Hotpoint HSS25ASHSS Installation instructions

Add to My manuals
128 Pages

advertisement

Hotpoint HSS25ASHSS Installation instructions | Manualzz
Side by Side
Refrigerators
GEAppliances.com
Safety Instructions . . . . . . . . . . . . . . . . .2–3
Operating Instructions
Automatic Icemaker . . . . . . . . . . . . . . . . . . 12,13
Care and Cleaning . . . . . . . . . . . . . . . . . . . 15,16
Crispers and Pans . . . . . . . . . . . . . . . . . . . . . . .11
ExpressChill™ . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5
Ice and Water Dispenser . . . . . . . . . . . . . . . .14
Refrigerator Doors . . . . . . . . . . . . . . . . . . . . . .10
Replacing the Light Bulbs . . . . . . . . . . . . . 16,17
Shelves and Bins . . . . . . . . . . . . . . . . . . . . . . .8, 9
Temperature Controls . . . . . . . . . . . . . . . . . . . . 4
TurboCool™ . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5
ClimateKepper2 . . . . . . . . . . . . . . . . . . . . . . . . . . 5
Water Filter . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 7
Installation Instructions
Installing the Refrigerator. . . . . . . . . . . . 23–26
Moving the Refrigerator . . . . . . . . . . . . . 19–22
Preparing to Install
the Refrigerator . . . . . . . . . . . . . . . . . . . . . . . . .18
Water Line Installation . . . . . . . . . . . . . . 27–29
Troubleshooting Tips . . . . . . . . . . . . 31–33
Owner’s Manual
and Installation
Models 22, 23, 25,26,27 and 29
Côte à Côte
Réfrigérateurs
Manuel d’utilisation
et d’installation
La section française commence à la page 40
Lado a Lado
Refrigeradores
Manual del propietario
e instalación
La sección en español empieza en la página 75
Normal Operating Sounds . . . . . . . . . . . . . . .30
Consumer Support
Consumer Support . . . . . . . . . . . . . Back Cover
Performance Data Sheets . . . . . . . . . . . . 34,35
Warranty . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .36
Write the model and serial numbers here:
Model # _________________________
Serial # __________________________
Find these numbers on a label inside the
refrigerator compartment at the top on the
right side.
200D8074P051 49-60646-4 10-14 GE
IMPORTANT SAFETY INFORMATION.
READ ALL INSTRUCTIONS BEFORE USING.
SAFETY
GE Appliances Website
For more information on your refrigerator’s operation, visit www.GEAppliances.com or
call 800.GECARES (800.432.2737). In Canada visit GEAppliances.ca or call 800.561.3344.
REFRIGERATOR SAFETY INFORMATION
This is the safety alert symbol. This symbol alerts you to potential hazards that can kill or hurt you and others. All
safety messages will follow the safety alert symbol and the word “DANGER”, “WARNING”, or “CAUTION”. These words are
defined as:
DANGER
Indicates a hazardous situation which, if not avoided, will result in death or serious injury.
WARNING Indicates a hazardous situation which, if not avoided, could result in death or serious injury.
CAUTION
Indicates a hazardous situation which, if not avoided, could result in minor or moderate injury.
IMPORTANT SAFETY INSTRUCTIONS
To reduce the risk of fire, explosion, electric shock, or injury when using your
WARNING
refrigerator follow these basic safety precautions:
„ This refrigerator must be properly installed and located in
accordance with the Installation Instructions before it is used.
„ Unplug the refrigerator before making repairs, replacing a light
bulb, or cleaning.
Note: Power to the refrigerator cannot be disconnected by any
setting on the control panel.
Note: Repairs must be performed by a qualified service
professional.
„ Replace all parts and panels before operating.
„ Do not store or use gasoline or other flammable vapors and
liquids in the vicinity of this or any other appliance.
CAUTION
IMPORTANT SAFETY INSTRUCTIONS
To reduce the risk of injury when using your refrigerator, follow these basic
safety precautions.
„ Do not clean glass shelves or covers with warm water
when they are cold. Glass shelves and covers may break if
exposed to sudden temperature changes or impact, such
as bumping or dropping. Tempered glass is designed to
shatter into many small pieces if it breaks.
„ Keep fingers out of the “pinch point” areas; clearances
between the doors and between the doors and cabinet are
necessarily small. Be careful closing doors when children
are in the area.
2
„ Because of potential safety hazards under certain conditions,
we strongly recommend against the use of an extension cord.
However, if you must use an extension cord, it is absolutely
necessary that it be a UL-listed (in the United States) or a CSA
certified (in Canada), 3-wire grounding type appliance extension
cord having a grounding type plug and outlet and that the electrical
rating of the cord be 15 amperes (minimum) and 120 volts.
„ To prevent suffocation and entrapment hazards to children,
remove the fresh food and freezer doors from any refrigerator
before disposing of it or discontinuing its use.
„ Do not allow children to climb, stand or hang on the door
handles or the shelves in the refrigerator. They could seriously
injure themselves.
„ Do not touch the cold surfaces in the freezer compartment
when hands are damp or wet, skin may stick to these
extremely cold surfaces.
„ Do not refreeze frozen foods which have thawed
completely.
„ In refrigerators with automatic icemakers, avoid contact
with the moving parts of the ejector mechanism, or with the
heating element that releases the cubes. Do not place fingers
or hands on the automatic ice making mechanism while the
refrigerator is plugged in.
GEAppliances.com
SAFETY
(CONT.)
INSTALLATION
WARNING
Explosion Hazard.
Keep flammable materials and vapors, such as gasoline, away from refrigerator. Failure to do so can
result in fire, explosion, or death.
CONNECTING ELECTRICITY
WARNING
Electrical Shock Hazard.
Plug into a grounded 3-prong outlet
Do not remove the ground prong
Do not use an adapter
Failure to follow these instructions can result in death, fire, or electrical shock.
Do not, under any circumstances, cut or remove the third (ground) prong from the power cord.
For personal safety, this appliance must be properly grounded.
The power cord of this appliance is equipped with a
3-prong (grounding) plug which mates with a standard
3-prong (grounding) wall outlet to minimize the
possibility of electric shock hazard from this appliance.
Have the wall outlet and circuit checked by a qualified
electrician to make sure the outlet is properly
grounded.
Where a standard 2-prong wall outlet is encountered,
it is your personal responsibility and obligation to have
it replaced with a properly grounded 3-prong wall
outlet. Do not use an adapter.
The refrigerator should always be plugged into its own
individual electrical outlet which has a voltage rating
that matches the rating plate.
A 115 Volt AC, 60 Hz, 15- or 20-amp fused, grounded
electrical supply is required. This provides the best
performance and also prevents overloading house
wiring circuits which could cause a fire hazard from
overheated wires.
Never unplug your refrigerator by pulling on the power
cord. Always grip plug firmly and pull straight out from
the outlet.
Repair or replace immediately all power cords that
have become frayed or otherwise damaged. Do not
use a cord that shows cracks or abrasion damage
along its length or at either end.
When moving the refrigerator away from the wall, be
careful not to roll over or damage the power cord.
PROPER DISPOSAL OF YOUR OLD REFRIGERATOR
WARNING Suffocation and child entrapment hazard.
Remove fresh-food and freezer doors from the refrigerator, prior to disposal. Failure to do so can result
in child entrapment which can lead to death or brain damage.
IMPORTANT:
Child entrapment and suffocation are not problems
of the past. Junked or abandoned refrigerators are
still dangerous even if they will sit for “just a few
days.” If you are getting rid of your old refrigerator,
please follow the instructions below to help prevent
accidents.
Refrigerants
All refrigeration products contain refrigerants,
which under federal law must be removed prior
to product disposal. If you are getting rid of an old
refrigeration product, check with the company
handling the disposal about what to do.
Before You Throw Away Your Old Refrigerator or
Freezer:
„ Take off the fresh food and freezer doors.
„ Leave the shelves in place so that children may
not easily climb inside.
READ AND FOLLOW THIS SAFETY INFORMATION CAREFULLY.
SAVE THESE INSTRUCTIONS
3
About the temperature controls.
Not all features are on all models. Your controls may be similar to the following:
OR
The temperature controls are preset in the factory at 37°F for the refrigerator compartment and 0°F for the
freezer compartment. Allow 24 hours for the temperature to stabilize to the preset recommended settings.
The temperature controls can display both the SET temperature as well as the actual temperature in the
refrigerator and freezer. The actual temperature may vary slightly from the SET temperature based on usage
and operating environment.
„On some models, setting both controls to the warmest setting until the display flashes (off) will stop
cooling in both the freezer and refrigerator compartments.
„On other models, setting either control to the warmest setting until the display flashes (off) will stop the
cooling to the freezer and refrigerator.
„NOTE: Turning the refrigerator off via the controls on the touch panel does not shut off electrical power to
the refrigerator.
NOTE: The refrigerator is shipped with protective film- covering the temperature controls. If this film was not
removed during installation, remove it now.
Performance Air Flow System
The Performance Air-Flow System is designed to
maximize temperature control in the refrigerator and
freezer compartments. This unique special feature
consists of the Air Tower along the back wall of the
refrigerator and the Air Tunnel on the bottom portion
of the freezer rear wall.
4
Placing food in front of the louvers on these
components will not affect performance. Although
the Air Tower and the Air Tunnel can be removed,
doing so will affect temperature performance. (For
removal instructions, on-line, 24 hours a day, contact
us at GEAppliances.com or call 800.GE.CARES.
In Canada, contact us at geappliances.ca or call
1.800.561.3344.)
About ClimateKeeper2.™ (on some models)
GEAppliances.com
How it Works
The ClimateKeeper2 ™ is the industry’s most
advanced refrigeration system, delivering
optimum temperature and humidity
performance to keep food garden fresh longer
and reduce freezer burn.
The ClimateKeeper2™ system features two
HYDSRUDWRUV³RQHIRUWKHUHIULJHUDWRUDQGRQH
for the freezer.
This provides two separate cooling systems,
and separates the airflow between the fresh
food and freezer compartments during normal
cooling operations.*
This ensures that the humidity levels in the
fresh food compartment are significantly higher
than in a conventional system,** allowing fresh
produce and other unsealed foods to retain
their moisture content and freshness longer.
Moisture sensitive foods such as fresh fruit,
salads, rice, etc., can now be stored on open
shelves without excessive moisture loss.
Due to the higher humidity in the refrigerator,
you may on occasion experience fog or
small amounts of moisture in the refrigerator
compartment. This is normal and may
come and go as different food loads and
environmental conditions change. Wipe dry
with a paper towel if desired.
The separate airflow system minimizes the
mixing of air between the two compartments,
which reduces fresh food odor transfer to
improve the taste of ice.
The ClimateKeeper2™ system also reduces
the number of defrosting cycles in the freezer
evaporator, thereby reducing freezer burn.
*Freezer air is used in the CustomCool™ feature.
**Testing shows a higher level of humidity in
the Fresh Food section in ClimateKeeper2™
refrigerators versus conventional units.
About TurboCool.™ (on some models)
How it Works
OR
TurboCool ™ rapidly cools the refrigerator
compartment in order to more quickly cool foods.
Use TurboCool ™ when adding a large amount
of food to the refrigerator compartment, putting
away foods after they have been sitting out at room
temperature or when putting away warm leftovers.
It can also be used if the refrigerator has been
without power for an extended period.
Once activated, the compressor will turn on
immediately and the fans will cycle on and off
at high speed as needed for eight hours. The
compressor will continue to run until the refrigerator
compartment cools to approximately 34°F (1°C),
then it will cycle on and off to maintain this setting.
After 8 hours, or if TurboCool ™ is pressed again,
the refrigerator compartment will return to the
original setting.
How to Use
Press TurboCool.™ The TurboCool ™ temperature
display will show Tc and the LED will be activated.
After TurboCool ™ is complete, the TurboCool ™
indicator light will go out.
NOTES: The refrigerator temperature cannot be
changed during TurboCool ™.
The freezer temperature is not affected
during TurboCool ™.
When opening the refrigerator door during
TurboCool ™, the fans will continue to run
if they have cycled on.
5
About ExpressChill™
.
(on some models)
How it Works
The ExpressChill™ feature is a system of
dampers, a fan and a temperature thermistor.
The pan is tightly sealed to prevent the pan’s
temperature from causing temperature
fluctuations in the rest of the refrigerator.
The controls for this pan are located in the top
of the refrigerator or on the dispenser with the
temperature controls.
How to Use
ExpressChill™
Empty the pan. Place the Chill tray in the
pan. Place the items on the tray and close
the pan completely.
Select the ExpressChill™ pad. On some
models, you can then select the chill time
(use chart to determine best setting). Other
models will only have one option (45
minutes). On models with multiple settings,
tap the pad until the light appears next to
the desired setting.
„To stop a feature before it is finished, tap
that feature’s pad until no options are
selected and the display is off.
„During ExpressChill™, the display on the
controls will count down the time in the
cycle.
How to Remove and Replace the Drawer
To remove:
Pull the drawer out to the stop position.
Lock all four swing locks by rotating them
to the lock position.
Rotate all four swing locks to the unlock
position.
Lift the front of the drawer up and out.
To replace:
Make sure all four swing locks are in the
unlock position.
Place the sides of the drawer into the
drawer supports, making sure the swing
locks fit on the drawer slots.
ExpressChill™ Chart (on some models)
NOTE: Results may vary depending on packaging, starting temperature and other food traits.
15 Minutes
„1 Beverage Can (12 oz)
„2 Small Juice Boxes
(6–8 oz each)
6
30 Minutes
„2 to 6 Beverage Cans
(12 oz each)
„ 2 Plastic 20 oz Bottles
of Beverage
„4 to 6 Small Juice Boxes
(6–8 oz each)
„3 Foil Juice Packets
„Wine (750 ml bottle)
45 Minutes
„2 Liters of Beverage
„1/2 Gallon of Juice
„*HODWLQ³SDFNDJH
About the water filter. (on some models)
GEAppliances.com
Water Filter Cartridge
The water filter cartridge is located in the back upper right
corner of the refrigerator compartment.
Cartridge
Holder
When to Replace the Filter on Models With a
Replacement Indicator Light
There is a replacement indicator light for the water filter
cartridge on the dispenser. This light will turn orange to tell you
that you need to replace the filter soon.
The filter cartridge should be replaced when the replacement
indicator light turns red or if the flow of water to the dispenser or
icemaker decreases.
Run water from the dispenser 1-1/2 gallons (about three
minutes) to clear the system and prevent sputtering.
Press and hold the WATER FILTER pad (on some models) on
the dispenser for 3 seconds.
When to Replace the Filter on Models Without a
Replacement Indicator Light
The filter cartridge should be replaced every six months or
earlier if the flow of water to the water dispenser or icemaker
decreases.
Removing the Filter Cartridge
If you are replacing the cartridge, first remove the old one by
slowly turning it to the left. Do not pull down on the cartridge. A
small amount of water may drip down.
NOTE: A newly-installed water filter cartridge may cause water
to spurt from the dispenser upon first use.
Filter Bypass Plug
You must use the filter bypass plug when a replacement filter
cartridge is not available. The dispenser and the icemaker will
not operate without the filter or filter bypass plug.
Installing the Filter Cartridge
If you are replacing a SmartWater cartridge with an
adapter, it must be removed before installing the cartridge.
To remove the adapter, turn it to the left about 1/4 turn.
If you are replacing a Water by Culligan cartridge, leave the
adapter in place. This adapter will stay in the refrigerator
when you replace future cartridges.
With adapter
Without adapter
(appearance may vary)
Some models
use this type of
water filter.
On models ithout a replacement indicator light, apply the
month and year sticker to the new cartridge to remind you
to replace the filter in six months.
Fill the replacement cartridge with water from the tap to
allow for better flow from the dispenser immediately after
installation.
Line up the arrow on the cartridge and the cartridge holder.
Place the top of the new cartridge up inside the holder. Do
not push it up into the holder.
Slowly turn it to the right until the filter cartridge stops. DO
NOT OVERTIGHTEN. As you turn the cartridge, it will
automatically raise itself into position. The cartridge will
move about 1/2 turn.
Filter
Bypass
Plug
SmartWater
Filter
Bypass
Plug
Water by Culligan
To use the filter bypass plug on Water by Culligan models, you
must first remove the filter adapter from the cartridge holder by
turning it to the left.
For the maximum benefit of your filtration system, GE
recommends the use of GE branded SmartWater filters only.
Using GE branded filters in GE and Hotpoint refrigerators
provides optimal performance and reliability. GE branded
SmartWater filters are always the right choice because they
are patented and designed specifically for GE products. GE
SmartWater filters meet rigorous industry NSF standards for
safety and quality that are important for products that are
filtering your water. GE has not qualified non-GE branded
filters for use in GE and Hotpoint refrigerators and there is no
assurance that non-GE branded filters meet GE’s standards for
quality, performance and reliability.
,I\RXKDYHTXHVWLRQV³YLVLWRXU:HEVLWHDWGEAppliances.com,
or call 1.800.GE.CARES (1.800.432.2737).
Replacement filters:
To order additional filter cartridges in the United States, visit our
Website at GEAppliances.com, or call GE Parts and Accessories,
800.626.2002.
See filter label for type of filter to order (MWF or MSWF).
Customers in Canada should consult the yellow pages for the
nearest Mabe Service Center.
7
About the shelves and bins.
Not all features are on all models.
Snugger
Refrigerator Door Bins and Freezer Door Tilt-Out Bins
Large Bins
The larger refrigerator door bins and freezer
tilt-out door bins are adjustable.
To remove: Lift the front of the bin straight up,
then lift up and out.
Refrigerator bin
To replace or relocate: Engage the back side of
the bin in the molded supports of the door. Then
push down on the front of the bin. Bin will lock
in place.
Small Bins
To remove: Lift the front of the bin straight up
then out.
Freezer bin
The snugger helps prevent tipping, spilling or
sliding of small items stored on the door shelf.
Place a finger on either side of the snugger near
the rear and move it back and forth to fit your
needs.
Top freezer bin
NOTE:
Be careful when
placing items in
the top bin. Make
sure that items do
not block or fall
into the ice chute.
To replace: Position the bin above the
rectangular molded supports on the door. Then
slide the bin down onto the support to lock it in
place.
Freezer tilt-out bin
Slide-Out Spillproof Shelf
The slide-out spillproof shelf allows you to
reach items stored behind others. The special
edges are designed to help prevent spills from
dripping to lower shelves.
To remove:
Slide the shelf out until it reaches the stop,
then press down on the tab and slide the shelf
straight out.
To replace or relocate:
Line the shelf up with the supports and slide it
into place. The shelf can be repositioned when
the door is at 90° or more. To reposition the
shelf, slide the shelf past the stops and angle
downward. Slide shelf down to the desired
position, line up with the supports and slide into
place.
Press tab and pull shelf
forward to remove
Make sure you push the shelves all the way
back in before you close the door.
Freezer Baskets (on some models)
To remove, slide out to the stop position, lift the
front past the stop position, and slide out.
Make sure you push the baskets all the way
back in before you close the door.
Freezer Baskets (on some models)
To remove, push the basket all the way to the
back of the freezer. Lift up until the back pins
are disengaged. Lift the entire basket up and
pull out.
8
Make sure you push the baskets all the way
back in before you close the door.
About the shelves and bins.
GEAppliances.com
Not all features are on all models.
QuickSpace™ Shelf (on some models)
This shelf splits in half and slides under itself for
storage of tall items on the shelf below.
On some models, this shelf can not be used in
the lowest position.
This shelf can be removed and replaced or
relocated just like Slide-Out Spillproof Shelves.
Slide-Out Freezer Shelves
To remove, slide out to the stop position, lift the
front past the stop position, and slide out from
rib.
Make sure you push the shelves all the way
back in before you close the door.
Fixed Freezer Shelves
To remove, lift the shelf up at the left side and
then bring the shelf out.
NOTE FOR DISPENSER MODELS: In order to
take full advantage of the tilt-out ice bin (on
some models), only store items on the shelf
below the ice bin that are no taller than the
lowest point on the bin.
Door Wine/Beverage Rack
(on some models)
This rack holds up to 5 cans, one bottle of
wine or one 2-liter bottle of soda.
The rack hangs from the sides of the dairy bin.
To remove:
Empty the wine/beverage rack.
Holding the bottom of the dairy bin, lift the
front straight up, then lift up and out.
To replace:
Reattach the rack to the sides of the bin.
To detach the rack from the dairy bin, pull
the rack’s side wires out of the holes on
each side of the dairy bin.
Engage the back side of the bin in the
molded supports on the door. Then push
down on the front of the bin. The bin will
lock into place.
ShelfSaver™ Rack
Door Can Rack
(on some models)
Use this rack to store
beverage cans for easy
access.
(on some models)
This door rack holds up to 9 cans.
NOTE: This rack can only be
mounted in the top position under
the dairy bin.
It can also hold a 9” x 13”
baking dish.
Removable Beverage Rack
(on some models)
The beverage rack is designed to
hold a bottle on its side. It can be
attached to any slide-out shelf.
1
2
To install:
Line up the large part of the
slots on the top of the rack with
the tabs under the shelf.
Then slide the rack back to lock
it in place.
9
About the refrigerator doors.
Refrigerator Doors (on some models)
The refrigerator doors may feel different
than the ones you are used to. The special
door opening/closing feature makes sure
the doors close all the way and are securely
sealed.
The resistance you feel at the stop position
will be reduced as the door is loaded with
food.
When opening and closing the door you will
notice a stop position. If the door is opened
past this stop point, the door will remain
open to allow you to load and unload food
more easily. When the door is only partially
open, it will automatically close.
When the door is only partially
open, it will automatically close.
Beyond this stop the door will stay
open.
Door Alignment
If doors are uneven, adjust the refrigerator
door.
Using a 7/16” socket wrench, turn the
door adjusting screw to the right to raise
the door; to the left, to lower it. (A nylon
plug, imbedded in the threads of the pin,
prevents the pin from turning unless a
wrench is used.)
7/16” Socket Wrench
To remove the base
grille, open the doors,
remove the screw at
each end of the base
grille and then pull
the grille straight out.
10
Raise
After one or two turns of the wrench,
open and close the refrigerator door
and check the alignment at the top of
the doors.
About the crispers and pans.
GEAppliances.com
Not all features are on all models.
Fruit and Vegetable Crispers
Excess water that may accumulate in the
bottom of the drawers should be wiped dry.
On some models, the bottom drawer has full
extension slides that allow full access to the
drawer.
HI
LO
Adjustable Humidity Crispers
Slide the control all the way to the HI setting to
provide high humidity recommended for most
vegetables.
Slide the control all the way to the LO setting to
provide lower humidity levels recommended for
most fruits.
Convertible Deli Pan (on some models)
T
ES
LD
O
CO
LD
C
The convertible deli pan has its own cold
air duct to allow a stream of cold air from
the freezer compartment or refrigerator
compartment to flow to the pan.
The variable temperature control regulates the
air flow from the Climate Keeper.
Set the control to the coldest setting to store
fresh meats.
Set the control to cold to convert the panto
normal refrigerator temperature and provide
extra vegetable storage space. The cold air
duct is turned off. Variable settings between
these extremes can be selected.
About crisper removal.
Not all features are on all models.
Crisper Removal
Crispers can easily be removed by pulling the
drawer straight out and lifting the drawer up
and over the stop location.
If the door prevents you from taking out the
drawers, first try to remove the door bins.
If this does not offer enough clearance, the
refrigerator will need to be rolled forward
until the door opens enough to slide the
drawers out. In some cases, when you roll the
refrigerator out, you will need to move the
refrigerator to the left or right as you roll it out.
11
About the automatic icemaker.
A newly installed refrigerator may take 12 to 24 hours to begin making ice.
Automatic Icemaker
7KHLFHPDNHUZLOOSURGXFHVHYHQFXEHVSHUF\FOH³
approximately 100–130 cubes in a 24-hour period, depending
on freezer compartment temperature, room temperature,
number of door openings and other use conditions.
If the refrigerator is operated before the water connection is
made to the icemaker, set the power switch in the OFF position.
When the refrigerator has been connected to the water supply,
set the power switch to the ON position.
The icemaker will fill with water when it cools to 15°F (–10°C).
A newly installed refrigerator may take 12 to 24 hours to begin
making ice cubes.
You will hear a buzzing sound each time the icemaker fills with
water.
Special note about dispenser models:
„ Some models have a tilt-out ice bin. The bin can be tilted
out as shown in the illustrations, and it will hold itself up
while you take ice out or turn the icemaker power switch on
and off. Be sure to put the bin back in place before closing
the door.
„ To restore your ice level from an empty bucket stage, the
following steps are recommended:
12 hours after the first batch of ice has fallen into the bin,
dispense 3 to 4 cubes.
After an additional 6 hours, dispense 3 to 4 cubes again.
These steps will restore your ice level in the shortest amount of
time.
Throw away the first few batches of ice to allow the water line
to clear.
Icemaker
Power
Switch
Icemaker
Be sure nothing interferes with the sweep of the feeler arm.
When the bin fills to the level of the feeler arm, the icemaker will
stop producing ice. It is normal for several cubes to be joined
together.
If ice is not used frequently, old ice cubes will become cloudy,
taste stale and shrink.
CAUTION
Avoid contact with the moving parts of
the ejector mechanism, or with the heating element (located
on the bottom of the ice maker) that releases the cubes.
Do not place fingers or hands on the automatic ice making
mechanism while the refrigerator is plugged in.
12
Power
Switch
Feeler Arm
(on some models)
Green
Power Light
Feeler Arm
(on some models)
NOTE:
In homes with lower than average water pressure,
you may hear the icemaker cycle multiple times
when making one batch of ice.
About the automatic icemaker. (cont)
Accessing Ice and Reaching the Power Switch on
Dispenser Models
GEAppliances.com
Models with a shelf above the ice bin
There are two types of ice storage bins on dispenser models.
One has a shelf above the bin, the other does not.
Special note for models with tilt-out ice bin:
„ These models have a tilt-out ice bin. The bin can be tilted
out as shown in the illustrations, and it will hold itself up
while you take ice out or turn the icemaker power switch
on and off. Be sure to put the bin back in place before
closing the door.
Shelf
Shelf
Ice Bin
Ice Bin
To reach the power switch, pull the
shelf straight out. Always be sure to
replace the shelf.
NOTE: In order to take full advantage of the tilt-out ice bin, only store items
on the shelf below the ice bin that are no taller than the lowest point on the
bin.
To access ice, pull the bin forward.
Models with tilt out ice bin
On some models, to access ice or reach the power switch:
To access ice and reach the icemaker power switch:
Lift the bin, then pull it forward
until the bin stops.
Lower the bin to access ice or
reach the power switch.
Pull the bin forward until the
bin stops.
Lower the bin to access ice or
reach the power switch.
Removing Ice Bin (dispenser models)
CAUTION
The ice bin is heavy when full.
Set the power switch to the OFF position before removing the
bin.
Rotate
When replacing the bin, be sure to press it firmly into place. If
it does not go all the way back, remove it and rotate the drive
mechanism 1/4 turn. Then push the bin back again.
Drive
Mechanism
Dispenser Models only
13
About the ice and water dispenser. (on some models)
To Use the Dispenser
Select CUBED ICE
or WATER
.
, CRUSHED ICE
Press the glass gently against the top of the
dispenser cradle.
The spill shelf is not self-draining. To reduce
water spotting, the shelf and its grille should be
cleaned regularly.
Spill Shelf
If no water is dispensed when the
refrigerator is first installed, there may be air
in the water line system. Press the dispenser
arm for at least two minutes to remove
trapped air from the water line and to fill the
water system. To flush out impurities in the
water line, throw away the first six glassfuls
of water.
CAUTION: Never put fingers or any other
objects into the ice crusher discharge
opening.
Locking the Dispenser
Press the LOCK pad for
3 seconds to lock the
dispenser and control
panel. To unlock, press and
hold the pad again for 3
seconds.
Dispenser Light
This pad turns the light in the
dispenser on and off. The
light also comes on when the
dispenser cradle is pressed.
For models with a bulb, if
the light burns out, it should
be replaced with a 6 watt
12V maximum bulb. For LED
models, contact Factory
Service.
Quick Ice (on some models)
When you need ice in a
hurry, press this pad to speed
up ice production. This will
increase ice production for
the following 48 hours or until
you press the pad again.
Door Alarm (on some
models)
To set the alarm, press this
pad until the indicator light
comes on. This alarm will
sound if either door is open
for more than 3 minutes.
The light goes out and the
beeping stops when you
close the door.
Important Facts About Your Dispenser
„ Do not add ice from trays or bags to the
storage drawer. It may not crush or dispense
well.
„ Avoid overfilling glass with ice and use of
narrow glasses. Backed-up ice can jam
the chute or cause the door in the chute to
freeze shut. If ice is blocking the chute, poke it
through with a wooden spoon.
„ Beverages and foods should not be quickchilled in the ice storage drawer. Cans,
bottles or food packages in the storage
drawer may cause the icemaker or auger to
jam.
„ To keep dispensed ice from missing the
glass, put the glass close to, but not touching,
the dispenser opening.
14
„ Some crushed ice may be dispensed
even though you selected CUBED ICE. This
happens occasionally when a few cubes
accidentally get directed to the crusher.
„ After crushed ice is dispensed, some water
may drip from the chute.
„ Sometimes a small mound of snow will form
on the door in the ice chute. This condition is
normal and usually occurs when you have
dispensed crushed ice repeatedly. The snow
will eventually evaporate.
Care and cleaning of the refrigerator.
GEAppliances.com
Cleaning the Outside
Dispenser drip area.
The dispenser drip area, beneath the grille,
should be wiped dry. Water left in this area may
leave deposits. Remove the deposits by adding
undiluted vinegar to the well. Soak until the
deposits disappear or become loose enough to
rinse away.
The dispenser cradle. Before cleaning, lock the
dispenser by pressing and holding the LOCK
pad for 3 seconds. Clean with warm water and
EDNLQJVRGDVROXWLRQ³DERXWDWDEOHVSRRQ
ml) of baking soda to a quart (1 liter) of water.
Rinse thoroughly and wipe dry.
The door handles and trim. Clean with a cloth
dampened with soapy water. Dry with a soft
cloth.
The stainless steel doors and door handles
(on some models) can be cleaned with a
commercially available stainless steel cleaner.
Cleaners with oxalic acid such as Bar Keepers
Friend Soft Cleanser™ will remove rust,
tarnish and small blemishes. Use only a liquid
cleanser free of grit and rub in the direction of
the brush lines with a damp soft sponge.
Do not use appliance wax or polish on the
stainless steel.
Keep the outside clean. Wipe with a clean cloth
lightly dampened with kitchen appliance wax or
mild liquid dish detergent. Dry and polish with a
clean, soft cloth.
Do not wipe the refrigerator with a soiled dish
cloth or wet towel. These may leave a residue
that can erode the paint. Do not use scouring
pads, powdered cleaners, bleach or cleaners
containing bleach because these products
can scratch and weaken the paint finish.
Cleaning the Inside
To help prevent odors, leave an open box
of baking soda in the fresh food and freezer
compartments.
Unplug the refrigerator before cleaning. If
this is not practical, wring excess moisture
out of sponge or cloth when cleaning around
switches, lights or controls.
8VHZDUPZDWHUDQGEDNLQJVRGDVROXWLRQ³
about a tablespoon (15 ml) of baking soda to
a quart (1 liter) of water. This both cleans and
neutralizes odors. Rinse and wipe dry.
CAUTION
Do not clean glass shelves
or covers with warm water when they are
cold. Glass shelves and covers may break
if exposed to sudden temperature changes
or impact such as bumping or dropping.
Tempered glass is designed to shatter into
many small pieces if it breaks.
Do not wash any plastic refrigerator parts in
the dishwasher.
The chill/thaw tray is dishwasher safe.
Use of any cleaning solution other than that
which is recommended, especially those that
contain petroleum distillates, can crack or
damage the interior of the refrigerator.
15
Care and cleaning of the refrigerator. (cont.)
Behind the Refrigerator
Be careful when moving the refrigerator away
from the wall. All types of floor coverings can
be damaged, particularly cushioned coverings
and those with embossed surfaces.
When pushing the refrigerator back, make
sure you don’t roll over the power cord or
icemaker supply line (on some models).
Pull the refrigerator straight out and return it
to position by pushing it straight in. Moving the
refrigerator in a side direction may result in
damage to the floor covering or refrigerator.
Preparing for Vacation
For long vacations or absences, remove food
and unplug the refrigerator. Clean the interior
with a baking soda solution of one tablespoon
(15 ml) of baking soda to one quart (1 liter) of
water. Leave the doors open.
If the temperature can drop below freezing,
have a qualified servicer drain the water supply
system (on some models) to prevent serious
property damage due to flooding.
Set the icemaker power switch to the OFF
position and shut off the water supply to the
refrigerator.
Preparing to Move
Secure all loose items such as shelves and
drawers by taping them securely in place to
prevent damage.
Be sure the refrigerator stays in an upright
position during moving.
When using a hand truck to move the
refrigerator, do not rest the front or back of the
refrigerator against the hand truck. This could
damage the refrigerator. Handle only from the
sides of the refrigerator.
Replacing the light bulbs. (on some models)
WARNING Before replacing a burned-out light bulb, the refrigerator should be unplugged in order to avoid contact with a
live wire filament. (A burned-out light bulb may break when being replaced.)
Turning the control to the OFF position does not remove power to the light circuit.
Your light shield will look like
one of the following:
Tabs
OR
Pocket
16
5HIULJHUDWRU&RPSDUWPHQW³8SSHU/LJKW
Unplug the refrigerator.
The bulbs are located at the top of the
compartment, inside the light shield. On
some models, a screw at the front of the
light shield will have to be removed. On
other models, the screw is located in the
pocket located at the back of the shield.
To remove the light shield, on some models,
press in on the tabs on the sides of the
shield and slide forward and out. On other
models, just slide the shield forward and
out.
After replacing the bulb with an appliance
bulb of the same or lower wattage, replace
the light shield and screw. When replacing
the light shield, make sure that the tabs at
the back of the shield fit into the slots at the
back of the light shield housing.
Plug the refrigerator back in.
Replacing the light bulbs. (cont)
GEAppliances.com
WARNING Before replacing a burned-out light bulb, the refrigerator should be unplugged in order to avoid contact with a
live wire filament. (A burned-out light bulb may break when being replaced.)
Turning the control to the OFF position does not remove power to the light circuit.
5HIULJHUDWRU&RPSDUWPHQW³/RZHU/LJKW
This light is located above the top drawer.
Unplug the refrigerator.
Lift the light shield up and pull it out.
After replacing the bulb with an appliance
bulb of the same or lower wattage, replace
the shield.
Plug the refrigerator back in.
Freezer Compartment
Unplug the refrigerator.
Remove the shelf just above the light shield.
(The shelf will be easier to remove if it is
emptied first.) Remove the screw at the top
of the light shield.
Replace the bulb with an appliance bulb
of the same or lower wattage, and
reinstall the light shield. When reinstalling
the light shield, make sure the top tabs
snap securely into place. Replace the
screw.
To remove the light shield, press in on the
sides, and lift up and out.
Reinstall the shelf and plug the
refrigerator back in.
Dispenser (on some models)
Unplug the refrigerator.
The bulb is located on the dispenser under
the control panel. Remove the light bulb by
turning it counterclockwise.
Replace the bulb with a bulb of the same
size and wattage.
Plug the refrigerator back in.
Replacing the lights on models with LED lighting
Setting the controls to OFF does not remove power to the light circuit. Not all features are on all models.
Refrigerator Compartment (on some models)
LED
Lighting
Display
There is an LED lighting display in the top and sides of the fresh food compartment and in the rear
and side of the freezer compartment on some models.
If this assembly needs to be replaced, call GE Service at 1.800.432.2737 in the United States or
1.800.561.3344 in Canada.
17
Installation
Instructions
Refrigerator
Models 22, 23, 25, 26, 27 & 29
Questions? Call 800.GE.CARES (800.432.2737) or Visit our Website at: GEAppliances.com
In Canada, call 1.800.561.3344 or Visit our Website at: www.geappliances.ca
BEFORE YOU BEGIN
PREPARATION
Read these instructions completely and carefully.
WATER SUPPLY TO THE ICEMAKER
•
If the refrigerator has an icemaker, it will have to be
connected to a cold water line. A GE water supply
kit (containing tubing, shutoff valve, fittings and
instructions) is available at extra cost from your
dealer, by visiting our Website at GEAppliances.
com (in Canada at www.geappliances.ca) or from
Parts and Accessories, 800.626.2002 (in Canada
1.800.661.1616).
IMPORTANT ³6DYHWKHVHLQVWUXFWLRQVIRU
local inspector’s use.
•
IMPORTANT
³2EVHUYHDOOJRYHUQLQJ
codes and ordinances.
• Note to Installer – Be sure to leave these
instructions with the Consumer.
• Note to Consumer – Keep these instructions for
future reference.
• Skill level – Installation of this appliance requires
basic mechanical skills.
• Completion time – Refrigerator Installation
30 minutes
Water Line Installation
30 minutes
• Proper installation is the responsibility of the
installer.
• Product failure due to improper installation is not
covered under the Warranty.
If the refrigerator has already been installed, remove
the base grille (see Step 2 in Moving the Refrigerator),
then skip to Step 5 in Installing the Refrigerator.
TOOLS YOU WILL NEED
3/8” and 5/16” Socket
1/2” and 7/16” Wrench
Plastic Putty Knife
Phillips Head Screwdriver
18
Installation Instructions
MOVING THE REFRIGERATOR
1 LOADING THE REFRIGERATOR
If the refrigerator must go through any
entrance that is less than 38” wide, the
doors must be removed. Proceed to
Step 3.
DO NOT remove the handles.
If all entrances are more than 38” wide,
skip to Installing the Refrigerator.
ONTO A HAND TRUCK
Leave all tape and door pads on doors until the
refrigerator is in its final location.
To move the refrigerator, use a padded hand
truck. Center the refrigerator on the hand truck
and secure the strap around the refrigerator.
DO NOT OVERTIGHTEN THE STRAP.
3 DISCONNECT THE WATER COUPLING
(on some models)
If the refrigerator has a water dispenser,
there is a water line from the cabinet into the
bottom hinge on the freezer door that must be
disconnected.
To disconnect, push in on the white collar of
the coupling and pull out the tubing.
White collar
2 REMOVE THE BASE GRILLE
Remove the grille by removing the two
Phillips head screws.
Bottom
freezer
hinge
19
Installation Instructions
MOVING THE REFRIGERATOR (CONT.)
4 DISCONNECT THE POWER COUPLING
6 CLOSE THE FREEZER AND
(on some models)
REFRIGERATOR DOORS
If the refrigerator has a water dispenser,
there is a power line (harness) from the cabinet
into the bottom hinge on the freezer door that
must be disconnected.
To disconnect, pull apart at the coupling.
Bottom
freezer
hinge
7 REMOVE THE FREEZER DOOR
A Remove the freezer door top hinge cover (if
equipped) by either squeezing it and pulling it
up or by prying it off with a plastic putty knife.
5 DISCONNECT THE ELECTRICAL
CONNECTORS (on some models)
If the refrigerator has a refreshment center,
there are electrical connectors (harnesses)
from the cabinet into the bottom hinge on the
refrigerator door that must be disconnected.
To disconnect, pull apart each connector.
B Remove the two 5/16” hex head screws, then
lift the hinge straight up to free the hinge pin.
5/16” Hex Head
C Open the freezer door to 90.°
Bottom
refrigerator
hinge
90°
20
Installation Instructions
7 REMOVE THE FREEZER DOOR (cont.)
8 REMOVE THE REFRIGERATOR DOOR
D As one person slowly lifts the freezer door up
and off the bottom hinge, the second person
should carefully guide the water line and power
line (harness) through the bottom hinge.
B Remove the two 5/16” hex head screws, then
lift the hinge straight up to free the hinge pin.
(cont.)
5/16” Hex Head
C Open the refrigerator door to 90.°
90°
E Set the door on a non-scratching surface with
the inside up.
8 REMOVE THE REFRIGERATOR DOOR
A Remove the refrigerator door top hinge cover
(if equipped) by either squeezing it and pulling it
up or by prying it off with a plastic putty knife.
90°
21
Installation Instructions
MOVING THE REFRIGERATOR (CONT.)
8 REMOVE THE REFRIGERATOR DOOR
9 REPLACING THE DOORS
(cont.)
To replace the doors, simply reverse steps 3
through 8.
D Lift the refrigerator door up and off the bottom
hinge.
If the refrigerator has a refreshment center,
one person should slowly lift the door up and
off the bottom hinge and the second person
should carefully guide the electrical lines
(harnesses) through the bottom hinge.
However, please note the following:
• When lowering the doors onto the bottom
hinges, make sure the second person
carefully guides the tube and harnesses
through the holes in the hinges.
• When connecting the water line, make sure
you insert the tubing all the way to the mark.
90°
Mark
• Do not pinch the tubing and harnesses when
placing the doors on the bottom hinges.
• When connecting the power line and the
electrical lines (refreshment center models
only), be sure that the connectors are seated
together fully.
Refreshment Center Models only
E
Set the door on a non-scratching surface with
the inside up.
22
Installation Instructions
INSTALLING THE REFRIGERATOR
REFRIGERATOR LOCATION
DIMENSIONS AND SPECIFICATIONS (for
23‘ CustomStyle™ models)
• Do not install the refrigerator where the
temperature will go below 60°F (16°C) because
it will not run often enough to maintain proper
temperatures.
• Do not install the refrigerator where the
temperature will go above 100°F (37°C) because
it will not perform properly.
• Do not install the refrigerator in a location exposed
to water (rain, etc.) or direct sunlight.
• Install it on a floor strong enough to support it
fully loaded.
701ø4” (178.4 cm)
36”
(91.4 cm)
CLEARANCES
Allow the following clearances for ease of
installation, proper air circulation and plumbing
and electrical connections:
Sides
Top
Back
23‘/25‘
CustomStyle™
1/8” (4 mm)
1” (25 mm)
1/2” (13 mm)
24” (61 cm)
23‘ (33” wide),
25‘, 26‘, 27‘, 29‘
1/8” (4 mm)
1” (25 mm)
-1” (25 mm)
DIMENSIONS AND SPECIFICATIONS (for
25‘ CustomStyle™ models)
DIMENSIONS AND SPECIFICATIONS
Water
24” (61 cm)
Cabinet
3/4” (19 mm)
Airspace
(1/2” [13 mm] Gap
+ 1/4” [6 mm] Wall
Plates)
Electrical
25” (63.5 cm)
Countertop
721ø4” (183.5 cm)*
36”
(91.4 cm)
24” (61 cm)
*721/4” (183.5 cm) required for full adjustment
of mobility wheels. If cabinets installed above
refrigerator have doors that are flush to the
top of the opening for the refrigerator, then
an additional 1/8” may be required to provide
clearance for cabinet doors to open freely.
23
Installation Instructions
INSTALLING THE REFRIGERATOR (CONT.)
1 CONNECTING THE REFRIGERATOR TO
C Fasten the tubing into the clamp provided to
hold it in position. You may need to pry open
the clamp.
THE HOUSE WATER LINE
(icemaker and dispenser models)
A cold water supply is required for automatic
icemaker and dispenser operation. If there
is not a cold water supply, you will need to
provide one. See “Installing the Water Line”
section.
Tubing Clamp
1/4” Tubing
1/4”
Compression Nut
Ferrule
(sleeve)
NOTES:
• Before making the connection to the
refrigerator, be sure the refrigerator power
cord is not plugged into the wall outlet.
• If your refrigerator does not have a water
filter, we recommend installing one if your
water supply has sand or particles that could
clog the screen of the refrigerator’s water
valve. Install it in the water line near the
refrigerator.
If using GE SmartConnect™ Refrigerator
Tubing Kit, you will need an additional tube
(WX08X10002) to connect the filter. Do not
cut plastic tube to install filter.
A If you are using copper tubing, place a
compression nut and ferrule (sleeve) onto the
end of the tubing coming from the house cold
water supply.
If you are using the GE SmartConnect™ tubing,
the nuts are already assembled to the tubing.
B If you are using copper tubing, insert the end of
the tubing into the refrigerator connection, at
the back of the refrigerator, as far as possible.
While holding the tubing, tighten the fitting.
If you are using GE SmartConnect™ tubing,
insert the molded end of the tubing into the
refrigerator connection, at the back of the
refrigerator, and tighten the compression nut
until it is hand tight. Then tighten one additional
turn with a wrench. Overtightening may cause
leaks.
Refrigerator
Connection
SmartConnect™ Tubing
Option 2
2 TURN ON THE WATER SUPPLY
Turn the water on at the shutoff valve (house
water supply) and check for any leaks.
3 PLUG IN THE REFRIGERATOR
Before plugging in the refrigerator, make sure
the icemaker power switch is set to the OFF
position.
See the grounding information attached to the
power cord.
24
Installation Instructions
5 LEVEL THE REFRIGERATOR (cont.)
4 PUT THE REFRIGERATOR IN PLACE
To adjust the
rollers on 23‘/25‘
CustomStyle™ models:
Move the refrigerator to its final location.
Turn the front roller
adjusting screws
clockwise to raise
the refrigerator,
Roller adjusting screws
counterclockwise to
lower it. Use a 3/8” hex
wrench with extension, or an adjustable wrench.
5 LEVEL THE REFRIGERATOR
The refrigerator can be leveled by adjusting the
rollers located near the bottom hinges.
These models also have rear adjustable
rollers so you can align the refrigerator with
your kitchen cabinets. Use a 3/8” hex wrench
with extension to turn the screws for the rear
UROOHUV³clockwise to raise the refrigerator,
counterclockwise to lower it.
Rollers
Raise
6 LEVEL THE DOORS
A Adjust the refrigerator door to make the doors
even at the top.
Rollers have three purposes:
• Rollers adjust so the door closes easily when
opened about halfway. (Raise the front about
5/8” [16 mm] from the floor.)
• Rollers adjust so the refrigerator is firmly
positioned on the floor and does not wobble.
• Rollers allow you to move the refrigerator
away from the wall for cleaning.
B To align:
Using a 7/16” wrench, turn the door adjusting
screw to the right to raise the door, to the left
to lower it.
NOTE:
A nylon plug, imbedded in the threads of the
pin, prevents the pin from turning unless a
wrench is used.
After one or two turns of the wrench, open
and close the refrigerator door and check the
alignment at the top of the doors.
To adjust the rollers on 23‘ (33” wide), 25‘, 26‘,
27‘ and 29‘ models:
• Turn the roller
adjusting screws
clockwise to raise
the refrigerator,
counterclockwise
to lower it. Use a
3/8” hex socket
or wrench, or an
adjustable wrench.
Doors should be even at top
Roller adjusting screw
Raise
7/16” wrench
25
Installation Instructions
INSTALLING THE REFRIGERATOR (CONT.)
7 REPLACE THE BASE GRILLE
9 START THE ICEMAKER
Replace the grille by installing the two Phillips
head screws.
Set the icemaker power switch to the I (on)
position. The icemaker will not begin to operate
until it reaches its operating temperature of
15°F (–9°C) or below. It will then begin operation
automatically. It will take 2–3 days to fill the ice
bin.
Power
switch
Power
switch
8 SET THE CONTROLS
Set the controls to the recommended setting.
NOTE:
In lower water pressure conditions, the water
valve may turn on up to 3 times to deliver
enough water to the icemaker.
26
Installation Instructions
INSTALLING THE WATER LINE (ICEMAKER & DISPENSER MODELS)
WHAT YOU WILL NEED
BEFORE YOU BEGIN
Recommended copper water supply kits are WX8X2,
WX8X3 or WX8X4, depending on the amount of tubing
you need. Approved plastic water supply lines are GE
SmartConnect™ Refrigerator Tubing (WX08X10006,
WX08X10015 and WX08X10025).
• Copper or GE SmartConnect™ Refrigerator Tubing
kit, 1/4” outer diameter to connect the refrigerator
to the water supply. If using copper, be sure both
ends of the tubing are cut square.
To determine how much tubing you need: measure
the distance from the water valve on the back of the
refrigerator to the water supply pipe. Be sure there
is sufficient extra tubing to allow the refrigerator to
move out from the wall after installation.
GE SmartConnect™ Refrigerator Tubing Kits are
available in the following lengths:
8’ (2.8 m) – WX08X10006
15’ (4.6 m) – WX08X10015
25’ (7.6 m) – WX08X10025
When connecting your refrigerator to a GE Reverse
Osmosis Water System, the only approved installation
is with a GE RVKit. For other reverse osmosis water
systems, follow the manufacturer’s recommendations.
If the water supply to the refrigerator is from
a Reverse Osmosis Water Filtration System
AND the refrigerator also has a water filter,
use the refrigerator’s filter bypass plug. Using
the refrigerator’s water filtration cartridge in
conjunction with the RO filter can result in hollow
ice cubes and slower water flow from the water
dispenser.
This water line installation is not warranted by
the refrigerator or icemaker manufacturer. Follow
these instructions carefully to minimize the risk of
expensive water damage.
Water hammer (water banging in the pipes) in
house plumbing can cause damage to refrigerator
parts and lead to water leakage or flooding. Call a
qualified plumber to correct water hammer before
installing the water supply line to the refrigerator.
To prevent burns and product damage, do not hook
up the water line to the hot water line.
If you use your refrigerator before connecting the
water line, make sure the icemaker power switch is
in the OFF position.
Do not install the icemaker tubing in areas where
temperatures fall below freezing.
When using any electrical device (such as a power
drill) during installation, be sure the device is double
insulated or grounded in a manner to prevent the
hazard of electric shock, or is battery powered.
All installations must be in accordance with local
plumbing code requirements.
27
Installation Instructions
INSTALLING THE WATER LINE (CONT.)
WHAT YOU WILL NEED (CONT.)
Install the shutoff valve on the nearest frequently used
drinking water line.
NOTE: The only GE approved plastic tubing is that
supplied in GE SmartConnect™ Refrigerator Tubing
kits. Do not use any other plastic water supply line
because the line is under pressure at all times.
Certain types of plastic will crack or rupture with age
and cause water damage to your home.
• A GE water supply kit (containing tubing, shutoff
valve and fittings listed below) is available
at extra cost from your dealer or from Parts
and Accessories, 800.626.2002 (in Canada
1.800.661.1616).
• A cold water supply. The water pressure must be
between 20 and 120 p.s.i. (1.4–8.1 bar).
1 SHUT OFF THE MAIN WATER SUPPLY
Turn on the nearest faucet long enough to clear
the line of water.
2 CHOOSE THE VALVE LOCATION
Choose a location for the valve that is easily
accessible. It is best to connect into the side of
a vertical water pipe. When it is necessary to
connect into a horizontal water pipe, make the
connection to the top or side, rather than at the
bottom, to avoid drawing off any sediment from
the water pipe.
• Power drill.
• 1/2” or adjustable wrench.
• Straight and Phillips blade screwdriver.
• Two 1/4” outer diameter compression nuts and 2
ferrules (sleeves)³WRFRQQHFWWKHFRSSHUWXELQJWR
the shutoff valve and the refrigerator water valve.
OR
• If you are using a GE SmartConnect™ Refrigerator
Tubing kit, the necessary fittings are preassembled
to the tubing.
3 DRILL THE HOLE FOR THE VALVE
Drill a 1/4” hole in the water pipe (even if using
a self-piercing valve), using a sharp bit. Remove
any burrs resulting from drilling the hole in the
pipe.
Take care not to allow water to drain into the
drill.
• If your existing copper water line has a flared fitting
at the end, you will need an adapter (available
at plumbing supply stores) to connect the water
line to the refrigerator OR you can cut off the
flared fitting with a tube cutter and then use a
compression fitting. Do not cut formed end from GE
SmartConnect™ Refrigerator tubing.
Failure to drill a 1/4” hole may result in reduced
ice production or smaller cubes.
• Shutoff valve to connect to the cold water line.
The shutoff valve should have a water inlet with a
minimum inside diameter of 5/32” at the point of
connection to the COLD WATER LINE. Saddle-type
shutoff valves are included in many water supply
kits. Before purchasing, make sure a saddle-type
valve complies with your local plumbing codes.
28
Installation Instructions
4 FASTEN THE SHUTOFF VALVE
7 CONNECT THE TUBING TO THE VALVE
Fasten the shutoff valve to the cold water pipe
with the pipe clamp.
Place the compression nut and ferrule (sleeve)
for copper tubing onto the end of the tubing and
connect it to the shutoff valve.
Pipe Clamp
Make sure the tubing is fully inserted into the
valve. Tighten the compression nut securely.
For plastic tubing from a GE SmartConnect™
Refrigerator Tubing kit, insert the molded end
of the tubing into the shutoff valve and tighten
compression nut until it is hand tight, then
tighten one additional turn with a wrench.
Overtightening may cause leaks.
Vertical Cold Water Pipe
Saddle-Type
Shutoff Valve
NOTE: Commonwealth of Massachusetts
Plumbing Codes 248CMR shall be adhered to.
Saddle valves are illegal and use is not permitted
in Massachusetts. Consult with your licensed
plumber.
Saddle-Type
Shutoff Valve
SmartConnect™ Tubing
5 TIGHTEN THE PIPE CLAMP
Packing Nut
Tighten the clamp screws until the sealing
washer begins to swell.
NOTE: Do not overtighten or you may crush the
tubing.
Outlet Valve
Ferrule (sleeve)
NOTE: Commonwealth of Massachusetts
Plumbing Codes 248CMR shall be adhered to.
Saddle valves are illegal and use is not permitted
in Massachusetts. Consult with your licensed
plumber.
Washer
Pipe Clamp
Compression Nut
Inlet End
Clamp
Screw
8 FLUSH OUT THE TUBING
Turn the main water supply on and flush out the
tubing until the water is clear.
Shut the water off at the water valve after about
one quart (1 liter) of water has been flushed
through the tubing.
6 ROUTE THE TUBING
Route the tubing between the cold water line
and the refrigerator.
Route the tubing through a hole drilled in the
wall or floor (behind the refrigerator or adjacent
base cabinet) as close to the wall as possible.
NOTE: Be sure there is sufficient extra tubing to
allow the refrigerator to move out from the wall
after installation.
To complete the installation of the refrigerator, go back
to Step 1 in Installing the Refrigerator.
29
Normal operating sounds.
Newer refrigerators sound different from older refrigerators. Modern refrigerators have more features and
use newer technology.
Do you hear what I hear? These sounds are normal.
HUMMM...
WHOOSH...
„ The new high efficiency compressor may run faster
and longer than your old refrigerator and you may
hear a high-pitched hum or pulsating sound while it is
operating.
„ Sometimes the refrigerator runs for an extended period,
especially when the doors are opened frequently. This
means that the Frost Guard™ feature is working to
prevent freezer burn and improve food preservation.
„ You may hear a whooshing sound when the doors close.
This is due to pressure equalizing within the refrigerator.
„ You may hear
the fans spinning at high speeds. This happens when
the refrigerator is first plugged in, when the doors are
opened frequently or when a large amount of food is
added to the refrigerator or freezer compartments. The
fans are helping to maintain the correct temperatures.
„If either door is open for over 3 minutes, you may hear
the fans come on in order to cool the light bulbs.
„ The fans change speeds in order to provide optimal
cooling and energy savings.
CLICKS, POPS,
CRACKS and CHIRPS
WATER SOUNDS
„ You may hear cracking or popping sounds when the
refrigerator is first plugged in. This happens as the
refrigerator cools to the correct temperature.
„Electronic dampers click open and closed to provide
optimal cooling and energy savings.
„ The compressor may cause a clicking or chirping sound
when attempting to restart (this could take up to 5
minutes).
„ The electronic control board may cause a clicking
sound when relays activate to control refrigerator
components.
„ Expansion and contraction of cooling coils during and
„ The flow of
refrigerant through the freezer cooling coils may make
a gurgling noise like boiling water.
„ Water dropping on the defrost heater can cause a
sizzling, popping or buzzing sound during the defrost
cycle.
„ A water dripping noise may occur during the defrost
cycle as ice melts from the evaporator and flows into
the drain pan.
„Closing the door may cause a gurgling sound due to
pressure equalization.
after defrost can cause a cracking or popping sound.
„ On models with an icemaker, after an icemaking cycle,
you may hear the ice cubes dropping into the ice
bucket.
30
For additional information on normal
icemaker and dispenser operating sounds,
see the About the automatic icemaker and
About the ice and water dispenser sections.
Before you call for service…
GEAppliances.com
Troubleshooting Tips
Save time and money! Review the charts on the following
pages first and you may not need to call for service.
Problem
Possible Causes
What To Do
Refrigerator does not
operate
Refrigerator in defrost cycle.
• Wait about 30 minutes for defrost cycle to end.
Either or both controls set to OFF.
• Set the controls to a lower temperature setting.
Refrigerator is unplugged.
• Push the plug completely into the outlet.
The fuse is blown/circuit
breaker is tripped.
• Replace fuse or reset the breaker.
Refrigerator is in showroom mode. • Unplug the refrigerator and plug it back in.
Vibration or rattling
(slight vibration
is normal)
Rollers need adjusting.
• See Rollers.
Motor operates for
long periods or cycles
on and off frequently.
(Modern refrigerators
with more storage
space and a larger
freezer require more
operating time. They
start and stop often
to maintain even
temperatures.)
Normal when refrigerator
is first plugged in.
• Wait 24 hours for the refrigerator to completely
cool down.
Often occurs when large
amounts of food are
placed in refrigerator.
• This is normal.
Door left open.
• Check to see if package is holding door open.
Hot weather or frequent
door openings.
• This is normal.
Temperature controls
set at the coldest
setting.
• See About the controls.
Temperature control not set
cold enough.
• See About the controls.
Warm weather or frequent
door openings.
• Set the temperature control one step colder.
See About the controls.
Door left open.
• Check to see if package is holding door open.
Door left open.
• Check to see if package is holding door open.
Refrigerator or freezer
compartment too warm
Frost or ice crystals
on frozen food
(frost within package
is normal)
Too frequent or too long
door openings.
Divider between
refrigerator and freezer
compartments
feels warm
Automatic energy saver
system circulates warm
liquid around front edge
of freezer compartment.
• This helps prevent condensation on the outside.
Automatic icemaker
does not work
Icemaker power switch
is in the OFF position.
Water supply turned off or
not connected.
Freezer compartment
too warm.
• Set the power switch to the ON position.
• See Installing the water line.
• Wait 24 hours for the refrigerator to completely
cool down.
Piled up cubes in the storage
bin cause the icemaker
to shut off.
• Level cubes by hand.
Ice cubes stuck in icemaker.
• Turn off the icemaker, remove cubes, and turn the
icemaker back on.
31
Before you call for service…
Problem
Possible Causes
What To Do
Ice cubes have
odor/taste
Ice storage bin needs cleaning.
• Empty and wash bin. Discard old cubes.
Food transmitting odor/taste
to ice cubes.
• Wrap foods well.
Interior of refrigerator
needs cleaning.
• See Care and cleaning.
Small or hollow cubes
Water filter clogged.
• Replace filter cartridge with new cartridge or with plug.
Slow ice cube freezing
Door left open.
• Check to see if package is holding door open.
Temperature control not set
cold enough.
• See About the controls.
Frequest ‘buzzing sound”
warm (on some models)
Icemaker power switch is in the 1 • Set the power switch to the 0 (off) position. Keeping it in
(on) position, but the water supply the 1 (on) position will damage the water valve.
to the refrigerator has not been
connected.
Orange glow in
the freezer
Defrost heater is on.
• This is normal.
Cube dispenser does not
work (on some models)
Icemaker turned off or
water supply turned off.
• Turn on icemaker or water supply.
Ice cubes are frozen to
icemaker feeler arm.
• Remove cubes.
An item is blocking or has fallen
into the ice chute inside the top
door bin of the freezer.
• Remove any item that might be blocking, or has fallen
into, the chute.
Irregular ice clumps in
storage container.
• Break up with fingertip pressure and discard
remaining clumps.
• Freezer may be too warm. Adjust the freezer control
to a colder setting, one position at a time, until clumps
do not form.
Dispenser is LOCKED.
• Press and hold the LOCK pad for 3 seconds.
Water has poor taste/odor Water dispenser has not been
(on some models)
used for a long time.
• Dispense water until all water in system is replenished.
Water in first glass is
warm (on some models)
Normal when refrigerator
is first installed.
• Wait 24 hours for the refrigerator to completely
cool down.
Water dispenser has not been
used for a long time.
• Dispense water until all water in system is replenished.
Water system has been drained.
• Allow several hours for replenished supply to chill.
Water dispenser does
Water supply line turned
not work (on some models) off or not connected.
• See Installing the water line.
Water filter clogged.
• Replace filter cartridge or remove filter and install plug.
Air may be trapped in the
water system.
• Press the dispenser arm for at least two minutes.
Dispenser is LOCKED.
• Press and hold the LOCK pad for 3 seconds.
Water spurting from
Newly-installed filter cartridge.
dispenser (on some models)
• Run water from the dispenser for 3 minutes (about
one and a half gallons).
Water is not dispensed
(on some models) but
icemaker is working
Water in reservoir is
frozen.
• Call for service.
Refrigerator control setting
is too cold.
• Set to a warmer setting.
32
GEAppliances.com
Problem
Possible Causes
What To Do
No water or ice cube
production
Supply line or shutoff
valve is clogged.
• Call a plumber.
Water filter clogged.
• Replace filter cartridge or remove filter and install plug.
Dispenser is LOCKED.
• Press and hold the LOCK pad for 3 seconds.
CUBED ICE was selected
but CRUSHED ICE
was dispensed
(on some models)
Last setting was
CRUSHED ICE.
• A few cubes were left in the crusher from the previous
setting. This is normal.
Refrigerator has odor
Foods transmitting
odor to refrigerator.
• Foods with strong odors should be tightly wrapped.
• Keep an open box of baking soda in the refrigerator;
replace every three months.
Interior needs cleaning.
• See Care and cleaning.
Moisture forms on
outside of refrigerator
Not unusual during
periods of high humidity.
• Wipe surface dry.
Moisture collects inside
(in humid weather, air
carries moisture into
refrigerator when doors
are opened)
Too frequent or too
long door openings.
•This is normal for the beverage center.
Interior light does
not work
No power at outlet.
• Replace fuse or reset the breaker.
Light bulb burned out.
• See Replacing the light bulbs.
For LED lights
• Call Service.
Water on kitchen floor or
on bottom of freezer
Cubes jammed in chute.
• Poke ice through with a wooden spoon.
Hot air from bottom
of refrigerator
Normal air flow cooling
motor. In the refrigeration
process, it is normal that
heat be expelled in the
area under the refrigerator.
Some floor coverings
are sensitive and will
discolor at these normal
and safe temperatures.
Refrigerator never
shuts off but the
temperatures are OK
Adaptive defrost keeps
compressor running during
door openings.
• This is normal. The refrigerator will cycle off after the
door remains closed for 2 hours.
Refrigerator is beeping
Door is open.
• Close door.
Door not closing properly
Door gasket on hinge side
sticking or folding over.
• Apply paraffin wax to the face of the gasket.
Actual temperature not
equal to Set temperature
Unit just plugged in.
• Allow 24 hours for system to stabilize.
Door open for too long.
• Allow 24 hours for system to stabilize.
Due to the highter humidity in the •This is normal for the beverage center.
refrigerator, you may on accasion loads and environmental conditions change.
experience fog or small amounts
with a per towel if desired.
of moisture in the refrigerator
compartment.
Warm food added to refrigerator. • Allow 24 hours for system to stabilize.
Defrost cycle is in process.
• Allow 24 hours for system to stabilize.
33
(on some models)
34
Performance Data Sheet (on some models)
SmartWater™ Filtration System³GE MWF Cartridge
Performance Data Information
Capacity: 300 Gallons (1,135 Liters)
7KHFRQFHQWUDWLRQRIWKHFRQWDPLQDQWVWHVWHGIRUWKLV¿OWHULQZDWHUHQWHULQJWKHV\VWHPZDVUHGXFHGWR
DFRQFHQWUDWLRQOHVVWKDQRUHTXDOWRWKHSHUPLVVLEOHOLPLWIRUZDWHUOHDYLQJWKHV\VWHPDVVSHFL¿HGLQ
16)$16,6WDQGDUGDQG6WDQGDUG6\VWHPWHVWHGDQGFHUWL¿HGE\16),QWHUQDWLRQDODJDLQVW16)
ANSI Standard 42 and Standard 53.
Please see geappliances.com for complete listing of the contaminants tested and the amounts reduced.
The following pharmaceutical reduction claims have not been certi¿ed by NSF International or the state of California.
Claims tested and veri¿ed by independent laboratory:
Contaminant
Reduction
Atenolol
Fluoxetine
Ibuprofen
Progesterone
Trimethoprim
AvHUDJH,Q¾XHQW
978 ng/L
907 ng/l
885 ng/L
1097 ng/L
415 ng/L
16)VSHFL½HG
Challenge Concentration
N/A
N/A
N/A
N/A
N/A
Avg %
Reduction
99.5%
99.4%
94.1%
99.5%
99.5%
Average Product
Water
Concentration
5.0 ng/L
5.4 ng/L
52.3 ng/L
5.0 ng/L
2.0 ng/L
Max Permissible
Product Water NSF Reduction
Concentration Requirements
N/A
N/A
N/A
N/A
N/A
N/A
N/A
N/A
N/A
N/A
NSF
Test Report
J-00121587
J-00121587
J-00121588
J-00121589
J-00121587
Application Guidelines/Water Supply Parameters
Service Flow
Water Supply
0.5 gpm (21.9 lpm)
Potable Water
Water Pressure
Water Temperature
40-120 psi (2.8-8.2 bar)
33°F-100°F (0.6°C-38°C)
It is essential that the manufacturer’s recommended installation, maintenance and filter replacement requirements be carried out for the product to perform as advertised.
See Installation Manual for Warranty information.
Note: While the testing was performed under standard laboratory conditions,
actual performance may vary.
Replacement Cartridge: MWF. For estimated costs of replacement elements
please call 1-800-626-2002 or visit our website at www.geapplianceparts.com.
WARNING
To reduce the risk associated with ingestion of contaminants:
• Do not use with water that is microbiologically unsafe or of unknown quality
without adequate disinfection before and after the system. Systems certL¿ed
for cyst reduction may be used on disinfected water that may contain ¿lterable
cysts. EPA Establishment Number 10350-MN-005.
For conditions of use, health claims certified by the California Department of Public
Health, and replacements, see performance data sheet. California Department
of Public Health Certification #05-1698. The contaminants or other substances
removed or reduced by this water filter are not necessarily in all users’ water.
REPLACEMENT
ELEMENT
NOTICE
To reduce the risk associated with property damage due to water leakage:
• Read and follow use instructions before installation and use of this system.
• Installation and use MUST comply with all state and local plumbing codes.
• Do not install if water pressure exceeds 120 psi (8.2 bar). If your water pressure
exceeds 80 psi, you must install a pressure-limiting valve. Contact a plumbing
professional if you are uncertain how to check your water pressure.
• Do not install where water hammer conditions may occur. If water hammer
conditions exist you must install a water hammer arrester. Contact a plumbing
professional if you are uncertain how to check for this condition.
• Do not install on hot water supply lines. The maximum operating water
temperature of this ¿lter system is 100º F (38º C).
• Protect ¿lter from freezing. Drain ¿lter when temperatures drop
below 33ºF (0.6ºC).
•
must be replaced every 6 months at the
rated capacity, or sooner if a noticeable reduction in ÀRw rate occurs.
Tested and cerWL½ed by NSF International
against NSF/ANSI Standard 42 and
Standard 53 in model GE MWF for the
reduction of the claims speci½Hd on the
performance data sheet.
35
Refrigerator Warranty.
For US Customers, all warranty service provided by our Factory Service
Centers, or an authorized Customer Care® technician. To schedule
service, visit us online at GEAppliances.com, or call 800.GE.CARES
(800.432.2737). Please have serial number and model number available
when calling for service. In Canada, call 800.561.3344.
For the Period of:
Staple your receipt here.
Proof of the original
purchase date is needed
to obtain service under the
warranty.
GE Will Replace
GE, GE PROFILE and GE Cáfe MODELS:
One Year
From the date of the original
purchase
Any part of the refrigerator which fails due to a defect in materials or workmanship.
During the limited one-year warranty, GE will also provide, free of charge, all labor and related
service to replace the defective part.
Thirty Days
(Water filter, if included)
From the original purchase
date of the refrigerator
Any part of the water filter cartridge which fails due to a defect in materials or workmanship. During
this limited thirty-day warranty, GE will also provide, free of charge, a replacement water filter
cartridge.
GE PROFILE and GE Cáfe MODELS ONLY:
Five Years
From the date of the
purchase
Any part of the sealed refrigerating system (the compressor, condenser, evaporator an all
connecting tubing) which fails due to a defect in materials or workmanship.
During this limited five-year sealed refrigerating system warranty, GE will also provide, free of
charge, all labor and related service to replace the defective part in the sealed refrigerating system.
What GE Will Not Cover:
„
Service trips to your home to teach you how to use the
product.
„
Improper installation, delivery or maintenance.
„ Failure of the product if it is abused, misused, or used for other
than the intended purpose or used commercially.
„ Loss of food due to spoilage.
„ Replacement of house fuses or resetting of circuit breakers.
„ Damage to finish, such as surface rust, tarnish, or small
blemishes not reported within 48 hours of delivery.
„ Damage caused by a non-GE brand water filter.
„ Replacement of the water filter cartridge, if included, due to
water pressure that is outside the specified operating range
or due to excessive sediment in the water supply.
„ Replacement of the light bulbs, if included, or water filter
cartridge, if included, other than as noted above.
„ Damage to the product caused by accident, fire, floods or acts
of God.
„ Incidental or consequential damage caused by possible
defects with this appliance.
„ Product not accessible to provide required service.
(;&/86,212),03/,(':$55$17,(6³<RXUVROHDQGH[FOXVLYHUHPHG\LVSURGXFWUHSDLUDVSURYLGHGLQWKLV
Limited Warranty. Any implied warranties, including the implied warranties of merchantability or fitness for a
particular purpose, are limited to one year or the shortest period allowed by law.
For US Customers: This warranty is extended to the original purchaser and any succeeding owner for products
purchased for home use within the USA. If the product is located in an area where service by a GE Authorized
Servicer is not available, you may be responsible for a trip charge or you may be required to bring the product
to an Authorized GE Service location for service. In Alaska, the warranty excludes the cost of shipping or service
calls to your home.
Some states do not allow the exclusion or limitation of incidental or consequential damages. This warranty gives
you specific legal rights, and you may also have other rights which vary from state to state. To know what your
legal rights are, consult your local or state consumer affairs office or your state’s Attorney General.
Warrantor: General Electric Company. Louisville, KY 40225
For Customers in Canada: This warranty is extended to the original purchaser and any succeeding owner for
products purchased in Canada for home use within Canada. In-home warrant service will be provided in areas
where it is available and deemed reasonable by Mabe to provide.
Warrantor Canada: MC Commercial, Burlington, Ontario, L7R 5B6
36
Notes...
GEAppliances.com
37
Notes...
38
GEAppliances.com
39
Notes...
40
Mesures de sécurité . . . . . . . . . . . . . 42, 43
Fonctionnement
Clayettes et bacs . . . . . . . . . . . . . . . . . . . . 48, 49
Entretien et nettoyage
du réfrigérateur . . . . . . . . . . . . . . . . . . . . . 55, 56
ExpressChill™ . . . . . . . . . . . . . . . . . . . . . . . . . . . .46
Le distributeur d’eau et de glaçons. . . . . . .54
Le filtre à eau . . . . . . . . . . . . . . . . . . . . . . . . . . .47
Les commandes . . . . . . . . . . . . . . . . . . . . . . . .44
Les portes du réfrigérateur . . . . . . . . . . . . . .50
Les tiroirs et contenants à légume . . . . . . .50
Machine à glaçons automatique . . . . . . 52,53
Remplacement des ampoules . . . . . . . . . . .56
TurboCool™ . . . . . . . . . . . . . . . . . . . . . . . . . . . . .45
Installation
Déménagement du réfrigérateur . . . . 58–63
Installation de la conduite d’eau . . . . . 67–69
Installation du réfrigérateur. . . . . . . . . . 64–66
Préparation . . . . . . . . . . . . . . . . . . . . . . . . . . . . .58
Conseils de dépannage . . . . . . . . . . . . 71–74
Bruits de fonctionnement normaux . . . . . . . . . 70
Soutien au consommateur
Feuillet de données relatives à la
performance de la cartouche MSWF . . . .76
Feuillet de données relatives à la
performance de la cartouche MWF . . . . . .77
Garantie . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .75
Soutien au consommateur . . . . . . . . . . . . . .80
Transcrivez les numéros de modèle et de série
ici :
# de modèle ___________________________
# de série _____________________________
Ils figurent sur l’étiquette qui se trouve à l’interieur du
compartiment réfrigérateur en haute à droite.
41
MESURES DE SÉCURITÉ IMPORTANTES.
LISEZ D’ABORD TOUTES LES DIRECTIVES.
SÉCURITÉ
Site Internet d’Électroménagers GE
Pour de plus amples informations sur le fonctionnement de votre réfrigérateur, consultez le
site www.electromenagersge.ca ou composez le 800.561.3344.
CONSIGNES DE SÉCURITÉ POUR LE RÉFRIGÉRATEUR
Ce symbole représente une alerte de sécurité. Ce symbole vous avise de dangers possibles pouvant causer
la mort, des blessures ou autres. Tous les messages de sécurité seront précédés du symbole d’alerte de sécurité
ainsi que des mots « DANGER », « AVERTISSEMENT » ou « MISE EN GARDE ». Ces messages sont les suivants :
Signale une situation qui présente un danger imminent et qui, si elle n’est pas évitée, entraînera des blessures
graves, voire la mort.
. un danger imminent et qui, si elle n’est pas évitée, peut entraîner des
AVERTISSEMENT Signale une situation qui présente
blessures graves, voire la mort.
ATTENTION Signale une situation qui présente un danger imminent et qui, si elle n’est pas évitée, peut entraîner des
blessures mineures ou graves.
DANGER
IMPORTANTES CONSIGNES DE SÉCURITÉ
Pour réduire le risque d’incendie, d’explosion, de choc électrique ou de blessures lorsque
AVERTISSEMENT
vous utilisez votre réfrigérateurde , veuillez suivre ces consignes de sécurité :
„ Ce réfrigérateur doit être correctement installé conformément
aux Consignes d’Installation avant toute utilisation.
„ Débranchez le réfrigérateur avant d’effectuer une réparation,
de remplacer une ampoule ou de le nettoyer.
Remarque : L’alimentation du réfrigérateur ne peut être
déconnectée par aucune des fonctions sur le panneau de
commande.
Remarque : Les réparations doivent être effectuées par un
professionnel qualifié.
„ Remettez toutes les pièces et panneaux en place avant
d’utiliser l’appareil.
„ Ne stockez pas ou n’utilisez pas d’essence ou d’autres vapeurs
et liquides inflammables à proximité de cet appareil ou de tout
autre appareil électroménager.
„ Nous déconseillons fortement l’utilisation d’une rallonge
à cause des risques potentiels dans certaines conditions.
Cependant, si l’utilisation d’un cordon prolongateur est
nécessaire, ce dernier doit obligatoirement être homologué UL
(aux USA) ou CSA (au Canada), à trois brins avec mise à la terre
pour appareil électroménager et doit être équipé d’une fiche et
d’une prise femelle avec terre. Les caractéristiques électriques
du cordon prolongateur doivent être de 15 ampères (minimum)
et de 120 volts.
„ Pour éviter les risques d’asphyxie et d’enfermement pour
les enfants. Démontez les portes du congélateur et du
compartiment de réfrigération avant de le mettre au rebut ou
d’interrompre son utilisation.
„ Ne laissez pas les enfants grimper, se mettre debout ou se
suspendre aux poignées de portes dans le réfrigérateur ou aux
clayettes du réfrigérateur. Ils pourraient se blesser gravement.
IMPORTANTES CONSIGNES DE SÉCURITÉ
Pour réduire le risque de blessures lorsque vous utilisez votre réfrigérateurde , veuillez
ATTENTION suivre ces consignes de sécurité.
„ Ne nettoyez pas les clayettes ou les couvercles en verre avec
de l’eau tiède quand ceux-ci sont froids. Les clayettes et
couvercles en verre peuvent se casser s’ils sont exposés à des
changements soudains de température ou si vous les cognez
ou les faites tomber. Le verre trempé est conçu pour se briser
en petits morceaux en cas de casse
„ Éloignez les doigts des parties du congélateur où l’on peut
facilement se pincer : les espaces entre les portes, et entre
les portes et les placards sont toujours étroits. Soyez prudent
lorsque vous fermez les portes en présence d’enfants.
42
„ Ne touchez pas les surfaces froides du congélateur lorsque
vous avez les mains humides ou mouillées. La peau risque
d’adhérer à ces surfaces extrêmement froides.
„ Ne recongelez pas les aliments surgelés qui ont complètement
dégelé.
„ Si votre réfrigérateur est doté d’une machine à glaçons
automatique, évitez le contact avec les pièces mobiles du
mécanisme éjecteur, ou avec l’élément chauffant qui libère les
glaçons. Ne posez pas les doigts ou les mains sur le mécanisme
de la machine à glaçons automatique pendant que le
réfrigérateur est branché.
www.electromenagersge.ca
SÉCURITÉ
(CONT.)
INSTALLATION
Risque d’explosion.
Conservez les matériaux et vapeurs inflammables tels que l’essence à l’écart de votre réfrigérateur.
Une explosion, un incendie voire la mort pourrait en résulter.
AVERTISSEMENT
BRANCHEMENTS ÉLECTRIQUES
Risque de choc électrique.
Branchez l’appareil dans une prise triple avec terre.
Ne retirez pas la broche de terre.
N’utilisez pas d’adaptateur.
Le non-respect de ces instructions peut entraîner des risques d’incendies, des chocs électriques ou la mort.
AVERTISSEMENT
Ne coupez pas ou n’enlevez pas, sous aucun prétexte, la troisième broche de mise à la terre du cordon
d’alimentation. Pour des raisons de sécurité, cet appareil doit être correctement mis à la terre.
Le cordon d’alimentation de cet appareil est équipé d’une fiche
à trois broches (pour une mise à la terre) qui s’adapte à la prise
de courant standard à 3 broches (pour une mise à la terre) pour
minimiser les risques de chocs électriques par cet appareil.
Faites vérifier la prise murale et le circuit électrique par
un électricien qualifié pour s’assurer que le système est
correctement mis à la terre.
Dans le cas d’une prise biphasée, l’installateur a la
responsabilité et l’obligation de la remplacer par une
prise triphasée correctement mise à la terre. N’utilisez pas
d’adaptateur.
Le réfrigérateur doit toujours être branché à sa propre prise
électrique d’une tension nominale correspondant à celle
indiquée sur sa plaque signalétique.
Une alimentation électrique à 115 volts CA, 60 Hz, avec
un fusible de 15 ou 20 ampères et une mise à la terre est
nécessaire. Ceci permet d’obtenir un meilleur rendement et
évite de surcharger les circuits électriques du domicile qui
risque d’occasionner un incendie en surchauffant.
Ne débranchez jamais le réfrigérateur en tirant sur le cordon
d’alimentation. Prenez toujours fermement la fiche en main et
tirez pour la sortir de la prise.
Réparez ou remplacez immédiatement tout cordon électrique
usé ou endommagé. N’utilisez pas un cordon fissuré ou
présentant des dommages dus aux frottements soit sur sa
longueur ou aux extrémités.
Lorsque vous éloignez votre réfrigérateur du mur, faites
attention à ne pas le faire rouler sur le cordon d’alimentation
afin de ne pas l’endommager.
MISE AU REBUT APPROPRIÉE DE VOTRE ANCIEN RÉFRIGÉRATEUR
Un enfant risque de suffoquer ou d’y être emprisonné.
Démontez les portes du compartiment de réfrigération et du compartiment de congélation du
réfrigérateur, avant mettre celui-ci au rebut. Le non-respect de cette recommandation peut entraîner
l’enfermement d’un enfant qui peut entraîner la mort ou des lésions cérébrales.
AVERTISSEMENT
IMPORTANT:
Les enfants pris au piège ou morts d’asphyxie sont
toujours d’actualité. Les réfrigérateurs jetés ou
abandonnés restent dangereux même si vous ne
les laissez au rebut que pour « quelques jours ». Si
vous voulez jeter votre ancien réfrigérateur, suivez les
instructions suivantes pour empêcher les accidents.
Avant de jeter votre ancien réfrigérateur ou
congélateur:
„ Démontez les portes du compartiment de
réfrigération et du compartiment de congélation.
„ Laissez les clayettes en place, pour éviter que des
enfants puissent facilement grimper dans votre
réfrigérateur.
Fluides frigorigènes
Les appareils réfrigérants contiennent des fluides
frigorigènes qui conformément à la législation
fédérale doivent être retirés avant la mise au
rebut de l’appareil. Si vous mettez au rebut
un ancien réfrigérateur contenant des fluides
frigorigènes, vérifiez la procédure à suivre auprès
de la compagnie responsable de l’élimination.
LISEZ ET SUIVEZ SOIGNEUSEMENT CES MESURES DE SÉCURITÉ.
CONSERVEZ CES INSTRUCTIONS
43
À propos des commandes de température.
Toutes les options ne sont pas disponibles sur tous les modèles. Les commandes de votre appareil peuvent se présenter ainsi:
OU
Les commandes de températures sont préréglées en usine à 3°C (37°F) pour le compartiment réfrigérateur
et à -18°C (0°F) pour le compartiment congélateur. Veuillez attendre 24 heures pour que la température se
stabilise au préréglage recommandé.
Les commandes de températures peuvent afficher les températures SET (fixées) ainsi que les températures
réelles à l’intérieur du réfrigérateur et du congélateur. La température actuelle peut légèrement varier de la
température SET (fixée) suivant les conditions d’utilisation et de fonctionnement.
„ Sur certains modèles, en mettant les deux commandes sur la température la plus élevée, le
refroidissement est arrêté dans les compartiments de congélation et de réfrigération.
„ Sur d’autres modèles, en mettant une des commandes sur la température la plus élevée jusqu’à ce
que l’affichage clignote (off), le refroidissement est arrêté dans les compartiments de congélation et de
réfrigération.
„ REMARQUE: En éteignant le réfrigérateur à l’aide des commandes sur le panneau à touches tactiles,
l’alimentation électrique de l’appareil n’est pas coupée.
REMARQUE: Le réfrigérateur est livré avec un film protecteur sur les commandes de températures. Si le film
n’a pas été retiré pendant l’installation, retirez-le maintenant.
Technologie Performance Air Flow
Le système Performance Air Flow est conçu pour
maximiser le contrôle de la température dans les
compartiments de congélation et de réfrigération.
Ce concept unique comprend une Air Tower (Tour
d’aération) le long de la paroi arrière du réfrigérateur et
un Air Tunnel (Tunnel d’aération) sur la partie inférieure
de la paroi arrière du congélateur.
44
Le fonctionnement de l’appareil ne sera pas affecté
si des aliments sont placés devant les grilles de ces
composants. Il est possible de retirer la Air Tower (tour
d’aération) et le Air Tunnel (tunnel d’aération). Toutefois,
ceci affectera les performances de l’appareil. (Pour le
démontage de ces composants, en ligne, 24 heures
sur 24, consultez notre site GEAppliances.com ou
appelez le 800.GE.CARES. Au Canada, veuillez consulter
notre site internet geappliances.ca ou nous contacter
au 1.800.561.3344.)
ClimateKeeper2™ (sur certains modèles)
www.electromenagersge.ca
Fonctionnement
Le système ClimateKeeper2™ est le système de
réfrigération le plus avancé qui soit permettant
l’obtention de conditions de température et
d’humidité optimales dans le réfrigérateur.
de légers brouillards ou de condensation dans
le compartiment de réfrigération est possible.
C’est un phénomène normal dont l’apparition
dépend des différentes quantités d’aliments et
des conditions environnementales.
Le système ClimateKeeper2™ est équipé de
GHX[pYDSRUDWHXUV³XQSRXUOHUpIULJpUDWHXUHW Si nécessaire, essuyez avec un chiffon sec.
un pour le congélateur.
Les flux d’air séparés minimisent le mélange
L’appareil est ainsi équipé de deux systèmes
d’air entre les deux compartiments, réduisent
de refroidissement séparé. Le flux d’air est
le transfert d’odeurs des aliments frais et
ainsi séparé entre les aliments frais et le
permettent d’améliorer le goût des glaçons.
compartiment congélateur pendant le cycle de
Le système ClimateKeeper2™ permet
refroidissement normal.
également de réduire le nombre de cycle de
Ceci permet d’avoir un taux d’humidité
dégivrage de l’évaporateur du congélateur
beaucoup plus élevé dans le compartiment de
réduisant ainsi les brûlures de congélation.
réfrigération que dans un système classique,
* l’air du congélateur est utilisé dans le cycle
** permettant aux aliments de conserver
CustomCool.
plus longtemps leur taux d’humidité et leur
fraîcheur. Les aliments sensibles à l’humidité
** Les essais démontrent un niveau d’humidité
ambiante tels que les fruits frais, les salades, le
plus élevé dans la partie Aliment Frais dans les
riz, etc. peuvent maintenant être stockés sur
réfrigérateurs équipés du ClimateKeeper2 .
des clayettes ouvertes sans perte d’humidité
excessive. A cause du taux d’humidité plus
important dans le réfrigérateur, la présence
Au sujet de TurboCool.™ (sur certains modèles)
Fonctionnement
OU
Le système TurboCool™ accélère le refroidissement
du compartiment réfrigérateur afin de refroidir
plus rapidement les aliments. Utilisez TurboCool™
lorsque vous ajoutez une grande quantité d’aliments
dans le compartiment réfrigérateur, lorsque vous
rangez des aliments après les avoir laissés à
température ambiante ou lorsque vous rangez des
restes d’aliments tièdes. Vous pouvez également
utiliser cette fonction lorsque votre réfrigérateur est
resté débranché pendant une période prolongée.
Une fois activé, le compresseur se met
immédiatement en marche et si nécessaire, les
ventilateurs se mettent en marche et s’arrêtent
rapidement à intervalles réguliers pendant huit
heures. Le compresseur continue à fonctionner
jusqu’à ce que le compartiment réfrigérateur se
refroidisse à une température d’environ 1°C (34°F),
puis il se met en marche et s’arrête à intervalles
réguliers pour maintenir cette température. Au bout
de huit heures, ou si vous appuyez sur la touche
TurboCool™, le compartiment réfrigérateur revient
à son réglage d’origine.
How to Use
Press TurboCool.™ The TurboCool ™ temperature
display will show Tc and the LED will be activated.
After TurboCool ™ is complete, the TurboCool ™
indicator light will go out.
NOTES: The refrigerator temperature cannot be
changed during TurboCool ™.
The freezer temperature is not affected
during TurboCool ™.
When opening the refrigerator door during
TurboCool ™, the fans will continue to run
if they have cycled on.
45
About ExpressChill™
.
(sur certains modèles)
Fonctionnement
Le fonction ExpressChill ™ comporte un système
de registres, un ventilateur et une thermistance.
Le bac est scellé hermétiquement afin d’empêcher
les variations de température dans le reste du
réfrigérateur.
Les commandes pour ce bac sont situées sur le
haut du réfrigérateur ou au niveau du distributeur
avec les commandes de température.
Mode d’emploi
Videz le bac. Placez le plateau Chill
(refroidissement) dans le bac. Placez les
aliments sur le plateau et fermez
complètement le bac.
ExpressChill™
Appuyez sur la touche ExpressChill™. Sur
certains modèles, vous pouvez sélectionner la
durée de refroidissement (utilisez le tableau
pour déterminer le meilleur réglage). Sur
d’autres modèles, vous n’avez qu’une seule
option (45 minutes). Sur les modèles à
possibilités de réglages multiples, appuyez sur
la touche jusqu’à ce que le voyant lumineux
apparaisse à côté du réglage souhaité.
„ Pour désactiver une fonction avant que le
cycle ne soit terminé, appuyez sur la touche
correspondant à cette fonction jusqu’à ce
qu’aucune option ne soit sélectionnée et
que l’écran s’éteigne.
„ Pendant le cycle de ExpressChill ™
le compte à rebours est affiché.
Retrait et remise en place du bac
Pour le retirer :
Tirez le bac jusqu’à la butée.
Faites tourner les quatre verrous jusqu’à leur
position déverrouillée.
Fermez les verrous en les faisant tourner en
position de verrouillage.
Soulevez l’avant du bac puis faites le sortir en
tirant.
Pour le remettre en place :
Assurez-vous que les quatre verrous soient en
position de déverrouillage.
Placez les côtés du bac dans les supports du
bac en vous assurant que les verrous soient
positionnés sur les encoches du tiroir.
Tableau ExpressChill™
(sur certains modèles)
REMARQUE : Les résultats varient selon l’emballage, la température original de l’aliment ou
certaines de ses caractéristiques.particularités
15 Minutes
„ 1 canette (12 oz)
„ 2 petites cartons de jus de
fruits (6–8 oz onces)
46
30 Minutes
„ 2 à 6 canettes (12 oz onces)
„ 2 bouteilles en plastique de
20 onces
„ 4 à 6 cartons de jus de fruits
(6 à 8 oz onces)
„ 3 packs de jus de fruits en
aluminium
„ Vin (bouteille de 750 ml)
45 Minutes
„ 2 litre de boisson
„1/2 gallon (1,9 litre) de jus de
fruits
„1 paquet de gélatine
Le filtre à eau (sur certains modèles)
www.electromenagersge.ca
Cartouche du filtre à eau
La cartouche du filtre à eau se trouve dans le coin droit arrière
supérieur du compartiment réfrigérateur, juste au-dessous des
commandes de température.
Portecartouche
À quel moment remplacer le filtre sur les modèles
avec indicateur lumineux de remplacement
Une lumière indique la nécessité de remplacer la cartouche du
filtre à eau sur le distributeur. Cette lumière devient orange pour
vous avertir de remplacer bientôt le filtre.
Vous devez remplacer la cartouche de filtre quand la lumière de
l’indicateur devient rouge ou quand le débit de l’eau qui va au
distibuteur d’eau ou au distributeur de glace diminue.
À quel moment remplacer le filtre sur les modèles
sans indicateur lumineux de remplacement
Faites couler l’eau du distributeur pendant 3 minutes
(environ 6 litres) afin de dégager le système et empêcher le
bredouillement.
Pressez et maintenez appuyée la touche WATER FILTER
(filtre à eau) sur le distributeur pendant 3 secondes (sur
certains modèles).
La cartouche du filtre doit être remplacée tous les six mois ou
moins si le débit d’eau du distributeur d’eau ou du distributeur
de glace diminue.
Retrait de la cartouche du filtre
S’il s’agit d’une cartouche de remplacement, enlevez d’abord
l’ancienne en la tournant lentement vers la gauche. Ne tirez pas
sur la cartouche. Un peu d’eau peut s’écouler.
Installation de la cartouche du filtre à eau
Si vous remplacez une cartouche SmartWater avec un
adaptateur, il doit être retiré avant l’installation de la
cartouche. Pour retirer l’adaptateur, faites-le pivoter vers la
gauche d’environ un quart de tour.
Si vous remplacez une cartouche Water by Culligan, laissez
l’adaptateur en place. Cet adaptateur demeurera dans le
réfrigérateur lorsque que vous remplacerez les futures
cartouches.
REMARQUE: Une cartouche de remplacement qui vient d’être
installée peut faire jaillir l’eau du distributeur.
Bouchon de dérivation du filtre
Il faut utiliser le bouchon de dérivation du filtre lorsqu’une
cartouche de remplacement n’est pas disponible. Le distributeur
et la machine à glaçons ne peuvent pas fonctionner sans le filtre
ou sans le bouchon de dérivation du filtre.
Bouchon de
dérivation
du filtre
SmartWater
Avec adaptateur Sans adaptateur
(l’apparence peut varier)
Certains modèles
utilisent ce type
de filtre à eau.
Sur les modèles sans indicateur lumineux de remplacement,
appliquer l’autocollant du mois et de l’année à la nouvelle
cartouche pour vous rappeler de remplacer le filtre dans six
mois.
Remplissez la cartouche de remplacement d’eau du robinet
immédiatement après l’installation afin de permettre un
meilleur débit du distributeur.
Alignez la flèche de la cartouche avec celle de support de
cartouche. Placez le haut de la nouvelle cartouche à
l’intérieur du support. Ne l’enfoncez pas dans le portecartouche.
Tournez la cartouche lentement vers la droite jusqu’au point
où la cartouche s’arrête. NE SERREZ PAS TROP FORT. Lorsque
vous la tournez, elle se lèvera en position automatiquement.
La cartouche fera approximativement une 1/2 rotation.
Bouchon de
dérivation
du filtre
Water by Culligan
Pour utiliser la prise de dérivation du filtre sur les modèles Water
by Culligan, vous devez d’abord retirer l’adaptateur du filtre du
support de la cartouche en le faisant pivoter vers la gauche.
Pour obtenir des résultats optimums de votre système de
filtration, GE vous recommande d’utiliser uniquement des filtres
GE SmartWater. L’utilisation de filtres GE dans les réfrigérateurs
GE et Hotpoint vous garantit une performance optimale et une
bonne fiabilité. Les filtres SmartWater de GE restent le bon choix
parce qu’ils sont spécifiquement conçus et brevetés pour les
produits GE. Les filtres GE SmartWater respectent les normes
rigoureuses de sécurité et de qualité NSF qui sont primordiales
lors de la filtration d’eau. GE n’a pas agréé des filtres de
marques différentes pour une utilisation dans les réfrigérateurs
GE et Hotpoint. Aucune assurance n’est donnée que les filtres
d’autres marques puissent respecter la qualité, performance et
fiabilité exigées par GE.
6LYRXVDYH]GHVTXHVWLRQV³YLVLWH]QRWUHVLWH:HEjO’adresse
www.electromenagersge.ca ou appelez le 1.888.261.2133.
Filtres de remplacement:
Pour commander des cartouches supplémentaires aux
États-Unis, visitez notre site Web à l’adresse ge.com, ou appelez
le Service des pièces et accessoires GE au 800.626.2002.
Voir l’étiquette du filtre pour le type de filtre à l’ordre (MWF ou
MSWF)
Les clients au Canada devraient consulter les pages jaunes pour
connaître la succursale Mabe la plus près.
47
Clayettes et bacs.
Toutes les caractéristiques ne sont pas disponibles sur tous les modèles.
L’ergot
Bacs de porte de réfrigérateur et bacs basculants de porte de congélateur.
Grands bacs
Vous pouvez régler les plus grands bacs de
porte de réfrigérateur et les bacs basculants de
porte de congélateur.
Enlèvement: Soulevez l’avant du bac droit vers
le haut, puis soulevez et enlevez.
Bac de porte de réfrigérateur
L’ergot aide à empêcher que de petits articles
placés sur la clayette de la porte se renversent,
coulent ou glissent. Mettez un doigt de chaque
côté de l’ergot près de l’arrière et faites bouger
la clayette vers l’avant ou vers l’arrière selon vos
besoins.
Bac supérieur de porte de congélateur
NOTE: Soyez
prudents lorsque
vous placez des
articles dans le
bac supérieur.
Assurez-vous
qu’aucun objet
ne bloque
ou tombe dans
la chute à
glaçons.
Remise en place ou relocalisation: Engagez
l’arrière du bac dans les soutiens moulés de la
porte. Puis poussez vers le bas l’avant du bac.
Le bac se fixe en place.
Petits bacs
Enlèvement: Soulevez l’avant du bac droit vers
le haut, puis enlevez.
Bac de congélateur
Remise en place: Placez le bac au dessus des
soutiens moulés rectangulaires de la porte. Puis
faites glisser le bac vers le bas dans les supports
pour le fixer en place.
Bac basculant de porte de congélateur
Clayette coulissante anti-déversement
Grâce à la clayette glissante anti-déversement,
vous pouvez atteindre des articles placés
derrière d’autres. Ses bords spéciaux sont
conçus pour empêcher tout déversement aux
clayettes inférieures.
Enlèvement:
Faites glisser la clayette vers l’extérieur jusqu’à
ce qu’elle atteigne son point d’arrêt, puis
appuyez le taquet vers le bas et faites glisser la
clayette directement vers l’extérieur.
Remise en place ou relocalisation:
Alignez la clayette avec les supports et
faites glisser en place. L’étagère peut être
repositionnée lorsque la porte est ouverte
à 90° ou plus. Pour ce faire, faites glisser
l’étagère au delà des butées et inclinez-la
vers le bas. Faites la glisser vers le bas dans la
position désirée, alignez-la avec les supports et
glissez-la en place.
Prenez soin de pousser la clayette jusqu’au
fond pour refermer la porte.
Appuyez sur le taquet et tirez la
clayette vers l’avant pour l’enlever
Paniers du congélateur (sur certains modèles)
Pour retirer, faites-la glisser jusqu’à la
position d’arrêt, soulevez l’avant au delà
de la position d’arrêt et faites sortir
en glissant.
Prenez soin de pousser les panniers jusqu’au
fond pour refermer la porte.
Paniers du congélateur (sur certains modèles)
Pour enlever, repousser le panier
complètement vers l’arrière du congélateur.
Soulevez-le jusqu’à ce que les broches arrière
soient dégagées. Soulevez le panier au complet
et retirez-le.
48
Prenez soin de pousser les panniers jusqu’au
fond pour refermer la porte.
Clayettes et bacs.
www.electromenagersge.ca
Toutes les caractéristiques ne sont pas disponibles sur tous les modèles.
Clayette QuickSpace™ (sur certains modèles)
Vous pouvez diviser en deux cette clayette et
faire coulisser sa partie avant sous sa partie
arrière pour ranger des articles de haute taille
sur la clayette du dessous.
Vous pouvez enlever cette clayette et la
remettre en place ou la placer comme une
clayette coulissante anti-déversement.
Dans certains modèles, vous ne pouvez pas
utiliser cette clayette dans la position la plus
basse.
Clayettes de congélateur à retrait par coulissement
Pour retirer, faites-la glisser jusqu’à la
position d’arrêt, soulevez l’avant au delà
de la position d’arrêt et faites-la glisser
en dehors du support.
Prenez soin de pousser les clayettes jusqu’au
fond pour refermer la porte.
Clayettes de congélateur fixes
Pour retirer, levez-la par le côté gauche
et ensuite retirez-la du réfrigérateur.
avantage du tiroir basculant, la taille des
articles déposés sur la clayette en dessous du
tiroir à glaçons ne doit pas excéder le point le
plus bas de ce tiroir.
REMARQUE CONCERNANT LES MODÈLES
AVEC DISTRIBUTEUR: Afin de tirer pleinement
Support à bouteilles de vin/
boissons (sur certains modèles)
Ce support peut contenir jusqu’à 5 canettes,
une bouteille de vin ou une bouteille de soda
de 2 litres.
Le support est accroché aux côtés du bac
à produits laitiers.
Pour enlever:
Videz le support.
En tenant la partie inférieure du bac à
produits laitiers, soulevez sa partie avant
en ligne droite, puis tirez vers le haut et
l’extérieur.
Pour dégager le support du bac à produits
laitiers, tirez sur les tiges latérales du
support pour les retirer des trous situés
sur les côtés u bac.
Pour replacer:
Accrochez le support aux côtés du bac.
Engagez la partie arrière du bac dans les
supports moulés de la porte. Poussez
ensuite la partie avant du bac vers le bas. Le
bac se verrouillera en place.
Casier ShelfSaver™
Râtelier de porte à boites
(sur certains modèles)
Utilisez ce casier pour
y ranger des canettes afin de
faciliter l’accès.
(sur certains modèles)
Ce râtelier de porte contient jusqu’à
9 boites.
REMARQUE: Vous ne pouvez
monter ce râtelier qu’en position du
haut, sous le bac à produits laitiers.
Le casier peut aussi servir pour
ranger un plat de cuisson au
four mesurant 9”x 13”.
Panier mobile à breuvage
(sur certains modèles)
Le panier à breuvage est conçu
pour contenir une bouteille de
côté.
Vous pouvez le fixer à n’importe
quelle clayette coulissante.
1
2
Installation:
Alignez la partie large des
fentes au sommer du panier
aux taquets qui se trouvent
sous la clayette.
Faites coulisser ensuite le
panier pour le fixer en position.
49
Les portes du réfrigérateur.
Portes du réfrigérateur (sur certains modèles)
Les portes de votre réfrigérateur ne sont
pas tout à fait comme celles dont vous
avez l’habitude. Un système spécial
d’ouverture/fermeture assure que les portes
ferment complètement et hermétiquement.
L’impression de résistance que vous
ressentez à la position d’arrêt diminue
lorsque des aliments sont rangés dans
la porte.
Lorsque vous ouvrez et fermez les portes,
vous remarquerez qu’elles sont munies
d’une position d’arrêt. Si vous ouvrez la porte
au delà de cette position d’arrêt, elle restera
ouverte afin de vous permettre de ranger
et de prendre vos aliments plus facilement.
Lorsque la porte est partiellement ouverte,
elle se ferme automatiquement.
Lorsque la porte est partiellement ouverte,
elle se ferme automatiquement.
Au delà de cette position d’arrêt la porte
restera ouverte.
Alignement des portes
Si les portes ne soient pas alignées, réglez la
porte du compartiment réfrigérateur.
À l’aide d’une clé à douille de
7/16 po, tournez la vis de réglage
de la porte vers la droite pour relever la
porte, ou vers la gauche pour l’abaisser.
(Une douille de nylon, encastrée dans les
filets de l’axe, empêchera celui-ci de
tourner si l’on ne se sert pas d’une clé.)
Clé à douille de 7/16 po
Pour enlever la grille
de la base, ouvrez les
portes, enlevez la vis
de chaque extrémité
de la grille, puis tirez
sur la grille.
50
Raise
Après avoir tourné la clé une ou deux
fois, ouvrez et fermez la porte du
compartiment réfrigérateur et vérifiez
l’alignement des portes à la partie
supérieure.
Les tiroirs de rangement.
www.electromenagersge.ca
Toutes les options ne sont pas disponibles sur tous les modèles.
Bacs à fruits et légumes
Essuyez l’eau qui peut s’accumuler dans le fond
des bacs.
bac.
Sur certains modèles, ,le bac inférieur est un
tiroir à extension complète pour permettre un
accès aux aliments sur toute la profondeur du
HI
LO
Bacs à légumes à humidité réglable
Faites coulisser la commande jusqu’à la
position HI (Élevée) pour obtenir une humidité
élevée recommandée pour la majorité des
légumes.
Faites coulisser la commande jusqu’à la
position LO (Faible) pour obtenir un taux
d’humidité faible recommandé pour la majorité
des fruits..
Bac à charcuterie convertible (sur certains modèles)
T
ES
LD
O
CO
LD
C
Le bac à charcuterie convertible est équipé de
son propre conduit d’air froid pour permettre
un flux d’air froid du compartiment de
réfrigération ou de congélation vers le bac à
charcuterie.
Le réglage de temperature variable permet de
réguler le flux d’air du Climate Keeper.
Réglez la température sur la température
la plus basse pour le stockage des viandes
fraiches.
Réglez la commande sur froid pour ramener
le bac à la température de réfrigération
normale et permettre un espace de stockage
supplémentaire pour les légumes. Le conduit
d’air froid est désactivé. Différents réglages
entre ces deux températures peuvent être
sélectionnés.
Retrait du bac à légumes.
Toutes les options ne sont pas disponibles sur tous les modèles.
Retrait du bac à légumes
Le bac à légumes peut être facilement retiré en
le tirant vers vous et en le soulevant par-dessus
la butée.
Si la porte vous empêche de retirer les tiroirs,
essayez d’abord de retirer les bacs de porte.
Si cela ne vous donne pas un dégagement
suffisant, il sera nécessaire de tirer le
réfrigérateur pour que la porte puisse être
suffisamment ouverte pour retirer les tiroirs.
Dans certains cas, lorsque vous sortez faites
rouler le réfrigérateur en le tirant vers vous, il
sera nécessaire de le déplacer vers la droite ou
vers la gauche.
51
Machine à glaçons automatique.
Il faut prévoir entre 12 et 24 heures avant qu’un réfrigérateur nouvellement installé commence à produire des glaçons.
Machine à glaçons automatique
7KHLFHPDNHUZLOOSURGXFHVHYHQFXEHVSHUF\FOH³
approximately 100–130 cubes in a 24-hour period, depending
on freezer compartment temperature, room temperature,
number of door openings and other use conditions.
If the refrigerator is operated before the water connection is
made to the icemaker, set the power switch in the OFF position.
When the refrigerator has been connected to the water supply,
set the power switch to the ON position.
The icemaker will fill with water when it cools to 15°F (–10°C).
A newly installed refrigerator may take 12 to 24 hours to begin
making ice cubes.
Remarque particulière au sujet des modèles avec distributeur :
„ Les modèles avec distributeur sont munis d’un tiroir à glace
basculant. Le tiroir peut basculer comme indiqué sur les
illustrations, et il se maintiendra en position élevée lorsque vous
prendrez de la glace ou mettrez l’interrupteur de la machine
à glaçons en position Marche ou Arrêt. Assurez-vous de
remettre le tiroir en place avant de fermer la porte.
„ Pour restaurer votre niveau de glaçons lorsque le seau est
vide, nous recommandons de suivre les étapes suivantes :
12 heures après la première chute de glaçons dans le tiroir,
distribuez 3 à 4 cubes.
You will hear a buzzing sound each time the icemaker fills with
water.
Après une autre période de 6 heures, distribuez 3 à 4 cubes
de nouveau.
Throw away the first few batches of ice to allow the water line
to clear.
Cette procédure restaurera votre niveau de glaçons dans la plus
brève période possible.
Be sure nothing interferes with the sweep of the feeler arm.
When the bin fills to the level of the feeler arm, the icemaker will
stop producing ice. It is normal for several cubes to be joined
together.
Machine à glaçons
Interrupteur
d’alimentation
Machine à glaçons
If ice is not used frequently, old ice cubes will become cloudy,
taste stale and shrink.
ATTENTION
Évitez le contact avec les pièces mobiles
Interrupteur
Green
GXPpFDQLVPHG·pMHFWLRQHWO·pOpPHQWFKDXȺDQWVLWXpGDQVOH d’alimentation Bras régulateur
Power Light
Bras régulateur
bas de la machine à glaçons) qui libère les cubes. Ne placez
(sur certains modèles)
(sur certains modèles)
ni les doigts ni les mains sur le mécanisme de production de
glace automatique lorsque le réfrigérateur est branché.
REMARQUE:
Dans les maisons où la pression de l’eau est plus faible que la
normale, vous entendrez la machine à glaçon se remettre en
marche à plusieurs reprises pour fabriquer un lot de glaçons.
52
www.electromenagersge.ca
Accès à la glace et à l’interrupteur sur les
modèles avec distributeur
Il existe deux types de tiroirs à glace sur les modèles avec
distributeur. Un type est doté d’une clayette au-dessus du tiroir,
l’autre type n’en a pas.
Remarque particulière au sujet des modèles avec distributeur
sans clayette au-dessus du tiroir à glace :
„ Ces modèles sont munis d’un tiroir à glace basculant. Le
tiroir peut basculer comme indiqué sur les illustrations, et il
se maintiendra en position élevée lorsque vous prendrez de
la glace ou mettrez l’interrupteur de la machine à glaçons en
position Marche ou Arrêt. Assurez-vous de remettre le tiroir
en place avant de fermer la porte.
REMARQUE: Pour restaurer votre niveau de glaçons lorsque
le seau est vide, nous recommandons de suivre les étapes
suivantes.
Modèles sans clayette au-dessus du tiroir à glace
Modèles avec clayette au-dessus du tiroir à glace
Clayette
Clayette
Tiroir à
glaçe
Tiroir à
glaçe
Pour avoir accès à la glace, tirez
sur le tiroir en avant.
Pour atteindre l’interrupteur, tirez
sur la clayette en ligne droite.
Assurez-vous de toujours remettre
la clayette en place.
Dans le cas des modèles avec distributeur, pour atteindre
la glace ou l’interrupteur :
Pour accéder à la glace ou l’interrupteur :
Soulevez le tiroir, puis tirez vers
l’avant jusqu’à son arrêt.
Abaissez le tiroir pour avoir accès
aux glaçons ou pour atteindre
le commutateur de marche.
Soulevez le tiroir, puis tirez
vers l’avant jusqu’à son arrêt.
Abaissez le tiroir pour avoir
accès aux glaçons ou pour
atteindre le commutateur de
marche.
Enlèvement du tiroir à glace (modèles avec
distributeur)
ATTENTION la glace pèse lourd quand le tiroir est plein.
Faites
tourner
Réglez le bouton de réglage en position OFF (arrêt) avant
d’enlever le tiroir.
Quand vous remettez le tiroir, assurez-vous de le presser
fermement en place. S’il ne va pas jusqu’au fond, enlevez-le
et faites tourner le mécanisme de mise en place d’1/4 de tour.
Repoussez alors le tiroir en place à nouveau.
Le mécanisme
de mise en
place
Modèles avec distributeur seulement
53
Le distributeur d’eau et de glaçons. (sur certains modèles)
Pour utiliser le distributeur
Bac de trop-plein
Sélectionnez CUBED ICE
(glaçons), CRUSHED
ICE
(glace concassée) ou WATER
(eau).
Appuyez doucement le verre contre le haut du
bras de distribution.
La clayette de trop-plein n’est pas munie d’un
système d’écoulement. Pour réduire les taches
d’eau, vous devez nettoyer régulièrement la
clayette et sa grille.
S’il n’y a pas d’eau distribuée lorsque le
réfrigérateur est initialement installé, il y a
peut-être de l’air dans la conduite d’eau.
Appuyez sur la commande de distribution
pendant deux minutes au minimum pour
expulser l’air de la conduite d’eau et remplir le
réservoir d’eau. Afin d’éliminer les éventuelles
impuretés provenant de la conduite d’eau,
jetez les six premiers verres d’eau.
ATTENTION: Ne mettez jamais les doigts
ou d’autres objets dans l’ouverture du
distributeur.
Verrouillage du
distributeur
Appuyez sur la touche
LOCK (verrouillage)
pendant 3 secondes pour
verrouiller le distributeur
et le panneau de réglage.
Pour déverrouiller,
appuyez sur la touche
et tenez-la enfoncée
pendant encore 3
secondes.
Lumière du
distributeur
Cette touche allume
et éteint la lumière du
distributeur. Vous allumez
également la lumière
en appuyant sur le bras
de distribution. Si cette
ampoule brûle, vous devez
la remplacer par une
ampoule d’au maximum 6
watts 12V.
Glace rapide (sur certains
modèles)
Si vous avez besoin de glace
rapidement, appuyez sur
cette touche pour accélérer
la production de glace. Cela
augmente la production de
glace pendant les 48 heures
suivantes ou jusqu’à ce que
vous appuyez à nouveau
sur cette touche.
Door Alarm (sur certains
modèles)
Pour mettre en marche le
signal sonore, appuyez sur
cette touche pour allumer
l’indicateur lumineux. Ce signal
sonne si l’une des portes reste
ouverte plus de
3 minutes. La lumière s’éteint
et le signal sonore s’arrête
quand vous fermez la porte.
Renseignements importants concernant votre distributeur
„ N’ajoutez pas dans le bac à glaçons des
glaçons non fabriqués par votre machine
à glaçons. Ils risquent d’être difficiles à
concasser ou à distribuer.
„ Évitez de trop remplir les verres de glaçons et
d’utiliser des verres étroits ou très hauts. Le
conduit peut se bloquer et le volet peut geler
et coincer. S’il y a des glaçons qui bloquent
le conduit, faites-les passer au moyen d’une
cuillère en bois.
„ Ne placez pas de boissons ou d’aliments
dans le bac à glaçons pour les rafraîchir. Les
boîtes, bouteilles et paquets alimentaires
peuvent coincer la machine à glaçons ou la
vis sans fin.
„ Afin que la glace distribuée ne puisse
manquer le verre, placer le verre à proximité
mais sans toucher l’ouverture du distributeur.
54
„ Même si vous avez sélectionné CUBED ICE
(glaçons), il est possible que de la glace
concassée tombe dans votre verre. Cela se
produit de temps à autre lorsque plusieurs
glaçons sont acheminés vers le broyeur.
„ Après distribution de la glace concassée, de
l’eau peut s’écouler du conduit.
„ Parfois, un peu de givre se forme sur le
volet du conduit à glace. Ce phénomène est
normal et se produit en général après des
distributions répétées de glace concassée. Le
givre va éventuellement évaporer.
Entretien et nettoyage du réfrigérateur.
www.electromenagersge.ca
Nettoyage de l’extérieur
Zone de ramasse-gouttes du
répartiteur.
La zone de trop-plein du distributeur, sous
la grille, doit être soigneusement essuyée.
L’eau laissée dans cette zone peut laisser des
marques. Eliminez ces dépôts en ajoutant
du vinaigre non dilué au conteneur. Laissez
tremper jusqu’à ce que les dépôts disparaissent
ou soient suffisamment lâches pour être
éliminés par rinçage.
Bras du distributeur Avant le nettoyage,
verrouillez le distributeur en appuyant sur la
touche LOCK (verrouillage) pendant 3 secondes.
Nettoyez à l’aide d’une solution d’eau tiède et
GHELFDUERQDWHGHVRXGH³HQYLURQXQHFXLOOqUH
à soupe (15 ml) de bicarbonate de soude dans
un litre d’eau. Rincez bien et essuyez.
Poignées et garniture de porte. Nettoyez-les à
l’aide d’un chiffon humecté d’eau savonneuse.
Séchez avec un chiffon doux.
Vous pouvez nettoyer les portes et les
poignées de porte en acier inoxydable
(sur certains modèles) avec un nettoyant
d’acier inoxydable vendu sur le marché.
Les nettoyants qui contiennent de l’acide
oxalique, tels que Bar Keepers Friend Soft
Cleanser™, éliminent la rouille, le ternissement
et les petites taches. Utilisez uniquement un
nettoyant liquide exempt d’abrasif et frottez
dans la direction des lignes de brossage à
l’aide d’une éponge souple imbibée.
N’utilisez pas de cire pour appareils ménagers
sur l’acier inoxydable.
Maintenez l’extérieur du réfrigérateur
propre. Essuyez-le avec un chiffon propre
légèrement humecté de cire pour appareils
électroménagers ou d’un détergent liquide
doux pour la vaisselle. Séchez et faites briller
avec un chiffon doux et propre.
N’essuyez pas le réfrigérateur avec un chiffon à
vaisselle ou un torchon humide sale. Ils pourraient
laisser un résidu qui endommagerait la peinture.
N’utilisez pas de tampons à récurer, de produits
nettoyants en poudre, de javellisant ou de produits
contenant du javellisant sous peine de rayer la
peinture et de la rendre moins résistante.
Nettoyage de l’intérieur
Pour éviter les mauvaises odeurs, laissez
une boîte ouverte de bicarbonate de soude
dans les compartiments réfrigérateur et
congélateur.
Débranchez le réfrigérateur avant de
le nettoyer. S’il est trop difficile de le faire,
essorez bien votre linge ou votre éponge pour
enlever l’excès d’eau lorsque vous nettoyez
autour des interrupteurs, des lampes ou des
commandes.
Utilisez une solution d’eau tiède et de
bicarbonate de soude– environ une cuillère à
soupe (15 ml) de bicarbonate de soude dans un
litre d’eau afin de nettoyer tout en neutralisant
les odeurs. Rincez et séchez.
ATTENTION
Ne nettoyez pas les
tablettes ou couvercles en verre avec de
l’eau chaude lorsqu’ils sont froids. Les
tablettes et couvercles en verre peuvent
se briser s’ils sont exposés à une variation
de température soudaine, ou soumis à un
impact s’ils sont heurtés ou échappés. S’il
se brise, le verre trempé est conçu pour
se fracturer en un grand nombre de petits
éclats.
Ne lavez aucune pièce en plastique du
réfrigérateur au lave-vaisselle.
Le plateau chill/thaw (refroidissement/
décongélation) peut aller au lave-vaisselle.
L’utilisation de solutions nettoyantes
autres que celles recommandées, plus
particulièrement celles contenant des
distillats de pétrole, peut fissurer ou
endommager l’intérieur du réfrigérateur.
55
Entretien et nettoyage du réfrigérateur. (cont.)
Derrière le réfrigérateur
Prenez un soin particulier lorsque vous éloignez
le réfrigérateur du mur. Tous les types de
revêtements de sol peuvent être endommagés,
particulièrement ceux qui sont coussinés ou
dont la surface est gaufrée.
Tirez le réfrigérateur en ligne droite et, lorsque
vous le remettez en place, poussez-le vers le
mur en ligne droite.
Les déplacements latéraux du réfrigérateur
pourraient endommager le revêtement de sol
ou le réfrigérateur.
Lorsque vous remettez le réfrigérateur en
place en le poussant, veillez à ne pas le faire
rouler sur le cordon d’alimentation ou sur la
conduite d’eau de la machine à glaçons.
Départ en vacances
Lorsque vous vous absentez pendant une
période prolongée, videz et débranchez le
réfrigérateur. Nettoyez l’intérieur avec une
solution d’eau et de bicarbonate de soude,
à raison d’une cuillère à soupe (15 ml) de
bicarbonate par pinte (1 litre) d’eau. Laissez les
portes ouvertes.
Mettez l’interrepteur d’alimentation de la
machine à glaçons à la position OFF (arrêt) et
fermez l’alimentation d’eau au réfrigérateur.
Si la température risque de descendre sous
le point de congélation, demandez à un
réparateur de vidanger la conduite d’eau
afin d’éviter les dégâts sérieux causés par les
inondations.
Déménagement
Immobilisez tous les éléments amovibles, tels
que les clayettes et les bacs, à l’aide
de ruban gommé pour éviter de les
endommager.
Si vous utilisez un charriot pour déménager
le réfrigérateur, ne laissez jamais le devant
ou le derrière du réfrigérateur reposer contre
Remplacement des ampoules.
le charriot. Cela pourrait endommager le
réfrigérateur. Ne transportez le réfrigérateur
que par les côtés.
Assurez-vous que le réfrigérateur demeure
debout pendant son déménagement.
(sur certains modèles)
AVERTISSEMENT
Avant de remplacer une ampoule grillée, le réfrigérateur doit être débranché afin d’éviter le contact avec un
filament sous tension. (Une ampoule grillée peut se briser lors de son remplacement.)
Le courant du circuit de la lampe n’est pas interrompu même en tournant le bouton de la commande de température vers la
position OFF (arrêt).
Votre pare-lumière rassemblera
une des suivantes :
&RPSDUWLPHQWUpIULJpUDWHXU³ODPSHVXSpULHXUH
Débranchez le réfrigérateur.
Taquets
OU
Poche
56
Les ampoules se trouvent en haut du
compartiment, à l’intérieur du pare-lumière.
Sur certains modèles, vous devez enlever
une vis qui se trouve à l’avant de l’écran.
Sur autres modèles, enlever la vis dans la
poche qui se trouve à l’arrière du parelumière.
Pour enlever le pare-lumière, sur certains
modèles, appuyez sur les taquets se
trouvant sur les côtés du pare-lumière et
enlevez en faisant glisser vers l’avant. Sur
d’autres modèles, faites simplement glisser
le pare-lumière vers l’avant et faites sortir.
Après avoir remplacé l’ampoule avec une
ampoule neuve pour appareil électrique de
capacité égale ou inférieure, remettez en
place la vis et le logement d’ampoule. Pour
remettre le pare-lumière, assurez-vous que
les taquets qui se trouvent à l’arrière du
pare-lumière aillent dans les trous qui
se trouvent à l’arrière du boîtier.
Rebranchez le réfrigérateur.
Remplacement des ampoules.
www.electromenagersge.ca
&RPSDUWLPHQWUpIULJpUDWHXU³ODPSHLQIpULHXH
Cette lumière se trouve au dessus du tiroir
d’en haut.
Débranchez le réfrigérateur.
Soulevez le pare-lumière et enlevez-le en
tirant.
Après avoir remplacé l’ampoule par une
ampoule d’appareil électro-ménager de
même puissance ou de puissance
inférieure, remettez le pare-lumière.
Rebranchez le réfrigérateur.
Compartiment congélateur
Débranchez le réfrigérateur.
Enlevez la clayette qui se trouve juste au
dessus du pare-lumière (vous pouvez
enlever cette clayette plus facilement après
l’avoir vidée). Retirez la vis se trouvant à la
partie supérieure du logement d’ampoule.
Pour enlever le pare-lumière, appuyez sur
les côtés et enlevez en soulevant.
Remplacez l’ampoule par une ampoule
d’appareil électro-ménager de même
puissance ou de puissance inférieure,
puis remontez le pare-lumière. Pour
remonter le pare-lumière, assurez-vous
que les taquets du haut soient
solidement fixés en place. Remettez la vis
(sur certains modèles).
Remontez la clayette et rebranchez
le réfrigérateur.
Distributeur (sur certains modèles)
Débranchez le réfrigérateur.
L’ampoule se trouve sur le distributeur sous
le panneau de réglage.
Enlevez l’ampoule en la faisant tourner
dans le sens opposé à celui des aiguilles
d’une montre.
Remplacez l’ampoule par une ampoule de
même taille et de même puissance.
Rebranchez le réfrigérateur.
Remplacement des ampoules.
Lorsque vous réglez les commandes sur OFF (Arrêt), l’alimentation électrique de l’ampoule n’est pas coupée.
Toutes les caractéristiques ne sont pas disponibles sur tous les modèles.
Compartiment réfrigérateur (modèles ACL seulement)
Affichage
DEL
Un affichage DEL apparaît dans le haut du compartiment réfrigérateur sur les modèles ACL. Si cet
ensemble doit être remplacé, communiquez avec le Service GE au 1.800.432.2737 aux États-Unis
ou 1.800.561.3344 au Canada.
57
Instructions
d’installation
Réfrigérateur
Modèles 22, 23, 25, 26, 27 & 29
Des Questions ? Appelez 800.GE.CARES (800.432.2737) ou consultez notre site internet : GEAppliances.com
Au Canada, appelez le 1.800.561.3344 ou consultez notre site internet : www.geappliances.ca
PREPARATION
ALIMENTATION D’EAU DE
LA MACHINE À GLAÇONS
AVANT DE COMMENCER
Lisez ces instructions entièrement et attentivement.
•
IMPORTANT ³Conservez ces instructions
Si le réfrigérateur est équipé d’une machine à glaçons,
il devra être branché à une alimentation d’eau. Vous
pouvez vous procurer une trousse GE de branchement
à l’alimentation d’eau (contenant tuyau, robinet,
raccords et instructions) auprès de votre fournisseur,
en consultant notre site internet GEAppliances.com (au
Canada par le site geappliances.ca), ou au Centre de
Pièces Détachées et d’Accessoires, au 800.626.2002
(au Canada, 1.800.661.1616).
pour l’inspecteur électrique local.
•
IMPORTANT ³Respectez tous les codes et
règlements en vigueur.
• Remarque pour l’installateur – Assurez–vous de
remettre ces instructions à l’utilisateur.
• Remarque pour l’utilisateur – Conservez ces
instructions pour toute référence future.
• Niveau de compétence – L’installation de
cet appareil nécessite des des connaissances de base
en mécanique.
• Délai d’exécution – Installation du réfrigérateur,
30 minutes.
Installation de la conduite d’eau
30 minutes
• L’installateur est responsable de l’installation correcte
de l’appareil.
• La panne de l’appareil due à une mauvaise
installation n’est pas couverte par la garantie.
Si le réfrigérateur a déjà été installé, enlevez
la grille de base (voir l’étape 2 de la section
Déménagement du réfrigérateur), puis sautez
à l’étape 5 de la section Installation du réfrigérateur.
OUTILLAGE NÉCESSAIRE
Cliquet de 3/8 po et de
5/16 po
Clés plates d’1/2 po et
de 7/16 po
Couteau à mastiquer en
plastique
Tournevis cruciforme (Phillips)
58
Instructions d’installation
DÉMÉNAGEMENT DU RÉFRIGÉRATEUR
1 CHARGEMENT DU RÉFRIGÉRATEUR
Si le réfrigérateur doit passer par
une ouverture de moins de 38 po
de largeur, ses portes doivent être
enlevées. Passez à l’étape 3.
N’ENLEVEZ PAS les poignées.
Si toutes les ouvertures ont plus de
38 po de largeur, sautez à la section
Installation du réfrigérateur.
SUR UN CHARIOT MANUEL
Laissez le ruban et les protecteurs sur
les portes jusqu’à ce que le réfrigérateur arrive
à destination.
Pour transporter le réfrigérateur, utilisez
un chariot manuel rembourré. Centrez le
réfrigérateur sur le chariot et entourez-le
d’une courroie. NE SERREZ PAS LA COURROIE
EXCESSIVEMENT.
3 DÉBRANCHEZ LE RACCORD
D’ALIMENTATION D’EAU
(sur certains modèles)
Si le compartiment réfrigération est doté d’un
rafraîchisseur d’eau, alors il faut débrancher
la conduite d’eau qui part de la carosserie et
s’insère dans la charnière inférieure de la porte
du compartiment congélation.
Pour débrancher, poussez sur le collet blanc du
raccord puis tirez sur le tube.
Collet blanc
2 ENLEVEZ LA GRILLE DE BASE
Enlevez la grille en retirant les deux vis à tête
cruciforme.
Charnière
inférieure du
compartiment
congélation
59
Instructions d’installation
DÉMÉNAGEMENT DU RÉFRIGÉRATEUR (SUITE)
4 DÉBRANCHEZ LE RACCORD
D’ALIMENTATION ÉLECTRIQUE (sur
certains modèles)
6 FERMEZ LES PORTES DES
COMPARTIMENTS CONGÉLATION ET
RÉFRIGÉRATION
Si le compartiment réfrigération est doté d’un
rafraîchisseur d’eau, alors il faut débrancher
la conduite électrique (faisceau) qui part de
la carosserie et s’insère dans la charnière
inférieure de la porte du compartiment
congélation.
Pour débrancher, tirez de chaque côté
du raccord.
7 ENLEVEZ LA PORTE DU
Charnière
inférieure du
compartiment
congélation
COMPARTIMENT CONGÉLATION
5 DÉBRANCHEZ LES CONNECTEURS
A Enlevez le couvercle de la charnière supérieure
de la porte du compartiment congélation, soit
en le pressant et le tirant vers le haut, soit en le
dégageant à l’aide d’un couteau à mastiquer
en plastique.
ÉLECTRIQUES (sur certains modèles)
Si le compartiment réfrigération est
doté d’un centre de rafraîchissement, alors il
faut débrancher les connecteurs électriques
(faisceaux) qui partent de la carosserie et
s’insèrent dans la charnière inférieure du
compartiment réfrigération.
Pour débrancher, tirez de chaque côté
des connecteurs.
B Enlevez les deux vis à tête hexagonale
5/16 po, puis soulevez la charnière en ligne
droite pour dégager l’axe de charnière.
Tête hexagonale 5/16 po
C Ouvrez la porte du compartiment congélation
à 90.°
Charnière
inférieure du
compartiment
réfrigération
90°
60
Instructions d’installation
7 ENLEVEZ LA PORTE DU
8 ENLEVEZ LA PORTE DU
D Pendant qu’une personne soulève lentement
la porte du compartiment congélation pour la
dégager de la charnière inférieure, une deuxième
personne doit minutieusement guider la conduite
d’eau et la conduite électrique (faisceau) à travers
la charnière inférieure.
B Enlevez les deux vis à tête hexagonale 5/16 po,
puis soulevez la charnière en ligne droite pour
dégager l’axe de charnière.
COMPARTIMENT CONGÉLATION
(suite)
COMPARTIMENT RÉFRIGÉRATION
(suite)
Tête hexagonale 5/16 po
C Ouvrez la porte du compartiment réfrigération
à 90.°
90°
E Placez la porte sur une surface lisse pour la
protéger des égratignures, l’intérieur vers le
haut.
90°
8 ENLEVEZ LA PORTE DU
COMPARTIMENT RÉFRIGÉRATION
A Enlevez le couvercle de la charnière supérieure
de la porte du compartiment réfrigération, soit
en le pressant et le tirant vers le haut, soit en le
dégageant à l’aide d’un couteau à mastiquer
en plastique.
61
Instructions d’installation
DÉMÉNAGEMENT DU RÉFRIGÉRATEUR (SUITE)
8 ENLEVEZ LA PORTE DU
9 REMISE EN PLACE DES PORTES
COMPARTIMENT RÉFRIGÉRATION
(suite)
Pour replacer les portes, inversez simplement
les étapes 3 à 8.
D Soulevez la porte du compartiment
réfrigération pour la dégager de la charnière
inférieure.
Si le compartiment réfrigération est doté d’un
centre de rafraîchissement, une personne doit
soulever lentement la porte pour la dégager
de la charnière inférieure, pendant qu’une
deuxième personne guide minutieusement les
conduites électriques (faisceaux) à travers la
charnière inférieure.
Veuillez cependant noter les points suivants :
• Au moment d’abaisser les portes sur
les charnières inférieures, une deuxième
personne doit guider minutieusement
le tube et les faisceaux électriques à travers
les ouvertures des charnières.
• Lorsque vous branchez la conduite d’eau,
assurez-vous d’insérer le tube jusqu’à la
marque.
90°
Marque
• Ne pincez pas le tube et les faisceaux
électriques lorsque vous placez les portes sur
les charnières inférieures.
• Lorsque vous branchez la ou les conduites
électriques (plusieurs conduites seulement
sur les modèles dotés d’un centre de
rafraîchissement), assurez-vous que les
connecteurs sont complètement imbriqués.
Modèles dotés d’un centre de refraîchissement seulement
E
Placez la porte sur une surface lisse pour la
protéger des égratignures, l’intérieur vers le
haut.
62
Instructions d’installation
INSTALLATION DU RÉFRIGÉRATEUR
EMPLACEMENT DU RÉFRIGÉRATEUR
DIMENSIONS ET SPÉCIFICATIONS
• N’installez jamais votre réfrigérateur dans
un emplacement où la température ambiante
sera inférieure à 16° C (60° F). Il ne se mettra pas
en marche suffisamment souvent pour maintenir
des températures convenables.
• N’installez jamais votre réfrigérateur dans
un emplacement où la température ambiante
sera supérieure à 37° C (100° F). Il ne
fonctionnera pas bien.
• N’installez pas le réfrigérateur dans un endroit
exposé à l’eau (pluie, etc.) ou directement aux
rayons solaires.
• Installez votre réfrigérateur sur un plancher
suffisamment solide pour le porter lorsqu’il est
plein.
(pour les modèles « CustomStyle™ » de 23’)
701ø4” (178.4 cm)
36”
(91.4 cm)
24” (61 cm)
DÉGAGEMENTS
Prévoyez les dégagements suivants pour
faciliter l’installation, la bonne circulation d’air
et les raccordements de plomberie et d’électricité :
Côtés
Dessus
Arrière
CustomStyle™
de 23’/25’
23’ (33 po de largeur),
25’, 26’, 27’ et 29’
4 mm (1/8 po)
25 mm (1 po)
13 mm (1/2 po)
4 mm (1/8 po)
25 mm (1 po)
25 mm (1 po)
DIMENSIONS ET SPÉCIFICATIONS
(pour les modèles « CustomStyle™ » de 25’)
DIMENSIONS ET SPÉCIFICATIONS
Eau
Électricité
721ø4” (183.5 cm)*
Armoire
de 61 cm
(24 po)
Dégagement de 19 mm
(3/4 po) (jeu de 13 mm
[1/2 po] + plaques murales
de 6 mm [1/4 po])
36”
(91.4 cm)
Dessus du
comptoir
de 63,5 cm
(25 po)
24” (61 cm)
*183,5 cm (72-1/4 po) sont nécessaires pour
bien régler les roues de mobilité. Si les armoires
placées sur le réfrigérateur ont des portes
qui sont alignées au sommet de l’ouverture du
réfrigérateur, vous pouvez avoir besoin de 1/8 po
d’espace libre supplémentaire pour permettre
une bonne ouverture des portes de l’armoire.
63
Instructions d’installation
INSTALLATION DU RÉFRIGÉRATEUR (SUITE)
1 BRANCHEMENT DU RÉFRIGÉRATEUR
C Fixez le tuyau dans le collet (fourni) pour le
maintenir en position. Il est possible que vous
deviez écarter le collet.
À LA CONDUITE D’EAU DE LA MAISON
(modèles avec machine à glaçons
et distributeur)
Collet à tuyau
Une alimentation d’eau froide est requise pour
faire fonctionner la machine à glaçons et le
distributeur. Vous devrez en fournir une si elle
n’existe pas. Voir la section Installation de la
conduite d’eau.
Tuyau 1/4 po
Écrou à compression
1/4 po
Bague
(manchon)
NOTES:
• Avant de brancher la conduite au
réfrigérateur, assurez-vous que le cordon
d’alimentation électrique n’est pas branché à
la prise murale.
• Si votre réfrigérateur n’est pas équipé de filtre
à eau, nous recommandons d’en monter un si
votre alimentation d’eau contient du sable ou
des particules qui peuvent boucher la grille
du robinet d’eau du réfrigérateur. Installez-le
sur la conduite d’eau près
du réfrigérateur. Si vous utilisez une trousse
GE SmartConnect™ Refrigerator Tubing,
vous aurez besoin d’un tuyau additionnel
(WX08X10002) pour brancher le filtre. Ne
coupez pas le tuyau de plastique pour
installer le filtre.
A Si vous utilisez un tuyau de cuivre, placez
un écrou de compression et une bague
(manchon) à l’extrémité du tuyau qui vient de
l’alimentation d’eau froide de la maison.
Si vous utilisez un tuyau GE SmartConnect,™ les
écrous sont déjà assemblés au tuyau.
Si vous utilisez un tuyau de cuivre, insérez aussi
loin que possible l’extrémité du tuyau dans le
raccord à l’arrière du réfrigérateur. Tout en
tenant le tuyau, serrez le raccord.
B Si vous utilisez un tuyau GE SmartConnect™,
insérez l’extrémité moulée du tuyau dans le
raccord à l’arrière du réfrigérateur, puis serrez
l’écrou à compression à la main. Serrez ensuite
un autre tour à l’aide d’une clé. Un serrage
excessif pourrait occasionner des fuites.
Raccord du
réfrigérateur
Tuyau SmartConnect™
Opción 2
2 OUVREZ L’ALIMENTATION D’EAU
Ouvrez l’alimentation d’eau au niveau du
robinet d’arrêt (l’alimentation d’eau de la
maison) et vérifiez la
présence de fuites.
3 BRANCHEZ LE CORDON
DU RÉFRIGÉRATEUR DANS LA PRISE
Avant de brancher le
réfrigérateur, assurez-vous
que l’interrupteur de la
machine à glaçons est à la
position OFF (arrêt).
Lisez l’étiquette concernant
la mise à la terre qui
est attachée au cordon
d’alimentation.
64
Instructions d’installation
5 METTEZ LE RÉFRIGÉRATEUR
4 PLACEZ LE RÉFRIGÉRATEUR
DE NIVEAU
(suite)
DANS SON EMPLACEMENT
Transportez le réfrigérateur jusqu’à
sa destination.
Pour ajuster
les roulettes
sur les modèles
CustomStyle™
Vis de réglage
de 23’ / 25’ :
Tournez les vis de réglage des roulettes dans
le sens des aiguilles d’une montre pour faire
monter le réfrigérateur, dans le sens opposé à
celui des aiguilles d’une montre pour le faire
descendre. Utilisez une clé hexagonale de 3/8
po avec extension ou une clé anglaise.
Ces modèles ont aussi des roulettes arrières
réglables, pour vous permettre d’aligner
le réfrigérateur aux armoires de cuisine. Utilisez
une clé hexagonale de 3/8 po. avec extension
pour tourner les vis pour les roulettes arrières,
dans le sens des aiguilles d’une montre pour
faire monter le réfrigérateur, dans le sens opposé
à celui des aiguilles d’une montre pour le faire
descendre.
5 METTEZ LE RÉFRIGÉRATEUR
DE NIVEAU
The refrigerator can be leveled by adjusting the
rollers located near the bottom hinges.
Relevez
Roulettes
Les roulettes de nivellement jouent trois rôles :
• Elles peuvent être réglées pour que les portes
se referment automatiquement lorsqu’elles
sont à moitié ouvertes. (Réglez le bord
inférieur avant du réfrigérateur à 16 mm
[5/8 po] du sol.)
• Elles peuvent être réglées de manière à permettre
à l’appareil de reposer solidement sur le sol
et l’empêcher ainsi de branler.
• Elles vous permettent d’éloigner
le réfrigérateur du mur pour le nettoyage.
6 ALIGNEZ LES PORTES
Réglez les portes du réfrigérateur pour qu’elles
soient bien alignées à la partie supérieure.
Pour aligner les portes :
A À l’aide d’une clé de 7/16 po, tournez la vis de
réglage de la porte vers la droite pour relever
la porte, ou vers la gauche pour l’abaisser.
Pour ajuster les roulettes sur les modèles
de les roulettes sur les modèles 23’
(33 po de largeur) 25’, 26’, 27’ et 29’ :
• Tournez les vis
de réglage des roulettes dans
le sens des
aiguilles
d’une montre
pour faire monter
le réfrigérateur,
dans le sens
opposé à celui des
aiguilles d’une
montre pour le
faire descendre.
Utilisez une douille
Vis de réglage
hexagonale ou une
clé de 3/8 po, ou une clé anglaise.
REMARQUE :
Une douille de nylon, encastrée dans les filets
de l’axe, empêchera celui-ci de tourner si l’on
ne se sert pas d’une clé.
B Après avoir
Portes doivent être alignées
tourné la clé
à la partie
supérieure
une ou deux
fois, ouvrez et
fermez la porte
du réfrigérateur
et vérifiez
l’alignement des
Relevez
portes à la partie
supérieure.
Clé 7/16 po
65
Instructions d’installation
INSTALLATION DU RÉFRIGÉRATEUR (SUITE)
7 REPLACEZ LA GRILLE DE BASE
9 METTEZ EN MARCHE
LA MACHINE À GLAÇONS
Replacez la grille de base en installant
les deux vis à tête cruciforme (Phillips).
Mettez le commutateur de la machine à
glaçons en position ON (marche). La machine
à glaçons ne se met en marche que lorsqu’elle
atteint une température de fonctionnement
de –9° C (15° F) ou moins. Elle commence
immédiatement à fonctionner. Il faudra 2 à 3
jours pour remplir le bac à glaçons.
Commutateur
d’alimentation
électrique
Commutateur
d’alimentation
électrique
8 RÉGLEZ LES COMMANDES
Réglez les commandes selon les
recommandations.
REMARQUE:
Si votre pression d’eau est trop faible, le robinet
peut se remettre en marche jusqu’à trois fois
pour envoyer suffisamment d’eau à la machine
à glaçons.
66
Instructions d’installation
INSTALLATION DE LA CONDUITE D’EAU (SUR CERTAINS MODÈLES)
AVANT DE COMMENCER
CE DONT VOUS AUREZ BESOIN
Nous recommandons les trousses d’alimentation d’eau en cuivre
WX8X2, WX8X3, WX8X4, selon le montant de conduite dont vous
avez besoin. Nous approuvons les conduites d’eau en matière
plastique GE SmartConnect™ Refrigerator Tubing (WX08X10006,
WX08X10015 et WX08X10025).
• Tuyaux en cuivre ou trousse GE SmartConnect™
Refrigerator Tubing, diamètre extérieur de 1/4 po pour
brancher le réfrigérateur à l’alimentation d’eau. Si vous
utilisez un tuyau en cuivre, assurez-vous que les deux
extrémités du tuyau soient coupées bien droit.
Si vous branchez votre réfrigérateur à un système d’eau GE
Reverse Osmosis, la seule installation approuvée est celle de la
trousse GE RVKit. Pour les autres systèmes d’osmose de l’eau,
suivez les recommandations du fabricant.
Pour trouver la longueur de tuyau dont vous aurez besoin:
mesurez la distance qui va du robinet d’eau situé derrière
le réfrigérateur jusqu’au tuyau d’alimentation d’eau.
Assurez-vous qu’il y ait assez de tuyau en trop pour vous
permettre de décoller
le réfrigérateur du mur après l’installation.
Les trousses GE SmartConnect™ Refrigerator Tubing sont
disponibles dans les dimensions suivantes:
Si le réfrigérateur est alimenté en eau à partir d’un système
de filtration d’eau par osmose inversée, ET si le réfrigérateur
comporte également un filtre à eau, utilisez le bouchon du circuit
de dérivation du filtre du réfrigérateur. Si la cartouche de filtration
d’eau du réfrigérateur est utilisée en conjonction avec le système
de filtration par osmose inversée, on peut observer une réduction
du débit d’eau au point de puisage, et la production de cubes de
glace creux.
Cette installation de conduite d’eau n’est pas garantie par le
fabricant de réfrigérateur ou de machine à glaçons. Suivez
soigneusement ces instructions pour minimiser le risque de
dommages onéreux d’inondation.
2,4 m (8 pi) – WX08X10006
4,6 m (15 pi) – WX08X10015
7,6 m (25 pi) – WX08X10025
Les coups de bélier (eau qui donne des coups dans les tuyaux)
dans la tuyauterie de la maison peuvent occasionner des
dommages aux pièces de votre réfrigérateur, ainsi que des fuites
ou des inondations. Appelez un plombier certifié pour corriger
les coups de bélier avant d’installer la conduite d’eau de votre
réfrigérateur.
Pour prévenir toute brûlure et tout dommage à votre
réfrigérateur, ne branchez jamais la conduite d’eau à une
canalisation d’eau chaude.
Si vous utilisez votre réfrigérateur avant de
brancher la conduite d’eau, assurez-vous de laisser
le commutateur de la machine à glaçons en position OFF (arrêt).
N’installez jamais les tuyaux de la machine à glaçons dans des
endroits où la température risque de descendre en dessous du
point de congélation.
Si vous utilisez un outil électrique (comme une perceuse
électrique) pendant l’installation, assurez-vous que l’isolement
ou le câblage de cet outil empêche tout danger de secousse
électrique.
Vous devez procéder à toutes vos installations conformément
aux exigences de votre code local de plomberie.
67
Instructions d’installation
INSTALLATION DE LA CONDUITE D’EAU (SUITE)
CE DONT VOUS AUREZ BESOIN (SUITE)
REMARQUE : Les seuls tuyaux en matière plastique
approuvés par GE sont ceux qui font fournis dans les
trousses GE SmartConnect™ Refrigerator Tubing. N’utilisez
jamais un autre tuyau en matière plastique, car le tuyau
d’alimentation d’eau est tout le temps sous pression.
Certaines catégories de tuyaux en matière plastique
peuvent devenir cassants avec l’âge et peuvent se fendre,
en occasionnant des dommages d’inondation dans votre
maison.
• Vous pouvez acheter une trousse d’alimentation d’eau GE
(contenant un tuyau en cuivre, un robinet d’arrêt et les
joints énumérés ci-dessous) chez votre distributeur local
ou en le commandant au service de pièces et
accessoires, au 1.800.661.1616.
• Une alimentation d’eau froide potable. La pression de
l’eau doit être entre 20 et 120 p.s.i. (1,4 et 8,1 bar).
Installez le robinet d’arrêt sur la canalisation d’eau
potable la plus fréquemment utilisée.
1 FERMEZ L’ALIMENTATION PRINCIPALE
D’EAU
Ouvrez le robinet le plus proche suffisamment
longtemps pour purger le tuyau.
2 CHOISISSEZ L’EMPLACEMENT
DU ROBINET
Choisissez pour le robinet un emplacement
facilement accessible. Il vaut mieux le brancher
de côté à un tuyau vertical. Si vous devez
le brancher à un tuyau horizontal, faites le
branchement en haut ou de côté, plutôt qu’en
bas du tuyau, pour éviter de recevoir des
sédiments du tuyau d’alimentation d’eau.
• Une perceuse électrique.
• Une clé de 1/2 po ou une clé
• Un tournevis à lame plate et
un tournevis Phillips.
anglaise.
• Deux écrous à compression
d’un diamètre extérieur de 1/4 po et deux bagues
(manchons)³SRXUEUDQFKHUOHWX\DXHQFXLYUHDXURELQHW
d’arrêt et au robinet d’eau du réfrigérateur.
OU
• Si vous utilisez une trousse GE
SmartConnect™ Refrigerator Tubing, les
garnitures nécessaires sont déjà montées
au tuyau.
• Si votre conduite d’eau en cuivre actuelle a un raccord
évasé à une extrémité, vous aurez besoin d’un
adaptateur (que vous trouverez dans votre magasin
de matériel de plomberie) pour brancher le tuyau d’eau
au réfrigérateur, OU vous pouvez couper le raccord
évasé à l’aide d’un coupe-tube, puis utiliser un raccord
à compression. Ne coupez jamais l’extrémité finie d’un
tuyau de la trousse GE SmartConnect™ Refrigerator
Tubing.
3 PERCEZ UN TROU POUR LE ROBINET
Percez un trou de 1/4 po dans le tuyau d’eau
(même si vous utilisez un robinet autotaraudeux),
à l’aide d’un foret dur. Enlevez toute barbure due
au perçage du trou dans le tuyau.
Faites attention de ne pas laisser de l’eau couler
dans votre perceuse électrique.
Si vous ne percez pas un trou de 1/4 po, vous
obtiendrez une production de glaçons réduite ou
des glaçons plus petits.
• Un robinet d’arrêt pour brancher le tuyau d’eau froide.
Le robinet d’arrêt doit avoir une entrée
d’eau avec un diamètre intérieur
minimal de 5/32 po au point de
jonction avec le TUYAU D’EAU FROIDE.
Des robinets d’arrêt à étrier sont souvent inclus dans les
trousses d’alimentation d’eau. Avant d’acheter, assurezvous que le robinet à étrier se conforme à vos codes de
plomberie locaux.
68
Installation Instructions
4 FIXEZ LE ROBINET D’ARRÊT
7 BRANCHEZ LE TUYAU AU ROBINET
Fixez le robinet d’arrêt à la conduite d’eau froide
à l’aide du collier de serrage.
Placez un écrou de compression et une bague
(manchon) à l’extrémité du tuyau et branchez-les
au robinet d’arrêt.
Collier de serrage
Assurez-vous que le tuyau soit bien inséré dans
le robinet. Serrez fort l’écrou de compression.
Pour le tuyau en matière plastique d’une trousse
GE SmartConnect™ Refrigerator Tubing, insérez
l’extrémité moulée du tuyau dans le robinet
d’arrêt et serrez l’écrou de compression à la
main, puis serrez un autre demi tour avec
une clé. Si vous serrez trop fort, vous pouvez
occasionner des fuites.
Conduite verticale
d’eau froide
Robinet d’arrêt
à étrier
REMARQUE : Vous devez vous conformer aux
Codes de plomberie 248CMR du Commonwealth
of Massachusetts. Les robinets d’arrêt à étrier sont
illégaux et leur utilisation n’est pas autorisée au
Massachusetts. Consultez votre plombier local.
Tuyau SmartConnect™
Presse-joint
5 SERREZ LE COLLIER DE SERRAGE
Serrez les vis du collier jusqu’à ce que la rondelle
d’étanchéité commence à enfler.
Robinet de sortie
Bague (manchon)
REMARQUE: Vous devez vous conformer aux
Codes de plomberie 248CMR du Commonwealth
of Massachusetts. Les robinets d’arrêt à étrier sont
illégaux et leur utilisation n’est pas autorisée au
Massachusetts. Consultez votre plombier local.
REMARQUE : Ne serrez pas trop. Vous risquez
d’écraser la conduite.
Rondelle
Collier de serrage
Écrou de compression
Robinet d’arrêt
à étrier
Entrée
Vis du
collier
8 PURGEZ LE TUYAU
Ouvrez le robinet d’alimentation principale d’eau
et purgez le tuyau jusqu’à ce que l’eau soit claire.
Fermez l’eau au niveau du robinet d’eau après
écoulement d’environ 1 litre (1 quart) d’eau par le
tuyau.
6 ACHEMINEZ LE TUYAU
Acheminez le tuyau entre la conduite d’eau
froide et le réfrigérateur.
Faites passer le tuyau par un trou percé dans le
mur ou le plancher (derrière le réfrigérateur ou au
niveau de l’armoire de cuisine adjacente), aussi près
du mur que possible.
REMARQUE: Assurez-vous d’avoir une longueur
de tuyau suffisante pour pouvoir éloigner le
réfrigérateur du mur après son installation.
Pour compléter l’installation du réfrigérateur, retournez
à l’étape 1 de la section Installation du réfrigérateur.
69
Bruits normaux de fonctionnement.
Les réfrigérateurs plus récents font des bruits différents de ceux des anciens. Les réfrigérateurs modernes
présentent plus de fonctions et sont plus avancés sur le plan technologique.
Entendez-vous ce que j’entends ? Ces bruits sont normaux.
HUMMM...
WHOOSH...
„ Le nouveau compresseur à rendement élevé peut
fonctionner plus longtemps et plus vite que votre
ancien réfrigérateur et vous pouvez entendre un
son modulé ou un ronflement aigu pendant son
fonctionnement.
„ Parfois le réfrigérateur fonctionne pendant une période
prolongée, surtout lorsque les portes sont ouvertes
fréquemment. Cela signifie que la fonction Frost Guard ™
est active pour empêcher la brûlure de congélation et
améliorer la conservation des aliments.
„ Vous pouvez entendre un sifflement lorsque les portes
se ferment. Cela vient de l’équilibrage de pression dans le
réfrigérateur.
CLICS, CLAQUEMENTS,
CRAQUEMENTS et
GRÉSILLEMENTS
OUIR !
„ Vous pouvez entendre les ventilateurs tourner
à hautes vitesses. Cela se produit lorsque le
réfrigérateur vient d’être branché, lorsque les portes
sont ouvertes fréquemment ou lors de l’ajout d’une
grande quantité d’aliments dans les compartiments
congélateur ou réfrigérateur. Les ventilateurs
permettent de maintenir les bonnes températures.
„ Si une des portes est ouverte pendant plus de
3 minutes, vous pouvez entendre l’activation des
ventilateurs permettant de refroidir les ampoules.
„ Les ventilateurs changent de vitesses pour assurer des
économies d’énergie et un refroidissement optimaux.
BRUITS D’EAU
„ Vous pouvez entendre des craquements ou des
„ Le passage de l’agent frigorifique dans les serpentins
„ Les registres électroniques s’ouvrent et se ferment pour
„ L’eau tombant sur l’élément chauffant de dégivrage
„ Le compresseur peut causer un clic ou un grésillement
„ Un bruit de suintement d’eau peut être entendu
claquements lorsque le réfrigérateur est branché pour
la première fois. Cela se produit lorsque le réfrigérateur
se refroidit à la bonne température.
assurer des économies d’énergie et un refroidissement
optimaux.
lors de la tentative de redémarrage
(cela peut prendre 5 minutes).
„ Le tableau de commande électronique peut causer un
clic lorsque les relais s’activent pour commander les
composants du réfrigérateur.
de refroidissement du congélateur peut être
accompagné d’un gargouillement semblable à celui de
l’eau en ébullition.
peut faire un bruit de grésillement, de claquement ou
de bourdonnement pendant le cycle de dégivrage.
pendant le cycle de dégivrage lorsque la glace
de l’évaporateur fond et tombe dans le bac de
récupération.
„ Fermer la porte peut causer un gargouillement
en raison de l’équilibrage de pression.
„ L’expansion et la contraction des serpentins de
refroidissement pendant et après le dégivrage peuvent
causer un craquement ou un claquement.
„ Sur les modèles équipés d’une machine à glaçons,
après un cycle de fabrication de glaçons, vous pouvez
entendre les glaçons tomber dans le bac.
70
Pour obtenir plus d’information sur les
bruits normaux de fonctionnement de
la machine à glaçons et le distributeur
d’eau et de glaçons, veuillez consultez les
sections Machine à glaçons automatique
et Le distributeur d’eau et de glaçons.
Avant d’appeler à un technicien…
ww.electromenagersge.ca
Conseils de dépannage – Économisez du temps et de l’argent! Consultez d’abord les
tableaux qui suivent et vous pourrez peut-être éviter de faire appel à un technicien.
Problème
Causes possibles
Que faire
Le réfrigérateur ne
fonctionne pas
Le cycle de dégivrage
est en cours.
• Attendez environ 30 minutes afin que le cycle de
dégivrage se termine.
Une des commandes ou les deux
est sur la position OFF (arrêt).
Le réfrigérateur est débranché.
• Réglez les commandes de température à une
température plus basse.
• Enfoncez complètement la fiche de l’appareil dans la
prise murale.
Le fusible est grillé/le disjoncteur
est déclenché.
• Remplacez le fusible ou réenclenchez le disjoncteur.
Votre réfrigérateur est en mode de
démonstration.
. •Débranchez votre réfrigérateur et rebranchez-le.
Les roulettes ont besoin d’
être réglées.
• Consultez la section Roulettes
Ceci est normal lorsque le
réfrigérateur vient d’être branché.
• Attendre 24 heures pour que le réfrigérateur refroidir.
complètement.
Vibration ou bruit
métallique (une légère
vibration est normale)
Ceci est fréquent lorsqu’une grande • C’est normal.
quantité d’aliments a été placée dans
le réfrigérater.
Température trop élevée
dans le congélateur ou
le réfrigérateur
Givre sur les aliments
surgelés (il est normal
que du givre se forme à
l’intérieur du paquet)
La porte est restée ouverte.
• Un paquet empêche peut-être la fermeture de la porte.
Temps chaud ou ouverture
fréquente des portes.
• C’est normal.
La température est réglée sur la
température la plus basse.
• Consultez la section « Commandes ».
La température n’est pas réglée
sur une température assez basse.
• Consultez la section « Commandes ».
Temps chaud ou ouverture
fréquente des portes.
• Réglez la commande des températures sur une
température plus basse. Consultez la section Commandes »..
La porte est restée ouverte.
• Un paquet empêche peut-être la fermeture
de la porte.
La porte est restée ouverte.
• Un paquet empêche peut-être la fermeture de la porte.
Ouverture trop fréquente ou
trop longue des portes.
La séparation entre
le réfrigérateur et le
congélateur est chaude
Le système automatique
• Ceci permet d’éviter des problèmes de condensation
d’économie d’énergie fait
sur l’extérieur de l’appareil.
circuler du liquide tiède à l’avant
du compartiment de congélation.
Formation lente des
glaçons (sur certains
modèles)
Porte laissée ouverte.
• Vérifiez qu’il n’y a pas un paquet qui empêche la
porte de fermer.
La commande de température
du congélateur n’est pas réglée
à une température assez froide.
• Consultez Les commandes.
Le distributeur d’eau n’a pas été
utilisé depuis longtemps.
• Faites couler l’eau jusqu’à ce que l’eau du système soit
remplacée par de l’eau fraîche.
Mauvais goût/odeur
de l’eau (sur certains
modèles)
71
Avant d’appeler à un technicien…
Problème
Causes possibles
Que faire
La machine à glaçons
ne fonctionne pas
L’interrupteur d’alimentation de la machine
à glaçons est à la position OFF (arrêt).
• Réglez l’interrupteur d’alimentation à la position
ON (marche).
L’alimentation en eau est coupée
ou n’est pas raccordée.
• Consultez Installation de la conduite d’eau.
Le compartiment congélateur
est trop chaud.
• Attendez 24 heures pour que la température
du réfrigérateur se stabilise.
Un amas de glaçons dans le bac provoque • Nivelez les glaçons à la main.
l’arrêt de la machine à glaçons.
Odeur/saveur anormale
des glaçons
Cubes de glace sont coincés dans
le distributeur.
• Débranchez le distributeur, enlevez les cubes
et rebranchez le distributeur.
Il faut nettoyer le bac à glaçons.
• Videz et lavez le bac à glaçons. Jetez les vieux glaçons.
Des aliments ont transmis leur
odeur/goût aux glaçons.
• Emballez bien les aliments.
Il faut nettoyer l’intérieur du
réfrigérateur.
• Consultez Entretien et nettoyage.
Petits glaçons ou glaçons Le filtre à eau est bouché.
creux à l’intérieur
• Remplacez la cartouche du filtre avec une nouvelle
cartouche ou installez le bouchon du filtre.
Le distributeur de glaçons La machine à glaçons est éteinte
ne fonctionne pas
ou l’alimentation en eau a été coupée.
(sur certains modèles)
Des glaçons sont collés au bras régulateur.
• Mettez en marche la machine à glaçons ou rétablissez
l’alimentation en eau.
L’eau versée dans le
premier verre est
chaude (sur certains
modèles)
Le distributeur d’eau
ne fonctionne pas
(sur certains modèles)
Un objet bloque ou est tombé dans la
chute à glace située à l’intérieur du
bac supérieur de la porte du
compartiment congélation.
• Enlevez tout objet qui bloque ou est tombé dans la chute.
Distributeur est VERROUILLÉ.
• Appuyez et maintenez enfoncée la touche LOCK
(verrouillage) pendant 3 secondes.
Blocs de glace irréguliers dans
le bac à glaçons.
• Brisez-en autant que possible avec vos doigts et jetez ceux
qui restent.
• Le congélateur est peut-être trop chaud. Réglez la
commande du congélateur sur une température plus
basse, en abaissant la commande d’une position à la fois
jusqu’à ce que les blocs de glace disparaissent.
Normal lorsque le réfrigérateur
est initialement installé.
• Attendez 24 heures pour que la température
du réfrigérateur se stabilise.
Le distributeur d’eau n’a pas été
utilisé depuis longtemps.
• Faites couler l’eau jusqu’à ce que l’eau du système soit
remplacée par de l’eau fraîche.
Le réservoir d’eau vient d’être vidangé.
• Attendez plusieurs heures pour que l’eau refroidisse.
L’alimentation en eau est
coupée ou n’est pas raccordée.
• Consultez Installation de la conduite d’eau.
Le filtre à eau est bouché.
• Remplacez la cartouche du filtre avec une nouvelle
cartouche ou installez le bouchon du filtre.
Il y a de l’air dans la conduite
d’eau.
• Appuyez sur le bras de distribution pendant
au moins deux minutes.
Distributeur est VERROUILLÉ.
• Appuyez et maintenez enfoncée la touche LOCK
(verrouillage) pendant 3 secondes.
L’eau jaillit du distributeur La cartouche du filtre vient d’être
installée.
72
• Retirez les glaçons.
• Faites couler l’eau du distributeur pendant 3 minutes
(environ 6 litres).
ww.electromenagersge.ca
Problème
Causes possibles
Que faire
La machine à glaçons
fonctionne, mais ne
distribue pas d’eau
L’eau du réservoir est gelée.
• Appelez un réparateur.
Le réglage de commande est
trop froid.
• Réglez le commande de température sur un réglage
plus chaud.
La machine à glaçons
ne distribue ni eau
ni glaçons
La conduite d’eau ou le
robinet d’arrêt est bouché.
• Appelez un plombier.
Le filtre à eau est bouché.
• Remplacez la cartouche du filtre avec une nouvelle
cartouche ou installez le bouchon du filtre.
Distributeur est VERROUILLÉ.
• Appuyez et maintenez enfoncée la touche LOCK
(verrouillage) pendant 3 secondes.
CUBED ICE (cubes de
glace) était choisi mais
CRUSHED ICE (glace
concassée) a été
distribuée (sur
certains modèles)
Le réglage précédent était
CRUSHED ICE.
• Quelques cubes sont restés et ont été concassés à cause
du réglage précédent. C’est normal.
Odeur dans
le réfrigérateur
Des aliments ont transmis
leur odeur au réfrigérateur.
• Les aliments à odeur forte doivent être emballés
hermétiquement.
• Gardez une boîte ouverte de bicarbonate de soude
dans le réfrigérateur.
Il faut nettoyer l’intérieur.
De la condensation
s’accumule à l’extérieur
Cela n’est pas inhabituel pendant • Essuyez bien la surface extérieure.
les périodes de forte humidité.
De la condensation
Les portes sont ouvertes trop
s’accumule à l’intérieur
fréquemment ou pendant trop
(par temps humide,
longtemps.
l’ouverture des portes
laisse entrer de l’humidité)
L’éclairage intérieur
ne fonctionne pas
• Consultez Entretien et nettoyage.
• C’est normal pour le centre de boissons.
Étant donné le taux d’humidité
• Ce phénomène est normal et son apparition sera
plus élevé dans le compartiment
fonction des variations de la charge d’aliments et des
du réfrigérateur, il est possible
conditions ambiantes. Sécher à l’aide d’un essuie-tout
d’y déceler la présence de
si désiré.
brouillard ou de petites quantités
de buée de temps à autre.
Il n’y a pas de courant au niveau
• Remplacez le fusible ou réenclenchez le disjoncteur.
de la prise.
L’ampoule est grillée.
• Consultez Remplacement des ampoules.
Eau sur le sol ou au fond
du congélateur
Il y a des glaçons bloqués dans
le conduit.
• Faites passer les glaçons à l’aide d’une cuillère en bois.
Air chaud à la base du
réfrigérateur
Courant d’air normal provenant
du moteur. Pendant le processus
de réfrigération, il est normal que
de la chaleur soit expulsée à la
base du réfrigérateur. Certains
revêtements de sol sont sensibles
et peuvent se décolorer sous
l’effet de cette température de
fonctionnement normale qui
est sans danger.
La porte ne se ferme
pas correctement
Le joint de la porte du côté des
charnières est collé ou replié.
• Mettre une couche de cire de paraffine sur le joint
de la porte.
73
Avant d’appeler à un technicien…
Problème
Causes possibles
Que faire
Lueur orange dans
le congélateur
Le cycle de dégivrage est
en cours.
• C’est normal.
Le réfrigérateur ne
s’arrête jamais mais
les températures sont
normales
La fonction de dégivrage
maintient le compresseur en
marche au cours de l’ouverture
des portes.
• Ceci est normal. Le réfrigérateur passe sur cycle
d’arrêt lorsque les portes ont été fermées pendant
2 heures.
Le réfrigérateur émet
un signal sonore
La porte est ouverte.
• Fermez la porte.
La température présente
n’est pas égale à celle
affichée
L’appareil vient d’être branché.
• Pour stabiliser le système, laissez 24 heures s’écouler.
La porte est restée ouverte trop
longtemps.
• Pour stabiliser le système, laissez 24 heures s’écouler.
Des aliments chauds ont été
placés dans le réfrigérateur.
• Pour stabiliser le système, laissez 24 heures s’écouler.
Cycle de dégivrage en cours.
• Pour stabiliser le système, laissez 24 heures s’écouler.
Le commutateur de marche de
la machine à glaçons est dans
la position I (marche), mais
l’arrivée d’eau au réfrigérateur
n’a pas été raccordée.
• Réglez le commutateur de marche sur la position
O (arrêt), car le garder dans la position I (marche)
endommagera le robinet d’eau.
Bourdonnement
fréquent
74
Garantie du réfrigérateur.
Toutes les réparations en vertu de la garantie sont fournis par nos Centre
de Service d’Usine ou par un technicien autorisé Customer Care®. Pour
prévoir une réparation, consultez notre site GEAppliances.com ou appelez le
800.GE.CARE5 (800.432.2737). Veuillez avoir votre numéro de série et votre
numéro de modèle à portée de main lorsque vous appelez pour obtenir un
service. Au Canada, appelez le 800.561.3344.
Pendant la période de
garantie de :
Agrafez votre facture ici.
Pour bénéficier du service
de réparation sous garantie,
une preuve de la date d’achat
initial est nécessaire.
GE remplacera :
GE, GE PROFILE et GE Cáfe MODÈLES UNIQUEMENT :
Un An
A compter de la date d’achat
initial
Toute pièce du réfrigérateur qui s’avère défectueuse en raison d’un défaut de matériau ou de
fabrication. Pendant la validité de la présente garantie limitée d’un an, GE fournira également
gratuitement la main d’œuvre et le service pour réparer la pièce défectueuse.
Trente jours
Toute pièce de la cartouche filtrante qui ne fonctionne pas à cause d’un vice de matériau ou de main
(filtre à eau, si inclus) A compter de d’œuvre. Pendant la validité de la présente garantie limitée de 30 jours, GE fournira gratuitement une
la date d’achat initial
cartouche filtrante de remplacement.
GE PROFILE et GE Cáfe MODÈLES UNIQUEMENT :
Cinq Ans
Toute pièce du système fermé du réfrigérateur (compresseur, condenseur, évaporateur et tous
A compter de la date d’achat les tuyaux de raccordement) qui s’avère défectueuse en raison d’un défaut de matériau ou de
fabrication. Pendant la validité de la présente garantie limitée de cinq an, GE fournira également
gratuitement la main d’œuvre et le service pour réparer la pièce défectueuse dans le système fermé
du réfrigérateur.
Ce qui n’est pas couvert par GE :
■ Les déplacements à votre domicile pour vous expliquer
l’utilisation de ce produit
■ Une installation, livraison ou maintenance défectueuse.
■ Une panne du produit par abus d’utilisation, par mauvaise
utilisation, par modification ou s’il a été utilisé dans un but autre
que celui pour lequel il a été fabriqué.
■ Détérioration des aliments.
■ Le remplacement des fusibles ou le réenclenchement du
disjoncteur du domicile.
■ Les dommages à la finition, tels que rouille de surface,
ternissement ou petites taches, non signalés dans un délai de
48 heures suivant la livraison.
■ Dommages causés par l’utilisation d’un filtre qui n’est pas de
marque GE.
■ Le remplacement de la cartouche filtrante, si incluse, à cause
d’une pression d’eau en dehors de la gamme de fonctionnement
recommandée ou à cause d’une concentration excessive de
sédiments dans l’eau d’alimentation.
■ Le remplacement des ampoules, si incluses, ou la cartouche
filtrante, si incluse, et dans des conditions autres que celles
susmentionnées.
■ Tout dommage causé par accident, incendie, inondation ou une
catastrophe naturelle.
■ Tout dommage fortuit ou indirect causé par des défauts
éventuels de cet appareil.
■ Le service s’il est impossible d’avoir accès au produit.
EXCLUSION DES GARANTIES TACITES - Votre recours exclusif est l’échange du produit suivant les modalités de
la Garantie Limitée. Toutes garanties tacites, y compris les garanties de valeurs marchandes ou d’adéquation
à des fins particulières, sont limitées à une durée d’un an ou à la durée la plus courte autorisée par la loi.
Pour les clients des États-Unis : Cette garantie est étendue à l’acheteur d’origine et aux propriétaires suivants
pour tout produit acheté pour une utilisation domestique aux États-Unis. Si le produit est installé dans une
région où ne se trouve aucun réparateur autorisé GE, vous devrez peut-être assumer les frais de transport ou
apporter l’appareil à un centre de service autorisé GE. En Alaska, cette garantie exclut le coût d’expédition ou de
dépannage à votre domicile.
Certains états n’acceptent pas d’exclusion ou de limites aux dommages indirects consécutifs. Certains droits
particuliers vous sont dévolus en vertu de la présente garantie et peuvent s’accompagner d’autres droits qui
varient selon votre lieu de résidence. Pour connaître vos droits juridiques, veuillez consulter le bureau local ou le
bureau d’état des affaires aux consommateurs ou le Procureur Général de votre état.
Garant : États-Unis : General Electric Company. Louisville, KY 40225
Cette garantie est étendue à l’acheteur d’origine et aux propriétaires suivants pour tout produit acheté aux
Canada pour une utilisation domestique aux Canada.Le service à domicile en vertu de la garantie sera fourni
dans les régions où il est disponible et où Mabe estime raisonnable de le fournir.
Garant Canada: MC Commercial, Burlington, Ontario, L7R 5B6
75
Données de performance
Système de Filtration à Cartouche ® MSWF
Ce système a été testé et certifié pour le modèle GE MWF conformément aux Normes NSF/ANSI n°42 et 53 pour la réduction des substances indiquées ci-dessous.
La concentration des substances indiquées dans l’eau alimentant le système a été réduite à une concentration inférieure ou égale à la limite autorisée pour l'eau
en sortie du système, telle que l’exigent les normes NSF/ANSI 42 et 53.* (Un coefficient de sécurité est ajouté au système pour les utilisations sans compteur).
Standard No. 42: Aesthetic effects
Paramètre
Chlorine Taste & Odor
Particules**
USEPA MCL
—
—
Qualité
influent Concentration
2.0 mg/L ± 10%
at least 10,000 particles/
mL
Moyenne
0.06 mg/L
408,333
Effluent
Maximum
0.10 mg/L
670,000
% Reduction
Moyenne
Maximum
97%
9.1%
95.5%
89.4%
Réduction exigeante Min.
≥ 50%
≥ 85%
Standard No. 53: Health effects
Parameter
Turbidité
Spores***
Plomb au pH 6.5
Plomb au pH 8.5
Mercure at pH 6.5
Mercure at pH 8.5
Lindane
Atrazine
2, 4-D
Toxaphene
Benzene
Carbofuran
P-Dichlorobenzène
Asbestos
USEPA MCL
1 NTU****
99.95% Reduction
0.010 mg/L
0.010 mg/L
0.002 mg/L
0.002 mg/L
0.0002 mg/L
0.003 mg/L
0.070 mg/L
0.003 mg/L
0.005 mg/L
0.040 mg/L
0.075 mg/L
99% Reduction
Qualité
influent Concentration
11 ± 1 NTU****
Minimum 50,000 L
0.15 mg/L ± 10%
0.15 mg/L ± 10%
0.006 mg/L ± 10%
0.006 mg/L ± 10%
0.002 mg/L ± 10%
0.009 mg/L ± 10%
0.210 mg/L ± 10%
0.015 mg/L ± 10%
0.015 mg/L ± 10%
0.080 mg/L ± 10%
0.225 mg/L ± 10%
10 7 to 10 8 fibers/L;
fibers > 10μm in length
Effluent
Moyenne
0.38 NTU
< 1 #/L
< 1 ppb
3.1 ppb
0.34 ppb
0.66 ppb
< 0.02 ppb
< 0.5 ppb
7.7 ppb
< 1 ppb
< 0.5 ppb
< 1 ppb
< 0.5 ppb
< 0.17 MF/L
Maximum
0.5 NTU
4 #/L
< 1 ppb
9.0 ppb
0.7 ppb
1.5 ppb
< 0.02 ppb
< 0.05 ppb
35 ppb
< 1 ppb
< 0.5 ppb
1 ppb
< 0.5 ppb
< 0.17 MF/L
% Reduction
Moyenne
Maximum
96.5%
95.4%
> 99.99%
> 99.99%
99.3%
99.3%
98.0%
95.5%
94.0%
89.6%
88.4%
73.7%
> 99.0%
> 99.0%
> 93.9%
> 94.3%
96.0%
82.0%
> 92.9%
> 92.9%
> 96.8%
> 97.0%
> 98.7%
> 98.7%
> 99.7%
> 99.8%
> 99%
> 99%
Concentration (mg/l) permise
pour l’eau le système
0.5 NTU
99.95%
0.010 mg/L
0.010 mg/L
0.002 mg/L
0.002 mg/L
0.0002 mg/L
0.003 mg/L
0.070 mg/L
0.003 mg/L
0.005 mg/L
0.040 mg/L
0.075 mg/L
99% Reduction
*Tested using pressure of 60 psig; pH of 7.5 ± 0.5; temp of 68º ± 5ºF (20º ± 2.5ºC).
**Measurement in Particles/mL. Particles used were 0.5-1 microns.
***Basé sur l’utillisation des oocystes de Cryptosporidium parvum.
****NTU=Nephelometric Turbidité Units
Capacité 300 gallons (1,135 liters). reduction de la contamination détermined par des tests NSF.
Directives d’utilisation/Paramètres de l’eau d’alimentation
Débit fourni
Alimentation en eau
0,9 gpm (3,14 lpm)
Eau potable
Pression d’alimentation
Température de l’eau
40-120 bar (40–120 lb/po²)
33ºF–100ºF (0,6ºC–38ºC)
ce produit soient respectées.
Consultez le manuel d’installation pour toute information sur la garantie
Spécifications d’utilisation
• Les substances contaminantes qui peuvent être réduites ou éliminées
par votre système de traitement d’eau ne sont pas obligatoirement présentes
dans votre eau.
Exigences d’installation / de fonctionnement/ de maintenance
• Vérifiez la conformité aux règlements et à la législation locale ou nationale.
• Il est à noter que ces essais ont été effectués dans des conditions
• Rincez la nouvelle cartouche à plein débit avec 6 litres d’eau
standards de laboratoire, la performance réelle peut varier.
(environ trois minutes) pour libérer l’air.
Les systèmes doivent être installés et utilisés conformément aux
•Remplacez la cartouche lorsque le débit devient trop faible.
procédures et directives données par le fabricant.
• Protégez contre le gel en retirant la cartouche si la température risque de
•
L’installation et l’utilisation DOIVENT être conformes à tous les codes locaux et
descendre en dessous de 40°F (4.4°C). N’installez pas ces systèmes dans des
nationaux de plomberie. Ne procédez pas à l’installation si la pression de l’eau
pièces où la température ambiante risque de dépasser 100°F (38°C) ou d’être
dépasse 120 lb/po². Si votre pression d’eau dépasse 80 lb/po² (552 kPa),
inférieure à 40°F (4.4°C). Ne connectez pas le système à une alimentation
il est nécessaire d’installer un système de limitation de pression.
d’eau chaude.
Contactez un plombier professionnel si n’êtes pas sûr de la méthode
Informations particulières
permettant de vérifier votre pression d’eau.
• La notice d’installation est fournie avec le produit.
• N’installez pas le système s’il y a des possibilités de coups de bélier. En cas de coup
• Le système d’eau potable doit être entretenu conformément aux instructions
de bélier, vous devez installer un dispositif anti-bélier. Contactez un plombier
du fabricant. Ceci inclut le remplacement des cartouches de filtre.
professionnel si n’êtes pas sûr de la méthode permettant de vérifier la présence
• N’utilisez jamais votre système de filtration avec une eau microbiologiquement
insalubre ou de qualité inconnue sans avoir un dispositif de désinfection adéquate
de ce problème.
en amont ou en aval de votre système. Les systèmes des spores peuvent
• Si votre système est équipé d’un dispositif anti-refoulement, un dispositif de contrôle
de pression due à la dilatation thermique doit être installé.
être utilisés sur une eau désinfectée pouvant contenir des spores filtrables.
• Pression requise : 40-120 lb/po² (2,8–8,2 bar), à l’épreuve des coups de bélier
• Température : 33–100°F (0,6–38°C)
• Débit : 0,9 gpm (3,14 lpm)
Testé et certifié par NSF International en conformité avec les normes ANSI/NSF 42 et 53 pour le modèle GE MWF pour la réduction de:
Norme n°42 : Paramètres esthétiques
Norme n°53 : Effets sur la santé
• Filtration mécanique
• Chimique
• Réduction chimique
– Réduction des particules, Class I
– Goût et odeur de chlore
– Réduction de l’atrazine
– Réduction de l’Endrine
– Réduction du benzène et du Carbofuran
– Réduction du 1,4 Dichlorobenzène et du
GE
2,4-D
– Réduction du plomb et du lindane
– Réduction du mercure et du Toxaphène
• Filtration mécanique
– Réduction des spores et de l’amiante
Appliances
Appliance Park
Louisville, KY 40225
geapplianceparts.com
REPLACEMENT
ELEMENT
© 2010 GE Company
76
PC61278B
Fiche technique de performance
Système de filtration SmartWaterMC - Cartouche MWF de GE
Données relatives au rendement
Capacité : 300 gallons (1135 litres)
/DFRQFHQWUDWLRQGHVFRQWDPLQDQWVWHVWpVSRXUFH¿OWUHGDQVO·HDXHQWUDQWGDQVOHV\VWqPHD
été réduite à une valeur inférieure ou égale à la limite admissible dans l’eau sortant du système,
FRQIRUPpPHQWDX[QRUPHVHWGHOD16)$16,/HV\VWqPHDpWpWHVWpHWFHUWL¿pSDU16)
International conformément aux normes 42 et 53 de la NSF/ANSI.
Veuillez visiter geappliances.com pour connaître la liste complète des contaminants testés et des
concentrations réduites.
Les énoncés de réduction pharmaceutiques n’ont pas été certifiés par la NSF International ou l’état de la Californie.
Énoncés éprouvés et vérifiés par un laboratoire indépendant :
Réduction
de contaminant
Aténolol
Fluoxétine
Ibuprofène
Progestérone
Triméthoprime
Moyenne pour l’eau
d’alimentation
978 ng/L
907 ng/l
885 ng/L
1097 ng/L
415 ng/L
Concentration d’amorce
spécifiée par NSF
N/A
N/A
N/A
N/A
N/A
Concentration
Concentration
% réduction
moyenne de
max permissible
moyenne
substance en sortie
en sortie
99.5%
5.0 ng/L
N/A
99.4%
5.4 ng/L
N/A
94.1%
52.3 ng/L
N/A
99.5%
5.0 ng/L
N/A
99.5%
2.0 ng/L
N/A
Exigences de
réduction NSF
N/A
N/A
N/A
N/A
N/A
Rapport
d’essai NSF
J-00121587
J-00121587
J-00121588
J-00121589
J-00121587
Directives et paramètres de l’alimentation en eau
Débit fourni
Alimentation en eau
0.5 gpm (21.9 lpm)
Eau potable
Pression d’eau
Température de l’eau
40-120 psi (2.8-8.2 bar)
33°F-100°F (0.6°C-38°C)
Il est impératif que les méthodes d’installation, d’entretien et de remplacement du filtre recommandées par le fabricant de ce produit soient respectées.
Consultez le manuel d’installation pour connaître les renseignements de la garantie.
Remarque : Bien que les essais aient été effectués dans des conditions normales
de laboratoire, la performance actuelle peut varier.
Cartouche de rechange : MWF. Pour connaître les coûts évalués des articles de
rechange, veuillez appeler au 1-800-626-2002 ou visitez notre site internet au
www.geapplianceparts.com.
AVIS
Pour réduire le risque associé aux dommages matériels causés par des fuites d’eau :
• Lisez et suivez les instructions avant de procéder à l’installation et d’utiliser votre système.
• L’installation et l’utilisation DOIVENT être conformes à tous les codes locaux
et nationaux de plomberie.
• Ne procédez pas à l’installation si la pression de l’eau dépasse 120 lb/po² (8,2 bars).
AVERTISSEMENT
Si votre pression d’eau dépasse 80 lb/po² (552 kPa), il est nécessaire d’installer un système
Pour réduire le risqué associé à l’ingestion de contaminants :
de limitation de pression. Communiquez avec un plombier professionnel si vous n’êtes
• N’utilisez pas l’eau dont la salubrité microbiologique est inconnue ou
pas sûr de la méthode de vérification de la pression d’eau.
dangereuse sans avoir effectué une désinfection des composants d’arrivée
• N’installez pas le système s’il y a des possibilités de coups de bélier. En cas de coup
et de sortie du système. Les systèmes certifiés pour la réduction de kystes
de bélier, vous devez installer un dispositif anticoup de bélier. Communiquez avec un
peuvent être utilisés pour de l’eau désinfectée contenant des kystes filtrables.
plombier professionnel si n’êtes pas sûr de la méthode permettant de vérifier cette condition.
Établissement EPA no 10350-MN-005.
• Ne raccordez pas le système à des conduites d’alimentation d’eau chaude.
Consultez la fiche technique de performance pour connaître les conditions d’utilisation, La température de service maximale de ce système de filtre est de 38 °C (100 °F).
les énoncés de santé certifiés par le service de santé publique de la Californie et les
• Protégez le filtre contre le gel. Vidangez l’eau du filtre lorsque la température se situe
remplacements. Certification du service de santé publique de la Californie
sous 0,6 °C (33 °F).
no 05-1698. Les contaminants qui peuvent être réduits ou éliminés par ce filtre à eau • La cartouche du filtre jetable doit être remplacée tous les six (6) mois ou moins si
ne sont pas obligatoirement présents dans votre eau.
le débit d’eau du distributeur d’eau ou du distributeur de glace diminue.
ARTICLE
DE RECHANGE
Mis à l’essai et certifié par NSF International
conformément aux normes 42 et 53 de la
ANSI/NSF du modèle MWF de GE pour les
énoncés de réductions mentionnés à la
fiche technique de performance.
77
Notes...
78
Notes...
ww.electromenagersge.ca
79
Soutien au consommateur.
Site Web appareils électroménagers GE
www.electromenagersge.ca
Vous avez une question ou vous avez besoin d’aide pour votre appareil électroménager? Contactez-nous par
Internet au site www.electromenagersge.ca 24 heures par jour, tous les jours de l’année.
Service de réparations
1.800.561.3344
Service de réparations GE est tout près de vous.
Pour faire réparer votre électroménager GE, il suffit de nous téléphoner.
Studio de conception réaliste
Sur demande, GE peut fournir une brochure sur l’aménagement d’une cuisine pour les personnes
à mobilité réduite.
Écrivez: Directeur, Relations avec les consommateurs, Mabe Canada, Inc.
Bureau 310, 1 Factory Lane
Moncton, N.B. E1C 9M3
Prolongation de garantie
www.electromenagersge.ca
Achetez un contrat d’entretien GE avant que votre garantie n’expire et bénéficiez d’un rabais substantiel. Ainsi
le service après-vente GE sera toujours là après expiration de la garantie.
Visitez notre site Web ou appelez-nous au 1.888.261.2133.
Pièces et accessoires
Ceux qui désirent réparer eux-mêmes leurs électroménagers peuvent recevoir pièces et accessoires
directement à la maison (cartes VISA, MasterCard et Discover acceptées).
Les directives stipulées dans le présent manuel peuvent être effectuées par n’importe quel utilisateur. Les
autres réparations doivent généralement être effectuées par un technicien qualifié. Soyez prudent, car une
réparation inadéquate peut affecter le fonctionnement sécuritaire de l’appareil.
Vous trouverez dans les pages jaunes de votre annuaire le numéro du Centre de service Mabe le plus proche.
Autrement, appelez-nous au 1.800.661.1616.
Contactez-nous
Si vous n’êtes pas satisfait du service après-vente dont vous avez bénéficié :
Premièrement, communiquez avec les gens qui ont réparé votre appareil.
Ensuite, si vous n’êtes toujours pas satisfait envoyez tous les détails – numéro de téléphone compris – au
Directeur, Relations avec les consommateurs, Mabe Canada, Inc.
Bureau 310, 1 Factory Lane
Moncton, N.B. E1C 9M3
Inscrivez votre appareil électroménager
www.electromenagersge.ca
Inscrivez votre appareil électroménager en direct, aussitôt que possible. Cela améliorera nos communications
et notre service après-vente. Vous pouvez également nous envoyer par la poste le formulaire d’inscription
joint à votre documentation.
80
Información de seguridad . . . . . . . . .82
Instrucciones de operación
Cuidado y limpieza del
refrigerador . . . . . . . . . . . . . . . . . . . . . . 89, 90
El dispensador de agua y de hielo . . . . 88
El dispositivo automático
para hacer hielo . . . . . . . . . . . . . . . . . . . . . .87
El filtro de agua . . . . . . . . . . . . . . . . . . . . . .81
ExpressChill™ . . . . . . . . . . . . . . . . . . . . . . . . .86
Gavetas y cacerolas . . . . . . . . . . . . . . . . . .84
Los controles del refrigerador . . . . . . . . .78
Los entrepaños y recipientes
del refrigerador . . . . . . . . . . . . . . . . . . . 82, 83
Puertas del refrigerador. . . . . . . . . . . . . . .84
Reemplazo de bombillas . . . . . . . . . . . . . .91
TurboCool™ . . . . . . . . . . . . . . . . . . . . . . . . . . .85
Instrucciones de instalación
Cómo instalar el refrigerador. . . .103–106
Cómo mover el refrigerador . . . . . . 99–102
Instalación de la tubería de agua107–109
Preparación para
instalar el refrigerador . . . . . . . . . . . . . . . .98
Solucionar problemas . . . . . . . .111–114
Sonidos normales de la operación. . . 110
Servicio al consumidor
Garantía . . . . . . . . . . . . . . . . . . . . . . . . . . . 115
Hoja de datos de funcionamiento . . . 115
Servicio al consumidor . . . . . . . . . . . . . . 119
Anote aquí los números de modelo y de
serie:
No._______________________________
No._______________________________
Usted los verá en una etiqueta en el interior
del compartimiento de refrigerador en la parte
superior en el lado derecho.
81
INFORMACIONES IMPORTANTES DE SEGURIDAD.
LEA PRIMERO TODAS LAS INSTRUCCIONES.
SEGURIDAD
Sitio Web de Electrodomésticos de GE
Para más información sobre el funcionamiento de su refrigerador, visite www.
GEAppliances.com o comuníquese al 1-800-GECARES (432-2737).
INFORMACIÓN DE SEGURIDAD DEL REFRIGERADOR
Éste es el símbolo de alerta de seguridad. El mismo alerta sobre potenciales riesgos de muerte o lesiones tanto para usted
con para otras personas. Todos los mensajes de seguridad estarán a continuación del símbolo de alerta de seguridad y con la
palabra “PELIGRO”, “ADVERTENCIA” o “PRECAUCIÓN”. Estas palabras se definen como:
PELIGRO
Signale une situation qui présente un danger imminent et qui, si elle n’est pas évitée, entraînera des blessures
graves, voire la mort.
ADVERTENCIA
Signale une situation qui présente un danger imminent et qui, si elle n’est pas évitée, peut entraîner des
blessures graves, voire la mort. .
PRECAUCIÓN Signale une situation qui présente un danger imminent et qui, si elle n’est pas évitée, peut entraîner des
blessures mineures ou graves.
ADVERTENCIA
INSTRUCCIONES IMPORTANTES DE SEGURIDAD
A fin de reducir el riesgo de incendio, explosión, descargas eléctricas o lesiones al usar
su refrigerador, siga estas precauciones básicas de seguridad:
„ Este refrigerador se deberá instalar y ubicar adecuadamente
de acuerdo con las Instrucciones de Instalación antes de ser
usado.
„ Desenchufe el refrigerador antes de hacer reparaciones,
reemplazar una lámpara de luz o hacer una limpieza.
Nota: La corriente que va al refrigerador no puede ser
desconectada por ninguna configuración del panel de control.
Nota: Las reparaciones deberán ser realizadas por un
Profesional del Servicio Técnico calificado.
„ Reemplace todas las piezas y paneles antes del uso.
„ No guarde ni use gasolina u otros vapores inflamables y
líquidos cerca de este u otros electrodomésticos.
„ Debido a los posibles riesgos sobre la seguridad bajo
ciertas condiciones, recomendamos enfáticamente no usar
PRECAUCIÓN
INSTRUCCIONES IMPORTANTES DE SEGURIDAD
$¿QGHUHGXFLUHOULHVJRGHOHVLRQHVDOXVDUHOUHIULJHUDGRUVLJDHVWDVSUHFDXFLRQHV
básicas.
„ No limpie estantes de vidrio ni tapas con agua caliente cuando
estén fríos. Los estantes de vidrio y las tapas se pueden romper
si son expuestos a cambios de temperatura repentinos o
impactos, tales como sacudones o caídas. El vidrio templado
está diseñado para destruirse en pequeñas piezas en caso de
rotura.
„ Mantenga los dedos fuera de los espacios de “riesgo de
lastimaduras”; los despejes entre las puertas y entre las
puertas y el gabinete son necesariamente pequeños. Tenga el
cuidado de cerrar las puertas cuando los niños se encuentren
en el área.
82
prolongadores. Sin embargo, si se debe usar un prolongador,
es absolutamente necesario que sea un prolongador para
electrodoméstico de la lista UL (en Estados Unidos) o uno
certificado por CSA (en Canadá), de 3 cables con conexión a
tierra, que cuente con un enchufe con conexión a tierra y un
tomacorriente con una graduación eléctrica del cable de 15
amperes (mínimo) y 120 volts.
„ A fin de evitar riesgos de que los niños sufran asfixia o queden
atrapados, retire las puertas de comidas frescas y del freezer
de cualquier refrigerador antes de deshacerse o dejar de usar
el mismo.
„ No permita que los niños se trepen, paren o cuelguen de las
manijas de la puerta o de los estantes del refrigerador. Podrían
sufrir lesiones graves.
„ No toque las superficies frías del compartimiento del freezer
cuando las manos estén húmedas o mojadas, ya que la piel se
podrá adherir a estas superficies extremadamente frías.
„ No vuelva a congelar comidas que hayan estado totalmente
congeladas en forma previa.
„ En refrigeradores con máquinas de hacer hielo automáticas,
evite el contacto con las partes móviles del mecanismo
eyector o con el elemento de calefacción que libera los cubos.
No coloque los dedos ni las manos en el mecanismo de la
máquina de hielo automática mientras el refrigerador esté
enchufado.
GEAppliances.com
SEGURIDAD
(CONT.)
Riesgo de Explosión.
Mantenga cualquier material y vapores inflamables, tales como gasolina, alejados del refrigerador. Si
no se cumple con esto se podrá producir una explosión, incendio o la muerte.
ADVERTENCIA
CONEXIÓN DE LA ELECTRICIDAD
ADVERTENCIA
Riesgo de Descarga Eléctrica.
Enchufe en un tomacorriente con conexión a tierra de 3 cables.
No elimine el cable de conexión a tierra.
No use un adaptador.
Si no se siguen estas instrucciones se podrá producir a muerte, incendios o descargas eléctricas.
Nunca, bajo ninguna circunstancia, corte o elimine el tercer cable (tierra) del cable de corriente.
Para su seguridad personal, este electrodoméstico debe estar adecuadamente conectado a tierra.
El cable de corriente de este electrodoméstico contiene un
enchufe de 3 cables (conexión a tierra) que se conecta a un
tomacorriente de pared estándar de 3 cables (conexión a
tierra) para minimizar la posibilidad de riesgos de descargas
eléctricas por parte del mismo.
Se requiere un suministro eléctrico con fusible y conexión
a tierra de 115 voltios de CA, 60 Hz, 15 o 20 amperes. Esto
garantiza el mejor funcionamiento y además previene la
sobrecarga de los circuitos del hogar, lo cual podría ocasionar
riesgos de incendio debido al recalentamiento de cables.
Contrate a un electricista calificado para que controle el
tomacorriente y el circuito eléctrico, a fin de asegurar que el
enchufe esté correctamente conectado a tierra.
Nunca desenchufe el refrigerador tirando del cable de
corriente. Siempre tome su enchufe firmemente y empuje el
mismo hacia afuera para retirarlo.
En caso de contar con un tomacorriente de pared de 2 cables,
es su responsabilidad y obligación reemplazarlo por un
tomacorriente de pared de 3 cables correctamente conectado
a tierra. No use un adaptador.
Repare o reemplace de inmediato todos los cables de corriente
pelados o con cualquier tipo de daño. No use un cable con
cortaduras o abrasión sobre su extensión o extremos.
El refrigerador debería estar siempre conectado a un enchufe
específico con un índice de voltaje equivalente al que figura en
su etiqueta de características técnicas.
Al alejar el refrigerador de la pared, se deberá tener cuidado de
que no ruede sobre ni dañe el cable de corriente.
FORMA ADECUADA DE DESCARTAR SU ANTIGUO REFRIGERADOR
: Riesgo de que los niños sufran asfixia o y queden atrapados.
Retire del refrigerador las puertas de comidas frescas y del freezer, antes de descartar el refrigerador.
Si esto no se realiza, los niños podrán quedar atrapados y ocasionar la muerte o daño cerebral.
ADVERTENCIA
IMPORTANTE:
Que un niño quede atrapado o que sufra una asfixia no
son problemas del pasado. Los refrigeradores antiguos
o abandonados aún son peligrosos, incluso aunque se
conserven por “sólo unos pocos días”. Si se deshará de su
antiguo refrigerador, siga las siguientes instrucciones a fin
de evitar accidentes.
Antes de Descartar su Antiguo Refrigerador o
Freezer:
„ Retire las puertas de comidas frescas y del freezer.
„ Deje los estantes en su lugar de modo que los niños no
puedan trepar dentro con facilidad.
Refrigerantes
Todos los productos de refrigeración cuentan con
refrigerantes, que de acuerdo con la ley federal
deberán ser eliminados antes de descartar el producto.
Si se deshará de un producto de refrigeración
antiguo, consulte a la compañía a cargo sobre cómo
deshacerse del mismo.
LEA Y SIGA ESTA INFORMACIÓN DE SEGURIDAD
CUIDADOSAMENTE.
GUARDE ESTAS INSTRUCCIONES
83
Sobre los controles de temperatura.
No todas las funciones corresponden a todos los modelos. Es posible que sus controles sean similares a los
siguientes:
O
Los controles de temperatura fueron configurados previamente en la fábrica en 37°F para el compartimiento del
refrigerador y en 0°F para el compartimiento del freezer. Espere 24 horas hasta que la temperatura se estabilice hasta
los ajustes de preconfiguración recomendados
Es posible que los controles de temperatura muestren la temperatura en SET (Ajustada) y la temperatura real en el
refrigerador y en el freezer. La temperatura real puede variar levemente de la temperatura en SET (Ajustada) en base al
uso y al ambiente donde se usa.
„ En algunos modelos, ajustar ambos controles en la configuración más caliente hasta que la pantalla titile (apagado)
detendrá el enfriamiento en los compa rtimientos del freezer y del refrigerador.
„ En algunos modelos, ajustar ambos controles en la configuración más caliente hasta que la pantalla titile (apagado)
detendrá el enfriamiento del freezer y del refrigerador.
„ NOTA: Apagar el refrigerador a través de los controles del panel táctil no apaga la corriente eléctrica del refrigerador.
NOTA: El refrigerador se envía con una envoltura que protege los controles de temperatura. Si esta envoltura no fue
retirada durante la instalación, retire la misma ahora.
Sistema de Funcionamiento del Flujo de Aire
El Sistema de Funcionamiento de Flujo de Aire fue
diseñado para maximizar el control de temperatura en
los compartimientos del refrigerador y del freezer. Esta
función especial y única cuenta con la Torre de Aire a lo
largo de la pared trasera del refrigerador y el Túnel de
Aire en la sección inferior de la pared trasera del freezer.
Colocar comida frente a la celosía de ventilación de estos
componentes no afectará el funcionamiento.
84
Aunque la Torre de Aire y el Túnel de Aire pueden ser
retirados, hacer esto afectará el funcionamiento de la
temperatura. Para acceder a instrucciones de retiro,
se puede comunicar con nosotros a través de Internet,
durante las 24 horas, visitándonos en GEAppliances.com,
o llamando al 800. GE.CARES (800.432.2737). En Canadá,
comuníquese con nosotros a geappliances.ca o llámenos
al 1.800.561.3344.)
Sobre ClimateKeeper2.™ (en algunos modelos)
GEAppliances.com
Cómo Funciona
El ClimateKeeper2™ es el sistema de
refrigeración más avanzado de la industria,
brindando un funcionamiento óptimo de la
temperatura y humedad, a fin de mantener la
comida fresca durante más tiempo y de reducir
quemaduras por congelación.
El sistema ClimateKeeper2 cuenta con dos
evaporadores; uno para el refrigerador y uno
para el freezer.
Esto provee dos sistemas de enfriamiento
separados, y separa el flujo de aire entre los
compartimientos de comida fresca y del freezer
durante operaciones de congelación normal.*
Esto asegura que los niveles de humedad
del compartimiento de comida fresca son
significativamente más altos que el sistema
convencional,** permitiendo que los productos
frescos y otras comidas no selladas retengan
su contenido de humedad y frescura por más
tiempo. Las comidas sensibles a la humedad
tales como frutas frescas, ensaladas, arroz, etc.
ahora se pueden guardar en estantes abiertos
sin pérdida excesiva de la humedad. Debido
al alto nivel de humedad en el refrigerador,
es posible que ocasionalmente se empañe
o que se produzcan pequeñas cantidades
de humedad en el compartimiento del
refrigerador. Esto es normal y puede variar
dependiendo de las cantidades de comida y
condiciones climáticas. Seque con una toalla de
papel si lo desea.
El sistema de flujo de aire separado minimiza la
mezcla de aire entre los dos compartimientos,
lo cual reduce la transferencia de olor de la
comida fresca, para mejorar el gusto del hielo.
El sistema ClimateKeeper2™ también reduce
el número de ciclos de descongelación del
evaporador del freezer, reduciendo así las
quemaduras por congelación.
*Se utiliza aire del freezer en la función
CustomCool™ .
**Pruebas muestran un nivel más alto de
humedad en la sección de Comida Fresca de
refrigeradores ClimateKeeper2™ con relación
a las unidades convencionales.
Sobre el TurboCool.™ (en algunos modelos).
How it Works
OR
TurboCool ™ rapidly cools the refrigerator
compartment in order to more quickly cool foods.
Use TurboCool ™ when adding a large amount
of food to the refrigerator compartment, putting
away foods after they have been sitting out at room
temperature or when putting away warm leftovers.
It can also be used if the refrigerator has been
without power for an extended period.
Once activated, the compressor will turn on
immediately and the fans will cycle on and off
at high speed as needed for eight hours. The
compressor will continue to run until the refrigerator
compartment cools to approximately 34°F (1°C),
then it will cycle on and off to maintain this setting.
After 8 hours, or if TurboCool ™ is pressed again,
the refrigerator compartment will return to the
original setting.
How to Use
Press TurboCool.™ The TurboCool ™ temperature
display will show Tc and the LED will be activated.
After TurboCool ™ is complete, the TurboCool ™
indicator light will go out.
NOTES: The refrigerator temperature cannot be
changed during TurboCool ™.
The freezer temperature is not affected
during TurboCool ™.
When opening the refrigerator door during
TurboCool ™, the fans will continue to run
if they have cycled on.
85
Sobre ExpressChill™. (en algunos modelos)
Cómo Funciona
La función ExpressChill™ es un sistema para
humedecer, un ventilador y un termistor.
El recipiente de comida está fuertemente sellado
para evitar que éste produzcan fluctuaciones de
temperatura en el resto del refrigerador.
Los controles de este recipiente se encuentran
ubicados en la parte superior del refrigerador o en
el dispensador con los controles de temperatura.
Cómo usar
ExpressChill™
(Refrigeración expresa)
Vacíe el recipiente. Coloque la bandeja de Frío
en el recipiente. Coloque los productos en la
bandeja y cierre el recipiente completamente.
Seleccione la tecla ExpressChill™. En algunos
modelos, puede entonces seleccionar el tiempo
de congelación (use el cuadro para determinar la
mejor configuración). Otros modelos sólo tendrán
una opción (45 minutos). En modelos con
configuraciones múltiples, presione la tecla hasta
que la luz aparezca junto a la configuración
deseada.
„ Para detener la función antes de que
finalice, presione la tecla de dicha
configuración hasta que no haya opciones
seleccionadas y la pantalla esté apagada.
„ Durante ExpressChill™ , la pantalla de los
controles realizará una cuenta regresiva en
el ciclo.
Cómo Retirar y Reemplazar el Cajón
Para retirar:
Empuje el cajón fuera de su posición final.
Gire los cuatro cierres balanceables hasta la
posición de desbloqueo.
Levante la parte frontal del cajón hacia arriba
y hacia afuera.
Para reemplazar:
Asegúrese de que los cuatro cierres
balanceables se encuentren en la posición de
desbloqueo.
Coloque los lados del cajón sobre los soportes,
asegurando que los cierres balanceables se
ajusten en las ranuras del cajón.
Bloquee los cuatro cierres balanceables,
rotando los mismos sobre la posición de
bloqueo.
Quadro de ExpressChill™ (en algunos modelos)
NOTA: Los resultados pueden variar dependiendo del embalaje, temperatura inicial y otras
características de la comida.
15 Minutos
„ 1 lata de bebida
(12 onzas)
„ 2 cajas pequeñas de jugo
(6–8 onzas cada una)
86
30 Minutos
„ 2–6 latas de bebida
(12 onzas cada una)
„ 2 botellas plásticas
de 20 onzas de bebida
„ 4–6 cajas pequeñas de jugo
(6–8 onzas cada una)
„ 3 paquetes de jugo enlatado
„ Vino (botella de 750 ml)
45 Minutos
„ Botella de bebida
de 2 litros
„ 1/2 galón de juego
„ *HODWLQD³SDTXHWH
El filtro de agua. (en algunos modelos)
GEAppliances.com
Cartucho del filtro de agua
El cartucho del filtro de agua está ubicado en la esquina superior
derecha trasera del compartimento del refrigerador.
Cuándo reemplazar el filtro en los modelos con luz indicadora
de recambio
En el dispensador hay una luz de indicación de recambio del
cartucho del filtro del agua. Esta luz se volverá anaranjada para
advertirle que necesita reemplazar el filtro pronto.
El cartucho del filtro debería reemplazarse cuando la luz
indicadora de recambio se vuelva roja o si la salida de agua al
dispensador o al dispositivo para hacer hielo disminuyera.
Cuándo reemplazar el filtro en los modelos sin luz indicadora
de recambio
El cartucho del filtro se debe reemplazar cada seis meses,
o antes, si disminuye el flujo de agua al dispensador o al
dispositivo para hacer hielo.
Cómo retirar el cartucho del filtro
Si está cambiando el cartucho, remueva primero el viejo
girándolo lentamente hacia la izquierda. No jale el cartucho
directamente hacia abajo. Un poco de agua puede gotear.
Instalar el cartucho del filtro
Si va a reemplazar un cartucho SmartWater con un
adaptador, debe retirar el adaptador antes de instalar
el cartucho. Para retirar el adaptador, gírelo hacia
la izquierda aproximadamente 1/4 de giro.
Si va a reemplazar un cartucho Water by Culligan, deje el
adaptador colocado. Este adaptador permanecerá en el
refrigerador cuando reemplace cartuchos en el futuro.
Cartridge
Holder
Deje correr el agua desde el dispensador por 3 minutos
(aprox. 11ø2 galons) para aclarar el sistema y para prevenir
salpicaduras.
Presione la tecla WATER FILTER en el dispensador y
manténgala presionada durante tres segundos (en algunos
modelos).
NOTA: Un cartucho de filtro de agua recién instalado puede
causar el agua de chorrear del dispensador.
Tapón de derivación del filtro
Se debe usar el tapón de derivación del filtro cuando un
cartucho de filtro de reemplazamiento no se puede encontrar.
El dispensador y el dispositivo para hacer hielo no pueden
funcionar sin el filtro o sin el tapón de derivación del filtro.
Tapón de
derivación
del filtro
SmartWater
Con adaptador
Sin adaptador
(el aspecto puede variar)
Algunos modelos
cuentan con este
tipo de filtro de
agua.
En los modelos sin luz indicadora de recambio, pegue la
etiqueta con el mes y el año al nuevo cartucho para que se
recuerde de cambiar el filtro en seis meses.
Llene el cartucho de reemplazo con agua de la llave para
permitir que ocurra un mejor flujo a partir del dispensador
inmediatamente después de la instalación.
Alinee la flecha del cartucho y del soporte del cartucho.
Coloque la parte superior del nuevo cartucho hacia arriba
dentro del soporte. No empuje el cartucho hacia arriba a
dentro del soporte.
Gire el cartucho lentamente hacia la derecha hasta que el
cartucho se pare. NO APRETAR MUY FUERTE. Mientras está
girándolo, el se alzará por sí mismo en su posición. El
cartucho rotará aproximadamente 1/2 de vuelta.
Tapón de
derivación
del filtro
Water by Culligan
Para usar el tapón de derivación del filtro en los modelos Water
by Culligan, primero debe quitar el adaptador del filtro del
soporte del cartucho girándolo hacia la izquierda.
Para obtener el máximo beneficio de su sistema de filtración,
GErecomienda que use los filtros de la marca SmartWater de
GEúnicamente. El uso de filtros de la marca GE en refrigeradores
GE y Hotpoint brinda un óptimo funcionamiento y confiabilidad.
Los filtros de la marca SmartWater de GE siempre son la
eleccióncorrecta, ya que están patentados y diseñados
específicamente para los productos GE. Los filtros SmartWater
de GE cumplen conrigurosos estándares NSF de la industria
sobre seguridad y calidad, que son importantes para los
productos que están filtrando su agua.GE no posee filtros de la
marca GE que no estén calificados para suuso en refrigeradores
GE y Hotpoint, y no existe seguridad de quelos filtros que no son
de la marca GE cumplan con los estándares deGE en relación a
calidad, funcionamiento y confiabilidad.
Si tiene preguntas, visite nuestro sitio web en GEAppliances.com,
o llame al 1.800.GE.CARES (1.800.432.2737).
Filtros de recambio:
Para pedir cartuchos adicionales en los Estados Unidos,
visite nuestro sitio Web, GEAppliances.com, o llame a GE para
partes y accesorios al 800.626.2002.
Consulte la etiqueta del filtro para el tipo de filtro a fin de (MWF
o MSWF)
Los clientes en Canadá deben consultar las páginas amarillas
más cercana para el Centro de Servicio de Mabe.
87
Los entrepaños y recipientes del refrigerador.
No todos los modelos tienen todas las características.
Tapa
deslizante
Recipiente del refrigerador
Recipiente de congelador
Recipientes de puerta del refrigerador y recipientes inclinables de puerta
de congelador
Recipientes grandes
Los recipientes de la puerta del refrigerador y los
recipientes inclinables de puerta de congelador
más grandes son ajustables.
Para extraerlos: Levante la parte frontal
del recipiente hacia arriba, luego levántelo
y sáquelo.
Para reemplazarlos o reubicarlos: Ajuste la
parte trasera del recipiente en los soportes
moldeados de la puerta. Luego presione hacia
abajo en la parte frontal del recipiente. El
recipiente se ajustará en su sitio.
La tapa deslizante ayuda a prevenir que un
golpecito haga derramarse algo o que las
cosas pequeñas guardadas en el interior del
entrepaño de la puerta se caigan o resbalen.
Ponga un dedo en cada lado de la tapa
deslizante hacia la parte trasera y muévala
hacia delante y hacia atrás para que se ajuste a
sus necesidades..
Recipiente superior del congelador
NOTA: Tenga
cuidado cuando
reemplace artículos
en el recipiente
superior. Cerciórese
de que ningún
artículo bloquee o
caiga en el vertedor
de hielo.
Recipientes pequeños
Para extraerlos: Levante la parte frontal del
recipiente hacia arriba, luego sáquelo.
Para reemplazarlos: Sitúe el recipiente
por encima de los soportes moldeados
rectangulares en la puerta. Luego deslice el
recipiente hacia abajo hacia el soporte para
que se ajuste en su lugar.
Recipiente inclinable del congelador
Entrepaño deslizable a prueba de derramamientos
Press tab and pull shelf
forward to remove
El entrepaño deslizable permite alcanzar
artículos guardados atrás de otros. Los
bordes especiales están diseñados para
ayudar a prevenir derramamientos o
goteos a los entrepaños que se encuentran
más abajo.
Para sacarlos:
Deslice el entrepaño hacia fuera hasta que
llegue al punto donde se atranca, luego apriete
la lengüeta hacia abajo y deslice el entrepaño
directamente hacia fuera.
Para reemplazarlos o reubicarlos:
Sitúe el entrepaño a la altura de las guías
y deslícelo hacia su lugar. El entrepaño puede
VHUUHFRORFDGRFXDQGRODSXHUWDHVWpDÛ
o más. Para recolocar el entrepaño, deslice
el entrepaño más allá de los topes y dele un
ángulo hacia abajo. Deslice el entrepaño hacia
abajo hasta llegar a la posición deseada,
colóquelo en línea con los soportes y deslícelo
en su lugar.
Asegúrese de haber empujado los
entrepaños hasta el fondo antes de cerrar la
puerta.
Cestas de congelador (en algunos modelos)
Para remover, deslícelo hasta la posición
tope, levante el frente más allá de la
posición de tope, y deslícelo hacia afuera.
Asegúrese de haber empujado las cestas
hasta el fondo antes de cerrar la puerta.
Cestas de congelador (en algunos modelos)
Para remover, empuje la canasta totalmente
hacia la parte posterior del congelador.
Levante hasta que los pasadores posteriores
sean desenganchados. Levante la canasta
completa hacia arriba y hacia afuera.
88
Asegúrese de haber empujado las cestas
hasta el fondo antes de cerrar la puerta.
Los entrepaños y recipientes del refrigerador.
GEAppliances.com
No todos los modelos tienen todas las características.
Entrepaño QuickSpace™ (en algunos modelos)
Este entrepaño se divide en dos y la mitad
se desliza debajo de sí mismo para guardar
artículos muy altos ubicados en el entrepaño
que se encuentra más abajo.
Este entrepaño se puede sacar y cambiar
y también puede reubicarse igual que
los entrepaños deslizables a prueba de
derramamientos.
En algunos modelos, este entrepaño no puede
usarse en la posición más baja.
Entrepaños deslizantes del congelador
Para remover, deslícelo hasta la posición
tope, levante el frente más allá de la
posición de tope, y deslícelo hacia afuera.
Asegúrese de haber empujado los
entrepaños hasta el fondo antes de cerrar la
puerta.
Entrepaños fijos del congelador
Para remover, deslice el entrepaño hacia
arriba en el lado izquierdo y entonces
extráigalo del alojamiento.
NOTA PARA LOS MODELOS CON DISPENSADORES:
Para aprovechar al máximo la inclinación para
sacar el hielo del cubo, solamente almacene
artículos en entrepaño debajo del cubo de
hielo que no sean más altos que el punto
inferior en el cubo.
Estante de vino/bebidas en la
puerta (en algunos modelos)
Este estante sostiene hasta 5 latas, una botella
de vino o una botella (2 litros) de refresco.
El estante cuelgan de los lados de la sección
de productos lácteos.
Para remover:
Vacíe el estante de vino/bebidas.
Sosteniendo el fondo de la sección de
productos lácteos, levante el frente
directamente hacia arriba, entonces
levante y extraiga.
Para separar el estante de la sección de
productos lácteos, extraiga los alambres
laterales del estante por los agujeros en cada
lado de la sección de productos lácteos.
Para reemplazar:
Pegue otra vez el estante a los lados
de la sección de productos lácteos.
Encaje el lado posterior en los apoyos
moldeados en la puerta. Luego empuje
hacia abajo en el frente de la sección. La
sección encajará en su lugar.
Estante ShelfSaver™
Estante de la Puerta para Latas
(en algunos modelos)
En este estante de la puerta se
pueden ubicar hasta 9 latas.
(en algunos modelos)
Use este estante para guardar
latas de bebidas con un fácil
acceso
NOTA: Este estante sólo puede ser
montado en la posición superior
debajo del recipiente de lácteos.
También se puede colocar un
plato de horneado de 9” x 13”.
Estante de Bebidas
Extraíble (en algunos modelos)
El estante de bebidas está
diseñado para ubicar una botella
sobre su costado. Se puede adherir
a cualquier repisa deslizable
1
2
Instalación:
Alinee la parte más grande
sobre las ranuras en la parte
superior del estante con las
lengüetas debajo de la repisa.
Luego vuelva a deslizar el
estante para que quede
bloqueado en su posición.
89
Puertas del refrigerador.
Puertas del refrigerador ( (en algunos modelos)
Es posible que Ud. note una diferencia entre
el manejo de las puertas de su antiguo
y nuevo refrigerador. La característica
especial de abertura y cierre de las puertas
asegura que estas cierren por completo y
permanezcan selladas firmemente.
La puerta se cerrará automáticamente
sólo cuando está parcialmente abierta.
Más allá de la posición de tope
de parada, la puerta permanecerá abierta.
La resistencia que Ud. puede notar en
la posición de tope de parada es menor
a medida que la puerta es cargada con
alimentos.
Cuando Ud. abre o cierre las puertas,
notará una posición de tope de parada. Si
la puerta es abierta más allá de este punto,
permanecerá abierta permitiéndole así de
meter y sacar alimentos del refrigerador con
más facilidad. La puerta se cerrará
automáticamente sólo cuando está
parcialmente abierta.
Alineación de las puertas
Si las puertas no están niveladas, ajuste
le puerta de los alimentos frescos.
Usando una llave de cubo de 7/16”, gire
el tornillo de ajuste de la puerta hacia la
derecha para elevar la puerta; gírelo
hacia la izquierda para hacerla
descender. (Un tapón de nylon está
encajado en la rosca del pin para
impedir que el pin gire a menos de que
se use una llave.)
Llave de cubo de 7/16”
Para quitar la parrilla
de la base, abra
las puertas, saque
los tornillos de cada
lado de la parrilla
y jale de la misma.
90
Levantar
Después de una o dos vueltas con la
llave, abra y cierre la puerta de los
alimentos frescos y luego controle la
alineación superior de las puertas.
Sobre los cajones y recipientes.
GEAppliances.com
No todas las funciones corresponden a todos los modelos.
Cajones de Frutas y Verduras
El exceso de agua que se puede acumular en la
parte inferior de los cajones se deberá limpiar.
En algunos modelos,el cajón inferior se puede
deslizar hasta alcanzar una extensión completa
que permite un acceso completo al cajón.
HI
LO
Cajones de Humedad Ajustables
Deslice el control hasta la configuración HI
(Alto) a fin de brindar el alto nivel de humedad
recomendado para la mayoría de las verduras.
Deslice el control hasta la configuración LO
(Bajo) a fin de brindar el bajo nivel de humedad
recomendado para la mayoría de las frutas.
Recipiente de Embutidos Convertible (en algunos modelos)
T
ES
LD
O
CO
LD
C
El recipiente de embutidos convertible
cuenta con su propio conducto de aire frío,
a fin de permitir que una corriente de aire
frío del compartimiento del freezer o del
compartimiento del refrigerador fluya hasta el
recipiente.
El control de temperatura variable regula
el flujo de aire de la función Climate Keeper
(Mantención del Clima).
Ajuste el control en la configuración más fría
para guardar carnes frescas.
Configure el control en frío para convertir
el recipiente a temperatura normal del
refrigerador y proveer espacio adicional para
verduras. El conducto de aire frío está apagado.
Se pueden seleccionar configuraciones
variables entre estos extremos.
Sobre cómo retirar el cajón.
No todas las funciones corresponden a todos los modelos.
Cómo Retirar el Cajón
El cajón se puede retirar fácilmente, empujando
hacia afuera y levantando el mismo en la
ubicación de detención.
Si la puerta le impide retirar los cajones,
primero intente retirar los estantes de la
puerta. Si esto no ofrece el espacio suficiente,
el refrigerador se deberá girar hacia adelante
hasta que la puerta se abra lo suficiente como
para deslizar los cajones hacia afuera. En
algunos casos, al girar el refrigerador hacia
afuera, es posible que necesite mover el mismo
hacia la izquierda o la derecha mientras lo
hace girar.
91
Acerca de la máquina automática.
Un refrigerador recién instalado puede necesitar entre 12 y 24 horas para empezar a hacer hielo.
Máquina para hacer hielo automática
La máquina de hielo producirá siete cubos por cicloaproximadamente 100-130 cubos en un período de 24 horas,
dependiendo de la temperatura del congelador, la emperatura
ambiente, el número de aperturas de puertas y las condiciones
de otro uso.
Si el refrigerador se usa antes de la toma de agua se hace a la
máquina de hielo, ponga el interruptor en la posición OFF.
Cuando el refrigerador está conectado al suministro de agua,
ponga el interruptor en la posición ON.
La máquina de hacer hielo se llenará de agua cuando se enfría a
15 ° F (-10 ° C). Un refrigerador recién instalado puede necesitar
entre 12 y 24 horas para empezar a hacer hielo.
Usted escuchará un zumbido cada vez que la máquina de hielo
se llena de agua.
Deseche las primeras tandas de hielo para permitir que la línea
de agua para limpiar.
Asegúrese de que nada interfiera con el movimiento del brazo
detector.
Cuando el contenedor se llene al nivel del brazo de llenado, la
máquina de hielo dejará de producir hielo. Es normal que varios
cubos para unirse entre sí.
Si el hielo no se usa con frecuencia, los cubos de hielo viejos se
opacan, adquieren un sabor rancio y se contraen.
PRECAUCIÓN
Nota especial sobre los modelos de dispensadores
„ Algunos modelos tienen una inclinación de hielo-un
contenedor de basura bin.The puede ser inclinado hacia
afuera como se muestra en las ilustraciones, y se sostendrá
por sí solo mientras usted extrae hielo o encienda la máquina
de hielo encienden y se apagan. Asegúrese de poner la
bandeja en su sitio antes de cerrar la puerta.
„ Para restaurar el nivel de hielo a partir de un envase vacío,
los pasos que se recomiendan las siguientes:
12 horas después de la primera tanda de hielo ha caído en
el cubo, dispensa de 3 a 4 cubos.
Después de un adicional de 6 horas, dispensa de 3 a 4
cubos de nuevo.
Estos pasos se restaurará el nivel de hielo en el menor tiempo
posible.
HIELO
Interruptor de
Brazo
Interruptor de
alimentación
HIELO
Luz verde de
alimentación
encendido
Brazo
Evite el contacto con las partes en
movimiento del mecanismo expulsor o con el elemento de
(en algunos modelos)
(en algunos modelos)
calefacción (ubicado en la parte inferior de la máquina de
NOTA:
hielos) que expulsa los cubos. No coloque los dedos ni las
manos en el mecanismo de la máquina de hielos automática En los hogares con menores que la presión
mientras el refrigerador esté enchufado.
promedio del agua, es posible que escuche el ciclo
de máquina de hielo varias veces al hacer un lote de
hielo.
92
GEAppliances.com
Acceso al hielo y el logro de el interruptor de
alimentación en los modelos dispensador
Hay dos tipos de estanterías de almacenamiento de hielo en
los modelos con dispensador. Uno tiene un estante encima de
el depósito, el otro no.
Nota especial para los modelos con depósito de hielo de
inclinación de salida:
„ Estos modelos tienen un depósito de hielo de inclinación
hacia fuera. El contenedor puede ser inclinado hacia afuera
como se muestra en las ilustraciones, y se sostendrá por
sí mientras que extrae hielo o gire el interruptor de la
máquina de hielos dentro y fuera. Asegúrese de poner la
bandeja en su sitio antes de cerrar la puerta.
Los modelos con un estante encima del cubo de hielo
NOTA: ICon el fin de aprovechar al máximo el depósito de hielo de
inclinación hacia fuera, sólo artículos de la tienda en el estante debajo del
cubo de hielo que no sean más altos que el punto más bajo de la bandeja.
Para tener acceso al hielo, tire
hacia adelante.
Los modelos con inclinación a cabo el depósito de hielo
En algunos modelos, para acceder a hielo o para alcanzar
el interruptor de encendido:
Para acceder a hielo y llegar al interruptor de la máquina de hielos :
Levante el cubo, entonces tírelo
hacia afuera hasta que el cubo
se detenga.
Baje la bandeja de acceso al
hielo o para alcanzar el
interruptor de encendido.
Estante
Estante
Cubo de hielo
Cubo de hielo
Tire de la bandeja hasta que el
cubo se detenga.
Para alcanzar el interruptor de
alimentación, tire de la plataforma
en línea recta. Siempre asegúrese
de reemplazar la plataforma.
Baje la bandeja de acceso al
hielo o alcanzar el interruptor.
Remueva el cubo de hielo (modelos de dispensadores)
PRECAUCIÓN El cubo de hielo es pesado cuando está lleno.
Coloque el interruptor en la posición OFF (apagado) antes de
remover el cubo.
Cuando reemplace el cubo, cerciórese de presionarlo
firmemente en su lugar. Si no entra hasta el máximo, remuévalo
y rote el mecanismo de accionamiento con una vuelta de 1/4.
Entonces empuje el cubo hacia atrás otra vez.
Rote
Mecanismo de
accionamiento
Modelos con dispensador solamente
93
El dispensador de agua y de hielo (en algunos modelos).
Para usar el dispensador
Seleccione CUBED ICE
(cubos de hielo),
CRUSHED ICE
(hielo triturado) o WATER
(agua).
Presione el vaso suavemente contra el brazo
del dispensador.
El recogedor no se vacía solo. Para evitar las
manchas de agua, el recogedor y la parrilla se
deberán limpiar regularmente.
Spill Shelf
Si no hay distribución de agua cuando el
refrigerador está primeramente instalado, hay
posibilidad de aire en el sistema de la línea de
agua. Oprima el brazo del dispensador durante
al menos dos minutos para eliminar el aire
atrapado de la línea de agua y llenar el sistema.
Para eliminar las impurezas de la línea de agua,
deseche los primeros seis vasos de agua.
PRECAUCION: No introduzca nunca los
dedos ni otros objetos en la apertura del
dispensador de hielo triturado.
Para bloquear el
dispensador
Presione la tecla LOCK
(bloqueo) durante
3 segundos para cerrar el
dispensador y el panel de
control.
Para desbloquearlo,
presione la misma tecla
durante 3 segundos
nuevamente.
Dispenser Light (Luz
del dispensador)
Esta tecla enciende y apaga
la luz del dispensador. La
luz también se enciende
al presionar el brazo del
dispensador. Si esta
luz se funde debería
reemplazarse con una
bombilla de un máximo de
6 vatios 12V.
Quick Ice (Hielo rápido) (en
algunos modelos)
Cuando necesite hielo
rápidamente, presione
esta tecla para acelerar la
producción de hielo. Esto
incrementará la producción
de hielo durante las
próximas 48 horas o hasta
que vuelva a presionar la
tecla.
Door Alarm (Alarma de
puerta)
(en algunos modelos)
Para ajustar la alarma,
presione esta tecla hasta
que la luz indicadora se
encienda. Esta alarma
sonará si cualquiera de la
puerta estuviera abierta
por más de 3 minutos.
La luz y el sonido cesan
automáticamente
al cerrarse la puerta.
Datos importantes de su dispensador
„ No agregue hielo de charolas o de bolsas en
el recipiente. Podría provocar que
no salga bien o que no se triture
adecuadamente.
„ Evite los vasos demasiado llenos de hielo y el
uso de vasos estrechos o demasiado altos. El
hielo amontonado podría obstruir el orificio
o hacer que se congele la puerta del orifico
de manera que no se pueda abrir. Si hubiera
hielo bloqueándolo, desprenda con una
cuchara de madera.
94
„ Las bebidas y los alimentos no se deberán
enfriar rápidamente en el recipiente del hielo.
Las latas, botellas o paquetes de comida
en el recipiente de hielos podrían causar la
obstrucción del dispositivo para hacer hielo o
del recipiente.
„ Para evitar que el hielo dispensado caiga
fuera del vaso, ponga el vaso cerca, pero sin
tocar, la apertura del dispensador.
„ Un poco de hielo triturado puede surtir
aunque había seleccionado CUBED ICE
(cubos de hielo). Esto sucede en ocasiones
cuando algunos cubos se canalizan en el
triturador.
„ Después de usar hielo triturado, un poco de
agua puede gotear del vertedero.
„ A veces, se formará un pequeño montón
de nieve en la salida del hielo situada en la
puerta. Esto es normal y, por regla general,
sucede cuando ha dispensado hielo picado
repetidamente. La nieve se evaporará por sí
misma.
Cuidado y limpieza del refrigerador.
GEAppliances.com
Limpiar el exterior
Área de goteo del dispensador
El pozo del dispensador, por debajo
de la parrilla, se debe mantener limpio y seco.
El agua que se queda en el pozo puede dejar
depósitos. Quite los depósitos agregando
vinagre sin diluir al pozo. Remoje hasta que
desaparezcan los depósitos o hasta que
se desprendan lo suficiente para quitarlos.
El brazo del dispensador. Antes de limpiar,
oprima y detenga la tecla LOCK (Bloqueo)
durante 3 segundos. Se limpia con
una solución de agua tibia y bicarbonato
de sodio–aproximadamente una cucharada (15
ml) de bicarbonato de sodio por
cada cuarto (1 litro) de agua. Enjuague
completamente con agua y seque.
Las manijas de la puerta y los ornamentos. Se
limpian con un paño humedecido con
una solución de detergente suave y agua.
Seque con un paño suave.
Los puertas y las manijas de las puertas
de acero inoxidable (en algunos modelos)
pueden ser limpiados con un limpiador para
acero inoxidable para usos comerciales. Los
limpiadores con ácido oxálico tales como Bar
Keepers Friend Soft Cleanser™ eliminarán el
óxido, deslustres y pequeñas manchas. Use
sólo un limpiador líquido libre de material
abrasivo y frote en la dirección de las líneas
del cepillo con una esponja suave y húmeda.
No utilice cera para electrodomésticos sobre
el acero inoxidable.
Mantenga limpio el terminado. Limpie
con un paño limpio ligeramente humedecido
con cera para aparatos de cocina o
un detergente suave y agua. Seque
y pula con un paño limpio y suave.
No limpie el refrigerador con un paño
sucio para trastes ni con un paño húmedo.
Estos podrían dejar residuos que afecten
a la pintura. No use estropajos, limpiadores
en polvo, blanqueadores ni limpiadores
que contengan blanqueador, ya que estos
productos podrían rayar y desprender
el terminado de pintura.
Limpiar el interior
Para evitar olores, deje una caja abierta de
bicarbonato de sodio en los compartimientos
de alimentos frescos y del congelador.
Desconecte el refrigerador antes
de limpiarlo. Si no fuera posible, exprima
el exceso de humedad de la esponja o del
paño cuando se limpie alrededor de botones,
bombillas o controles.
Use agua caliente y una solución de
bicarbonato de sodio–aproximadamente una
cucharada (15 ml) de bicarbonato de sodio
por cada cuarto (1 litro) de agua. Esta solución
limpia y neutraliza olores. Enjuague y seque.
PRECAUCIÓN No limpie estantes de
vidrio ni tapas con agua caliente cuando
estén fríos. Los estantes de vidrio y las
tapas se pueden romper si son expuestos
a cambios de temperatura repentinos o
impactos tales como sacudones o caídas.
El vidrio templado está diseñado para
destruirse en pequeñas piezas en caso de
rotura.
No lave ninguna parte plástica del
refrigerador en la lavadora de platos.
La bandeja de Enfriar/Descongelar
se puede lavar en el lavaplatos.
El uso de cualquier solución de limpieza
que no sea la recomendada, especialmente
aquella que contienen destilados del petróleo,
pueden agrietar o dañar el interior del
refrigerador.
95
Cuidado y limpieza del refrigerador. (cont.)
Atrás del refrigerador
Se deberá tener cuidado al retirar el
refrigerador de la pared. Todos los tipos de
recubrimiento de pisos se pueden dañar, sobre
todo los recubrimientos acojinados y los que
tienen superficies repujadas.
Jale el refrigerador en forma recta y empuje
nuevamente para devolverlo a su posición.
Mover el refrigerador en dirección lateral puede
causar daños al recubrimiento del piso o al
refrigerador.
Al empujar el refrigerador a su lugar, asegúrese
de no pasar sobre el cable eléctrico ni sobre la
línea de alimentación del dispositivo para hacer
hielos (en algunos modelos).
Preparación para vacacion

advertisement

Related manuals

advertisement