IQ 150S/250S
IQ 150S/250S
Electronic Self-Enclosed Submeters with
Wifi Ethernet Capability
User & Installation Manual
IM02601006E Rev 1.0
Copyright © 2012 by Eaton Corporation. All rights reserved.
Eaton, Power Xpert, PowerChain Management, Powerware, and X-Slot are registered trademarks of Eaton Corporation or its subsidiaries and affiliates. Microsoft
and Windows are registered trademarks of Microsoft Corporation. Modbus is a
registered trademark of Schneider Electric.
EATON CORPORATION - CONFIDENTIAL AND PROPRIETARY NOTICE TO PERSONS RECEIVING THIS DOCUMENT AND/OR TECHNICAL INFORMATION
THIS DOCUMENT, INCLUDING THE DRAWING AND INFORMATION CONTAINED
THEREON, IS CONFIDENTIAL AND IS THE EXCLUSIVE PROPERTY OF EATON
CORPORATION, AND IS MERELY ON LOAN AND SUBJECT TO RECALL BY EATON
AT ANY TIME. BY TAKING POSSESSION OF THIS DOCUMENT, THE RECIPIENT
ACKNOWLEDGES AND AGREES THAT THIS DOCUMENT CANNOT BE USED IN
ANY MANNER ADVERSE TO THE INTERESTS OF EATON, AND THAT NO PORTION
OF THIS DOCUMENT MAY BE COPIED OR OTHERWISE REPRODUCED WITHOUT
THE PRIOR WRITTEN CONSENT OF EATON. IN THE CASE OF CONFLICTING
CONTRACTUAL PROVISIONS, THIS NOTICE SHALL GOVERN THE STATUS OF THIS
DOCUMENT.
DISCLAIMER OF WARRANTIES AND LIMITATION OF LIABILITY
The information, recommendations, descriptions and safety notations in this document are based on Eaton Electrical Inc. and/or Eaton Corporation’s (“Eaton”) experience and judgment and may not cover all contingencies. If further information is
required, an Eaton sales office should be consulted.
Sale of the product shown in this literature is subject to the terms and conditions
outlined in appropriate Eaton selling policies or other contractual agreement between Eaton and the purchaser.
THERE ARE NO UNDERSTANDINGS, AGREEMENTS, WARRANTIES, EXPRESSED
OR IMPLIED, INCLUDING WARRANTIES OF FITNESS FOR A PARTICULAR PURPOSE OR MERCHANTABILITY, OTHER THAN THOSE SPECIFICALLY SET OUT
IN ANY EXISTING CONTRACT BETWEEN THE PARTIES. ANY SUCH CONTRACT
STATES THE ENTIRE OBLIGATION OF EATON. THE CONTENTS OF THIS DOCUMENT SHALL NOT BECOME PART OF OR MODIFY ANY CONTRACT BETWEEN
THE PARTIES.
In no event will Eaton be responsible to the purchaser or user in contract, in tort
(including negligence), strict liability or otherwise for any special, indirect, incidental
or consequential damage or loss whatsoever, including but not limited to damage
or loss of use of equipment, plant or power system, cost of capital, loss of power,
additional expenses in the use of existing power facilities, or claims against the
purchaser or user by its customers resulting from the use of the information, recommendations and descriptions contained herein.
Product Registration
PLEASE REGISTER YOUR PRODUCT
By registering your product you’re registering for the warranty in addition to
receiving important update information.
You can register your product in one of three ways:
1. Go online to: www.eaton.com/powerxpert and click on Product
Registration under Related Links.
2. Fill out and return the product registration card that can be found in the
packet of information you received.
3. Fill out the product registration information below and fax this page to
919-431-6240.
Product:__________________________________________________________
Product Model or Version Number:_____________________________________
Product Serial or License Number:_____________________________________
Company:________________________________________________________
Your Name:_______________________________________________________
Address:_________________________________________________________
Address:_________________________________________________________
City:_________________________________ State:________
Zip:_______
Email:___________________________________________________________
Today’s Date:_____________________________________________________
Phone:___________________________________________________________
Eaton GO number (if known)_________________________________________
IQ 150S/250S
Table of Contents
Table of Contents
1: Introduction
1-1
About This Manual
1-1
Warranty and Liability Information
1-1
Safety Precautions
1-2
FCC Information
1-2
2: IQ 150S/250S Submeter Overview and
Specifications
2-1
2.1: Hardware Overview
2-1
2.1.1: Ordering Information
2-3
2.1.2: Measured Values
2-4
2.1.3: Utility Peak Demand
2-5
2.2: Specifications
2-5
2.3: Compliance
2-10
2.4: Accuracy
2-10
3: Mechanical Installation
3-1
3.1: Overview
3-1
3.2: Install the Base
3-1
3.2.1:Mounting Diagrams
3-2
3.3: Secure the Cover
3-6
4: Electrical Installation
4-1
4.1: Considerations When Installing Meters
4-1
4.2: Electrical Connections
4-2
IM02601006E
www.eaton.com
TOC-1
IQ 150S/250S
Table of Contents
4.3: Ground Connections
4-3
4.4: Voltage Fuses
4-3
4.5: Electrical Connection Diagrams
4-4
5: Communication Installation
5-1
5.1: IQ 150S/250S Communication
5-1
5.1.1: RS485 Communication Com 2 (485 Option)
5-1
5.1.2: KYZ Output
5-3
5.1.3: Ethernet Connection
5-4
5.2: Meter Communication and Programming Overview
5-5
5.2.1: How to Connect to the Submeter
5-5
5.2.2: IQ 150S Submeter Device Profile Settings
5-8
5.2.3: IQ 250S Submeter Device Profile Settings
5-13
5.2.4: Polling the IQ 150S/250S Submeter
5-47
5.2.5: Using the IQ 150S/250S Tools Menu
5-55
5.2.6: Performing Other Tasks with Eaton Meter Configuration
Software
5-58
6: Ethernet Configuration
6-1
6.1: Introduction
6-1
6.2: Factory Default Settings
6-1
6.2.1: Modbus/TCP to RTU Bridge Setup
6-2
6.3: Configure Network Module
6-3
6.3.1: Configuration Requirements
6-4
6.3.2: Configuring the Ethernet Adapter
6-5
6.3.3: Detailed Configuration Parameters
6-8
IM02601006E
www.eaton.com
TOC-2
IQ 150S/250S
Table of Contents
6.3.4: Setup Details
6-9
6.3.4.1: Encryption Key
6-11
6.4: Network Module Hardware Initialization
6-13
7: Using the Submeter
7-1
7.1: Introduction
7-1
7.1.A: Understanding Submeter Face Elements
7-1
7.1.B: Understanding Submeter Face Buttons
7-2
7.2: Using the Front Panel
7-3
7.2.1: Understanding Startup and Default Displays
7-3
7.2.2: Using the Main Menu
7-4
7.2.3: Using Reset Mode
7-5
7.2.4: Entering a Password
7-6
7.2.5: Using Configuration Mode
7-7
7.2.5.1: Configuring the Scroll Feature
7-9
7.2.5.2: Configuring CT Setting
7-10
7.2.5.3: Configuring PT Setting
7-11
7.2.5.4: Configuring Connection Setting
7-13
7.2.5.5: Configuring Communication Port Setting
7-13
7.2.6: Using Operating Mode
7-15
7.3: Understanding the % of Load Bar
7-16
7.4: Performing Watt-Hour Accuracy Testing (Verification)
7-17
A: IQ 150S/250S Meter Navigation Maps
A-1
A.1: Introduction
A-1
IM02601006E
www.eaton.com
TOC-3
IQ 150S/250S
Table of Contents
A.2: Navigation Maps
A-1
B: IQ 150S/250S Meter Modbus Map
B-1
B.1: Introduction
B-1
B.2: Modbus Register Map Sections
B-1
B.3: Data Formats
B-1
B.4: Floating Point Values
B-2
B.5: Retrieving Logs Using the IQ 250S Meter's Modbus Map
B-3
B.5.1: Data Formats
B-4
B.5.2: IQ 250S Meter Logs
B-4
B.5.3: Block Definitions
B-5
B.5.4: Log Retrieval
B-15
B.5.4.1: Auto-Increment
B-15
B.5.4.2: Modbus Function Code 0x23
B-16
B.5.4.3: Log Retrieval Procedure
B-17
B.5.4.4: Log Retrieval Example
B-20
B.6: Modbus Register Map
B-28
C: IQ 150S Meter DNP Map
C-1
C.1: Introduction
C-1
C.2: DNP Implementation
C-1
C.3: Data Link Layer
C-2
C.4: Transport Layer
C-3
C.5: Application Layer
C-3
C.5.1: Object and Variation
C-4
IM02601006E
www.eaton.com
TOC-4
IQ 150S/250S
Table of Contents
C.5.1.1: Binary Output Status (Obj. 10, Var. 2)
C-5
C.5.1.2: Control Relay Output Block (Obj. 12, Var. 1)
C-6
C.5.1.3: 32-Bit Binary Counter Without Flag (Obj. 20, Var. 5)
C-7
C.5.1.4: 16-Bit Analog Input Without Flag (Obj. 30, Var. 4)
C-7
C.5.1.5: Class 0 Data (Obj. 60, Var. 1)
C-13
C.5.1.6: Internal Indications (Obj. 80, Var. 1)
C-13
C.6: IQ 150S Meter DNP Mapping (DNP-1 to DNP-2)
C-13
D: IQ 250S Meter DNP Map
D-1
D.1: Overview
D-1
D.2: Physical Layer
D-1
D.3: Data Link Layer
D-1
D.4: Application Layer
D-2
D.5: Error Reply
D-3
D.6: IQ 250S Meter’s DNP Register Map
D-3
D.7: DNP Message Layouts
D-6
D.8: Internal Indication Bits
D-9
IM02601006E
www.eaton.com
TOC-5
IQ 150S/250S
Table of Contents
This page intentionally left blank.
IM02601006E
www.eaton.com
TOC-6
IQ 150S/250S
1: Introduction
1 Introduction
About This Manual
This document is the user manual for the installation, operation, and maintenance of the Eaton IQ
150S/250S Meter. It is intended for authorized and qualified personnel who use the IQ 150S/250S
Meter. Please refer to the specific WARNINGS and CAUTIONS in this section before proceeding.
For Technical Support and after hour emergencies, contact our Power Quality Technical Support
team at 1-800-809-2772, option 4 / sub-option 1 or by email at [email protected]
For those outside the United States and Canada, call 414-449-7100 option 4 / sub-option 1. You
can also visit us on the web at http://www.eaton.com and follow the Products link.
Warranty and Liability Information
NO WARRANTIES EXPRESSED OR IMPLIED, INCLUDING WARRANTIES OF FITNESS FOR A
PARTICULAR PURPOSE OF MERCHANTABILITY, OR WARRANTIES ARISING FROM
COURSE OR DEALING OR USAGE OF TRADE ARE MADE REGARDING THE INFORMATION,RECOMMENDATIONS, AND DESCRIPTIONS CONTAINED HEREIN.
In no event will Eaton be responsible to the purchaser or user in contract, in tort (including negligence), strict liability or otherwise for any special, indirect, incidental, or consequential damage or
loss of use of equipment, plant or power system, cost of capital, loss of power, additional expenses
in the use of existing power facilities, or claims against the purchaser or user by its customers
resulting from the use of the information and descriptions contained herein.
Eaton disclaims liability for any modifications or interfaces with other equipment that are not in
conformity with the specifications and information contained within this manual. Any unauthorized
action of this kind can jeopardize operation, safety, or reliability.
The information contained in this document is believed to be accurate at the time of publication,
however, Eaton assumes no responsibility for any errors which may appear here and reserves the
right to make changes without notice.
IM02601006E
www.eaton.com
1-1
IQ 150S/250S
1: Introduction
Safety Precautions
All safety codes, safety standards, and/or regulations must be strictly observed in the installation,
operation, and maintenance of this device.
WARNINGS refer to instructions that, if not followed, can result in death or injury.
CAUTIONS refer to instructions that, if not followed, can result in equipment damage.
WARNINGS
SHOCK HAZARDS:
IMPROPER INSTALLATION CAN CAUSE DEATH, INJURY, AND/OR EQUIPMENT DAMAGE.
Follow all Warnings and Cautions. Completely read and understood the information in this document before attempting to install or operate the equipment. Improper wiring could cause death,
injury, or equipment damage. Only qualified personnel are to service the IQ 150S/250S Meter.
TROUBLESHOOTING PROCEDURES MAY REQUIRE PROXIMITY TO EXPOSED ENERGIZED(LIVE) ELECTRICAL WIRING AND/OR PARTS WHERE THE HAZARD OF FATAL ELECTRIC SHOCK IS PRESENT. Exercise extreme care to avoid injury or death. Always disconnect,
lock-out, and tag the current and voltage sources and the control power supply circuit before
touching the connections or components on the rear face of the meter base unit.
FAILURE TO GROUND THE IQ 150S/250S METER MAY RESULT IN INJURY, DEATH, OR
EQUIPMENT DAMAGE. Properly ground the IQ 150S/250S Meter during installation.
FCC Information
Regarding the wireless module:
• This device complies with Part 15 of the FCC rules. Operation is subject to the following two
conditions: 1) this device may not cause harmful interference, and 2) this device must accept
any interference received, including interference that may cause undesired operation.
• The antenna provided must not be replaced with an different type. Attaching a different antenna
will void the FCC approval and the FCC ID can no longer be considered.
IM02601006E
www.eaton.com
1-2
IQ 150S/250S
1: Introduction
Covered by one or more of the following patents:
US Patent Numbers D526920, D525893, 6751563, 6735535, 6636030.
IM02601006E
www.eaton.com
1-3
IQ 150S/250S
1: Introduction
This page intentionally left blank.
IM02601006E
www.eaton.com
1-4
IQ 150S/250S
2: Overview and Specifications
2: IQ 150S/250S Submeter Overview and Specifications
2.1: Hardware Overview
Eaton’s IQ 150S/250S submeter is designed to measure
revenue grade electrical energy usage and communicate
that information via various communication media. The unit
supports RS485, RJ45 wired Ethernet or IEEE 802.11 WiFi
Ethernet connections. This allows the submeter to be
placed anywhere within an industrial or commercial facility
and still communicate quickly and easily back to central
software.
The unit is designed with advanced measurement
capabilities, allowing it to achieve high performance
accuracy. The IQ 150S meter is specified as a 0.2% class
energy meter for billing applications (the IQ 250S is so
specified for Class 10 only). To verify the submeter’s performance and calibration, power providers use field test standards to verify that the unit’s energy measurements are correct. The IQ 150S/250S meter is a
traceable revenue meter and contains a utility grade test pulse to verify rated accuracy.
The IQ 250S meter has up to 2 MegaBytes* for datalogging. It offers three
historical logs, a Limits (Alarm) log, and a System Events log.
*NOTE: Because the memory is flash-based rather than NVRAM (non-volatile
random-access memory), some sectors are reserved for overhead, erase procedures, and spare
sectors for long-term wear reduction.
IQ 150S/250S meter features detailed in this manual are:
• 0.2% Class Revenue Certifiable Energy and Demand Submeter (IQ 250S Class 10 only)
• Meets ANSI C12.20 (0.2%) and IEC 62053-22 (0.2%) Classes (IQ 250S Class 10 only)
• Multifunction Measurement including Voltage, Current, Power, Frequency, Energy, etc.
• Three line 0.56” bright red LED display
• 2 MegaBytes Memory for Datalogging (IQ 250S)
IM02601006E
www.eaton.com
2-1
IQ 150S/250S
2: Overview and Specifications
• Real Time Clock for Time-Stamping of Logs (Logs are available only with the IQ 250S)
• Percentage of Load bar for Analog meter perception
• Modbus RTU (over Serial) and Modbus TCP (over Ethernet)
• Serial RS485 communication
• Ethernet and wireless Ethernet (WiFi)
• Easy to use faceplate programming
• Direct interface with most Building Management systems
The IQ 150S/250S submeter uses standard 5 or 1 Amp CTs (either split or donut). It surface
mounts to any wall and is easily programmed. The unit is designed specifically for easy installation and advanced communication.
IM02601006E
www.eaton.com
2-2
IQ 150S/250S
2: Overview and Specifications
2.1.1: Ordering Information
IQ -
150 - S - A - 6 - 5 - 1 - 1
1
2
3
4
5
6
1. Model:
150 = Energy
250 = Energy Plus
2. Meter Type
S = Self-enclosed Submeter
3. Frequency:
5 = 50 Hz System
6 = 60 Hz System
4. Current Input:
5 = 5 Amp Secondary
1 = 1 Amp Secondary
5. Power Supply:
1 = Universal, (90 - 400) VAC @50/60Hz or (100-370) VDC
6. Communication
1 = RS485 with Modbus RTU and KYZ Pulse Output
2 = RJ45 Ethernet Connection or Wireless (802.11b) with Modbus TCP and KYZ
Pulse Output (also configurable for RS485)
Example: IQ 150-S-A-6-5-1-1
(IQ 150 Self-enclosed Energy submeter with 60Hz System, 5 Amp Secondary, 90-400 VAC/100370 VDC Power Supply, RS485 Modbus and KYZ Pulse Output)
IM02601006E
www.eaton.com
2-3
IQ 150S/250S
2: Overview and Specifications
2.1.2: Measured Values
The IQ 150S/250S meter provides the following measured values all in real time and some additionally as average, maximum and minimum values.
IQ150S/250S Meter Measured Values
Measured Values
Real Time
Average
Maximum
Minimum
Voltage L-N
X
X
X
Voltage L-L
X
X
X
Current per Phase
X
X
X
X
Current Neutral
X
Watts
X
X
X
X
VAR
X
X
X
X
VA
X
X
X
X
PF
X
X
X
X
+Watt-hr
X
-Watt-hr
X
Watt-hr Net
X
+VAR-hr
X
-VAR-hr
X
VAR-hr Net
X
VA-hr
X
Frequency
X
X
X
Voltage Angles
X
Current Angles
X
% of Load Bar
X
IM02601006E
www.eaton.com
2-4
IQ 150S/250S
2: Overview and Specifications
2.1.3: Utility Peak Demand
The IQ150S/250S meter provides user-configured Block (Fixed) window or Rolling window
Demand. This feature allows you to set up a customized Demand profile. Block window Demand is
Demand used over a user-configured Demand period (usually 5, 15 or 30 minutes). Rolling
window Demand is a fixed window Demand that moves for a user-specified subinterval period.
For example, a 15-minute Demand using 3 subintervals and providing a new Demand reading
every 5 minutes, based on the last 15 minutes.
Utility Demand features can be used to calculate kW, kVAR, kVA and PF readings. All other
parameters offer Max and Min capability over the user-selectable averaging period. Voltage provides an Instantaneous Max and Min reading which displays the highest surge and lowest sag
seen by the meter
2.2: Specifications
Power Supply
Range:
Universal, (90 to 400)VAC
@50/60Hz or
(100 to 370)VDC
Power Consumption:
16 VA Maximum
Voltage Inputs (Measurement Category III)
Range:
IQ 150S: Universal, Auto-ranging
up to 416VAC L-N, 721VAC L-L
IQ 250S: Universal, Auto-ranging
up to 576VAC L-N, 721VAC L-L
Supported hookups:
3 Element Wye, 2.5 Element Wye,
2 Element Delta, 4 Wire Delta
Input Impedance:
1M Ohm/Phase
Burden:
0.36VA/Phase Max at 600V,
0.0144VA/Phase at 120V
Pickup Voltage:
IM02601006E
10VAC
www.eaton.com
2-5
IQ 150S/250S
Connection:
2: Overview and Specifications
Screw terminal - #6 - 32 screws
See Figure 3.1
Input Wire Gauge:
AWG#16 - 26
Fault Withstand:
Meets IEEE C37.90.1 (Surge
Withstand Capability)
Reading:
Programmable Full Scale to any PT
Ratio
Current Inputs
Class 10:
5A Nominal, 10 Amp Maximum
Class 2:
1A Nominal, 2 Amp Secondary
Burden:
0.005VA Per Phase Max at 11 Amps
Pickup Current:
0.1% of Nominal
Connections:
Screw terminal - #6-32 screws
(Diagram 3.1)
Current Surge Withstand:
100A/10 seconds at 23o C
Reading:
Programmable Full Scale to any CT
Ratio
Isolation
All Inputs and Outputs are galvanically isolated and tested to 2500VAC
Environmental Rating
Storage:
(-20 to +70)o C
Operating:
(-20 to +70)o C
Humidity:
to 95% RH Non-condensing
Faceplate Rating:
NEMA12 (Water Resistant)
IM02601006E
www.eaton.com
2-6
IQ 150S/250S
2: Overview and Specifications
Measurement Methods
Voltage, Current:
True RMS
Power:
Sampling at 400+ Samples per
Cycle on All Channels Measured
Readings Simultaneously
A/D Conversion:
6 Simultaneous 24 bit Analog to
Digital Converters
Update Rate
Watts, VAR and VA:
Every 6 cycles, e.g., 100
milliseconds (Ten times per
second) @60Hz
All other parameters:
Every 60 cycles, e.g, 1 second
@60Hz
Communication Format
RS485
Protocols:
Modbus RTU, Modbus ASCII, DNP
3.0, Modbus TCP (for Ethernetenabled)
Com Port Baud Rate:
9600 to 57600 b/s
Com Port Address:
001-247
Data Format:
8 Bit, No Parity
Wireless Ethernet (Optional)
802.11b Wireless or
WiFi or RJ45 Connection
10/100BaseT Ethernet
128 bit WEP Encryption
128 bit Wireless Security
Modbus TCP Protocol
IM02601006E
www.eaton.com
2-7
IQ 150S/250S
2: Overview and Specifications
Mechanical Parameters
Dimensions:
(H7.9 x W7.6 x D3.2) inches,
(H200.7 x W193.0 x D81.3) mm
Weight:
4 pounds
KYZ/RS485 Port Specifications
RS485 Transceiver; meets or exceeds EIA/TIA-485 Standard:
Type:
Two-wire, half duplex
Min. Input Impedance:
96kΩ
Max. Output Current:
±60mA
Wh Pulse
KYZ output contacts (and infrared LED light pulses through face plate; see Section 6.4 for Kh values):
Pulse Width:
40ms for IQ 150S; 90ms for IQ
250S
Full Scale Frequency:
~6Hz for IQ 150S; ~3Hz for IQ
250S
Contact type:
Solid State – SPDT (NO – C – NC)
Relay type:
Solid state
Peak switching voltage:
DC ±350V
Continuous load current:
120mA
Peak load current:
350mA for 10ms
On resistance, max.:
35Ω
Leakage current:
1µ[email protected]
Isolation:
AC 3750V
Reset State:
(NC - C) Closed; (NO - C) Open
IM02601006E
www.eaton.com
2-8
IQ 150S/250S
2: Overview and Specifications
Infrared LED:
Peak Spectral Wavelength:
940nm
Reset State:
Off
Internal Schematic:
Output Timing:
T [s] =
NC
[
Watthour
pulse
P[Watt ]
3600. Kh
]
IR LED Light Pulses
Through face plate
C
*40ms
NO
P[Watt] - Not a scaled value
Kh – See Section 7-4 for values
LED
OFF
LED
ON
*40ms
LED
OFF
LED
OFF
LED
ON
KYZ output
Contact States
Through Backplate
NC
NC
NC
NC
NC
C
C
C
C
C
NO
NO
NO
NO
NO
MSISFORTHE)13METERPULSEWIDTHISMSFORTHE)13METER
IM02601006E
www.eaton.com
2-9
IQ 150S/250S
2: Overview and Specifications
2.3: Compliance
• IEC 62053-22 (0.2% Accuracy), IQ 250S - Class 10 only
• ANSI C12.20 (0.2% Accuracy), IQ 250S - Class 10 only
• ANSI (IEEE) C37.90.1 Surge Withstand
• ANSI C62.41 (Burst)
• IEC1000-4-2: ESD
• IEC1000-4-3: Radiated Immunity
• IEC1000-4-4: Fast Transient
• IEC1000-4-5: Surge Immunity
• UL Listed
• CE Compliant
2.4: Accuracy
For 23oC, 3 Phase balanced Wye or Delta load, at 50 or 60 Hz (as per order), 5A (Class 10) nominal unit:
Parameter
Accuracy
Accuracy Input Range
Voltage L-N [V]
0.1% of reading2
(69 to 480)V
Voltage L-L [V]
0.1% of reading
(120 to 600)V
Current Phase [A]
0.1% of reading1
(0.15 to 5)A
Current Neutral (calculated) 2.0% of Full Scale1
[A]
Active Power Total [W]
0.2% of reading1,2
Active Energy Total [Wh]
0.2% of reading1,2
Reactive Power Total [VAR] 0.2% of reading1,2
Reactive Energy Total
[VARh]
Apparent Power Total [VA]
IM02601006E
0.2% of reading1,2
0.2% of reading1,2
www.eaton.com
(0.15 to 5)A @ (45 to 65)Hz
(0.15 to 5)A @ (69 to 480)V
@ +/- (0.5 to 1) lag/lead PF
(0.15 to 5)A @ (69 to 480)V
@ +/- (0.5 to 1) lag/lead PF
(0.15 to 5)A @ (69 to 480)V
@ +/- (0 to 0.8) lag/lead PF
(0.15 to 5)A @ (69 to 480)V
@ +/- (0 to 0.8) lag/lead PF
(0.15 to 5)A @ (69 to 480)V
@ +/- (0.5 to 1) lag/lead PF
2-10
IQ 150S/250S
Apparent Energy Total [VAh]0.2% of reading1,2
2: Overview and Specifications
Power Factor
0.2% of reading1,2
Frequency
+/- 0.01Hz
(0.15 to 5)A @ (69 to 480)V
@ +/- (0.5 to 1) lag/lead PF
(0.15 to 5)A @ (69 to 480)V
@ +/- (0.5 to 1) lag/lead PF
(45 to 65)Hz
Load Bar
+/- 1 segment
(0.005 to 6)A
1 For
2.5 element programmed units, degrade accuracy by an additional 0.5% of
reading.
• For 1A (Class 2) Nominal, degrade accuracy by an additional 0.5% of reading.
• For 1A (Class 2) Nominal, the input current range for Accuracy specification is 20% of the values listed in the table.
2
For unbalanced voltage inputs where at least one crosses the 150V auto-scale
threshold (for example, 120V/120V/208V system), degrade accuracy by additional
0.4%.
IM02601006E
www.eaton.com
2-11
IQ 150S/250S
2: Overview and Specifications
This page intentionally left blank.
IM02601006E
www.eaton.com
2-12
IQ 150S/250S
3: Mechanical Installation
3: Mechanical Installation
3.1: Overview
The IQ 150S/250S meter can be installed on any wall See Chapter 4 for wiring diagrams.
Mount the meter in a dry location, which is free from dirt and corrosive substances.
Recommended Installation Tools
• #2 Phillips screwdriver
• Wire cutters
3.2: Install the Base
1. Determine where you want to install the submeter.
2. With the submeter power off, open the top of the submeter. Use the front cover support to keep
the cover open as you perform the installation (see Figure 3.1).
Front cover
support
Front cover
support base:
ONLY insert
Front cover support
here Circ
uit Board
Opened
Screw
Figure 3.1: Submeter with Cover Open
IM02601006E
www.eaton.com
3-1
IQ 150S/250S
3: Mechanical Installation
CAUTIONS!
• Remove the antenna before opening the unit.
• Only use the front cover support if you are able to open the front cover to the extent that you can
fit the front cover support into its base. DO NOT rest the front cover support on the inside of the
meter, even for a short time - by doing so, you may damage components on the board assembly. Always insert the front cover support into its base.
3. Find the 4 Installation Slots and insert screws through each slot into the wall or panel.
4. Fasten securely - DO NOT overtighten. Maximum recommended torque is
0.5/0.6 Nm (4.42/5.31 lbF in).
3.2.1:Mounting Diagrams
v
CM
v
CM
-/5.4).'0,!4%
v
CM
v
CM
v
CM
Figure 3.2: Mounting Plate Dimensions
IM02601006E
www.eaton.com
3-2
IQ 150S/250S
3: Mechanical Installation
v
CM
v
CM
!NTENNA,ENGTHvCM
Figure 3.3: Front Dimensions
IM02601006E
www.eaton.com
3-3
IQ 150S/250S
3: Mechanical Installation
v
CM
Figure 3.4: Side Dimensions
IM02601006E
www.eaton.com
3-4
IQ 150S/250S
3: Mechanical Installation
12”/30.4cm
Figure 3.5: Open Cover Dimensions
w
DN
$57PMUBHF$POUSPM1PXFS(SPVOE
5ISPVHI)FSF $PNNVOJDBUJPOT,:;5ISPVHI)FSF
Figure 3.6: Bottom View with Access Holes
IM02601006E
www.eaton.com
3-5
IQ 150S/250S
3: Mechanical Installation
3.3: Secure the Cover
1. Close the cover, making sure that power and communications wires exit the submeter through
the openings at the base (see Figure 3.6).
CAUTION! To avoid damaging components on the board assembly, make sure the front cover
support is in the upright position before closing the front cover.
2. Using the 3 enclosed screws, secure the cover to the base in three places - DO NOT overtighten (you may damage the cover). Maximum recommended torque is
0.5/0.6 Nm (4.42/5.31 lbF in).
3. The unit can be sealed after the front cover is closed. To seal the unit, thread a seal tag (not
supplied by Eaton) through the housing located between the bottom access holes (see figures
3.6 and 3.7).
4. Reattach the antenna, if applicable.
Closed
Screw
Lockable Revenue Seal
Figure 3.7: Submeter with Closed Cover
IM02601006E
www.eaton.com
3-6
IQ 150S/250S
4: Electrical Installation
4: Electrical Installation
4.1: Considerations When Installing Meters
Installation of the IQ 150S/250S meter must be performed only by qualified personnel who follow standard safety precautions during all procedures. Those
personnel should have appropriate training and experience with high voltage
devices. Appropriate safety gloves, safety glasses and protective clothing is
recommended.
During normal operation of the IQ 150S/250S meter, dangerous voltages flow through many parts
of the meter, including: Terminals and any connected CTs (Current Transformers) and PTs (Potential Transformers), all I/O Modules (Inputs and Outputs) and their circuits. All Primary and Secondary circuits can, at times, produce lethal voltages and currents. Avoid contact with any currentcarrying surfaces.
Do not use the meter or any I/O Output Device for primary protection or in an energy-limiting capacity. The meter can only be used as secondary protection.
Do not use the meter for applications where failure of the meter may cause harm or death.
Do not use the meter for any application where there may be a risk of fire.
All meter terminals should be inaccessible after installation.
Do not apply more than the maximum voltage the meter or any attached device can withstand.
Refer to meter and/or device labels and to the Specifications for all devices before applying voltages.
Do not HIPOT/Dielectric test any Outputs, Inputs or Communications terminals.
Eaton recommends the use of Shorting Blocks and Fuses for voltage leads and power supply to
prevent hazardous voltage conditions or damage to CTs, if the meter needs to be removed from
service. CT grounding is optional.
IM02601006E
www.eaton.com
4-1
IQ 150S/250S
4: Electrical Installation
IMPORTANT!
• IF THE EQUIPMENT IS USED IN A MANNER NOT SPECIFIED BY
THE MANUFACTURER, THE PROTECTION PROVIDED BY THE
EQUIPMENT MAY BE IMPAIRED.
• THERE IS NO REQUIRED PREVENTIVE MAINTENANCE OR
INSPECTION NECESSARY FOR SAFETY. HOWEVER, ANY REPAIR
OR MAINTENANCE SHOULD BE PERFORMED BY THE FACTORY.
DISCONNECT DEVICE: The following part is considered the equipment disconnect device. A SWITCH OR CIRCUIT-BREAKER SHALL BE INCLUDED IN
THE END-USE EQUIPMENT OR BUILDING INSTALLATION. THE SWITCH
SHALL BE IN CLOSE PROXIMITY TO THE EQUIPMENT AND WITHIN EASY
REACH OF THE OPERATOR. THE SWITCH SHALL BE MARKED AS THE
DISCONNECTING DEVICE FOR THE EQUIPMENT.
4.2: Electrical Connections
All wiring for the IQ 150S/250S is done through the front of the unit (lifting the cover with the power
to the unit OFF) so that the unit can be surface mounted. Connecting cables exit the unit via two
openings in the base plate (see figures 3.6 and 4.1).
DO NOT over-torque screws. Maximum recommended torque is
0.5/0.6 Nm (4.42/5.31 lbF in).
IM02601006E
www.eaton.com
4-2
IQ 150S/250S
4: Electrical Installation
Wireless Ethernet Connection
Current
Inputs
Electronic Circuits
Ethernet, RJ45
Jack
RS485 Output
(Do not put the
Voltage on these
terminals!)
Ia Ia Ib Ib Ic Ic
(+) (-) (+) (-) (+) (-)
Va Vb Vc Vn L1 L2 PE
Z K Y + - SH
RS-485
KYZ Pulse
Output
Voltage
Inputs
(Do not overtorque screws)
*
**
Power Supply
Inputs (Inputs
are unipolar)
Access Holes for
Wiring
* CT, Voltage, Control Power, and Ground
* Communications and KYZ
Figure 4.1: Submeter Connections
4.3: Ground Connections
The meter's Ground Terminal (PE) should be connected directly to the installation's protective
earth ground.
4.4: Voltage Fuses
Eaton recommends the use of fuses on each of the sense voltages and on the control power, even
though the wiring diagrams in this chapter do not show them.
• Use a 0.1 Amp fuse on each Voltage input.
• Use a 3 Amp fuse on the power supply.
IM02601006E
www.eaton.com
4-3
IQ 150S/250S
4: Electrical Installation
4.5: Electrical Connection Diagrams
Choose the diagram that best suits your application. Make sure the CT polarity is
correct.
1. Three Phase, Four-Wire System Wye with Direct Voltage, 3 Element
a. Dual Phase Hookup
b. Single Phase Hookup
3. Three Phase, Four-Wire System Wye with Direct Voltage, 2.5 Element
4. Three-Phase, Four-Wire Wye with PTs, 3 Element
5. Three-Phase, Four-Wire Wye with PTs, 2.5 Element
6. Three-Phase, Three-Wire Delta with Direct Voltage (No PTs, 2 CTs)
7. Three-Phase, Three-Wire Delta with Direct Voltage (No PTs, 3 CTs)
8. Three-Phase, Three-Wire Delta with 2 PTs, 2 CTs
9. Three-Phase, Three-Wire Delta with 2 PTs, 3 CTs
10. Current Only Measurement (Three Phase)
11. Current Only Measurement (Dual Phase)
12. Current Only Measurement (Single Phase)
IM02601006E
www.eaton.com
4-4
IQ 150S/250S
4: Electrical Installation
1. Service: WYE, 4-Wire with No PTs, 3 CTs
A
B
C
N
Ic
Ib
Electronic Circuits
Ia
Ia Ia Ib Ib Ic Ic
(+) (-) (+) (-) (+) (-)
Va Vb Vc Vref L1 L2 PE
Power Supply Inputs
L2 is for Neutral
A
B
C
N
Select: "3 EL WYE" (3 Element Wye) in Meter Programming setup.
IM02601006E
www.eaton.com
4-5
IQ 150S/250S
4: Electrical Installation
1a. Dual Phase Hookup
A
B
C
N
Ic
Ib
Electronic Circuits
Ia
Ia Ia Ib Ib Ic Ic
(+) (-) (+) (-) (+) (-)
Va Vb Vc Vref L1 L2 PE
Power Supply Inputs
A
IM02601006E
B
C
N
www.eaton.com
4-6
IQ 150S/250S
4: Electrical Installation
1b. Single Phase Hookup
A
B
C
N
Ic
Ib
Electronic Circuits
Ia
Ia Ia Ib Ib Ic Ic
(+) (-) (+) (-) (+) (-)
Va Vb Vc Vref L1 L2 PE
Power Supply Inputs
A
IM02601006E
B
C
N
www.eaton.com
4-7
IQ 150S/250S
4: Electrical Installation
2. Service: 2.5 Element WYE, 4-Wire with No PTs, 3 CTs
A
B
C
N
Ic
Ib
Electronic Circuits
Ia
Ia Ia Ib Ib Ic Ic
(+) (-) (+) (-) (+) (-)
Va Vb Vc Vref L1 L2 PE
Power Supply Inputs
A
B
C
N
Select: "2.5 EL WYE" (2.5 Element Wye) in Meter Programming setup.
IM02601006E
www.eaton.com
4-8
IQ 150S/250S
4: Electrical Installation
3. Service: WYE, 4-Wire with 3 PTs, 3 CTs
A
B
C
N
Ic
Ib
Electronic Circuits
Ia
Ia Ia Ib Ib Ic Ic
(+) (-) (+) (-) (+) (-)
Va Vb Vc Vn L1 L2 PE
Power Supply Inputs
A
B
C
N
Select: "3 EL WYE" (3 Element Wye) in Meter Programming setup.
IM02601006E
www.eaton.com
4-9
IQ 150S/250S
4: Electrical Installation
4. Service: 2.5 Element WYE, 4-Wire with 2 PTs, 3 CTs
A
B
C
N
Ic
Ib
Ia
Ia Ia Ib Ib Ic Ic
(+) (-) (+) (-) (+) (-)
Va Vb Vc Vref L1 L2 PE
Power Supply Inputs
A
B
C
N
Select: "2.5 EL WYE" (2.5 Element Wye) in Meter Programming setup.
IM02601006E
www.eaton.com
4-10
IQ 150S/250S
4: Electrical Installation
5. Service: Delta, 3-Wire with No PTs, 2 CTs
A
B
C
Ia
Ic
Electronic Circuits
Ia Ia Ib Ib Ic Ic
(+) (-) (+) (-) (+) (-)
Va Vb Vc Vref L1 L2 PE
Power Supply Inputs
A
B
C
Select: "2 Ct dEL" (2 CT Delta) in Meter Programming setup.
IM02601006E
www.eaton.com
4-11
IQ 150S/250S
4: Electrical Installation
6. Service: Delta, 3-Wire with No PTs, 3 CTs
A
B
C
Ia
Ib
Ic
Electronic Circuits
Ia Ia Ib Ib Ic Ic
(+) (-) (+) (-) (+) (-)
Va Vb Vc Vref L1 L2 PE
Power Supply Inputs
A
B
C
Select: "2 Ct dEL" (2 CT Delta) in Meter Programming setup.
IM02601006E
www.eaton.com
4-12
IQ 150S/250S
4: Electrical Installation
7. Service: Delta, 3-Wire with 2 PTs, 2 CTs
A
B
C
Ia
Ic
Electronic Circuits
Ia Ia Ib Ib Ic Ic
(+) (-) (+) (-) (+) (-)
Va Vb Vc Vref L1 L2 PE
Power Supply Inputs
A
B
C
Select: "2 Ct dEL" (2 CT Delta) in Meter Programming setup.
IM02601006E
www.eaton.com
4-13
IQ 150S/250S
4: Electrical Installation
8. Service: Delta, 3-Wire with 2 PTs, 3 CTs
A
B
C
Ia
Electronic Circuits
Ib
Ic
Ia Ia Ib Ib Ic Ic
(+) (-) (+) (-) (+) (-)
Va Vb Vc Vref L1 L2 PE
Power Supply Inputs
A
B
C
Select: "2 Ct dEL" (2 CT Delta) in Meter Programming setup.
IM02601006E
www.eaton.com
4-14
IQ 150S/250S
4: Electrical Installation
9. Service: Current Only Measurement (Three Phase)
A
B
C
N
Ic
Ib
Electronic Circuits
Ia
Ia Ia Ib Ib Ic Ic
(+) (-) (+) (-) (+) (-)
Va Vb Vc Vref L1 L2 PE
20VAC
Minimum*
Power Supply Inputs
A
B
C
N
Select: "3 EL WYE" (3 Element Wye) in Meter Programming setup.
NOTE: Even if the meter is used for only Amp readings, the unit requires a Volts AN reference.
Please make sure that the Voltage input is attached to the meter. AC
Control Power can be used to provide the reference signal.
IM02601006E
www.eaton.com
4-15
IQ 150S/250S
4: Electrical Installation
10. Service: Current Only Measurement (Dual Phase)
A
B
N
Ib
Electronic Circuits
Ia
Ia Ia Ib Ib Ic Ic
(+) (-) (+) (-) (+) (-)
Va Vb Vc Vref L1 L2 PE
20VAC
Minimum*
Power Supply Inputs
A
B
N
Select: "3 EL WYE" (3 Element Wye) in Meter Programming setup.
NOTE: Even if the meter is used for only Amp readings, the unit requires a Volts AN reference.
Please make sure that the Voltage input is attached to the meter. AC
Control Power can be used to provide the reference signal.
IM02601006E
www.eaton.com
4-16
IQ 150S/250S
4: Electrical Installation
11. Service: Current Only Measurement (Single Phase)
A
N
Electronic Circuits
Ia
Ia Ia Ib Ib Ic Ic
(+) (-) (+) (-) (+) (-)
Va Vb Vc Vref L1 L2 PE
20VAC
Minimum*
A
Power Supply Inputs
N
Select: "3 EL WYE" (3 Element Wye) in Meter Programming setup.
NOTE: Even if the meter is used for only Amp readings, the unit requires a Volts AN reference.
Please make sure that the Voltage input is attached to the meter. AC
Control Power can be used to provide the reference signal.
IM02601006E
www.eaton.com
4-17
IQ 150S/250S
4: Electrical Installation
This page intentionally left blank.
IM02601006E
www.eaton.com
4-18
IQ 150S/250S
5: Communication
5: Communication Installation
5.1: IQ 150S/250S Communication
The IQ 150S/250S submeter provides a communication port plus a KYZ pulse output. The communication port, Com 2, provides RS485 or RJ45 Ethernet or WiFi Ethernet communication (see
Chapter 6 for Ethernet communication).
5.1.1: RS485 Communication Com 2 (485 Option)
The IQ 150S/250S submeter's RS485 port uses standard 2-Wire, half duplex architecture. The
RS485 connector is located on the front of the meter, under the cover. A connection can easily be
made to a Master device or to other slave devices, as shown below.
NOTE: Care should be taken to connect + to + and - to - connections.
Wireless Ethernet Connection
Electronic Circuits
JP2: Must be in
position 1-2 for
RS485 **
Ia Ia Ib Ib Ic Ic
(+) (-) (+) (-) (+) (-)
Va Vb Vc Vn L1 L2 PE
Z K Y + - SH
RS485
To Other
Devices
Pulse Contacts
IM02601006E
www.eaton.com
5-1
IQ 150S/250S
5: Communication
The IQ150S/250S submeter's RS485 connection can be programmed with the buttons on the face
of the meter or by using Eaton Meter Configuration software.
Standard RS485 Port Settings
Address: 001 to 247
Baud Rate: 9600, 19200, 38400 or 57600 Baud
Protocol: Modbus RTU, Modbus ASCII, or DNP 3.0
** The position of Jumper 2 (JP2) must be set for either RS485 or Ethernet communication. See
the figure below. You put the jumper on positions 2 and 3 for LAN (Ethernet) communication, and
on 1 and 2 for RS485 communication.
Electro Industries
/GaugeTech
14
7
7
7
8
8
8
13
WD
*0
13
23,!.
3ETTINGS
IM02601006E
www.eaton.com
5-2
IQ 150S/250S
5: Communication
5.1.2: KYZ Output
The KYZ pulse output provides pulsing energy values that verify the submeter's readings and
accuracy.
The KYZ Pulse Output is located on the face of the meter, under the cover and just below the
RS485 connection.
See Section 2.2 for the KYZ output specifications; see Section 7.4 for pulse constants.
Wireless Ethernet Connection
Electronic Circuits
Ia Ia Ib Ib Ic Ic
(+) (-) (+) (-) (+) (-)
Va Vb Vc Vn L1 L2 PE
Z K Y + - SH
RS-485
To Other
Devices
Pulse Contacts
IM02601006E
www.eaton.com
5-3
IQ 150S/250S
5: Communication
5.1.3: Ethernet Connection
In order to use the IQ 150S/250S submeter’s Ethernet capability, the Ethernet Module must be
installed in your meter, and the JP2 must be set to positions 2-3. You can use either wired
Ethernet, or WiFi.
For wired Ethernet, use Standard RJ45 10/100BaseT cable to connect to the IQ 150S/250S
submeter. The RJ45 line is inserted into the RJ45 port of the meter.
For WiFi connections, make sure you have the correct antenna attached to the meter.
Wireless Ethernet Connection
Ethernet Module
Electronic Circuits
JP2: Must be in
position 2-3 for
**
Ethernet (RJ45 or WiFi)
Ia Ia Ib Ib Ic Ic
(+) (-) (+) (-) (+) (-)
Va Vb Vc Vn L1 L2 PE
Z K Y + - SH
RS-485
To Other
Devices
Refer to Chapter 6 for instructions on how to set up the Network Module.
** See the JP2 figure and instructions on page 5-2.
IM02601006E
www.eaton.com
5-4
IQ 150S/250S
5: Communication
5.2: Meter Communication and Programming Overview
Programming and communication can utilize the RS485 connection shown in Section 5.1.1 or the
RJ45/WiFi connection shown in Section 5.1.3. Once a connection is established, Eaton Meter
Configuration software can be used to program the meter and communicate to other devices.
Meter Connection
To provide power to the meter, use one of the wiring diagrams in Chapter 4 or attach an Aux cable
to GND, L(+) and N(-).
The RS485 cable attaches to SH, - and + as shown in Section 5.1.1.
5.2.1: How to Connect to the Submeter
1. Open Eaton Meter Configuration software.
2. Click the Connect icon on the Icon bar.
The Connect screen opens, showing the Initial settings. Make sure your settings are the same as
those shown here, except for the IP Address field, which must be your device’s IP address. The
address shown here is the default Ethernet option address.
NOTE: The settings you make will depend on whether you are connecting to the meter via Serial
Port (screen on the left) or Network (screen on the right). Use the pull-down menus to make any
necessary changes.
IM02601006E
www.eaton.com
5-5
IQ 150S/250S
5: Communication
3. Click the Connect button on the screen.
NOTE: You may have to disconnect power, reconnect power and then click Connect.
The Device Status screen appears, confirming a connection.
4. Click OK.
5. The Eaton Meter Configuration software Main screen appears. Click the Profile icon in the Title
Bar.
6. You will see the IQ 150S/250S meter’s Device Profile screen.
NOTE: The following screens are for the IQ 150S. If you are connected to an IQ 250S, see
Section 5.2.3.
The tabs at the top of the screen allow you to navigate between settings screens (see below).
7. Click the Communications tab. You will see the following screen. Use this screen to enter communication settings for the meter's RS485 port (COM 2) Make any necessary changes to settings.
IM02601006E
www.eaton.com
5-6
IQ 150S/250S
5: Communication
8. Valid Communication Settings are as follows:
COM2
(RS485)
Address
(1-247)
Protocol
(Modbus RTU, Modbus ASCII or DNP)
Baud Rate
(9600 to 57600)
Response Delay
(0-750 msec)
9. When changes are complete, click the Update button to send the new profile to the meter.
10. Click Exit to leave the Device Profile or click other menu items to change other aspects of the
Device Profile (see following section for instructions).
IM02601006E
www.eaton.com
5-7
IQ 150S/250S
5: Communication
5.2.2: IQ 150S Submeter Device Profile Settings
NOTE: You can view this manual online by clicking Help>Contents from the Eaton Meter Configuration Software’s Main screen.
CT, PT Ratios and System Wiring (Scaling tab)
The screen fields and acceptable entries are as follows:
CT Ratios
CT Numerator (Primary): 1 - 9999
CT Denominator (Secondary): 5 or 1 Amp
NOTE: This field is display only.
CT Multiplier: 1, 10 or 100
Current Full Scale: Calculations based on selections. Click Recalculate to see the result of
changes.
PT Ratios
PT Numerator (Primary): 1 - 9999
PT Denominator (Secondary): 40 - 600
IM02601006E
www.eaton.com
5-8
IQ 150S/250S
5: Communication
PT Multiplier: 1, 10, 100, or 1000
Voltage Full Scale: Calculations based on selections. Click Recalculate to see the result of
changes.
System Wiring
3 Element Wye; 2.5 Element Wye; 2 CT Delta
Phases Displayed
A, AB, or ABC
NOTE: Voltage Full Scale = PT Numerator x PT Multiplier
Example:
A 14400/120 PT would be entered as:
PT Numerator:
1440
PT Denominator:
120
Multiplier:
10
This example would display a 14.40kV.
Example CT Settings:
200/5 Amps: Set the Ct-n value for 200, Ct-Multiplier value for 1
800/5 Amps: Set the Ct-n value for 800, Ct-Multiplier value for 1
2,000/5 Amps: Set the Ct-n value for 2000, Ct-Multiplier value for 1
10,000/5 Amps: Set the Ct-n value for 1000, Ct-Multiplier value for 10
Example PT Settings:
277/277 Volts: Pt-n value is 277, Pt-d value is 277, Pt-Multiplier is 1
14,400/120 Volts: Pt-n value is 1440, Pt-d value is 120, Pt-Multiplier value is 10
138,000/69 Volts: Pt-n value is 1380, Pt-d value is 69, Pt-Multiplier value is 100
345,000/115 Volts: Pt-n value is 3450, Pt-d value is 115, Pt-Multiplier value is 100
IM02601006E
www.eaton.com
5-9
IQ 150S/250S
5: Communication
345,000/69 Volts: Pt-n value is 345, Pt-d value is 69, Pt-Multiplier value is 1000
NOTE: Settings are the same for Wye and Delta configurations.
Energy and Display
The settings on this screen determine the display configuration of the meter’s
faceplate.
The screen fields and acceptable entries are as follows:
Power and Energy Format
Power Scale: Unit, kilo (k), Mega (M), or auto.
Energy Digits: 5, 6, 7, or 8
Energy Decimal Places: 0-6
Energy Scale: Unit, kilo (k), or Mega (M)
For Example: a reading for Digits: 8; Decimals: 3; Scale: k would be formatted:
00123.456k
Power Direction: View as Load or View as Generator
IM02601006E
www.eaton.com
5-10
IQ 150S/250S
5: Communication
Demand Averaging
Averaging Method: Block or Rolling
Interval (Minutes): 5, 15, 30, or 60
Sub Interval (if Rolling is selected): 1-4
Auto Scroll
Click to set On or Off.
Display Configuration:
Click Values to be displayed.
NOTE: You MUST select at least ONE.
NOTE: If incorrect values are entered on this screen the following message appears:WARNING:
Current, CT, PT and Energy Settings will cause invalid energy accumulator values.
Change the settings until the message disappears.
IM02601006E
www.eaton.com
5-11
IQ 150S/250S
5: Communication
Settings
The screen fields are as follows:
Password
NOTE: The meter is shipped with Password Disabled. There is NO DEFAULT
PASSWORD.
Enable Password for Reset: click to Enable.
Enable Password for Configuration: click to Enable.
Change Password: click to Change.
Device Designation: optional user-assigned label.
IM02601006E
www.eaton.com
5-12
IQ 150S/250S
5: Communication
5.2.3: IQ 250S Submeter Device Profile Settings
1. When you are connected to an IQ 250S meter and click Profile, you see the following screen.
The IQ 250S meter’s Profile screen features a Tree Menu on the left for Settings navigation,
and Buttons and a Title Bar that allow you to perform tasks, for example, updating the Device
Profile.
Selecting Settings
• The Tree Menu on the left side of the screen allows you to navigate between
Settings. The example screen pictured above shows the Tree Menu you see when you first
open the screen. Click on the + next to a Setting (for example, Revenue & Energy Settings)
to see additional Setting options.
• From the Tree Menu, click on the Setting you want to configure (for example, System Settings) to display its screen in the right side of the Device Profile screen.
IM02601006E
www.eaton.com
5-13
IQ 150S/250S
5: Communication
Performing Tasks
You can perform tasks from either the Device Profile screen Buttons or from the Title Bar.
The screen Buttons and their functions are as follows:
•·Update Device: Click to send the current settings to the meter.
NOTE: You must click the Update Device button after making changes to the Settings screens, if you want to update the connected meter’s
settings.
• Save Profile: Click to save the Device Profile settings to a file. You will see the Save
Programmable Settings window, shown below. Give a name to the Device Profile
and click Save.
IM02601006E
www.eaton.com
5-14
IQ 150S/250S
5: Communication
•·Load Profile: Click to load a previously saved Device Profile Settings file. You will
see the Load Programmable Settings window, shown below. Select the saved
Device Profile you want and click Open. The settings from that file will now appear in
the Settings screens; for example, the CT and PT Ratios will be those from the
saved Device Profile, rather than from the currently connected meter.
• View Report: Click to open a Notepad window containing the Device
Profile settings in a text file.
- Print the text file by selecting File>Print from the Notepad Title Bar.
- Save the text file by selecting File>Save from the Notepad Title Bar.
• Exit: Click to leave the Device Profile Editor.
2. Click the Communications tab. You will see the following screen. Use this screen to enter communication settings for the meter's RS485 port (COM 2) Make any necessary changes to settings.
IM02601006E
www.eaton.com
5-15
IQ 150S/250S
5: Communication
3. Valid Communication Settings are as follows:
COM2
(RS485)
Address
(1-247)
Protocol
(Modbus RTU, Modbus ASCII or DNP)
Baud Rate
(9600 to 57600)
Response Delay
(0-750 msec)
4. When changes are complete, click the Update Device button to send the new
profile to the meter.
5. Click Exit to leave the Device Profile or click other menu items to change other aspects of the
Device Profile (see following section for instructions).
IM02601006E
www.eaton.com
5-16
IQ 150S/250S
5: Communication
Additional Settings for the IQ250S
CT, PT Ratios and System Hookup
The screen fields and acceptable entries are as follows:
CT Ratios
CT Numerator (Primary): 1 - 9999
CT Denominator (Secondary): 5 or 1 Amp
NOTE: This field is display only.
CT Multiplier: 1, 10 or 100
Current Full Scale: Calculations based on selections. Click Recalculate to see the result of
changes.
PT Ratios
PT Numerator (Primary): 1 - 9999
PT Denominator (Secondary): 40 - 600
IM02601006E
www.eaton.com
5-17
IQ 150S/250S
5: Communication
PT Multiplier: 1, 10, 100, or 1000
Voltage Full Scale: Calculations based on selections. Click Recalculate to see the result of
changes.
System Wiring
3 Element Wye; 2.5 Element Wye; 2 CT Delta
Phases Displayed
A, AB, or ABC
NOTE: Voltage Full Scale = PT Numerator x PT Multiplier
Example:
A 14400/120 PT would be entered as:
PT Numerator:
1440
PT Denominator:
120
Multiplier:
10
This example would display a 14.40kV.
Example CT Settings:
200/5 Amps: Set the Ct-n value for 200, Ct-Multiplier value for 1
800/5 Amps: Set the Ct-n value for 800, Ct-Multiplier value for 1
2,000/5 Amps: Set the Ct-n value for 2000, Ct-Multiplier value for 1
10,000/5 Amps: Set the Ct-n value for 1000, Ct-Multiplier value for 10
Example PT Settings:
277/277 Volts: Pt-n value is 277, Pt-d value is 277, Pt-Multiplier is 1
14,400/120 Volts: Pt-n value is 1440, Pt-d value is 120, Pt-Multiplier value is 10
138,000/69 Volts: Pt-n value is 1380, Pt-d value is 69, Pt-Multiplier value is 100
345,000/115 Volts: Pt-n value is 3450, Pt-d value is 115, Pt-Multiplier value is 100
IM02601006E
www.eaton.com
5-18
IQ 150S/250S
5: Communication
345,000/69 Volts: Pt-n value is 345, Pt-d value is 69, Pt-Multiplier value is 1000
NOTE: Settings are the same for Wye and Delta configurations.
Time Settings
Use this setting to enable or disable Daylight Savings Time for the IQ 250S, and to set the beginning and ending times for Daylight Savings Time. You can also set the Time Zone and enable
Clock Sync if supported by your meter.
1. From the Tree Menu, click General Settings>Time Settings.
2. Check or uncheck the box to Enable or Disable Daylight Savings time.
3. Use the entry fields to set the start and end times for the Daylight Savings Time feature, if
enabled. Select the values you want from the Month, Week, Day of the Week, and Hour fields.
4. Select the time Zone and Clock Sync options from the pull-down menus.
NOTE: The Hour field uses a 24-Hour clock.
IM02601006E
www.eaton.com
5-19
IQ 150S/250S
5: Communication
System Settings
From the Tree Menu, click General Settings>System Settings. From this screen, you can do the
following:
• Enable or Disable Password for Resetting and/or Configuration: click the radio
button next to Yes or No. Enabling Password protection prevents unauthorized tampering with
devices.
IMPORTANT! You must set up a password before enabling Password Protection. Click the
Change button next to Change Password if you have not already set up a password.
When you click the Change button next to Change Password in the Settings screen, you will see
the Enter the New Password screen.
1. Type in the new password (0 - 9999).
IM02601006E
www.eaton.com
5-20
IQ 150S/250S
5: Communication
2. Retype the password.
3. Click Change. The new password is saved and the meter restarts.
NOTE: If Password Protection has already been enabled for configuration and you attempt to
change the password, you will see the Enter Password screen (shown below) after you click
Change. Enter the old password and click OK to proceed with the password change.
You can enable or disable a Password for Resetting (Reset Max/Min Energy Settings) and Configuration (Device Profile) in the Systems Settings screen (see previous page).
NOTE: If you enable a Password for Resetting, you must also enable it for Configuration.
IMPORTANT! You must set up a password before enabling Password Protection. Click the
Change button next to Change Password if you have not already set up a password and follow the
above instructions.
When anyone attempts to make a change that is under Password protection, the Enter Password
screen opens. (See the example screen above.) If the correct Password is not entered, the change
does not take place.
IM02601006E
www.eaton.com
5-21
IQ 150S/250S
5: Communication
Display Configuration
The settings on this screen determine the display configuration of the meter’s
faceplate.
The screen fields and acceptable entries are as follows:
• Phases Displayed: A; A and B; A, B, and C. This field determines which phases
display on the faceplate. For example, if you select A and B, only those two phases
will be displayed on the faceplate.
• Auto Scroll Display: Yes or No. This field enables or disables the scrolling of selected
readings on the faceplate. If enabled, the readings scroll every 5 seconds.
• Enable on Face Plate of Display: Check the boxes of the Readings you want
displayed on the faceplate of the meter. You must select at least one reading.
• Power Direction: View as Load or View as Generator
• Flip Power Factor Sign: Yes or No.
• Current Display Auto-Scale: On or Off (no decimal places)
IM02601006E
www.eaton.com
5-22
IQ 150S/250S
5: Communication
• Load Bar Custom Configuration: Click this bar to add Current scaling. Additional
fields open on the screen - see the figure below.
Enter the Current scale you want to use, The Primary Full Scale field will reflect your entry (as it
says on the screen, Primary Full Scale Current for the Load Bar is equal to the Current scale
multiplied by the CT multiplier.
Energy, Power Scaling, and Averaging
Use this setting to configure:
• The display of Power in the meter
• The display and storage of Energy in the meter
• The interval over which Average values are computed.
Functional Overview of Energy Settings and Averaging
Energy Scaling
Energy Setting includes:
• Digits (the number of digits in the reading)
• Decimals (the number of decimal places in the reading)
• Energy Scale: the scale of the reading – unit; kilo (number times 1000); Mega (number times 1
million).
Energy settings allow you to balance the resolution (or accuracy) of the energy stored, with the
interval over which energy rollover occurs. For example, the maximum resolution for a k scale
reading is: 99999.999k.
IM02601006E
www.eaton.com
5-23
IQ 150S/250S
5: Communication
To calculate the speed at which the energy will rollover, you must know the Energy Full Scale,
which is computed from the CT and PT Full Scale values (see Section 9.2.4.1). The formula for
calculating Energy Full Scale is:
Wye system: CT Full Scale x PT Full Scale x 3
Delta system: CT Full Scale x PT Full Scale x 3 x 3
For example, for a CT Full Scale of 2000, PT Full Scale of 14400, Wye system:
2000 x 14400 x 3=86400000
In this example, the energy will increment at 86400000 Watts per hour, or 24000 Watts per second.
This value allows you to determine the number of digits, decimal places, and energy scale you
want to configure for the Energy settings, when you take into account the rollover time. To determine the number of hours before rollover, use this formula:
[Max Resolution]/[Full Scale] = #Hours, where Max Resolution = maximum digits and decimals for
the Energy scale in use.
Using the example from above, with an energy scale of Mega, the formula would be:
99999.999 M/86.4 M = 1157.4074 hours or about 48 days until rollover.
NOTE: To increase the number of days until rollover, you can:
• Increase the number of digits (to 8)
• Decrease the number of decimal places (to 0)
• Increase the Energy Scale (to M).
Demand Averaging
Demand is the average rate of energy use over time. The IQ 250S supports two types of demand
averaging: Fixed demand and Sliding demand:
• Fixed demand records the average demand for time intervals that you define (usually 5, 15 or 30
minutes).
IM02601006E
www.eaton.com
5-24
IQ 150S/250S
5: Communication
• Sliding demand functions like multiple, overlapping Fixed demand. You define the subintervals
at which an average of demand is calculated. An example of Sliding demand would be a 15minute Demand block using 5-minute subintervals, thus providing a new demand reading every
5 minutes, based on the last 15 minutes.
From the Tree Menu, click Energy Settings> Energy, Power Scaling, and Averaging.
The screen fields and acceptable entries are as follows:
• Energy Settings
Energy Digits: 5; 6; 7; 8
Energy Decimal Places: 0 - 6
Energy Scale: unit; kilo (K); Mega (M)
For example: a reading for Digits: 8; Decimals: 3; Scale: K would be formatted:
00123.456k
IM02601006E
www.eaton.com
5-25
IQ 150S/250S
5: Communication
NOTE: Your selection in the Energy Settings fields determines the precision of energy stored
for display and polling. Refer to the Functional Overview at the beginning of this section for
more information.
• Power Settings:
Power Scale: Auto; unit; kilo (K); Mega (M)
Apparent Power (VA) Calculation Method: Arithmetic Sum or Vector Sum
• Demand Averaging:
Type: Fixed or Sliding
Interval (Fixed demand) or Sub-Interval (Sliding demand) in minutes: 5; 15; 30; 60
Number of Subintervals: 1; 2; 3; 4
Interval Window: This field is display only. It is the product of the values entered in the SubInterval and Number of Subintervals fields.
NOTE: You will only see the Number of Subintervals and Interval Window fields if
you select Sliding Demand.
IM02601006E
www.eaton.com
5-26
IQ 150S/250S
5: Communication
Transformer/Line Loss Compensation
Transformer/Line Loss Compensation allows you to add or subtract losses to meter registration.
From the Tree Menu, click Revenue & Energy Settings>Transformer/Line Loss
Compensation.
This screen displays the current values for the meter's Transformer Loss Compensation. The
screen fields and acceptable entries are as follows
• Percent Loss of Watts due to Iron and Copper/Positive Watts and Negative Watts
• Percent Loss of VARS due to Iron and Copper/Positive and Negative Watts
• Drop-down menu #1. Choose from: Disabled, Fe Only, Cu Only, Both Fe and Cu.
• Drop-down menu #2. Choose from: Add to Watts and VAR; Add to Watts and Subtract from VAR;
Subtract from Watts and Add to VAR; Add to Watts and VAR; Subtract from Watts and VAR.
1. Click TLC Calculator to find the values to enter into the Percent Loss fields. The TLC Calculator
button launches an Excel Spreadsheet that makes the calculations for you once you enter the
required data.
WARNING! Eaton Meter Configuration Software automatically launches the Excel Spreadsheet
IM02601006E
www.eaton.com
5-27
IQ 150S/250S
5: Communication
when you click the TLC Calculator button. If you do not have Excel software installed on your
computer, a Warning message is displayed instead of the worksheet.
EXCEL NOTE: For most Excel users, the spreadsheet does run until you give the application permission to run the Macros contained in the sheet. You give permission by changing the Excel
Security Setting from High to Medium, as follows:
a. From the Excel toolbar, click Tools>Security>Options.
b. On the Security Tab page, click the Macro Security button.
c. Select Medium Security.
4. Enter the percent Loss of Watts and VARS for copper and iron in the appropriate fields.
IM02601006E
www.eaton.com
5-28
IQ 150S/250S
5: Communication
Configuring Limits (IQ 250S)
Use this screen to assign Limits for the meter.
Functional Overview for Limits:
Limits are transition points used to divide acceptable and unacceptable measurements. When a
value goes above or below the limit, an out-of-limit condition occurs. You can set and configure up
to eight Limits for the IQ 250S meter.
Once they are configured, you can view the out-of-Limits (or Alarm) conditions in the Limits Polling
screen.
You can assign the eight limits to readings from three groups of parameters:
• Readings (Instantaneous Voltage; Instantaneous Current; Total and Per Phase Power and
Power Factor; Frequency; and Neutral Current)
• Demand (Current; Per Phase, Total Power and Power Factor)
From the Tree Menu, click Power Quality and Alarm Settings>Limits.
The current settings for Limits are shown in the screen.
IM02601006E
www.eaton.com
5-29
IQ 150S/250S
5: Communication
The bottom of the screen shows the Full Scale values for:
• Voltage
• Current
• Frequency
• Power
• Power Total
• Power Factor
• Phase Angles
1. Select a limit by double-clicking on the Assigned Channel field.
2. You will see the screen shown below.
Select a Group and an Item for the Limit.
3. Click OK.
4. To Configure a Limit, double-click on the Field to set the following values:
• Above and Below Setpoint:% of Full Scale (the point at which the reading goes out of limit)
Examples:
100% of 120V Full Scale = 120V
90% of 120V Full Scale = 108V
• Above and Below Return Hysteresis: the point at which the reading goes back within limit
(see figure below)
IM02601006E
www.eaton.com
5-30
IQ 150S/250S
5: Communication
Examples:
Above Setpoint = 110%; Below Setpoint = 90%
(Out of Limit above 132V);(Out of Limit below 108V)
Above Return Hysteresis = 105%; Below Return Hysteresis = 95%
(Stay out of Limit until below 126V)(Stay out of Limit until above 114V)
+ MEASURED VALUE
Above Limit
condition
Above Limit Trigger point
HYSTERESIS
Return point from Above Limit condition
Return point from Below Limit condition
HYSTERESIS
Below Limit Trigger point
Below Limit
condition
0
TIME
- MEASURED VALUE
(if applicable)
NOTES:
• The Primary fields are display only. They show what the set point and return
Hysteresis value are for each limit.
• If the Above Return Hysteresis is greater than the Above Set Point, the Above Limit is Disabled;
if the Below Return Hysteresis is less than the Below Set Point, the Below Limit is Disabled. You
may want to use this feature to disable either the Above Limit or Below Limit condition for a
reading.
• If you are entering negative limits, be aware that the negative value affects the way the above
and below limits function, since negative numbers are processed as signed values.
IM02601006E
www.eaton.com
5-31
IQ 150S/250S
5: Communication
Configuring Historical Logs (IQ250S)
Use this setting to select the parameters to be stored in each of the IQ 250S meter's three Historical Logs.
Functional Overview of Historical Logs:
Having three historical logs affords you the flexibility of programming each log with unique parameters. For example, you might program Historical Log 1 to record Power Quality parameters (for
example, Limits/Alarms), Log 2 to record Demand parameters, and Log 3 to record Energy parameters.
Historical Log parameters can be selected from eight groups:
• Measured Values (Instantaneous Voltage; Instantaneous Current; Total and Per Phase Power
and Power Factor; Frequency; Neutral Current; Symmetrical
Components and Voltage Unbalances)
• Demand (Current; Per Phase, Total Power and Power Factor)
• Maximums (Maximum values for all of the readings listed above)
• Minimums (Minimum values for all of the readings listed above)
• Energy (Watt-hours, VA-hours, VAR-hours)
• Short Term Min (Min value within the Demand Interval)
• Short Term Max (Max value within the Demand Interval)
• Uncompensated ((Watt-hours, VA-hours, VAR-hours)
IM02601006E
www.eaton.com
5-32
IQ 150S/250S
5: Communication
From the Tree Menu, click Trending Profiles>Historical Log Profile (1-3).
This screen lets you select items to be stored in the historical log you selected. The Group field
determines the items that are available for selection.
1. Select a Group. The possible selections are: Measured Values, Demand, Maximums, Minimums, Energy, Short Term Min, Short Term Max, and Uncompensated.
2. Select items for your log:
a. Highlight the item(s) you want in the Selectable Items box.
b. Click Add. The item(s) are added to the Selected Items box.
c. To remove item(s), highlight them in the Selected Items box and click Remove.
4. Set the Logging Interval (Minutes). The available choices are: 1, 3, 5, 10, 15, 30, 60. The Logging Interval determines when the meter takes a snapshot.
NOTE: There are two display fields at the bottom of the Historical Log Profile screen. They show
the Total Bytes Used and the Bytes Remaining for this historical log. These fields are updated as
IM02601006E
www.eaton.com
5-33
IQ 150S/250S
5: Communication
you make selections on the screen. The total number of bytes available per log record is approximately 234.
Configuring Historical Log Sectors (IQ250S)
Use this setting to increase or decrease the amount of records each of the IQ 250S meter's three
Historical logs can store, and the duration each log can run, before becoming filled.
From the Tree Menu, click Trending Profiles>Historical Log Sectors.
The screen shows the current space allocation for the meter's Historical logs, including:
• The number of bytes allocated to each log
• The number of records available for each log
• The duration of each log
To change the current allocation for a log:
1. Click on one of the double yellow lines dividing the individual logs.
IM02601006E
www.eaton.com
5-34
IQ 150S/250S
5: Communication
2. You will see a line with arrows on each side. Drag the line in either direction to increase or
decrease the log allocation. The display fields for the logs will reflect any changes you make to
the allocation.
Viewing Log Status/Retrieving Logs (IQ 250S)
Follow these steps to view Log status and/or retrieve logs.
1. Click Logs>Statistics or Logs>Retrieve Log(s) from Device from the Title bar (or click the Log
Status or Retrieve Logs icons). You will see the screen shown below.
2. This screen shows the following information for all of the IQ 250S meter’s logs:
• % in Use - the amount of the log that is currently being used
• # of Records - the number of records currently in the log
• Max Records - the maximum number of records the log can hold
• Record Size - the current record size in Bytes
• Newest Record - the date and time stamp of the most recent record in the log
• Logging Started - the date and time that logging began
• Retrieve Log - a checkbox that lets you select log retrieval
• Status - whether the log is Available or Not Available for retrieval
3. To retrieve a log, click its Retrieve Log checkbox.
NOTE: The System Events log is always retrieved when a log is retrieved: its box is always
checked.
IM02601006E
www.eaton.com
5-35
IQ 150S/250S
5: Communication
4. Use the pull-down menu for Retrieval Mode to select one of two options:
• Partial Retrieval (this is the default Retrieval mode)
• Time Range Retrieval
NOTES:
• In Partial Retrieval mode, only the newest records are retrieved. This increases
retrieval speed, since records that have previously been retrieved are ignored. When
the log is full, it will roll over. Partial Retrieval mode should be used for Billing and
continuous logging.
• The Time Range Retrieval mode is useful if you want to retrieve specific events. If
you select Use Time Range from the pull-down menu, date range fields will display,
allowing you to select the time range for data retrieval. Only records (within the specified time range) that are newer than the latest records in the log database can be
retrieved for any selected logs. For this reason, Time Range Retrieval should not be
used for Billing or continuous logging purposes. The only way to retrieve earlier
records using Time Range Retrieval is to delete the existing log database(s) before
retrieving the log(s).
5. Click Retrieve.
a. You will see a screen that shows the percent retrieved for each log, the time elapsed since
retrieval began, and any messages.
b. After the logs have been retrieved, you will see a screen which shows you the Mode, Start
time, and Status of Log Conversion.
c. The Log Viewer opens.
NOTES:
• Only one person at a time can download a log. If someone else is downloading a log, it will be
unavailable until the download is complete.
• Retrieve logs as often as you want. Each time you retrieve a log file, Eaton Meter
Configuration Software appends only the newest records and captures to the existing database.
IM02601006E
www.eaton.com
5-36
IQ 150S/250S
5: Communication
Using the Log Viewer (IQ 250S)
To access Log Viewer, either:
• Retrieve logs from a connected meter, as shown in the previous section.
• Click the Open Log icon from the Eaton Meter Configuration Software’s Main screen. The
Retrieved Logs directory opens, allowing you to pick a previously stored log file.
• Run Log Viewer from the Windows® Start menu.
You will see the Log Viewer’s main screen, shown below.
1. Choose the log data file(s) you want to view in either of the following ways:
• If you have retrieved logs through Eaton Meter Configuration Software, the meter’s designated label is shown in the field above the Meter 1 button. Click the Log’s button on the right
side of the screen to view a log. (The buttons of unavailable logs are grayed out and
unselectable.)
IM02601006E
www.eaton.com
5-37
IQ 150S/250S
5: Communication
• If you want to view a previously retrieved log, click either Meter button (1 or 2). Log Viewer
opens a window prompting you to select a log database (.db). See the example screen
below.
2. Select the file you want and click Open.
NOTE: You can choose a different log file (.db) for Meter 1 and for Meter 2.
3. Select the data points you want to view by clicking the Data Points button in Log Viewer’s Main
screen. You will see the screen shown below. Note that the number of data points you see
reflects the number of parameters in the log.
IM02601006E
www.eaton.com
5-38
IQ 150S/250S
5: Communication
4. From the Available Data Points column, click on the data points you want to include when viewing the log file.
• To select multiple points, hold down the Ctrl key while clicking.
• To select points in sequence, hold down the Shift key while clicking.
• Click the Add button to move the Data Points to the Selected Data Points column.
• Click the Restore button to return the selection to its previous setting.
5. When you finish your selection, click OK to return to Log Viewer’s main screen.
6. Select the portion of the log you want to view by specifying a time range. Log Viewer bases its
time/date format on your computer’s Regional Settings (Windows® Control Panel). Click the
Time Range button. You will see the following screen.
• To select a specific time range, click the Between radio button and enter a date and time in
each field. You can also the arrows to open a calendar for the date and to increment the time
field.
• To select a range of hours, days, months or years only, click the appropriate radio button and
use the arrows to select the range.
IM02601006E
www.eaton.com
5-39
IQ 150S/250S
5: Communication
7. Click OK. The time range you selected is displayed in the Log Viewer’s main screen.
8. Click on the Historical Trends button or View Data>Snapshots. Log Viewer displays trending
data for the selected log file based on the time range and data points you chose. See the example screen shown below.
• The name of the log file and the type of data point are listed in the top row.
• You can move the columns, so that the most important data is most accessible. Right-click on
the column title and drag it to the desired location on the table.
• To save the data to your clipboard, right-click with the cursor positioned anywhere in the table.
IM02601006E
www.eaton.com
5-40
IQ 150S/250S
5: Communication
• To sort the data by Date/Time or data point, in either ascending or descending order, click the
Sort button and use the pull-down menus to make your selection. See the screen shown
below.
9. To display Trending data as either an XY, Circular, or Advanced graph, click the Graph button.
You will see the following screen.
The Available Items column lists the log’s data points. (To add a new data point, return to Log
Viewer’s main screen and click the Data Points button.)
a. Click on the data points you want to graph.
b. Click the Add button. The items appear in the Graph Items column.
IM02601006E
www.eaton.com
5-41
IQ 150S/250S
5: Communication
• To select multiple data points, hold down the Ctrl key while clicking.
• To select data points in sequence, hold down the Shift key while clicking.
NOTE: Only six data points in total can be graphed at one time. If there are two
open log files, you can only select three data points per file.
c. To view the graph, click either the Circular, XY, or Advanced Graph buttons. See the example
graphs below and on the next page.
Circular Graph
IM02601006E
www.eaton.com
5-42
IQ 150S/250S
5: Communication
XY Graph
Advanced Graph
IM02601006E
www.eaton.com
5-43
IQ 150S/250S
5: Communication
The following instructions pertain to all of the graphs:
• To change the starting point of the graph, choose a new date/time segment from the Starting
Date/Time to View pull-down menu.
• To change the amount of time represented on the graph, enter a value in the Number of Days to
View field and press Enter or click on the Redraw button.
• To change the scale of the graph, enter a value in the Minimum Value and Maximum Value fields
and press Enter or the Redraw button.
• To view one sample at a time, click in the Move by Sample box; then click on the Forward or
Reverse buttons each time you would like to view the next (or previous) sample.
• To view a continuous, sample-by-sample rendering of the graph, click the Move by Sample box
and the Auto Show box. Select a speed by sliding the Auto Show Speed bar left or right; click on
the Forward or Reverse buttons to determine the direction of the Auto Show. To stop Auto
Show, deselect the Auto Show box.
• To print the graph on a color printer, check the Color Printout box and click Print.
• To print the graph on a black-and-white printer, click the Use Symbols box and click Print.
• To copy the graph data to the computer’s clipboard, select Copy from the File menu. Paste the
data into a spreadsheet, such as Excel®.
• To export the graph’s data, select Export Data from the File menu.
• To change the graph’s color assignments, select Select Colors from the Options menu. You will
see the screen shown on the next page.
IM02601006E
www.eaton.com
5-44
IQ 150S/250S
5: Communication
NOTES:
• The Advanced Graph also has a Color button which opens the Color Assignments
screen.
• The Color Assignments screen is slightly different for the Advanced Graph.
• The small squares under the Color heading represent the color currently
assigned to each component of the graph.
• To make adjustments to an Item’s color, click the radio button beside it and create a
new color by moving the red, green and blue sliders. Create black by moving all sliders down, white by moving all sliders up. The large square on the right shows the
color you have created.
• Click OK to return to the graph; Log Viewer redraws the graph using the new color
scheme.
• Click the Restore button to return all color schemes to their default
values.
10.When you are finished using the Log Viewer, click the X button or File>Exit to close the screen.
NOTE: You can also view the Limits log (listing any alarms) and System Events log (listing firmware changes, logging start and stop times, Runtime start, stop, and end times, resets, change
of meter’s programmable settings and other system events.) From the Log Viewer’s Main
screen:
IM02601006E
www.eaton.com
5-45
IQ 150S/250S
5: Communication
• Click the Out of Limit button to view the Limits log (you need to download this log or select an
already downloaded log first. See the instructions beginning on page 5-35).
• Click the System Events button to view the System Events log.
IM02601006E
www.eaton.com
5-46
IQ 150S/250S
5: Communication
5.2.4: Polling the IQ 150S/250S Submeter
The Real Time Poll features of Eaton Meter Configuration software are used to continuously view
instantaneous values within an IQ 150S/250S meter. The software provides tabular views of
metered values, circuit measurements, interval data, and pulse data.
The Real Time Poll features are divided into three groups, accessed by clicking Real-Time Poll in
the Title Bar:
• Real Time Readings
• Revenue, Energy and Demand Readings
• Power Quality
When you click Real Time Readings; Revenue, Energy and Demand Readings; and Power Quality, you will see a sub-menu that allows you to select individual polling screens.
NOTE: Clicking the Polling icon on the Title Bar is the same as selecting Instantaneous Polling
from the Real-Time Poll>Real Time Readings menu; clicking the Phasors icon on the Title Bar is
the same as selecting Phasors from the Real-Time Poll>Power Quality menu.
IM02601006E
www.eaton.com
5-47
IQ 150S/250S
5: Communication
Instantaneous Polling
Click Real-Time Poll>Real Time Readings>Instantaneous Polling. You will see the screen shown
below.
NOTE: This screen capture is for an IQ 150S meter. If you are connected to an IQ 250S meter you
won’t see the THD% section of the screen.
• Click Print to print a copy of the screen.
• Click Help to view instructions for this screen.
• Click OK to return to the main screen.
IM02601006E
www.eaton.com
5-48
IQ 150S/250S
5: Communication
Poll Max and Min Readings
Click Real-Time Poll>Real Time Readings>Poll Max and Min Readings. You will see the screen
shown below.
This screen displays the maximum and minimum values and the time of their
occurrence for all of the IQ 150S/250S Real-Time readings. Use the scroll bar to view readings not
displayed on the screen.
• Click Copy to copy the readings to the clipboard. You can then paste them into another document, for example, an Excel file.
• Click OK to close the screen.
IM02601006E
www.eaton.com
5-49
IQ 150S/250S
5: Communication
Uncompensated and Short Term Max and Min Readings
Click Real-Time Poll>Real Time Readings>Uncompensated and Short Term Max and Min Readings. You will see the screen shown below.
The initial display shows the uncompensated readings for the meter. Click the Short Term Maximum and Minimum Voltages to see those readings.
• Click Copy to copy the readings to the clipboard. You can then paste them into another document, for example, an Excel file.
• Click Close to close the screen.
IM02601006E
www.eaton.com
5-50
IQ 150S/250S
5: Communication
Power and Energy
Click Real-Time Poll>Revenue, Energy and Demand Readings>Power and Energy. You will see
the screen shown below.
This screen displays the power and energy for Total power and all three phases.
1. Click the tabs at the top of the screen to select the view you want:
• Total
• Phase A
• Phase B
• Phase C
2. Click Print to print the readings.
3. Click OK to close the screen.
IM02601006E
www.eaton.com
5-51
IQ 150S/250S
5: Communication
Poll Phasors
Click Real Time Poll>Power Quality>Phasors. You will see the screen shown below.
The Phasors screen displays the Phase relationships of the currently connected meter.
1. To adjust the Phasor display, click Options at the bottom of the screen.You will see the screen
shown below.
IM02601006E
www.eaton.com
5-52
IQ 150S/250S
5: Communication
a. In the Display Angles Increasing and Phasor Rotation boxes, select either Clockwise or
Counter Clockwise.
b. From the pull-down menu at the bottom of the screen, select Vectors, Triangles, or Vectors
and Triangles to change the graphic representation of the data.
2. Click OK to save your selections and return to the Phasors screen.
3. From the Phasors screen:
• Click Copy to save a copy of the screen to the clipboard.
• Click Print to send a copy of the graph to a printer.
• Click Help to view instructions for this screen.
4. Click OK to return to the main screen.
IM02601006E
www.eaton.com
5-53
IQ 150S/250S
5: Communication
Poll Limits (IQ 250S)
Click Real-Time Poll>Power Quality and Alarms>Limits. You will see the screen shown below.
This screen shows the current status of any Limits programmed in the Device Profile.
NOTE: See instructions for configuring Limits, earlier in this chapter.
1. The displayed fields are:
• Limit ID – the identification of the limit
• Label - the item the Limit is set for
• Value – the current reading for this item
• Status/Limit1/Limit2 – whether the current reading is “In” or “Out” for the Above
(Limit 1) and Below (Limit 2) Setpoints
• Limit 1/Setting/Point/Hysteresis – Above: the point above which the reading
goes out of limit (Setpoint) and the point at which it returns to within limit
(Hysteresis)
• Limit 2/Setting/Point/Hysteresis – Below: the point below which the reading goes
out of limit (Setpoint) and the point at which it returns to within limit
(Hysteresis).
2. Click Print to print the screen.
3. Click OK to close the screen.
IM02601006E
www.eaton.com
5-54
IQ 150S/250S
5: Communication
5.2.5: Using the IQ 150S/250S Tools Menu
The Tools Menu allows you to access specific functions for the IQ 150S/250S meter. Click Tools
from the Title Bar to display the Tools Menu.
Accessing the Device Profile Screen
Click the first option, Edit Current Device Profile, to open the Device Profile screen. This menu
option performs the same function as clicking the Profile icon in the Title Bar.
Setting Device Time
Click Tools>Set Device Time. You will see the screen shown below.
This screen allows you to set the meter’s internal clock and/or synchronize it to your
PC’s time. The meter’s clock is used for logging and other time retrieval purposes.
• You can enter a new Month, Day, and Year in the Date fields.
• Check the box next to Use PC Time to synchronize the meter to your PC; uncheck the box if
you want to reset the time manually. You can then enter the Hour, Minute, and Seconds you
want in the Time fields.
IM02601006E
www.eaton.com
5-55
IQ 150S/250S
5: Communication
• Click Send to send the new date and/or time to the meter; click Cancel to close
the screen.
Retrieving Device Time
Click Tools>Retrieve Device Time. You will see the screen shown below.
This screen displays the meter’s internal time. If Daylight Savings Time is enabled, ‘DST’ displays
in one of the fields to the right of the Time field.
Click OK to close the screen.
Reset Device Information
Click this option to reset Max/Min values. You will see the screen shown below. Click the checkbox
and click Reset to reset max/min values; click Cancel to close the screen without resetting.
Retrieve Device Status
IM02601006E
www.eaton.com
5-56
IQ 150S/250S
5: Communication
Click this option to see the Device status screen for the meter. this is the same screen that displays when you first connect to the meter.
Flash Update Firmware
Click this option to upgrade the meter’s firmware. You will see the screen shown below.
1. Click Browse to locate the flash file.
2. Click OK to update the firmware with the flash file.
3. When flashing is complete, click Exit to close the screen.
NOTE: Flash updating of firmware can only be done at a Baud Rate of 57600.
IM02601006E
www.eaton.com
5-57
IQ 150S/250S
5: Communication
5.2.6: Performing Other Tasks with Eaton Meter Configuration
Software
The following sections contain instructions for other tasks you can perform using the Eaton Meter
Configuration software.
Connection Manager
Use Connection Manager to add or remove connection locations and/or devices at locations.
1. Click Connection>Connection Manager or click on the Connect Mgr icon. You will see the
screen shown below.
List of Locations:
On the left side of the Connection Manager screen is a List of Locations. These are the locations
of one or more meters to which you can connect. You can add a location and/or a device; edit a
location and/or device; or remove a location and/or device.
• To add a location:
IM02601006E
www.eaton.com
5-58
IQ 150S/250S
5: Communication
a. Click the Add button. You will see the Connection Manager Location Editor screen. On this
screen, you program the Communication settings for each
new location.
b. Type a name for the new location.
c. Click Serial Port or Network.
d. Enter Communication settings:
• Com Port: COM 1 - 99
• Baud Rate: 1200 - 115200
• Flow Control: None or Hardware
• Data Bits: 8 (or 7)
• Parity: None (Even, Odd)
e. To add a device:
IM02601006E
www.eaton.com
5-59
IQ 150S/250S
5: Communication
- Click Add Serial (to add a Serial Port connected device) or Add Net (to add a
Network connected device) in the Devices at Location box. You can add up to
255 devices (Serial Port and/or Network connected) at one location.
NOTES:
• All devices must have the same connection parameters: Baud, Parity and Flow Control.
• Multiple devices slow down polling.
• If you are connecting to a device through the Power Xpert® Gateway, the protocol
must be Modbus TCP.
f. To edit a device:
- Select the device from the Devices at Location box. (Scroll down to find all
devices.)
- Click Edit. You will see the Connection Manager Location Device Editor screen,
shown below.
- Use this screen to program the device properties for each device at a location.
If the device has a Serial Port device connection, you will see the example
screen on the left; if the device has a Network device connection, you will see
the example screen on the right.
NOTE: Click the Network or Serial button at the top of the screen to switch
connection screens.
- Enter Device Properties:
IM02601006E
www.eaton.com
5-60
IQ 150S/250S
5: Communication
• Address: 1 - 247 (Unique Address)
• Name: Device Name
• Description: (Type and Number, for example)
• Protocol: Modbus RTU, ASCII, or Modbus TCP
• Device Type: IQ Meter
• Comm Port: 1 or 2 (Serial Port Only)
• IP Address:100.10.10.10 (for example) (Network Only)
• Port Number:502 (Default) (Network Only)
- Click Close to save settings and return to the Connection Manager Location
Editor screen.
g. To remove a device, select the device from the Devices at Location box and
click
Remove.
h. Click Close to return to the Connection Manager screen.
• To edit a location:
a. Select a location from the List of Locations box.
b. Click the Edit button. The Connection Manager Location Editor screen appears, displaying
the current settings for the location.
c. Make any changes to settings and/or devices at the location.
d. Click Close to exit the screen.
• To remove a location:
a. Select a location from the List of Locations box.
b. Click Remove.
c. Click Yes in the Confirmation window.
IM02601006E
www.eaton.com
5-61
IQ 150S/250S
5: Communication
• To sort the list of locations:
a. Select a sort method (A-Z, Z-A, Newest-Oldest or Oldest-Newest) from the pull-down menu.
b. Click Sort By.
• To connect to a location:
a. Select the location you want to connect to from the List of Locations box.
NOTE: You may
only connect to one location at a time. To change to a different location, you must disconnect
from the current location by selecting it and clicking Disconnect.
b. Click Connect. When the connection is made, the selected location appears in the Connected To Locations section of the screen.
c. Click Close. The Device Status screen opens, confirming the connection. The computer Status bar at the bottom of the screen also confirms the computer’s connection parameters.
NOTE: If the connection fails, a popup screen alerts you. Check that all cables are secure, that
the RS232 cable is connected to the correct Com Port on the computer, and that the computer is
set to use the same baud rate and protocol as the meter to which the computer is connected.
Disconnecting from an IQ 150S/250S meter
To disconnect from a meter or from a location, do one of the following:
• Click on the Disconnect icon in the Title Bar.
• Select Connection>Disconnect from the Title Bar.
• From the Connection Manager screen, select the location from the Connected to Location field
and click the Disconnect button.
IM02601006E
www.eaton.com
5-62
IQ 150S/250S
5: Communication
Changing the Primary Device/Address
Use this feature to select another meter as the primary device.
1. Click Connect>Change Primary Device/Address. You will see the screen shown below.
2. Enter the address of the device you want to designate as the new Primary Device.
3. Click OK.
Merging Connection Databases
Use this feature to combine two sets of cnexcom databases.
1. Click Connection>Merge Connection Databases. You will see the screen shown below. It allows
you to select the two databases to merge.
2. Click the Browse button next to each field to pick the databases. The Source cnexcom database
will be merged into the Destination cnexcom database.
3. Click the Merge button to proceed with the merge; click OK to exit the screen.
IM02601006E
www.eaton.com
5-63
IQ 150S/250S
5: Communication
Using the Options Screen
1. Click View>Options. You will see the screen shown below. Use this screen to access the following features:
• Paths for Eaton Meter Configuration software files
• Data Scan mode
Use the tabs at the top of the screen to access these features.
2. The first display is the Paths screen, shown above. Use this screen to view or change the paths
the Eaton Meter Configuration software uses for data.
IM02601006E
www.eaton.com
5-64
IQ 150S/250S
5: Communication
3. Click the Data Scan Mode tab to see the screen shown below. Use this screen to select normal
scan rate or to enter a custom scan rate.
4. Click:
• Apply to apply your selection(s) and keep the Options screen open
• OK to apply your selection and close the Options screen
• Cancel to close the Options screen without saving any selections that have not been applied
Using the Help Menu
The Help menu, accessed by clicking Help in the Title Bar, allows you to:
• View this manual online: click Help>this User Manual.
• View information about the Eaton Meter Configuration software, including version
number:
click Help>About Eaton Meter Configuration Software.
IM02601006E
www.eaton.com
5-65
IQ 150S/250S
5: Communication
This page intentionally left blank.
IM02601006E
www.eaton.com
5-66
IQ 150S/250S
6: Ethernet Configuration
6: Ethernet Configuration
6.1: Introduction
The IQ 150S/250S submeter has an option for a WiFi (Wireless) or RJ45 Ethernet connection.
This option allows the submeter to be set up for use in a LAN (Local Area Network), using standard WiFi base stations. Configuration for these connections is easily accomplished through your
PC using Telnet connections. Then you can access the submeter to perform meter functions
directly through any computer on your LAN: the IQ 150S/250S meter does not need to be directly
connected (wired) to these computers for it to be accessed.
This chapter outlines the procedures you use to set up the IQ 150S/250S submeter to function via
its Ethernet configuration.
6.2: Factory Default Settings
The settings shown in Section 6.2.1 are the default settings for the IQ 150S/250S submeter: they
are the settings programmed into your meter when it is shipped to you. You may need to modify
some of these settings when you set up your Ethernet configuration.
NOTES:
• Change Settings 1 and 6 ONLY. Settings 2, 3, and 4 must be the same as shown in Section
6.2.1. If they are not, reset them to the values shown in Section 6.2.1.
• If setting 3 is not CP0..! Defaults (In), the procedure for Network Module Hardware Initialization
(Section 6.3.4) will not work.
IM02601006E
www.eaton.com
6-1
IQ 150S/250S
6: Ethernet Configuration
6.2.1: Modbus/TCP to RTU Bridge Setup
1) Network/IP Settings:
Network Mode…………Wired Only
IP Address .............10.0.0.1
Default Gateway .....--- not set --Netmask ...............255.255.255.0
2) Serial & Mode Settings:
Protocol ................Modbus/RTU,Slave(s) attached
Serial Interface ..... 57600,8,N,1,RS232,CH1
3) Modem/Configurable Pin Settings:
CP0..! Defaults (In) CP1..! GPIO (In)
CP2..! GPIO (In)
CP3..! GPIO (In)
CP4..! GPIO (In)
CP5..! GPIO (In)
CP6..! GPIO (In)
CP7..! GPIO (In)
CP8..! GPIO (In)
CP9..! GPIO (In)
CP10.! GPIO (In)
RTS Output ......... Fixed High/Active
4) Advanced Modbus Protocol settings:
Slave Addr/Unit Id Source .. Modbus/TCP header
Modbus Serial Broadcasts ...Disabled (Id=0 auto-mapped to 1)
MB/TCP Exception Codes ....Yes (return 00AH and 00BH)
Char, Message Timeout ...... 00050msec, 05000msec
6) WLAN Settings:
WLAN ............... Disabled, network:LTRX_IBSS
Topology……………. AdHoc, Country: US, Channel: 11
IM02601006E
www.eaton.com
6-2
IQ 150S/250S
6: Ethernet Configuration
Security……………… none
TX Data rate…….. 11 Mbps auto fallback
Power management….. not supported in ad hoc mode
D)efault settings, S)ave, Q)uit without save
Select Command or parameter set (1..6) to change:
6.3: Configure Network Module
These procedures detail how to set up the IQ 150S/250S meter on the Network Module.
Only one person at a time can be logged into the network port. This eliminates the possibility of
several people trying to configure the Ethernet interface simultaneously.
IM02601006E
www.eaton.com
6-3
IQ 150S/250S
6: Ethernet Configuration
6.3.1: Configuration Requirements
• You may want to consult your Network Administrator before performing these procedures, since
some functions may be restricted to the Network Administrator.
• If you have only one Ethernet adapter (network card), the screen displays only that configuration. You will use this Ethernet adapter to access the IQ 150S/250S meter's Network Module.
You may have to configure the Ethernet adapter in order to use it with the IQ 150S/250S
meter's Network Module, using the instructions in Section 6.4.2.
• If you have multiple Ethernet adapters (network cards) installed on your computer, you must
choose, configure and use the correct one to access the Network Module.
• The Ethernet Adapter must be set up for point-to-point connection in order for it to connect to the
IQ 150S/250S meter's Network module, as follows:
IP Address should be 10.0.0.2
Subnet Mask should be 255.255.255.0
These settings can be made in the Ethernet Adapter. Follow the procedure in Section 6.3.2.
IM02601006E
www.eaton.com
6-4
IQ 150S/250S
6: Ethernet Configuration
6.3.2: Configuring the Ethernet Adapter
1. From the PC’s Start Menu, select Settings>Network Connections or Control Panel>Network Connections. You will see a screen like the one shown below.
2. Right click on the Local Area Network connection you will be using to connect to the IQ 150S/
250S submeter, and select Properties from the pull-down menu. You will see the screen shown
on the next page.
IM02601006E
www.eaton.com
6-5
IQ 150S/250S
6: Ethernet Configuration
3. Select Internet Protocol [TCP/IP] from the middle of the screen and click the
Properties button. You will see the screen shown below.
IM02601006E
www.eaton.com
6-6
IQ 150S/250S
6: Ethernet Configuration
4. Click the Use the Following IP Address radio button. The screen changes to allow you to enter
the IP Address and Subnet Mask.
a. Enter 10.0.0.2 in the IP Address field.
b. Enter 255.255.255.0 in the Subnet Mask field.
3. Click the OK button.
4. You can now close the Local Area Connection Properties and Network Connection windows.
IM02601006E
www.eaton.com
6-7
IQ 150S/250S
6: Ethernet Configuration
6.3.3: Detailed Configuration Parameters
Certain parameters must be configured before the Ethernet interface can function on a network.
The following procedure can be locally or remotely configured.
Use a Telnet connection to configure the unit over the network. The Ethernet interface's configuration is stored in meter memory and is retained without power. The configuration can be changed
at any time. The Ethernet interface performs a reset after the configuration has been changed and
stored.
Establish a Telnet connection to port 9999:
NOTE: If your PC is running
Windows 7, you need to enable Telnet
before using it.
1. Open the Control Panel.
2. Select Programs and Features.
3. Select Turn Windows features
on or off.
4. Check the box for Telnet Client.
5. Click OK. The Telnet client is
now available.
1. From the Windows Start menu, click Run and type 'cmd'.
2. Click the OK button to bring up Windows's Command Prompt window.
3. In the Command Prompt window, type:
telnet 10.0.0.1 9999 and press the Enter key.
NOTE: Be sure to include a space between the IP address and 9999.
Microsoft Windows XP [Version 5.1.2600]
(C) Copyright 1985-2001 Microsoft Corp.
C:\Documents and Settings\Administrator>telnet 10.0.0.1 9999
The following parameters appear, for example:
IM02601006E
www.eaton.com
6-8
IQ 150S/250S
6: Ethernet Configuration
Serial Number 5415404 MAC Address 00:20:4A:54:3C:2C
Software Version V01.2 (000719)
Press Enter to go into Setup Mode
4. Press Enter again, quickly.
5. After entering Setup Mode (confirm by pressing Enter), you can configure the parameters for the
software you are using by entering one of the numbers on the Change Setup Menu, or you can
confirm default values by pressing Enter. Be sure to store new configurations when you are finished. The Ethernet Interface will then perform a power reset and the Factory Default Settings
will display again (refer to Section 6.2.1).
6.3.4: Setup Details
This section illustrates how each section of settings appears on the screen, if you press Y (Yes) to
change one or more of the settings.
CAUTION! Change Settings 1 and 6 ONLY. Settings 2, 3, and 4 must be the same as shown in
Section 6.2.1. If they are not, reset them to the values shown in Section 6.2.1.
Network IP Settings Detail (1) (Set device with static IP Address.)
Network Mode: 0=Wired only, 1=Wireless Only <0> ? 1
IP Address <010> 192.<000> 168.<000> .<000> .<001>
Set Gateway IP Address <N> ? Y
Gateway IP Address : <192> .<168> .<000> .<001>
Set Netmask <N for default> <Y> ? Y
<255> .<255> .<255> .<000>
Change telnet config password <N> ? N
Serial & Mode Settings (2) (Make sure these settings match those shown in Section 6.2.1.)
Attached Device (1=Slave 2=Master) (1) ? 1
Serial Protocol (1=Modbus/RTU 2=Modbus/ASCII) (1) ? 1
IM02601006E
www.eaton.com
6-9
IQ 150S/250S
6: Ethernet Configuration
Use serial connector (1=CH1 2=CH2) (1) ? 1
Interface Type (1=RS232 2=RS422/RS485+4-wire 3=RS485+2-wire) (1) ? 1
Enter serial parameters (57600,8,N,1) 57600, 8, N, 1
Modem/Configurable Pin Settings (3) (Make sure these settings match those shown in Section 6.2.1.)
CAUTION! You must configure this setting correctly in order to be able to use the Network Module
Hardware Initialization procedure (Section 6.4).
Press 3. The following appears on the screen:
CP0 Function (hit space to toggle) GPIO (In)
Press the Space bar until the following appears on the screen:
CP0 Function (hit space to toggle) Defaults(In)
Press Enter. The following appears on the screen:
Invert (active low) (Y) ?
Press Y.
Ignore other settings (press Enter through the rest of Setting 3).
Advanced Modbus Protocol settings (4) (Make sure these settings match those shown in
Section 6.2.1.)
Slave address (0 for auto, or 1..255 fixed otherwise) (0) ? 0
Allow Modbus Broadcasts (1=Yes 2=No) (2) ? 2
Use MB/TCP 00BH/00AH Exception Responses (1=No 2=Yes) (2) ? 2
Disable Modbus/TCP pipeline (1=No 2=Yes) (1) ? 1
Character Timeout (0 for auto, or 10-6950 msec) (50) 50
Message Timeout (200-65000 msec) (5000) 5000
Serial TX delay after RX (0-1275 msec) (0) 0
IM02601006E
www.eaton.com
6-10
IQ 150S/250S
6: Ethernet Configuration
Swap 4x/0H to get 3x/1x (N) ? N
Local slave address for GPIO (0 to disable, or 1..255) (0) ? 0
WLAN Settings Detail (6) (The settings shown are recommended by Eaton for use with IQ
150S/250S submeter.)
Topology: 0=Infrastructure, 1=Ad-Hoc <1> ? 0
Network name <SSID> <LTRX_IBSS> ? Eaton_IQ150S_250S
Security suite: 0=none, 1=WEP, 2=WPA, 3=WPA2/802.11i <0> ? 0
TX Data rate: 0=fixed, 1=auto fallback <1> ? 1
TX Data rate: 0=1, 1=2, 2=5.5, 3=11, 4=18, 5=24, 6=36, 7=54 Mbps <3> ? 7
Enable power management <N> ? Y
IMPORTANT NOTES:
• The settings for the Wireless Access Point should be IDENTICAL to the settings for LWAN,
shown above. For programming, see the User's Manual for the Wireless Access Point in use.
• See Section 6.3.4.1 for information on using an Encryption key.
Exiting the screen
CAUTION! DO NOT PRESS 'D.'
Press 'S' to Save the settings you've entered.
6.3.4.1: Encryption Key
Eaton recommends that you use 128-bit encryption when setting up your Ethernet configuration.
In the WLAN Settings (6), set Security WEP (1), Authentication shared (1), WEP128 (1) and
Change Key (Y).
When Change Key (Y) is entered, you are required to enter an Encryption Key. You can manually
enter 26 hexadecimal characters (required for 128-bit encryption) or you can use a WEP Key provider online (example: www.powerdog.com/wepkey.cgi). WEP Key providers should note on their
website that their encryption algorithm is for the Wired Equivalent Privacy portion of
IEEE 802.11b/g.
IM02601006E
www.eaton.com
6-11
IQ 150S/250S
6: Ethernet Configuration
WEP Key Provider Steps
1. Input 26 alphanumeric characters as your Passphrase.
PASSPHRASE TO HEXADECIMAL WEP KEYS
Enter the passphrase below.
1009egbck001036ab
Generate keys
IMPORTANT! Remember your Passphrase.
2. Click the Generate Keys button. Your Hexadecimal WEP Keys appear.
PASSPHRASE TO HEXADECIMAL WEP KEYS
The passphrase 1009egbcke001306ab produces the following keys:
64-BIT (40-BIT KEYS)
1. AA43FB768D
2. 637D8DB9CE
3. AFDE50AF61
4. 0c35E73E25
128-BIT (104-BIT) KEY
041D7773D8B2C1D97BE9531DC
3. Input the 128-bit Key in the Change Key section of the WLAN Settings (6).
4. Continue inputting settings.
5. Press 'S' to Save your settings.
IM02601006E
www.eaton.com
6-12
IQ 150S/250S
6: Ethernet Configuration
6.4: Network Module Hardware Initialization
If you don't know your current Network Module settings, or if the settings are lost, you can use this
method to initialize the hardware with known settings you can then work with.
Main Board
2ESET"UTTON
Electro Industries
/GaugeTech
14
*0
7
7
7
8
8
8
13
WD
*0
13
1. Place a shorting block on JP3 and press the Reset button on the main board.
NOTE: JP3 is located on the right hand side, upper corner of the main board. The
shorting block can be "borrowed" from JP2, located at the middle, right hand side. See the figure shown above.
2. After you press the Reset button, move the jumper back to JP2.
3. Make sure your settings are the same as those in Section 6.2.1. Follow the steps in Section 6.3
to configure the Network Module.
IM02601006E
www.eaton.com
6-13
IQ 150S/250S
6: Ethernet Configuration
This page intentionally left blank.
IM02601006E
www.eaton.com
6-14
IQ 150S/250S
7: Using the Submeter
7: Using the Submeter
7.1: Introduction
The IQ 150S/250S submeter can be configured and a variety of functions can be accomplished by
using the Elements and the Buttons on the submeter face. This chapter reviews front panel
navigation. See Appendix A for complete Navigation maps.
7.1.A: Understanding Submeter Face Elements
Reading
Type
Indicator
MENU
MAX
ENTER
VOLTS L-N
MIN
VOLTS L-L
-
LM1
LM2
AMPS
A
Parameter
Designator
WNARP
VA/Hz
PRG
120%-
-
90%-
% of Load
Bar
0000
60%30%-
Wh
VARh
B
VAh
C
Wh Pulse
KILO
MEGA
%LOAD
Watt-hour
Test Pulse
Scaling
Factor
Figure 7.1: Faceplate with Elements
The meter face features the following elements:
• Reading Type Indicator: e.g., Max (The meter shown above is an IQ 250S - the LM1 and LM2
indicators are not one the IQ 150S meter.)
• Parameter Designator: e.g., Volts L-N
• Watt-Hour Test Pulse: Energy pulse output to test accuracy
• Scaling Factor: Kilo or Mega multiplier of displayed readings
• % of Load Bar: Graphic Display of Amps as % of the Load (Refer to Section 7.3 for additional
information.)
IM02601006E
www.eaton.com
7-1
IQ 150S/250S
7: Using the Submeter
7.1.B: Understanding Submeter Face Buttons
Menu
MENU
MAX
ENTER
VOLTS L-N
MIN
LM1
LM2
Enter
VOLTS L-L
-
AMPS
A
WNARP
VA/Hz
PRG
120%90%60%-
0000
-
30%-
Down
Wh
VARh
B
VAh
C
Wh Pulse
KILO
MEGA
%LOAD
Right
Figure 7.2: Faceplate with Buttons
The meter face has Menu, Enter, Down and Right buttons, which let you perform the following
functions:
• View Meter Information
• Enter Display Modes
• Configure Parameters (may be Password Protected)
• Perform Resets (may be Password Protected)
• Perform LED Checks
• Change Settings
• View Parameter Values
• Scroll Parameter Values
• View Limit States (IQ 250S)
IM02601006E
www.eaton.com
7-2
IQ 150S/250S
7: Using the Submeter
7.2: Using the Front Panel
You can access four modes using the IQ 150S/250S submeter’s front panel buttons:
• Operating mode (Default)
• Reset mode
• Configuration mode
• Information mode - Information mode displays a sequence of screens that show model information, such as Frequency, Amps, etc.
Use the Menu, Enter, Down and Right buttons to navigate through each mode and its related
screens.
NOTES:
• See Appendix A for the complete display mode Navigation maps.
• The meter can also be configured using software; see Chapter 5 for instructions.
7.2.1: Understanding Startup and Default Displays
Upon Power Up, the meter displays a sequence of screens:
• Lamp Test screen where all LEDs are lit
• Lamp Test screen where all digits are lit
• Firmware screen showing build number
• Error screen (if an error exists)
After startup, if auto-scrolling is enabled, the IQ 150S/250S meter scrolls the parameter readings
on the right side of the front panel. The Kilo or Mega LED lights, showing the scale for the Wh,
VARh and VAh readings. Figure 7.3 shows an example of a Wh reading.
IM02601006E
www.eaton.com
7-3
IQ 150S/250S
MENU
MAX
7: Using the Submeter
ENTER
VOLTS L-N
MIN
LM1
LM2
VOLTS L-L
-
AMPS
A
WNARP
VA/Hz
PRG
0000
- 0.659
-
120%90%60%30%-
Wh
VARh
B
VAh
C
Wh Pulse
KILO
MEGA
%LOAD
Figure 7.3: Display Showing Watt-hr Reading
The IQ 150S/250S meter continues to provide scrolling readings until one of the
buttons on the front panel is pressed, causing the meter to enter one of the other Modes.
7.2.2: Using the Main Menu
1. Press the Menu button. The Main Menu screen appears.
• The Reset: Demand mode (rStd) appears in the A window. Use the Down button to scroll, causing the Reset: Energy (rStE), Configuration (CFG), Operating (OPr), and Information (InFo)
modes to move to the A window.
• The mode that is currently flashing in the A window is the “Active” mode, which means it is the
mode that can be configured.
MENU
ENTER
MENU
ENTER
MENU
ENTER
-
A
-
A
-
A
-
B
-
B
-
B
-
C
-
C
-
C
For example: Press Down Twice - CFG moves to A window. Press Down Twice - OPr moves to A window.
IM02601006E
www.eaton.com
7-4
IQ 150S/250S
7: Using the Submeter
2. Press the Enter button from the Main Menu to view the Parameters screen for the mode that is
currently active.
7.2.3: Using Reset Mode
Reset mode has two options:
• Reset: Demand (rStd): resets the Max and Min values.
• Reset: Energy (rStE): resets the energy accumulator fields.
1. Press the Enter button while either rStd or
rStE is in the A window. The Reset Demand
MENU
MENU
ENTER
ENTER
No or Reset Energy No screen appears.
-
A
-
A
• If you press the Enter button again, the
-
B
-
B
-
C
-
C
Main Menu appears, with the next mode in
the A window. (The Down button does not
affect this screen.)
• If you press the Right button, the Reset
Demand YES or Reset Energy YES screen
appears. Press Enter to perform a reset.
NOTE: If Password protection is enabled for
reset, you must enter the four digit password
MENU
ENTER
MENU
ENTER
-
A
-
A
-
B
-
B
-
C
-
C
before you can reset the meter (see Chapter 5 for
information on Password protection). To enter a
password, follow the instructions in Section 7.2.4.
CAUTION! Reset Demand YES resets all Max and Min values.
2. Once you have performed a reset, the screen displays either “rSt dMd donE” or
“rSt EnEr donE”and then resumes auto-scrolling parameters.
IM02601006E
www.eaton.com
7-5
IQ 150S/250S
7: Using the Submeter
7.2.4: Entering a Password
If Password protection has been enabled in the software for reset and/or configuration (see
Chapter 5 for more information), a screen appears requesting a password when you try to reset
the meter and/or configure settings through the front panel.
• PASS appears in the A window and 4 dashes appear in the B window. The leftmost dash is
flashing.
1. Press the Down button to scroll numbers from 0 to 9 for the flashing dash. When the correct
number appears for that dash, use the Right button to move to the next dash.
Example: The left screen, below, shows four dashes. The right screen shows the display after the
first two digits of the password have been entered.
MENU
MENU
ENTER
-
A
-
-
B
-
-
C
-
ENTER
PASS
12__
A
B
C
2. When all 4 digits of the password have been selected, press the Enter button.
• If you are in Reset Mode and you enter the correct password, “rSt dMd donE” or “rSt EnEr
donE”appears and the screen resumes auto-scrolling parameters.
• If you are in Configuration Mode and you enter the correct password, the display returns to
the screen that required a password.
• If you enter an incorrect password, “PASS ---- FAIL” appears and:
MENU
• The previous screen is re-displayed, if you are in Reset
Mode.
• The previous Operating mode screen is re-displayed, if
you are in Configuration mode.
IM02601006E
www.eaton.com
ENTER
-
A
-
B
-
C
7-6
IQ 150S/250S
7: Using the Submeter
7.2.5: Using Configuration Mode
Configuration mode follows Reset: Energy on the Main Menu.
To access Configuration mode
1. Press the Menu button while the meter is auto-scrolling parameters.
2. Press the Down button until the Configuration Mode option (CFG) is in the A window.
3. Press the Enter button. The Configuration Parameters screen appears.
4. Press the Down button to scroll through the configuration parameters: Scroll (SCrL), CT, PT,
Connection (Cnct) and Port. The parameter currently ‘Active,” i.e., configurable, flashes in the A
window.
5. Press the Enter button to access the Setting screen for the currently active
parameter.
NOTE: You can use the Enter button to scroll through all of the Configuration parameters and their
Setting screens, in order.
MENU
ENTER
MENU
ENTER
-
A
-
A
-
B
-
B
-
C
-
C
Press Enter when CFG is in A window - Parameter screen appears Press Down- Press Enter when
Parameter you want is in A window
6. The parameter screen appears, showing the current settings. To change the settings:
• Use either the Down button or the Right button to select an option.
• To enter a number value, use the Down button to select the number value for a digit and the
Right button to move to the next digit.
IM02601006E
www.eaton.com
7-7
IQ 150S/250S
7: Using the Submeter
NOTE: When you try to change the current setting and Password protection is enabled for the
meter, the Password screen appears. See Section 7.2.4 for instructions on entering a password.
7. Once you have entered the new setting, press the Menu button twice.
8. The Store ALL YES screen appears. You can either:
• Press the Enter button to save the new setting.
• Press the Right button to access the Store ALL no screen; then press the Enter button to
cancel the Save.
9. If you have saved the settings, the Store ALL done screen appears and the meter resets.
MENU
MENU
ENTER
MENU
ENTER
ENTER
-
A
-
A
-
A
-
B
-
B
-
B
-
C
-
C
-
C
Press the Enter button to save
the settings. Press the Right
Press the Enter button to
Cancel the Save.
The settings have been
saved.
button for Stor All no screen.
IM02601006E
www.eaton.com
7-8
IQ 150S/250S
7: Using the Submeter
7.2.5.1: Configuring the Scroll Feature
When in Auto Scroll mode, the meter performs a scrolling display, showing each parameter for 7
seconds, with a 1 second pause between parameters. The parameters that the meter displays
have been selected through Eaton Meter Configuration
software (refer to Chapter 5 for instructions).
To enable or disable Auto-scrolling:
1. Press the Enter button when SCrl is in the A window. The Scroll YES
screen appears.
2. Press either the Right or Down button if you want to access the
Scroll no screen. To return to the Scroll YES screen, press either button.
MENU
ENTER
-
A
-
B
-
C
3. Press the Enter button on either the Scroll YES screen (to enable
auto-scrolling) or the Scroll no screen (to disable auto-scrolling).
4. The CT- n screen appears (this is the next Configuration mode
parameter).
NOTES:
MENU
ENTER
-
A
-
B
-
C
• To exit the screen without changing scrolling options, press the Menu
button.
• To return to the Main Menu screen, press the Menu button twice.
• To return to the scrolling (or non-scrolling) parameters display, press the Menu button three
times.
IM02601006E
www.eaton.com
7-9
IQ 150S/250S
7: Using the Submeter
7.2.5.2: Configuring CT Setting
The CT Setting has three parts: Ct-n (numerator), Ct-d (denominator), and Ct-S (scaling).
1. Press the Enter button when Ct is in the A window. The Ct-n screen appears. You can either:
• Change the value for the CT numerator.
• Access one of the other CT screens by pressing the Enter button: press Enter once to
access the Ct-d screen, twice to access the Ct-S screen.
NOTE: The Ct-d screen is preset to a 5 amp or 1 amp value at the factory and cannot be
changed.
a. To change the value for the CT numerator:
From the Ct-n screen:
• Use the Down button to select the number value for a digit.
• Use the Right button to move to the next digit.
b. To change the value for CT scaling
From the Ct-S screen:
Use the Right button or the Down button to choose the scaling you want. The Ct-S setting
can be 1, 10, or 100.
NOTE: If you are prompted to enter a password, refer to Section 7.2.4 for instructions on doing so.
2. When the new setting is entered, press the Menu button twice.
3. The Store ALL YES screen appears. Press Enter to save the new CT setting.
Example CT Settings:
200/5 Amps: Set the Ct-n value for 200 and the Ct-S value for 1.
800/5 Amps: Set the Ct-n value for 800 and the Ct-S value for 1.
2,000/5 Amps: Set the Ct-n value for 2000 and the Ct-S value for 1.
10,000/5 Amps: Set the Ct-n value for 1000 and the Ct-S value for 10.
IM02601006E
www.eaton.com
7-10
IQ 150S/250S
7: Using the Submeter
NOTES:
• The value for Amps is a product of the Ct-n value and the Ct-S value.
• Ct-n and Ct-S are dictated by primary current; Ct-d is secondary current.
MENU
MENU
ENTER
ENTER
MENU
ENTER
MENU
ENTER
-
A
-
A
-
A
-
A
-
B
-
B
-
B
-
B
-
C
-
C
-
C
-
C
Press Enter
Use buttons to set Ct-n
Ct-d cannot be changed
Use buttons to select
scaling
7.2.5.3: Configuring PT Setting
The PT Setting has three parts: Pt-n (numerator), Pt-d (denominator), and Pt-S (scaling).
1. Press the Enter button when Pt is in the A window. The PT-n screen appears. You can either:
• Change the value for the PT numerator.
• Access one of the other PT screens by pressing the Enter button: press Enter once to
access the Pt-d screen, twice to access the Pt-S screen.
a. To change the value for the PT numerator or denominator:
From the Pt-n or Pt-d screen:
• Use the Down button to select the number value for a digit.
• Use the Right button to move to the next digit.
IM02601006E
www.eaton.com
7-11
IQ 150S/250S
7: Using the Submeter
b. To change the value for the PT scaling:
From the Pt-S screen:
Use the Right button or the Down button to choose the scaling you want. The Pt-S setting
can be 1, 10, 100, or 1000.
NOTE: If you are prompted to enter a password, refer to Section 7.2.4 for instructions on doing so.
2. When the new setting is entered, press the Menu button twice.
3. The STOR ALL YES screen appears. Press Enter to save the new PT setting.
Example PT Settings:
277/277 Volts: Pt-n value is 277, Pt-d value is 277, Pt-S value is 1.
14,400/120 Volts: Pt-n value is 1440, Pt-d value is 120, Pt-S value is 10.
138,000/69 Volts: Pt-n value is 1380, Pt-d value is 69, Pt-S value is 100.
345,000/115 Volts: Pt-n value is 3450, Pt-d value is 115, Pt-S value is 100.
345,000/69 Volts: Pt-n value is 345, Pt-d value is 69, Pt-S value is 1000.
NOTE: Pt-n and Pt-S are dictated by primary voltage; Pt-d is secondary voltage.
MENU
ENTER
MENU
ENTER
MENU
ENTER
-
A
-
A
-
A
-
B
-
B
-
B
-
C
-
C
-
C
Use buttons to set Pt-n
IM02601006E
Use buttons to set Pt-d
www.eaton.com
Use buttons to select scaling
7-12
IQ 150S/250S
7: Using the Submeter
7.2.5.4: Configuring Connection Setting
1. Press the Enter button when Cnct is in the A window. The Cnct screen appears.
2. Press the Right button or Down button to select a configuration. The choices are:
• 3 Element Wye (3 EL WYE)
• 2.5 Element Wye (2.5EL WYE)
• 2 CT Delta (2 Ct dEL)
NOTE: If you are prompted to enter a password, refer to Section 7.2.4 for instructions on doing so.
3. When you have made your selection, press the Menu button twice.
4. The STOR ALL YES screen appears. Press Enter to save the setting.
MENU
ENTER
-
A
-
B
-
C
Use buttons to select configuration
7.2.5.5: Configuring Communication Port Setting
Port configuration consists of: Address (a three digit number), Baud Rate (9600; 19200; 38400; or
57600), and Protocol (DNP 3.0; Modbus RTU; or Modbus ASCII).
1. Press the Enter button when POrt is in the A window. The Adr (address) screen appears. You
can either:
• Enter the address.
• Access one of the other Port screens by pressing the Enter button: press Enter once to
access the bAUd screen (Baud Rate), twice to access the Prot screen (Protocol).
IM02601006E
www.eaton.com
7-13
IQ 150S/250S
7: Using the Submeter
a. To enter the Address
From the Adr screen:
• Use the Down button to select the number value for a digit.
• Use the Right button to move to the next digit.
b. To select the Baud Rate:
From the bAUd screen:
Use the Right button or the Down button to select the setting you want.
c. To select the Protocol:
From the Prot screen:
Press the Right button or the Down button to select the setting you want.
NOTE: If you are prompted to enter a password, refer to Section 7.2.4 for instructions on doing so.
2. When you have finished making your selections, press the Menu button twice.
3. The STOR ALL YES screen appears. Press Enter to save the settings.
MENU
MENU
ENTER
ENTER
MENU
ENTER
-
A
-
A
-
A
-
B
-
B
-
B
-
C
-
C
-
C
Use buttons to enter Address
IM02601006E
Use buttons to select Baud Rate
www.eaton.com
Use buttons to select Protocol
7-14
IQ 150S/250S
7: Using the Submeter
7.2.6: Using Operating Mode
Operating mode is the IQ150S/250S submeter’s default mode, that is, the standard front panel display. After starting up, the meter automatically scrolls through the parameter screens, if scrolling is
enabled. Each parameter is shown for 7 seconds, with a 1 second pause between parameters.
Scrolling is suspended for 3 minutes after any button is pressed.
1. Press the Down button to scroll all the parameters in Operating mode. The currently “Active,”
i.e., displayed, parameter has the Indicator light next to it, on the right face of the meter.
2. Press the Right button to view additional readings for that parameter. The table below shows
possible readings for Operating mode. Sheet 2 in Appendix A shows the Operating mode Navigation map.
NOTE: Readings or groups of readings are skipped if not applicable to the meter type or hookup,
or if they are disabled in the programmable settings.
OPERATING MODE PARAMETER READINGS
POSSIBLE READINGS
VOLTS L-N
VOLTS_LN
VOLTS_LN_
MAX
VOLTS_LN_
MIN
VOLTS L-L
VOLTS_LL
VOLTS_LL_
MAX
VOLTS_LL_
MIN
AMPS
AMPS
AMPS_NEU
TRAL
AMPS_MAX
AMPS_MIN
W/VAR/PF
W_VAR_PF
W_VAR_PF
_MAX_POS
W_VAR_PF
_MIN_POS
W_VAR_PF
_MIN_NEG
VA/Hz
VA_FREQ
VA_FREQ_
MAX
VA_FREQ_
MIN
Wh
KWH_REC
KWH_DEL
KWH_NET
KWH_TOT
VARh
KVARH_PO
S
KVARH_NE
G
KVARH_NE
T
KVARH_TO
T
VAh
KVAH
IM02601006E
www.eaton.com
VOLTS_LN_
THD
AMPS_THD
7-15
IQ 150S/250S
7: Using the Submeter
7.3: Understanding the % of Load Bar
The 10-segment LED bar graph at the bottom left of the IQ 150S/250S meter’s front panel provides a graphic representation of Amps. The segments light according to the load, as shown in the
table below.
When the Load is over 120% of Full Load, all segments flash “On” (1.5 secs) and “Off” (0.5 secs).
Segments
Load >= % Full Load
none
no load
1
1%
1-2
15%
1-3
30%
1-4
45%
1-5
60%
1-6
72%
1-7
84%
1-8
96%
1-9
108%
1-10
120%
All Blink
>120%
MENU
MAX
ENTER
VOLTS L-N
MIN
LM1
LM2
VOLTS L-L
-
AMPS
A
WNARP
VA/Hz
PRG
10
120%90%60%-
0000
-
30%-
1
IM02601006E
Wh
VARh
B
VAh
C
Wh Pulse
KILO
MEGA
%LOAD
www.eaton.com
7-16
IQ 150S/250S
7: Using the Submeter
7.4: Performing Watt-Hour Accuracy Testing (Verification)
To be certified for revenue metering, power providers and utility companies must
verify that the billing energy meter performs to the stated accuracy. To confirm the meter’s performance and calibration, power providers use field test standards to ensure that the unit’s energy
measurements are correct. Since the IQ 150S/250S submeter is a traceable revenue meter, it
contains a utility grade test pulse that can be used to gate an accuracy standard. This is an essential feature required of all billing grade meters.
• Refer to Figure 7.5 for an example of how this process works.
• Refer to Table 7.1 for the Wh/Pulse constants for accuracy testing.
MENU
MAX
ENTER
VOLTS L-N
MIN
LM1
LM2
VOLTS L-L
-
AMPS
A
WNARP
VA/Hz
PRG
120%90%60%-
0000
-
30%-
Wh
VARh
B
VAh
C
Wh Pulse
Watt-hour
Test Pulse
KILO
MEGA
%LOAD
Figure 7.4: Watt-hour Test Pulse
IM02601006E
www.eaton.com
7-17
IQ 150S/250S
MENU
MAX
ENTER
VOLTS L-N
MIN
LM1
LM2
7: Using the Submeter
VOLTS L-L
-
A
-
B
-
C
AMPS
WNARP
%THD
VA/Hz
Wh
PRG
lrDA
VARh
VAh
Test Pulses
120%90%60%30%-
Energy Pulses
Wh Pulse
KILO
Energy
Standard
MEGA
%LOAD
Comparator
Error
Results
Figure 7.5: Using the Watt-hour Test Pulse
Meter
IQ 150S
IQ 250S
Input Voltage
Level
Class 10
Models
Class 2 Models
Below 150V
0.2505759630
0.0501151926
Above 150V
1.0023038521
0.2004607704
Below 150V
0.500017776
0.1000035555
Above 150V
2.000071103
0.400014221
Table 7.1: Infrared & KYZ Pulse Constants for Accuracy Testing - Kh Watt-hour per pulse
NOTES:
• Minimum pulse width for the IQ 150S is 40 milliseconds; minimum pulse width for the IQ 250S is
90 milliseconds.
• Refer to Chapter 2, Section 2.2, for Wh Pulse specifications.
IM02601006E
www.eaton.com
7-18
IQ 150S/250S
A: Navigation Maps
A: IQ 150S/250S Meter Navigation Maps
A.1: Introduction
You can configure the IQ 150S/250S meter and perform related tasks using the buttons on the
meter face. Chapter 7 contains a description of the buttons on the meter face and instructions for
programming the meter using them. The meter can also be programmed using software (see
Chapter 5).
A.2: Navigation Maps (Sheets 1 to 4)
The IQ 150S/250S meter’s Navigation maps begin on the next page. The maps show in detail how
to move from one screen to another and from one display mode to another using the buttons on
the face of the meter. All display modes automatically return to Operating mode after 10 minutes
with no user activity.
IQ 150S/250S meter Navigation map titles
• Main Menu Screens (Sheet 1)
• Operating mode screens (Sheet 2)
• Reset mode screens (Sheet 3)
• Configuration mode screens (Sheet 4)
IM02601006E
www.eaton.com
A-1
IQ 150S/250S
A: Navigation Maps
Main Menu Screens (Sheet 1)
STARTUP
sequence run once at meter startup:
2 lamp test screens, hardware information
screen, firmware version screen,
(conditional) error screens
10 minutes with no user activity
sequence completed
MENU
MAIN MENU:
OPR (blinking)
RSTD
RSTE
OPERATING MODE
ENTER
DOWN
RESET DEMAND MODE
ENTER
DOWN
DOWN
10 minutes
with no
user activity
MENU
MAIN MENU:
RSTD (blinking)
RSTE
CFG
sequence
completed
grid of meter data screens.
See pages A-3
sequence of screens to get password, if
required, and reset max/min data.
See page A-4
MENU
MAIN MENU:
RSTE (blinking)
CFG
INFO
RESET ENERGY MODE
ENTER
DOWN
sequence of screens to get password, if
required, and reset energy accumulators.
See page A-4
MENU
MAIN MENU:
CFG (blinking)
INFO
OPR
CONFIGURATION MODE
ENTER
DOWN
grid of meter settings screens with
password-protected edit capability.
See page A-5
Configuration Mode is not
available during a
Programmable Settings
update via a COM port.
MENU
MAIN MENU:
INFO (blinking)
OPR
RSTD
INFORMATION
ENTER
sequence of screens to show model
information, same as STARTUP except
lamp tests omitted.
MAIN MENU Screen
MAIN MENU screen scrolls through 4 choices,
showing 3 at a time. The top choice is always the
"active" one, which is indicated by blinking the legend.
SYMBOLS
single screen
all screens
for a display
mode
BUTTONS
MENU
Returns to previous menu from any screen in any mode
ENTER
Indicates acceptance of the current screen and advances to the
next one
DOWN, RIGHT
Navigation:
Navigation and edit buttons
No digits or legends are blinking. On a menu, down advances
to the next menu selection, right does nothing. In a grid of
screens, down advances to the next row, right advances to the
next column. Rows, columns, and menus all navigate circularly.
A digit or legend is blinking to indicate that it is eligible for
change. When a digit is blinking, down increases the digit
value, right moves to the next digit. When a legend is blinking,
either button advances to the next choice legend.
group of
screens
Editing:
action taken
button
IM02601006E
www.eaton.com
A-2
IQ 150S/250S
A: Navigation Maps
Operating Mode Screens (Sheet 2)
See Notes 1 & 3
RIGHT
VOLTS_LN
RIGHT
VOLTS_LN_MAX
RIGHT
VOLTS_LN_MIN
DOWN2
DOWN2
(from any VOLTS_LN
screen)
See Note 1
RIGHT
VOLTS_LL
RIGHT
VOLTS_LL_MAX
RIGHT
VOLTS_LL_MIN
DOWN2
(from any VOLTS_LL screen)
RIGHT
RIGHT
AMPS
RIGHT
IN
See Note 1
AMPS_MAX
RIGHT
AMPS_MIN
DOWN2
DOWN2
(from any AMPS screen)
See Note 1
RIGHT
W_VAR_PF
DOWN2
RIGHT
W_VAR_PF
_MAX_POS
RIGHT
W_VAR_PF
_MIN_POS
RIGHT
W_VAR_PF
_MAX_NEG
RIGHT
W_VAR_PF
_MIN_NEG
DOWN2
(from any W_VAR_PF screen)
See Note 1
RIGHT
VA_FREQ
RIGHT
VA_FREQ_MAX
RIGHT
VA_FREQ_MIN
DOWN2
(from any VA_FREQ screen)
See Note 1
RIGHT
KWH_REC
RIGHT
RIGHT
KWH_DEL
KWH_NET
RIGHT
KWH_TOT
DOWN2
(from any KWH screen)
See Note 1
RIGHT
KVARH_POS
RIGHT
KVARH_NEG
RIGHT
KVARH_NET
RIGHT
KVARH_TOT
DOWN2
(from any KVARH screen)
See Note 1
KVAH
MENU
(from any
operating mode
screen)
IM02601006E
Notes
1 Group is skipped if not applicable to the meter type or hookup or if explicitly disabled via
programmable settings.
2 DOWN occurs without user intervention every 7 seconds if scrolling is enabled.
3 No Volts LN screens for Delta 2CT hookup.
4 Scrolling is suspended for 3 minutes after any button press.
to Main Menu
see page A-2
www.eaton.com
A-3
IQ 150S/250S
A: Navigation Maps
Reset Mode Screens (Sheet 3)
from MAIN MENU
from MAIN MENU
(RSTD selected)
(RSTE selected)
ENTER
RESET_ENERGY_NO:
RST
ENER
no (blinking)
RESET_MM_NO:
RST
DMD
no (blinking)
RIGHT
RIGHT
RIGHT
RESET_ENERGY_YES:
RST
ENER
yes (blinking)
RIGHT
RESET_MM_YES:
RST
DMD
yes (blinking)
ENTER
ENTER
is password required?
is password required?
yes
yes
increment
blinking digit
no
no
DOWN
energy
RESET_ENTER_PW:
PASS
#### (one # blinking)
make next digit
blink
RIGHT
demand
ENTER
is password
correct?
ENTER
yes
reset all max &
min values
reset all max &
min values
energy
which reset?
demand
which reset?
RESET_MM_CONFIRM:
RST
DMD
DONE
no
2 sec
RESET_PW_FAIL:
PASS
####
FAIL
RESET_ENERGY_CONFIRM:
RST
ENER
DONE
2 sec.
2 sec.
to previous operating
mode screen
see page A-3
to previous operating
mode screen
see page A--3 or
this page, above
MENU
(from any
reset mode
screen)
to Main Menu
see page A-2
IM02601006E
www.eaton.com
A-4
IQ 150S/250S
A: Navigation Maps
Configuration Mode Screens (Sheet 4)
See Note 1
ENTER
CONFIG_MENU:
SCRL (blinking)
CT
PT
DOWN
DOWN or
RIGHT3
toggle
scroll
setting
ENTER
MENU
ENTER
CONFIG_MENU:
CT (blinking)
PT
CNCT
DOWN
SCROLL_EDIT:
SCRL
yes or no
(choice blinking if edit)
ENTER
ENTER
CTN_EDIT:
DOWN
increment
blinking
digit
MENU
CT-N
####
(one # blinking if edit)
CTD_SHOW:
CT-D
1 or 5
RIGHT
blink
next
digit
ENTER
ENTER
PTN_EDIT:
DOWN
DOWN
increment
blinking
digit
MENU
PTD_EDIT:
PT-N
####
(one # blinking if edit)
RIGHT
blink
next
digit
PT-D
####
(one # blinking if edit)
DOWN
increment
blinking
digit
RIGHT
blink
next
digit
PT_MULT_EDIT:
PT-S
1 or 10 or 100 or 1000
(choice blinking if edit)
DOWN
MENU
DOWN
ENTER
DOWN2
CONNECT_EDIT:
CNCT
1 of 3 choices
(choice blinking if edit)
ENTER
MENU2
DOWN
increment
blinking
digit
ADDRESS_EDIT:
ADR
###
(one # blinking if edit)
DOWN
increment
blinking
digit
yes
MENU
PASSWORD_EDIT:
PASS
#### (one # blinking)
SAVE_YES:
STOR
ALL?
yes (blinking)
RIGHT RIGHT
see page A-2
IM02601006E
SAVE_NO:
STOR
ALL?
no (blinking)
PROTOCOL_EDIT:
PROT
1 of 3 choices
(choice blinking if edit)
DOWN or
RIGHT
show
next
choice
ENTER2
RIGHT
blink
next
digit
ENTER
first DOWN or RIGHT in view
access (if password required)
save new
configuration
DOWN
increment
blinking
digit
SAVE_CONFIRM:
STOR
ALL
DONE
2 sec.
MENU
DOWN or
RIGHT
show
next
choice
PROT choices:
MOD RTU,
MOD ASCI,
DNP
Notes:
1. Initial access is view-only. View access shows the existing settings. At the
first attempt to change a setting (DOWN or RIGHT pressed), password is
requested (if enabled) and access changes to edit. Edit access blinks the digit
or list choice eligible for change and lights the PRG LED.
2. Skip over password edit screen and menu selection if access is view-only
or if password is disabled.
3. Scroll setting may be changed with view or edit access.
4. ENTER accepts an edit; MENU abandons it.
MENU
(per row of the originating screen)
MENU
to Main Menu
ENTER
BAUD_EDIT:
BAUD
##.#
(choice blinking if edit)
RIGHT
blink
next
digit
ENTER
CONFIG_MENU screen
scrolls through 6 choices,
showing 3 at a time. The
top choice is always the
"active" one, indicated by
blinking the legend.
no
ENTER
ENTER
CONFIG_MENU:
PASS2 (blinking)
SCRL
CT
any changes?
CNCT choices:
3 EL WYE,
2 CT DEL,
2.5EL WYE
DOWN or
RIGHT
show
next
choice
MENU
CONFIG_MENU:
PORT (blinking)
PASS2
SCRL
DOWN or
RIGHT
show
next
choice
ENTER
ENTER
CONFIG_MENU:
CNCT (blinking)
PORT
PASS2
DOWN or
RIGHT
show
next
choice
ENTER
ENTER
CONFIG_MENU:
PT (blinking)
CNCT
PORT
CT_MULT_EDIT:
CT-S
1 or 10 or 100
(choice blinking if edit)
reboot
ENTER
CFG_ENTER_PW:
PASS
### (one # blinking)
ENTER
is password
correct?
no
See Note 1
RIGHT
blink
next
digit
yes
to the originating
EDIT screen
to previous operating
mode screen
see page A-3 or A-4
www.eaton.com
A-5
IQ 150S/250S
A: Navigation Maps
This page intentionally left blank.
IM02601006E
www.eaton.com
A-6
IQ 150S/250S
B: Modbus Map
B: IQ 150S/250S Meter Modbus Map
B.1: Introduction
The Modbus Map for the IQ 150S/250S Meter gives details and information about the possible
readings of the meter and about the programming of the meter. The IQ 150S/250S can be
programmed using the buttons on the face plate of the meter (Chapter 7). The meter can also be
programmed using software. For programming instructions, see Section 5.2.
B.2: Modbus Register Map Sections
The IQ 150S/250S Modbus Register Map includes the following sections:
Fixed Data Section, Registers 1- 47, details the Meter’s Fixed Information described in Section
7.2.
Meter Data Section, Registers 1000 - 5003, details the Meter’s Readings, including Primary
Readings, Energy Block, Demand Block, Maximum and Minimum Blocks, Phase Angle Block and
Status Block. Operating Mode readings are described in Section 7.2.6.
Commands Section, Registers 20000 - 26011, details the Meter’s Resets Block,
Programming Block, Other Commands Block and Encryption Block.
Programmable Settings Section, Registers 30000 - 30067, details the Meter’s Basic Setups.
Secondary Readings Section, Registers 40001 - 40100, details the Meter’s Secondary Readings
Setups.
IQ 250S Only - Log Retrieval Section, Registers 49997 - 51127, details log and retrieval. See Section B.5 for instructions on retrieving logs.
B.3: Data Formats
ASCII:
ASCII characters packed 2 per register in high,
low order and without any termination characters.
SINT16/UINT16:
16-bit signed/unsigned integer.
SINT32/UINT32:
32-bit signed/unsigned integer spanning 2
registers. The lower-addressed register is the
high order half.
IM02601006E
www.eaton.com
B-1
IQ 150S/250S
FLOAT:
B: Modbus Map
32-bit IEEE floating point number spanning 2
registers. The lower-addressed register is the
high order half (i.e., contains the exponent).
B.4: Floating Point Values
Floating Point Values are represented in the following format:
Register
0
Byte
1
0
1
0
1
Bit
7
6
5
4
3
2
1
0
7
6
5
4
3
2
1
0
7
6
5
4
3
2
1
0
7
6
5
4
3
2
1
0
Meaning
s
e
e
e
e
e
e
e
e
m
m
m
m
m
m
m
m
m
m
m
m
m
m
m
m
m
m
m
m
m
m
m
sign
exponent
mantissa
The formula to interpret a Floating Point Value is:
-1sign x 2 exponent-127 x 1.mantissa = 0x0C4E11DB9
-1sign x 2 137-127 x 1· 1000010001110110111001
-1 x 210 x 1.75871956
-1800.929
Register
0x0C4E1
Byte
0x01DB9
0x0C4
Bit
Meaning
0x0E1
0x01D
0x0B9v
7
6
5
4
3
2
1
0
7
6
5
4
3
2
1
0
7
6
5
4
3
2
1
0
7
6
5
4
3
2
1
0
1
1
0
0
0
1
0
0
1
1
1
0
0
0
0
1
0
0
0
1
1
1
0
1
1
0
1
1
1
0
0
1
s
e
e
e
e
e
e
e
e
m
m
m
m
m
m
m
m
m
m
m
m
m
m
m
m
m
m
m
m
m
m
m
sign
exponent
mantissa
1
0x089 + 137
0b011000010001110110111001
Formula Explanation:
C4E11DB9 (hex)
11000100 11100001 00011101 10111001
(binary)
The sign of the mantissa (and therefore the number) is 1, which represents a negative value.
The Exponent is 10001001 (binary) or 137 decimal.
IM02601006E
www.eaton.com
B-2
IQ 150S/250S
B: Modbus Map
The Exponent is a value in excess 127. So, the Exponent value is 10.
The Mantissa is 11000010001110110111001 binary.
With the implied leading 1, the Mantissa is (1).611DB9 (hex).
The Floating Point Representation is therefore -1.75871956 times 2 to the 10.
Decimal equivalent: -1800.929
NOTES:
• Exponent = the whole number before the decimal point.
• Mantissa = the positive fraction after the decimal point.
B.5: Retrieving Logs Using the IQ 250S Meter's Modbus Map
This section describes the log interface system of the IQ 250S meter from a programming point of
view. It is intended for programmers implementing independent drivers for log retrieval from the
meter. It describes the meaning of the meter's Modbus Registers related to log retrieval and
conversion, and details the procedure for retrieving a log's records.
NOTES:
• All references assume the use of Modbus function codes 0x03, 0x06, and 0x10, where each register is a 2 byte MSB (Most Significant Byte) word, except where otherwise noted.
• The carat symbol (^) notation is used to indicate mathematical "power." For example, 2^8
means 28; which is 2 x 2 x 2 x 2 x 2 x 2 x 2 x 2, which equals 256.
IM02601006E
www.eaton.com
B-3
IQ 150S/250S
B: Modbus Map
B.5.1: Data Formats
Time stamp: Stores a date from 2000 to 2099. Time stamp has a Minimum resolution of 1 second.
Byte
0
1
2
3
4
5
Value
Year
Month
Day
Hour
Minute
Second
Range
0-99 (+2000)
1-12
1-31
0-23
0-59
0-59
Mask
0x7F
0x0F
0x1F
0x1F
0x3F
0x3F
The high bits of each time stamp byte are used as flags to record meter state information at the
time of the time stamp. These bits should be masked out, unless needed.
B.5.2: IQ 250S Meter Logs
The IQ 2500S meter has 5 logs: System Event, Alarm (Limits), and 3 Historical logs. Each log is
described below.
1. System Event (0): The System Event log is used to store events which happen in, and to, the
meter. Events include Startup, Reset Commands, Log Retrievals, etc. The System Event Log
Record takes 20 bytes, 14 bytes of which are available when the log is retrieved.
Byte
0
1
2
Value
timestamp
3
4
5
6
7
8
9
10
11
12
13
Group
Event
Mod
Chan
Param1
Param2
Param3
Param4
NOTE: The complete Systems Events table is shown in Section B.5.5, step 1, on page B-19.
2. Alarm Log (1): The Alarm Log records the states of the 8 Limits programmed in the meter.
• Whenever a limit goes out (above or below), a record is stored with the value that caused the
limit to go out.
• Whenever a limit returns within limit, a record is stored with the "most out of limit" value for
that limit while it was out of limit.
The Alarm Log Record uses 16 bytes, 10 bytes of which are available when the log is retrieved.
IM02601006E
Byte
0
1
2
Value
timestamp
3
4
5
6
7
8
direction
limit#
Value%
www.eaton.com
9
B-4
IQ 150S/250S
B: Modbus Map
The limit # byte is broken into a type and an ID.
Bit
0
1
Value
type
0
2
3
0
0
4
5
6
7
0
Limit ID
3. Historical Log 1 (2): The Historical Log records the values of its assigned registers at the programmed interval.
NOTE: See Section B.5.3, Number 1, for details on programming and interpreting the log.
Byte
0
1
2
Value
timestamp
3
4
5
6
-
-
N
values . . .
4. Historical Log 2 (3): Same as Historical Log 1.
5. Historical Log 3 (4): Same as Historical Log 1.
B.5.3: Block Definitions
This section describes the Modbus Registers involved in retrieving and interpreting an IQ 250S
meter’s Log. Other sections refer to certain 'values' contained in this section. See the corresponding value in this section for details.
NOTES:
• “Register” is the Modbus Register Address in 0-based Hexadecimal notation. To convert it to 1based decimal notation, convert from hex16 to decimal10 and add 1. For example: 0x03E7 =
1000.
• “Size” is the number of Modbus Registers (2 byte) in a block of data.
Historical Log Programmable Settings:
The Historical Logs are programmed using a list of Modbus Registers that will be copied into the
Historical Log record. In other words, Historical Log uses a direct copy of the Modbus Registers to
control what is recorded at the time of record capture.
To supplement this, the programmable settings for the Historical Logs contain a list of descriptors,
which group registers into items. Each item descriptor lists the data type of the item, and the num-
IM02601006E
www.eaton.com
B-5
IQ 150S/250S
B: Modbus Map
ber of bytes for that item. By combining these two lists, the Historical Log record can be interpreted.
For example: Registers 0x03E7 and 0x03E8 are programmed to be recorded by the historical log.
The matching descriptor gives the data type as float, and the size as 4 bytes. These registers program the log to record "Primary Readings Volts A-N."
Historical Log Blocks:
Start Register:
0x7917 (Historical Log 1)
0x79D7 (Historical Log 2)
0x7A97 (Historical Log 3)
Block Size:
192 registers per log (384 bytes)
The Historical Log programmable settings are comprised of 3 blocks, one for each log. Each is
identical to the others, so only Historical Log 1 is described here. All register addresses in this section are given as the Historical Log 1 address (0x7917).
Each Historical Log Block is composed of 3 sections: The header, the list of registers to log, and
the list of item descriptors.
Header:
Registers:
0x7917 - 0x7918
Size:
2 registers
Byte
0
1
Value
# Registers
# Sectors
2
3
Interval
• # Registers: The number of registers to log in the record. The size of the record in memory is [12
+ (# Registers x 2)]. The size during normal log retrieval is [6 + (# Registers x 2)]. If this value is
0, the log is disabled. Valid values are {0-117}.
• # Sectors: The number of Flash Sectors allocated to this log. Each sector is 64kb, minus a sector header of 20 bytes. 15 sectors are available for allocation between Historical Logs 1, 2, and
3. The sum of all Historical Logs may be less than 15. If this value is 0, the log is disabled. Valid
values are {0-15}.
IM02601006E
www.eaton.com
B-6
IQ 150S/250S
B: Modbus Map
• Interval: The interval at which the Historical Log's Records are captured. This value is an enumeration:
0x01
1 minute
0x02
3 minute
0x04
5 minute
0x08
10 minute
0x10
15 minute
0x20
30 minute
0x40
60 minute
Register List:
Registers:
0x7919 - 0x798D
Size:
1 register per list item, 117 list items
The Register List controls what Modbus Registers are recorded in each record of the Historical
Log. Since many items, such as Voltage, Energy, etc., take up more than 1 register, multiple registers need to be listed to record those items.
For example: Registers 0x03E7 and 0x03E8 are programmed to be recorded by the historical log.
These registers program the log to record "Primary Readings Volts A-N."
• Each unused register item should be set to 0x0000 or 0xFFFF to indicate that it should be
ignored.
• The actual size of the record, and the number of items in the register list which are used, is
determined by the # registers in the header.
• Each register item is the Modbus Address in the range of 0x0000 to 0xFFFF.
Item Descriptor List:
Registers:
0x798E - 0x79C8
Size:
1 byte per item, 117 bytes (59 registers)
IM02601006E
www.eaton.com
B-7
IQ 150S/250S
B: Modbus Map
While the Register List describes what to log, the Item Descriptor List describes how to interpret
that information. Each descriptor describes a group of register items, and what they mean.
Each descriptor is composed of 2 parts:
• Type: The data type of this descriptor, such as signed integer, IEEE floating point, etc. This is the
high nibble of the descriptor byte, with a value in the range of 0-14. If this value is 0xFF, the
descriptor should be ignored.
0
ASCII: An ASCII string, or byte array
1
Bitmap: A collection of bit flags
2
Signed Integer: A 2's Complement integer
3
Float: An IEEE floating point
4
Energy: Special Signed Integer, where the value
is adjusted by the energy settings in the meter's
Programmable Settings.
5
Unsigned Integer
6
Signed Integer 0.1 scale: Special Signed Integer,
where the value is divided by 10 to give a 0.1
scale.
7-14
Unused
15
Disabled: used as end list marker.
• Size: The size in bytes of the item described. This number is used to determine the pairing of
descriptors with register items.
For example: If the first descriptor is 4 bytes, and the second descriptor is 2 bytes, then the first
2 register items belong to the 1st descriptor, and the 3rd register item belongs to the 2nd
descriptor.
NOTE: As can be seen from the example, above, there is not a 1-to-1 relation between the register list and the descriptor list. A single descriptor may refer to multiple register items.
Register Items
Descriptors
0x03C7/
Float, 4 byte
IM02601006E
www.eaton.com
B-8
IQ 150S/250S
B: Modbus Map
0x03C8
0x1234
Signed Int, 2 byte
NOTE: The sum of all descriptor sizes must equal the number of bytes in the data portion of the
Historical Log record.
Log Status Block:
The Log Status Block describes the current status of the log in question. There is one header block
for each of the logs. Each log's header has the following base address:
Log
Base Address
Alarms:
0xC737
System:
0xC747
Historical 1:
0xC757
Historical 2:
0xC767
Historical 3:
0xC777
Bytes
Value
Type
Range
# Bytes
0-3
Max Records
UINT32
0 to 4,294,967,294
4
4-7
Number of Records Used
UINT32
1 to 4,294,967,294
4
8-9
Record Size in Bytes
UINT16
4 to 250
2
10-11
Log Availability
UINT16
12-17
Timestamp, First Record
TSTAMP
1Jan2000 - 31Dec2099
6
18-23
Timestamp, Last Record
TSTAMP
1Jan2000 - 31Dec2099
6
24-31
Reserved
2
8
• Max Records: The maximum number of records the log can hold given the record size, and sector allocation. The data type is an unsigned integer from 0 - 2^32.
IM02601006E
www.eaton.com
B-9
IQ 150S/250S
B: Modbus Map
• Records Used: The number of records stored in the log. This number will equal the Max Records
when the log has filled. This value will be set to 1 when the log is reset. The data type is an
unsigned integer from 1 - 2^32.
NOTE: The first record in every log before it has rolled over is a "dummy" record, filled with all
0xFF's. When the log is filled and rolls over, this record is overwritten.
• Record Size: The number of bytes in this record, including the timestamp. The data type is an
unsigned integer in the range of 14 - 242.
• Log Availability: A flag indicating if the log is available for retrieval, or if it is in use by another
port.
0
Log Available for retrieval
1
Not used
2
In use by COM2 (RS485)
0xFFFF
Log Not Available - the log cannot be retrieved.
This indicates that the log is disabled.
NOTE: To query the port by which you are currently connected, use the Port ID register:
Register:
0x1193
Size:
1 register
Description: A value from 1-4, which enumerates the port that the requestor is currently connected on.
NOTES:
• When Log Retrieval is engaged, the Log Availability value will be set to the port that engaged
the log. The Log Availability value will stay the same until either the log has been disengaged, or 5 minutes have passed with no activity. It will then reset to 0 (available).
• Each log can only be retrieved by one port at a time.
• Only one log at a time can be retrieved.
• First Timestamp: Timestamp of the oldest record.
IM02601006E
www.eaton.com
B-10
IQ 150S/250S
B: Modbus Map
• Last Timestamp: Timestamp of the newest record.
Log Retrieval Block:
The Log Retrieval Block is the main interface for retrieving logs. It is comprised of 2 parts: the
header and the window. The header is used to program the particular data the meter presents
when a log window is requested. The window is a sliding block of data that can be used to access
any record in the specified log.
Session Com Port: The IQ 250S meter's Com Port which is currently retrieving logs. Only one
Com Port can retrieve logs at any one time.
Registers:
0xC34E - 0xC34E
Size:
1 register
0
No Session Active
1
(Not used by the IQ 250S)
2
COM2 (RS485)
To get the current Com Port, see the NOTE on querying the port, on the previous page.
IM02601006E
www.eaton.com
B-11
IQ 150S/250S
B: Modbus Map
Log Retrieval Header:
The Log Retrieval Header is used to program the log to be retrieved, the record(s) of that log to be
accessed, and other settings concerning the log retrieval.
Registers:
0xC34F - 0xC350
Size:
2 registers
Bytes
Value
Type
Format
Description
# Bytes
0-1
Log Number,
Enable,
Scope
UINT16
nnnnnnnn esssssss
nnnnnnnn log to
retrieve,
e - retrieval
session
enable
sssssss retrieval
mode
2
2-3
Records per
Window,
Number of
Repeats
UINT16
wwwwwwww nnnnnnnn
wwwwwwww records per
window,
nnnnnnnn repeat count
2
• Log Number: The log to be retrieved. Write this value to set which log is being retrieved.
0
System Events
1
Alarms
2
Historical Log 1
3
Historical Log 2
4
Historical Log 3
IM02601006E
www.eaton.com
B-12
IQ 150S/250S
B: Modbus Map
• Enable: This value sets if a log retrieval session is engaged (locked for retrieval) or disengaged
(unlocked, read for another to engage). Write this value with 1(enable) to begin log retrieval.
Write this value with 0(disable) to end log retrieval.
0
Disable
1
Enable
• Scope: Sets the amount of data to be retrieved for each record. The default should be 0 (normal).
0
Normal
1
Timestamp Only
2
Image
• Normal [0]: The default record. Contains a 6-byte timestamp at the beginning, then N data
bytes for the record data.
• Timestamp [1]: The record only contains the 6-byte timestamp. This is most useful to determine a range of available data for non-interval based logs, such as Alarms and System
Events.
• Image [2]: The full record, as it is stored in memory. Contains a 2-byte checksum, 4-byte
sequence number, 6-byte timestamp, and then N data bytes for the record data.
• Records Per Window: The number of records that fit evenly into a window. This value is set-able,
as less than a full window may be used. This number tells the retrieving program how many
records to expect to find in the window.
(RecPerWindow x RecSize) = #bytes used in the window.
This value should be ((123 x 2) \ recSize), rounded down.
For example, with a record size of 30, the RecPerWindow = ((123 x 2) \ 30) = 8.2 ~= 8
IM02601006E
www.eaton.com
B-13
IQ 150S/250S
B: Modbus Map
• Number of Repeats: Specifies the number of repeats to use for the Modbus Function Code 0x23
(35). Since the meter must pre-build the response to each log window request, this value must
be set once, and each request must use the same repeat count. Upon reading the last register
in the specified window, the record index will increment by the number of repeats, if auto-increment is enabled. Section B.5.4.2 has additional information on Function Code 0x23.
0
Disables auto-increment
1
No Repeat count, each request will only get 1
window.
2-8
2-8 windows returned for each Function Code
0x23 request.
Bytes
Value
Type
Format
Description
# Bytes
0-3
Offset of
First Record
in Window
UINT32
ssssssss nnnnnnnn
nnnnnnnn nnnnnnnn
ssssssss window status nn…nn 24-bit record
index number.
4
4-249
Log Retrieve
Window
UINT16
246
Log Retrieval Window Block:
The Log Retrieval Window block is used to program the data you want to retrieve from the log. It
also provides the interface used to retrieve that data.
Registers:
0xC351 - 0xC3CD
Size:
125 registers
• Window Status: The status of the current window. Since the time to prepare a window may
exceed an acceptable modbus delay (1 second), this acts as a state flag, signifying when the
window is ready for retrieval. When this value indicates that the window is not ready, the data in
the window should be ignored. Window Status is Read-only, any writes are ignored.
0
Window is Ready
0xFF
Window is Not Ready
IM02601006E
www.eaton.com
B-14
IQ 150S/250S
B: Modbus Map
• Record Number: The record number of the first record in the data window. Setting this value controls which records will be available in the data window.
• When the log is engaged, the first (oldest) record is "latched." This means that record number
0 will always point to the oldest record at the time of latching, until the log is disengaged
(unlocked).
• To retrieve the entire log using auto-increment, set this value to 0, and retrieve the window
repeatedly, until all records have been retrieved.
NOTES:
• When auto-increment is enabled, this value will automatically increment so that the
window will "page" through the records, increasing by RecordsPerWindow each
time that the last register in the window is read.
• When auto-increment is not enabled, this value must be written-to manually, for
each window to be retrieved.
• Log Retrieval Data Window: The actual data of the records, arranged according to the above
settings.
B.5.4: Log Retrieval
Log Retrieval is accomplished in 3 basic steps:
1. Engage the log.
2. Retrieve each of the records.
3. Disengage the log.
B.5.4.1: Auto-Increment
In Eaton’s traditional Modbus retrieval system, you write the index of the block of data to retrieve,
then read that data from a buffer (window). To improve the speed of retrieval, the index can be
automatically incremented each time the buffer is read.
In the IQ 250S meter, when the last register in the data window is read, the record index is incremented by the Records per Window.
IM02601006E
www.eaton.com
B-15
IQ 150S/250S
B: Modbus Map
B.5.4.2: Modbus Function Code 0x23
QUERY
Field Name
Example (Hex)
Slave Address
01
Function
23
Starting Address Hi
C3
Starting Address Lo
51
# Points Hi
00
# Points Lo
7D
Repeat Count
04
RESPONSE
Field Name
Example (Hex)
Slave Address
01
Function
23
# Bytes Hi
03
# Bytes Lo
E0
Data
...
Function Code 0x23 is a user defined Modbus function code, which has a format similar to
Function Code 0x03, except for the inclusion of a "repeat count." The repeat count (RC) is used to
indicate that the same N registers should be read RC number of times. (See the Number of
Repeats bullet on page B-14.)
IM02601006E
www.eaton.com
B-16
IQ 150S/250S
B: Modbus Map
NOTES:
• By itself this feature would not provide any advantage, as the same data will be returned RC
times. However, when used with auto-incrementing, this function condenses up to 8 requests
into 1 request, which decreases communication time, as fewer transactions are being made.
• Keep in mind that the contents of the response data is the block of data you requested, repeated
N times. For example, when retrieving log windows, you
normally request both the window index, and the window data. This means that the first couple
of bytes of every repeated block will contain the index of that
window.
• In the IQ 250S meter repeat counts are limited to 8 times for Modbus RTU, and 4 times for Modbus ASCII.
The response for Function Code 0x23 is the same as for Function Code 0x03, with the data blocks
in sequence.
IMPORTANT! Before using Function Code 0x23, always check to see if the current connection
supports it. Some relay devices do not support user defined function codes; if that is the case, the
message will stall. Other devices don't support 8 repeat counts.
B.5.4.3: Log Retrieval Procedure
The following procedure documents how to retrieve a single log from the oldest record to the newest record, using the "normal" record type (see Scope). All logs are retrieved using the same
method. See Section B.5.4.4 for a Log Retrieval example.
NOTES:
• This example uses auto-increment.
• In this example, Function Code 0x23 is not used.
• You will find referenced topics in Section B.5.3. Block Definitions.
• Modbus Register numbers are listed in brackets.
1. Engage the Log:
a. Read the Log Status Block.
IM02601006E
www.eaton.com
B-17
IQ 150S/250S
B: Modbus Map
i.. Read the contents of the specific logs' status block [0xC737+, 16 reg] (see Log
Headers).
ii. Store the # of Records Used, the Record Size, and the Log Availability.
iii. If the Log Availability is not 0, stop Log Retrieval; this log is not available at this
time. If Log Availability is 0, proceed to step 1b (Engage the log).
This step is done to ensure that the log is available for retrieval, as well as retrieving information for later use.
b. Engage the log: write log to engage to Log Number, 1 to Enable, and the desired mode to
Scope (default 0 (Normal)) [0xC34F, 1 reg]. This is best done as a
single-register write.
This step will latch the first (oldest) record to index 0, and lock the log so that only this port
can retrieve the log, until it is disengaged.
c. Verify the log is engaged: read the contents of the specific logs' status block [0xC737+, 16
reg] again to see if the log is engaged for the current port (see Log Availability). If the Log is
not engaged for the current port, repeat step 1b (Engage the log).
d. Write the retrieval information.
i. Compute the number of records per window, as follows:
RecordsPerWindow = (246 \ RecordSize)
• If using 0x23, set the repeat count to 2-8. Otherwise, set it to 1.
• Since we are starting from the beginning for retrieval, the first record index is
0.
ii. Write the Records per window, the Number of repeats (1), and Record Index (0)
[0xC350, 3 reg].
This step tells the IQ 250S meter what data to return in the window.
2. Retrieve the records:
a. Read the record index and window: read the record index, and the data window [0xC351,
125 reg].
IM02601006E
www.eaton.com
B-18
IQ 150S/250S
B: Modbus Map
• If the meter Returns a Slave Busy Exception, repeat the request.
• If the Window Status is 0xFF, repeat the request.
• If the Window Status is 0, go to step 2b (Verify record index).
NOTES:
• We read the index and window in 1 request to minimize communication time, and to
ensure that the record index matches the data in the data window returned.
• Space in the window after the last specified record (RecordSize x RecordPerWindow) is padded with 0xFF, and can be safely discarded.
b. Verify that the record index incremented by Records Per Window. The record index of the
retrieved window is the index of the first record in the window. This value will increase by
Records Per Window each time the window is read, so it should be 0, N, N x 2, N x 3 . . . for
each window retrieved.
• If the record index matches the expected record index, go to step 2c (Compute next
expected record index).
• If the record index does not match the expected record index, then go to step 1d
(Write the retrieval information), where the record index will be the same as the
expected record index. This will tell the IQ 250S meter to repeat the records you
were expecting.
c. Compute next Expected Record Index.
• If there are no remaining records after the current record window, go to step 3 (Disengage the log).
• Compute the next expected record index by adding Records Per Window, to the current expected record index. If this value is greater than the number of records, resize the window so it only contains the remaining records and go to step 1d (Write
the retrieval information), where the Records Per Window will be the same as the
remaining records.
3. Disengage the log: write the Log Number (of log being disengaged) to the Log Index and 0 to
the Enable bit [0xC34F, 1 reg].
IM02601006E
www.eaton.com
B-19
IQ 150S/250S
B: Modbus Map
B.5.4.4: Log Retrieval Example
The following example illustrates a log retrieval session. The example makes the
following
assumptions:
• Log Retrieved is Historical Log 1 (Log Index 2).
• Auto-Incrementing is used.
• Function Code 0x23 is not used (Repeat Count of 1).
• The Log contains Volts-AN, Volts-BN, Volts-CN (12 bytes).
• 100 Records are available (0-99).
• COM Port 2 (RS485) is being used (see Log Availability).
• There are no Errors.
• Retrieval is starting at Record Index 0 (oldest record).
• Protocol used is Modbus RTU. The checksum is left off for simplicity.
• The IQ 250S meter is at device address 1.
• No new records are recorded to the log during the log retrieval process.
IM02601006E
www.eaton.com
B-20
IQ 150S/250S
B: Modbus Map
1. Read [0xC757, 16 reg], Historical Log 1 Header Block.
Send:
0103 C757 0010
Command:
Register Address:
0xC757
# Registers:
16
--------------------------------------------------Receive:
010320 00000100 00000064 0012 0000
060717101511 060718101511
0000000000000000
Data:
Max Records:
0x100 = 256 records maximum.
Num Records:
0x64 = 100 records currently logged.
Record Size:
0x12 = 18 bytes per record.
Log Availability:
0x00 = 0, not in use, available for retrieval.
First Timestamp:
0x060717101511 = July 23, 2006, 16:21:17
Last Timestamp:
0x060717101511 = July 24, 2006, 16:21:17
NOTE: This indicates that Historical Log 1 is available for retrieval.
2. Write 0x0280 -> [0xC34F, 1 reg], Log Enable.
Send:
0106 C34F 0280
Command:
Register Address:
0xC34F
# Registers:
1 (Write Single Register Command)
Data:
Log Number:
IM02601006E
2 (Historical Log 1)
www.eaton.com
B-21
IQ 150S/250S
Enable:
1 (Engage log)
Scope:
0 (Normal Mode)
B: Modbus Map
--------------------------------------------------Receive:
0106C34F0280 (echo)
NOTE: This engages the log for use on this COM Port, and latches the oldest record as record
index 0.
3. Read [0xC757, 16 reg], Availability is 0.
Send:
0103 C757 0010
Command:
Register Address:
0xC757
# Registers:
16
--------------------------------------------------Receive:
010320 00000100 00000064 0012 0002
060717101511 060718101511
0000000000000000
Data:
Max Records:
0x100 = 256 records maximum.
Num Records:
0x64 = 100 records currently logged.
Record Size:
0x12 = 18 bytes per record.
Log Availability:
0x02 = 2, In use by COM2, RS485 (the current
port)
First Timestamp:
0x060717101511 = July 23, 2006, 16:21:17
Last Timestamp:
0x060717101511 = July 24, 2006, 16:21:17
NOTE: This indicates that the log has been engaged properly in step 2. Proceed to retrieve the
log.
IM02601006E
www.eaton.com
B-22
IQ 150S/250S
B: Modbus Map
4. Compute #RecPerWin as (246\18)=13. Write 0x0D01 0000 0000 -> [0xC350, 3 reg] Write
Retrieval Info. Set Current Index as 0.
Send:
0110 C350 0003 06 0D01 00 000000
Command:
Register Address:
0xC350
# Registers:
3, 6 bytes
Data:
Records per Window:
13. Since the window is 246 bytes, and the record
is 18 bytes, 246\18 = 13.66, which means that
13 records evenly fit into a single window. This is
234 bytes, which means later on, we only need to
read 234 bytes (117 registers) of the window to
retrieve the records.
# of Repeats:
1. We are using auto-increment (so not 0), but
not function code 0x23.
Window Status:
0 (ignore)
Record Index:
0, start at the first record.
---------------------------------------------------Receive:
0110C3500003 (command ok)
NOTES:
• This sets up the window for retrieval; now we can start retrieving the records.
• As noted above, we compute the records per window as 246\18 = 13.66, which is rounded to 13
records per window. This allows the minimum number of requests to be made to the meter,
which increases retrieval speed.
IM02601006E
www.eaton.com
B-23
IQ 150S/250S
B: Modbus Map
5. Read [0xC351, 125 reg], first 2 reg is status/index, last 123 reg is window data. Status OK.
Send:
0103 C351 007D
Command:
Register Address:
0xC351
# Registers:
0x7D, 125 registers
--------------------------------------------------Receive:
0103FA 00000000
060717101511FFFFFFFFFFFFFFFFFFFFFFFF
06071710160042FAAACF42FAAD1842FAA9A8 . . .
Data:
Window Status:
0x00 = the window is ready.
Index:
0x00 = 0, The window starts with the 0'th record,
which is the oldest record.
Record 0:
The next 18 bytes is the 0'th record (filler).
Timestamp:
0x060717101511, = July 23, 2006, 16:21:17
Data:
This record is the "filler" record. It is used by the
meter so that there is never 0 records. It should
be ignored. It can be identified by the data being
all 0xFF.
NOTE: Once a log has rolled over, the 0'th record
will be a valid record, and the filler record will
disappear.
Record 1:
The next 18 bytes is the 1'st record.
Timestamp:
0x060717101600 July 23, 2006, 16:22:00
Data:
Volts AN:
0x42FAAACF, float = 125.33~
Volts BN:
0x42FAAD18, float = 125.33~
IM02601006E
www.eaton.com
B-24
IQ 150S/250S
Volts CN:
B: Modbus Map
0x42FAA9A8, float = 125.33~
. . . 13 records
NOTES:
• This retrieves the actual window. Repeat this command as many times as necessary to retrieve
all of the records when auto-increment is enabled.
• Note the filler record. When a log is reset (cleared) in the meter, the meter always adds a first
"filler" record, so that there is always at least 1 record in the log. This "filler" record can be identified by the data being all 0xFF, and it being index 0. If a record has all 0xFF for data, the timestamp is valid, and the index is NOT 0, then the record is legitimate.
• When the "filler" record is logged, its timestamp may not be "on the interval." The next record
taken will be on the next "proper interval," adjusted to the hour. For example, if the interval is 1
minute, the first "real" record will be taken on the next minute (no seconds). If the interval is 15
minutes, the next record will be taken at :15, :30, :45, or :00 - whichever of those values is next
in sequence.
6. Compare the index with Current Index.
NOTES:
• The Current Index is 0 at this point, and the record index retrieved in step 5 is 0: thus we go to
step 8.
• If the Current Index and the record index do not match, go to step 7. The data that was received
in the window may be invalid, and should be discarded.
7. Write the Current Index to [0xC351, 2 reg].
Send:
0110 C351 0002 04 00 00000D
Command:
Register Address:
0xC351
# Registers:
2, 4 bytes
Data:
IM02601006E
www.eaton.com
B-25
IQ 150S/250S
Window Status:
0 (ignore)
Record Index:
0x0D = 13, start at the 14th record.
B: Modbus Map
---------------------------------------------------Receive:
0110C3510002 (command ok)
NOTES:
• This step manually sets the record index, and is primarily used when an out-of-order record
index is returned on a read (step 6).
• The example assumes that the second window retrieval failed somehow, and we need to
recover by requesting the records starting at index 13 again.
8. For each record in the retrieved window, copy and save the data for later interpretation.
9. Increment Current Index by RecordsPerWindow.
NOTES:
• This is the step that determines how much more of the log we need to retrieve.
• On the first N passes, Records Per Window should be 13 (as computed in step 4), and the current index should be a multiple of that (0, 13, 26, . . .). This amount will decrease when we
reach the end (see step 10).
• If the current index is greater than or equal to the number of records (in this case 100), then all
records have been retrieved; go to step 12. Otherwise, go to step 10 to check if we are nearing
the end of the records.
10. If number records - current index < RecordsPerWindow, decrease to match.
NOTES:
• Here we bounds-check the current index, so we don't exceed the records available.
• If the number of remaining records (#records - current index) is less than the Records per Window, then the next window is the last, and contains less than a full window of records. Make
records per window equal to remaining records (#records-current index). In this example, this
IM02601006E
www.eaton.com
B-26
IQ 150S/250S
B: Modbus Map
occurs when current index is 91 (the 8'th window). There are now 9 records available (100-91),
so make Records per Window equal 9.
11. Repeat steps 5 through 10.
NOTES:
• Go back to step 5, where a couple of values have changed.
Pass
CurIndex
FirstRecIndex RecPerWindow
0
0
0
13
1
13
13
13
2
26
26
13
3
39
39
13
4
52
52
13
5
65
65
13
6
78
78
13
7
91
91
9
8
100
------
-------
• At pass 8, since Current Index is equal to the number of records (100), log retrieval should stop;
go to step 12 (see step 9 Notes).
12. No more records available, clean up.
IM02601006E
www.eaton.com
B-27
IQ 150S/250S
B: Modbus Map
13. Write 0x0000 -> [0xC34F, 1 reg], disengage the log.
Send:
0106 C34F 0000
Command:
Register Address:
0xC34F
# Registers:
1 (Write Single Register Command)
Data:
Log Number:
0 (ignore)
Enable:
0 (Disengage log)
Scope:
0 (ignore)
---------------------------------------------------Receive:
0106C34F0000 (echo)
NOTES:
• This disengages the log, allowing it to be retrieved by other COM ports.
• The log will automatically disengage if no log retrieval action is taken for 5 minutes.
B.6: Modbus Register Map
The IQ 150S and 250S meters' Modbus register maps begin on the following page. The first map
is for the IQ 150S, and the second is for the IQ 250S.
IM02601006E
www.eaton.com
B-28
B: Modbus Map
IQ 150S
Modbus Address
Hex
Description1
Decimal
Units or
Resolution
Range6
Format
#
Reg
Comments
Fixed Data Section
Identification Block
0000 - 0007
0008 - 000F
0010 - 0010
read-only
1 - 8
9 - 16
17 - 17
Reserved
Meter Serial Number
Meter Type
ASCII
UINT16
16 char
bit-mapped
none
none
-------t --------
0011 - 0012
0013 - 0013
0014 - 0014
18 - 19
20 - 20
21 - 21
Firmware Version
Map Version
Meter Configuration
ASCII
UINT16
UINT16
4 char
0 to 65535
bit-mapped
none
none
-------- --ffffff
0015 - 0015
0016 - 0026
0027 - 002E
22 - 22
23 - 39
40 - 47
ASIC Version
Reserved
Reserved
UINT16
0-65535
none
t = transducer model (1=yes, 0=no)
8
8
1
2
1
1
ffffff = calibration frequency (50 or 60)
Block Size:
Meter Data Section
2
Primary Readings Block, 6 cycles (IEEE Floating Point)
read-only
0383 - 0384
900 - 901
Watts, 3-Ph total
FLOAT
-9999 M to +9999 M
watts
2
0385 - 0386
902 - 903
VARs, 3-Ph total
FLOAT
-9999 M to +9999 M
VARs
2
0387 - 0388
904 - 905
VAs, 3-Ph total
FLOAT
-9999 M to +9999 M
VAs
2
Block Size:
Primary Readings Block, 60 cycles (IEEE Floating Point)
03E7 - 03E8
1000 - 1001
Volts A-N
03E9 - 03EA
1002 - 1003
Volts B-N
03EB - 03EC
1004 - 1005
Volts C-N
03ED - 03EE
1006 - 1007
Volts A-B
03EF - 03F0
1008 - 1009
Volts B-C
03F1 - 03F2
1010 - 1011
Volts C-A
03F3 - 03F4
1012 - 1013
Amps A
03F5 - 03F6
1014 - 1015
Amps B
03F7 - 03F8
1016 - 1017
Amps C
03F9 - 03FA
1018 - 1019
Watts, 3-Ph total
03FB - 03FC
1020 - 1021
VARs, 3-Ph total
03FD - 03FE
1022 - 1023
VAs, 3-Ph total
03FF - 0400
1024 - 1025
Power Factor, 3-Ph total
0401 - 0402
1026 - 1027
Frequency
IM02601006E
1
17
8
47
6
read-only
FLOAT
FLOAT
FLOAT
FLOAT
FLOAT
FLOAT
FLOAT
FLOAT
FLOAT
FLOAT
FLOAT
FLOAT
FLOAT
FLOAT
www.eaton.com
0 to 9999 M
0 to 9999 M
0 to 9999 M
0 to 9999 M
0 to 9999 M
0 to 9999 M
0 to 9999 M
0 to 9999 M
0 to 9999 M
-9999 M to +9999 M
-9999 M to +9999 M
-9999 M to +9999 M
-1.00 to +1.00
0 to 65.00
volts
volts
volts
volts
volts
volts
amps
amps
amps
watts
VARs
VAs
none
Hz
2
2
2
2
2
2
2
2
2
2
2
2
2
2
MM-1
B: Modbus Map
IQ 150S
(
)
pp
p
Modbus Address
Hex
Decimal
0403 - 0404
1028 - 1029
Description1
Neutral Current
Format
FLOAT
Units or
Resolution
Range6
0 to 9999 M
#
Reg
Comments
amps
Block Size:
Primary Energy Block
044B - 044C
1100 - 1101
read-only
W-hours, Received
SINT32
044D - 044E
1102 - 1103
W-hours, Delivered
SINT32
044F - 0450
0451 - 0452
0453 - 0454
1104 - 1105
1106 - 1107
1108 - 1109
W-hours, Net
W-hours, Total
VAR-hours, Positive
SINT32
SINT32
SINT32
0455 - 0456
1110 - 1111
VAR-hours, Negative
SINT32
0457 - 0458
1112 - 1113
VAR-hours, Net
0459 - 045A
1114 - 1115
045B - 045C
1116 - 1117
0 to 99999999 or
0 to -99999999
0 to 99999999 or
0 to -99999999
-99999999 to 99999999
0 to 99999999
0 to 99999999
Wh per energy format
Wh per energy format
* Wh received & delivered always have
opposite signs
* Wh received is positive for "view as load",
delivered is positive for "view as generator"
2
2
SINT32
Wh per energy format
Wh per energy format
* 5 to 8 digits
VARh per energy format
* decimal point implied, per energy format
0 to -99999999
VARh per energy format
* resolution of digit before decimal point =
-99999999 to 99999999 VARh per energy format units, kilo, or mega, per energy format
2
VAR-hours, Total
SINT32
0 to 99999999
VARh per energy format
2
VA-hours, Total
SINT32
0 to 99999999
VAh per energy format
Primary Demand Block (IEEE Floating Point)
07CF - 07D0
2000 - 2001
Amps A, Average
07D1 - 07D2
2002 - 2003
Amps B, Average
07D3 - 07D4
2004 - 2005
Amps C, Average
07D5 - 07D6
2006 - 2007
Positive Watts, 3-Ph, Average
07D7 - 07D8
2008 - 2009
Positive VARs, 3-Ph, Average
07D9 - 07DA
2010 - 2011
Negative Watts, 3-Ph, Average
07DB - 07DC
2012 - 2013
Negative VARs, 3-Ph, Average
07DD - 07DE
2014 - 2015
VAs, 3-Ph, Average
07DF - 07E0
2016 - 2017
Positive PF, 3-Ph, Average
07E1 - 07E2
2018 - 2019
Negative PF, 3-PF, Average
2
18
read-only
FLOAT
FLOAT
FLOAT
FLOAT
FLOAT
FLOAT
FLOAT
FLOAT
FLOAT
FLOAT
0 to 9999 M
0 to 9999 M
0 to 9999 M
-9999 M to +9999 M
-9999 M to +9999 M
-9999 M to +9999 M
-9999 M to +9999 M
-9999 M to +9999 M
-1.00 to +1.00
-1.00 to +1.00
amps
amps
amps
watts
VARs
watts
VARs
VAs
none
none
Block Size:
Primary Minimum Block (IEEE Floating Point)
0BB7 - 0BB8
3000 - 3001
Volts A-N, Minimum
0BB9 - 0BBA
3002 - 3003
Volts B-N, Minimum
0BBB - 0BBC
3004 - 3005
Volts C-N, Minimum
0BBD - 0BBE
3006 - 3007
Volts A-B, Minimum
0BBF - 0BC0
3008 - 3009
Volts B-C, Minimum
2
2
2
2
* see note 10
Block Size:
IM02601006E
2
30
2
2
2
2
2
2
2
2
2
2
20
read-only
FLOAT
FLOAT
FLOAT
FLOAT
FLOAT
www.eaton.com
0 to 9999 M
0 to 9999 M
0 to 9999 M
0 to 9999 M
0 to 9999 M
volts
volts
volts
volts
volts
2
2
2
2
2
MM-2
B: Modbus Map
IQ 150S
Modbus Address
Hex
0BC1
0BC3
0BC5
0BC7
0BC9
0BCB
0BCD
0BCF
0BD1
0BD3
0BD5
0BD7
-
0BC2
0BC4
0BC6
0BC8
0BCA
0BCC
0BCE
0BD0
0BD2
0BD4
0BD6
0BD8
Description1
Decimal
3010
3012
3014
3016
3018
3020
3022
3024
3026
3028
3030
3032
-
3011
3013
3015
3017
3019
3021
3023
3025
3027
3029
3031
3033
Format
Volts C-A, Minimum
Amps A, Minimum Avg Demand
Amps B, Minimum Avg Demand
Amps C, Minimum Avg Demand
Positive Watts, 3-Ph, Minimum Avg Demand
Positive VARs, 3-Ph, Minimum Avg Demand
Negative Watts, 3-Ph, Minimum Avg Demand
Negative VARs, 3-Ph, Minimum Avg Demand
VAs, 3-Ph, Minimum Avg Demand
Positive Power Factor, 3-Ph, Minimum Avg Demand
Negative Power Factor, 3-Ph, Minimum Avg Demand
Frequency, Minimum
FLOAT
FLOAT
FLOAT
FLOAT
FLOAT
FLOAT
FLOAT
FLOAT
FLOAT
FLOAT
FLOAT
FLOAT
Range6
0 to 9999 M
0 to 9999 M
0 to 9999 M
0 to 9999 M
0 to +9999 M
0 to +9999 M
0 to +9999 M
0 to +9999 M
-9999 M to +9999 M
-1.00 to +1.00
-1.00 to +1.00
0 to 65.00
Units or
Resolution
#
Reg
Comments
volts
amps
amps
amps
watts
VARs
watts
VARs
VAs
none
none
Hz
Block Size:
Primary Maximum Block (IEEE Floating Point)
0C1B - 0C1C
3100 - 3101
Volts A-N, Maximum
0C1D - 0C1E
3102 - 3103
Volts B-N, Maximum
0C1F - 0C20
3104 - 3105
Volts C-N, Maximum
0C21 - 0C22
3106 - 3107
Volts A-B, Maximum
0C23 - 0C24
3108 - 3109
Volts B-C, Maximum
0C25 - 0C26
3110 - 3111
Volts C-A, Maximum
0C27 - 0C28
3112 - 3113
Amps A, Maximum Avg Demand
0C29 - 0C2A
3114 - 3115
Amps B, Maximum Avg Demand
0C2B - 0C2C
3116 - 3117
Amps C, Maximum Avg Demand
0C2D - 0C2E
3118 - 3119
Positive Watts, 3-Ph, Maximum Avg Demand
0C2F - 0C30
3120 - 3121
Positive VARs, 3-Ph, Maximum Avg Demand
0C31 - 0C32
3122 - 3123
Negative Watts, 3-Ph, Maximum Avg Demand
0C33 - 0C34
3124 - 3125
Negative VARs, 3-Ph, Maximum Avg Demand
0C35 - 0C36
3126 - 3127
VAs, 3-Ph, Maximum Avg Demand
0C37 - 0C38
3128 - 3129
Positive Power Factor, 3-Ph, Maximum Avg Demand
0C39 - 0C3A
3130 - 3131
Negative Power Factor, 3-Ph, Maximum Avg Demand
0C3B - 0C3C
3132 - 3133
Frequency, Maximum
read-only
FLOAT
FLOAT
FLOAT
FLOAT
FLOAT
FLOAT
FLOAT
FLOAT
FLOAT
FLOAT
FLOAT
FLOAT
FLOAT
FLOAT
FLOAT
FLOAT
0 to 9999 M
0 to 9999 M
0 to 9999 M
0 to 9999 M
0 to 9999 M
0 to 9999 M
0 to 9999 M
0 to 9999 M
0 to 9999 M
0 to +9999 M
0 to +9999 M
0 to +9999 M
0 to +9999 M
-9999 M to +9999 M
-1.00 to +1.00
-1.00 to +1.00
FLOAT
0 to 65.00
volts
volts
volts
volts
volts
volts
amps
amps
amps
watts
VARs
watts
VARs
VAs
none
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
none
Hz
Block Size:
Reserved Block7, 13
0F9F - 0F9F
0FA0 - 0FA0
0FA1 - 0FA1
0FA2 - 0FA2
IM02601006E
2
2
2
2
2
2
2
2
2
2
2
2
34
2
34
read-only
4000
4001
4002
4003
-
4000
4001
4002
4003
Reserved
Reserved
Reserved
Reserved
UINT16
UINT16
UINT16
UINT16
www.eaton.com
0 to 9999, or 65535
0 to 9999, or 65535
0 to 9999, or 65535
0 to 9999, or 65535
0.1%
0.1%
0.1%
0.1%
1
1
1
1
MM-3
B: Modbus Map
IQ 150S
Modbus Address
Hex
0FA3
0FA4
0FA5
0FA6
0FA7
0FA8
0FA9
0FAA
0FAB
0FAC
0FAD
0FAE
0FAF
0FB0
0FB1
-
0FA3
0FA4
0FA5
0FA6
0FA7
0FA8
0FA9
0FAA
0FAB
0FAC
0FAD
0FAE
0FAF
0FB0
0FB8
Description1
Decimal
4004
4005
4006
4007
4008
4009
4010
4011
4012
4013
4014
4015
4016
4017
4018
-
4004
4005
4006
4007
4008
4009
4010
4011
4012
4013
4014
4015
4016
4017
4025
Format
Range6
Units or
Resolution
#
Reg
Comments
Reserved
Reserved
Reserved
Reserved
Reserved
Reserved
Reserved
Reserved
Reserved
Reserved
Reserved
Reserved
Reserved
Reserved
Reserved
1
1
1
1
1
1
1
1
1
1
1
1
1
1
8
0FB9 - 0FBC
4026 - 4029
Reserved
4
0FBD - 0FC4
4030 - 4037
Reserved
8
0FC5 - 0FC8
4038 - 4041
Reserved
4
Block Size:
Phase Angle Block14
1003 - 1003
4100
1004 - 1004
4101
1005 - 1005
4102
1006 - 1006
4103
1007 - 1007
4104
1008 - 1008
4105
read-only
-
4100
4101
4102
4103
4104
4105
Phase A Current
Phase B Current
Phase C Current
Angle, Volts A-B
Angle, Volts B-C
Angle, Volts C-A
SINT16
SINT16
SINT16
SINT16
SINT16
SINT16
-1800 to +1800
-1800 to +1800
-1800 to +1800
-1800 to +1800
-1800 to +1800
-1800 to +1800
0.1 degree
0.1 degree
0.1 degree
0.1 degree
0.1 degree
0.1 degree
Block Size:
Status Block
1387 - 1387
5000 - 5000
Meter Status
UINT16
bit-mapped
--exnpch ssssssss
1388 - 1388
1389 - 138A
5001 - 5001
5002 - 5003
Reserved
Time Since Reset
UINT32
0 to 4294967294
4 msec
read-only
exnpch = EEPROM block OK flags
(e=energy, x=max, n=min, p=programmable
settings, c=calibration, h=header),
ssssssss = state (1=Run, 2=Limp, 10=Prog
Set Update via buttons, 12=Prog Set
Update via COM2)
wraps around after max coun
Block Size:
IM02601006E
42
www.eaton.com
1
1
1
1
1
1
6
1
1
2
4
MM-4
B: Modbus Map
IQ 150S
Modbus Address
Hex
Description1
Decimal
Range6
Format
Commands Section
Resets Block9
4E1F - 4E1F
4E20 - 4E20
Units or
Resolution
#
Reg
Comments
4
write-only
20000 - 20000
20001 - 20001
Reset Max/Min Blocks
Reset Energy Accumulators
UINT16
UINT16
password5
password5
Block Size:
Meter Programming Block
55EF - 55EF
22000 - 22000
55F0 - 55F0
22001 - 22001
Initiate Programmable Settings Update
3
Terminate Programmable Settings Update
UINT16
UINT16
55F1 - 55F1
22002 - 22002
3
Calculate Programmable Settings Checksum
UINT16
55F2 - 55F2
22003 - 22003
Programmable Settings Checksum3
UINT16
55F3 - 55F3
22004 - 22004
Write New Password3
UINT16
read/conditional write
meter enters PS update mode
password5
any value
meter leaves PS update mode via reset
meter calculates checksum on RAM copy
of PS block
read/write checksum register; PS block
saved in EEPROM on write8
0000 to 9999
1
1
2
1
1
1
1
1
write-only register; always reads zero
59D7 - 59D7
23000 - 23000
Initiate Meter Firmware Reprogramming
UINT16
password5
Block Size:
Other Commands Block
61A7 - 61A7
25000 - 25000
read/write
Force Meter Restart
UINT16
password5
1
causes a watchdog reset, always reads 0
Block Size:
Encryption Block
658F - 659A
26000 - 26011
1
6
Perform a Secure Operation
read/write
encrypted command to read password or
change meter type
Block Size:
UINT16
1
12
12
Programmable Settings Section
Basic Setups Block
IM02601006E
752F - 752F
30000 - 30000
CT multiplier & denominator
UINT16
bit-mapped
dddddddd mmmmmmmm
7530 - 7530
7531 - 7531
7532 - 7532
30001 - 30001
30002 - 30002
30003 - 30003
CT numerator
PT numerator
PT denominator
UINT16
UINT16
UINT16
1 to 9999
1 to 9999
1 to 9999
none
none
none
www.eaton.com
write only in PS update mode
high byte is denominator (1 or 5, read-only),
low byte is multiplier (1, 10, or 100)
1
1
1
1
MM-5
B: Modbus Map
IQ 150S
Modbus Address
IM02601006E
Description1
Format
Range6
Units or
Resolution
Decimal
7533 - 7533
30004 - 30004
PT multiplier & hookup
UINT16
bit-mapped
mmmmmmmm MMMMhhhh
MMMMmmmmmmmm is PT multiplier (1,
10, 100, 1000),
hhhh is hookup enumeration (0 = 3 element
wye[9S], 1 = delta 2 CTs[5S], 3 = 2.5
element wye[6S])
1
7534 - 7534
30005 - 30005
Averaging Method
UINT16
bit-mapped
--iiiiii b----sss
iiiiii = interval (5,15,30,60)
b = 0-block or 1-rolling
sss = # subintervals (1,2,3,4)
1
7535 - 7535
30006 - 30006
Power & Energy Format
UINT16
bit-mapped
pppp--nn -eee-ddd
pppp = power scale (0-unit, 3-kilo, 6-mega,
8-auto)
nn = number of energy digits (5-8 --> 0-3)
eee = energy scale (0-unit, 3-kilo, 6-mega)
ddd = energy digits after decimal point (0-6)
See note 10.
1
7536 - 7536
30007 - 30007
Operating Mode Screen Enables
UINT16
bit-mapped
00000000 eeeeeeee
eeeeeeee = op mode screen rows on(1) or
off(0), rows top to bottom are bits low order
to high order
1
7537 - 753D
753E - 753E
30008 - 30014
30015 - 30015
Reserved
User Settings Flags
UINT16
bit-mapped
---g--nn srp--wf-
g = enable alternate full scale bargraph
current (1=on, 0=off)
nn = number of phases for voltage &
current screens (3=ABC, 2=AB, 1=A,
0=ABC)
s = scroll (1=on, 0=off)
r = password for reset in use (1=on, 0=off)
p = password for configuration in use
(1=on, 0=off)
w = pwr dir (0-view as load, 1-view as
generator)
f = flip power factor sign (1=yes, 0=no)
753F - 753F
30016 - 30016
Full Scale Current (for load % bargraph)
UINT16
0 to 9999
none
If non-zero and user settings bit g is set,
this value replaces CT numerator in the full
scale current calculation.
7540 - 7547
30017 - 30024
Meter Designation
ASCII
16 char
none
www.eaton.com
Comments
#
Reg
Hex
7
1
1
8
MM-6
B: Modbus Map
IQ 150S
Modbus Address
Description1
Hex
Decimal
7548 - 7548
7549 - 7549
30025 - 30025
30026 - 30026
Reserved
COM2 setup
754A
754B
754C
754D
754E
754F
7550
7555
755A
755F
7564
7569
756E
30027
30028
30029
30030
30031
30032
30033
30038
30043
30048
30053
30058
30063
COM2 address
Reserved
Reserved
Reserved
Reserved
Reserved
-
754A
754B
754C
754D
754E
754F
7554
7559
755E
7563
7568
756D
7572
-
30027
30028
30029
30030
30031
30032
30037
30042
30047
30052
30057
30062
30067
Format
Units or
Resolution
Range6
UINT16
bit-mapped
----dddd -ppp-bbb
UINT16
1 to 247
none
#
Reg
Comments
dddd = reply delay (* 50 msec)
ppp = protocol (1-Modbus RTU, 2-Modbus
ASCII, 3-DNP)
Block Size:
1
1
1
1
1
1
1
1
5
5
5
5
5
5
5
68
12-Bit RTU Readings Section
12-Bit RTU Block
9C40
9C41
9C42
9C43
9C44
9C45
9C46
9C47
9C48
9C49
9C4A
IM02601006E
-
9C40
9C41
9C42
9C43
9C44
9C45
9C46
9C47
9C48
9C49
9C4A
40001
40002
40003
40004
40005
40006
40007
40008
40009
40010
40011
-
40001
40002
40003
40004
40005
40006
40007
40008
40009
40010
40011
System Sanity Indicator
Volts A-N
Volts B-N
Volts C-N
Amps A
Amps B
Amps C
Watts, 3-Ph total
VARs, 3-Ph total
VAs, 3-Ph total
Power Factor, 3-Ph total
UINT16
UINT16
UINT16
UINT16
UINT16
UINT16
UINT16
UINT16
UINT16
UINT16
UINT16
0 or 1
2047 to 4095
2047 to 4095
2047 to 4095
0 to 4095
0 to 4095
0 to 4095
0 to 4095
0 to 4095
2047 to 4095
1047 to 3047
none
volts
volts
volts
amps
amps
amps
watts
VARs
VAs
none
9C4B - 9C4B
40012 - 40012
Frequency
UINT16
0 to 2730
Hz
9C4C - 9C4C
9C4D - 9C4D
9C4E - 9C4E
40013 - 40013
40014 - 40014
40015 - 40015
Volts A-B
Volts B-C
Volts C-A
UINT16
UINT16
UINT16
2047 to 4095
2047 to 4095
2047 to 4095
volts
volts
volts
www.eaton.com
read-only except as noted
0 indicates proper meter operatio
2047= 0, 4095= +150
volts = 150 * (register - 2047) / 2047
0= -10, 2047= 0, 4095= +10
amps = 10 * (register - 2047) / 2047
0= -3000, 2047= 0, 4095= +3000
watts, VARs, VAs =
3000 * (register - 2047) / 2047
1047= -1, 2047= 0, 3047= +1
pf = (register - 2047) / 1000
0= 45 or less, 2047= 60, 2730= 65 or more
freq = 45 + ((register / 4095) * 30)
2047= 0, 4095= +300
volts = 300 * (register - 2047) / 2047
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
MM-7
B: Modbus Map
IQ 150S
pp
p
Modbus Address
Hex
9C4F
9C50
9C51
9C52
9C53
9C54
9C55
9C57
-
9C4F
9C50
9C51
9C52
9C53
9C54
9C56
9C58
Description1
Decimal
40016
40017
40018
40019
40020
40021
40022
40024
-
40016
40017
40018
40019
40020
40021
40023
40025
Range6
Format
Units or
Resolution
#
Reg
Comments
CT numerator
CT multiplier
CT denominator
PT numerator
PT multiplier
PT denominator
W-hours, Positive
W-hours, Negative
UINT16
UINT16
UINT16
UINT16
UINT16
UINT16
UINT32
UINT32
1 to 9999
1, 10, 100
1 or 5
1 to 9999
1, 10, 100
1 to 9999
0 to 99999999
0 to 99999999
none
none
none
none
none
none
Wh per energy format
Wh per energy format
VAR-hours, Positive
UINT32
0 to 99999999
VARh per energy format
2
0 to 99999999
* resolution of digit before decimal point =
VARh per energy format units, kilo, or mega, per energy format
2
2
CT = numerator * multiplier / denominator
PT = numerator * multiplier / denominator
* 5 to 8 digits
1
1
1
1
1
1
2
2
* decimal point implied, per energy format
9C59 - 9C5A
9C5B - 9C5C
40026 - 40027
40028 - 40029
VAR-hours, Negative
UINT32
9C5D - 9C5E
40030 - 40031
VA-hours
UINT32
0 to 99999999
VAh per energy format
9C5F - 9C5F
9C60 - 9CA2
9CA3 - 9CA3
40032 - 40032
40033 - 40099
40100 - 40100
Neutral Current
Reserved
Reset Energy Accumulators
UINT16
N/A
UINT16
0 to 4095
N/A
amps
none
password5
* see note 10
see Amps A/B/C above
write-only register; always reads as 0
Block Size:
1
67
1
100
End of Map
Data Formats
ASCII
SINT16 / UINT16
SINT32 / UINT32
FLOAT
Notes
1
2
IM02601006E
ASCII characters packed 2 per register in high, low order and without any termination characters.
16-bit signed / unsigned integer.
32-bit signed / unsigned integer spanning 2 registers. The lower-addressed register is the high order half.
32-bit IEEE floating point number spanning 2 registers. The lower-addressed register is the high order half (i.e., contains the exponent).
All registers not explicitly listed in the table read as 0. Writes to these registers will be accepted but won't actually change the register (since it doesn't exist).
Meter Data Section items read as 0 until first readings are available or if the meter is not in operating mode. Writes to these registers will be accepted but won't actually change the register.
3
4
Register valid only in programmable settings update mode. In other modes these registers read as 0 and return an illegal data address exception if a write is attempted.
Meter command registers always read as 0. They may be written only when the meter is in a suitable mode. The registers return an illegal data address exception if a write is attempted in an incorrect
mode.
5
If the password is incorrect, a valid response is returned but the command is not executed. Use 5555 for the password if passwords are disabled in the programmable settings.
www.eaton.com
MM-8
IQ 150S
B: Modbus Map
(continued)
6
7
8
IM02601006E
M denotes a 1,000,000 multiplier.
Not used.
Writing this register causes data to be saved permanently in EEPROM. If there is an error while saving, a slave device failure exception is returned and programmable settings mode automatically
terminates via reset.
9
10
11
12
13
14
Reset commands make no sense if the meter state is LIMP. An illegal function exception will be returned.
Energy registers should be reset after a format change.
Not used.
Not used.
Not used.
All 3 voltage angles are measured for Wye and Delta hookups. For 2.5 Element, Vac is measured and Vab & Vbc are calculated. If a voltage phase is missing, the two voltage angles in which it
participates are set to zero. A and C phase current angles are measured for all hookups. B phase current angle is measured for Wye and is zero for other hookups. If a voltage phase is missing, its cu
angle is zero.
15
If any register in the programmable settings section is set to a value other than the acceptable value then the meter will stay in LIMP mode. Please read the comments section or the range for each register
in programmable settings section for acceptable values.
www.eaton.com
MM-9
IQ 150S
B: Modbus Map
This page intentionally left blank.
IM02601006E
www.eaton.com
MM-10
B: Modbus Map
IQ 250S
Modbus Address
Fixed Data Section
Identification Block
Hex
)
read-only
0HWHU1DPH
0HWHU6HULDO1XPEHU
0HWHU7\SH
Format
$6&,,
$6&,,
8,17
Range (Note 6)
FKDU
FKDU
ELWPDSSHG
Units or Resolution
QRQH
QRQH
VWYYY
)LUPZDUH9HUVLRQ
0DS9HUVLRQ
0HWHU&RQILJXUDWLRQ
$6&,,
8,17
8,17
FKDU
WR
ELWPDSSHG
QRQH
QRQH
FFFIIIIII
$
(
$6,&9HUVLRQ
%RRW)LUPZDUH9HUVLRQ
5HVHUYHG
5HVHUYHG
0HWHU7\SH1DPH
5HVHUYHG
5HVHUYHG
8,17
$6&,,
FKDU
QRQH
QRQH
$6&,,
FKDU
QRQH
W V YYY 9VZLWFK
9 VWDQGDUG6
FFF &7GHQRPLQDWRURU
IIIIII FDOLEUDWLRQIUHTXHQF\RU
5HVHUYHG
5HVHUYHG
%ORFN6L]H
'
(
Description (Note 1)
Decimal
Comments
# Reg
Meter Data Section (Note 2)
Primary Readings Block
(
(
(%
('
()
)
)
)
)
)
)%
)'
))
%
'
)
%
'
Hex
(
($
(&
((
)
)
)
)
)
)$
)&
)(
$
&
(
$
&
IM02601006E
Decimal
Description (Note 1)
9ROWV$1
9ROWV%1
9ROWV&1
9ROWV$%
9ROWV%&
9ROWV&$
$PSV$
$PSV%
$PSV&
:DWWV3KWRWDO
9$5V3KWRWDO
9$V3KWRWDO
3RZHU)DFWRU3KWRWDO
)UHTXHQF\
1HXWUDO&XUUHQW
:DWWV3KDVH$
:DWWV3KDVH%
:DWWV3KDVH&
9$5V3KDVH$
9$5V3KDVH%
9$5V3KDVH&
9$V3KDVH$
9$V3KDVH%
9$V3KDVH&
3RZHU)DFWRU3KDVH$
3RZHU)DFWRU3KDVH%
3RZHU)DFWRU3KDVH&
5HVHUYHG
read-only
Format
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
Range (Note 6)
WR0
WR0
WR0
WR0
WR0
WR0
WR0
WR0
WR0
0WR0
0WR0
0WR0
WR
WR
WR0
0WR0
0WR0
0WR0
0WR0
0WR0
0WR0
0WR0
0WR0
0WR0
WR
WR
WR
www.eaton.com
Units or Resolution
YROWV
YROWV
YROWV
YROWV
YROWV
YROWV
DPSV
DPSV
DPSV
ZDWWV
9$5V
9$V
QRQH
+]
DPSV
ZDWWV
ZDWWV
ZDWWV
9$5V
9$5V
9$5V
9$V
9$V
9$V
QRQH
QRQH
QRQH
Comments
3HUSKDVHSRZHUDQG3)KDYHYDOXHV
RQO\IRU:<(KRRNXSDQGZLOOEH
]HURIRUDOORWKHUKRRNXSV
5HVHUYHG
%ORFN6L]H
# Reg
MM-1
B: Modbus Map
IQ 250S
Primary Energy Block
'%
Hex
'&
Format
6,17
''
'(
:KRXUV'HOLYHUHG
6,17
')
(
(
(
(
(
(%
('
(
(
(
(
(
($
(&
((
:KRXUV1HW
:KRXUV7RWDO
9$5KRXUV3RVLWLYH
9$5KRXUV1HJDWLYH
9$5KRXUV1HW
9$5KRXUV7RWDO
9$KRXUV7RWDO
:KRXUV5HFHLYHG3KDVH$
6,17
6,17
6,17
6,17
6,17
6,17
6,17
6,17
()
)
:KRXUV5HFHLYHG3KDVH%
6,17
)
)
:KRXUV5HFHLYHG3KDVH&
6,17
)
)
:KRXUV'HOLYHUHG3KDVH$
6,17
)
)
:KRXUV'HOLYHUHG3KDVH%
6,17
)
)
:KRXUV'HOLYHUHG3KDVH&
6,17
)
)%
)'
))
%
'
)
%
'
)
)$
)&
)(
$
&
(
$
&
(
:KRXUV1HW3KDVH$
:KRXUV1HW3KDVH%
:KRXUV1HW3KDVH&
:KRXUV7RWDO3KDVH$
:KRXUV7RWDO3KDVH%
:KRXUV7RWDO3KDVH&
9$5KRXUV3RVLWLYH3KDVH$
9$5KRXUV3RVLWLYH3KDVH%
9$5KRXUV3RVLWLYH3KDVH&
9$5KRXUV1HJDWLYH3KDVH$
9$5KRXUV1HJDWLYH3KDVH%
9$5KRXUV1HJDWLYH3KDVH&
9$5KRXUV1HW3KDVH$
9$5KRXUV1HW3KDVH%
9$5KRXUV1HW3KDVH&
9$5KRXUV7RWDO3KDVH$
9$5KRXUV7RWDO3KDVH%
9$5KRXUV7RWDO3KDVH&
9$KRXUV3KDVH$
9$KRXUV3KDVH%
9$KRXUV3KDVH&
6,17
6,17
6,17
6,17
6,17
6,17
6,17
6,17
6,17
6,17
6,17
6,17
6,17
6,17
6,17
6,17
6,17
6,17
6,17
6,17
6,17
IM02601006E
read-only
Decimal
Description (Note 1)
:KRXUV5HFHLYHG
Range (Note 6)
WRRU
WR
WRRU
WR
WR
WR
WR
WR
WR
WR
WR
WRRU
WR
WRRU
WR
WRRU
WR
WRRU
WR
WRRU
WR
WRRU
WR
WR
WR
WR
WR
WR
WR
WR
WR
WR
WR
WR
WR
WR
WR
WR
WR
WR
WR
WR
WR
WR
www.eaton.com
Units or Resolution
:KSHUHQHUJ\IRUPDW
:KSHUHQHUJ\IRUPDW
:KSHUHQHUJ\IRUPDW
:KSHUHQHUJ\IRUPDW
9$5KSHUHQHUJ\IRUPDW
9$5KSHUHQHUJ\IRUPDW
9$5KSHUHQHUJ\IRUPDW
9$5KSHUHQHUJ\IRUPDW
9$KSHUHQHUJ\IRUPDW
:KSHUHQHUJ\IRUPDW
Comments
:KUHFHLYHGGHOLYHUHGDOZD\VKDYHRSSRVLWHVLJQV
# Reg
:KUHFHLYHGLVSRVLWLYHIRUYLHZDVORDGGHOLYHUHGLVSRVLWLYHIRUYLHZDVJHQHUDWRU
WRGLJLWV
GHFLPDOSRLQWLPSOLHGSHUHQHUJ\IRUPDW
UHVROXWLRQRIGLJLWEHIRUHGHFLPDOSRLQW XQLWVNLORRUPHJDSHUHQHUJ\IRUPDW
VHHQRWH
:KSHUHQHUJ\IRUPDW
:KSHUHQHUJ\IRUPDW
:KSHUHQHUJ\IRUPDW
:KSHUHQHUJ\IRUPDW
:KSHUHQHUJ\IRUPDW
:KSHUHQHUJ\IRUPDW
:KSHUHQHUJ\IRUPDW
:KSHUHQHUJ\IRUPDW
:KSHUHQHUJ\IRUPDW
:KSHUHQHUJ\IRUPDW
:KSHUHQHUJ\IRUPDW
9$5KSHUHQHUJ\IRUPDW
9$5KSHUHQHUJ\IRUPDW
9$5KSHUHQHUJ\IRUPDW
9$5KSHUHQHUJ\IRUPDW
9$5KSHUHQHUJ\IRUPDW
9$5KSHUHQHUJ\IRUPDW
9$5KSHUHQHUJ\IRUPDW
9$5KSHUHQHUJ\IRUPDW
9$5KSHUHQHUJ\IRUPDW
9$5KSHUHQHUJ\IRUPDW
9$5KSHUHQHUJ\IRUPDW
9$5KSHUHQHUJ\IRUPDW
9$KSHUHQHUJ\IRUPDW
9$KSHUHQHUJ\IRUPDW
9$KSHUHQHUJ\IRUPDW
%ORFN6L]H
MM-2
B: Modbus Map
IQ 250S
Primary Demand Block
&)
'
'
'
'
'
'%
''
')
(
(
(
(
(
(%
('
()
)
)
)
)
)
)%
)'
))
%
'
Hex
'
'
'
'
'
'$
'&
'(
(
(
(
(
(
($
(&
((
)
)
)
)
)
)$
)&
)(
$
&
(
IM02601006E
Decimal
Description (Note 1)
$PSV$$YHUDJH
$PSV%$YHUDJH
$PSV&$YHUDJH
3RVLWLYH:DWWV3K$YHUDJH
3RVLWLYH9$5V3K$YHUDJH
1HJDWLYH:DWWV3K$YHUDJH
1HJDWLYH9$5V3K$YHUDJH
9$V3K$YHUDJH
3RVLWLYH3)3K$YHUDJH
1HJDWLYH3)3)$YHUDJH
1HXWUDO&XUUHQW$YHUDJH
3RVLWLYH:DWWV3KDVH$$YHUDJH
3RVLWLYH:DWWV3KDVH%$YHUDJH
3RVLWLYH:DWWV3KDVH&$YHUDJH
3RVLWLYH9$5V3KDVH$$YHUDJH
3RVLWLYH9$5V3KDVH%$YHUDJH
3RVLWLYH9$5V3KDVH&$YHUDJH
1HJDWLYH:DWWV3KDVH$$YHUDJH
1HJDWLYH:DWWV3KDVH%$YHUDJH
1HJDWLYH:DWWV3KDVH&$YHUDJH
1HJDWLYH9$5V3KDVH$$YHUDJH
1HJDWLYH9$5V3KDVH%$YHUDJH
1HJDWLYH9$5V3KDVH&$YHUDJH
9$V3KDVH$$YHUDJH
9$V3KDVH%$YHUDJH
9$V3KDVH&$YHUDJH
3RVLWLYH3)3KDVH$$YHUDJH
3RVLWLYH3)3KDVH%$YHUDJH
3RVLWLYH3)3KDVH&$YHUDJH
1HJDWLYH3)3KDVH$$YHUDJH
1HJDWLYH3)3KDVH%$YHUDJH
1HJDWLYH3)3KDVH&$YHUDJH
read-only
Format
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
Range (Note 6)
WR0
WR0
WR0
0WR0
0WR0
0WR0
0WR0
0WR0
WR
WR
WR0
0WR0
0WR0
0WR0
0WR0
0WR0
0WR0
0WR0
0WR0
0WR0
0WR0
0WR0
0WR0
0WR0
0WR0
0WR0
WR
WR
WR
WR
WR
WR
www.eaton.com
Units or Resolution
DPSV
DPSV
DPSV
ZDWWV
9$5V
ZDWWV
9$5V
9$V
QRQH
QRQH
DPSV
ZDWWV
ZDWWV
ZDWWV
9$5V
9$5V
9$5V
ZDWWV
ZDWWV
ZDWWV
9$5V
9$5V
9$5V
9$V
9$V
9$V
QRQH
QRQH
QRQH
QRQH
QRQH
QRQH
Comments
%ORFN6L]H
# Reg
MM-3
B: Modbus Map
IQ 250S
Uncompensated Readings Block
%%
%%
%%%
%%'
%%)
%&
%&
%&
2%&
%&
%&%
%&'
%&)
%'
%'
%'
%'
Hex
%%
%%$
%%&
%%(
%&
%&
%&
%&
%&
%&$
%&&
%&(
%'
%'
%'
%'
%'
Format
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
6,17
%'
%'$
:KRXUV'HOLYHUHG
6,17
%'%
%''
%')
%(
%(
%(
%(
%(
%'&
%'(
%(
%(
%(
%(
%(
%($
:KRXUV1HW
:KRXUV7RWDO
9$5KRXUV3RVLWLYH
9$5KRXUV1HJDWLYH
9$5KRXUV1HW
9$5KRXUV7RWDO
9$KRXUV7RWDO
:KRXUV5HFHLYHG3KDVH$
6,17
6,17
6,17
6,17
6,17
6,17
6,17
6,17
%(%
%(&
:KRXUV5HFHLYHG3KDVH%
6,17
%('
%((
:KRXUV5HFHLYHG3KDVH&
6,17
%()
%)
:KRXUV'HOLYHUHG3KDVH$
6,17
%)
%)
:KRXUV'HOLYHUHG3KDVH%
6,17
%)
%)
:KRXUV'HOLYHUHG3KDVH&
6,17
%)
%)
%)
%)%
%)'
%))
&
&
&
&
&
&%
&'
&)
&
&
&
&
&
&%
&'
%)
%)
%)$
%)&
%)(
&
&
&
&
&
&$
&&
&(
&
&
&
&
&
&$
&&
&(
:KRXUV1HW3KDVH$
:KRXUV1HW3KDVH%
:KRXUV1HW3KDVH&
:KRXUV7RWDO3KDVH$
:KRXUV7RWDO3KDVH%
:KRXUV7RWDO3KDVH&
9$5KRXUV3RVLWLYH3KDVH$
9$5KRXUV3RVLWLYH3KDVH%
9$5KRXUV3RVLWLYH3KDVH&
9$5KRXUV1HJDWLYH3KDVH$
9$5KRXUV1HJDWLYH3KDVH%
9$5KRXUV1HJDWLYH3KDVH&
9$5KRXUV1HW3KDVH$
9$5KRXUV1HW3KDVH%
9$5KRXUV1HW3KDVH&
9$5KRXUV7RWDO3KDVH$
9$5KRXUV7RWDO3KDVH%
9$5KRXUV7RWDO3KDVH&
9$KRXUV3KDVH$
9$KRXUV3KDVH%
9$KRXUV3KDVH&
6,17
6,17
6,17
6,17
6,17
6,17
6,17
6,17
6,17
6,17
6,17
6,17
6,17
6,17
6,17
6,17
6,17
6,17
6,17
6,17
6,17
IM02601006E
read-only
Decimal
Description (Note 1)
:DWWV3KWRWDO
9$5V3KWRWDO
9$V3KWRWDO
3RZHU)DFWRU3KWRWDO
:DWWV3KDVH$
:DWWV3KDVH%
:DWWV3KDVH&
9$5V3KDVH$
9$5V3KDVH%
9$5V3KDVH&
9$V3KDVH$
9$V3KDVH%
9$V3KDVH&
3RZHU)DFWRU3KDVH$
3RZHU)DFWRU3KDVH%
3RZHU)DFWRU3KDVH&
:KRXUV5HFHLYHG
Range (Note 6)
0WR0
0WR0
0WR0
WR
0WR0
0WR0
0WR0
0WR0
0WR0
0WR0
0WR0
0WR0
0WR0
WR
WR
WR
WRRU
WR
WRRU
WR
WR
WR
WR
WR
WR
WR
WR
WRRU
WR
WRRU
WR
WRRU
WR
WRRU
WR
WRRU
WR
WRRU
WR
WR
WR
WR
WR
WR
WR
WR
WR
WR
WR
WR
WR
WR
WR
WR
WR
WR
WR
WR
WR
WR
www.eaton.com
Units or Resolution
ZDWWV
9$5V
9$V
QRQH
ZDWWV
ZDWWV
ZDWWV
9$5V
9$5V
9$5V
9$V
9$V
9$V
QRQH
QRQH
QRQH
:KSHUHQHUJ\IRUPDW
:KSHUHQHUJ\IRUPDW
:KSHUHQHUJ\IRUPDW
:KSHUHQHUJ\IRUPDW
9$5KSHUHQHUJ\IRUPDW
9$5KSHUHQHUJ\IRUPDW
9$5KSHUHQHUJ\IRUPDW
9$5KSHUHQHUJ\IRUPDW
9$KSHUHQHUJ\IRUPDW
:KSHUHQHUJ\IRUPDW
Comments
3HUSKDVHSRZHUDQG3)KDYHYDOXHV
RQO\IRU:<(KRRNXSDQGZLOOEH
]HURIRUDOORWKHUKRRNXSV
:KUHFHLYHGGHOLYHUHGDOZD\VKDYHRSSRVLWHVLJQV
# Reg
:KUHFHLYHGLVSRVLWLYHIRUYLHZDVORDGGHOLYHUHGLVSRVLWLYHIRUYLHZDVJHQHUDWRU
WRGLJLWV
GHFLPDOSRLQWLPSOLHGSHUHQHUJ\IRUPDW
UHVROXWLRQRIGLJLWEHIRUHGHFLPDOSRLQW XQLWVNLORRUPHJDSHUHQHUJ\IRUPDW
VHHQRWH
:KSHUHQHUJ\IRUPDW
:KSHUHQHUJ\IRUPDW
:KSHUHQHUJ\IRUPDW
:KSHUHQHUJ\IRUPDW
:KSHUHQHUJ\IRUPDW
:KSHUHQHUJ\IRUPDW
:KSHUHQHUJ\IRUPDW
:KSHUHQHUJ\IRUPDW
:KSHUHQHUJ\IRUPDW
:KSHUHQHUJ\IRUPDW
:KSHUHQHUJ\IRUPDW
9$5KSHUHQHUJ\IRUPDW
9$5KSHUHQHUJ\IRUPDW
9$5KSHUHQHUJ\IRUPDW
9$5KSHUHQHUJ\IRUPDW
9$5KSHUHQHUJ\IRUPDW
9$5KSHUHQHUJ\IRUPDW
9$5KSHUHQHUJ\IRUPDW
9$5KSHUHQHUJ\IRUPDW
9$5KSHUHQHUJ\IRUPDW
9$5KSHUHQHUJ\IRUPDW
9$5KSHUHQHUJ\IRUPDW
9$5KSHUHQHUJ\IRUPDW
9$KSHUHQHUJ\IRUPDW
9$KSHUHQHUJ\IRUPDW
9$KSHUHQHUJ\IRUPDW
%ORFN6L]H
MM-4
B: Modbus Map
IQ 250S
Phase Angle Block
Hex
Description (Note 1)
Decimal
3RUW,'
0HWHU6WDWXV
Description (Note 1)
Format
6,17
6,17
6,17
6,17
6,17
6,17
Range (Note 6)
WR
WR
WR
WR
WR
WR
Units or Resolution
GHJUHH
GHJUHH
GHJUHH
GHJUHH
GHJUHH
GHJUHH
Format
8,17
8,17
Range (Note 6)
WR
ELWPDSSHG
Units or Resolution
QRQH
PPPSFKIIHHFFF
Comments
,GHQWLILHVZKLFK6KDUN&20SRUWDPDVWHULVFRQQHFWHGWRIRU&20IRU&20HWF
PPP PHDVXUHPHQWVWDWH RII UXQQLQJQRUPDOO\ OLPSPRGH ZDUPXS ERRW
RWKHUVXQXVHG6HHQRWH
SFK 190(0EORFN2.IODJVS SURILOHF FDOLEUDWLRQK KHDGHUIODJLVLI2.
II IODVKVWDWH LQLWLDOL]LQJ ORJJLQJGLVDEOHGE\9VZLWFK ORJJLQJ
HH HGLWVWDWH VWDUWXS QRUPDO SULYLOHJHGFRPPDQGVHVVLRQ SURILOHXSGDWHPRGH
FFF SRUWHQDEOHGIRUHGLW QRQH &20&20 IURQWSDQHO
KLJKE\WHLVVHWSW LQ RXW
ORZE\WHLVVHWSW LQ RXW
VHHQRWHV
ZUDSVDURXQGDIWHUPD[FRXQW
5HVHUYHG
6XQ 0RQHWF
%ORFN6L]H
%ORFN6L]H
Status Block
/LPLWV6WDWXV
8,17
ELWPDSSHG
%
(
)
$
'
(
)
7LPH6LQFH5HVHW
0HWHU2Q7LPH
&XUUHQW'DWHDQG7LPH
5HVHUYHG
&XUUHQW'D\RI:HHN
8,17
767$03
767$03
8,17
WR
-DQ'HF
-DQ'HF
WR
PVHF
VHF
VHF
GD\
Format
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
Range (Note 6)
WR0
WR0
WR0
WR0
WR0
WR0
WR0
WR0
WR0
WR0
WR0
WR0
Units or Resolution
YROWV
YROWV
YROWV
YROWV
YROWV
YROWV
YROWV
YROWV
YROWV
YROWV
YROWV
YROWV
)
)
)%
)'
))
)
)
)
)
)
)%
)'
IM02601006E
Description (Note 1)
Decimal
9ROWV$1SUHYLRXV'HPDQGLQWHUYDO6KRUW7HUP0LQLPXP
9ROWV%1SUHYLRXV'HPDQGLQWHUYDO6KRUW7HUP0LQLPXP
9ROWV&1SUHYLRXV'HPDQGLQWHUYDO6KRUW7HUP0LQLPXP
9ROWV$%SUHYLRXV'HPDQGLQWHUYDO6KRUW7HUP0LQLPXP
9ROWV%&SUHYLRXV'HPDQGLQWHUYDO6KRUW7HUP0LQLPXP
9ROWV&$SUHYLRXV'HPDQGLQWHUYDO6KRUW7HUP0LQLPXP
9ROWV$16KRUW7HUP0LQLPXP
9ROWV%16KRUW7HUP0LQLPXP
9ROWV&16KRUW7HUP0LQLPXP
9ROWV$%6KRUW7HUP0LQLPXP
9ROWV%&6KRUW7HUP0LQLPXP
9ROWV&$6KRUW7HUP0LQLPXP
www.eaton.com
# Reg
Comments
0LQLPXPLQVWDQWDQHRXVYDOXHPHDVXUHGGXULQJWKHGHPDQGLQWHUYDOEHIRUHWKHRQHPRVW
UHFHQWO\FRPSOHWHG
0LQLPXPLQVWDQWDQHRXVYDOXHPHDVXUHGGXULQJWKHPRVWUHFHQWO\FRPSOHWHGGHPDQGLQWHUYDO
%ORFN6L]H
# Reg
read-only
Short term Primary Minimum Block
Hex
)
)$
)&
)(
)
)
)
)
)
)$
)&
)(
Comments
%ORFN6L]H
read-only
Hex
read-only
Decimal
3KDVH$&XUUHQW
3KDVH%&XUUHQW
3KDVH&&XUUHQW
$QJOH9ROWV$%
$QJOH9ROWV%&
$QJOH9ROWV&$
# Reg
MM-5
B: Modbus Map
IQ 250S
Primary Minimum Block
))
)
)
)
)
)
)%
)'
))
)
)
)
)
)
)%
)'
))
)
)
)
)
)
)%
)'
))
)
)
)
)
)
)%
)'
))
)
)
)
)
)
)%
)'
)(
))
)
)
)
)
Hex
)
)
)
)
)
)$
)&
)(
)
)
)
)
)
)$
)&
)(
)
)
)
)
)
)$
)&
)(
)
)
)
)
)
)$
)&
)(
)
)
)
)
)
)$
)&
)'
)(
))
)
)
)
)%
IM02601006E
Decimal
Description (Note 1)
9ROWV$10LQLPXP
9ROWV%10LQLPXP
9ROWV&10LQLPXP
9ROWV$%0LQLPXP
9ROWV%&0LQLPXP
9ROWV&$0LQLPXP
$PSV$0LQLPXP$YJ'HPDQG
$PSV%0LQLPXP$YJ'HPDQG
$PSV&0LQLPXP$YJ'HPDQG
3RVLWLYH:DWWV3K0LQLPXP$YJ'HPDQG
3RVLWLYH9$5V3K0LQLPXP$YJ'HPDQG
1HJDWLYH:DWWV3K0LQLPXP$YJ'HPDQG
1HJDWLYH9$5V3K0LQLPXP$YJ'HPDQG
9$V3K0LQLPXP$YJ'HPDQG
3RVLWLYH3RZHU)DFWRU3K0LQLPXP$YJ'HPDQG
1HJDWLYH3RZHU)DFWRU3K0LQLPXP$YJ'HPDQG
)UHTXHQF\0LQLPXP
1HXWUDO&XUUHQW0LQLPXP$YJ'HPDQG
3RVLWLYH:DWWV3KDVH$0LQLPXP$YJ'HPDQG
3RVLWLYH:DWWV3KDVH%0LQLPXP$YJ'HPDQG
3RVLWLYH:DWWV3KDVH&0LQLPXP$YJ'HPDQG
3RVLWLYH9$5V3KDVH$0LQLPXP$YJ'HPDQG
3RVLWLYH9$5V3KDVH%0LQLPXP$YJ'HPDQG
3RVLWLYH9$5V3KDVH&0LQLPXP$YJ'HPDQG
1HJDWLYH:DWWV3KDVH$0LQLPXP$YJ'HPDQG
1HJDWLYH:DWWV3KDVH%0LQLPXP$YJ'HPDQG
1HJDWLYH:DWWV3KDVH&0LQLPXP$YJ'HPDQG
1HJDWLYH9$5V3KDVH$0LQLPXP$YJ'HPDQG
1HJDWLYH9$5V3KDVH%0LQLPXP$YJ'HPDQG
1HJDWLYH9$5V3KDVH&0LQLPXP$YJ'HPDQG
9$V3KDVH$0LQLPXP$YJ'HPDQG
9$V3KDVH%0LQLPXP$YJ'HPDQG
9$V3KDVH&0LQLPXP$YJ'HPDQG
3RVLWLYH3)3KDVH$0LQLPXP$YJ'HPDQG
3RVLWLYH3)3KDVH%0LQLPXP$YJ'HPDQG
3RVLWLYH3)3KDVH&0LQLPXP$YJ'HPDQG
1HJDWLYH3)3KDVH$0LQLPXP$YJ'HPDQG
1HJDWLYH3)3KDVH%0LQLPXP$YJ'HPDQG
1HJDWLYH3)3KDVH&0LQLPXP$YJ'HPDQG
5HVHUYHG
5HVHUYHG
5HVHUYHG
5HVHUYHG
5HVHUYHG
5HVHUYHG
5HVHUYHG
read-only
Format
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
Range (Note 6)
WR0
WR0
WR0
WR0
WR0
WR0
WR0
WR0
WR0
WR0
WR0
WR0
WR0
0WR0
WR
WR
WR
WR0
0WR0
0WR0
0WR0
0WR0
0WR0
0WR0
0WR0
0WR0
0WR0
0WR0
0WR0
0WR0
0WR0
0WR0
0WR0
WR
WR
WR
WR
WR
WR
Units or Resolution
YROWV
YROWV
YROWV
YROWV
YROWV
YROWV
DPSV
DPSV
DPSV
ZDWWV
9$5V
ZDWWV
9$5V
9$V
QRQH
QRQH
+]
DPSV
ZDWWV
ZDWWV
ZDWWV
9$5V
9$5V
9$5V
ZDWWV
ZDWWV
ZDWWV
9$5V
9$5V
9$5V
9$V
9$V
9$V
QRQH
QRQH
QRQH
QRQH
QRQH
QRQH
www.eaton.com
Comments
5HVHUYHG
%ORFN6L]H
# Reg
MM-6
B: Modbus Map
IQ 250S
Primary Minimum Timestamp Block
&)
'
'
'
'%
'(
(
(
(
($
('
)
)
)
)
)&
))
%
(
$
'
&
)
%
(
$
'
Hex
'
'
'
'$
''
(
(
(
(
(&
()
)
)
)
)%
)(
$
'
&
)
%
(
$
'
&
)
IM02601006E
Decimal
Description (Note 1)
9ROWV$10LQ7LPHVWDPS
9ROWV%10LQ7LPHVWDPS
9ROWV&10LQ7LPHVWDPS
9ROWV$%0LQ7LPHVWDPS
9ROWV%&0LQ7LPHVWDPS
9ROWV&$0LQ7LPHVWDPS
$PSV$0LQ$YJ'PG7LPHVWDPS
$PSV%0LQ$YJ'PG7LPHVWDPS
$PSV&0LQ$YJ'PG7LPHVWDPS
3RVLWLYH:DWWV3K0LQ$YJ'PG7LPHVWDPS
3RVLWLYH9$5V3K0LQ$YJ'PG7LPHVWDPS
1HJDWLYH:DWWV3K0LQ$YJ'PG7LPHVWDPS
1HJDWLYH9$5V3K0LQ$YJ'PG7LPHVWDPS
9$V3K0LQ$YJ'PG7LPHVWDPS
3RVLWLYH3RZHU)DFWRU3K0LQ$YJ'PG7LPHVWDPS
1HJDWLYH3RZHU)DFWRU3K0LQ$YJ'PG7LPHVWDPS
)UHTXHQF\0LQ7LPHVWDPS
1HXWUDO&XUUHQW0LQ$YJ'PG7LPHVWDPS
3RVLWLYH:DWWV3KDVH$0LQ$YJ'PG7LPHVWDPS
3RVLWLYH:DWWV3KDVH%0LQ$YJ'PG7LPHVWDPS
3RVLWLYH:DWWV3KDVH&0LQ$YJ'PG7LPHVWDPS
3RVLWLYH9$5V3KDVH$0LQ$YJ'PG7LPHVWDPS
3RVLWLYH9$5V3KDVH%0LQ$YJ'PG7LPHVWDPS
3RVLWLYH9$5V3KDVH&0LQ$YJ'PG7LPHVWDPS
1HJDWLYH:DWWV3KDVH$0LQ$YJ'PG7LPHVWDPS
1HJDWLYH:DWWV3KDVH%0LQ$YJ'PG7LPHVWDPS
1HJDWLYH:DWWV3KDVH&0LQ$YJ'PG7LPHVWDPS
1HJDWLYH9$5V3KDVH$0LQ$YJ'PG7LPHVWDPS
1HJDWLYH9$5V3KDVH%0LQ$YJ'PG7LPHVWDPS
1HJDWLYH9$5V3KDVH&0LQ$YJ'PG7LPHVWDPS
9$V3KDVH$0LQ$YJ'PG7LPHVWDPS
9$V3KDVH%0LQ$YJ'PG7LPHVWDPS
9$V3KDVH&0LQ$YJ'PG7LPHVWDPS
3RVLWLYH3)3KDVH$0LQ$YJ'PG7LPHVWDPS
3RVLWLYH3)3KDVH%0LQ$YJ'PG7LPHVWDPS
3RVLWLYH3)3KDVH&0LQ$YJ'PG7LPHVWDPS
1HJDWLYH3)3KDVH$0LQ$YJ'PG7LPHVWDPS
1HJDWLYH3)3KDVH%0LQ$YJ'PG7LPHVWDPS
1HJDWLYH3)3KDVH&0LQ$YJ'PG7LPHVWDPS
5HVHUYHG
5HVHUYHG
5HVHUYHG
5HVHUYHG
5HVHUYHG
5HVHUYHG
5HVHUYHG
read-only
Format
767$03
767$03
767$03
767$03
767$03
767$03
767$03
767$03
767$03
767$03
767$03
767$03
767$03
767$03
767$03
767$03
767$03
767$03
767$03
767$03
767$03
767$03
767$03
767$03
767$03
767$03
767$03
767$03
767$03
767$03
767$03
767$03
767$03
767$03
767$03
767$03
767$03
767$03
767$03
Range (Note 6)
-DQ'HF
-DQ'HF
-DQ'HF
-DQ'HF
-DQ'HF
-DQ'HF
-DQ'HF
-DQ'HF
-DQ'HF
-DQ'HF
-DQ'HF
-DQ'HF
-DQ'HF
-DQ'HF
-DQ'HF
-DQ'HF
-DQ'HF
-DQ'HF
-DQ'HF
-DQ'HF
-DQ'HF
-DQ'HF
-DQ'HF
-DQ'HF
-DQ'HF
-DQ'HF
-DQ'HF
-DQ'HF
-DQ'HF
-DQ'HF
-DQ'HF
-DQ'HF
-DQ'HF
-DQ'HF
-DQ'HF
-DQ'HF
-DQ'HF
-DQ'HF
-DQ'HF
Units or Resolution
VHF
VHF
VHF
VHF
VHF
VHF
VHF
VHF
VHF
VHF
VHF
VHF
VHF
VHF
VHF
VHF
VHF
VHF
VHF
VHF
VHF
VHF
VHF
VHF
VHF
VHF
VHF
VHF
VHF
VHF
VHF
VHF
VHF
VHF
VHF
VHF
VHF
VHF
VHF
www.eaton.com
Comments
5HVHUYHG
%ORFN6L]H
# Reg
MM-7
B: Modbus Map
IQ 250S
Short term Primary Maximum Block
Hex
)
%
'
)
$
&
(
Decimal
Description (Note 1)
9ROWV$1SUHYLRXV'HPDQGLQWHUYDO6KRUW7HUP0D[LPXP
9ROWV%1SUHYLRXV'HPDQGLQWHUYDO6KRUW7HUP0D[LPXP
9ROWV&1SUHYLRXV'HPDQGLQWHUYDO6KRUW7HUP0D[LPXP
9ROWV$%SUHYLRXV'HPDQGLQWHUYDO6KRUW7HUP0D[LPXP
9ROWV%&SUHYLRXV'HPDQGLQWHUYDO6KRUW7HUP0D[LPXP
9ROWV&$SUHYLRXV'HPDQGLQWHUYDO6KRUW7HUP0D[LPXP
9ROWV$10D[LPXP
9ROWV%10D[LPXP
9ROWV&10D[LPXP
9ROWV$%0D[LPXP
9ROWV%&0D[LPXP
9ROWV&$0D[LPXP
Range (Note 6)
WR0
WR0
WR0
WR0
WR0
WR0
WR0
WR0
WR0
WR0
WR0
WR0
Units or Resolution
YROWV
YROWV
YROWV
YROWV
YROWV
YROWV
YROWV
YROWV
YROWV
YROWV
YROWV
YROWV
Format
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
Range (Note 6)
WR0
WR0
WR0
WR0
WR0
WR0
WR0
WR0
WR0
WR0
WR0
WR0
WR0
0WR0
WR
WR
WR
WR0
0WR0
0WR0
0WR0
0WR0
0WR0
0WR0
0WR0
0WR0
0WR0
0WR0
0WR0
0WR0
0WR0
0WR0
0WR0
WR
WR
WR
WR
WR
WR
Units or Resolution
YROWV
YROWV
YROWV
YROWV
YROWV
YROWV
DPSV
DPSV
DPSV
ZDWWV
9$5V
ZDWWV
9$5V
9$V
QRQH
QRQH
+]
DPSV
ZDWWV
ZDWWV
ZDWWV
9$5V
9$5V
9$5V
ZDWWV
ZDWWV
ZDWWV
9$5V
9$5V
9$5V
9$V
9$V
9$V
QRQH
QRQH
QRQH
QRQH
QRQH
QRQH
Primary Maximum Block
%
'
)
%
'
)
%
'
)
%
'
)
%
'
)
$
%
Hex
$
&
(
$
&
(
$
&
(
$
&
(
$
&
(
$
IM02601006E
Decimal
Description (Note 1)
9ROWV$10D[LPXP
9ROWV%10D[LPXP
9ROWV&10D[LPXP
9ROWV$%0D[LPXP
9ROWV%&0D[LPXP
9ROWV&$0D[LPXP
$PSV$0D[LPXP$YJ'HPDQG
$PSV%0D[LPXP$YJ'HPDQG
$PSV&0D[LPXP$YJ'HPDQG
3RVLWLYH:DWWV3K0D[LPXP$YJ'HPDQG
3RVLWLYH9$5V3K0D[LPXP$YJ'HPDQG
1HJDWLYH:DWWV3K0D[LPXP$YJ'HPDQG
1HJDWLYH9$5V3K0D[LPXP$YJ'HPDQG
9$V3K0D[LPXP$YJ'HPDQG
3RVLWLYH3RZHU)DFWRU3K0D[LPXP$YJ'HPDQG
1HJDWLYH3RZHU)DFWRU3K0D[LPXP$YJ'HPDQG
)UHTXHQF\0D[LPXP
1HXWUDO&XUUHQW0D[LPXP$YJ'HPDQG
3RVLWLYH:DWWV3KDVH$0D[LPXP$YJ'HPDQG
3RVLWLYH:DWWV3KDVH%0D[LPXP$YJ'HPDQG
3RVLWLYH:DWWV3KDVH&0D[LPXP$YJ'HPDQG
3RVLWLYH9$5V3KDVH$0D[LPXP$YJ'HPDQG
3RVLWLYH9$5V3KDVH%0D[LPXP$YJ'HPDQG
3RVLWLYH9$5V3KDVH&0D[LPXP$YJ'HPDQG
1HJDWLYH:DWWV3KDVH$0D[LPXP$YJ'HPDQG
1HJDWLYH:DWWV3KDVH%0D[LPXP$YJ'HPDQG
1HJDWLYH:DWWV3KDVH&0D[LPXP$YJ'HPDQG
1HJDWLYH9$5V3KDVH$0D[LPXP$YJ'HPDQG
1HJDWLYH9$5V3KDVH%0D[LPXP$YJ'HPDQG
1HJDWLYH9$5V3KDVH&0D[LPXP$YJ'HPDQG
9$V3KDVH$0D[LPXP$YJ'HPDQG
9$V3KDVH%0D[LPXP$YJ'HPDQG
9$V3KDVH&0D[LPXP$YJ'HPDQG
3RVLWLYH3)3KDVH$0D[LPXP$YJ'HPDQG
3RVLWLYH3)3KDVH%0D[LPXP$YJ'HPDQG
3RVLWLYH3)3KDVH&0D[LPXP$YJ'HPDQG
1HJDWLYH3)3KDVH$0D[LPXP$YJ'HPDQG
1HJDWLYH3)3KDVH%0D[LPXP$YJ'HPDQG
1HJDWLYH3)3KDVH&0D[LPXP$YJ'HPDQG
5HVHUYHG
5HVHUYHG
5HVHUYHG
5HVHUYHG
5HVHUYHG
5HVHUYHG
5HVHUYHG
read-only
Format
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
Comments
0D[LPXPLQVWDQWDQHRXVYDOXHPHDVXUHGGXULQJWKHGHPDQGLQWHUYDOEHIRUHWKHRQHPRVW
UHFHQWO\FRPSOHWHG
0D[LPXPLQVWDQWDQHRXVYDOXHPHDVXUHGGXULQJWKHPRVWUHFHQWO\FRPSOHWHGGHPDQGLQWHUYDO
%ORFN6L]H
read-only
www.eaton.com
Comments
5HVHUYHG
%ORFN6L]H
# Reg
# Reg
MM-8
B: Modbus Map
IQ 250S
Primary Maximum Timestamp Block
%
%$
%'
&
&
&
&
&&
&)
'
'
'
'%
'(
(
(
(
($
('
)
)
)
)
)&
))
%
(
$
'
&
)
%
(
Hex
%
%&
%)
&
&
&
&%
&(
'
'
'
'$
''
(
(
(
(
(&
()
)
)
)
)%
)(
$
'
&
)
%
(
$
'
)
IM02601006E
Decimal
Description (Note 1)
9ROWV$10D[7LPHVWDPS
9ROWV%10D[7LPHVWDPS
9ROWV&10D[7LPHVWDPS
9ROWV$%0D[7LPHVWDPS
9ROWV%&0D[7LPHVWDPS
9ROWV&$0D[7LPHVWDPS
$PSV$0D[$YJ'PG7LPHVWDPS
$PSV%0D[$YJ'PG7LPHVWDPS
$PSV&0D[$YJ'PG7LPHVWDPS
3RVLWLYH:DWWV3K0D[$YJ'PG7LPHVWDPS
3RVLWLYH9$5V3K0D[$YJ'PG7LPHVWDPS
1HJDWLYH:DWWV3K0D[$YJ'PG7LPHVWDPS
1HJDWLYH9$5V3K0D[$YJ'PG7LPHVWDPS
9$V3K0D[$YJ'PG7LPHVWDPS
3RVLWLYH3RZHU)DFWRU3K0D[$YJ'PG7LPHVWDPS
1HJDWLYH3RZHU)DFWRU3K0D[$YJ'PG7LPHVWDPS
)UHTXHQF\0D[7LPHVWDPS
1HXWUDO&XUUHQW0D[$YJ'PG7LPHVWDPS
3RVLWLYH:DWWV3KDVH$0D[$YJ'PG7LPHVWDPS
3RVLWLYH:DWWV3KDVH%0D[$YJ'PG7LPHVWDPS
3RVLWLYH:DWWV3KDVH&0D[$YJ'PG7LPHVWDPS
3RVLWLYH9$5V3KDVH$0D[$YJ'PG7LPHVWDPS
3RVLWLYH9$5V3KDVH%0D[$YJ'PG7LPHVWDPS
3RVLWLYH9$5V3KDVH&0D[$YJ'PG7LPHVWDPS
1HJDWLYH:DWWV3KDVH$0D[$YJ'PG7LPHVWDPS
1HJDWLYH:DWWV3KDVH%0D[$YJ'PG7LPHVWDPS
1HJDWLYH:DWWV3KDVH&0D[$YJ'PG7LPHVWDPS
1HJDWLYH9$5V3KDVH$0D[$YJ'PG7LPHVWDPS
1HJDWLYH9$5V3KDVH%0D[$YJ'PG7LPHVWDPS
1HJDWLYH9$5V3KDVH&0D[$YJ'PG7LPHVWDPS
9$V3KDVH$0D[$YJ'PG7LPHVWDPS
9$V3KDVH%0D[$YJ'PG7LPHVWDPS
9$V3KDVH&0D[$YJ'PG7LPHVWDPS
3RVLWLYH3)3KDVH$0D[$YJ'PG7LPHVWDPS
3RVLWLYH3)3KDVH%0D[$YJ'PG7LPHVWDPS
3RVLWLYH3)3KDVH&0D[$YJ'PG7LPHVWDPS
1HJDWLYH3)3KDVH$0D[$YJ'PG7LPHVWDPS
1HJDWLYH3)3KDVH%0D[$YJ'PG7LPHVWDPS
1HJDWLYH3)3KDVH&0D[$YJ'PG7LPHVWDPS
5HVHUYHG
5HVHUYHG
5HVHUYHG
5HVHUYHG
5HVHUYHG
5HVHUYHG
5HVHUYHG
read-only
Format
767$03
767$03
767$03
767$03
767$03
767$03
767$03
767$03
767$03
767$03
767$03
767$03
767$03
767$03
767$03
767$03
767$03
767$03
767$03
767$03
767$03
767$03
767$03
767$03
767$03
767$03
767$03
767$03
767$03
767$03
767$03
767$03
767$03
767$03
767$03
767$03
767$03
767$03
767$03
Range (Note 6)
-DQ'HF
-DQ'HF
-DQ'HF
-DQ'HF
-DQ'HF
-DQ'HF
-DQ'HF
-DQ'HF
-DQ'HF
-DQ'HF
-DQ'HF
-DQ'HF
-DQ'HF
-DQ'HF
-DQ'HF
-DQ'HF
-DQ'HF
-DQ'HF
-DQ'HF
-DQ'HF
-DQ'HF
-DQ'HF
-DQ'HF
-DQ'HF
-DQ'HF
-DQ'HF
-DQ'HF
-DQ'HF
-DQ'HF
-DQ'HF
-DQ'HF
-DQ'HF
-DQ'HF
-DQ'HF
-DQ'HF
-DQ'HF
-DQ'HF
-DQ'HF
-DQ'HF
Units or Resolution
VHF
VHF
VHF
VHF
VHF
VHF
VHF
VHF
VHF
VHF
VHF
VHF
VHF
VHF
VHF
VHF
VHF
VHF
VHF
VHF
VHF
VHF
VHF
VHF
VHF
VHF
VHF
VHF
VHF
VHF
VHF
VHF
VHF
VHF
VHF
VHF
VHF
VHF
VHF
www.eaton.com
Comments
5HVHUYHG
%ORFN6L]H
# Reg
MM-9
B: Modbus Map
IQ 250S
Commands Section (Note 4)
Resets Block (Note 9)
()
(
(
(
(
(
(
(
(
(
(%
(&
('
((
Hex
()
(
(
(
(
(
(
(
((
($
(%
(&
('
((
write-only
Decimal
Description (Note 1)
5HVHW0D[0LQ%ORFNV
5HVHW(QHUJ\$FFXPXODWRUV
5HVHW$ODUP/RJ1RWH
Format
8,17
8,17
8,17
Range (Note 6)
SDVVZRUG1RWH
SDVVZRUG1RWH
SDVVZRUG1RWH
8,17
8,17
8,17
8,17
SDVVZRUG1RWH
SDVVZRUG1RWH
SDVVZRUG1RWH
SDVVZRUG1RWH
Decimal
Description (Note 1)
,QLWLDWH0HWHU)LUPZDUH5HSURJUDPPLQJ
)RUFH0HWHU5HVWDUW
2SHQ3ULYLOHJHG&RPPDQG6HVVLRQ
Format
8,17
8,17
8,17
Range (Note 6)
SDVVZRUG1RWH
SDVVZRUG1RWH
SDVVZRUG1RWH
8,17
8,17
8,17
8,17
8,17
767$03
8,17
SDVVZRUG1RWH
WR
WR
WR
DQ\YDOXH
-DQ'HF
DQ\YDOXH
VHF
Format
8,17
5HVHW6\VWHP/RJ1RWH
5HVHW+LVWRULFDO/RJ1RWH
5HVHW+LVWRULFDO/RJ1RWH
5HVHW+LVWRULFDO/RJ1RWH
5HVHUYHG
5HVHUYHG
5HVHUYHG
5HVHUYHG
5HVHUYHG
5HVHUYHG
5HVHUYHG
Comments
# Reg
5HSO\WRDUHVHWORJFRPPDQGLQGLFDWHVWKDWWKHFRPPDQGZDVDFFHSWHGEXWQRWQHFHVVDULO\WKDW
WKHUHVHWLVILQLVKHG3ROOORJVWDWXVEORFNWRGHWHUPLQHWKLV
6HWWR
5HVHUYHG
%ORFN6L]H
Units or Resolution
Comments
FDXVHVDZDWFKGRJUHVHWDOZD\VUHDGV
PHWHUZLOOSURFHVVFRPPDQGUHJLVWHUVWKLVUHJLVWHUWKURXJK
&ORVH3ULYLOHJHG&RPPDQG
6HVVLRQ
UHJLVWHUEHORZIRUPLQXWHVRUXQWLOWKHVHVVLRQLVFORVHGZKLFKHYHUFRPHVILUVW
PHWHUHQWHUV36XSGDWHPRGH
PHWHUFDOFXODWHVFKHFNVXPRQ5$0FRS\RI36EORFN
UHDGZULWHFKHFNVXPUHJLVWHU36EORFNVDYHGLQQRQYRODWLOHPHPRU\RQZULWH1RWH
ZULWHRQO\UHJLVWHUDOZD\VUHDGV]HUR
PHWHUOHDYHV36XSGDWHPRGHYLDUHVHW
VDYHGRQO\ZKHQUGUHJLVWHULVZULWWHQ
5HVHUYHG
5HVHUYHG
HQGVDQRSHQFRPPDQGVHVVLRQ
%ORFN6L]H
conditional write
Privileged Commands Block
$
%
&
'
(
)
$
Hex
$
%
&
'
(
$
,QLWLDWH3URJUDPPDEOH6HWWLQJV8SGDWH
&DOFXODWH3URJUDPPDEOH6HWWLQJV&KHFNVXP1RWH
3URJUDPPDEOH6HWWLQJV&KHFNVXP1RWH
:ULWH1HZ3DVVZRUG1RWH
7HUPLQDWH3URJUDPPDEOH6HWWLQJV8SGDWH1RWH
6HW0HWHU&ORFN
5HVHUYHG
5HVHUYHG
&ORVH3ULYLOHJHG&RPPDQG6HVVLRQ
Encryption Block
)
Hex
$
IM02601006E
Decimal
Description (Note 1)
3HUIRUPD6HFXUH2SHUDWLRQ
read/write
Range (Note 6)
www.eaton.com
Units or Resolution
Units or Resolution
Comments
HQFU\SWHGFRPPDQGWRUHDGSDVVZRUGRUFKDQJHPHWHUW\SH
%ORFN6L]H
# Reg
# Reg
MM-10
B: Modbus Map
IQ 250S
Programmable Settings Section
Basic Setups Block
)
Hex
)
write only in PS update mode
Decimal
Description (Note 1)
&7PXOWLSOLHUGHQRPLQDWRU
Format
8,17
Range (Note 6)
ELWPDSSHG
&7QXPHUDWRU
37QXPHUDWRU
37GHQRPLQDWRU
37PXOWLSOLHUKRRNXS
8,17
8,17
8,17
8,17
WR
WR
WR
ELWPDSSHG
Units or Resolution
Comments
GGGGGGGGPPPPPPPP KLJKE\WHLVGHQRPLQDWRURUUHDGRQO\
ORZE\WHLVPXOWLSOLHURU
QRQH
QRQH
QRQH
PPPPPPPP
PP«PP 37PXOWLSOLHURU
PPPPKKKK
KKKK KRRNXSHQXPHUDWLRQ HOHPHQWZ\H>[email protected] GHOWD&7V>[email protected] HOHPHQW
Z\H>[email protected]
LLLLLLEVVV
LLLLLL LQWHUYDO
E EORFNRUUROOLQJ
VVV VXELQWHUYDOV
SSSSLLQQIHHHGGG
SSSS SRZHUVFDOHXQLWNLORPHJDDXWR
LL SRZHUGLJLWVDIWHUGHFLPDOSRLQW
DSSOLHVRQO\LII DQGSSSSLVQRWDXWR
QQ QXPEHURIHQHUJ\GLJLWV!
HHH HQHUJ\VFDOHXQLWNLORPHJD
I GHFLPDOSRLQWIRUSRZHU
GDWDGHSHQGDQWSODFHPHQW
IL[HGSODFHPHQWSHULLYDOXH
GGG HQHUJ\GLJLWVDIWHUGHFLPDOSRLQW
6HHQRWH
[HHHHHHHH
HHHHHHHH RSPRGHVFUHHQURZVRQRIIURZVWRSWRERWWRPDUHELWVORZRUGHUWRKLJKRUGHU
[ VHWWRVXSSUHVV3)RQ:9$53)VFUHHQV
KKKKKZZZGGGPPPP
DSSOLHVRQO\LIGD\OLJKWVDYLQJVLQ8VHU6HWWLQJV)ODJV RQVSHFLILHVZKHQWRPDNHFKDQJHRYHU
KKKKK KRXU
ZZZ ZHHNIRUVWWKIRUODVW
GGG GD\RIZHHNIRU6XQ6DW
PPPP PRQWK
([DPSOH$0RQWKHWK6XQGD\RI0DUFK
KKKKK ZZZ GGG PPPP $YHUDJLQJ0HWKRG
8,17
ELWPDSSHG
3RZHU(QHUJ\)RUPDW
8,17
ELWPDSSHG
2SHUDWLQJ0RGH6FUHHQ(QDEOHV
8,17
ELWPDSSHG
'D\OLJKW6DYLQJ2Q5XOH
8,17
ELWPDSSHG
(
'
(
'D\OLJKW6DYLQJ2II5XOH
5HVHUYHG
8VHU6HWWLQJV)ODJV
8,17
8,17
ELWPDSSHG
ELWPDSSHG
KKKKKZZZGGGPPPP
JLQQVUSG\ZID
)
)
)XOO6FDOH&XUUHQWIRUORDGEDUJUDSK
8,17
WR
QRQH
IM02601006E
www.eaton.com
5HVHUYHG
J HQDEOHDOWHUQDWHIXOOVFDOHEDUJUDSKFXUUHQW
RQ RII
L IL[HGVFDOHDQGIRUPDWFXUUHQWGLVSOD\
QRUPDODXWRVFDOHGFXUUHQWGLVSOD\
DOZD\VVKRZDPSVZLWKQRGHFLPDOSODFHV
QQ QXPEHURISKDVHVIRUYROWDJHFXUUHQWVFUHHQ
$%& $% $ $%&
V VFUROO RQ RII
U SDVVZRUGIRUUHVHWLQXVH RQ RII
S SDVVZRUGIRUFRQILJXUDWLRQLQXVH RQ RII
G GD\OLJKWVDYLQJWLPHFKDQJHV RII RQ
\ GLDJQRVWLFHYHQWVLQV\VWHPORJ \HV QR
Z SRZHUGLUHFWLRQ
YLHZDVORDG YLHZDVJHQHUDWRU
I IOLSSRZHUIDFWRUVLJQ \HV QR
D DSSDUHQWSRZHUFRPSXWDWLRQPHWKRG
DULWKPHWLFVXP YHFWRUVXP
,IQRQ]HURDQGXVHUVHWWLQJVELWJLVVHWWKLVYDOXHUHSODFHV&7QXPHUDWRULQWKHIXOOVFDOH
FXUUHQWFDOFXODWLRQ6HH1RWH
# Reg
MM-11
B: Modbus Map
IQ 250S
Basic Setups Block - continued
Hex
$
%
&
'
(
)
$
)
(
&
&
&
&
&
&
&
&$
&%
&&
(
(
Decimal
0HWHU'HVLJQDWLRQ
&20VHWXS
write only in PS update mode
Description (Note 1)
Range (Note 6)
FKDU
ELWPDSSHG
Units or Resolution
QRQH
GGGG
$
%
&
'
&20VHWXS
&20DGGUHVV
/LPLW,GHQWLILHU
/LPLW2XW+LJK6HWSRLQW
/LPLW,Q+LJK7KUHVKROG
8,17
8,17
8,17
6,17
6,17
ELWPDSSHG
WR
WR
WR
WR
GGGGSSSEEE
QRQH
RIIXOOVFDOH
RIIXOOVFDOH
(
)
/LPLW2XW/RZ6HWSRLQW
/LPLW,Q/RZ7KUHVKROG
6,17
6,17
WR
WR
RIIXOOVFDOH
RIIXOOVFDOH
(
'
&
&
&
&
&
&
&
&
&$
&%
/LPLW
/LPLW
/LPLW
/LPLW
/LPLW
/LPLW
/LPLW
5HVHUYHG
5HVHUYHG
ZDWWVORVVGXHWRLURQZKHQZDWWVSRVLWLYH
ZDWWVORVVGXHWRFRSSHUZKHQZDWWVSRVLWLYH
YDUORVVGXHWRLURQZKHQZDWWVSRVLWLYH
YDUORVVGXHWRFRSSHUZKHQZDWWVSRVLWLYH
ZDWWVORVVGXHWRLURQZKHQZDWWVQHJDWLYH
ZDWWVORVVGXHWRFRSSHUZKHQZDWWVQHJDWLYH
YDUORVVGXHWRLURQZKHQZDWWVQHJDWLYH
YDUORVVGXHWRFRSSHUZKHQZDWWVQHJDWLYH
WUDQVIRUPHUORVVFRPSHQVDWLRQXVHUVHWWLQJVIODJ
6,17
6,17
6,17
6,17
6,17
6,17
6,17
8,17
8,17
8,17
8,17
8,17
8,17
8,17
8,17
8,17
VDPHDV/LPLW
WR
WR
WR
WR
WR
WR
WR
WR
ELWPDSSHG
VDPHDV/LPLW
FIZY
(
(
5HVHUYHG
3URJUDPPDEOH6HWWLQJV8SGDWH&RXQWHU
8,17
5HVHUYHGIRU6RIWZDUH8VH
Hex
Comments
GGGG UHSO\GHOD\PVHF
SSS SURWRFRO0RGEXV5780RGEXV$6&,,'13
EEE EDXGUDWH
XVH0RGEXVDGGUHVVDVWKHLGHQWLILHUVHHQRWHV
6HWSRLQWIRUWKHDERYHOLPLW/0VHHQRWHV
7KUHVKROGDWZKLFKDERYHOLPLWFOHDUVQRUPDOO\OHVVWKDQRUHTXDOWRWKHDERYHVHWSRLQWVHH
QRWHV
6HWSRLQWIRUWKHEHORZOLPLW/0VHHQRWHV
7KUHVKROGDWZKLFKEHORZOLPLWFOHDUVQRUPDOO\JUHDWHUWKDQRUHTXDOWRWKHEHORZVHWSRLQW
VHHQRWHV
VDPHDV/LPLW
5HVHUYHG
5HVHUYHG
FGLVDEOHFRPSHQVDWLRQIRUORVVHVGXHWRFRSSHU
HQDEOHFRPSHQVDLRQIRUORVVHVGXHWRFRSSHU
IGLVDEOHFRPSHQVDWLRQIRUORVVHVGXHWRLURQ
HQDEOHFRPSHQVDLRQIRUORVVHVGXHWRLURQ
ZDGGZDWWFRPSHQVDWLRQ
VXEWUDFWZDWWFRPSHQVDWLRQ
YDGGYDUFRPSHQVDWLRQ
VXEWUDFWYDUFRPSHQVDWLRQ
5HVHUYHG
,QFUHPHQWVHDFKWLPHSURJUDPPDEOHVHWWLQJVDUHFKDQJHGRFFXUVZKHQQHZFKHFNVXPLV
FDOFXODWHG
5HVHUYHG
%ORFN6L]H
write only in PS update mode
Decimal
Description (Note 1)
+LVWRULFDO/RJ6L]HV
Format
8,17
Range (Note 6)
ELWPDSSHG
Units or Resolution
HHHHHHHHVVVVVVVV
Comments
KLJKE\WHLVQXPEHURIUHJLVWHUVWRORJLQHDFKUHFRUG
ORZE\WHLVQXPEHURIIODVKVHFWRUVIRUWKHORJVHHQRWH
LQHLWKHUE\WHGLVDEOHVWKHORJ
RQO\ELWVHWD PLQE PLQF PLQG PLQH PLQI PLQJ PLQK (2,
SXOVH
XVH0RGEXVDGGUHVVDVWKHLGHQWLILHUVHHQRWH
VDPHDV5HJLVWHU,GHQWLILHU
5HVHUYHGIRUVRIWZDUHXVH
Log Setups Block
Format
$6&,,
8,17
# Reg
# Reg
+LVWRULFDO/RJ,QWHUYDO
8,17
ELWPDSSHG
KJIHGFED
$
(
'
'
'
$
+LVWRULFDO/RJ5HJLVWHU,GHQWLILHU
+LVWRULFDO/RJ5HJLVWHU,GHQWLILHUV
+LVWRULFDO/RJ6RIWZDUH%XIIHU
+LVWRULFDO/RJ6L]HV,QWHUYDO5HJLVWHUV6RIWZDUH%XIIHU
WR
WR
$
%
+LVWRULFDO/RJ6L]HV,QWHUYDO5HJLVWHUV6RIWZDUH%XIIHU
%
%
8,17
8,17
VDPHDV+LVWRULFDO
/RJ
VDPHDV+LVWRULFDO
/RJ
5HVHUYHG
%ORFN6L]H
&))
(
IM02601006E
)(
5HVHUYHG
5HVHUYHG
5HVHUYHG
www.eaton.com
MM-12
B: Modbus Map
IQ 250S
12-Bit Readings Section
12-Bit Block
&
&
&
&
&
&
&
&
&
&
&$
read-only except as noted
Hex
&
&
&
&
&
&
&
&
&
&
&$
Decimal
Description (Note 1)
6\VWHP6DQLW\,QGLFDWRU
9ROWV$1
9ROWV%1
9ROWV&1
$PSV$
$PSV%
$PSV&
:DWWV3KWRWDO
9$5V3KWRWDO
9$V3KWRWDO
3RZHU)DFWRU3KWRWDO
Format
8,17
8,17
8,17
8,17
8,17
8,17
8,17
8,17
8,17
8,17
8,17
Range (Note 6)
RU
WR
WR
WR
WR
WR
WR
WR
WR
WR
WR
Units or Resolution
QRQH
YROWV
YROWV
YROWV
DPSV
DPSV
DPSV
ZDWWV
9$5V
9$V
QRQH
&%
&%
)UHTXHQF\
8,17
WR
+]
&&
&'
&(
&)
&
&
&
&
&
&
&
&
&%
&'
&)
&
&
&
&
&
&%
&'
&)
&
&
&
&
&
&%
&'
&(
&)
&
&
&
&
&
&
&
&&
&'
&(
&)
&
&
&
&
&
&
&
&$
&&
&(
&
&
&
&
&
&$
&&
&(
&
&
&
&
&
&$
&&
&'
&(
&)
&
&
&
&
&
&
&
9ROWV$%
9ROWV%&
9ROWV&$
&7QXPHUDWRU
&7PXOWLSOLHU
&7GHQRPLQDWRU
37QXPHUDWRU
37PXOWLSOLHU
37GHQRPLQDWRU
:KRXUV3RVLWLYH
:KRXUV1HJDWLYH
9$5KRXUV3RVLWLYH
9$5KRXUV1HJDWLYH
9$KRXUV
:KRXUV3RVLWLYH3KDVH$
:KRXUV3RVLWLYH3KDVH%
:KRXUV3RVLWLYH3KDVH&
:KRXUV1HJDWLYH3KDVH$
:KRXUV1HJDWLYH3KDVH%
:KRXUV1HJDWLYH3KDVH&
9$5KRXUV3RVLWLYH3KDVH$
9$5KRXUV3RVLWLYH3KDVH%
9$5KRXUV3RVLWLYH3KDVH&
9$5KRXUV1HJDWLYH3KDVH$
9$5KRXUV1HJDWLYH3KDVH%
9$5KRXUV1HJDWLYH3KDVH&
9$KRXUV3KDVH$
9$KRXUV3KDVH%
9$KRXUV3KDVH&
:DWWV3KDVH$
:DWWV3KDVH%
:DWWV3KDVH&
9$5V3KDVH$
9$5V3KDVH%
9$5V3KDVH&
9$V3KDVH$
9$V3KDVH%
9$V3KDVH&
3RZHU)DFWRU3KDVH$
8,17
8,17
8,17
8,17
8,17
8,17
8,17
8,17
8,17
8,17
8,17
8,17
8,17
8,17
8,17
8,17
8,17
8,17
8,17
8,17
8,17
8,17
8,17
8,17
8,17
8,17
8,17
8,17
8,17
8,17
8,17
8,17
8,17
8,17
8,17
8,17
8,17
8,17
8,17
WR
WR
WR
WR
RU
WR
WR
WR
WR
WR
WR
WR
WR
WR
WR
WR
WR
WR
WR
WR
WR
WR
WR
WR
WR
WR
WR
WR
WR
WR
WR
WR
WR
WR
WR
WR
WR
YROWV
YROWV
YROWV
QRQH
QRQH
QRQH
QRQH
QRQH
QRQH
:KSHUHQHUJ\IRUPDW
:KSHUHQHUJ\IRUPDW
9$5KSHUHQHUJ\IRUPDW
9$5KSHUHQHUJ\IRUPDW
9$KSHUHQHUJ\IRUPDW
:KSHUHQHUJ\IRUPDW
:KSHUHQHUJ\IRUPDW
:KSHUHQHUJ\IRUPDW
:KSHUHQHUJ\IRUPDW
:KSHUHQHUJ\IRUPDW
:KSHUHQHUJ\IRUPDW
9$5KSHUHQHUJ\IRUPDW
9$5KSHUHQHUJ\IRUPDW
9$5KSHUHQHUJ\IRUPDW
9$5KSHUHQHUJ\IRUPDW
9$5KSHUHQHUJ\IRUPDW
9$5KSHUHQHUJ\IRUPDW
9$KSHUHQHUJ\IRUPDW
9$KSHUHQHUJ\IRUPDW
9$KSHUHQHUJ\IRUPDW
ZDWWV
ZDWWV
ZDWWV
9$5V
9$5V
9$5V
9$V
9$V
9$V
QRQH
&
&
&
&$
&
&
&$
&$
3RZHU)DFWRU3KDVH%
3RZHU)DFWRU3KDVH&
5HVHUYHG
5HVHW(QHUJ\$FFXPXODWRUV
8,17
8,17
1$
8,17
WR
WR
1$
SDVVZRUG1RWH
QRQH
QRQH
QRQH
IM02601006E
www.eaton.com
Comments
LQGLFDWHVSURSHUPHWHURSHUDWLRQ
YROWV UHJLVWHU
DPSV UHJLVWHU
ZDWWV9$5V9$V UHJLVWHU
SI UHJLVWHU
RUOHVV RUPRUHIUHT UHJLVWHU
YROWV UHJLVWHU
&7 QXPHUDWRUPXOWLSOLHUGHQRPLQDWRU
37 QXPHUDWRUPXOWLSOLHUGHQRPLQDWRU
WRGLJLWV
GHFLPDOSRLQWLPSOLHGSHUHQHUJ\IRUPDW
UHVROXWLRQRIGLJLWEHIRUHGHFLPDOSRLQW XQLWVNLORRUPHJDSHUHQHUJ\IRUPDW
VHHQRWH
ZDWWV9$5V9$V UHJLVWHU
SI UHJLVWHU
5HVHUYHG
ZULWHRQO\UHJLVWHUDOZD\VUHDGVDV
%ORFN6L]H
# Reg
MM-13
B: Modbus Map
IQ 250S
Log Retrieval Section
Log Retrieval Block
&&
&(
&)
Hex
&'
&(
&)
read/write except as noted
Decimal
Description (Note 1)
/RJ5HWULHYDO6HVVLRQ'XUDWLRQ
/RJ5HWULHYDO6HVVLRQ&RP3RUW
/RJ1XPEHU(QDEOH6FRSH
Format
8,17
8,17
8,17
Range (Note 6)
WR
WR
ELWPDSSHG
Units or Resolution
PVHF
QQQQQQQQHVVVVVVV
Comments
# Reg
LIQRVHVVLRQDFWLYHZUDSVDURXQGDIWHUPD[FRXQW
LIQRVHVVLRQDFWLYHIRUVHVVLRQDFWLYHRQ&20&20
KLJKE\WHLVWKHORJQXPEHUV\VWHPDODUPKLVWRU\KLVWRU\KLVWRU\,2FKDQJHV
ZDYHIRUPUHVHUYHGIRUIXWXUHXVH
HLVUHWULHYDOVHVVLRQHQDEOHRUGLVDEOH
VVVVVVVLVZKDWWRUHWULHYHQRUPDOUHFRUGWLPHVWDPSVRQO\FRPSOHWHPHPRU\LPDJHQR
GDWDYDOLGDWLRQLILPDJH
KLJKE\WHLVUHFRUGVSHUZLQGRZLIV RUUHFRUGVSHUEDWFKLIV ORZE\WHLVQXPEHURIUHSHDWV
IRUIXQFWLRQRUWRVXSSUHVVDXWRLQFUHPHQWLQJPD[QXPEHURIUHSHDWVLV578RU
$6&,,WRWDOZLQGRZVDEDWFKLVDOOWKHZLQGRZV
VVVVVVVVLVZLQGRZVWDWXVWRZLQGRZQXPEHU[))QRWUHDG\WKLVE\WHLVUHDGRQO\
QQ«QQLVDELWUHFRUGQXPEHU7KHORJ
VILUVWUHFRUGLVODWFKHGDVDUHIHUHQFHSRLQWZKHQWKH
VHVVLRQLVHQDEOHG7KLVRIIVHWLVDUHFRUGLQGH[UHODWLYHWRWKDWSRLQW9DOXHSURYLGHGLVWKH
UHODWLYHLQGH[RIWKHZKROHRUSDUWLDOUHFRUGWKDWEHJLQVWKHZLQGRZ
PDSSHGSHUUHFRUGOD\RXWDQGUHWULHYDOVFRSHUHDGRQO\
%ORFN6L]H
&
&
5HFRUGVSHU:LQGRZRU%DWFK5HFRUG6FRSH6HOHFWRU
1XPEHURI5HSHDWV
8,17
ELWPDSSHG
ZZZZZZZZVQQQQQQQ
&
&
2IIVHWRI)LUVW5HFRUGLQ:LQGRZ
8,17
ELWPDSSHG
VVVVVVVVQQQQQQQQ
QQQQQQQQQQQQQQQQ
&
&&'
/RJ5HWULHYH:LQGRZ
8,17
VHHFRPPHQWV
QRQH
Format
8,17
8,17
8,17
8,17
Range (Note 6)
WR
WR
WR
Units or Resolution
UHFRUG
UHFRUG
E\WH
QRQH
767$03
767$03
-DQ'HF
-DQ'HF
VDPHDVDODUPORJVWDWXV
EORFN
VDPHDVDODUPORJVWDWXV
EORFN
VDPHDVDODUPORJVWDWXV
EORFN
VDPHDVDODUPORJVWDWXV
EORFN
VHF
VHF
DYDLODEOH
LQXVHE\&20
[)))) QRWDYDLODEOHORJVL]H 5HVHUYHG
,QGLYLGXDO/RJ6WDWXV%ORFN6L]H
%ORFN6L]H
Log Status Block
&
&
&%
&&
&)
&
&
&
&'
&
&
&
&
&
+LVWRULFDO/RJ6WDWXV%ORFN
&
&
+LVWRULFDO/RJ6WDWXV%ORFN
&
&
+LVWRULFDO/RJ6WDWXV%ORFN
&
&
&
&%
read only
Hex
Decimal
Description (Note 1)
Alarm Log Status Block
&
/RJ6L]HLQ5HFRUGV
&$
1XPEHURI5HFRUGV8VHG
&%
5HFRUG6L]HLQ%\WHV
&&
/RJ$YDLODELOLW\
7LPHVWDPS)LUVW5HFRUG
7LPHVWDPS/DVW5HFRUG
5HVHUYHG
6\VWHP/RJ6WDWXV%ORFN
5HVHUYHG
5HVHUYHG
Comments
# Reg
End of Map
IM02601006E
www.eaton.com
MM-14
B: Modbus Map
IQ 250S
Data Formats
$6&,,
6,178,17
6,178,17
)/2$7
767$0 3
$6&,,FKDUDFWHUVSDFNHGSHUUHJLVWHULQKLJKORZRUGHUDQGZLWKRXWDQ\WHUPLQDWLRQFKDUDFWHUV
ELWVLJQHGXQVLJQHGLQWHJHU
ELWVLJQHGXQVLJQHGLQWHJHUVSDQQLQJUHJLVWHUV7KHORZHUDGGUHVVHGUHJLVWHULVWKHKLJKRUGHUKDOI
ELW,(((IORDWLQJSRLQWQXPEHUVSDQQLQJUHJLVWHUV7KHORZHUDGGUHVVHGUHJLVWHULVWKHKLJKRUGHUKDOILHFRQWDLQVWKHH[SRQHQW
DGMDFHQWUHJLVWHUVE\WHVHDFK)LUVWORZHVWDGGUHVVHGUHJLVWHUKLJKE\WHLV\HDUORZE\WHLVPRQWK0LGGOHUHJLVWHUKLJKE\WHLVGD\ORZE\WHLVKRXUSOXV'67ELW
'67GD\OLJKWVDYLQJWLPHELWLVELW[7KLUGUHJLVWHUKLJKE\WHLVPLQXWHVORZE\WHLVVHFRQGV)RUH[DPSOH$0RQ2FWREHUZRXOGEH[$[&[DVVXPLQJ'67LVLQHIIHFW
Notes
$OOUHJLVWHUVQRWH[SOLFLWO\OLVWHGLQWKHWDEOHUHDGDV:ULWHVWRWKHVHUHJLVWHUVZLOOEHDFFHSWHGEXWZRQ
WDFWXDOO\FKDQJHWKHUHJLVWHUVLQFHLWGRHVQ
WH[LVW
0HWHU'DWD6HFWLRQLWHPVUHDGDVXQWLOILUVWUHDGLQJVDUHDYDLODEOHRULIWKHPHWHULVQRWLQRSHUDWLQJPRGH:ULWHVWRWKHVHUHJLVWHUVZLOOEHDFFHSWHGEXWZRQ
WDFWXDOO\FKDQJHWKHUHJLVWHU
5HJLVWHUYDOLGRQO\LQSURJUDPPDEOHVHWWLQJVXSGDWHPRGH,QRWKHUPRGHVWKHVHUHJLVWHUVUHDGDVDQGUHWXUQDQLOOHJDOGDWDDGGUHVVH[FHSWLRQLIDZULWHLVDWWHPSWHG
0HWHUFRPPDQGUHJLVWHUVDOZD\VUHDGDV7KH\PD\EHZULWWHQRQO\ZKHQWKHPHWHULVLQDVXLWDEOHPRGH7KHUHJLVWHUVUHWXUQDQLOOHJDOGDWDDGGUHVVH[FHSWLRQLIDZULWHLVDWWHPSWHGLQDQLQFRUUHFWPRGH
,IWKHSDVVZRUGLVLQFRUUHFWDYDOLGUHVSRQVHLVUHWXUQHGEXWWKHFRPPDQGLVQRWH[HFXWHG8VHIRUWKHSDVVZRUGLISDVVZRUGVDUHGLVDEOHGLQWKHSURJUDPPDEOHVHWWLQJV
0GHQRWHVDPXOWLSOLHU
(DFKLGHQWLILHULVD0RGEXVUHJLVWHU)RUHQWLWLHVWKDWRFFXS\PXOWLSOHUHJLVWHUV)/2$76,17HWFDOOUHJLVWHUVPDNLQJXSWKHHQWLW\PXVWEHOLVWHGLQDVFHQGLQJRUGHU
)RUH[DPSOHWRORJSKDVH$YROWV9$VDQG9$KRXUVWKHUHJLVWHUOLVWZRXOGEH[([([[['[(DQGWKHQXPEHURIUHJLVWHUV[KLJKE\WHZRXOGEH
:ULWLQJWKLVUHJLVWHUFDXVHVGDWDWREHVDYHGSHUPDQHQWO\LQQRQYRODWLOHPHPRU\5HSO\WRWKHFRPPDQGLQGLFDWHVWKDWLWZDVDFFHSWHGEXWQRWZKHWKHURUQRWWKHVDYHZDVVXFFHVVIXO7KLVFDQRQO\EHGHWHUPLQHGDIWHUWKHPHWHUKDVUHVWDUWHG
5HVHWFRPPDQGVPDNHQRVHQVHLIWKHPHWHUVWDWHLV/,03$QLOOHJDOIXQFWLRQH[FHSWLRQZLOOEHUHWXUQHG
(QHUJ\UHJLVWHUVVKRXOGEHUHVHWDIWHUDIRUPDWFKDQJH
(QWLWLHVWREHPRQLWRUHGDJDLQVWOLPLWVDUHLGHQWLILHGE\0RGEXVDGGUHVV(QWLWLHVRFFXS\LQJPXOWLSOH0RGEXVUHJLVWHUVVXFKDVIORDWLQJSRLQWYDOXHVDUHLGHQWLILHGE\WKHORZHUUHJLVWHUDGGUHVV,IDQ\RIWKHOLPLWVLVXQXVHGVHWLWVLGHQWLILHUWR]HUR
,IWKHLQGLFDWHG0RGEXVUHJLVWHULVQRWXVHGRULVDQRQVHQVLFDOHQWLW\IRUOLPLWVLWZLOOEHKDYHDVDQXQXVHGOLPLW
7KHUHDUHVHWSRLQWVSHUOLPLWRQHDERYHDQGRQHEHORZWKHH[SHFWHGUDQJHRIYDOXHV/0LVWKHWRRKLJKOLPLW/0LVWRRORZ7KHHQWLW\JRHVRXWRIOLPLWRQ/0ZKHQLWVYDOXHLVJUHDWHUWKDQWKHVHWSRLQW
,WUHPDLQVRXWRIOLPLWXQWLOWKHYDOXHGURSVEHORZWKHLQWKUHVKROG/0ZRUNVVLPLODUO\LQWKHRSSRVLWHGLUHFWLRQ,IOLPLWVLQRQO\RQHGLUHFWLRQDUHRILQWHUHVWVHWWKHLQWKUHVKROGRQWKHZURQJVLGHRIWKHVHWSRLQW
/LPLWVDUHVSHFLILHGDVRIIXOOVFDOHZKHUHIXOOVFDOHLVDXWRPDWLFDOO\VHWDSSURSULDWHO\IRUWKHHQWLW\EHLQJPRQLWRUHG
FXUUHQW
)6 &7QXPHUDWRU&7PXOWLSOLHU
YROWDJH
)6 37QXPHUDWRU37PXOWLSOLHU
SKDVHSRZHU
)6 &7QXPHUDWRU&7PXOWLSOLHU37QXPHUDWRU37PXOWLSOLHU>[email protected]
VLQJOHSKDVH
)6 &7QXPHUDWRU&7PXOWLSOLHU37QXPHUDWRU37PXOWLSOLHU>[email protected]
IUHTXHQF\
)6 RU
SRZHUIDFWRU
)6 SHUFHQWDJH
)6 DQJOH
)6 QD
QD
$EORFNRIGDWDDQGFRQWUROUHJLVWHUVLVDOORFDWHGIRUHDFKRSWLRQVORW,QWHUSUHWDWLRQRIWKHUHJLVWHUGDWDGHSHQGVRQZKDWFDUGLVLQWKHVORW
0HDVXUHPHQWVWDWHV2IIRFFXUVGXULQJSURJUDPPDEOHVHWWLQJVXSGDWHV5XQLVWKHQRUPDOPHDVXULQJVWDWH/LPSLQGLFDWHVWKDWDQHVVHQWDLOQRQYRODWLOHPHPRU\EORFNLVFRUUXSWHGDQG:DUPXSRFFXUVEULHIO\DSSUR[LPDWHO\VHFRQGVDWVWDUWXSZKLOHWKHUHDGLQJVVWDELOL]H
5XQVWDWHLVUHTXLUHGIRUPHDVXUHPHQWKLVWRULFDOORJJLQJGHPDQGLQWHUYDOSURFHVVLQJOLPLWDODUPHYDOXDWLRQDQGPLQPD[FRPSDULVRQVV5HVHWWLQJPLQPD[RUHQHUJ\LVDOORZHGRQO\LQUXQDQGRIIVWDWHVZDUPXSZLOOUHWXUQDEXV\H[FHSWLRQ
,QOLPSVWDWHWKHPHWHUUHERRWVDWPLQXWHLQWHUYDOVLQDQHIIRUWWRFOHDUWKHSUREOHP
/LPLWVHYDOXDWLRQIRUDOOHQWLWHVH[FHSWGHPDQGDYHUDJHVFRPPHQFHVLPPHGLDWHO\DIWHUWKHZDUPXSSHULRG(YDOXDWLRQIRUGHPDQGDYHUDJHVPD[LPXPGHPDQGVDQGPLQLPXPGHPDQGVFRPPHQFHVDWWKHHQGRIWKHILUVWGHPDQGLQWHUYDODIWHUVWDUWXS
QD
7KHUHDUHRUIODVKVHFWRUVDYDLODEOHLQDFRPPRQSRROIRUGLVWULEXWLRQDPRQJWKHKLVWRULFDOORJV
7KHSRROVL]HQXPEHURIVHFWRUVIRUHDFKORJDQGWKHQXPEHURIUHJLVWHUVSHUUHFRUGWRJHWKHUGHWHUPLQHWKHPD[LPXPQXPEHURIUHFRUGVDORJFDQKROG
6 QXPEHURIVHFWRUVDVVLJQHGWRWKHORJ
QD
/RJVFDQQRWEHUHVHWGXULQJORJUHWULHYDO%XV\H[FHSWLRQZLOOEHUHWXUQHG
IM02601006E
www.eaton.com
MM-15
IQ 250S
B: Modbus Map
This page intentionally left blank.
IM02601006E
www.eaton.com
MM-16
IQ 150S
C: DNP Map
C: IQ 150S Meter DNP Map
C.1: Introduction
The IQ 150S meter’s DNP map shows the client-server relationship in the meter’s use of DNP
Protocol.
C.2: DNP Implementation
PHYSICAL LAYER
The IQ 150S meter can use RS485 as the physical layer. This is accomplished by connecting a PC
to the meter using the meter’s RS485 connection (see Chapter 5).
RS485
RS485 provides multi-drop network communication capabilities. Multiple meters can be placed on
the same bus, allowing for a Master device to communicate with any of the other devices.
Appropriate network configuration and termination should be evaluated for each installation to
insure optimal performance (see Chapter 5).
Communication Parameters
IQ 150S meters communicate in DNP 3.0 using the following communication settings:
• 8 Data Bits
• No Parity
• 1 Stop Bit
• Baud Rates: 9600, 19200, 38400, 57600
IM02601006E
www.eaton.com
C-1
IQ 150S
C: DNP Map
C.3: Data Link Layer
The Data Link Layer for IQ 150S meters is subject to the following considerations:
Control Field
The Control Byte contains several bits and a Function Code.
Control Bits
Communication directed to the meter should be Primary Master messages (DIR = 1, PRM = 1).
Response will be primary Non-Master messages (DIR = 0, PRM = 1). Acknowledgment will be
Secondary Non-Master messages (DIR = 0, PRM = 0).
Function Codes
IQ 150S meters support all of the Function Codes for DNP 3.0.
Reset of Data Link (Function 0)
Before confirmed communication with a master device, the Data Link Layer must be reset. This is
necessary after a meter has been restarted, either by applying power to the meter or reprogramming the meter. The meter must receive a RESET command before confirmed communication can
take place. Unconfirmed communication is always possible and does not require a RESET.
User Data (Function 3)
After receiving a request for USER DATA, the meter generates a Data Link
CONFIRMATION, signaling the reception of the request, before the actual request is processed. If
a response is required, it is also sent as UNCONFIRMED USER DATA.
Unconfirmed User Data (Function 4)
After receiving a request for UNCONFIRMED USER DATA, if a response is required, it is sent as
UNCONFIRMED USER DATA.
Address
DNP 3.0 allows for addresses from 0 - 65534 (0x0000 - 0xFFFE) for individual device identification, with the address 65535 (0xFFFF) defined as an all stations address. IQ 150S/250S meters'
addresses are programmable from 0 - 247 (0x0000 - 0x00F7), and address 65535 (0xFFFF) is
recognized as the all stations address.
IM02601006E
www.eaton.com
C-2
IQ 150S
C: DNP Map
C.4: Transport Layer
The Transport Layer as implemented on IQ 150S meters is subject to the
following considerations:
Transport Header
Multiple-frame messages are not allowed for IQ 150S meters. Each Transport Header should
indicate it is both the first frame (FIR = 1) as well as the final frame
(FIN = 1).
C.5: Application Layer
The Application Layer contains a header (Request or Response Header, depending on direction)
and data.
Application Headers
Application Headers contain the Application Control Field and the Function Code.
Application Control Field
Multiple-fragment messages are not allowed for IQ 150S meters. Each Application Header should
indicate it is both the first fragment (FIR = 1) as well as the final fragment (FIN = 1).
Application-Level confirmation is not used by IQ 150S meters.
Function Codes
The following Function codes are implemented on IQ 150S meters.
Read (Function 1)
Objects supporting the READ function are:
• Binary Outputs (Object 10)
• Counters (Object 20)
• Analog Inputs (Object 30)
• Class (Object 60)
IM02601006E
www.eaton.com
C-3
IQ 150S
C: DNP Map
These Objects can be read either by requesting a specific Variation available as listed in this
appendix, or by requesting Variation 0. READ requests for Variation 0 of an Object is fulfilled with
the Variation listed in this appendix.
Write (Function 2)
Objects supporting the WRITE function are:
• Internal Indications (Object 80)
Direct Operate (Function 5)
Objects supporting the DIRECT OPERATE function are:
• Control Relay Output Block (Object 12)
Direct Operate - No Acknowledgment (Function 6)
Objects supporting the DIRECT OPERATE - NO ACKNOWLEDGMENT function are:
• Change to MODBUS RTU Protocol
Response (Function 129)
Application responses from IQ 150S meters use the RESPONSE function.
Application Data
Application Data contains information about the Object and Variation, as well as the Qualifier and
Range.
C.5.1: Object and Variation
The following Objects (Obj.) and Variations (Var.) are supported by IQ 150S meters:
• Binary Output Status (Object 10, Variation 2) †
• Control Relay Output Block (Object 12, Variation 1)
• 32-Bit Binary Counter Without Flag (Object 20, Variation 5) †
• 16-Bit Analog Input Without Flag (Object 30, Variation 4) †
• Class 0 Data (Object 60, Variation 1) †
IM02601006E
www.eaton.com
C-4
IQ 150S
C: DNP Map
• Internal Indications (Object 80, Variation 1)
† READ requests for Variation 0 are honored with the above Variations.
C.5.1.1: Binary Output Status (Obj. 10, Var. 2)
Binary Output Status supports the following function:
Read (Function 1)
A READ request for Variation 0 is responded to with Variation 2.
Binary Output Status is used to communicate the following data measured by IQ 150S meter:
Energy Reset State
Change to MODBUS RTU Protocol State
Energy Reset State (Point 0)
IQ 150S meters accumulate power generated or consumed over time as Hour Readings, which
measure positive VA Hours and positive and negative W Hours and VAR Hours. These readings
can be reset using a Control Relay Output Block object (Object 12). The Binary Output Status
point reports whether the Energy Readings are in the process of being reset, or are accumulating.
Normally, readings are being accumulated - the state of this point reads as '0'. If readings are in
the process of being reset, the state of this point reads as '1'.
Change to Modbus RTU Protocol State (Point 1)
IQ 150S meters can of change from DNP Protocol to Modbus RTU Protocol. This enables the user
to update the Device Profile of the meter (this does not change the meter’s Protocol setting). A
meter reset brings communication back to DNP. A status reading of "1" equals Open, or de-energized. A reading of "0" equals Closed, or energized.
IM02601006E
www.eaton.com
C-5
IQ 150S
C: DNP Map
C.5.1.2: Control Relay Output Block (Obj. 12, Var. 1)
Control Relay Output Block supports the following functions:
Direct Operate (Function 5)
Direct Operate - No Acknowledgment (Function 6)
Control Relay Output Blocks are used for the following purposes:
Energy Reset
Change to MODBUS RTU Protocol
Energy Reset (Point 0)
As stated previously, IQ 150S meters accumulate power generated or consumed over time as
Hour Readings, which measure positive VA Hours and positive and negative W Hours and VAR
Hours. These readings may be reset using Point 0.
Change to Modbus RTU Protocol (Point 1)
Refer to Section C.5.1.1 on the previous page for the Change to Modbus Protocol information.
Use of the DIRECT OPERATE (Function 5) function will operate only with the settings of Pulsed
ON (Code = 1 of Control Code Field) once (Count = 0x01) for ON 1
millisecond and OFF 0 milliseconds.
IM02601006E
www.eaton.com
C-6
IQ 150S
C: DNP Map
C.5.1.3: 32-Bit Binary Counter Without Flag (Obj. 20, Var. 5)
Counters support the following functions:
Read (Function 1)
A READ request for Variation 0 is responded to with Variation 5.
Counters are used to communicate the following data measured by IQ 150S/250S meters:
Hour Readings
Hour Readings (Points 0 - 4)
Point
Readings
Unit
0
+W hour
Wh
1
-W hour
Wh
2
+VAR hour
VARh
3
-VAR hour
VARh
4
+VA hour
VAh
NOTE: These readings may be cleared by using the Control Relay Output Block (see previous
Section C.5.1.2).
C.5.1.4: 16-Bit Analog Input Without Flag (Obj. 30, Var. 4)
Analog Inputs support the following functions:
Read (Function 1)
A READ request for Variation 0 is responded to with Variation 4.
Analog Inputs are used to communicate the following data measured by IQ 150S meters:
• Health Check
• Phase-to-Neutral Voltage
• Phase-to-Phase Voltage
• Phase Current
IM02601006E
www.eaton.com
C-7
IQ 150S
C: DNP Map
• Total Power
• Three Phase Total VAs
• Three Phase Power Factor Total
• Frequency
• Three Phase +Watts Max Avg Demand
• Three Phase +VARs Max Avg Demand
• Three Phase -Watts Max Avg Demand
• Three Phase -VARs Max Avg Demand
• Three Phase VAs Max Avg Demand
• Angle, Phase Power
• Angle, Phase-to-Phase Voltage
• CT Numerator, Multiplier, Denominator
• PT Numerator, Multiplier, Denominator
Health Check (Point 0)
The Health Check point is used to indicate problems detected by the IQ 150S meter. A value of
zero (0x0000) indicates the meter does not detect a problem. Non-zero values indicate a detected
anomaly.
IM02601006E
www.eaton.com
C-8
IQ 150S
C: DNP Map
Phase-to-Neutral Voltage (Points 1 - 3)
Point
Reading
1
Phase AN Voltage
2
Phase BN Voltage
3
Phase CN Voltage
These points are formatted as 2's complement fractions. They represent a fraction of a 150V Secondary input. Inputs of above 150V Secondary are pinned at 150V
Secondary.
Phase-to-Phase Voltage (Points 4 - 6)
Point
Reading
4
Phase AB Voltage
5
Phase BC Voltage
6
Phase CA Voltage
These points are formatted as 2's complement fractions. They represent a fraction of a 300V Secondary input. Inputs of above 30 V Secondary are pinned at 300V
Secondary.
Phase Current (Points 7 - 9)
Point
Reading
7
Phase A Current
8
Phase B Current
9
Phase C Current
These points are formatted as 2's complement fractions. They represent a fraction of a 10A Secondary input. Inputs of above 10A Secondary are pinned at 10A Secondary.
Total Power (Points 10 - 11)
IM02601006E
Point
Reading
10
Total Watt
www.eaton.com
C-9
IQ 150S
C: DNP Map
Point
Reading
11
Total VAR
These points are formatted as 2's complement fractions. They represent a fraction of 4500W Secondary in normal operation, or 3000W Secondary in Open Delta operation. Inputs above/below +/4500 or +/-3000W Secondary are pinned at +/-4500 or +/-3000W Secondary, respectively.
Total VA (Point 12)
Point
Reading
12
Total VA
This point is formatted as a 2's complement fraction. It represents a fraction of 4500W Secondary
in normal operation, or 3000W Secondary in Open Delta operation. Inputs above/below +/-4500 or
+/-3000W Secondary are pinned at +/-4500 or +/-3000W Secondary, respectively.
Power Factor (Point 13)
Point
Reading
13
Power Factor Total
This point is formatted as a 2's complement integer. It represents Power Factors from -1.000
(0x0FC18) to +1.000 (0x003E8). In Open Delta operation, Total Power Factor (Point 13) is always
zero.
Frequency (Point 14)
Point
Reading
14
Frequency
This point is formatted as a 2's complement fraction. It represents the Frequency as measured on
Phase A Voltage in units of cHz (centiHertz, 1/100 Hz). Inputs below 45.00 Hz are pinned at 0
(0x0000); inputs above 75.00 Hz are pinned at 9999 (0x270F).
IM02601006E
www.eaton.com
C-10
IQ 150S
C: DNP Map
Maximum Demands of Total Power (Points 15 - 19)
Point
Reading
15
Maximum Positive Demand Total Watts
16
Maximum Positive Demand Total VARs
17
Maximum Negative Demand Total Watts
18
Maximum Negative Demand Total VARs
19
Maximum Average Demand VAs
These points are formatted as 2's complement fractions. They represent a fraction of 4500W Secondary in normal operation, or 3000W Secondary in Open Delta operation. Inputs above/below +/4500 or +/-3000W Secondary are pinned at +/-4500 or +/-3000W Secondary, respectively.
Phase Angle (Points 20 - 25)
Point
Reading
20
Phase A Current Angle
21
Phase B Current Angle
22
Phase C Current Angle
23
Volts A-B Angle
24
Volts B-C Angle
25
Volts C-A Angle
These points are formatted as 2's complement integers. They represent angles from -180.00
(0x0F8F8) to +180.00 (0x00708).
CT & PT Ratios (Points 26 - 31)
IM02601006E
Point
Reading
26
CT Ratio Numerator
27
CT Ratio Multiplier
28
CT Ratio Denominator
29
PT Ratio Numerator
30
PT Ratio Multiplier
www.eaton.com
C-11
IQ 150S
C: DNP Map
Point
Reading
31
PT Ratio Denominator
These points are formatted as 2's complement integers. They can be used to convert from units in
terms of the Secondary of a CT or PT into units in terms of the Primary of a CT or PT. The ratio of
Numerator divided by Denominator is the ratio of Primary to Secondary.
IQ 150S meters typically use Full Scales relating Primary Current to 5A and Primary Voltage to
120V. However, these Full scales can range from mAs to thousands of kAs, and from mVs, to
thousands of kVs. Following are example settings:
CT Example Settings
200 Amps: Set the Ct-n value for 200 and the Ct-S value for 1.
800 Amps: Set the Ct-n value for 800 and the Ct-S value for 1.
2,000 Amps: Set the Ct-n value for 2000 and the Ct-S value for 1.
10,000 Amps:Set the Ct-n value for 1000 and the Ct-S value for 10.
NOTE: CT Denominator is fixed at 5 for 5A units; CT Denominator is fixed at 1 for 1A units.
PT Example Settings
277 Volts (Reads 277 Volts): Pt-n value is 277, Pt-d value is 277, Pt-S value is 1.
120 Volts (Reads 14,400 Volts): Pt-n value is 1440, Pt-d value is 120, Pt-S value is 10.
69 Volts (Reads 138,000 Volts): Pt-n value is 1380, Pt-d value is 69, Pt-S value is 100.
115 Volts (Reads 347,000 Volts): Pt-n value is 3470, Pt-d value is 115, Pt-S value is 100.
69 Volts (Reads 347,000 Volts): Pt-n value is 347, Pt-d value is 69, Pt-S value is 1000.
IM02601006E
www.eaton.com
C-12
IQ 150S
C: DNP Map
C.5.1.5: Class 0 Data (Obj. 60, Var. 1)
Class 0 Data supports the following functions:
Read (Function 1)
A request for Class 0 Data from a IQ 150S meter returns three Object Headers. Specifically, it
returns 16-Bit Analog Input Without Flags (Object 30, Variation 4), Points 0 - 31, followed by 32-Bit
Counters Without Flags (Object 20, Variation 5), Points 0 - 4, followed by Binary Output Status
(Object 10, Variation 2), Points 0 - 1. (There is NO Object 1.)
A request for Object 60, Variation 0 is treated as a request for Class 0 Data.
C.5.1.6: Internal Indications (Obj. 80, Var. 1)
Internal Indications support the following functions:
Write (Function 2)
Internal Indications may be indexed by Qualifier Code 0.
Device Restart (Point 0)
This bit is set whenever the meter resets. The polling device may clear this bit by Writing (Function
2) to Object 80, Point 0.
C.6: IQ 150S Meter DNP Mapping (DNP-1 to DNP-2)
The IQ 150S DNP Point Map follows.
Binary Output States, Control Relay Outputs, Binary Counters (Primary) and Analog Inputs are
described on Page 1.
Internal Indication is described on Page 2.
IM02601006E
www.eaton.com
C-13
IQ 150S
C: DNP Map
This page intentionally left blank.
IM02601006E
www.eaton.com
C-14
C:
IQ 150S
Object Point Var
Description
Binary Output States
10
0
2 Reset Energy Counters
10
1
2 Change to Modbus RTU
Protocol
Control Relay Outputs
12
0
1 Reset Energy Counters
Format
Range
Multiplier
Units
BYTE
BYTE
Always 1
Always 1
N/A
none
N/A
none
Read via Class 0 only
N/A
N/A
N/A
N/A
none
Responds to Function 5 (Direct Operate),
Qualifier Code 17x or 28x, Control Code 3,
Count 0, On 0 msec, Off 1 msec ONLY.
N/A
none
Responds to Function 6 (Direct Operate No Ack), Qualifier Code 17x, Control Code
3, Count 0, On 0 msec, Off 1 msec ONLY.
multiplier = 10 (n-d),
where n and d are
derived from the
energy format. n = 0,
3, or 6 per energy
format scale and d =
number of decimal
places.
W hr
example:
W hr
energy format = 7.2K and W-hours counter
= 1234567
N/A
12
1
1 Change to Modbus RTU
Protocol
Binary Counters (Primary)
20
0
4 W-hours, Positive
20
20
20
20
1
2
3
4
4 W-hours, Negative
4 VAR-hours, Positive
4 VAR-hours, Negative
4 VA-hours, Total
Analog Inputs (Secondary)
30
0
5 Meter Health
30
1
5 Volts A-N
30
2
5 Volts B-N
30
3
5 Volts C-N
30
4
5 Volts A-B
30
5
5 Volts B-C
30
6
5 Volts C-A
30
7
5 Amps A
30
30
8
9
5 Amps B
5 Amps C
Comments
Read via Class 0 only
UINT32
0 to 99999999
UINT32
0 to 99999999
UINT32
UINT32
UINT32
0 to 99999999
0 to 99999999
0 to 99999999
SINT16
SINT16
SINT16
SINT16
SINT16
SINT16
SINT16
SINT16
0 or 1
0 to 32767
0 to 32767
0 to 32767
0 to 32767
0 to 32767
0 to 32767
0 to 32767
N/A
(150 / 32768)
(150 / 32768)
(150 / 32768)
(300 / 32768)
(300 / 32768)
(300 / 32768)
(10 / 32768)
none
V
V
V
V
V
V
0 = OK
A
Values above 10A secondary read 32767.
SINT16
SINT16
0 to 32767
0 to 32767
(10 / 32768)
(10 / 32768)
A
A
VAR hr
VAR hr
VA hr
n=3 (K scale), d=2 ( 2 digits after decimal
(3-2)
= 101 = 10, so
point), multiplier = 10
energy is 1234567 * 10 Whrs, or 12345.67
KWhrs
Read via Class 0 only
Values above 150V secondary read 32767.
Values above 300V secondary read 32767.
Electro Industries/GaugeTech
IM02601006E
www.eaton.com
DNP-1
C:
IQ 150S
Object Point Var
Description
30
10
5 Watts, 3-Ph total
30
11
5 VARs, 3-Ph total
30
12
5 VAs, 3-Ph total
30
13
5 Power Factor, 3-Ph total
30
14
5 Frequency
30
15
5 Positive Watts, 3-Ph,
Maximum Avg Demand
30
16
5 Positive VARs, 3-Ph,
Maximum Avg Demand
30
17
5 Negative Watts, 3-Ph,
Maximum Avg Demand
30
18
5 Negative VARs, 3-Ph,
Maximum Avg Demand
30
19
5 VAs, 3-Ph, Maximum Avg
Demand
30
20
5 Angle, Phase A Current
30
21
5 Angle, Phase B Current
30
22
5 Angle, Phase C Current
30
23
5 Angle, Volts A-B
30
24
5 Angle, Volts B-C
30
25
5 Angle, Volts C-A
30
26
5 CT numerator
30
27
5 CT multiplier
30
28
5 CT denominator
30
29
5 PT numerator
30
30
5 PT multiplier
30
31
5 PT denominator
30
32
5 Neutral Current
Internal Indication
80
0
1 Device Restart Bit
Format
SINT16
SINT16
SINT16
SINT16
SINT16
SINT16
Range
-32768 to +32767
-32768 to +32767
0 to +32767
-1000 to +1000
0 to 9999
-32768 to +32767
Multiplier
(4500 / 32768)
(4500 / 32768)
(4500 / 32768)
0.001
0.01
(4500 / 32768)
SINT16
-32768 to +32767
(4500 / 32768)
SINT16
-32768 to +32767
(4500 / 32768)
SINT16
-32768 to +32767
(4500 / 32768)
SINT16
-32768 to +32767
(4500 / 32768)
SINT16
SINT16
SINT16
SINT16
SINT16
SINT16
SINT16
SINT16
SINT16
SINT16
SINT16
SINT16
SINT16
-1800 to +1800
-1800 to +1800
-1800 to +1800
-1800 to +1800
-1800 to +1800
-1800 to +1800
1 to 9999
1, 10, or 100
1 or 5
1 to 9999
1, 10, or 100
1 to 9999
0 to 32767
0.1
0.1
0.1
0.1
0.1
0.1
N/A
N/A
N/A
N/A
N/A
N/A
(10 / 32768)
degree
degree
degree
degree
degree
degree
none
none
none
none
none
none
A
N/A
N/A
N/A
none
Units
W
VAR
VA
none
Hz
Comments
W
VAR
W
VAR
VA
CT ratio =
(numerator * multiplier) / denominator
PT ratio =
(numerator * multiplier) / denominator
For 1A model, multiplier is (2 / 32768) and
values above 2A secondary read 32767.
Clear via Function 2 (Write), Qualifier Code
0.
Electro Industries/GaugeTech
IM02601006E
www.eaton.com
DNP-2
IQ 250S
D: DNP Map
D: IQ 250S Meter DNP Map
D.1: Overview
This Appendix describes the functionality of the IQ250S meter's version of the DNP protocol. A
DNP programmer needs this information to retrieve data from the IQ 250S meter. The DNP version used by the IQ 250S is a reduced set of the Distributed Network Protocol Version 3.0 subset
2; it gives enough functionality to get critical measurements from the IQ 250S meter.
The IQ 250S meter's DNP version supports Class 0 object/qualifiers 0,1,2,6, only. No event generation is supported. The IQ 250S meter always acts as a secondary device (slave) in DNP
communication.
D.2: Physical Layer
The IQ250S meter's DNP version uses serial communication. Port 2 (RS485 compliant port) is
used. Speed and data format is transparent for the IQ250S meter's DNP version: they can be set
to any supported value.
D.3: Data Link Layer
The IQ 250S meter can be assigned a value from 1 to 65534 as the target device address. The
data link layer follows the standard frame FT3 used by DNP Version 3.0 protocol, but only 4
functions are implemented: Reset Link, Reset User, Unconfirmed User Data, and Link Status, as
depicted in the following table.
Function
Function Code
Reset Link
0
Reset User
1
Unconfirmed User Data
4
Link Status
9
Table D.1: Supported Link Functions
[dst] and [src] are the device address of the IQ 250S meter and Master device, respectively. Refer
to Section D.7 for more detail on supported frames for the data link layer.
IM02601006E
www.eaton.com
D-1
IQ 250S
D: DNP Map
In order to establish optimal communication with the IQ 250S meter, we recommend that you perform the Reset Link and Reset User functions. The Link Status is not mandatory, but can be performed as well. The inter-character time-out for DNP is 1 second. If this amount of time, or more,
elapses between two consecutive characters within a FT3 frame, the frame will be dropped.
D.4: Application Layer
The IQ 250S meter’s DNP version supports the Read, Write, Direct Operate and Direct Operate
Unconfirmed functions.
• The Read function (code 01) provides a means for reading the critical measurement data from
the meter. This function should be posted to read object 60 variation 1, which will read all the
available Class 0 objects from the DNP register map. See the register map in Section C.6. In
order to retrieve all objects with their respective variations, the qualifier must be set to ALL
(0x06). See Section D.7 for an example showing a read Class 0 request data from the meter.
• The Write function (code 02) provides a means for clearing the Device restart bit in the Internal
Indicator register only. This is mapped to Object 80, point 0 with variation 1. When clearing the
restart device indicator use qualifier 0. Section D.7 shows the supported frames for this function.
• The Direct Operate function (code 05) is intended for resetting the energy counters and the
Demand counters (minimum and maximum energy registers). These actions are mapped to
Object 12, points 0 and 2, which act as control relays. The relays must be operated (On) in 0
msec and released (Off) in 1 msec only. Qualifiers 0x17 or x28 are supported for writing the
energy reset. Sample frames are shown in Section D.7.
• The Direct Operate Unconfirmed (or Unacknowledged) function (code 06) is intended for asking
the communication port to switch to Modbus RTU protocol from DNP. This switching acts as a
control relay mapped into Object 12, point 1 in the meter. The relay must be operated with qualifier 0x17, code 3 count 0, with 0 milliseconds on and 1 millisecond off, only. After sending this
request the current communication port will accept Modbus RTU frames only. To make this port
go back to DNP protocol, the unit must be powered down and up. Section D.7 shows the constructed frame to perform DNP to Modbus RTU protocol change.
IM02601006E
www.eaton.com
D-2
IQ 250S
D: DNP Map
D.5: Error Reply
In the case of an unsupported function, or any other recognizable error, an error reply is generated
from the IQ 250S meter to the Primary station (the requester). The Internal Indicator field will
report the type of error: unsupported function or bad parameter.
The broadcast acknowledge and restart bit are also signaled in the Internal Indicator field, but they
do not indicate an error condition.
D.6: IQ 250S Meter’s DNP Register Map
Object 10 - Binary Output States
Object
Point
Var
Description
Format
10
0
2
Reset Energy
Counters
BYTE
10
1
2
Change to
Modbus RTU
Protocol
10
2
2
Reset Demand
Cntrs (Max /
Min )
Range
Multiplier
Units
Comments
Always 1
N/A
None
Read by Class 0 or with
qualifier 0, 1, 2, or 6
BYTE
Always 1
N/A
None
Read by Class 0 or with
qualifier 0, 1, 2, or 6
BYTE
Always 1
N/A
None
Read by Class 0 or with
qualifier 0, 1, 2, or 6
Object 12 - Control Relay Outputs
Object
Point
Var
12
0
1
12
1
12
2
IM02601006E
Description
Format
Range
Multiplier
Units
Comments
Reset Energy
Counters
N/A
N/A
N/A
none
Responds to Function 5
(Direct Operate), Qualifier Code 17x or 28x,
Control Code 3, Count 0,
On 0 msec, Off 1 msec
ONLY.
1
Change to
Modbus RTU
Protocol
N/A
N/A
N/A
none
Responds to Function 6
(Direct Operate - No
Ack), Qualifier Code
17x, Control Code 3,
Count 0, On 0 msec, Off
1 msec ONLY.
1
Reset Demand
Counters (Max
/ Min)
N/A
N/A
N/A
none
Responds to Function 5
(Direct Operate), Qualifier Code 17x or 28x,
Control Code 3, Count 0,
On 0 msec, Off 1 msec
ONLY.
www.eaton.com
D-3
IQ 250S
D: DNP Map
Object 20 - Binary Counters (Primary Readings) - Read via Class 0 or with qualifier 0, 1, 2,
or 6
Object
Point
Var
20
0
5
20
1
20
Description
Format
Range
Multiplier
Units
W-hours,
Positive
UINT32
0 to
99999999
Multiplier =
10(n-d),
where n and d
are derived
from the
energy format.
n = 0, 3, or 6
per energy
format scale
and d =
number of
decimal
places.
5
W-hours,
Negative
UINT32
0 to
99999999
Whr
2
5
VAR-hours,
Positive
UINT32
0 to
99999999
VARhr
20
3
5
VAR-hours,
Negative
UINT32
0 to
99999999
VARhr
20
4
5
VA-hours,
Total
UINT32
0 to
99999999
VAhr
Whr
Comments
example:
energy format =
7.2K and Whours counter =
1234567 n=3 (K
scale), d=2 ( 2
digits after decimal point), multiplier = 10(3-2)
= 101 = 10, so
energy is
1234567 * 10
Whrs, or
12345.67 KWhrs
Object 30 - Analog Inputs (Secondary Readings) - Read via Class 0 or with qualifier 0, 1, 2,
or 6
Object
Point
Var
30
0
4
Meter Health
sint16
0 or 1
N/A
None
0 = OK
30
1
4
Volts A-N
sint16
0 to 32767
(150 / 32768)
V
Values above
150V
secondary
read 32767.
30
2
4
Volts B-N
sint16
0 to 32767
(150 / 32768)
V
30
3
4
Volts C-N
sint16
0 to 32767
(150 / 32768)
V
30
4
4
Volts A-B
sint16
0 to 32767
(300 / 32768)
V
30
5
4
Volts B-C
sint16
0 to 32767
(300 / 32768)
V
30
6
4
Volts C-A
sint16
0 to 32767
(300 / 32768)
V
30
7
4
Amps A
sint16
0 to 32767
(10 / 32768)
A
IM02601006E
Description
Format
Range
www.eaton.com
Multiplier
Units
Comments
Values above
300V
secondary
read 32767.
Values above
10A
secondary
read 32767.
D-4
IQ 250S
Object
Point
Var
30
8
4
Amps B
sint16
0 to 32767
(10 / 32768)
A
30
9
4
Amps C
sint16
0 to 32767
(10 / 32768)
A
30
10
4
Watts, 3-Ph
total
sint16
-32768 to
+32767
(4500 /
32768)
W
30
11
4
VARs, 3-Ph
total
sint16
-32768 to
+32767
(4500 /
32768)
VAR
30
12
4
VAs, 3-Ph total
sint16
0 to +32767
(4500 /
32768)
VA
30
13
4
Power Factor,
3-Ph total
sint16
-1000 to
+1000
0.001
None
30
14
4
Frequency
sint16
0 to 9999
0.01
Hz
30
15
4
Positive Watts,
3-Ph,
Maximum Avg
Demand
sint16
-32768 to
+32767
(4500 /
32768)
W
30
16
4
Positive VARs,
3-Ph,
Maximum Avg
Demand
sint16
-32768 to
+32767
(4500 /
32768)
VAR
30
17
4
Negative
Watts, 3-Ph,
Maximum Avg
Demand
sint16
-32768 to
+32767
(4500 /
32768)
W
30
18
4
Negative
VARs, 3-Ph,
Maximum Avg
Demand
sint16
-32768 to
+32767
(4500 /
32768)
VAR
30
19
4
VAs, 3-Ph,
Maximum Avg
Demand
sint16
-32768 to
+32767
(4500 /
32768)
VA
30
20
4
Angle, Phase A
Current
sint16
-1800 to
+1800
0.1
degree
30
21
4
Angle, Phase B
Current
sint16
-1800 to
+1800
0.1
degree
30
22
4
Angle, Phase C
Current
sint16
-1800 to
+1800
0.1
degree
30
23
4
Angle, Volts
A-B
sint16
-1800 to
+1800
0.1
degree
30
24
4
Angle, Volts
B-C
sint16
-1800 to
+1800
0.1
degree
30
25
4
Angle, Volts
C-A
sint16
-1800 to
+1800
0.1
degree
IM02601006E
Description
Format
D: DNP Map
Range
www.eaton.com
Multiplier
Units
Comments
D-5
IQ 250S
Description
Format
D: DNP Map
Object
Point
Var
Range
Multiplier
Units
30
26
4
CT numerator
sint16
1 to 9999
N/A
none
30
27
4
CT multiplier
sint16
1, 10, or 100
N/A
none
30
28
4
CT
denominator
sint16
1 or 5
N/A
none
30
29
4
PT numerator
SINT16
1 to 9999
N/A
none
30
30
4
PT multiplier
SINT16
1, 10, or 100
N/A
none
30
31
4
PT
denominator
SINT16
1 to 9999
N/A
none
30
32
4
Neutral
Current
SINT16
0 to 32767
(10 / 32768)
A
Comments
CT ratio =
(numerator
* multiplier)
/ denominator
PT ratio =
(numerator
* multiplier)
/ denominator
For 1A
model, multiplier is (2 /
32768) and
values above
2A
secondary
read 32767
Object 80 - Internal Indicator
Object
Point
Var
80
7
1
Description
Device Restart Bit
Format
Range
Multiplier
Units
N/A
N/A
N/A
none
Comments
Clear via
Function 2
(Write),
Qualifier
Code 0.
D.7: DNP Message Layouts
Legend
All numbers are in hexadecimal base. In addition the following symbols are used.
dst
16 bit frame destination address
src
16 bit frame source address
crc
IM02601006E
DNP Cyclic redundant checksum (polynomial
x16+x13+x12+x11+x10+x7+x6+x5+x2+1)
x
transport layer data sequence number
y
application layer data sequence number
www.eaton.com
D-6
IQ 250S
D: DNP Map
Link Layer related frames
Reset Link
Request
05
64
05
C0
dst
src
crc
Reply
05
64
05
00
src
dst
crc
Request
05
64
05
C1
dst
src
crc
Reply
05
64
05
00
src
dst
crc
Request
05
64
05
C9
dst
src
crc
Reply
05
64
05
0B
src
dst
crc
Reset User
Link Status
Application Layer related frames
Clear Restart
Request 05
Cx
64
Cy
0E
02
C4 dst
50 01 00
Reply
64
Cy
0A
81
44 src
dst
int. ind. crc
05
Cx
src
07 07
crc
00 crc
crc
Class 0 Data
Request
05
Cx
64
Cy
0B
01
C4 dst
3C 01 06
src
crc
crc
Request
05
(alternate) Cx
64
Cy
14
01
C4 dst
3C 02 06
src
3C 03
crc
06 3C 04
Reply
(same for
either
request)
05 64
Cx Cy
pt 1
00 00
pt6 pt
pt
pt
pt
IM02601006E
06
3C 01
72 44 src
dst
crc
81 int. ind. 14 05 00 00 04 pt 0
pt 2
pt 3
pt 4
20 pt 0
pt 1
pt 2
pt 3
pt 4
7
15
23
31
pt
pt
pt
pt
8
16
24
32
pt 9
pt 17
pt 25
0A 02
pt 10
pt 18
pt 26
00 00
pt 11
pt 19
pt 27
02 pt0
www.eaton.com
pt 12
pt 20
pt 28
pt1 pt2
06 crc
pt 1
1E 04
pt 5
pt6
crc
crc
crc
pt 13
pt 21
pt 29
crc
crc
crc
crc
D-7
IQ 250S
D: DNP Map
Reset Energy
Request 05
Cx
00
64
Cy
00
18
05
00
C4 dst
0C 01 17
crc
src
01 00
crc
03 00
00
00
00
00
01
00
crc
Reply
64
Cy
00
1A
81
00
44 src
dst
int. ind. 0C 01 17
00 00 crc
crc
01 00
03
00
00
00
00
00
crc
05
Cx
01
Request
05
(alternate) Cx
01
64
Cy
00
1A
05
00
Reply
64
Cy
00
1C 44 src
dst
crc
81 int. ind. 0C 01 28 01 00
01 00 00 00 00 crc
05
Cx
00
C4 dst
src
0C 01 28 01 00
00 00 crc
crc
00 00
03
00
00
00
00
00
crc
00
00
03
00
00
00
crc
Switch to Modbus
Request 05
Cx
00
64
Cy
00
18
06
00
C4 dst
0C 01 17
crc
src
01 01
crc
03 00
00
00
00
00
01
00
crc
No Reply
Reset Demand (Maximums & Minimums)
Request 05
Cx
00
64
Cy
00
18
05
00
C4 dst
0C 01 17
crc
src
01 02
crc
03 00
00
00
00
00
01
00
crc
Reply
05
Cx
01
64
Cy
00
1A
81
00
44 src
dst
int. ind. 0C 01 17
00 00 crc
crc
01 02
03
00
00
00
00
00
crc
Request 05
(alternate) Cx
01
64
Cy
00
1A
05
00
C4 dst
src
0C 01 28 01 02
00 00 crc
crc
00 00
03
00
00
00
00
00
crc
Reply
64
Cy
00
1C 44 src
dst
crc
81 int. ind. 0C 01 28 01 02
01 00 00 00 00 crc
00
00
03
00
00
00
crc
05
Cx
00
Error Reply
Reply
05
Cx
IM02601006E
64
Cy
0A 44 src
dst
81 int. ind. crc
crc
www.eaton.com
D-8
IQ 250S
D: DNP Map
D.8: Internal Indication Bits
Bits implemented in the IQ 250S meter are listed below. All others are always reported as zeroes.
Bad Function
Occurs if the function code in a User Data request is not Read (0x01), Write (0x02), Direct Operate
(0x05), or Direct Operate, No Ack (0x06).
Object Unknown
Occurs if an unsupported object is specified for the Read function. Only objects 10, 20, 30, and 60
are supported.
Out of Range
Occurs for most other errors in a request, such as requesting points that don’t exist or direct
operate requests in unsupported formats.
Buffer Overflow
Occurs if a read request or a read response is too large for its respective buffer. In general, if the
request overflows, there will be no data in the response while if the response overflows at least the
first object will be returned. The largest acceptable request has a length field of 26, i.e. link header
plus 21 bytes more, not counting checksums. The largest possible response has 7 blocks plus the
link header.
Restart
All Stations
These 2 bits are reported in accordance with standard practice.
IM02601006E
www.eaton.com
D-9
IQ 250S
D: DNP Map
This page intentionally left blank.
IM02601006E
www.eaton.com
D-10
Was this manual useful for you? yes no
Thank you for your participation!

* Your assessment is very important for improving the work of artificial intelligence, which forms the content of this project

Download PDF

advertisement