fire is still burning, it will resume normal
operation.
Contact your dealer if you have questions about UPS
compatibility with your appliance.
Harman® Surefire 512H Battery Back-up The 512H
connects to a 12 volt deep cycle battery that will run your
appliance for up to eight (8) hours. It includes a trickle
charge feature that keeps your battery charged when power
is available. NOTE: If the power is out for longer than
battery life, smoke leakage may still occur unless your
stove has been safely shut down.
20
!
WARNING
!
CAUTION
Use only Harman® approved battery back-up devices.
Other products may not operate properly, can create
unsafe conditions or damage your appliance.
Always keep appliance doors and hopper lid closed
and latched during operation and during power
failures to minimize risk of smoke or burn-back.
D. Emergency Manual Ignition
Harman® pellet stoves and inserts should be lit using the
automatic ignition system. This is the safest and most
reliable way for igniting the unit, In the event the automatic
igniter is not functioning, these steps may be followed to
manually light the stove or insert in the “Constant Burn”
mode. Manual lighting is for emergency purposes only,
and the igniter should be repaired or replaced as soon as
practical.
!
WARNING
Only use fire starter commercially marketed for pellet
stoves and inserts, including wax coated wood chips,
pellet starter gel and pellet igniter blocks. Use any other
type of fire starter is prohibited.
To avoid serious injury or death read and follow
manufacturer’s warning and instructions for use of fire
starter. Use of firestarters is only permitted when performing
a cold start.
Never attempt to manually light a stove or insert that has
been operated recently and is not at room temperature.
If automatic ignition was attempted, be sure to give the
stove or insert at least 30 minutes or longer to cool to room
temperature.
Be sure that the stove or insert is in the “Constant Burn”
mode of operation.
Once all the precautions have been taken, follow these
steps:
1.On the touch control, select the Burn Mode icon then select
“Constant Burn”.
2.Arrow back and select the Igniter icon then select “Manual”
for the ignition method. Select the Home Icon to go back
to the Main Menu.
3.Fill burn pot with pellets, only half way. (Do Not Over Fill).
4.Add firestarter to pellets following manufacturer’s
instructions.
5.Light pellet gel with a match, and close the door, touch
the On/Off icon on the home screen. Operation will begin
when the fire reaches the proper temperature.
Harman® • Absolute43 Owner’s Manual_R1 • 2015 -___ • 03/15
3-90-777000c
E. Troubleshooting
ISSUES
Stove does not feed
SOLUTIONS
• No fuel in hopper.
• Firebox draft may be too low for sensing switch in feeder
circuit to operate. Check for closed doors, loose or missing
gasket on doors or hopper lid.
• Feed motor will not run until the ESP control senses a
certain temperature. Maybe you did not put enough fuel or
starting gel in the burn pot before manually lighting the fire
(In Constant Burn, Manual Light Only.)
• Restriction in the hopper or feeder. Remove all fuel and
examine. Clear the obstruction.
• Feed motor has failed.
Partially burned pellets
• Feed rate too high.
• Poor air to fuel mixture. (Check burn pot clean-out cover
and air intake).
• Burn pot may need to be cleaned.
• Combination of all the above.
Smoke smell
Seal the vent pipe joints and connection to stove with silicone.
The exhaust vent is the only part of the system that is under
positive pressure.
Fire has gone out
• No fuel in hopper.
• Draft is too low, blocked flue.
• Something is restricting fuel flow.
• Hopper lid not closed properly.
• Feed motor or combustion fan has failed.
Smoke is visible coming out of vent
• Air-fuel ratio is too rich.
- Feed rate too high.
- Draft too low caused by a gasket leak.
Low heat output
• Feed rate too low
• Draft too low because of gasket leak.
• Poor quality or damp pellets
• Combination of 1 and 2.
21
Harman® • Absolute43 Owner’s Manual_R1 • 2015 -___ • 03/15
3-90-777000c
F. Contact Information
a brand of
Hearth & Home Technologies
352 Mountain House Road, Halifax, PA 17032
www.harmanstoves.com
Please contact your Harman® dealer with any questions or concerns.
For the location of your nearest Harman® dealer,
please visit www.harmanstoves.com.
- NOTES ________________________________________________________________________________
________________________________________________________________________________
________________________________________________________________________________
________________________________________________________________________________
________________________________________________________________________________
________________________________________________________________________________
________________________________________________________________________________
________________________________________________________________________________
________________________________________________________________________________
NOTICE
DO NOT DISCARD THIS MANUAL
• Important operating
and maintenance
instructions included.
• Read, understand and follow
these instructions for safe
installation and operation.
• Leave this manual with
party responsible for use
and operation.
Printed in U.S.A. - Copyright 2012
22
Harman® • Absolute43 Owner’s Manual_R1 • 2015 -___ • 03/15
3-90-777000c
Was this manual useful for you? yes no
Thank you for your participation!

* Your assessment is very important for improving the work of artificial intelligence, which forms the content of this project

Download PDF

advertisement