Toshiba BDX1250KE User's Manual

Add to My manuals
73 Pages

advertisement

Toshiba BDX1250KE User's Manual | Manualzz
Blu-ray Disc™ Player
BDX1250KE
Owner’s Manual
Contents
English
1 Important ................................................................................................................... 3-4
Safety and important notice ..............................................................................................3
Disposal of your old product and batteries ...................................................................... 3-4
2 Your Product .............................................................................................................. 5-7
Regions codes ................................................................................................................. 5
Product overview ............................................................................................................. 6
Remote Control................................................................................................................ 7
3 Connections ............................................................................................................... 8-9
Connecting to a TV .......................................................................................................... 8
Optional Connection ......................................................................................................... 8
Connect USB device ......................................................................................................... 9
Connect Power ................................................................................................................ 9
4 Preparation ................................................................................................................. 10
Prepare the remote control ............................................................................................. 10
Setting up the player ...................................................................................................... 10
5 Playback ................................................................................................................. 11-13
Playback Functions .....................................................................................................11-13
6 Customizing ............................................................................................................14-20
General Setting ..........................................................................................................14-18
Display Setting...........................................................................................................18-19
Audio Setting..................................................................................................................20
System information ........................................................................................................ 20
6SHFL¿FDWLRQ ............................................................................................................... 21
8 Troubleshooting .....................................................................................................22-23
9 Glossary ..................................................................................................................24-25
10 License Information ...............................................................................................26-48
2
Safety and important notice
Disposal of your old product and
batteries
Warning:
‡5LVNRIRYHUKHDWLQJ1HYHULQVWDOOWKHSURGXFWLQD
FRQ¿QHGVSDFH$OZD\VOHDYHDVSDFHRIDWOHDVW
10cm around the product for ventilation. Ensure
curtains or other objects never cover the
ventilation slots on the product.
‡1HYHUSODFHWKHSURGXFWUHPRWHFRQWURORU
EDWWHULHVQHDUQDNHGÀDPHVRURWKHUKHDW
sources, including direct sunlight.
‡2QO\XVHWKLVSURGXFWLQGRRUV.HHSWKLVSURGXFW
DZD\IURPZDWHUPRLVWXUHDQGOLTXLG¿OOHG
objects.
‡1HYHUSODFHWKLVSURGXFWRQRWKHUHOHFWULFDO
equipment.
‡.HHSDZD\IURPWKLVSURGXFWGXULQJOLJKWQLQJ
storms.
‡:KHUHWKHPDLQVSOXJRUDQDSSOLDQFHFRXSOHULV
used as the disconnect device, the disconnect
device shall remain readily operable.
LASER
CAUTION:
86(2)&21752/625$'-8670(17625
3(5)250$1&(2)352&('85(627+(57+$1
7+26(63(&,),('+(5(,10$<5(68/7,1
+$=$5'2865$',$7,21(;32685(
CAUTION:
9,6,%/($1',19,6,%/(/$6(55$',$7,21
:+(123(1$1',17(5/2&.6'()($7(''2
12767$5(,172%($0
LOCATION:
,16,'(1($57+('(&.0(&+$1,60
EU Conformity Statement
This product is marked with "CE" and complies
therefore with the applicable harmonized
(XURSHDQVWDQGDUGVOLVWHGXQGHUWKH/RZ
9ROWDJH'LUHFWLYH(&DQGWKH(0&
Directive 2004/108/EC. ErP Directive 2009/125/
EC
Responsible for CE-marking is
726+,%$(8523(*0%+
+DPPIHOGGDPP'1HXVV*HUPDQ\
Pb,Hg,Cd
Following information is only valid for EUmember States:
Disposal of products
The crossed out wheeled dust bin symbol
indicates that products must be collected and
disposed of separately from household waste.
Integrated batteries and accumulators can
be disposed of with the product. They will be
separated at the recycling centres.
The black bar indicates that the product was
placed on the market after August 13, 2005.
By participating in separate collection of
products and batteries, you will help to assure
the proper disposal of products and batteries
and thus help to prevent potential negative
consequences for the environment and human
health.
For more detailed information about the
collection and recycling programmes available
in your country, please contact your retailer
where the product was purchased.
Disposal of batteries and/or accumulators
The crossed out wheeled dust bin symbol
indicates that batteries and/or accumulators
must be collected and disposed of separately
from household waste.
If the battery or accumulator contains more
than the specified values of lead (Pb),
mercury (Hg),and/or cadmium (Cd) defined in
the Battery Directive (2006/66/EC), then the
chemical symbols for lead (Pb), mercury (Hg)
and/or cadmium (Cd) will appear below the
crossed out wheeled dust bin symbol.
By participating in separate collection of
batteries, you will help to assure the proper
disposal of products and batteries and
thus help to prevent potential negative
consequences for the environment and
human health.
For more detailed information about the
collection and recycling programmes available
in your country, please contact your retailer
where the product was purchased.
Copyright notice
This product incorporates copyright
protection technology that is protected by
U.S. patents and other intellectual
property rights. Use of this copyright
protection technology must be authorized
by Rovi Corporation, and is intended for
3
English
1 Important
English
home and other limited viewing uses only
unless otherwise authorized by Rovi
Corporation. Reverse engineering or
disassembly is prohibited.
Notice for Trademark
+'0,WKH+'0,ORJRDQG+LJK'H¿QLWLRQ
0XOWLPHGLD,QWHUIDFHDUHWUDGHPDUNVRU
UHJLVWHUHGWUDGHPDUNVRI+'0,/LFHQVLQJ
//&LQWKH8QLWHG6WDWHVDQGRWKHU
countries.
µ$9&+'¶DQGWKHµ$9&+'¶ORJRDUH
trademarks of Panasonic Corporation and
Sony Corporation.
‘DVD Video¶ is a trademark of DVD Format/
/RJR/LFHQVLQJ&RUSRUDWLRQ
2UDFOHDQG-DYDDUHUHJLVWHUHGWUDGHPDUNV
RI2UDFOHDQGRULWVDI¿OLDWHV2WKHUQDPHV
may be trademarks of their respective
owners.
BONUSVIEW ™
Blu-ray Disc70, Blu-ray70%'/LYH70,
%21869,(:70, and the logos are
trademarks of the Blu-ray Disc Association.
0DQXIDFWXUHGXQGHUOLFHQVHIURP'ROE\
/DERUDWRULHV'ROE\DQGWKHGRXEOH'
symbol are trademarks of Dolby
/DERUDWRULHV
0DQXIDFWXUHGXQGHUOLFHQVHXQGHU86
3DWHQW1RV
RWKHU
86DQGZRUOGZLGHSDWHQWVLVVXHG
SHQGLQJ'76+'WKH6\PERO'76+'
and the Symbol together are registered
WUDGHPDUNV'76+'0DVWHU$XGLR_
(VVHQWLDOLVDWUDGHPDUNRI'76,QF
3URGXFWLQFOXGHVVRIWZDUH‹'76,QF$OO
Rights Reserved.
4
$%287',9;9,'(2
'LY;® is a digital video format created by
'LY;,QF7KLVLVDQRI¿FLDO'LY;&HUWL¿HG®
GHYLFHWKDWSOD\V'LY;YLGHR9LVLWGLY[FRP
for more information and software tools to
FRQYHUW\RXU¿OHVLQWR'LY;YLGHR
$%287',9;9,'(221'(0$1'
7KLV'LY;&HUWL¿HG® device must be
UHJLVWHUHGLQRUGHUWRSOD\SXUFKDVHG'LY;
Video-on-Demand (VOD) movies. To
obtain your registration code, locate the
'LY;92'VHFWLRQLQ\RXUGHYLFHVHWXS
PHQX*RWRYRGGLY[FRPIRUPRUH
information on how to complete your
registration.
'LY;®'LY;&HUWL¿HG® and associated logos
DUHWUDGHPDUNVRI'LY;,QFDQGDUHXVHG
under license.
)RU+'7HVW.LWSYDQGODWHU
'LY;&HUWL¿HG®WRSOD\'LY;® video up to
+'SLQFOXGLQJSUHPLXPFRQWHQW
Region
Regions Codes
Both the Blu-ray Disc70 Player and the
discs are coded by region. These regional
codes must match in order to play the
GLVF,IWKHFRGHVGRQRWPDWFKWKHGLVF
will not play.
7KH5HJLRQ1XPEHUIRUWKLV%OXUD\'LVF70
Player is described on the rear panel of the
Blu-ray Disc70 player.
Region
" %
$
#
DVD discs that
can be played
ALL
1
ALL
2
ALL
3
" !
#
!
ALL
4
" ALL
5
"!"
ALL
6
Blu-ray™ discs that
can be played
English
2 Your Product
North America,
Central America,
South America,
Korea, Japan, Taiwan,
Hong Kong and
South East Asia.
Europe, Greenland,
French territories,
Middle East, Africa,
Australia and
New Zealand.
India, China, Russia,
Central and
South Asia.
Feature highlights
+LJK'H¿QLWLRQHQWHUWDLQPHQW
:DWFKKLJKGH¿QLWLRQFRQWHQWGLVFZLWK
+'79+LJK'H¿QLWLRQ7HOHYLVLRQ&RQQHFW
LWWKURXJKDKLJKVSHHG+'0,FDEOH<RX
FDQHQMR\H[FHOOHQWSLFWXUHTXDOLW\XSWR
1080p resolution with the frame rate of 24
frames per second with progressive scan
output.
BD-Live70
Connect this player to the movie studios
website via the LAN jack to access a
variety of up-to-date content (e.g.
refreshed previews and exclusive special
features).
Blu-ray Disc 70 Java
Blu-ray Disc 70-DYD%'-$SSOLFDWLRQ
7KH%'520IRUPDWVXSSRUWV-DYDIRU
LQWHUDFWLYHIXQFWLRQV³%'-´RIIHUVFRQWHQW
providers almost unlimited functionality
ZKHQFUHDWLQJLQWHUDFWLYH%'520WLWOHV
5
Product overview
English
Main Unit
6
7
NO
4
3
Control
Function
a
Turns the power on or restores the unit to the standby mode.
b
#9
Playback/Pause.
c
Y
Stop play.
d
;
Open or close the disc compartment.
e
Display panel
Show information about the current status of this unit.
f
,56HQVRU
3RLQWWKHUHPRWHFRQWURODWWKH,5VHQVRU
g
Disc compartment
/RDGVDGLVFLQWRWKHGLVFGULYH
1
6
5
2
3
4
2
1
5
NO
Control
Function
a
AC power cord
Connects to a standard AC outlet.
b
&2$;,$/MDFN
2XWSXWGLJLWDODXGLRVLJQDOVZKHQFRQQHFWLQJWKHFRD[LDOGLJLWDOFDEOH
c
HDMI OUTPUT jack
2XWSXWVYLGHRDXGLRVLJQDOVWRDFRQQHFWHG79PRQLWRURU$9DPSOL¿HU
&RQQHFWWRD79PRQLWRURU$9DPSOL¿HUHTXLSSHGZLWK+'0,LQSXW.
d
LAN jack
8VHWKLVWRFRQQHFWWRDQHWZRUNZLWKDQDOZD\VRQEURDGEDQGFRQQHFWLRQ,WLV
UHVHUYHGIRUIXWXUHXVDJHRI%'/LYHŒ
e
USB jack
&RQQHFWD86%ÀDVKGULYH
English
Remote Control
OPEN/CLOSE
/ Open/ Close the disc tray
Number Buttons
Select numbered items in a menu
Press to enter track/ chapter/ title
numbers/password directly
CLEAR
/ To clear an entry or the bookmark and program you set
MC(Media Center)
/ To open/close Media Center
POP MENU/MENU
/ To display a menu included on many
Blu-ray Disc™/DVD video discs
OK
/ Acknowledge/ Confirm menu selection
/ Navigation/ Cursor buttons for moving
to the left / right / up / down
/ Press
during JPEG playback to rotate the
current photo track, but the JPEG playback
will be paused
RETURN
/ Return to previous menu
TOP MENU
/ To display the disc title during playback
PROGRAM
/ To access program list.
DIGEST
/ To access JPEG thumbnail
view during playback
SUBTITLE
/ To display subtitle; press repeatedly
to select different subtitles available
in your disc
AUDIO
/ To select the sound stream; press
repeatedly to select different audio
streams available in your disc
ANGLE
/ Switch the camera angle during playback
REMOTE SIGNAL EMITTER
/ Point remote control to the sensor on
the front panel
ON / STANDBY
7 To switch the Blu-ray Disc™ Player to ON or
standby mode
SETUP
Enters or exits the system setup menu
REPEAT A-B
0 To repeat from A to B
REPEAT
0 Selects various repeat mode.
SEARCH
0 To search a title, chapter, track or
playing time
DISPLAY
0 To display a window to locate a title,
chapter or track
/
Instant replay/instant search
F.R & F.F
Fast reverse/ fast forward
PLAY/PAUSE
0 Start/Pause playback
PREV & NEXT
0 Skip to previous/next chapter/ title/track
STOP
0 Stop playback
Do a slow forward during normal
playback
Advance the picture frame by
frame during pause mode
ZOOM
7 To zoom out/in
BOOKMARK
7 To bookmark at any point during playback
PIP (Picture in Picture)
7 Switch on or off the secondary video
PIP AUDIO
Switch the secondary audio
of secondary video(PIP) to on or off
HDMI
7 To change resolution of HDMI video
output to fit TV. Such as 1080p, 1080i… etc
7
3 Connections
English
0DNHWKHIROORZLQJFRQQHFWLRQWRXVHWKLV
product.
Connecting to a TV
Connect the product to TV to view the
playback from the disc.
Connect to the HDMI Jack
Optional Connection
Option 1:&RQQHFWWRWKHGLJLWDODPSOL¿HU
receiver
Option 2: Connect to network
Option 1: Connect to the digital
DPSOL¿HUUHFHLYHU
Route the sound from this player to other
device to enhance audio output.
DIGITAL AUDIO
INPUT
COAXIAL
HDMI IN
&RQQHFWD+'0,FDEOHIURPWKH+'0,
RXWSXWMDFNRQWKLVSURGXFWWRWKH+'0,
input jack on the TV.
Note: ʹzŽƵĐĂŶŽƉƟŵŝnjĞƚŚĞǀŝĚĞŽŽƵƚƉƵƚďLJ
ƉƌĞƐƐŝŶŐƚŚĞ,D/ďƵƩŽŶƌĞƉĞĂƚĞĚůLJƚŽƐĞůĞĐƚ
ƚŚĞďĞƐƚƌĞƐŽůƵƟŽŶǁŚŝĐŚƚŚĞdsĐĂŶƐƵƉƉŽƌƚ͘
&RQQHFWDFRD[LDOFDEOHIURPWKH
&2$;,$/MDFNRQWKLVSURGXFWWRWKH
&2$;,$/MDFNRQWKHGHYLFH
Option 2: Connect to network
Connect this product to the network to
HQMR\%'/LYH70 bonus content and
software upgrade by network.
&RQQHFWWKHQHWZRUNFDEOHIURPWKH/$1
MDFNRQWKHSURGXFWWRWKH/$1MDFNRQWKH
network system.
8
Connect USB device
English
A USB device provides an additional memory
WRVRIWZDUHXSJUDGHDQGHQMR\%'/LYH70
bonus content.
<RXFDQDOVRHQMR\SOD\LQJEDFN03-3(*
03(*'LY;® ¿OHV VWRUHG LQ WKH 86% ÀDVK
device.
1. Connect the USB Flash device to the
USB jack on this product.
Notes:
-­‐ Connect only a USB Flash device to the USB jack on this product.
-­‐ To enjoy BD-­‐Live™ bonus content, as your
local storage, use a 1 GB or larger USB
memory.
Ͳ&Žƌ ƐŽŵĞ ůƵͲƌĂLJdD ĚŝƐĐƐ ǁŝƚŚ Ͳ>ŝǀĞdD ĨĞĂƚƵƌĞ͕LJŽƵŵĂLJŶĞĞĚƚŽƉůƵŐŝŶƚŚĞh^ĚĞǀŝĐĞ
ďĞĨŽƌĞůŽĂĚŝŶŐƚŚĞĚŝƐĐ͘KƚŚĞƌǁŝƐĞ͕ƚŚĞĚŝƐĐŵĂLJ
ŶŽƚƉůĂLJďĂĐŬ͘
-­‐ TOSHIBA does not guarantee 100%
ĐŽŵƉĂƟďŝůŝƚLJǁŝƚŚĂůůh^&ůĂƐŚĚĞǀŝĐĞƐ͘
Connect Power
&RQQHFWWKH$&SRZHUFDEOHWR
- the wall socket.
‡7KHSURGXFWLVUHDG\WREHVHWXSIRUXVH
Notes: ʹĞĨŽƌĞĐŽŶŶĞĐƟŶŐƚŚĞƉŽǁĞƌĐŽƌĚ͕ĞŶƐƵƌĞ
LJŽƵŚĂǀĞĐŽŵƉůĞƚĞĚĂůůŽƚŚĞƌĐŽŶŶĞĐƟŽŶƐ͘
– ZŝƐŬŽĨƉƌŽĚƵĐƚĚĂŵĂŐĞ͊ŶƐƵƌĞƚŚĂƚƚŚĞƉŽǁĞƌ
ƐƵƉƉůLJǀŽůƚĂŐĞĐŽƌƌĞƐƉŽŶĚƐƚŽƚŚĞǀŽůƚĂŐĞƉƌŝŶƚĞĚ
ŽŶƚŚĞďĂĐŬŽĨƚŚĞƵŶŝƚ͘
ʹdŚĞƚLJƉĞƉůĂƚĞŝƐůŽĐĂƚĞĚŽŶƚŚĞďĂĐŬŽĨƚŚĞƵŶŝƚ͘
9
4 Preparation
Setting up the player
English
Always follow the instructions in this chapter
in sequence.
Note:
ͲhƐĞŽĨĐŽŶƚƌŽůƐŽƌĂĚũƵƐƚŵĞŶƚƐŽƌ
ƉĞƌĨŽƌŵĂŶĐĞŽĨƉƌŽĐĞĚƵƌĞƐŽƚŚĞƌƚŚĂŶŚĞƌĞŝŶ
ŵĂLJƌĞƐƵůƚŝŶŚĂnjĂƌĚŽƵƐƌĂĚŝĂƟŽŶĞdžƉŽƐƵƌĞŽƌ
ŽƚŚĞƌƵŶƐĂĨĞŽƉĞƌĂƟŽŶ͘
Prepare the remote control
Initial Setting
:KHQ\RXWXUQRQWKLVXQLWIRUWKH¿UVWWLPH
you need to follow these steps.
1. A welcome page will be displayed when
this product is powered on.
3UHVV2.WRHQWHUODQJXDJHVHWWLQJ
3. Select your desired language,
resolution and aspect ratio using S/T, then
SUHVV2.
3UHVV6(783WRH[LWWKH6HWXSPHQX
1. Open the battery compartment.
,QVHUWRQH5EDWWHU\ZLWKFRUUHFW
polarity (+/-) as indicated.
3. Close the battery compartment.
Notes: Ͳ/ĨLJŽƵĂƌĞŶŽƚŐŽŝŶŐƚŽƵƐĞƚŚĞƌĞŵŽƚĞĐŽŶƚƌŽů
ĨŽƌĂůŽŶŐƟŵĞ͕ƌĞŵŽǀĞƚŚĞďĂƩĞƌLJ͘
Ͳ ZŝƐŬ ŽĨ ĞdžƉůŽƐŝŽŶ͊ <ĞĞƉ ďĂƩĞƌLJ ĂǁĂLJ ĨƌŽŵ
ŚĞĂƚ͕ƐƵŶƐŚŝŶĞŽƌĮƌĞ͘EĞǀĞƌĚŝƐĐĂƌĚďĂƩĞƌLJŝŶ
ĮƌĞ͘
Use the SETUP menu
1. Press SETUP to display the Setup menu
when the Blu-ray Disc70 Player is playing or
no disc. And press SETUP WRH[LWWKH6HWXS
menu.
‡7KHPD[LPXPRSHUDEOHUDQJHVIURP
the unit are as follows.
/LQHRIVLJKWDSSUR[P
(LWKHUVLGHRIWKHFHQWUHDSSUR[P
within 30°
$ERYHDSSUR[PZLWKLQƒ
%HORZDSSUR[PZLWKLQƒ
7m
10
Find the correct viewing input
1. Press to turn on this product.
2. Turn on the TV and switch to the correct
video-in input (refer to the TV user manual
on how to select the correct input).
10 m
7m
dŝƉ͗
ͲtŚĞŶƉůĂLJŝŶŐŚŝŐŚͲĚĞĮŶŝƟŽŶƐŽƵƌĐĞƐ LJŽƵŵƵƐƚƉƌĞƐƐ
STOP „ ďƵƩŽŶƚŽĞŶƚĞƌSETUP ŝŶƚĞƌĨĂĐĞ͘
Select menu display language
1. Press SETUP, [General Setting] menu
is displayed.
2. Select [Language], then press X.
3. Select [OSD], then press X.
- The language options may vary for
different regions.
4. Press S/T to select a language, then
press 2.
Note:
Ͳ/ĨƚŚŝƐĚŝƐĐƉůĂLJĞƌŝƐĐŽŶŶĞĐƚĞĚƚŽĂ,D/
ĐŽŵƉůŝĂŶƚds͕ƐŬŝƉƚŚŝƐƐĞƚƚŝŶŐ͘/ƚƐǁŝƚĐŚĞƐ
ĂƵƚŽŵĂƚŝĐĂůůLJƚŽƚŚĞƐĂŵĞK^ŵĞŶƵůĂŶŐƵĂŐĞ
ĂƐƉĞƌLJŽƵƌdsƐĞƚƚŝŶŐ͘
Playback Functions
Basic Playback
1. Press button on the front panel or the
remote control, your Blu-ray Disc™ player
will turn on.
The unit will take around 20 seconds to
warm up.
2. Turn on the TV, and then select the input
setting on the TV that matches the
connection method you used to connect your
player.
3UHVV23(1&/26(; to slide out the disc
tray.
4. Place a disc on the disc tray with the label
IDFLQJXSDQGWKHQSUHVV23(1&/26(; to
slide back and close the disc tray.
The disc loading time depends on the types
of disc you are loading, and loading a Blu-ray
Disc70 will take longer time.
,IWKHGLVFGRHVQRWVWDUWSOD\LQJ
automatically, please press #9 to start
playback.
,ID%OXUD\'LVF70 or DVD menu displays,
XVHFXUVRUEXWWRQVWRVHOHFW3/$<7KHQ
SUHVV2.WRFRQ¿UP
7RHMHFWWKHGLVFSUHVV23(1&/26(;.
Pause playback
1. Press #9 to pause playback. The sound
will be muted.
2. Press #9 to resume the playback.
Stop playback
1. Press STOP „ button once to go to resume
mode, the TV screen will show the resume logo.
2. Press STOP „ twice to stop the playback
completely.
3. Press #9 to resume playback from the point
where playback is stopped or from the
beginning of the disc after the playback is
completely stopped.
1RWDOO%OXUD\70 discs support the resume
feature.
Fast Forward and Fast Reverse
VHTXHQFH
;;;;;
2. Press #9 to resume playback.
3. Press F.R N to fast reverse through the
disc. The fast reverse speed changes based on
how many times you pressed the button.
The speed will increase through the
IROORZLQJVHTXHQFH
;;;;;
4. Press #9 to resume playback.
Instant Search and Instant Replay
1. During playback, press and hold .button,
you can search 30 seconds forward.
2. During playback, press and hold N
button, you can instant replay the content
from 10 seconds before.
3UHYLRXVDQG1H[W
During playback, press PREV button,
and you can skip back to the previous
chapter or track. Each press of this button
will allow you to skip a chapter or track till
the beginning of the disc.
3UHVVRI1(;7 button during playback
ZLOODOORZ\RXWRVNLSWKHSOD\EDFNWRQH[W
chapter or track.
Slow Forward
1. Press # during normal playback. The slow
forward speed is 1/16 in default.
2. To change slow forward speed, press #
repeatedly, and the slow forward speed will be
FKDQJHGLQWKHIROORZLQJVHTXHQFH
1/4, 1/2, normal.
7RH[LWVORZIRUZDUGPRGHDQGUHWXUQWR
normal playback, press #9.
Step Forward
Use this feature to help you to enjoy the
video frame by frame.
1. Press #9 during normal playback, then
playback will change to pause state.
2. Press # repeatedly to advance the
picture frame by frame.
3. Press #9 to resume normal playback.
HDMI
:KHQWKHUHLV¿OHRUGLVFEHLQJSOD\HGLWLV
not allowed to switch resolution through
WKH+'0,EXWWRQRIWKH5HPRWH&RQWURO
1. Press F.F . to fast forward through the
disc. The fast forward speed changes based on
how many times you pressed the button. The
speed will increase through the following
11
English
5 Playback
Advanced Playback
English
12
DISPLAY
Press this button and the screen will display
VRPHLQIRUPDWLRQDERXWGLVFVXFKDV7LWOH
number, Chapter number, Track number,
(ODSVHG7LPH0RGH$XGLR$QJOHDQG
Subtitle languages. Press this button again to
turn off the information display.
REPEAT
Press REPEAT repeatedly to select different
repeat modes.
'9'5HSHDW&KDSWHU5HSHDW7LWOHDQG$OO
9&'3%&2II&'-3(*035HSHDW7UDFNDQG
All.
A-B
To play certain section within the video or
song, press A-B button to set the start point.
Then, press A-B button again to set the end
point and complete the setting. The selected
section will be played repeatedly.
Press A-B button the third time to cancel this
function.
The end point cannot be set until 5 seconds
of playback has elapsed from the start point.
SEARCH
'XULQJSOD\EDFNSUHVV6($5&+EXWWRQWR
edit Title, Chapter, and Time.
Press W/XDQG2.EXWWRQRQWKHUHPRWH
control to select Title, Chapter, or Time. Then
press the numeric buttons or S/T and then
SUHVV2.7KHSOD\EDFNZLOOVNLS to the
desired location.
For Time Search, press S/T to select Title
or Chapter time search.
SUBTITLE
Press this button repeatedly and the screen
ZLOOGLVSOD\³;;;;;;´RU³2II´7KH³;´
indicates the current number of this
ODQJXDJH³;;´LQGLFDWHVWKHWRWDOQXPEHURI
ODQJXDJH³;;;´LQGLFDWHVWKHODQJXDJH
The number of available languages depends
on the disc.
RETURN
Press this button to return to the previous
on-screen menu in setup menu such as
([WHUQDO0HPRU\,QIRUPDWLRQ3DUHQWDO
Control, Country Code, etc.
'XULQJ03-3(*9,'(2SOD\EDFNSUHVV
5(7851RQFHLWZLOOUHWXUQEDFNWR0HGLD
Center page.
During VCD disc playback and PBC On is
selected, press the button to return to PBC
0HQX
ANGLE
During playback, press this button to change
the angle of the picture. The screen will
GLVSOD\³$QJOH;;´7KH¿UVW³;´LQGLFDWHVWKH
FXUUHQWQXPEHURIDQJOHDQGWKHVHFRQG³;´
indicates total number of angle.
1RWDOO%OXUD\70 or DVD has the multi-angle
feature. The screen will take around 5
seconds to change.
TOP MENU
<RXPD\SUHVVWKLVEXWWRQDWDQ\WLPHDQG
the Blu-ray Disc70 or DVD video disc
playback will pop up the disc menu.
POP MENU0(18
During Blu-ray Disc70 playback, press POP
0(180(18WRGLVSOD\WKHGLVFWLWOHDQGWKH
playback will not be stopped even the menu
is on the screen.
1. Press the S/T/W/X buttons to select an
RSWLRQWKHQSUHVV2.WRFRQ¿UP
3UHVV3230(180(18WRFORVHWKH
menu.
'XULQJ '9' SOD\EDFN SUHVV 323 0(18
0(18WRRSHQWKHGLVFPHQX
'XULQJ9&'SOD\EDFNSUHVV3230(180(18
to switch PBC On/Off.
'XULQJ GLVSOD\LQJ 86% DQG 'DWD 'LVF ¿OH
FRQWHQW LQ PHGLD FHQWHU SUHVV 323 0(18
0(18 WR DGG WKH 3KRWR0XVLF9LGHR ¿OHV WR
the playlist.
1.Press S/T/W/X buttons to select an
RSWLRQXQGHUWKH3KRWR0XVLF9LGHR¿OHV
,QWKH¿OHEURZVHUSUHVVX to select the
¿OHVWREHDGGHGWRWKHSOD\OLVW¥
ZLOODSSHDUEHVLGHWKHVHOHFWHG¿OHV
3UHVV3230(180(18EXWWRQDSRSXS
menu will appear, then press S/T DQG 2.
button to select "Add to Playlist" to add the
¿OHVWRWKH3OD\OLVW6HOHFWDOODQG&OHDUDOO
options are also available. Select "Cancel" to
H[LWWKHSRSXSPHQX
$OO WKH VHOHFWHG ¿OHV ZLOO EH DGGHG WR WKe
3OD\OLVW IROGHU <RX FDQ SOD\ RU GHOHWH WKH
¿OHVLQWKHSOD\OLVW
3UHVV3230(180(18WRGHOHWHWKH
VHOHFWHG¿OHVLQ3OD\OLVW
SETUP
Press the SETUP button, and the screen will
display some information about the player,
VXFKDV
‡ General Setting
‡ Display Setting
‡ Audio Setting
‡ 6\VWHP,QIRUPDWLRQ
PROGRAM
During CD/DVD/VCD playback, you can press
this button to edit the sequence of the
playlist.
BOOKMARK
During VCD/DVD'LY;® disc playback, press
WKH%22.0$5.EXWWRQWRDGGWKH
ERRNPDUNSUHVVDQGKROGIRUDIHZ
seconds to display the list of bookmark
which you added before on the screen,
WKHQ\RXFDQSUHVVWKH2.EXWWRQWRVHOHFW
WKHERRNPDUNRU&/($5EXWWRQWRGHOHWH
the bookmark.
AUDIO
3UHVV$8',2EXWWRQRQWKHUHPRWHFRQWUROWR
select the audio streams that set within the
Blu-ray70 or DVD disc.
7KHVFUHHQZLOOGLVSOD\
$8',2;;;;;;;;;;
³;´TKH&XUUHQW$XGLR6WUHDP1XPEHU
>6XEWLWOH6W\OH@:KHQ\RXSOD\WKH%OXUD\'LVF70 or
'9'GLVFDQGLILWKDVH[WHUQDOVXEWLWOH\RXZLOOVHHLW
in OSC menu
>%LWUDWH@8VHS/Tto select your desired Bitrate.
>6WLOO2II@&ORVHWKH6WLOOIHDWXUHRI'9'GLVF
For some DVD discs, a certain video picture will be
frozen as a still picture during the process of playback
to let the user has a better view of certain picture. To
continue playback, select Still Off.
>,QVWDQW6HDUFK@,QVWDQWVHDUFKVHFRQGV
forward.
>,QVWDQW5HSOD\@5HSOD\WKHFRQWHQWIURPVHFRQGV
before.
dŝƉƐ͗
-­‐ dŚĞƐƉĞĐŝĮĞĚŽƉĞƌĂƟŽŶĨŽƌĞĂĐŚŝƚĞŵǁŝůůǀĂƌLJǁŝƚŚ
ĚŝƐĐƚLJƉĞƐ͘ŶĚƐŽŵĞŝƚĞŵƐĂƌĞĂǀĂŝůĂďůĞŽŶůLJǁŚĞŶ
ƚŚĞĚŝƐĐŝƐƐƵƉƉŽƌƚĂďůĞ͘
ͲdŚĞŝǀyΠƐƵďƟƚůĞĮůĞŶĂŵĞ;͘ƐƵďͿŚĂƐƚŽďĞƐĂǀĞĚ
ƵŶĚĞƌƚŚĞƐĂŵĞĮůĞŶĂŵĞĂƐƚŚĞŵŽǀŝĞ;͘ĂǀŝͿŝŶƚŚĞ
ƐĂŵĞĨŽůĚĞƌ;Ğ͘Ő͘&ŽůĚĞƌ͗ĂďĐ͘ĂǀŝĂŶĚĂďĐ͘ƐƵďͿ͘
Blu-ray Disc70 BONUSVIEW70
Playing Secondary Video (Picture-in-Picture) and
Secondary Audio is for Blu-ray Disc70 only.
Secondary video can be played from a disc
FRPSDWLEOHZLWKWKH3LFWXUHLQ3LFWXUH3,3IXQFWLRQ
For the playback method, refer to the instructions
for the disc.
7XUQRQVHFRQGDU\YLGHRE\SUHVVLQJWKH3,3
button.
2. Press the 3,3$8',2EXWWRQWRVHOHFWWKH
VHFRQGDU\DXGLRDQGVHOHFWDQRSWLRQH[FHSW2II
The secondary audio is opened, you can hear the
disc secondary video sound.
,QRUGHUWRKHDUWKHVHFRQGDU\DXGLRWKH3,3
feature on the disc must be turned on.
3UHVVWKH3,3EXWWRQDJDLQWRWXUQRIIWKH
secondary video.
Primary video
Secondary video
with Secondary Audio
This function is not available when the primary
YLGHRLVSOD\HGLQ6HDUFK6ORZ0RWLRQRU)UDPH
by-Frame or Fast Forward/ Reverse mode.
To listen to the secondary audio, the digital audio
output must be set to "Bitstream", "Re-encode" or
3&02WKHUZLVHRQO\WKHprimary audio can be
heard.
Notes:
ͲEŽƚĂůůƚŚĞůƵͲƌĂLJΡĚŝƐĐƐĐĂŶƐƵƉƉŽƌƚƚŚŝƐ
ĨƵŶĐƟŽŶ͘
Ͳ,ŝŐŚĞĮŶŝƟŽŶW/W;^ĞĐŽŶĚsŝĚĞŽͿŝƐŶŽƚƐƵƉƉŽƌƚĞĚ͘
13
English
³;;´7KHWRWDOQXPEHURI$XGLR6WUHDP
³;;;´$XGLR/DQJXDJH
³;;;;´$XGLR7HFKQRORJ\
MC
3UHVVWKLVEXWWRQWRSOD\PHGLD¿OHVLQWKH86%
ZOOM
3UHVV=220EXWWRQUHSHDWHGO\WR=RRPLQRXW
playback in the video.
=RRPPRGH=RRP[!=RRP[!=RRP
[!=RRP!=RRP!=RRP
DIGEST
During playback of -3(*GLVFSUHVV',*(67
to view a page of 12 thumbnail images.
- Use S/T/W/X to select an image.
3UHVV2.WRYLHZWKHVHOHFWHGLPDJHLQIXOO
screen and subsequent images will be
displayed one after another automatically.
- Press PREV 1(;7 to view the
SUHYLRXVRUQH[WWKXPEQDLOVFUHHQ
PIP AUDIO
3UHVV3,3$8',2EXWWRQWRRSHQWKH
VHFRQGDU\DXGLRRIVHFRQGDU\YLGHR3,3¶V
sub-window video).
OSC
Press OSC to open On Screen Control menu
GXULQJSOD\EDFN,QWKLVPHQX\RXFDQPDNH
some playback-related control.
The on screen control contains following
LWHPV
>7LWOH@7KHWLWOHLQFXUUHQWSOD\EDFNWLWOHVLQ
total. Select your desired title to playback.
>&KDSWHU@7KHFKDSWHULQFXUUHQWSOD\EDFN
chapters in total. Select your desired chapter
to playback.
>7LPH@9LHZWKHHODSVHGUHPDLQLQJSOD\EDFN
time of title/chapter. Use S/T WRYLHZWKH
elapsed playback time of title, the remaining
playback time of title, the elapsed playback
time of chapter, and the remaining playback
time of chapter.
>0RGH@6HOHFWSOD\EDFNPRGHDPRQJ
VKXIÀHUDQGRPDQGQRUPDO
>$XGLR@7KH%OXUD\'LVF70'9'GLVF¶V
soundtrack language. Use S/T to view the
audio available in the disc and select your
desired Audio type.
>$QJOH@7KHDQJOHYLHZRIFXUUHQWSOD\EDFN
the angles in total. Please reference
Playback > Angle to see more detailed info.
Use S/T to select your desired angle view.
>6XEWLWOH@7KH6XEWLWOHLQFXUUHQWSOD\EDFN
Use S/T to view the subtitles available in
the disc and select your desired subtitle type
or turn it off.
Note:
Ͳ/ŶĂĐĐŽƌĚĂŶĐĞǁŝƚŚƚŚĞĚŝīĞƌĞŶƚĚŝƐĐƐ͕ƚŚĞƌĞ
ǁŽƵůĚďĞĚŝīĞƌĞŶƚƐƵďƟƚůĞƐ͘^ƵĐŚĂƐ
ĞŶƚƌĂůƵƌŽƉĞ
LJƌŝůůŝĐ
>ĂƟŶ/
'ƌĞĞŬ
dƵƌŬŝƐŚ
,ĞďƌĞǁ
6 Customizing
English
This section describes the various setting
option of this Blu-ray Disc70 player.
,IWKHVHWXSRSWLRQLVJUH\HGRXWLWPHDQV
the setting cannot be changed at the
current state.
General Setting
1. Press SETUP button on the remote
FRQWURO7KH6HWXS0HQXDSSHDUV
General Setting
System
Screen Saver
On
Language
Disc Auto Playback
On
Playback
CEC
On
Security
Load Default
More...
Network
Upgrade
More...
Move cursor key to select menu option
then use “OK” key to select
SETUP Exit
2. Press T to select an option, then press
X to access.
3. Press S/T to select a setup option and
press X
4. Select the setting you wish to change
DQGSUHVV2.WRFRQ¿UP
- Press W to return to the previous menu.
[System]
To change the following system option to
personalize your Blu-ray Disc70 player
r [Screen Saver]
Turn On or Off the screen saver mode.
,WKHOSVWRSURWHFWWKH79VFUHHQ
{ On } – Set the screen saver active
DIWHUDSSUR[LPDWHO\PLQXWHVZLWKQR
RSHUDWLRQ<RXFDQWXUQRIIWKHVFUHHQ
saver by pressing the SETUP button.
- The Blu-ray Disc70 Player will switch to
standby mode if there is no operation
after the screen saver is engaged for
DSSUR[LPDWHO\PLQXWHV
{ Off } – Turn off the screen saver
mode.
r [Disc Auto Playback]
Turn On or Off the disc automatic
playback switching mode.
{On} – The disc playback automatically
after loading.
{Off} – Turn off disc auto playback
mode.
r [CEC]
7KLVSOD\HUVXSSRUWV5(*=$/,1.ZKLFK
XVHVWKH+'0,&(&&RQVXPHU
14
(OHFWURQLFV&RQWUROSURWRFRO<RXFDQ
use one single remote control to control
DOO5(*=$/,1.FRPSOLDQWGHYLFHVWKDW
DUHFRQQHFWHGWKURXJK+'0,
connectors.
{On`7XUQVRQ5(*=$/,1.IHDWXUHV
:LWK&(&RQGXULQJ79VWDQGE\ZLWK
the Blu-ray Disc70 Player on, pressing
6(7833/$<3$86(ZLOOSRZHURQWKH
79:KHQ\RXWXUQWKH79RIIWKLVXQLW
will automatically turn off.
{Off`'LVDEOHV5(*=$/,1.IHDWXUHV
r [Load Default]
Reset all settings of Blu-ray Disc70 Player
to initial default state.
- Follow the instruction on the TV screen
WRFRQ¿UPWKHGHIDXOWVHWWLQJRSHUDWLRQ
1. Select Load Default.
$GLDORJXHER[SRSVXSVKRZQDV
EHORZ6HOHFW2.
Load Default
Do you want to load default?
Cancel
OK
,WPD\WDNHDZKLOHZKHQORDGLQJ
default is in progress. Please wait...
Load Default
Loading default, please wait...
30%
79ZLOOGLVSOD\DVIROORZ
Welcome
to the Toshiba Blu-ray Disc Player Setting
Wizard.
Some simple settings are suggested before you
begin. You can also access detailed settings
from the Setup Menu.
OK
Next
3UHVV2.HQWHUODQJXDJHVHWWLQJ
PressS/T to select a language option.
Choose
an OSD language before starting.
The language selected will be applied not only
here but also in other OSD windows, menus
etc.
English
Français
Deutsch
Italiano
Español
Português
Previous
OK
Next
Auto
Choose
a resolution that fits your TV.
480i/576i
Change will be applied immediately, you have
15s to determine whether to save the setting
or rollback to prior resolution. Better
performance will be provided by an HDMI
connection!
480p/576p
720p
1080i
1080p
Previous
OK
Next
Press S/T WRVHOHFWDQRSWLRQ3UHVV2.
6HOHFW<HVRU1RXVLQJS/T.
Resolution
has been changed!
14s
Yes
Does everything looks all right with this
resolution? Press Yes if you want to apply it.
Press No to rollback to previous one.
Previous
No
OK
Next
3UHVV2.HQWHU$VSHFWUDWLRVHWWLQJ
Choose
an aspect ratio that fits your TV.
The change will be applied in the next page.
Determine whether to save the setting or
rollback to the previous aspect ratio.
Previous
16:9 Full
16:9 Normal
4:3 Pan&Scan
4:3 Letterbox
OK
Next
Press S/T WRVHOHFWDQRSWLRQ3UHVV2.
Setting
Notes:
Ͳ/ĨƐĞƚ΀ŝƐĐƵƚŽWůĂLJďĂĐŬ΁ƚŽ΀Kī΁͕ĂŌĞƌLJŽƵ
ŝŶƐĞƌƚƚŚĞĚŝƐĐƚŚĂƚĐŽŶƚĂŝŶƐƚŚĞƵƉŐƌĂĚĞĚ
ŝŶĨŽƌŵĂƟŽŶƚŽƵƉŐƌĂĚĞƐLJƐƚĞŵ͕LJŽƵŚĂǀĞƚŽƐƚĂƌƚ
ƵƉŐƌĂĚĞĨƌŽŵƚŚŝƐŽƉƟŽŶŽĨ^dhWDĞŶƵ͘
Ͳ/ĨƚŚĞƵƉŐƌĂĚĞĮůĞƉĂĐŬĂŐĞĚŝĚŶŽƚƉĂƐƐƚŚĞ
ǀĞƌŝĮĐĂƟŽŶ͕ĞƌƌŽƌƉƌŽŵƉƚŝƐĚŝƐƉůĂLJĞĚ͕ĐŚĞĐŬƚŚĞ
ƉĂĐŬĂŐĞĂŐĂŝŶ;ƐƵĐŚĂƐƚŚĞƉĂĐŬĂŐĞŝƐŶŽƚ
ĐŽŵƉůĞƚĞͿ
ͲDĂŬĞƐƵƌĞƚŚĞĮƌŵǁĂƌĞǀĞƌƐŝŽŶŝƐŶŽƚĂŶŽůĚ
ǀĞƌƐŝŽŶ͘
ͲtŚĞŶLJŽƵƵƉŐƌĂĚĞƚŚĞƐLJƐƚĞŵƵƐŝŶŐh^&ůĂƐŚ
ĚĞǀŝĐĞ͕LJŽƵƐŚŽƵůĚŵĂŬĞĂŶĞǁĨŽůĚĞƌŶĂŵĞĚ
hW'ͺ>>͕ĂŶĚĐŽƉLJƚŚĞƵƉŐƌĂĚĞĮůĞŝŶƚŽƚŚŝƐ
ĨŽůĚĞƌ͘
SW upgrade by Network introduction
There are two modes to upgrade via
LQWHUQHW$XWRPDWLF0RGHDQG,QWHUDFWLYH
0RGH
$XWRPDWLF0RGH
The player will check the internet whether it
is connected automatically when powered on.
,IFRQQHFWHGSOD\HUZLOOWU\WRFRQQHFWWKH
Toshiba server to check if there is new
¿UPZDUHIRUWKHSOD\HU
,I\HVWKHSOD\HUZLOOSRSXSDPHVVDJHRQ
the screen to inform you that an upgrading
¿UPZDUHLVDYDLODEOHRQWKHLQWHUQHW<RXFDQ
choose whether to upgrade or not.
Upgrade
wizard is complete!
Now press the OK button to finish and return
to the Setup Menu.
Previous
New software found! Upgrade?
OK
Finish
3UHVV2.WRUHWXUQWR>*HQHUDO6HWWLQJ@
0HQX
r [Upgrade]
For software upgrades to enhance
performance, you could select the
following upgrade method and start to
upgrade.
{Disc}/{USB Storage}/{Network}
6:XSJUDGHE\'LVF86%6WRUDJH
Upgrade the software from the disc or USB
Flash device.
,QVHUWWKHGLVFRUFRQQHFWWKH86%)ODVK
GHYLFHZKLFKFRQWDLQVWKHXSJUDGH¿OH
package.
2. Follow the instruction on the TV
VFUHHQWRFRQ¿UPXSJUDGHRSHUDWLRQ
- The system will reboot after 5 seconds or
2.NH\LVSUHVVHG
Cancel
OK
Start
,QWHUDFWLYH0RGH:
<RXFDQDOVRGRQHWZRUNXSJUDGHYLDVHWXS
menu.
<RXVKRXOGPDNHVXUHWKDWWKHSOD\HULV
FRQQHFWHGWRWKHLQWHUQHW¿UVW
Press "SETUP" button of the remote control,
WKHQFKRRVH6\VWHP!8SJUDGH!
1HWZRUNDQGSUHVV2.EXWWRQ7KHQWKH
player will connect the Toshiba server to
FKHFNLIWKHUHLVQHZ¿UPZDUHIRUWKHSOD\HU
Upgrade
Connecting to the server. Please wait!
,I\HVWKHSOD\HUZLOOSRSXSDPHVVDJHRQ
the screen and you can choose whether to
15
English
3UHVV2.HQWHU5HVROXWLRQVHWWLQJ
upgrade or not.
Upgrade
English
New software found! Upgrade?
Cancel
Start
OK
,IQRWKHSOD\HUZLOOSRSXSDPHVVDJHRQ
the screen to inform you that there is no new
¿UPZDUHIRUWKHSOD\HU
Upgrade
Current version is latest. Update is not
available.
3UHVV2.WRVHOHFW(UDVHWKHGDWDLQ
the BUDA folder will be cleared.
[Language]
6HWXSWKH26'2Q6FUHHQ'LVSOD\0HQX
Audio and Subtitle default language for the
player.
General Setting
System
OSD
English
Language
Menu
English
Playback
Audio
English
Security
Subtitle
English
Network
Move cursor key to select menu option
then use “OK ” key to select
SETUP Exit
r[OSD]
Cancel
ZĞŵĂƌŬ͗
/ĨLJŽƵĐŚŽŽƐĞƚŽƵƉŐƌĂĚĞƚŚĞŶĞǁ&t͕
ϭ͘dŚĞƉůĂLJĞƌǁŝůůďĞŐŝŶƚŽĚŽǁŶůŽĂĚƚŚĞ
ƵƉŐƌĂĚĞĨŝůĞĂŶĚƉŽƉƵƉĂŵĞƐƐĂŐĞƚŽƐŚŽǁ
ƚŚĞƉƌŽŐƌĞƐƐ͘
Upgrade
Downloading upgrade file.Please wait!
Select the default on-screen display language.
r [Menu]
Select the default menu language.
r[Audio]
Select the default audio language.
r[Subtitle]
Select the default subtitle language.
[Playback]
General Setting
Cancel
Ϯ͘tŚĞŶĚŽǁŶůŽĂĚŝƐĨŝŶŝƐŚĞĚ͕ƚŚĞƉůĂLJĞƌǁŝůů
ƉŽƉƵƉĂŵĞƐƐĂŐĞĨŽƌLJŽƵ͕ĂŶĚLJŽƵĐĂŶĐŚŽŽƐĞ
ǁŚĞƚŚĞƌƚŽƉƌŽĐĞĞĚǁŝƚŚƚŚĞƵƉŐƌĂĚŝŶŐŽƌŶŽƚ͘
/ĨLJŽƵĐŚŽŽƐĞƚŽƵƉŐƌĂĚĞ͕ƚŚĞƉůĂLJĞƌǁŝůůďĞŐŝŶ
ƚŽƵƉŐƌĂĚĞ͕ĂŶĚƉŽƉƵƉĂŵĞƐƐĂŐĞƚŽƐŚŽǁƚŚĞ
ƉƌŽŐƌĞƐƐ͘tŚĞŶƵƉŐƌĂĚĞŝƐĚŽŶĞ͕ƚŚĞƉůĂLJĞƌ
ǁŝůůƌĞƐƚĂƌƚ͘
$WWHQWLRQ'R127FXWRIIWKHSRZHUVXSSO\
ZKHQ WKH ILUPZDUH LV XSJUDGLQJ 2U WKH
player might become unworkable.
r >([WHUQDO0HPRU\@
([WHUQDO 0HPRU\ ZRXOG EH XVHG LQ %'
/LYH70 IXQFWLRQ :KHQ \RX SOXJ LQ WKH
86%ÀDVKGHYLFHZKLFKKDVDWOHDVW*%
IUHH VSDFH WR SOD\ %'/LYH70 function,
the Blu-ray Disc70 system would make a
directory named BUDA automatically.
,QIRUPDWLRQZLOOGLVSOD\WKH)UHHVL]H
3UHVV2.
2. Follow the instruction on the TV
VFUHHQWRVHOHFW^,QIRUPDWLRQ`
General Setting
Screen Save
Information
Disc Auto Playback
Off
Language
Playback
CEC
On
Security
Disc Auto Upgrade
On
Network
Load Default
More...
Erase
System
Free size is : 0MB
Move cursor key to select menu option
then use “OK ” key to select
16
On
RETURN Return
System
Angle Mark
On
Language
PIP Mark
On
Playback
Secondary Audio...
On
Security
Last Memory
On
Network
PBC
On
Move cursor key to select menu option
then use “OK ” key to select
r [Angle Mark]
SETUP
Exit
Some Blu-ray70 discs/DVDs contain the
scenes recorded with multiple angles,
which allow you to enjoy the videos with
your desired angles, therefore the angle
mark is displayed only when the Blu-ray
Disc™/DVD disc is supportable for multiDQJOHDQG$QJOH0DUNLVVHWWR21
{On} – Display the angle mark.
{Off`±+LGHWKHDQJOHPDUN
r [PIP Mark]
7KH3LFWXUH,Q3LFWXUH3,3PRGHGLVSOD\
two pictures on the TV screen at the same
WLPHWKHIXOOVFUHHQSLFWXUHLVFDOOHG0DLQ
:LQGRZDQGWKHVPDOOLQVHWZLQGRZLV
FDOOHG6XE:LQGRZ7KH3,3PDUNLV
GLVSOD\HGZKHQLQ3,3PRGHDQG3,30DUN
LVVHWWR21
{On`±'LVSOD\WKH3,3PDUN
{Off`±+LGHWKH3,3PDUN
Note:
Ͳ,ŝŐŚĞĮŶŝƟŽŶW/W;^ĞĐŽŶĚsŝĚĞŽͿŝƐŶŽƚƐƵƉƉŽƌƚĞĚ͘
r [Secondary Audio Mark]
{On`±'LVSOD\6HFRQGDU\$XGLR0DUN
,I\RXRSHQWKHGLVFWUD\RUVZLWFKWKLV
Blu-ray Disc™ player to standby state
during normal playback, the Blu-ray Disc™
player can memorize the end playing
point, the player will start playback from
WKHPHPRUL]HGSRLQWQH[WWLPH
{On`±$FWLYH/DVW0HPRU\IHDWXUH
{Off`±'LVDEOH/DVW0HPRU\IHDWXUH
Note:
ͲEŽƚĂůůƚŚĞůƵͲƌĂLJdDĚŝƐĐƐĐĂŶƐƵƉƉŽƌƚƚŚŝƐ
ĨƵŶĐƟŽŶ͘
r [PBC]
VCD2.0 has PBC control (Playback
Control) menu, which allow you to interact
with the system via menu.
{On} – Display playback control menu, use
180%(5NH\VWRVHOHFWGHVLUHGRSWLRQ
{Off`±+LGHSOD\EDFNFRQWUROPHQXDQG
start playback from track1 automatically.
r [Closed Caption]
Allow people who are deaf or hearing
impaired, to have access to television
programming by displaying the audio
SRUWLRQ RI D WHOHYLVLRQ SURJUDPPH DV WH[W
on the screen.
{On} – Display the Closed Caption .
{Off`±+LGHWKH&ORVHG&DSWLRQ
r [DivX(R) VOD DRM]
7KH'LY;592''50PHDQV'LY;59LGHR
RQ'HPDQG'LJLWDO5LJKW0DQDJHPHQW
'LY;® is the name of a revolutionary new
video codec which is based on the new
03(*FRPSUHVVLRQVWDQGDUGIRUYLGHR
<RX ZLOO EH DEOH WR SOD\ 'LY;® movies
using this player.
<RXFDQRQO\SOD\'LY;® videos that
ZHUHUHQWHGRUSXUFKDVHGZLWKWKH'LY;®
registration code of this product.
6HOHFWWKH'LY;592''50RSWLRQ\RX
FDQ¿QGWKLVSURGXFW
VUHJLVWUDWLRQFRGH
To learn more please visit
KWWSZZZGLY[FRPYRG
[Security]
r [Change password]
Follow the instruction on the TV set or
change the password for locked discs
and play restricted DVDs.
General Setting
System
Language
Playback
Security
Network
Change Password
Language
Country Code
Playback
Parental Control
Move cursor key to select menu option
then use “OK ” key to select
On
Load Default
More...
RETURN Return
General Setting
System
Language
Playback
Security
Network
Screen Save
Off
Change Password
Disc Auto Playback
On
CEC
On
New password :
Disc Auto Upgrade
Confirm password :
Load Default
Move cursor key to select menu option
then use “OK ” key to select
On
More...
RETURN Return
(QWHUWKHQHZSDVVZRUGDJDLQWRFRQ¿UP
r [Country Code]
This ensures that you will be able to see
the scenes intended for your current
residential Country/Area.
8VH180%(5.H\VWRHQWHU\RXU
password, then you can choose your
Country/Area.
r [Parental Control]
Restricts access to discs that are
unsuitable for children. These discs must
be recorded with rating.
3UHVV2.
8VH180%(5NH\VWRHQWHUWKH
password
General Setting
System
Language
Playback
Screen Save
Off
Parental Control
Disc Auto Playback
On
Enter
CECpassword:
On
Security
Disc Auto Upgrade
On
Network
Load Default
More...
Move cursor key to select menu option
then use “OK ” key to select
RETURN Return
6HOHFWDUDWLQJOHYHOWKHQSUHVV2.
General Setting
System
Language
Playback
More...
More...
Off
Network
On
Disc Auto Upgrade
8VH180%(5NH\VWRHQWHUIRXUGLJLW
old password. The default password is
"0000".
2. Enter the new password.
More...
Security
CEC
Please enter current password:
Move cursor key to select menu option
then use “OK ” key to select
General Setting
System
Screen Save
Off
Change Password
Disc Auto Playback
On
Screen Save
Off
Parental Control
Disc Auto Playback
On
Select level:
CEC
Off
On
[1] KID SAFE
Security
[2] G
Disc Auto Upgrade
On
Network
Load Default
More...
RETURN Return
SETUP Exit
17
English
{Off`±+LGHWKH6HFRQGDU\$XGLR0DUN
r [Last Memory]
Items
Description
English
KID SAFE Safe for kids
G
All children and general guidance
PG
Parental guidance
PG-13
Parental guidance for children under 13
PGR
Parental guidance Recommended
R
Restricted viewing
NC-17
No one 17 and under allowed
ADULT
Adult only
Notes: ͲZĂƚĞĚĚŝƐĐƐĂďŽǀĞƚŚĞůĞǀĞůLJŽƵƐĞƚŝŶ΀WĂƌĞŶƚĂů
ŽŶƚƌŽů΁ƌĞƋƵŝƌĞĂƉĂƐƐǁŽƌĚƚŽďĞĞŶƚĞƌĞĚ͘
Ͳ dŚĞ ƌĂƟŶŐƐ ĂƌĞ ĐŽƵŶƚƌLJ ĚĞƉĞŶĚĞŶƚ͘ dŽ ĂůůŽǁ
ĂůůĚŝƐĐƐƚŽƉůĂLJ͕ƐĞůĞĐƚΖKīΖ͘
[Network]
General Setting
System
IP Setting
Language
Connection Test
Playback
BD-Live Connecti
Security
Information
Network
Move cursor key to select menu option
then use “OK ” key to select
SETUP Exit
7RHQMR\%'/LYHŒERQXVFRQWHQWVVHW
up the network connection.
Note:
ͲŶƐƵƌĞƚŚĂƚƚŚĞŶĞƚǁŽƌŬĐĂďůĞŝƐƉƌŽƉĞƌůLJ
ĐŽŶŶĞĐƚĞĚĂŶĚƚŚĞƌŽƵƚĞƌŝƐƐǁŝƚĐŚĞĚŽŶ͘
1. Connect the Blu-ray Disc™ player to
the broadband modem or router.
,QWKH6HWXSPHQXVHOHFW>1HWZRUN@
then press X.
6HOHFW>,36HWWLQJ@LQWKHPHQXWKHQ
SUHVV2.WRVHOHFW>$XWR@$Q,3DGGUHVV
is obtained automatically.
,IQR,3DGGUHVVLVREWDLQHGVHOHFW
>0DQXDO@WRLQSXW,3$GGUHVV6XEQHW
0DVN'HIDXOW*DWHZD\'16'16
DQGSUHVV2.WRUHFRQQHFWDJDLQWRWKH
QHWZRUN,WZLOOWU\WRREWDLQWKH,3
address again.
3UHVV5(7851RUSUHVV2.WRH[LW
Notes:
Ͳ ƵƌŝŶŐ ΀DĂŶƵĂů΁ ŵŽĚĞ͕ ŝĨ ƚŚĞ ŶƵŵďĞƌ ŝƐ ĞŶƚĞƌĞĚ
ŝŶĐŽƌƌĞĐƚůLJ͕ƉƌĞƐƐdƚŽĞƌĂƐĞƚŚĞŶƵŵďĞƌ͘
ͲĐŽŶƚƌĂĐƚǁŝƚŚƚŚĞƉƌŽǀŝĚĞƌŝƐŶĞĞĚĞĚƚŽĐŽŶŶĞĐƚƚŽ
ƚŚĞ/ŶƚĞƌŶĞƚ͘
ͲdŚŝƐƉůĂLJĞƌĚŽĞƐŶŽƚƐƵƉƉŽƌƚĂƵƚŽŵĂƟĐĚĞƚĞĐƟŽŶŽĨ
ĐƌŽƐƐͲĐĂďůĞƐ͘hƐĞƚŚĞƐƚƌĂŝŐŚƚ;ƐƚĂŶĚĂƌĚͿ>EĐĂďůĞ͘
Ͳ >ŽĂĚŝŶŐ Ͳ>ŝǀĞΡ ĐŽŶƚĞŶƚ ĨƌŽŵ ƚŚĞ ŝŶƚĞƌŶĞƚ ŵĂLJ
ƚĂŬĞƐŽŵĞƟŵĞ͕ĚĞƉĞŶĚŝŶŐŽŶƚŚĞĮůĞƐŝnjĞĂŶĚƚŚĞ
ƐƉĞĞĚŽĨƚŚĞŝŶƚĞƌŶĞƚĐŽŶŶĞĐƟŽŶ͘
18
r [IP Setting]
{Auto} – Auto obtain network information.
{Manual}±0DQXDOVHWXSQHWZRUN
information.
r [Connection Test]
'LVSOD\1HWZRUNFRQQHFWLRQVWDWXV
information.
r [BD-Live Connection]
{Permitted} – During playback of
%'/LYHŒGLVFWKHGLVFPD\
automatically download all information
from appointed network.
{Partial Permitted} – During
SOD\EDFNRI%'/LYHŒGLVFWKHGLVFPD\
automatically download partial of the
information from appointed network.
{Prohibited} – Disable downloading
information from network.
r [Information]
'LVSOD\DOO1HWZRUN,QIRUPDWLRQ
Display Setting
1. Press SETUP, [General Setting] menu
is displayed.
2. Press X to select [Display Setting],
then press T.
3. Select an option, press X to access.
Display Setting
TV
TV Screen
Video Process
Resolution
Auto
Color Space
YCbCr422
16:9 Full
HDMI Deep Color
Off
HDMI 1080/24p
On
Move cursor key to select menu option
then use “OK ” key to select
SETUP Exit
4. Press S/T to select a setup option and
press X
5. Select the setting you wish to change
DQGSUHVV2.WRFRQ¿UP
- Press W to return to the previous
menu.
- Press 6(783WRH[LWWKHPHQX
[TV]
r [TV Screen]
Select the screen format according to
how you want the picture to appear on
the TV.
{16:9 Full} – For a disc with the aspect
UDWLRRIWKHRXWSXWYLGHRLV
VWUHWFKHGLQWRIXOOVFUHHQ
{16:9 Normal} – For a disc with the
DVSHFWUDWLRRIWKHRXWSXWYLGHRLV
resized vertically to match what will be
seen on the display.
{4:3 Pan&Scan} – For standard TV, it
r [HDMI Deep Color]
This feature is available only when the
GLVSOD\GHYLFHLVFRQQHFWHGE\D+'0,
cable, and when it supports Deep
Colour feature.
{30 bits} – Output 30 bits Colour.
{36 bits} – Output 36 bits Colour.
{Off} – Output standard 24 bits Colour.
Note:
ͲtŚĞŶƚŚĞĐŽůŽƵƌƐƉĂĐĞŝƐΗzďƌϰϮϮΗ͕ĞǀĞŶŝĨ
,D/ĞĞƉŽůŽƌŝƐƐĞƚƚŽϯϬďŝƚƐͬϯϲďŝƚƐ͕ŝƚŝƐŶŽƚ
ŽƵƚƉƵƚǁŝƚŚĞĞƉŽůŽƵƌ͘
r [HDMI 1080 24p]
{On} – Enable 1080/24p video
resolution setting.
{Off} – Disable 1080/24p video
resolution setting.
Notes about HDMI 1080/24p:
,I\RXZDQWWKH+]RXWSXWLWVKRXOGIXO¿OOEHORZ
3 conditions:
1.TV supports the 24Hz display;
2.Player choose the 24Hz option in the setup
menu;
3.Media must be the 24Hz video.
ƚŚĞƉůĂLJŝŶŐůƵͲƌĂLJŝƐĐΡĐŽŶƚĞŶƚƐĂƌĞ&ŝůŵ
ƐŽƵƌĐĞ͘
ͲƵƌŝŶŐ,D/ϭϬϴϬͬϮϰƉƉůĂLJďĂĐŬ͕ƚŚĞƌĞǁŝůů
ďĞŶŽĐŽŵƉŽƐŝƚĞŽƵƚƉƵƚ͘
[Video Process]
Display Setting
TV
Video Adjust
More...
Video Process
Sharpness
Low
Move cursor key to select menu option
then use “OK ” key to select
SETUP Exit
r [Video Adjust]
6HOHFWDSUHGH¿QHGVHWWLQJRIWKHYLGHR
3UHVV2.
2. PressW/X to adjust the video
%ULJKWQHVV&RQWUDVW+XHDQG
Saturation.
{Brightness} - Press W/X to adjust
the brightness of display, goes left
means dark and right means bright.
{Contrast} - Press W/X to adjust
the contrast of display, goes left
means low contrast and right means
high contrast.
{Hue} - Press W/XWRDGMXVWWKH+XH
of display, goes left means low hue
and right means high hue.
{Saturation} - Press W/X to adjust
the saturation of display, goes left
means low Saturation and right means
high saturation.
3UHVV5(7851WRH[LW
Brightness
Contrast
Hue
Saturation
Change
RETURN Exit
r [Sharpness]
6HOHFWWKHOHYHORIVKDUSQHVV+LJK
0LGGOH/RZ
{High`6HOHFW+LJKVKDUSQHVVOHYHO
{Middle`6HOHFW0LGGOHVKDUSQHVV
level.
{Low`6HOHFW/RZVKDUSQHVVOHYHO
Notes:
ͲdŚŝƐƌĞƐŽůƵƟŽŶďĞĐŽŵĞƐĞīĞĐƟǀĞŽŶůLJǁŚĞŶ
19
English
displays a wide picture on the entire
screen and cuts off the redundant
portions.
{/HWWHUER[} – For standard TV, it
displays a wide picture with two black
ERUGHUVRQWKHWRSDQGERWWRPRI
screen.
r [Resolution]
Select a video output resolution that is
compatible with your TV display
capability.
{Auto} – Select the most suitable
resolution according to the TV .
{LL}, {SS}, {720p},
{1080i}, {1080p}
– Select a video resolution setting that
is best supported by the TV See TV
manual for details.
r [Color Space]
6HOHFWDSUHGH¿QHG&RORXUVSDFHRI
picture.
{RGB} – Select RGB Colour space.
{YCbCr`±6HOHFW<&E&U&RORXUVSDFH
{YCbCr422`±6HOHFW<&E&U&RORXU
space.
{Full RGB} – Select Full RGB Colour
space.
Audio Setting
English
1. Press SETUP, [General Setting] menu
is displayed.
2. Press X to select [Audio Setting],
then press T .
3. Select an option, press X to access.
Audio Setting
Audio Output
Spdif
PCM
HDMI
PCM
Down_samp
48K
Dolby DRC
Auto
Move cursor key to select menu option
then use “OK ” key to select
20
SETUP Exit
4. Press S/T to select a setup option and
press X
5. Select the setting you wish to change
DQGSUHVV2.WRFRQ¿UP
- Press W to return to the previous
menu.
- Press 6(783WRH[LWWKHPHQX
[Audio Output]
r [Spdif]
6HOHFWWKHRXWSXWPRGHRI&2$;,$/
MDFNRSWLRQVLQFOXGH%LWVWUHDP3&0
Re-encode and Off.
{Bitstream} – Output digital signal
without any processing.
{PCM} – Output digital signal with
SURFHVVLQJRQO\WZRFKDQQHOVH[SRUW
{Re-encode} – Auto select signal type
IURP&2$;,$/MDFNDFFRUGLQJWRWKH
Audio stream on disc.
{Off`±1RRXWSXWIRU63',)
r [HDMI]
6HOHFWWKHRXWSXWPRGHRI+'0,2XW
MDFNRSWLRQVLQFOXGH%LWVWUHDP3&0
Re-encode and Off.
{Bitstream`±2XWSXW+'0,GLJLWDO
signal without any processing.
{PCM`±2XWSXW+'0,GLJLWDOVLJQDO
with processing, only two channels
H[SRUW
{Re-encode} – Auto select signal type
IURP+'0,2XWMDFNDFFRUGLQJWRWKH
Audio stream on disc.
{Off`±1RRXWSXWIRU+'0,
r [Down_samp]
Select the digital audio signal sampling
frequency.
{48K} – For discs recorded at sampling
UDWHRIN+]
{96K} – For discs recorded at sampling
UDWHRIN+]
{192K} – For discs recorded at sampling
UDWHRIN+]
r [Dolby DRC]
Select the Dynamic Range Control mode
which makes it available to listen to a
movie at a low volume without losing
sound clarity.
{Off`±1RQG\QDPLFUDQJHFRPSUHVV
{On} – Dynamic range compress.
{Auto} – Adjust the DRC according to
input audio.
The setting of Auto is effective for Dolby
7UXH+'
System Information
1. Press SETUP, [General Setting] menu
is displayed.
2. Press X to select [System
Information].
7KHFXUUHQWVRIWZDUHYHUVLRQDQG0$&
address will be displayed.
- Press W to return to the previous
menu.
- Press 6(783WRH[LWWKHPHQX
System Information
Software version: V XX
MAC: E8-9D-87-XX-XX-XX
Move cursor key to select menu option
then use “OK ” key to select
SETUP Exit
Playable media
7KLVSURGXFWFDQSOD\
‡%OXUD\'LVFŒ9LGHR%'55(%'$9
‡'9''9'9LGHR'9'55:
'9'55:'9'55'/'XDO/D\HU
‡9LGHR&'69&'
‡$XGLR&'&'5&'5:
‡$9&+'
‡86%ÀDVKGHYLFH
ŽŵƉĂƟďůĞĮůĞĨŽƌŵĂƚƐ
Video
6LJQDOV\VWHP3$/176&
+'0,2XWSXWLLSS
720p, 1080i, 1080p, 1080/24p.
JPEG
‡6XSSRUWHG¿OHH[WHQVLRQ
MSJ
RUµMSHJ
‡-3(*,62IRUPDW
‡'RHVQRWVXSSRUW3LFWXUH&'
Audio
‡'LJLWDORXWSXW&RD[LDO
0.5 Vp-p (75 ohm)
‡+'0,RXWSXW
DivX®
‡6XSSRUWHG¿OHH[WHQVLRQ
',9;
‡'LY;+'
LAN
r /$1WHUPLQDO%$6(7%$6(7;
USB
‡86%86%)XOOVSHHG86%
+LJKVSHHG
‡6XSSRUWLQJUDQJH)ODVKGLVNFDUG
UHDGHUSRUWV86%+8%86%0DVV
Storage Class Device.
‡6XSSRUWHG¿OHV\VWHP)$7
‡0D[LPXPVL]HVXSSRUWHG*%
‡'RHVQRWVXSSRUWXQSRZHUHG+''
Main Unit
‡3RZHUVXSSO\UDWLQJ
99+]
‡3RZHUFRQVXPSWLRQ:
‡3RZHUFRQVXPSWLRQLQVWDQGE\PRGH
:
‡'LPHQVLRQVZ[K[G
360 × 38.5 × 205 (mm)
‡1HW:HLJKWNJ
‡2SHUDWLQJWHPSHUDWXUHƒ&WRƒ&
‡2SHUDWLQJKXPLGLW\/HVVWKDQ
(no condensation)
MP3 tracks
‡6XSSRUWHG¿OHH[WHQVLRQ
PS
‡6XSSRUWHGDXGLRFRGHF03
‡,62IRUPDW
‡6XSSRUWHGFRUUHVSRQGLQJELWUDWHNESV
320 kbps
‡6XSSRUWHGVDPSOLQJIUHTXHQFLHVN+]
N+]N+]
MKV
‡6XSSRUWHG¿OHH[WHQVLRQV
0.9
‡6XSSRUWHGYLGHRFRGHFV+03+3
'LY;03(*63$6303(*03(*
‡6XSSRUWHGDXGLRFRGHFV$$&FK
FK03$&'76/3&0
‡6XSSRUWHGVXEWLWOHV7H[W87)66$
60,68%657$66
‡3OD\EDFNRI0.9¿OHVLQ&'55:PD\
not be compatible
‡6RPH0.9IRUPDWGLVFVPD\QRWSOD\
depending on the video resolution and
frame rate condition
Other formats
‡03
PS
PRY
$9,
DYL
03(*
PSJ
PSHJ
Accessories supplied
‡5HPRWHFRQWURO
‡ One R03 (AAA size) battery
‡6LPSOH,%
21
English
7 6SHFL¿FDWLRQ
8 Troubleshooting
English
,I\RXH[SHULHQFHDQ\RIWKHIROORZLQJGLI¿FXOWLHVZKLOHXVLQJWKLVXQLWFKHFNWKHOLVWEHORZ
EHIRUHFRQVXOWLQJ\RXUQHDUHVW726+,%$GHDOHU
Problem
Tip
1RUHDFWLRQWRWKH
remote control.
Connect the product to the power outlet.
Point the remote control at the product.
,QVHUWWKHEDWWHU\FRUUHFWO\
,QVHUWQHZEDWWHU\LQWKHUHPRWHFRQWURO
1RYLGHRVLJQDORQWKH
display device.
Turn on the TV.
6HWWKH79WRWKHFRUUHFWH[WHUQDOLQSXW
Select the correct video resolution.
Set TV System of TV correctly.
,QFRUUHFWRUQRDXGLR
video signal on the
DPSOL¿HUGLVSOD\GHYLFH
YLD+'0,FDEOH
,IWKHXQLWLVFRQQHFWHGWRWKHXQDXWKRUL]HGGLVSOD\GHYLFHZLWK
DQ+'0,FDEOHWKHDXGLRYLGHRVLJQDOPD\QRWEHRXWSXW
1RKLJKGH¿QLWLRQYLGHR
signal on the TV.
'RHVWKHGLVFFRQWDLQKLJKGH¿QLWLRQYLGHR"+LJKGH¿QLWLRQ
video is not available when the disc does not contain it.
(QVXUHWKHDPSOL¿HUGLVSOD\GHYLFHVVHWWLQJPDWFKWKH%OXUD\
Disc™ player.
'RHVWKH79VXSSRUWKLJKGH¿QLWLRQYLGHR"+LJKGH¿QLWLRQYLGHR
is not available when the TV does not support it.
1RDXGLRVLJQDOIURPWKH
loudspeakers of the
audio system.
Turn on the audio system.
6HWWKHDXGLRV\VWHPWRWKHFRUUHFWH[WHUQDOLQSXW
,QFUHDVHWKHYROXPHOHYHORIWKHDXGLRV\VWHP
Cannot play back a disc.
0DNHVXUHWKDWWKH%OXUD\'LVFŒSOD\HUVXSSRUWVWKHGLVF
0DNHVXUHWKDWWKH%OXUD\'LVFŒSOD\HUVXSSRUWVWKHUHJLRQ
code of the DVD or Blu-ray Disc™.
)RU'9'5:5RU'9'5:5PDNHVXUHWKDWWKHGLVFLV
¿QDOL]HG
Clean the disc.
&DQQRWSOD\EDFN-3(*
¿OHVIURPDGLVF
0DNHVXUHWKDWWKHGLVFZDVUHFRUGHGLQWKH-3(*,62IRUPDW
&DQQRWSOD\'LY;®¿OHV
0DNHVXUHWKDWWKH¿OHZDVUHFRUGHGLQWKH+RU03(*
format.
&DQQRWSOD\03¿OHV
from a disc.
0DNHVXUHWKDWWKHGLVFZDVUHFRUGHGLQWKH,62IRUPDW
0DNHVXUHWKDWWKHELWUDWHRIWKH03¿OHVLVEHWZHHQDQG
320 kbps.
0DNHVXUHWKDWWKHVDPSOHUDWHRIWKH03¿OHVLVN+]
N+]RUN+]
22
0DNHVXUHWKDWWKHVHOHFWHGJURXSIROGHUGRHVQRWFRQWDLQ
PRUHWKDQ¿OHVIRU'9'DQG¿OHVIRU&'
0DNHVXUHWKDWWKH¿OHH[WHQVLRQLVMSJ-3*MSHJRU-3(*
&DQQRW¿QGD03¿OH
0DNHVXUHWKDWWKHVHOHFWHGIROGHUGRHVQRWFRQWDLQPRUHWKDQ
¿OHVIRU'9'DQG¿OHVIRU&'
0DNHVXUHWKDWWKH¿OHH[WHQVLRQLVPSRU03
&DQQRWXSJUDGH6:
:KHQ\RXXSJUDGHWKHV\VWHPZLWK86%)ODVKGHYLFH\RX
VKRXOGPDNHDQHZIROGHUQDPHG83*B$//DQGFRS\WKH
XSJUDGH¿OHLQWRWKLVIROGHU
:KHQ\RXXSJUDGHWKHV\VWHPE\QHWZRUNSOHDVHPDNHVXUH
WKHSOD\HULVFRQQHFWHGWRWKHLQWHUQHWZKHQXSJUDGLQJWKH6:
Sometimes the options
of setup menu cannot
be selected.
:KHQSOD\LQJD'9'GLVFRU%OXUD\'LVF™, press STOP
button once, the player will go into stop resume mode,
meanwhile you cannot change some settings in setup menu
such as language subitem menu, audio, subtitle etc.
,I\RXZDQWWRFKDQJHWKDWSUHVV6723EXWWRQWZLFHWKH
player will go into full stop mode, then you can do it.
23
English
&DQQRW¿QGD-3(*¿OH
9 Glossary
English
Aspect ratio
Aspect ratio refers to the length to height
ratio of TV screens. The ratio of a standard
79LVZKLOHWKHUDWLRRIDKLJK
GH¿QLWLRQRUZLGH79LV7KHOHWWHUER[
allows you to enjoy a picture with a wider
SHUVSHFWLYHRQDVWDQGDUGVFUHHQ
$9,
$XGLR9LGHR,QWHUOHDYHNQRZQE\LWV
DFURQ\P$9,LVDPXOWLPHGLDFRQWDLQHU
RUPDW$9,¿OHVFDQFRQWDLQERWKDXGLRDQG
YLGHRGDWDLQD¿OHFRQWDLQHUWKDWDOORZV
synchronous audio-with-video playback.
Blu-ray Disc70
Blu-ray Disc70LVDQH[WJHQHUDWLRQRSWLFDO
YLGHRGLVFFDSDEOHRIVWRULQJ¿YHWLPHV
more data than a conventional DVD. The
ODUJHFDSDFLW\PDNHVLWSRVVLEOHWREHQH¿W
IURPWKHIHDWXUHVVXFKDVKLJKGH¿QLWLRQ
videos, multichannel surround sound,
interactive menus and so on.
%21869,(:70
This is a Blu-ray Disc70-Video (Final Standard
3UR¿OHRU3UR¿OHWKDWVXSSRUWV
interactive content encoded on the disc,
such as picture-in-picture. This means you
can play the primary video and secondary
video simultaneously.
Digital Audio
Digital Audio is a sound signal that has
been converted into numerical values.
Digital sound can be transmitted through
multiple channels. Analogue sound can
only be transmitted through two channels.
'LY;®
'LY;® is a codec (compression/decompression) that can compress images to a very
small amount of data.
'LY;&HUWL¿HG®WRSOD\'LY;®YLGHRXSWR+'
1080p, including premium content.
$%287',9;9,'(2
'LY;® is a digital video format created by
'LY;,QF7KLVLVDQRI¿FLDO'LY;&HUWL¿HG®
24
GHYLFHWKDWSOD\V'LY;YLGHR9LVLW
GLY[FRPIRUPRUHLQIRUPDWLRQDQG
VRIWZDUHWRROVWRFRQYHUW\RXU¿OHVLQWR'LY;
video.
$%287',9;9,'(221'(0$1'
7KLV'LY;&HUWL¿HG® device must be
UHJLVWHUHGLQRUGHUWRSOD\SXUFKDVHG'LY;
Video-on-Demand (VOD) movies. To obtain
\RXUUHJLVWUDWLRQFRGHORFDWHWKH'LY;92'
section in your device setup menu. Go to
YRGGLY[FRPIRUPRUHLQIRUPDWLRQRQKRZ
to complete your registration.
Dolby® Digital
The system to compress digital sound
GHYHORSHGE\'ROE\/DERUDWRULHV,WRIIHUV
you sound of stereo (2ch) or multichannel
audio.
Dolby® Digital Plus
'ROE\'LJLWDO3OXVLVWKHQH[WJHQHUDWLRQ
digital audio compression technology
GHYHORSHGDVDQH[WHQVLRQWR'ROE\'LJLWDO
Blu-ray Disc™ supports 7.1 multi-channel
surround sound output.
Dolby®7UXH+'
'ROE\7UXH+'LVDORVVOHVVFRGLQJ
WHFKQRORJ\GHYHORSHGIRUQH[WJHQHUDWLRQ
optical discs. Blu-ray Disc70 supports 7.1
multi-channel surround sound output.
DTS®
DTS is a multi-channel surround sound
system. By connecting to DTS decoder,
you can enjoy movie dynamic and realistic
sound like movie theater. DTS surround
sound technologies were developed by
'76,QF
'76+'®
'76+'LVDORVVOHVVFRGLQJWHFKQRORJ\
GHYHORSHGDVDQH[WHQVLRQRIWKHRULJLQDO
DTS Coherent Acoustics format.
Blu-ray Disc™ supports 7.1 multi-channel
surround sound output.
+'&3
+LJKEDQGZLGWK'LJLWDO&RQWHQW3URWHFWLRQ
7KLVLVDVSHFL¿FDWLRQWKDWSURYLGHVD
secure transmission of digital contents
between different devices (to prevent
unauthorized copyright.)
+'0,®
+LJK'H¿QLWLRQ0XOWLPHGLD,QWHUIDFH+'0,
is a high-speed digital interface that can
WUDQVPLWXQFRPSUHVVHGKLJKGH¿QLWLRQ
YLGHRDQGGLJLWDOPXOWLFKDQQHODXGLR,W
delivers high quality picture and sound
TXDOLW\+'0,LVIXOO\EDFNZDUGFRPSDWLEOH
ZLWK'9,$VUHTXLUHGE\WKH+'0,VWDQGDUG
FRQQHFWLQJWR+'0,RU'9,SURGXFWVZLWKRXW
+'&3+LJKEDQGZLGWK'LJLWDO&RQWHQW
Protection) will result in no Video or Audio
output.
-3(*
A very common digital still picture format.
A still-picture data compression system
SURSRVHGE\WKH-RLQW3KRWRJUDSKLF([SHUW
Group, which features small decrease in
image quality in spite of its high compression
UDWLR)LOHVDUHUHFRJQL]HGE\WKHLU¿OH
H[WHQVLRQµMSJ¶RUµMSHJ¶
/$1/RFDO$UHD1HWZRUN
A group of linked devices in a company,
VFKRRORUKRPH,QGLFDWHVWKHERXQGDULHV
of a particular network.
/RFDOVWRUDJH
This storage area is used as destination for
VWRULQJDGGLWLRQDOFRQWHQWVIURP%'/LYH™
enabled Blu-ray Disc™-Video.
0.9
7KH 0DWURVND 0XOWLPHGLD &RQWDLQHU LV DQ
RSHQVWDQGDUGIUHHFRQWDLQHUIRUPDWD¿OH
format that can hold an unlimited number
of video, audio, picture or subtitle tracks
LQVLGHDVLQJOH¿OH,WLVLQWHQGHGWRVHUYHDV
a universal format for storing common
multimedia content, like movies or TV
shows.
03
$¿OHIRUPDWZLWKDVRXQGGDWD
FRPSUHVVLRQV\VWHP03LVWKH
DEEUHYLDWLRQRI0RWLRQ3LFWXUH([SHUWV
*URXSRU03(*$XGLR/D\HU:LWK
WKH03IRUPDWRQH&'5RU&'5:FDQ
contain about 10 times more data than a
regular CD.
03
03 ¿OH IRUPDW LV D PXOWLPHGLD FRQWDLQHU
IRUPDW VWDQGDUG VSHFL¿HG DV D SDUW RI
03(*,WLVPRVWFRPPRQO\XVHGWRVWRUH
digital video and digital audio streams,
HVSHFLDOO\WKRVHGH¿QHGE\03(*03(*
+«EXWFDQDOVREHXVHGWRVWRUHRWKHU
data such as subtitles and still images.
PBC
Playback Control. A system where you
navigate through a Video CD/Super VCD
with on-screen menus that are recorded
RQWRWKHGLVF<RXFDQHQMR\LQWHUDFWLYH
playback and search.
3&0
3XOVH&RGH0RGXODWLRQ$GLJLWDODXGLR
encoding system.
Region code
A system that allows discs to be played
only in the region designated. This unit
only plays discs that have compatible
UHJLRQFRGHV<RXFDQ¿QGWKHUHJLRQFRGH
of your unit on the product label. Some
discs are compatible with more than one
UHJLRQRU$//UHJLRQV
25
English
'76+'0DVWHU$XGLR70
$GLVFHQFRGHGZLWK'76+'0DVWHU$XGLR
GHOLYHUV$//RIWKHLQIRUPDWLRQIURPWKH
RULJLQDOPDVWHUUHFRUGLQJ²ELWIRUELWLW
V
identical to what the sound engineers laid
GRZQ$XGLRGRHVQ
WJHWDQ\EHWWHUWKDQ
this.
License Information on the Software Used in This Product
English
This document is statement purpose only. Not concerned with operation of this
product.
The software pre-installed in this product consists of multiple, independent software components. Each software
component is copyrighted by a third party. This product uses software components that are distributed as freeware
XQGHUDWKLUGSDUW\HQGXVHUOLFHQVHDJUHHPHQWRUFRS\ULJKWQRWLFHKHUHLQDIWHUUHIHUUHGWRDVD³(8/$´
6RPH(8/$VUHTXLUHWKDWWKHVRXUFHFRGHRIWKHDSSOLFDEOHFRPSRQHQWEHGLVFORVHGDVWKHFRQGLWLRQIRUGLVWULEXWLQJWKHVRIWZDUHFRPSRQHQWLQH[HFXWDEOHIRUPDW<RXFDQFKHFNWKHVRIWZDUHFRPSRQHQWVVXEMHFWWRVXFK(8/$
UHTXLUHPHQWVRQWKHIROORZLQJHPDLODGGUHVV
(PDLODGGUHVVOLQX[#WRVKLEDGPHFRMS
726+,%$SURYLGHVDZDUUDQW\IRUWKLVSURGXFW\RXKDYHSXUFKDVHGXQGHUFRQGLWLRQVVHWIRUWKE\726+,%$+RZHYHU
VRPHRIWKHVRIWZDUHFRPSRQHQWVGLVWULEXWHGXQGHUDQ(8/$DUHPDGHDYDLODEOHIRUXVHE\WKHXVHURQWKHDVVXPStion that they are not copyrighted or warranted by a third party. These software components are licensed to the user
free of charge and therefore not covered by any warranty within the scope of the applicable laws. These software
FRPSRQHQWVDUHQRWVXEMHFWWRDQ\FRS\ULJKWVRURWKHUWKLUGSDUW\ULJKWVDQGDUHSURYLGHGLQ³DVLV´FRQGLWLRQZLWKRXW
DQ\ZDUUDQW\ZKHWKHUH[SUHVVRULPSOLHG³:DUUDQW\´KHUHLQFOXGHVEXWQRWOLPLWHGWRDQLPSOLHGZDUUDQW\IRUPDUNHWDELOLW\RU¿WQHVVIRUVSHFL¿FXVHV$OOULVNVDVVRFLDWHGZLWKWKHTXDOLW\RUSHUIRUPDQFHRIWKHVHVRIWZDUHFRPSRQHQWVDUHDVVXPHGE\WKHXVHU726+,%$VKDOOQRWEHOLDEOHZKDWVRHYHUIRUDQ\FRVWRIUHSDLURUFRUUHFWLRQRURWKHU
LQFLGHQWDOH[SHQVHLQFXUUHGLQFRQQHFWLRQZLWKDGHIHFWIRXQGLQDQ\RIWKHVHVRIWZDUHFRPSRQHQWV8QOHVVVSHFL¿HG
under the applicable laws or in a written agreement, a party who changes or redistributes the software with consent
from the copyright holders or based on the aforementioned licenses shall not be held liable whatsoever for any loss
arising from the use of or inability to use such software components. The same applies even when the copyright
KROGHUVRUUHOHYDQWWKLUGSDUWLHVKDYHEHHQLQIRUPHGRIWKHSRVVLELOLW\RIVXFKORVV³/RVV´KHUHLQFOXGHVQRUPDO
VSHFLDOLQFLGHQWDODQGLQGLUHFWORVVLQFOXGLQJEXWQRWOLPLWHGWRWKHORVVRIGDWDRULWVDFFXUDF\ORVVLQFXUUHGE\WKH
XVHURUDQ\WKLUGSDUW\DQGLQWHUIDFHLQFRPSDWLELOLW\ZLWKRWKHUVRIWZDUH3OHDVHUHDGHDFK(8/$IRUGHWDLOVRQWKH
use conditions and items that must be observed regarding these software components.
7KHWDEOHEHORZOLVWVWKHVRIWZDUHFRPSRQHQWVSUHLQVWDOOHGLQWKLVSURGXFWZKLFKDUHVXEMHFWWR(8/$V7KHXVHU
VKRXOGUHDGWKHDSSOLFDEOH(8/$VFDUHIXOO\EHIRUHXVLQJWKHVHVRIWZDUHFRPSRQHQWV7KH(8/$VDUHH[KLELWHGLQWKHLU
RULJLQDOWH[W(QJOLVKDVH[DFWO\ZULWWHQE\WKHUHVSHFWLYHSDUWLHV
26
Project name
Project license
Linux kernel
GPLv2
SquashFS
GPLv2
Busybox
GPLv2
Das U-boot
GPLv2
gcc libgcc
GPLv3.txt and gcc-exception.txt (GPLv3 with GCC Runtime
Library Exception)
gcc libstdc++
GPLv3.txt and gcc-exception.txt (GPLv3 with GCC Runtime
Library Exception)
glibc
LGPLv2.1
LIRC
GPLv2
International Components for Unicode
ICULicense.txt
OpenSSL
openssl.txt
zlib
zlib.txt
FreeType
FreeType.txt
Expat
expat.txt
libcurl
libcurl.txt
Independent JPEG group
libjpeg-7.txt
c-ares
c-arse.txt
mtd-utils
GPLv2
libmtp
LGPLv2.1
libusb
LGPLv2.1
libusb-compat
LGPLv2.1
Unicode Bidirectional Algorithm
Unicode_Bidirectional_Algorithm.txt
HarfBuzz
HarfBuzz.txt
$FWLYLWLHVRWKHUWKDQFRS\LQJGLVWULEXWLRQDQGPRGL¿FDWLRQDUH
QRWFRYHUHGE\WKLV/LFHQVHWKH\DUHRXWVLGHLWVVFRSH7KHDFW
of running the Program is not restricted, and the output from
the Program is covered only if its contents constitute a work
based on the Program (independent of having been made by
UXQQLQJWKH3URJUDP:KHWKHUWKDWLVWUXHGHSHQGVRQZKDW
the Program does.
The licenses for most software are designed to take away your
IUHHGRPWRVKDUHDQGFKDQJHLW%\FRQWUDVWWKH*18*HQHUDO
3XEOLF/LFHQVHLVLQWHQGHGWRJXDUDQWHH\RXUIUHHGRPWRVKDUH
and change free software--to make sure the software is free for
DOOLWVXVHUV7KLV*HQHUDO3XEOLF/LFHQVHDSSOLHVWRPRVWRIWKH
)UHH6RIWZDUH)RXQGDWLRQ
VVRIWZDUHDQGWRDQ\RWKHUSURJUDP
whose authors commit to using it. (Some other Free Software
)RXQGDWLRQVRIWZDUHLVFRYHUHGE\WKH*18/HVVHU*HQHUDO3XEOLF/LFHQVHLQVWHDG<RXFDQDSSO\LWWR\RXUSURJUDPVWRR
<RX PD\ FRS\ DQG GLVWULEXWH YHUEDWLP FRSLHV RI WKH 3URJUDP
VVRXUFHFRGHDV\RXUHFHLYHLWLQDQ\PHGLXPSURYLGHG
that you conspicuously and appropriately publish on each copy
DQ DSSURSULDWH FRS\ULJKW QRWLFH DQG GLVFODLPHU RI ZDUUDQW\
NHHSLQWDFWDOOWKHQRWLFHVWKDWUHIHUWRWKLV/LFHQVHDQGWRWKH
DEVHQFH RI DQ\ ZDUUDQW\DQG JLYH DQ\ RWKHU UHFLSLHQWV RI WKH
3URJUDPDFRS\RIWKLV/LFHQVHDORQJZLWKWKH3URJUDP
:KHQZHVSHDNRIIUHHVRIWZDUHZHDUHUHIHUULQJWRIUHHGRP
QRWSULFH2XU*HQHUDO3XEOLF/LFHQVHVDUHGHVLJQHGWRPDNH
sure that you have the freedom to distribute copies of free
software (and charge for this service if you wish), that you
receive source code or can get it if you want it, that you can
FKDQJHWKHVRIWZDUHRUXVHSLHFHVRILWLQQHZIUHHSURJUDPV
and that you know you can do these things.
To protect your rights, we need to make restrictions that forbid
anyone to deny you these rights or to ask you to surrender
the rights.
These restrictions translate to certain responsibilities for you if
you distribute copies of the software, or if you modify it.
)RU H[DPSOH LI \RX GLVWULEXWH FRSLHV RI VXFK D SURJUDP
whether gratis or for a fee, you must give the recipients all
WKHULJKWVWKDW\RXKDYH<RXPXVWPDNHVXUHWKDWWKH\WRR
receive or can get the source code. And you must show them
these terms so they know their rights.
:HSURWHFW\RXUULJKWVZLWKWZRVWHSVFRS\ULJKWWKHVRIWware, and (2) offer you this license which gives you legal permission to copy, distribute and/or modify the software.
$OVRIRUHDFKDXWKRU
VSURWHFWLRQDQGRXUVZHZDQWWRPDNH
certain that everyone understands that there is no warranty for
WKLVIUHHVRIWZDUH,IWKHVRIWZDUHLVPRGL¿HGE\VRPHRQHHOVH
and passed on, we want its recipients to know that what they
have is not the original, so that any problems introduced by
RWKHUVZLOOQRWUHÀHFWRQWKHRULJLQDODXWKRUV
UHSXWDWLRQV
Finally, any free program is threatened constantly by software
SDWHQWV :H ZLVK WR DYRLG WKH GDQJHU WKDW UHGLVWULEXWRUV RI D
free program will individually obtain patent licenses, in effect
making the program proprietary. To prevent this, we have
PDGHLWFOHDUWKDWDQ\SDWHQWPXVWEHOLFHQVHGIRUHYHU\RQH
V
free use or not licensed at all.
The precise terms and conditions for copying, distribution and
PRGL¿FDWLRQIROORZ
*18*(1(5$/38%/,&/,&(16(
7(506 $1' &21',7,216 )25 &23<,1* ',675,%87,21
$1'02',),&$7,21
7KLV/LFHQVHDSSOLHVWRDQ\SURJUDPRURWKHUZRUNZKLFK
contains a notice placed by the copyright holder saying it may
EHGLVWULEXWHGXQGHUWKHWHUPVRIWKLV*HQHUDO3XEOLF/LFHQVH
The "Program", below, refers to any such program or work,
and a "work based on the Program" means either the Program
RU DQ\ GHULYDWLYH ZRUN XQGHU FRS\ULJKW ODZ WKDW LV WR VD\ D
work containing the Program or a portion of it, either verbatim
RUZLWKPRGL¿FDWLRQVDQGRUWUDQVODWHGLQWRDQRWKHUODQJXDJH
+HUHLQDIWHU WUDQVODWLRQ LV LQFOXGHG ZLWKRXW OLPLWDWLRQ LQ WKH
WHUPPRGL¿FDWLRQ(DFKOLFHQVHHLVDGGUHVVHGDV\RX
<RXPD\FKDUJHDIHHIRUWKHSK\VLFDODFWRIWUDQVIHUULQJDFRS\
DQG \RX PD\ DW \RXU RSWLRQ RIIHU ZDUUDQW\ SURWHFWLRQ LQ H[change for a fee.
<RX PD\ PRGLI\ \RXU FRS\ RU FRSLHV RI WKH 3URJUDP RU
any portion of it, thus forming a work based on the Program,
DQGFRS\DQGGLVWULEXWHVXFKPRGL¿FDWLRQVRUZRUNXQGHUWKH
terms of Section 1 above, provided that you also meet all of
WKHVHFRQGLWLRQV
D <RX PXVW FDXVH WKH PRGL¿HG ¿OHV WR FDUU\ SURPLQHQW
QRWLFHVVWDWLQJWKDW\RXFKDQJHGWKH¿OHVDQGWKHGDWHRIDQ\
change.
E<RXPXVWFDXVHDQ\ZRUNWKDW\RXGLVWULEXWHRUSXEOLVK
that in whole or in part contains or is derived from the Program
or any part thereof, to be licensed as a whole at no charge to all
WKLUGSDUWLHVXQGHUWKHWHUPVRIWKLV/LFHQVH
F ,I WKH PRGL¿HG SURJUDP QRUPDOO\ UHDGV FRPPDQGV
interactively when run, you must cause it, when started running
for such interactive use in the most ordinary way, to print or
display an announcement including an appropriate copyright
notice and a notice that there is no warranty (or else, saying
that you provide a warranty) and that users may redistribute
the program under these conditions, and telling the user how to
YLHZDFRS\RIWKLV/LFHQVH([FHSWLRQLIWKH3URJUDPLWVHOILV
interactive but does not normally print such an announcement,
your work based on the Program is not required to print an
announcement.)
7KHVHUHTXLUHPHQWVDSSO\WRWKHPRGL¿HGZRUNDVDZKROH
,I LGHQWL¿DEOH VHFWLRQV RI WKDW ZRUN DUH QRW GHULYHG IURP WKH
Program, and can be reasonably considered independent and
VHSDUDWHZRUNVLQWKHPVHOYHVWKHQWKLV/LFHQVHDQGLWVWHUPV
do not apply to those sections when you distribute them as
separate works. But when you distribute the same sections
as part of a whole which is a work based on the Program, the
GLVWULEXWLRQRIWKHZKROHPXVWEHRQWKHWHUPVRIWKLV/LFHQVH
ZKRVH SHUPLVVLRQV IRU RWKHU OLFHQVHHV H[WHQG WR WKH HQWLUH
whole, and thus to each and every part regardless of who wrote
it.
Thus, it is not the intent of this section to claim rights or contest
\RXUULJKWVWRZRUNZULWWHQHQWLUHO\E\\RXUDWKHUWKHLQWHQWLV
WRH[HUFLVHWKHULJKWWRFRQWUROWKHGLVWULEXWLRQRIGHULYDWLYHRU
collective works based on the Program.
,Q DGGLWLRQ PHUH DJJUHJDWLRQ RI DQRWKHU ZRUN QRW EDVHG RQ
the Program with the Program (or with a work based on the
Program) on a volume of a storage or distribution medium does
QRWEULQJWKHRWKHUZRUNXQGHUWKHVFRSHRIWKLV/LFHQVH
<RXPD\FRS\DQGGLVWULEXWHWKH3URJUDPRUDZRUNEDVHG
RQLWXQGHU6HFWLRQLQREMHFWFRGHRUH[HFXWDEOHIRUPXQGHU
the terms of Sections 1 and 2 above provided that you also do
RQHRIWKHIROORZLQJ
27
English
*18*(1(5$/38%/,&/,&(16(
9HUVLRQ-XQH
&RS\ULJKW&)UHH6RIWZDUH)RXQGDWLRQ,QF
)UDQNOLQ6WUHHW)LIWK)ORRU%RVWRQ0$86$
Everyone is permitted to copy and distribute verbatim copies
of this license document, but changing it is not allowed.
Preamble
English
a) Accompany it with the complete corresponding machinereadable source code, which must be distributed under the
terms of Sections 1 and 2 above on a medium customarily used
IRUVRIWZDUHLQWHUFKDQJHRU
b) Accompany it with a written offer, valid for at least three
years, to give any third party, for a charge no more than your
cost of physically performing source distribution, a complete
machine-readable copy of the corresponding source code, to
be distributed under the terms of Sections 1 and 2 above on a
PHGLXPFXVWRPDULO\XVHGIRUVRIWZDUHLQWHUFKDQJHRU
c) Accompany it with the information you received as to the
offer to distribute corresponding source code. (This alternative
is allowed only for non-commercial distribution and only if you
UHFHLYHGWKHSURJUDPLQREMHFWFRGHRUH[HFXWDEOHIRUPZLWK
such an offer, in accord with Subsection b above.)
The source code for a work means the preferred form of the
ZRUNIRUPDNLQJPRGL¿FDWLRQVWRLW)RUDQH[HFXWDEOHZRUN
complete source code means all the source code for all modules
LW FRQWDLQV SOXV DQ\ DVVRFLDWHG LQWHUIDFH GH¿QLWLRQ ¿OHV SOXV
the scripts used to control compilation and installation of
WKH H[HFXWDEOH +RZHYHU DV D VSHFLDO H[FHSWLRQ WKH VRXUFH
code distributed need not include anything that is normally
distributed (in either source or binary form) with the major
components (compiler, kernel, and so on) of the operating
V\VWHPRQZKLFKWKHH[HFXWDEOHUXQVXQOHVVWKDWFRPSRQHQW
LWVHOIDFFRPSDQLHVWKHH[HFXWDEOH
,IGLVWULEXWLRQRIH[HFXWDEOHRUREMHFWFRGHLVPDGHE\RIIHULQJ
access to copy from a designated place, then offering equivalent
access to copy the source code from the same place counts as
distribution of the source code, even though third parties are
not compelled to copy the source along with the object code.
<RX PD\ QRW FRS\ PRGLI\ VXEOLFHQVH RU GLVWULEXWH WKH
3URJUDPH[FHSWDVH[SUHVVO\SURYLGHGXQGHUWKLV/LFHQVH$Q\
attempt otherwise to copy, modify, sublicense or distribute the
Program is void, and will automatically terminate your rights
XQGHUWKLV/LFHQVH
+RZHYHUSDUWLHVZKRKDYHUHFHLYHGFRSLHVRUULJKWVIURP\RX
XQGHU WKLV /LFHQVH ZLOO QRW KDYH WKHLU OLFHQVHV WHUPLQDWHG VR
long as such parties remain in full compliance.
<RXDUHQRWUHTXLUHGWRDFFHSWWKLV/LFHQVHVLQFH\RXKDYH
QRWVLJQHGLW+RZHYHUQRWKLQJHOVHJUDQWV\RXSHUPLVVLRQWR
modify or distribute the Program or its derivative works. These
DFWLRQVDUHSURKLELWHGE\ODZLI\RXGRQRWDFFHSWWKLV/LFHQVH
Therefore, by modifying or distributing the Program (or any
work based on the Program), you indicate your acceptance
RI WKLV /LFHQVH WR GR VR DQG DOO LWV WHUPV DQG FRQGLWLRQV IRU
copying, distributing or modifying the Program or works based
on it.
6. Each time you redistribute the Program (or any work based
on the Program), the recipient automatically receives a license
from the original licensor to copy, distribute or modify the
3URJUDPVXEMHFWWRWKHVHWHUPVDQGFRQGLWLRQV<RXPD\QRW
LPSRVH DQ\ IXUWKHU UHVWULFWLRQV RQ WKH UHFLSLHQWV
H[HUFLVH RI
WKHULJKWVJUDQWHGKHUHLQ<RXDUHQRWUHVSRQVLEOHIRUHQIRUFLQJ
FRPSOLDQFHE\WKLUGSDUWLHVWRWKLV/LFHQVH
,I DV D FRQVHTXHQFH RI D FRXUW MXGJPHQW RU DOOHJDWLRQ
of patent infringement or for any other reason (not limited
to patent issues), conditions are imposed on you (whether
by court order, agreement or otherwise) that contradict the
FRQGLWLRQV RI WKLV /LFHQVH WKH\ GR QRW H[FXVH \RX IURP WKH
FRQGLWLRQV RI WKLV /LFHQVH ,I \RX FDQQRW GLVWULEXWH VR DV WR
VDWLVI\VLPXOWDQHRXVO\\RXUREOLJDWLRQVXQGHUWKLV/LFHQVHDQG
any other pertinent obligations, then as a consequence you may
QRWGLVWULEXWHWKH3URJUDPDWDOO)RUH[DPSOHLIDSDWHQW
license would not permit royalty-free redistribution of the
Program by all those who receive copies directly or indirectly
28
through you, then the only way you could satisfy both it and
WKLV/LFHQVHZRXOGEHWRUHIUDLQHQWLUHO\IURPGLVWULEXWLRQRIWKH
Program.
,I DQ\ SRUWLRQ RI WKLV VHFWLRQ LV KHOG LQYDOLG RU XQHQIRUFHDEOH
under any particular circumstance, the balance of the section
is intended to apply and the section as a whole is intended to
apply in other circumstances.
,WLVQRWWKHSXUSRVHRIWKLVVHFWLRQWRLQGXFH\RXWRLQIULQJHDQ\
patents or other property right claims or to contest validity of
DQ\VXFKFODLPVWKLVVHFWLRQKDVWKHVROHSXUSRVHRISURWHFWLQJ
the integrity of the free software distribution system, which is
LPSOHPHQWHG E\ SXEOLF OLFHQVH SUDFWLFHV 0DQ\ SHRSOH KDYH
made generous contributions to the wide range of software
distributed through that system in reliance on consistent
DSSOLFDWLRQRIWKDWV\VWHPLWLVXSWRWKHDXWKRUGRQRUWRGHFLGH
if he or she is willing to distribute software through any other
system and a licensee cannot impose that choice.
This section is intended to make thoroughly clear what is
EHOLHYHGWREHDFRQVHTXHQFHRIWKHUHVWRIWKLV/LFHQVH
,IWKHGLVWULEXWLRQDQGRUXVHRIWKH3URJUDPLVUHVWULFWHGLQ
certain countries either by patents or by copyrighted interfaces,
the original copyright holder who places the Program under this
/LFHQVHPD\DGGDQH[SOLFLWJHRJUDSKLFDOGLVWULEXWLRQOLPLWDWLRQ
H[FOXGLQJWKRVHFRXQWULHVVRWKDWGLVWULEXWLRQLVSHUPLWWHGRQO\
LQ RU DPRQJ FRXQWULHV QRW WKXV H[FOXGHG ,Q VXFK FDVH WKLV
/LFHQVHLQFRUSRUDWHVWKHOLPLWDWLRQDVLIZULWWHQLQWKHERG\RI
WKLV/LFHQVH
9. The Free Software Foundation may publish revised and/or
QHZYHUVLRQVRIWKH*HQHUDO3XEOLF/LFHQVHIURPWLPHWRWLPH
Such new versions will be similar in spirit to the present version,
but may differ in detail to address new problems or concerns.
(DFK YHUVLRQ LV JLYHQ D GLVWLQJXLVKLQJ YHUVLRQ QXPEHU ,I WKH
3URJUDP VSHFL¿HV D YHUVLRQ QXPEHU RI WKLV /LFHQVH ZKLFK
applies to it and "any later version", you have the option of
following the terms and conditions either of that version or of
any later version published by the Free Software Foundation.
,I WKH 3URJUDP GRHV QRW VSHFLI\ D YHUVLRQ QXPEHU RI WKLV
/LFHQVH \RX PD\ FKRRVH DQ\ YHUVLRQ HYHU SXEOLVKHG E\ WKH
Free Software Foundation.
,I\RXZLVKWRLQFRUSRUDWHSDUWVRIWKH3URJUDPLQWRRWKHU
free programs whose distribution conditions are different,
write to the author to ask for permission. For software which
is copyrighted by the Free Software Foundation, write to the
)UHH6RIWZDUH)RXQGDWLRQZHVRPHWLPHVPDNHH[FHSWLRQVIRU
this. Our decision will be guided by the two goals of preserving
the free status of all derivatives of our free software and of
promoting the sharing and reuse of software generally.
12:$55$17<
%(&$86(7+(352*5$0,6/,&(16(')5((2)&+$5*(
7+(5(,612:$55$17<)257+(352*5$0727+((;7(17
3(50,77('%<$33/,&$%/(/$:(;&(37:+(127+(5:,6(
67$7(' ,1 :5,7,1* 7+( &23<5,*+7 +2/'(56 $1'25
27+(5 3$57,(6 3529,'( 7+( 352*5$0 $6 ,6 :,7+287
:$55$17< 2) $1< .,1' (,7+(5 (;35(66(' 25 ,03/,('
,1&/8',1*%87127/,0,7('727+(,03/,(':$55$17,(6
2) 0(5&+$17$%,/,7< $1' ),71(66 )25 $ 3$57,&8/$5
385326( 7+( (17,5( 5,6. $6 72 7+( 48$/,7< $1'
3(5)250$1&( 2) 7+( 352*5$0 ,6 :,7+ <28 6+28/'
7+( 352*5$0 3529( '()(&7,9( <28 $6680( 7+( &267
2)$//1(&(66$5<6(59,&,1*5(3$,525&255(&7,21
,112(9(1781/(665(48,5('%<$33/,&$%/(/$:25
$*5(('72,1:5,7,1*:,//$1<&23<5,*+7+2/'(525
$1<27+(53$57<:+20$<02',)<$1'255(',675,%87(
7+(352*5$0$63(50,77('$%29(%(/,$%/(72<28)25
7KLV *HQHUDO 3XEOLF /LFHQVH GRHV QRW SHUPLW LQFRUSRUDWLQJ
\RXU SURJUDP LQWR SURSULHWDU\ SURJUDPV ,I \RXU SURJUDP LV
a subroutine library, you may consider it more useful to permit
OLQNLQJSURSULHWDU\DSSOLFDWLRQVZLWKWKHOLEUDU\,IWKLVLVZKDW
\RX ZDQW WR GR XVH WKH *18 /HVVHU *HQHUDO 3XEOLF /LFHQVH
LQVWHDGRIWKLV/LFHQVH
(1'2)7(506$1'&21',7,216
*18/(66(5*(1(5$/38%/,&/,&(16(
Version 2.1, February 1999
&RS\ULJKW&)UHH6RIWZDUH)RXQGDWLRQ,QF
)UDQNOLQ6WUHHW)LIWK)ORRU%RVWRQ0$86$
+RZWR$SSO\7KHVH7HUPVWR<RXU1HZ3URJUDPV
,I\RXGHYHORSDQHZSURJUDPDQG\RXZDQWLWWREHRIWKH
greatest possible use to the public, the best way to achieve this
is to make it free software which everyone can redistribute and
change under these terms.
7RGRVRDWWDFKWKHIROORZLQJQRWLFHVWRWKHSURJUDP,WLV
VDIHVWWRDWWDFKWKHPWRWKHVWDUWRIHDFKVRXUFH¿OHWRPRVW
HIIHFWLYHO\ FRQYH\ WKH H[FOXVLRQ RI ZDUUDQW\ DQG HDFK ¿OH
should have at least the "copyright" line and a pointer to where
the full notice is found.
RQHOLQHWRJLYHWKHSURJUDP
VQDPHDQGDEULHILGHDRI
ZKDWLWGRHV!
&RS\ULJKW&\HDU!QDPHRIDXWKRU!
7KLVSURJUDPLVIUHHVRIWZDUH\RXFDQUHGLVWULEXWHLWDQGRU
PRGLI\LWXQGHUWKHWHUPVRIWKH*18*HQHUDO3XEOLF/LFHQVHDV
SXEOLVKHGE\WKH)UHH6RIWZDUH)RXQGDWLRQHLWKHUYHUVLRQRI
WKH/LFHQVHRUDW\RXURSWLRQDQ\ODWHUYHUVLRQ
This program is distributed in the hope that it will be
XVHIXO EXW :,7+287 $1< :$55$17< ZLWKRXW HYHQ WKH
LPSOLHG ZDUUDQW\ RI 0(5&+$17$%,/,7< RU ),71(66 )25 $
3$57,&8/$5385326(6HHWKH*18*HQHUDO3XEOLF/LFHQVH
for more details.
<RX VKRXOG KDYH UHFHLYHG D FRS\ RI WKH *18 *HQHUDO
3XEOLF /LFHQVH DORQJ ZLWK WKLV SURJUDP LI QRW ZULWH WR WKH
)UHH6RIWZDUH)RXQGDWLRQ,QF)UDQNOLQ6WUHHW)LIWK)ORRU
%RVWRQ0$86$
Also add information on how to contact you by electronic and
paper mail.
,IWKHSURJUDPLVLQWHUDFWLYHPDNHLWRXWSXWDVKRUWQRWLFHOLNH
WKLVZKHQLWVWDUWVLQDQLQWHUDFWLYHPRGH
Gnomovision version 69, Copyright (C) year name of author
*QRPRYLVLRQFRPHVZLWK$%62/87(/<12:$55$17<IRU
GHWDLOVW\SHCVKRZZ
This is free software, and you are welcome to redistribute it
XQGHUFHUWDLQFRQGLWLRQVW\SHCVKRZF
IRUGHWDLOV
7KH K\SRWKHWLFDO FRPPDQGV CVKRZ Z
DQG CVKRZ F
VKRXOG
VKRZWKHDSSURSULDWHSDUWVRIWKH*HQHUDO3XEOLF/LFHQVH2I
course, the commands you use may be called something other
WKDQCVKRZZ
DQGCVKRZF
WKH\FRXOGHYHQEHPRXVHFOLFNV
or menu items--whatever suits your program.
<RXVKRXOGDOVRJHW\RXUHPSOR\HULI\RXZRUNDVDSURJUDPPHU
or your school, if any, to sign a "copyright disclaimer" for the
SURJUDPLIQHFHVVDU\+HUHLVDVDPSOHDOWHUWKHQDPHV
<R\RG\QH,QFKHUHE\GLVFODLPVDOOFRS\ULJKWLQWHUHVWLQWKH
SURJUDP µ*QRPRYLVLRQ¶ ZKLFK PDNHV SDVVHV DW FRPSLOHUV
ZULWWHQE\-DPHV+DFNHU
VLJQDWXUHRI7\&RRQ!$SULO
Ty Coon, President of Vice
LGPLv2.1
Everyone is permitted to copy and distribute verbatim copies
of this license document, but changing it is not allowed.
>7KLV LV WKH ¿UVW UHOHDVHG YHUVLRQ RI WKH /HVVHU *3/ ,W DOVR
FRXQWV DV WKH VXFFHVVRU RI WKH *18 /LEUDU\ 3XEOLF /LFHQVH
version 2, hence the version number 2.1.]
Preamble
The licenses for most software are designed to take away your
IUHHGRPWRVKDUHDQGFKDQJHLW%\FRQWUDVWWKH*18*HQHUDO
3XEOLF /LFHQVHV DUH LQWHQGHG WR JXDUDQWHH \RXU IUHHGRP WR
share and change free software--to make sure the software is
free for all its users.
7KLVOLFHQVHWKH/HVVHU*HQHUDO3XEOLF/LFHQVHDSSOLHVWRVRPH
specially designated software packages--typically libraries--of
the Free Software Foundation and other authors who decide
WR XVH LW <RX FDQ XVH LW WRR EXW ZH VXJJHVW \RX ¿UVW WKLQN
carefully about whether this license or the ordinary General
3XEOLF /LFHQVH LV WKH EHWWHU VWUDWHJ\ WR XVH LQ DQ\ SDUWLFXODU
FDVHEDVHGRQWKHH[SODQDWLRQVEHORZ :KHQZHVSHDNRIIUHHVRIWZDUHZHDUHUHIHUULQJWRIUHHGRP
RIXVHQRWSULFH2XU*HQHUDO3XEOLF/LFHQVHVDUHGHVLJQHGWR
make sure that you have the freedom to distribute copies of
IUHHVRIWZDUHDQGFKDUJHIRUWKLVVHUYLFHLI\RXZLVKWKDW\RX
UHFHLYHVRXUFHFRGHRUFDQJHWLWLI\RXZDQWLWWKDW\RXFDQ
FKDQJHWKHVRIWZDUHDQGXVHSLHFHVRILWLQQHZIUHHSURJUDPV
and that you are informed that you can do these things.
To protect your rights, we need to make restrictions that
forbid distributors to deny you these rights or to ask you to
surrender these rights. These restrictions translate to certain
responsibilities for you if you distribute copies of the library or if
you modify it.
)RUH[DPSOHLI\RXGLVWULEXWHFRSLHVRIWKHOLEUDU\ZKHWKHU
gratis or for a fee, you must give the recipients all the
ULJKWVWKDWZHJDYH\RX<RXPXVWPDNHVXUHWKDWWKH\
WRRUHFHLYHRUFDQJHWWKHVRXUFHFRGH,I\RXOLQNRWKHU
code with the library, you must provide complete object
¿OHVWRWKHUHFLSLHQWVVRWKDWWKH\FDQUHOLQNWKHPZLWKWKH
library after making changes to the library and recompiling
it. And you must show them these terms so they know their
rights.
:H SURWHFW \RXU ULJKWV ZLWK D WZRVWHS PHWKRG ZH
copyright the library, and (2) we offer you this license, which
gives you legal permission to copy, distribute and/or modify the
library.
To protect each distributor, we want to make it very
clear that there is no warranty for the free library. Also,
LIWKHOLEUDU\LVPRGL¿HGE\VRPHRQHHOVHDQGSDVVHGRQ
the recipients should know that what they have is not the
RULJLQDOYHUVLRQVRWKDWWKHRULJLQDODXWKRU
VUHSXWDWLRQ
will not be affected by problems that might be introduced
by others. Finally, software patents pose a constant threat
WRWKHH[LVWHQFHRIDQ\IUHHSURJUDP:HZLVKWRPDNH
sure that a company cannot effectively restrict the users
29
English
'$0$*(6,1&/8',1*$1<*(1(5$/63(&,$/,1&,'(17$/
25 &216(48(17,$/ '$0$*(6 $5,6,1* 287 2) 7+( 86(
25 ,1$%,/,7< 72 86( 7+( 352*5$0 ,1&/8',1* %87
127/,0,7('72/2662)'$7$25'$7$%(,1*5(1'(5('
,1$&&85$7( 25 /266(6 6867$,1(' %< <28 25 7+,5'
3$57,(625$)$,/85(2)7+(352*5$07223(5$7(:,7+
$1<27+(5352*5$06(9(1,)68&++2/'(52527+(5
3$57< +$6 %((1 $'9,6(' 2) 7+( 3266,%,/,7< 2) 68&+
'$0$*(6
English
of a free program by obtaining a restrictive license from
a patent holder. Therefore, we insist that any patent
license obtained for a version of the library must be
FRQVLVWHQWZLWKWKHIXOOIUHHGRPRIXVHVSHFL¿HG
in this license.
0RVW*18VRIWZDUHLQFOXGLQJVRPHOLEUDULHVLV
FRYHUHGE\WKHRUGLQDU\*18*HQHUDO3XEOLF/LFHQVH7KLVOLFHQVHWKH*18/HVVHU*HQHUDO3XEOLF
/LFHQVHDSSOLHVWRFHUWDLQGHVLJQDWHGOLEUDULHVDQG
is quite different from the ordinary General PubOLF/LFHQVH:HXVHWKLVOLFHQVHIRUFHUWDLQOLEUDULHV
in order to permit linking those libraries into nonfree programs.
:KHQDSURJUDPLVOLQNHGZLWKDOLEUDU\ZKHWKHU
statically or using a shared library, the combination of
the two is legally speaking a combined work, a derivative
of the original library. The ordinary General Public
/LFHQVHWKHUHIRUHSHUPLWVVXFKOLQNLQJRQO\LIWKH
HQWLUHFRPELQDWLRQ¿WVLWVFULWHULDRIIUHHGRP7KH/HVVHU
*HQHUDO3XEOLF/LFHQVHSHUPLWVPRUHOD[FULWHULDIRUOLQNLQJ
RWKHUFRGHZLWKWKHOLEUDU\:HFDOOWKLVOLFHQVHWKH/HVVHU
*HQHUDO3XEOLF/LFHQVHEHFDXVHLWGRHV/HVVWRSURWHFWWKH
XVHU
VIUHHGRPWKDQWKHRUGLQDU\*HQHUDO3XEOLF/LFHQVH
,WDOVRSURYLGHVRWKHUIUHHVRIWZDUHGHYHORSHUV/HVVRI
an advantage over competing non-free programs. These
disadvantages are the reason we use the ordinary General
3XEOLF/LFHQVHIRUPDQ\OLEUDULHV+RZHYHUWKH/HVVHUOLFHQVH
provides advantages in certain special circumstances. For
H[DPSOHRQUDUHRFFDVLRQVWKHUHPD\EHDVSHFLDOQHHG
to encourage the widest possible use of a certain library,
so that it becomes a de-facto standard. To achieve this,
non-free programs must be allowed to use the library. A
more frequent case is that a free library does the same
MREDVZLGHO\XVHGQRQIUHHOLEUDULHV,QWKLVFDVHWKHUH
is little to gain by limiting the free library to free software
RQO\VRZHXVHWKH/HVVHU*HQHUDO3XEOLF/LFHQVH,QRWKHU
cases, permission to use a particular library in non-free
programs enables a greater number of people to use a large
ERG\RIIUHHVRIWZDUH)RUH[DPSOHSHUPLVVLRQWRXVHWKH
*18&/LEUDU\LQQRQIUHHSURJUDPVHQDEOHVPDQ\PRUH
SHRSOHWRXVHWKHZKROH*18RSHUDWLQJV\VWHPDVZHOODV
LWVYDULDQWWKH*18/LQX[RSHUDWLQJV\VWHP$OWKRXJKWKH
/HVVHU*HQHUDO3XEOLF/LFHQVHLV/HVVSURWHFWLYHRIWKH
XVHUV
IUHHGRPLWGRHVHQVXUHWKDWWKHXVHURIDSURJUDP
WKDWLVOLQNHGZLWKWKH/LEUDU\KDVWKHIUHHGRPDQGWKH
ZKHUHZLWKDOWRUXQWKDWSURJUDPXVLQJDPRGL¿HGYHUVLRQ
RIWKH/LEUDU\7KHSUHFLVHWHUPVDQGFRQGLWLRQVIRUFRS\LQJ
GLVWULEXWLRQDQGPRGL¿FDWLRQIROORZ3D\FORVHDWWHQWLRQWR
the difference between a "work based on the library" and
a "work that uses the library". The former contains code
derived from the library, whereas the latter must be combined
with the library in order to run.
*18/(66(5*(1(5$/38/,&/,&(16(
7(506$1'&21',7,216)25&23<,1*',675,%87,21
$1'02',),&$7,21
7KLV/LFHQVH$JUHHPHQWDSSOLHVWRDQ\VRIWZDUHOLEUDU\
or other program which contains a notice placed by the
copyright holder or other authorized party saying it may be
GLVWULEXWHGXQGHUWKHWHUPVRIWKLV/HVVHU*HQHUDO3XEOLF
/LFHQVHDOVRFDOOHGWKLV/LFHQVH(DFKOLFHQVHHLVDGGUHVVHG
as "you". A "library" means a collection of software functions
and/or data prepared so as to be conveniently linked with
application programs (which use some of those functions
DQGGDWDWRIRUPH[HFXWDEOHV
7KH/LEUDU\EHORZUHIHUVWRDQ\VXFKVRIWZDUHOLEUDU\
or work which has been distributed under these terms. A
ZRUNEDVHGRQWKH/LEUDU\PHDQVHLWKHUWKH/LEUDU\RUDQ\
GHULYDWLYHZRUNXQGHUFRS\ULJKWODZWKDWLVWRVD\DZRUN
FRQWDLQLQJWKH/LEUDU\RUDSRUWLRQRILWHLWKHUYHUEDWLP
RUZLWKPRGL¿FDWLRQVDQGRUWUDQVODWHGVWUDLJKWIRUZDUGO\
LQWRDQRWKHUODQJXDJH+HUHLQDIWHUWUDQVODWLRQLVLQFOXGHG
30
ZLWKRXWOLPLWDWLRQLQWKHWHUPPRGL¿FDWLRQ
"Source code" for a work means the preferred form of the
ZRUNIRUPDNLQJPRGL¿FDWLRQVWRLW)RUDOLEUDU\FRPSOHWH
source code means all the source code for all modules it
FRQWDLQVSOXVDQ\DVVRFLDWHGLQWHUIDFHGH¿QLWLRQ¿OHVSOXV
the scripts used to control compilation and installation of
the library. Activities other than copying, distribution and
PRGL¿FDWLRQDUHQRWFRYHUHGE\WKLV/LFHQVHWKH\DUH
outside its scope. The act of running a program using the
/LEUDU\LVQRWUHVWULFWHGDQGRXWSXWIURPVXFKDSURJUDPLV
covered only if its contents constitute a work based on the
/LEUDU\LQGHSHQGHQWRIWKHXVHRIWKH/LEUDU\LQDWRROIRU
ZULWLQJLW:KHWKHUWKDWLVWUXHGHSHQGVRQZKDWWKH/LEUDU\
GRHVDQGZKDWWKHSURJUDPWKDWXVHVWKH/LEUDU\GRHV
<RXPD\FRS\DQGGLVWULEXWHYHUEDWLPFRSLHVRIWKH
/LEUDU\
VFRPSOHWHVRXUFHFRGHDV\RXUHFHLYHLWLQDQ\
medium, provided that you conspicuously and appropriately
publish on each copy an appropriate copyright notice
DQGGLVFODLPHURIZDUUDQW\NHHSLQWDFWDOOWKHQRWLFHV
WKDWUHIHUWRWKLV/LFHQVHDQGWRWKHDEVHQFHRIDQ\
ZDUUDQW\DQGGLVWULEXWHDFRS\RIWKLV/LFHQVHDORQJ
ZLWKWKH/LEUDU\
<RXPD\FKDUJHDIHHIRUWKHSK\VLFDODFWRI
transferring a copy, and you may at your option
RIIHUZDUUDQW\SURWHFWLRQLQH[FKDQJHIRUDIHH
<RXPD\PRGLI\\RXUFRS\RUFRSLHVRIWKH/LEUDU\RU
DQ\SRUWLRQRILWWKXVIRUPLQJDZRUNEDVHGRQWKH/LEUDU\
DQGFRS\DQGGLVWULEXWHVXFKPRGL¿FDWLRQVRUZRUNXQGHUWKH
terms of Section 1 above, provided that you also meet all of
WKHVHFRQGLWLRQV
D7KHPRGL¿HGZRUNPXVWLWVHOIEHDVRIWZDUH
library.
E<RXPXVWFDXVHWKH¿OHVPRGL¿HGWRFDUU\
prominent notices stating that you changed
WKH¿OHVDQGWKHGDWHRIDQ\FKDQJH
F<RXPXVWFDXVHWKHZKROHRIWKHZRUNWREHOLFHQVHGDW
QRFKDUJHWRDOOWKLUGSDUWLHVXQGHUWKHWHUPVRIWKLV/LFHQVH
G,IDIDFLOLW\LQWKHPRGL¿HG/LEUDU\UHIHUVWRDIXQFWLRQ
or a table of data to be supplied by an application program
that uses the facility, other than as an argument passed
when the facility is invoked, then you must make a good faith
effort to ensure that, in the event an application does not
supply such function or table, the facility still operates, and
performs whatever part of its purpose remains meaningful.
)RUH[DPSOHDIXQFWLRQLQDOLEUDU\WRFRPSXWHVTXDUH
URRWVKDVDSXUSRVHWKDWLVHQWLUHO\ZHOOGH¿QHGLQGHSHQGHQW
of the application. Therefore, Subsection 2d requires that any
application-supplied function or table used by this function
PXVWEHRSWLRQDOLIWKHDSSOLFDWLRQGRHVQRWVXSSO\LWWKH
square root function must still compute square roots.) These
UHTXLUHPHQWVDSSO\WRWKHPRGL¿HGZRUNDVDZKROH,I
LGHQWL¿DEOHVHFWLRQVRIWKDWZRUNDUHQRWGHULYHGIURPWKH
/LEUDU\DQGFDQEHUHDVRQDEO\FRQVLGHUHGLQGHSHQGHQWDQG
VHSDUDWHZRUNVLQWKHPVHOYHVWKHQWKLV/LFHQVHDQGLWV
terms, do not apply to those sections when you distribute
them as separate works. But when you distribute the same
sections as part of a whole which is a work based on the
/LEUDU\WKHGLVWULEXWLRQRIWKHZKROHPXVWEHRQWKHWHUPVRI
WKLV/LFHQVHZKRVHSHUPLVVLRQVIRURWKHUOLFHQVHHVH[WHQGWR
the entire whole, and thus to each and every part regardless
of who wrote it. Thus, it is not the intent of this section to
claim rights or contest your rights to work written entirely
E\\RXUDWKHUWKHLQWHQWLVWRH[HUFLVHWKHULJKWWRFRQWURO
the distribution of derivative or collective works based on the
/LEUDU\,QDGGLWLRQPHUHDJJUHJDWLRQRIDQRWKHUZRUNQRW
EDVHGRQWKH/LEUDU\ZLWKWKH/LEUDU\RUZLWKDZRUNEDVHGRQ
WKH/LEUDU\RQDYROXPHRIDVWRUDJHRUGLVWULEXWLRQPHGLXP
GRHVQRWEULQJWKHRWKHUZRUNXQGHUWKHVFRSHRIWKLV/LFHQVH
<RXPD\RSWWRDSSO\WKHWHUPVRIWKHRUGLQDU\*18
*HQHUDO3XEOLF/LFHQVHLQVWHDGRIWKLV/LFHQVHWRDJLYHQ
FRS\RIWKH/LEUDU\7RGRWKLV\RXPXVWDOWHUDOOWKH
QRWLFHVWKDWUHIHUWRWKLV/LFHQVHVRWKDWWKH\UHIHUWRWKH
RUGLQDU\*18*HQHUDO3XEOLF/LFHQVHYHUVLRQLQVWHDG
LQWKH/LEUDU\ZLOOQRWQHFHVVDULO\EHDEOHWRUHFRPSLOHWKH
DSSOLFDWLRQWRXVHWKHPRGL¿HGGH¿QLWLRQVE8VH
a suitable shared library mechanism for linking with the
/LEUDU\$VXLWDEOHPHFKDQLVPLVRQHWKDWXVHVDWUXQ
WLPHDFRS\RIWKHOLEUDU\DOUHDG\SUHVHQWRQWKHXVHU
V
computer system, rather than copying library functions into
WKHH[HFXWDEOHDQGZLOORSHUDWHSURSHUO\ZLWKDPRGL¿HG
version of the library, if the user installs one, as long as the
PRGL¿HGYHUVLRQLVLQWHUIDFHFRPSDWLEOHZLWKWKHYHUVLRQ
that the work was made with. c) Accompany the work with a
written offer, valid for at least three years, to give the same
XVHUWKHPDWHULDOVVSHFL¿HGLQ6XEVHFWLRQDDERYHIRUD
charge no more than the cost of performing this distribution.
G,IGLVWULEXWLRQRIWKHZRUNLVPDGHE\RIIHULQJDFFHVVWR
copy from a designated place, offer equivalent access to copy
WKHDERYHVSHFL¿HGPDWHULDOVIURPWKHVDPHSODFH e) Verify that the user has already received a copy of
these materials or that you have already sent this user a
FRS\)RUDQH[HFXWDEOHWKHUHTXLUHGIRUPRIWKHZRUN
WKDWXVHVWKH/LEUDU\PXVWLQFOXGHDQ\GDWDDQGXWLOLW\
SURJUDPVQHHGHGIRUUHSURGXFLQJWKHH[HFXWDEOHIURP
LW+RZHYHUDVDVSHFLDOH[FHSWLRQWKHPDWHULDOVWREH
distributed need not include anything that is normally
distributed (in either source or binary form) with the
major components (compiler, kernel, and so on) of the
RSHUDWLQJV\VWHPRQZKLFKWKHH[HFXWDEOHUXQVXQOHVV
WKDWFRPSRQHQWLWVHOIDFFRPSDQLHVWKHH[HFXWDEOH
,WPD\KDSSHQWKDWWKLVUHTXLUHPHQWFRQWUDGLFWVWKH
license restrictions of other proprietary libraries that do
not normally accompany the operating system. Such
a contradiction means you cannot use both them
DQGWKH/LEUDU\WRJHWKHULQDQH[HFXWDEOHWKDW\RX
distribute.
<RXPD\SODFHOLEUDU\IDFLOLWLHVWKDWDUHDZRUNEDVHG
RQWKH/LEUDU\VLGHE\VLGHLQDVLQJOHOLEUDU\WRJHWKHUZLWK
RWKHUOLEUDU\IDFLOLWLHVQRWFRYHUHGE\WKLV/LFHQVHDQG
distribute such a combined library, provided that the separate
GLVWULEXWLRQRIWKHZRUNEDVHGRQWKH/LEUDU\DQGRIWKHRWKHU
library facilities is otherwise permitted, and provided that you
GRWKHVHWZRWKLQJV
a) Accompany the combined library with a copy of the
VDPHZRUNEDVHGRQWKH/LEUDU\XQFRPELQHGZLWKDQ\
other library facilities. This must be distributed under the
terms of the Sections above.
b) Give prominent notice with the combined
library of the fact that part of it is a work based
RQWKH/LEUDU\DQGH[SODLQLQJZKHUHWR¿QGWKH
accompanying uncombined form of the same work.
<RXPD\QRWFRS\PRGLI\VXEOLFHQVHOLQNZLWKRU
GLVWULEXWHWKH/LEUDU\H[FHSWDVH[SUHVVO\SURYLGHGXQGHU
WKLV/LFHQVH$Q\DWWHPSWRWKHUZLVHWRFRS\PRGLI\
VXEOLFHQVHOLQNZLWKRUGLVWULEXWHWKH/LEUDU\LVYRLGDQG
ZLOODXWRPDWLFDOO\WHUPLQDWH\RXUULJKWVXQGHUWKLV/LFHQVH
+RZHYHUSDUWLHVZKRKDYHUHFHLYHGFRSLHVRUULJKWVIURP
\RXXQGHUWKLV/LFHQVHZLOOQRWKDYHWKHLUOLFHQVHVWHUPLQDWHG
so long as such parties remain in full compliance.
<RXDUHQRWUHTXLUHGWRDFFHSWWKLV/LFHQVHVLQFH
\RXKDYHQRWVLJQHGLW+RZHYHUQRWKLQJHOVHJUDQWV
\RXSHUPLVVLRQWRPRGLI\RUGLVWULEXWHWKH/LEUDU\RULWV
derivative works. These actions are prohibited by law if
\RXGRQRWDFFHSWWKLV/LFHQVH7KHUHIRUHE\PRGLI\LQJRU
GLVWULEXWLQJWKH/LEUDU\RUDQ\ZRUNEDVHGRQWKH/LEUDU\
\RXLQGLFDWH\RXUDFFHSWDQFHRIWKLV/LFHQVHWRGRVRDQG
all its terms and conditions for copying, distributing or
PRGLI\LQJWKH/LEUDU\RUZRUNVEDVHGRQLW
(DFKWLPH\RXUHGLVWULEXWHWKH/LEUDU\RUDQ\ZRUN
EDVHGRQWKH/LEUDU\WKHUHFLSLHQWDXWRPDWLFDOO\UHFHLYHVD
license from the original licensor to copy, distribute, link with
RUPRGLI\WKH/LEUDU\VXEMHFWWRWKHVHWHUPVDQGFRQGLWLRQV
<RXPD\QRWLPSRVHDQ\IXUWKHUUHVWULFWLRQVRQWKHUHFLSLHQWV
H[HUFLVHRIWKHULJKWVJUDQWHGKHUHLQ<RXDUHQRWUHVSRQVLEOH
IRUHQIRUFLQJFRPSOLDQFHE\WKLUGSDUWLHVZLWKWKLV/LFHQVH
,IDVDFRQVHTXHQFHRIDFRXUWMXGJPHQWRUDOOHJDWLRQ
of patent infringement or for any other reason (not limited
31
English
RIWRWKLV/LFHQVH,IDQHZHUYHUVLRQWKDQYHUVLRQRI
WKHRUGLQDU\*18*HQHUDO3XEOLF/LFHQVHKDVDSSHDUHG
then you can specify that version instead if you wish.) Do
not make any other change in these notices. Once this
change is made in a given copy, it is irreversible for that
FRS\VRWKHRUGLQDU\*18*HQHUDO3XEOLF/LFHQVHDSSOLHVWR
all subsequent copies and derivative works made from that
copy. This option is useful when you wish to copy part of
WKHFRGHRIWKH/LEUDU\LQWRDSURJUDPWKDWLVQRWDOLEUDU\
<RXPD\FRS\DQGGLVWULEXWHWKH/LEUDU\RUDSRUtion or derivative of it, under Section 2) in object code
RUH[HFXWDEOHIRUPXQGHUWKHWHUPVRI6HFWLRQVDQG
above provided that you accompany it with the complete
corresponding machine-readable source code, which must
be distributed under the terms of Sections 1 and 2 above
on a medium customarily used for software interchange.
,IGLVWULEXWLRQRIREMHFWFRGHLVPDGHE\RIIHULQJ
access to copy from a designated place, then offering
equivalent access to copy the source code from the
VDPHSODFHVDWLV¿HVWKHUHTXLUHPHQWWRGLVWULEXWHWKH
source code, even though third parties are not compelled
to copy the source along with the object code.
5. A program that contains no derivative of any portion of
WKH/LEUDU\EXWLVGHVLJQHGWRZRUNZLWKWKH/LEUDU\E\EHLQJ
compiled or linked with it, is called a "work that uses the
/LEUDU\6XFKDZRUNLQLVRODWLRQLVQRWDGHULYDWLYHZRUN
RIWKH/LEUDU\DQGWKHUHIRUHIDOOVRXWVLGHWKHVFRSHRIWKLV
/LFHQVH+RZHYHUOLQNLQJDZRUNWKDWXVHVWKH/LEUDU\
ZLWKWKH/LEUDU\FUHDWHVDQH[HFXWDEOHWKDWLVDGHULYDWLYH
RIWKH/LEUDU\EHFDXVHLWFRQWDLQVSRUWLRQVRIWKH/LEUDU\
UDWKHUWKDQDZRUNWKDWXVHVWKHOLEUDU\7KHH[HFXWDEOH
LVWKHUHIRUHFRYHUHGE\WKLV/LFHQVH6HFWLRQVWDWHVWHUPV
IRUGLVWULEXWLRQRIVXFKH[HFXWDEOHV:KHQDZRUNWKDW
XVHVWKH/LEUDU\XVHVPDWHULDOIURPDKHDGHU¿OHWKDWLV
SDUWRIWKH/LEUDU\WKHREMHFWFRGHIRUWKHZRUNPD\EHD
GHULYDWLYHZRUNRIWKH/LEUDU\HYHQWKRXJKWKHVRXUFHFRGH
LVQRW:KHWKHUWKLVLVWUXHLVHVSHFLDOO\VLJQL¿FDQWLIWKH
ZRUNFDQEHOLQNHGZLWKRXWWKH/LEUDU\RULIWKHZRUNLVLWVHOI
a library. The threshold for this to be true is not precisely
GH¿QHGE\ODZ,IVXFKDQREMHFW¿OHXVHVRQO\QXPHULFDO
parameters, data structure layouts and accessors, and small
macros and small inline functions (ten lines or less in length),
WKHQWKHXVHRIWKHREMHFW¿OHLVXQUHVWULFWHGUHJDUGOHVV
RIZKHWKHULWLVOHJDOO\DGHULYDWLYHZRUN([HFXWDEOHV
FRQWDLQLQJWKLVREMHFWFRGHSOXVSRUWLRQVRIWKH/LEUDU\
will still fall under Section 6.) Otherwise, if the work is a
GHULYDWLYHRIWKH/LEUDU\\RXPD\GLVWULEXWHWKHREMHFWFRGH
IRUWKHZRUNXQGHUWKHWHUPVRI6HFWLRQ$Q\H[HFXWDEOHV
containing that work also fall under Section 6, whether
RUQRWWKH\DUHOLQNHGGLUHFWO\ZLWKWKH/LEUDU\LWVHOI
$VDQH[FHSWLRQWRWKH6HFWLRQVDERYH\RXPD\
DOVRFRPELQHRUOLQNDZRUNWKDWXVHVWKH/LEUDU\ZLWK
WKH/LEUDU\WRSURGXFHDZRUNFRQWDLQLQJSRUWLRQVRIWKH
/LEUDU\DQGGLVWULEXWHWKDWZRUNXQGHUWHUPVRI\RXU
FKRLFHSURYLGHGWKDWWKHWHUPVSHUPLWPRGL¿FDWLRQ
RIWKHZRUNIRUWKHFXVWRPHU
VRZQXVHDQGUHYHUVH
HQJLQHHULQJIRUGHEXJJLQJVXFKPRGL¿FDWLRQV
<RXPXVWJLYHSURPLQHQWQRWLFHZLWKHDFKFRS\RIWKH
ZRUNWKDWWKH/LEUDU\LVXVHGLQLWDQGWKDWWKH/LEUDU\DQG
LWVXVHDUHFRYHUHGE\WKLV/LFHQVH<RXPXVWVXSSO\D
FRS\RIWKLV/LFHQVH,IWKHZRUNGXULQJH[HFXWLRQGLVSOD\V
copyright notices, you must include the copyright notice for
WKH/LEUDU\DPRQJWKHPDVZHOODVDUHIHUHQFHGLUHFWLQJWKH
XVHUWRWKHFRS\RIWKLV/LFHQVH$OVR\RXPXVWGRRQHRI
WKHVHWKLQJVD$FFRPSDQ\WKHZRUNZLWKWKHFRPSOHWH
FRUUHVSRQGLQJPDFKLQHUHDGDEOHVRXUFHFRGHIRUWKH/LEUDU\
including whatever
changes were used in the work (which
PXVWEHGLVWULEXWHGXQGHU6HFWLRQVDQGDERYHDQGLI
WKHZRUNLVDQH[HFXWDEOHOLQNHGZLWKWKH/LEUDU\ZLWKWKH
FRPSOHWHPDFKLQHUHDGDEOHZRUNWKDWXVHVWKH/LEUDU\
as object code and/or source code, so that the
user can
PRGLI\WKH/LEUDU\DQGWKHQUHOLQNWRSURGXFHDPRGL¿HG
H[HFXWDEOHFRQWDLQLQJWKHPRGL¿HG/LEUDU\,WLVXQGHUVWRRG
WKDWWKHXVHUZKRFKDQJHVWKHFRQWHQWVRIGH¿QLWLRQV¿OHV
English
to patent issues), conditions are imposed on you (whether
by court order, agreement or otherwise) that contradict the
FRQGLWLRQVRIWKLV/LFHQVHWKH\GRQRWH[FXVH\RXIURPWKH
FRQGLWLRQVRIWKLV/LFHQVH,I\RXFDQQRWGLVWULEXWHVRDVWR
VDWLVI\VLPXOWDQHRXVO\\RXUREOLJDWLRQVXQGHUWKLV/LFHQVHDQG
any other pertinent obligations, then as a consequence you
PD\QRWGLVWULEXWHWKH/LEUDU\DWDOO)RUH[DPSOHLIDSDWHQW
license would not permit royalty-free redistribution of the
/LEUDU\E\DOOWKRVHZKRUHFHLYHFRSLHVGLUHFWO\RULQGLUHFWO\
through you, then the only way you could satisfy both it and
WKLV/LFHQVHZRXOGEHWRUHIUDLQHQWLUHO\IURPGLVWULEXWLRQ
RIWKH/LEUDU\
,IDQ\SRUWLRQRIWKLVVHFWLRQLVKHOGLQYDOLGRUXQHQIRUFHable under any particular circumstance, the balance of the
section is intended to apply, and the section as a whole
LVLQWHQGHGWRDSSO\LQRWKHUFLUFXPVWDQFHV,WLVQRWWKH
purpose of this section to induce you to infringe any patents
or other property right claims or to contest validity of any
VXFKFODLPVWKLVVHFWLRQKDVWKHVROHSXUSRVHRISURWHFWLQJ
the integrity of the free software distribution system which is
LPSOHPHQWHGE\SXEOLFOLFHQVHSUDFWLFHV0DQ\SHRSOHKDYH
made generous contributions to the wide range of software
distributed through that system in reliance on consistent
DSSOLFDWLRQRIWKDWV\VWHPLWLVXSWRWKHDXWKRUGRQRUWR
decide if he or she is willing to distribute software through
any other system and a licensee cannot impose that choice.
This section is intended to make thoroughly clear what is
EHOLHYHGWREHDFRQVHTXHQFHRIWKHUHVWRIWKLV/LFHQVH
,IWKHGLVWULEXWLRQDQGRUXVHRIWKH/LEUDU\LVUHVWULFWHG
in certain countries either by patents or by copyrighted
interfaces, the original copyright holder who places the
/LEUDU\XQGHUWKLV/LFHQVHPD\DGGDQH[SOLFLWJHRJUDSKLFDO
GLVWULEXWLRQOLPLWDWLRQH[FOXGLQJWKRVHFRXQWULHVVRWKDW
distribution is permitted only in or among countries not
WKXVH[FOXGHG,QVXFKFDVHWKLV/LFHQVHLQFRUSRUDWHV
WKHOLPLWDWLRQDVLIZULWWHQLQWKHERG\RIWKLV/LFHQVH
13. The Free Software Foundation may publish revised
DQGRUQHZYHUVLRQVRIWKH/HVVHU*HQHUDO3XEOLF/LFHQVH
from time to time. Such new versions will be similar in
spirit to the present version, but may differ in detail to
address new problems or concerns.Each version is given
DGLVWLQJXLVKLQJYHUVLRQQXPEHU,IWKH/LEUDU\VSHFL¿HVD
YHUVLRQQXPEHURIWKLV/LFHQVHZKLFKDSSOLHVWRLWDQGDQ\
later version", you have the option of following the terms
and conditions either of that version or of any later version
SXEOLVKHGE\WKH)UHH6RIWZDUH)RXQGDWLRQ,IWKH/LEUDU\
does not specify a license version number, you may choose
any version ever published by the Free Software Foundation.
,I\RXZLVKWRLQFRUSRUDWHSDUWVRIWKH/LEUDU\LQWR
other free programs whose distribution conditions are
incompatible with these, write to the author to ask for
permission. For software which is copyrighted by the
Free Software Foundation, write to the Free Software
)RXQGDWLRQZHVRPHWLPHVPDNHH[FHSWLRQVIRUWKLV2XU
decision will be guided by the two goals of preserving the
free status of all derivatives of our free software and of
promoting the sharing and reuse of software generally.
12:$55$17<
%(&$86(7+(/,%5$5<,6/,&(16(')5((2)&+$5*(
7+(5(,612:$55$17<)257+(/,%5$5<727+((;7(17
3(50,77('%<$33/,&$%/(/$:(;&(37:+(127+(5:,6(
67$7(' ,1 :5,7,1* 7+( &23<5,*+7 +2/'(56 $1'25
27+(5 3$57,(6 3529,'( 7+( /,%5$5< $6 ,6 :,7+287
:$55$17< 2) $1< .,1' (,7+(5 (;35(66(' 25 ,03/,('
,1&/8',1* %87 127 /,0,7(' 72 7+( ,03/,(' :$55$17,(6 2) 0(5&+$17$%,/,7< $1' ),71(66 )25 $ 3$57,&8/$5 385326( 7+( (17,5( 5,6. $6 72 7+( 48$/,7< $1'
3(5)250$1&(2)7+(/,%5$5<,6:,7+<286+28/'7+(
/,%5$5<3529('()(&7,9(<28$6680(
7+(
&267 2) $// 1(&(66$5< 6(59,&,1* 5(3$,5 25 &255(&7,21
,112(9(1781/(665(48,5('%<$33/,&$%/(/$:25
32
$*5(('72,1:5,7,1*:,//$1<&23<5,*+7+2/'(525
$1<27+(53$57<:+20$<02',)<$1'255(',675,%87(
7+(/,%5$5<$63(50,77('$%29(%(/,$%/(72<28)25
'$0$*(6,1&/8',1*$1<*(1(5$/63(&,$/,1&,'(17$/
25&216(48(17,$/'$0$*(6$5,6,1*2872)7+(86(25
,1$%,/,7<7286(7+(/,%5$5<,1&/8',1*%87127/,0,7('72/2662)'$7$25'$7$%(,1*5(1'(5(',1$&&85$7(25/266(66867$,1('%<<28257+,5'3$57,(625
$)$,/85(2)7+(/,%5$5<7223(5$7(:,7+$1<27+(5
62)7:$5((9(1,)
68&+ +2/'(5 25 27+(5 3$57<
+$6 %((1 $'9,6(' 2) 7+( 3266,%,/,7< 2) 68&+ '$0$*ES.
(1'2)7(506$1'&21',7,216
+RZ WR
$SSO\7KHVH7HUPVWR<RXU1HZ/LEUDULHV
,I \RX GHYHORS D QHZ OLEUDU\ DQG \RX ZDQW LW WR EH RI WKH
greatest possible use to the public, we recommend making it
IUHHVRIWZDUHWKDWHYHU\RQHFDQUHGLVWULEXWHDQGFKDQJH<RX
can do so by permitting redistribution under these terms (or,
alternatively, under the terms of the
ordinary General PubOLF/LFHQVH7RDSSO\WKHVHWHUPVDWWDFKWKHIROORZLQJQRWLFHV
WRWKHOLEUDU\,WLVVDIHVWWRDWWDFKWKHPWRWKHVWDUWRIHDFK
VRXUFH¿OHWRPRVWHIIHFWLYHO\FRQYH\WKHH[FOXVLRQRIZDUUDQW\
DQG HDFK ¿OH VKRXOG KDYH DW OHDVW WKH FRS\ULJKW OLQH DQG D
pointer to where the full notice is found.
RQHOLQHWRJLYHWKHOLEUDU\
VQDPHDQGDEULHILGHDRIZKDW
LWGRHV!
&RS\ULJKW&\HDU!QDPHRIDXWKRU!
7KLVOLEUDU\LVIUHHVRIWZDUH\RXFDQUHGLVWULEXWHLWDQGRU
PRGLI\LWXQGHUWKHWHUPVRIWKH*18/HVVHU*HQHUDO3XEOLF/LFHQVHDVSXEOLVKHGE\WKH)UHH6RIWZDUH)RXQGDWLRQHLWKHUYHUVLRQRIWKH/LFHQVHRUDW\RXURSWLRQDQ\ODWHUYHUVLRQ
This library is distributed in the hope that it will be useful,
EXW:,7+287$1<:$55$17<ZLWKRXWHYHQWKHLPSOLHGZDUUDQW\ RI 0(5&+$17$%,/,7< RU ),71(66 )25 $ 3$57,&8/$5
385326(6HHWKH*18/HVVHU*HQHUDO3XEOLF/LFHQVHIRUPRUH
GHWDLOV <RX VKRXOG KDYH UHFHLYHG D FRS\ RI WKH *18 /HVVHU
*HQHUDO3XEOLF/LFHQVHDORQJZLWKWKLVOLEUDU\LIQRWZULWHWRWKH
)UHH6RIWZDUH)RXQGDWLRQ,QF)UDQNOLQ6WUHHW)LIWK)ORRU
%RVWRQ0$86$$OVRDGGLQIRUPDWLRQRQKRZWR
FRQWDFW\RXE\HOHFWURQLFDQGSDSHUPDLO<RXVKRXOGDOVRJHW
your employer (if you work as a programmer) or your school, if
any, to sign a "copyright disclaimer" for the library, if necessary.
+HUH LV D VDPSOH DOWHU WKH QDPHV <R\RG\QH ,QF KHUHE\
GLVFODLPVDOOFRS\ULJKWLQWHUHVWLQWKHOLEUDU\C)URE
DOLEUDU\IRU
WZHDNLQJNQREVZULWWHQE\-DPHV5DQGRP+DFNHU VLJQDWXUHRI7\&RRQ!$SULO 7\ &RRQ 3UHVLGHQW RI
9LFH7KDW
VDOOWKHUHLVWRLW
ICU License - ICU 1.8.1 and later
&23<5,*+7$1'3(50,66,21127,&(
&RS\ULJKWF,QWHUQDWLRQDO%XVLQHVV0DFKLQHV&RUporation and others
All rights reserved.
Permission is hereby granted, free of charge, to any person
obtaining a copy of this software and associated documentation
¿OHV WKH 6RIWZDUH WR GHDO LQ WKH 6RIWZDUH ZLWKRXW UHVWULFtion, including without limitation the rights to use, copy, modify,
merge, publish, distribute, and/or sell copies of the Software,
and to permit persons to whom the Software is furnished to do
so, provided that the above copyright notice(s) and this permission notice appear in all copies of the Software and that both
the above copyright notice(s) and this permission notice appear
in supporting documentation.
7+(62)7:$5(,63529,'('$6,6:,7+287:$55$17<
2) $1< .,1' (;35(66 25 ,03/,(' ,1&/8',1* %87 127
/,0,7(' 72 7+( :$55$17,(6 2) 0(5&+$17$%,/,7< ),71(66)25$3$57,&8/$5385326($1'121,1)5,1*(0(17
2) 7+,5' 3$57< 5,*+76 ,1 12 (9(17 6+$// 7+( &23<5,*+7 +2/'(5 25 +2/'(56 ,1&/8'(' ,1 7+,6 127,&(
%( /,$%/( )25 $1< &/$,0 25 $1< 63(&,$/ ,1',5(&7 25
([FHSW DV FRQWDLQHG LQ WKLV QRWLFH WKH QDPH RI D FRS\ULJKW
holder shall not be used in advertising or otherwise to promote
the sale, use or other dealings in this Software without prior
written authorization of the copyright holder.
All trademarks and registered trademarks mentioned herein are
the property of their respective owners.
LICENSE ISSUES
/,&(16(,668(6
==============
7KH2SHQ66/WRRONLWVWD\VXQGHUDGXDOOLFHQVHLHERWKWKH
conditions of
WKH 2SHQ66/ /LFHQVH DQG WKH RULJLQDO 66/HD\ OLFHQVH DSSO\
to the toolkit.
6HHEHORZIRUWKHDFWXDOOLFHQVHWH[WV$FWXDOO\ERWKOLFHQVHV
are BSD-style
2SHQ 6RXUFH OLFHQVHV ,Q FDVH RI DQ\ OLFHQVH LVVXHV UHODWHG
WR2SHQ66/
SOHDVHFRQWDFWRSHQVVOFRUH#RSHQVVORUJ
2SHQ66//LFHQVH
--------------/* ====================================
================================
&RS\ULJKW F 7KH 2SHQ66/ 3URMHFW $OO ULJKWV
reserved.
*
* Redistribution and use in source and binary forms, with or
without
PRGL¿FDWLRQDUHSHUPLWWHGSURYLGHGWKDWWKHIROORZLQJFRQditions
DUHPHW
*
* 1. Redistributions of source code must retain the above copyright
* notice, this list of conditions and the following disclaimer.
*
* 2. Redistributions in binary form must reproduce the above
copyright
* notice, this list of conditions and the following disclaimer
in
*
the documentation and/or other materials provided with
the
* distribution.
*
* 3. All advertising materials mentioning features or use of
this
VRIWZDUHPXVWGLVSOD\WKHIROORZLQJDFNQRZOHGJPHQW
7KLVSURGXFWLQFOXGHVVRIWZDUHGHYHORSHGE\WKH2SHQ66/
Project
IRU XVH LQ WKH 2SHQ66/ 7RRONLW KWWSZZZRSHQVVO
org/)"
*
7KHQDPHV2SHQ66/7RRONLWDQG2SHQ66/3URMHFWPXVW
not be used to
*
endorse or promote products derived from this software
without
*
prior written permission. For written permission, please
contact
RSHQVVOFRUH#RSHQVVORUJ
*
* 5. Products derived from this software may not be called
2SHQ66/
QRUPD\2SHQ66/DSSHDULQWKHLUQDPHVZLWKRXWSULRU
written
SHUPLVVLRQRIWKH2SHQ66/3URMHFW
*
* 6. Redistributions of any form whatsoever must retain the
following
DFNQRZOHGJPHQW
7KLVSURGXFWLQFOXGHVVRIWZDUHGHYHORSHGE\WKH2SHQ66/
Project
IRUXVHLQWKH2SHQ66/7RRONLWKWWSZZZRSHQVVORUJ
*
7+,662)7:$5(,63529,'('%<7+(2SHQ66/352-(&7
CC$6,6
$1'$1<
(;35(66(' 25 ,03/,(' :$55$17,(6 ,1&/8',1* %87
127/,0,7('727+(
,03/,(':$55$17,(62)0(5&+$17$%,/,7<$1'),71(66
)25$3$57,&8/$5
385326( $5( ',6&/$,0(' ,1 12 (9(17 6+$// 7+(
2SHQ66/352-(&725
,76&2175,%87256%(/,$%/()25$1<',5(&7,1',5(&7
,1&,'(17$/
63(&,$/(;(03/$5<25&216(48(17,$/'$0$*(6,1&/8',1*%87
127/,0,7('72352&85(0(172)68%67,787(*22'6
256(59,&(6
/266 2) 86( '$7$ 25 352),76 25 %86,1(66 ,17(55837,21
+2:(9(5 &$86(' $1' 21 $1< 7+(25< 2) /,$%,/,7<
:+(7+(5,1&2175$&7
675,&7/,$%,/,7<257257,1&/8',1*1(*/,*(1&(25
27+(5:,6(
$5,6,1* ,1 $1< :$< 287 2) 7+( 86( 2) 7+,6 62)7:$5((9(1,)$'9,6('
2)7+(3266,%,/,7<2)68&+'$0$*(
* ====================================
================================
*
* This product includes cryptographic software written by Eric
<RXQJ
HD\#FU\SWVRIWFRP7KLVSURGXFWLQFOXGHVVRIWZDUHZULWten by Tim
+XGVRQWMK#FU\SWVRIWFRP
*
*/
2ULJLQDO66/HD\/LFHQVH
----------------------&RS\ULJKW&(ULF<RXQJHD\#FU\SWVRIWFRP
* All rights reserved.
*
7KLVSDFNDJHLVDQ66/LPSOHPHQWDWLRQZULWWHQ
E\(ULF<RXQJHD\#FU\SWVRIWFRP
* The implementation was written so as to conform with
1HWVFDSHV66/
*
* This library is free for commercial and non-commercial use
as long as
* the following conditions are adhered to. The following conditions
* apply to all code found in this distribution, be it the RC4,
RSA,
OKDVK'(6HWFFRGHQRWMXVWWKH66/FRGH7KH66/GRFXmentation
* included with this distribution is covered by the same copyright terms
H[FHSWWKDWWKHKROGHULV7LP+XGVRQWMK#FU\SWVRIWFRP
*
&RS\ULJKWUHPDLQV(ULF<RXQJ
VDQGDVVXFKDQ\&RS\ULJKW
notices in
* the code are not to be removed.
,IWKLVSDFNDJHLVXVHGLQDSURGXFW(ULF<RXQJVKRXOGEH
given attribution
* as the author of the parts of the library used.
7KLV FDQ EH LQ WKH IRUP RI D WH[WXDO PHVVDJH DW SURJUDP
startup or
LQGRFXPHQWDWLRQRQOLQHRUWH[WXDOSURYLGHGZLWKWKHSDFN-
33
English
&216(48(17,$/'$0$*(625$1<'$0$*(6:+$762(9(5
5(68/7,1*)520/2662)86('$7$25352),76:+(7+(5
,1$1$&7,212)&2175$&71(*/,*(1&(2527+(57257,286$&7,21$5,6,1*2872)25,1&211(&7,21:,7+
7+(86(253(5)250$1&(2)7+,662)7:$5(
English
age.
*
* Redistribution and use in source and binary forms, with or
without
PRGL¿FDWLRQDUHSHUPLWWHGSURYLGHGWKDWWKHIROORZLQJFRQditions
DUHPHW
* 1. Redistributions of source code must retain the copyright
* notice, this list of conditions and the following disclaimer.
* 2. Redistributions in binary form must reproduce the above
copyright
* notice, this list of conditions and the following disclaimer
in the
*
documentation and/or other materials provided with the
distribution.
* 3. All advertising materials mentioning features or use of
this software
PXVWGLVSOD\WKHIROORZLQJDFNQRZOHGJHPHQW
* "This product includes cryptographic software written by
(ULF<RXQJHD\#FU\SWVRIWFRP
7KH ZRUG FU\SWRJUDSKLF
FDQ EH OHIW RXW LI WKH URXWLQHV
from the library
EHLQJXVHGDUHQRWFU\SWRJUDSKLFUHODWHG
,I\RXLQFOXGHDQ\:LQGRZVVSHFL¿FFRGHRUDGHULYDWLYH
thereof) from
* the apps directory (application code) you must include an
DFNQRZOHGJHPHQW
7KLV SURGXFW LQFOXGHV VRIWZDUH ZULWWHQ E\ 7LP +XGVRQ
WMK#FU\SWVRIWFRP
*
7+,6 62)7:$5( ,6 3529,'(' %< (5,& <281* CC$6 ,6
$1'
$1<(;35(6625,03/,(':$55$17,(6,1&/8',1*%87
127/,0,7('727+(
,03/,(':$55$17,(62)0(5&+$17$%,/,7<$1'),71(66
)25$3$57,&8/$5385326(
$5(',6&/$,0(',112(9(176+$//7+($87+2525
&2175,%87256%(/,$%/(
)25$1<',5(&7,1',5(&7,1&,'(17$/63(&,$/(;(03/$5<25&216(48(17,$/
'$0$*(6,1&/8',1*%87127/,0,7('72352&85(0(172)68%67,787(*22'6
256(59,&(6/2662)86('$7$25352),7625%86,1(66,17(55837,21
+2:(9(5 &$86(' $1' 21 $1< 7+(25< 2) /,$%,/,7<
:+(7+(5,1&2175$&7675,&7
/,$%,/,7<257257,1&/8',1*1(*/,*(1&(2527+(5:,6($5,6,1*,1$1<:$<
2872)7+(86(2)7+,662)7:$5((9(1,)$'9,6('2)
7+(3266,%,/,7<2)
68&+'$0$*(
*
* The licence and distribution terms for any publically available version or
* derivative of this code cannot be changed. i.e. this code
cannot simply be
* copied and put under another distribution licence
>LQFOXGLQJWKH*183XEOLF/LFHQFH@
*/
zlib
]OLEKLQWHUIDFHRIWKH
]OLE
JHQHUDOSXUSRVHFRPSUHVVLRQ
library
YHUVLRQ-XO\WK
&RS\ULJKW&-HDQORXS*DLOO\DQG0DUN$GOHU
7KLV VRIWZDUH LV SURYLGHG DVLV
ZLWKRXW DQ\ H[SUHVV RU
LPSOLHGZDUUDQW\,QQRHYHQWZLOOWKHDXWKRUVEHKHOGOLDEOHIRU
any damages arising from the use of this software.
Permission is granted to anyone to use this software for any
34
purpose, including commercial applications, and to alter it and
UHGLVWULEXWHLWIUHHO\VXEMHFWWRWKHIROORZLQJUHVWULFWLRQV
7KHRULJLQRIWKLVVRIWZDUHPXVWQRWEHPLVUHSUHVHQWHG\RX
PXVWQRWFODLPWKDW\RXZURWHWKHRULJLQDOVRIWZDUH,I\RXXVH
this software in a product, an acknowledgment in the product
documentation would be appreciated but is not required.
2. Altered source versions must be plainly marked as such, and
must not be misrepresented as being the original software.
3. This notice may not be removed or altered from any source
distribution.
-HDQORXS*DLOO\MORXS#J]LSRUJ
0DUN$GOHUPDGOHU#DOXPQLFDOWHFKHGX
*/
The FreeType Project LICENSE
-DQ
&RS\ULJKW E\ 'DYLG 7XUQHU 5REHUW :LOKHOP
DQG:HUQHU/HPEHUJ
,QWURGXFWLRQ
============
The FreeType Project is distributed in several archive packDJHV
some of them may contain, in addition to the FreeType font
engine,various tools and contributions which rely on, or relate
to, the FreeType Project.
7KLV OLFHQVH DSSOLHV WR DOO ¿OHV IRXQG LQ VXFK SDFNDJHV
DQG ZKLFK GR QRW IDOO XQGHU WKHLU RZQ H[SOLFLW OLFHQVH 7KH
license affects thus the FreeType font engine, the test
SURJUDPVGRFXPHQWDWLRQDQGPDNH¿OHVDWWKHYHU\OHDVW
7KLVOLFHQVHZDVLQVSLUHGE\WKH%6'$UWLVWLFDQG,-*
,QGHSHQGHQW-3(**URXSOLFHQVHVZKLFKDOOHQFRXUDJHLQFOXsion and use of free software in commercial and freeware
SURGXFWVDOLNH$VDFRQVHTXHQFHLWVPDLQSRLQWVDUHWKDW
:HGRQ
WSURPLVHWKDWWKLVVRIWZDUHZRUNV+RZHYHUZHZLOO
EHLQWHUHVWHGLQDQ\NLQGRIEXJUHSRUWVCDVLV
GLVWULEXWLRQ
<RXFDQXVHWKLVVRIWZDUHIRUZKDWHYHU\RXZDQWLQSDUWVRU
IXOOIRUPZLWKRXWKDYLQJWRSD\XVCUR\DOW\IUHH
XVDJH
<RXPD\QRWSUHWHQGWKDW\RXZURWHWKLVVRIWZDUH,I\RX
use it, or only parts of it, in a program, you must acknowledge
somewhere in your documentation that you have used the
)UHH7\SHFRGHCFUHGLWV
:HVSHFL¿FDOO\SHUPLWDQGHQFRXUDJHWKHLQFOXVLRQRIWKLV
VRIWZDUHZLWKRUZLWKRXWPRGL¿FDWLRQVLQFRPPHUFLDOSURGXFWV:HGLVFODLPDOOZDUUDQWLHVFRYHULQJ7KH)UHH7\SH3URMect and assume no liability related to The FreeType Project.
Finally, many people asked us for a preferred form for
DFUHGLWGLVFODLPHUWRXVHLQFRPSOLDQFHZLWKWKLVOLFHQVH:H
WKXVHQFRXUDJH\RXWRXVHWKHIROORZLQJWH[W
"""
3RUWLRQVRIWKLVVRIWZDUHDUHFRS\ULJKW‹\HDU!7KH)UHH7\SH
Project (www.freetype.org). All rights reserved.
"""
3OHDVH UHSODFH \HDU! ZLWK WKH YDOXH IURP WKH )UHH7\SH
version you actually use.
/HJDO7HUPV
===========
'H¿QLWLRQV
C<RX
UHIHUV WR WKH OLFHQVHH RU SHUVRQ XVLQJ WKH SURMHFW
ZKHUHCXVLQJ
LVDJHQHULFWHUPLQFOXGLQJFRPSLOLQJWKHSURMHFW
V
VRXUFH FRGH DV ZHOO DV OLQNLQJ LW WR IRUP D CSURJUDP
RU
CH[HFXWDEOH
This program is referred to as `a program using the
)UHH7\SHHQJLQH
7KLVOLFHQVHDSSOLHVWRDOO¿OHVGLVWULEXWHGLQWKHRULJLQDO
FreeType Project, including all source code, binaries and
GRFXPHQWDWLRQXQOHVVRWKHUZLVHVWDWHGLQWKH¿OHLQLWV
RULJLQDOXQPRGL¿HGIRUPDVGLVWULEXWHGLQWKHRULJLQDODUFKLYH
,I\RXDUHXQVXUHZKHWKHURUQRWDSDUWLFXODU¿OHLVFRYHUHG
by this license, you must contact us to verify this.
The FreeType Project is copyright (C) 1996-2000 by David
Turner,
5REHUW :LOKHOP DQG :HUQHU /HPEHUJ $OO ULJKWV UHVHUYHG
H[FHSWDV
VSHFL¿HGEHORZ
1R:DUUDQW\
7+( )5((7<3( 352-(&7 ,6 3529,'(' C$6 ,6
:,7+287
:$55$17<2)$1<
.,1'(,7+(5(;35(6625,03/,(',1&/8',1*%87127
/,0,7('72
:$55$17,(62)0(5&+$17$%,/,7<$1'),71(66)25
$3$57,&8/$5
385326( ,1 12 (9(17 :,// $1< 2) 7+( $87+256 25
&23<5,*+7+2/'(56
%( /,$%/( )25 $1< '$0$*(6 &$86(' %< 7+( 86( 25
7+(,1$%,/,7<72
86(2)7+()5((7<3(352-(&7
2. Redistribution
This license grants a worldwide, royalty-free, perpetual
DQG LUUHYRFDEOH ULJKW DQG OLFHQVH WR XVH H[HFXWH SHUIRUP
compile,display, copy, create derivative works of, distribute
and sublicense the FreeType Project (in both source and object
FRGHIRUPVDQGGHULYDWLYHZRUNVWKHUHRIIRUDQ\SXUSRVH
DQGWRDXWKRUL]HRWKHUVWRH[HUFLVHVRPHRUDOORIWKHULJKWV
JUDQWHGKHUHLQVXEMHFWWRWKHIROORZLQJFRQGLWLRQV
Redistribution of source code must retain this license
¿OH C)7/7;7
XQDOWHUHG DQ\ DGGLWLRQV GHOHWLRQV RU
FKDQJHV WR WKH RULJLQDO ¿OHV PXVW EH FOHDUO\ LQGLFDWHG LQ
accompanying documentation. The copyright notices of the
XQDOWHUHGRULJLQDO ¿OHV PXVW EH SUHVHUYHG LQ DOO FRSLHV RI
VRXUFH¿OHV
Redistribution in binary form must provide a disclaimer that
states that the software is based in part of the work of the
)UHH7\SH7HDPLQWKHGLVWULEXWLRQGRFXPHQWDWLRQ:HDOVR
HQFRXUDJH\RXWRSXWDQ85/WRWKH)UHH7\SHZHESDJHLQ\RXU
GRFXPHQWDWLRQWKRXJKWKLVLVQ
WPDQGDWRU\
These conditions apply to any software derived from or
EDVHGRQWKH)UHH7\SH3URMHFWQRWMXVWWKHXQPRGL¿HG¿OHV
,I\RXXVHRXUZRUN\RXPXVWDFNQRZOHGJHXV+RZHYHUQR
fee need be paid to us.
3. Advertising
1HLWKHUWKH)UHH7\SHDXWKRUVDQGFRQWULEXWRUVQRU\RXVKDOO
use the name of the other for commercial, advertising, or
SURPRWLRQDOSXUSRVHVZLWKRXWVSHFL¿FSULRUZULWWHQSHUPLVVLRQ
more of the following phrases to refer to this software in
\RXU GRFXPHQWDWLRQ RU DGYHUWLVLQJ PDWHULDOV C)UHH7\SH
3URMHFW
C)UHH7\SH (QJLQH
C)UHH7\SH OLEUDU\
RU C)UHH7\SH
'LVWULEXWLRQ
As you have not signed this license, you are not required to
DFFHSWLW+RZHYHUDVWKH)UHH7\SH3URMHFWLVFRS\ULJKWHG
material, only this license, or another one contracted with the
authors, grants you the right to use, distribute, and modify it.
Therefore, by using, distributing, or modifying the FreeType
Project, you indicate that you understand and accept all the
terms of this license.
4. Contacts
7KHUHDUHWZRPDLOLQJOLVWVUHODWHGWR)UHH7\SH
IUHHW\SH#QRQJQXRUJ
Discusses general use and applications of FreeType, as well
as future and wanted additions to the library and distribution.
,I\RXDUHORRNLQJIRUVXSSRUWVWDUWLQWKLVOLVWLI\RX
KDYHQ
WIRXQGDQ\WKLQJWRKHOS\RXLQWKHGRFXPHQWDWLRQ
IUHHW\SHGHYHO#QRQJQXRUJ
Discusses bugs, as well as engine internals,
LVVXHVVSHFL¿FOLFHQVHVSRUWLQJHWF
design
Our home page can be found at
KWWSZZZIUHHW\SHRUJ
([SDW
Copyright (c) 1998, 1999, 2000 Thai Open Source Software
&HQWHU/WGDQG&ODUN&RRSHU
&RS\ULJKW F ([SDW
maintainers.
Permission is hereby granted, free of charge, to any person
obtaining a copy of this software and associated documentation
¿OHVWKH6RIWZDUHWRGHDOLQWKH6RIWZDUHZLWKRXWUHVWULFWLRQ
including without limitation the rights to use, copy, modify,
merge, publish, distribute, sublicense, and/or sell copies of
the Software, and to permit persons to whom the Software is
IXUQLVKHGWRGRVRVXEMHFWWRWKHIROORZLQJFRQGLWLRQV
The above copyright notice and this permission notice shall be
included in all copies or substantial portions of the Software.
7+(62)7:$5(,63529,'('$6,6:,7+287:$55$17<
2)$1<.,1'
(;35(6625,03/,(',1&/8',1*%87127/,0,7('727+(
:$55$17,(62)
0(5&+$17$%,/,7< ),71(66 )25 $ 3$57,&8/$5 385326(
$1'121,1)5,1*(0(17
,112(9(176+$//7+($87+25625&23<5,*+7+2/'(56
%(/,$%/()25$1<
&/$,0 '$0$*(6 25 27+(5 /,$%,/,7< :+(7+(5 ,1 $1
$&7,212)&2175$&7
7257 25 27+(5:,6( $5,6,1* )520 287 2) 25 ,1
&211(&7,21:,7+7+(
62)7:$5( 25 7+( 86( 25 27+(5 '($/,1*6 ,1 7+(
62)7:$5(
Curl
&23<5,*+7$1'3(50,66,21127,&(
&RS\ULJKW F 'DQLHO 6WHQEHUJ GDQLHO#KD[[
VH!
:H VXJJHVW EXW GR QRW UHTXLUH WKDW \RX XVH RQH RU
35
English
7KURXJKRXWWKLVOLFHQVHWKHWHUPVCSDFNDJH
C)UHH7\SH3URMHFW
DQGC)UHH7\SHDUFKLYH
UHIHUWRWKHVHWRI¿OHVRULJLQDOO\
GLVWULEXWHG E\ WKH DXWKRUV 'DYLG 7XUQHU 5REHUW :LOKHOP
DQG:HUQHU/HPEHUJDVWKHC)UHH7\SH3URMHFW
EHWKH\QDPHG
DVDOSKDEHWDRU¿QDOUHOHDVH
All rights reserved.
English
Permission to use, copy, modify, and distribute this software for
any purpose with or without fee is hereby granted, provided
that the above copyright notice and this permission notice appear in all copies.
7+(62)7:$5(,63529,'('$6,6:,7+287:$55$17<
2)$1<.,1'(;35(6625
,03/,(' ,1&/8',1* %87 127 /,0,7(' 72 7+( :$55$17,(62)0(5&+$17$%,/,7<
),71(66 )25 $ 3$57,&8/$5 385326( $1' 121,1)5,1*(0(172)7+,5'3$57<5,*+76,1
12(9(176+$//7+($87+25625&23<5,*+7+2/'(56%(
/,$%/()25$1<&/$,0
'$0$*(62527+(5/,$%,/,7<:+(7+(5,1$1$&7,212)
&2175$&7725725
27+(5:,6( $5,6,1* )520 287 2) 25 ,1 &211(&7,21
:,7+7+(62)7:$5(257+(86(2527+(5'($/,1*6,1
7+(62)7:$5(
([FHSW DV FRQWDLQHG LQ WKLV QRWLFH WKH QDPH RI D FRS\ULJKW
holder shall not
be used in advertising or otherwise to promote the sale, use
or other dealings
in this Software without prior written authorization of the
copyright holder.
IJG
:HGRQ
WSURPLVHWKDWWKLVVRIWZDUHZRUNV%XWLI\RX¿QG
DQ\EXJVSOHDVHOHWXVNQRZ
<RXFDQXVHWKLVVRIWZDUHIRUZKDWHYHU\RXZDQW<RXGRQ
W
have to pay us.
<RXPD\QRWSUHWHQGWKDW\RXZURWHWKLVVRIWZDUH,I\RX
use it in a program, you must acknowledge somewhere in your
GRFXPHQWDWLRQWKDW\RX
YHXVHGWKH,-*FRGH
,QOHJDOHVH
7KH DXWKRUV PDNH 12 :$55$17< RU UHSUHVHQWDWLRQ HLWKHU
H[SUHVV RU LPSOLHGZLWK UHVSHFW WR WKLV VRIWZDUH LWV TXDOLW\
DFFXUDF\ PHUFKDQWDELOLW\ RU ¿WQHVV IRU D SDUWLFXODU SXUSRVH
7KLVVRIWZDUHLVSURYLGHG$6,6DQG\RXLWVXVHUDVVXPHWKH
entire risk as to its quality and accuracy.
7KLVVRIWZDUHLVFRS\ULJKW&7KRPDV*/DQH
$OO5LJKWV5HVHUYHGH[FHSWDVVSHFL¿HGEHORZ
Permission is hereby granted to use, copy, modify, and distribute
this software (or portions thereof) for any purpose, without fee,
VXEMHFWWRWKHVHFRQGLWLRQV
,IDQ\SDUWRIWKHVRXUFHFRGHIRUWKLVVRIWZDUHLVGLVWULEXWHG
WKHQWKLV5($'0(¿OHPXVWEHLQFOXGHGZLWKWKLVFRS\ULJKWDQG
QRZDUUDQW\ QRWLFH XQDOWHUHG DQG DQ\ DGGLWLRQV GHOHWLRQV
RU FKDQJHV WR WKH RULJLQDO ¿OHV PXVW EH FOHDUO\ LQGLFDWHG LQ
accompanying documentation.
,IRQO\H[HFXWDEOHFRGHLVGLVWULEXWHGWKHQWKHDFFRPSDQ\LQJ
documentation must state that "this software is based in part
RQWKHZRUNRIWKH,QGHSHQGHQW-3(**URXS
(3) Permission for use of this software is granted only if the user
DFFHSWV IXOO UHVSRQVLELOLW\ IRU DQ\ XQGHVLUDEOH FRQVHTXHQFHV
WKHDXWKRUVDFFHSW12/,$%,/,7<IRUGDPDJHVRIDQ\NLQG
These conditions apply to any software derived from or based
RQWKH,-*FRGHQRWMXVWWRWKHXQPRGL¿HGOLEUDU\,I\RXXVH
our work, you ought to acknowledge us.
3HUPLVVLRQLV127JUDQWHGIRUWKHXVHRIDQ\,-*DXWKRU
VQDPH
or company name in advertising or publicity relating to this
software or products derived from it. This software may be
UHIHUUHGWRRQO\DVWKH,QGHSHQGHQW-3(**URXS
V
software".
:HVSHFL¿FDOO\SHUPLWDQGHQFRXUDJHWKHXVHRIWKLVVRIWZDUH
36
as the basis of commercial products, provided that all warranty
or liability claims are assumed by the product vendor.
DQVLNQUF LV LQFOXGHG LQ WKLV GLVWULEXWLRQ E\ SHUPLVVLRQ RI /
Peter Deutsch, sole proprietor of its copyright holder, Aladdin
(QWHUSULVHV RI 0HQOR 3DUN &$ DQVLNQUF LV 127 FRYHUHG
by the above copyright and conditions, but instead by the
XVXDO GLVWULEXWLRQ WHUPV RI WKH )UHH 6RIWZDUH )RXQGDWLRQ
principally,that you must include source code if you redistribute
LW 6HH WKH ¿OH DQVLNQUF IRU IXOO GHWDLOV +RZHYHU VLQFH
ansi2knr.c is not needed as part of any program generated
IURP WKH ,-* FRGH WKLV GRHV QRW OLPLW \RX PRUH WKDQ WKH
foregoing paragraphs do.
7KH 8QL[ FRQ¿JXUDWLRQ VFULSW FRQ¿JXUH ZDV SURGXFHG ZLWK
*18$XWRFRQI
,W LV FRS\ULJKW E\ WKH )UHH 6RIWZDUH )RXQGDWLRQ EXW LV IUHHO\
distributable.
7KHVDPHKROGVIRULWVVXSSRUWLQJVFULSWVFRQ¿JJXHVVFRQ¿J
VXEOWFRQ¿J OWPDLQVK $QRWKHU VXSSRUW VFULSW LQVWDOOVK LV
copyright
E\0,7EXWLVDOVRIUHHO\GLVWULEXWDEOH
,WDSSHDUVWKDWWKHDULWKPHWLFFRGLQJRSWLRQRIWKH-3(*VSHFLV
FRYHUHGE\SDWHQWVRZQHGE\,%0$77DQG0LWVXELVKL+HQFH
arithmetic coding cannot legally be used without obtaining one
or more licenses. For this reason,support for arithmetic coding
KDVEHHQUHPRYHGIURPWKHIUHH-3(*VRIWZDUH
(Since arithmetic coding provides only a marginal gain over
WKH XQSDWHQWHG +XIIPDQ PRGH LW LV XQOLNHO\ WKDW YHU\ PDQ\
implementations will support it.)
So far as we are aware, there are no patent restrictions on the
remaining code.
7KH,-*GLVWULEXWLRQIRUPHUO\LQFOXGHGFRGHWRUHDGDQGZULWH
*,)¿OHV
7R DYRLG HQWDQJOHPHQW ZLWK WKH 8QLV\V /=: SDWHQW *,)
reading support has
EHHQUHPRYHGDOWRJHWKHUDQGWKH*,)ZULWHUKDVEHHQVLPSOL¿HG
WRSURGXFHXQFRPSUHVVHG*,)V7KLVWHFKQLTXHGRHVQRWXVH
WKH/=:DOJRULWKPWKHUHVXOWLQJ*,)¿OHVDUHODUJHUWKDQXVXDO
EXWDUHUHDGDEOHE\DOOVWDQGDUG*,)GHFRGHUV
:H DUH UHTXLUHG WR VWDWH WKDW 7KH *UDSKLFV ,QWHUFKDQJH
Format(c) is the Copyright property of CompuServe
,QFRUSRUDWHG *,)VP LV D 6HUYLFH 0DUN SURSHUW\ RI
&RPSX6HUYH,QFRUSRUDWHG
CharisSIL OFL
6,/23(1)217/,&(16(9HUVLRQ)HEUXDU\
35($0%/(
7KH JRDOV RI WKH 2SHQ )RQW /LFHQVH 2)/ DUH WR VWLPXODWH
worldwide development of collaborative font projects, to
support the font creation efforts of academic and linguistic
communities, and to provide a free and open framework in
which fonts may be shared and improved in partnership with
others.
7KH 2)/ DOORZV WKH OLFHQVHG IRQWV WR EH XVHG VWXGLHG
PRGL¿HGDQGUHGLVWULEXWHGIUHHO\DVORQJDVWKH\DUHQRWVROG
by themselves. The fonts, including any derivative works, can
be bundled, embedded, redistributed and/or sold with any
software provided that any reserved names are not used by
derivative works. The fonts and derivatives,however, cannot
be released under any other type of license. The requirement
for fonts to remain under this license does not apply to any
document created using the fonts or their derivatives.
'(),1,7,216
)RQW6RIWZDUHUHIHUVWRWKHVHWRI¿OHVUHOHDVHGE\WKH&RS\ULJKW
5HVHUYHG)RQW1DPHUHIHUVWRDQ\QDPHVVSHFL¿HGDVVXFKDIWHU
the copyright statement(s).
Original Version refers to the collection of Font Software compoQHQWVDVGLVWULEXWHGE\WKH&RS\ULJKW+ROGHUV
0RGL¿HG 9HUVLRQ UHIHUV WR DQ\ GHULYDWLYH PDGH E\ DGGLQJ WR
deleting,or substituting -- in part or in whole -- any of the components of the Original Version, by changing formats or by porting the Font Software to a new environment.
Author refers to any designer, engineer, programmer, technical
writer or other person who contributed to the Font Software.
3(50,66,21&21',7,216
Permission is hereby granted, free of charge, to any person
obtaining a copy of the Font Software, to use, study, copy,
PHUJH HPEHG PRGLI\ UHGLVWULEXWH DQG VHOO PRGL¿HG DQG
XQPRGL¿HGFRSLHVRIWKH)RQW6RIWZDUHVXEMHFWWRWKHIROORZLQJ
FRQGLWLRQV
1HLWKHU WKH )RQW 6RIWZDUH QRU DQ\ RI LWV LQGLYLGXDO
FRPSRQHQWVLQ 2ULJLQDO RU 0RGL¿HG 9HUVLRQV PD\ EH VROG E\
itself.
2ULJLQDO RU 0RGL¿HG 9HUVLRQV RI WKH )RQW 6RIWZDUH PD\ EH
bundled,redistributed and/or sold with any software, provided
that each copy contains the above copyright notice and this
OLFHQVH 7KHVH FDQ EH LQFOXGHG HLWKHU DV VWDQGDORQH WH[W
¿OHVKXPDQUHDGDEOHKHDGHUVRULQWKHDSSURSULDWHPDFKLQH
UHDGDEOHPHWDGDWD¿HOGVZLWKLQWH[WRUELQDU\¿OHVDVORQJDV
WKRVH¿HOGVFDQEHHDVLO\YLHZHGE\WKHXVHU
1R 0RGL¿HG 9HUVLRQ RI WKH )RQW 6RIWZDUH PD\ XVH WKH
5HVHUYHG )RQW 1DPHV XQOHVV H[SOLFLW ZULWWHQ SHUPLVVLRQ LV
JUDQWHGE\WKHFRUUHVSRQGLQJ&RS\ULJKW+ROGHU7KLVUHVWULFWLRQ
only applies to the primary font name as presented to the
users.
7KH QDPHV RI WKH &RS\ULJKW +ROGHUV RU WKH $XWKRUV
of the Font Software shall not be used to promote, endorse
RUDGYHUWLVHDQ\0RGL¿HG9HUVLRQH[FHSWWRDFNQRZOHGJHWKH
FRQWULEXWLRQVRIWKH&RS\ULJKW+ROGHUVDQGWKH$XWKRUVRU
ZLWKWKHLUH[SOLFLWZULWWHQSHUPLVVLRQ
7KH )RQW 6RIWZDUH PRGL¿HG RU XQPRGL¿HG LQ SDUW RU LQ
whole,must be distributed entirely under this license, and must
not be distributed under any other license. The requirement
for fonts to remain under this license does not apply to any
document created using the Font Software.
7(50,1$7,21
This license becomes null and void if any of the above conditions
are not met.
',6&/$,0(5
7+( )217 62)7:$5( ,6 3529,'(' $6 ,6 :,7+287
:$55$17< 2) $1< .,1'(;35(66 25 ,03/,('
,1&/8',1* %87 127 /,0,7(' 72 $1< :$55$17,(6 2)
0(5&+$17$%,/,7< ),71(66 )25 $ 3$57,&8/$5 385326(
$1' 121,1)5,1*(0(17 2) &23<5,*+7 3$7(17
75$'(0$5. 25 27+(5 5,*+7 ,1 12 (9(17 6+$// 7+(
&23<5,*+7 +2/'(5 %( /,$%/( )25 $1< &/$,0 '$0$*(6
25 27+(5 /,$%,/,7<,1&/8',1* $1< *(1(5$/ 63(&,$/
,1',5(&7,1&,'(17$/25&216(48(17,$/
'$0$*(6:+(7+(5,1$1$&7,212)&2175$&7725725
27+(5:,6($5,6,1*)5202872)7+(86(25,1$%,/,7<
7286(7+()21762)7:$5(25)52027+(5'($/,1*6,1
7+()21762)7:$5(
&RS\ULJKWE\WKH0DVVDFKXVHWWV,QVWLWXWHRI7HFKQRORJ\
Permission to use, copy, modify, and distribute this software
and its documentation for any purpose and without fee is
hereby granted, provided that
the above copyright notice appear in all copies and that both
that copyright notice and this permission notice appear in
VXSSRUWLQJGRFXPHQWDWLRQDQGWKDWWKHQDPHRI0,7QRWEH
used in advertising or publicity pertaining to distribution of the
VRIWZDUHZLWKRXWVSHFL¿FZULWWHQSULRUSHUPLVVLRQ
0,7 PDNHV QR UHSUHVHQWDWLRQV DERXW WKH VXLWDELOLW\ RI WKLV
VRIWZDUHIRUDQ\SXUSRVH,WLVSURYLGHGDVLVZLWKRXWH[SUHVV
or implied warranty.
JFFH[FHSWLRQ
*&& 5817,0( /,%5$5< (;&(37,21 9HUVLRQ 0DUFK
&RS\ULJKW & )UHH 6RIWZDUH )RXQGDWLRQ ,QF
KWWSIVIRUJ!(YHU\RQHLVSHUPLWWHGWRFRS\DQGGLVWULEXWH
verbatim copies of this license document, but changing it is not
DOORZHG 7KLV *&& 5XQWLPH /LEUDU\ ([FHSWLRQ ([FHSWLRQ LV
DQ DGGLWLRQDO SHUPLVVLRQ XQGHU VHFWLRQ RI WKH *18 *HQHUDO
3XEOLF /LFHQVH YHUVLRQ *3/Y ,W DSSOLHV WR D JLYHQ ¿OH
WKH 5XQWLPH /LEUDU\ WKDW EHDUV D QRWLFH SODFHG E\ WKH
FRS\ULJKWKROGHURIWKH¿OHVWDWLQJWKDWWKH¿OHLVJRYHUQHGE\
*3/YDORQJZLWKWKLV([FHSWLRQ
:KHQ\RXXVH*&&WRFRPSLOHDSURJUDP*&&PD\FRPELQH
SRUWLRQVRIFHUWDLQ*&& KHDGHU ¿OHV DQG UXQWLPH OLEUDULHV ZLWK
WKHFRPSLOHGSURJUDP7KHSXUSRVHRIWKLV([FHSWLRQLVWRDOORZ
FRPSLODWLRQRIQRQ*3/LQFOXGLQJSURSULHWDU\SURJUDPVWRXVH
LQ WKLV ZD\ WKH KHDGHU ¿OHV DQG UXQWLPH OLEUDULHV FRYHUHG E\
WKLV([FHSWLRQ'H¿QLWLRQV$¿OHLVDQ,QGHSHQGHQW0RGXOH
LI LW HLWKHU UHTXLUHV WKH 5XQWLPH /LEUDU\ IRU H[HFXWLRQ DIWHU D
Compilation Process, or makes use of an interface provided
E\ WKH 5XQWLPH /LEUDU\ EXW LV QRW RWKHUZLVH EDVHG RQ WKH
5XQWLPH/LEUDU\*&&PHDQVDYHUVLRQRIWKH*18&RPSLOHU
&ROOHFWLRQZLWKRUZLWKRXWPRGL¿FDWLRQVJRYHUQHGE\YHUVLRQ
RU D VSHFL¿HG ODWHU YHUVLRQ RI WKH *18 *HQHUDO 3XEOLF
/LFHQVH*3/ZLWKWKHRSWLRQRIXVLQJDQ\VXEVHTXHQWYHUVLRQV
SXEOLVKHG E\ WKH )6) *3/FRPSDWLEOH 6RIWZDUH LV VRIWZDUH
ZKRVHFRQGLWLRQVRISURSDJDWLRQPRGL¿FDWLRQDQGXVHZRXOG
permit combination with GCC in accord with the license of GCC.
"Target Code" refers to output from any compiler for a real
RU YLUWXDOWDUJHW SURFHVVRU DUFKLWHFWXUH LQ H[HFXWDEOH IRUP RU
VXLWDEOHIRULQSXWWRDQDVVHPEOHUORDGHUOLQNHUDQGRUH[HFXWLRQ
SKDVH 1RWZLWKVWDQGLQJ WKDW 7DUJHW &RGH GRHV QRW LQFOXGH
data in any format that is used as a compiler intermediate
representation, or used for producing a compiler intermediate
representation. The "Compilation Process" transforms code
entirely represented in non-intermediate languages designed
IRU KXPDQZULWWHQ FRGH DQGRU LQ -DYD 9LUWXDO 0DFKLQH E\WH
FRGHLQWR7DUJHW&RGH7KXVIRUH[DPSOHXVHRIVRXUFHFRGH
generators and preprocessors need not be considered part of
the Compilation Process, since the Compilation Process can be
understood as starting with the output of the generators or
preprocessors. A Compilation Process is "Eligible" if it is done
XVLQJ*&&DORQHRUZLWKRWKHU*3/FRPSDWLEOHVRIWZDUHRULI
LWLVGRQHZLWKRXWXVLQJDQ\ZRUNEDVHGRQ*&&)RUH[DPSOH
XVLQJ QRQ*3/FRPSDWLEOH 6RIWZDUH WR RSWLPL]H DQ\ *&&
intermediate representations would not qualify as an Eligible
Compilation Process.
*UDQW RI $GGLWLRQDO 3HUPLVVLRQ <RX KDYH SHUPLVVLRQ WR
propagate a work of Target Code formed by combining
WKH 5XQWLPH /LEUDU\ ZLWK ,QGHSHQGHQW 0RGXOHV HYHQ LI
such propagation would otherwise violate the terms of
*3/Y SURYLGHG WKDW DOO 7DUJHW &RGH ZDV JHQHUDWHG E\
(OLJLEOH &RPSLODWLRQ 3URFHVVHV <RX PD\ WKHQ FRQYH\ VXFK D
combination under terms of your choice, consistent with the
OLFHQVLQJRIWKH,QGHSHQGHQW0RGXOHV
1R:HDNHQLQJRI*&&&RS\OHIW
7KHDYDLODELOLW\RIWKLV([FHSWLRQGRHVQRWLPSO\DQ\JHQHUDO
presumption that third-party software is unaffected by the
copyleft requirements of the license of GCC.
c-ares
37
English
+ROGHUV XQGHU WKLV OLFHQVH DQG FOHDUO\ PDUNHG DV VXFK 7KLV
PD\LQFOXGHVRXUFH¿OHVEXLOGVFULSWVDQGGRFXPHQWDWLRQ
GPLv2
*18*(1(5$/38%/,&/,&(16(
9HUVLRQ-XQH 1991
English
&RS\ULJKW&)UHH6RIWZDUH)RXQGDWLRQ,QF
)UDQNOLQ6WUHHW)LIWK)ORRU%RVWRQ0$86$
Everyone is permitted to copy and distribute verbatim copies
of this license document, but changing it is not allowed.
Preamble
The licenses for most software are designed to take away
\RXU IUHHGRP WR VKDUH DQG FKDQJH LW %\ FRQWUDVW WKH *18
*HQHUDO3XEOLF/LFHQVHLVLQWHQGHGWRJXDUDQWHH\RXUIUHHGRP
to share and change free software--to make sure the software
LVIUHHIRUDOOLWVXVHUV7KLV*HQHUDO3XEOLF/LFHQVHDSSOLHVWR
PRVW RI WKH )UHH 6RIWZDUH )RXQGDWLRQ
V VRIWZDUH DQG WR DQ\
other program whose authors commit to using it. (Some other
)UHH 6RIWZDUH )RXQGDWLRQ VRIWZDUH LV FRYHUHG E\ WKH *18
/HVVHU *HQHUDO 3XEOLF /LFHQVH LQVWHDG <RX FDQ DSSO\ LW WR
your programs, too.
:KHQZHVSHDNRIIUHHVRIWZDUHZHDUHUHIHUULQJWRIUHHGRP
QRWSULFH2XU*HQHUDO3XEOLF/LFHQVHVDUHGHVLJQHGWRPDNH
sure that you have the freedom to distribute copies of free
software (and charge for this service if you wish), that you
receive source code or can get it if you want it, that you can
FKDQJHWKHVRIWZDUHRUXVHSLHFHVRILWLQQHZIUHHSURJUDPV
and that you know you can do these things.
To protect your rights, we need to make restrictions that forbid
anyone to deny you these rights or to ask you to surrender
the rights.
These restrictions translate to certain responsibilities for you if
you distribute copies of the software, or if you modify it.
)RU H[DPSOH LI \RX GLVWULEXWH FRSLHV RI VXFK D SURJUDP
whether gratis or for a fee, you must give the recipients all
WKHULJKWVWKDW\RXKDYH<RXPXVWPDNHVXUHWKDWWKH\WRR
receive or can get the source code. And you must show them
these terms so they know their rights.
:H SURWHFW \RXU ULJKWV ZLWK WZR VWHSV FRS\ULJKW WKH
software, and (2) offer you this license which gives you legal
permission to copy, distribute and/or modify the software.
$OVRIRUHDFKDXWKRU
VSURWHFWLRQDQGRXUVZHZDQWWRPDNH
certain that everyone understands that there is no warranty for
WKLVIUHHVRIWZDUH,IWKHVRIWZDUHLVPRGL¿HGE\VRPHRQHHOVH
and passed on, we want its recipients to know that what they
have is not the original, so that any problems introduced by
RWKHUVZLOOQRWUHÀHFWRQWKHRULJLQDODXWKRUV
UHSXWDWLRQV
Finally, any free program is threatened constantly by software
SDWHQWV:HZLVKWRDYRLGWKHGDQJHUWKDWUHGLVWULEXWRUVRID
free program will individually obtain patent licenses, in effect
making the program proprietary. To prevent this, we have
PDGHLWFOHDUWKDWDQ\SDWHQWPXVWEHOLFHQVHGIRUHYHU\RQH
V
free use or not licensed at all.
The precise terms and conditions for copying, distribution and
PRGL¿FDWLRQIROORZ
*18*(1(5$/38%/,&/,&(16(
7(506 $1' &21',7,216 )25 &23<,1* ',675,%87,21
$1'02',),&$7,21
7KLV/LFHQVHDSSOLHVWRDQ\SURJUDPRURWKHUZRUNZKLFK
contains a notice placed by the copyright holder saying it may
EHGLVWULEXWHGXQGHUWKHWHUPVRIWKLV*HQHUDO3XEOLF/LFHQVH
The "Program", below, refers to any such program or work,
and a "work based on the Program" means either the Program
RU DQ\ GHULYDWLYH ZRUN XQGHU FRS\ULJKW ODZ WKDW LV WR VD\ D
work containing the Program or a portion of it, either verbatim
RUZLWKPRGL¿FDWLRQVDQGRUWUDQVODWHGLQWRDQRWKHUODQJXDJH
+HUHLQDIWHU WUDQVODWLRQ LV LQFOXGHG ZLWKRXW OLPLWDWLRQ LQ WKH
WHUPPRGL¿FDWLRQ(DFKOLFHQVHHLVDGGUHVVHGDV\RX
$FWLYLWLHVRWKHUWKDQFRS\LQJGLVWULEXWLRQDQGPRGL¿FDWLRQDUH
QRWFRYHUHGE\WKLV/LFHQVHWKH\DUHRXWVLGHLWVVFRSH7KHDFW
of running the Program is not restricted, and the output from
the Program is covered only if its contents constitute a work
based on the Program (independent of having been made by
UXQQLQJWKH3URJUDP:KHWKHUWKDWLVWUXHGHSHQGVRQZKDW
the Program does.
<RXPD\FRS\DQGGLVWULEXWHYHUEDWLPFRSLHVRIWKH3URJUDP
V
source code as you receive it, in any medium, provided that
you conspicuously and appropriately publish on each copy
DQ DSSURSULDWH FRS\ULJKW QRWLFH DQG GLVFODLPHU RI ZDUUDQW\
NHHSLQWDFWDOOWKHQRWLFHVWKDWUHIHUWRWKLV/LFHQVHDQGWRWKH
DEVHQFHRIDQ\ZDUUDQW\DQGJLYHDQ\RWKHUUHFLSLHQWVRIWKH
3URJUDPDFRS\RIWKLV/LFHQVHDORQJZLWKWKH3URJUDP
<RX PD\ FKDUJH D IHH IRU WKH SK\VLFDO DFW RI WUDQVIHUULQJ D
copy, and you may at your option offer warranty protection in
H[FKDQJHIRUDIHH
<RX PD\ PRGLI\ \RXU FRS\ RU FRSLHV RI WKH 3URJUDP RU
any portion of it, thus forming a work based on the Program,
DQGFRS\DQGGLVWULEXWHVXFKPRGL¿FDWLRQVRUZRUNXQGHUWKH
terms of Section 1 above, provided that you also meet all of
WKHVHFRQGLWLRQV
D <RX PXVW FDXVH WKH PRGL¿HG ¿OHV WR FDUU\ SURPLQHQW
QRWLFHVVWDWLQJWKDW\RXFKDQJHGWKH¿OHVDQGWKHGDWHRIDQ\
change.
E<RXPXVWFDXVHDQ\ZRUNWKDW\RXGLVWULEXWHRUSXEOLVK
that in whole or in part contains or is derived from the Program
or any part thereof, to be licensed as a whole at no charge to
DOOWKLUGSDUWLHVXQGHUWKHWHUPVRIWKLV/LFHQVH
F ,I WKH PRGL¿HG SURJUDP QRUPDOO\ UHDGV FRPPDQGV
interactively when run, you must cause it, when started running
for such interactive use in the most ordinary way, to print or
display an announcement including an appropriate copyright
notice and a notice that there is no warranty (or else, saying
that you provide a warranty) and that users may redistribute
the program under these conditions, and telling the user how to
YLHZDFRS\RIWKLV/LFHQVH([FHSWLRQLIWKH3URJUDPLWVHOILV
interactive but does not normally print such an announcement,
your work based on the Program is not required to print an
announcement.)
7KHVHUHTXLUHPHQWVDSSO\WRWKHPRGL¿HGZRUNDVDZKROH,I
LGHQWL¿DEOH VHFWLRQV RI WKDW ZRUN DUH QRW GHULYHG IURP WKH
Program, and can be reasonably considered independent and
VHSDUDWHZRUNVLQWKHPVHOYHVWKHQWKLV/LFHQVHDQGLWVWHUPV
do not apply to those sections when you distribute them as
separate works. But when you distribute the same sections
as part of a whole which is a work based on the Program,
the distribution of the whole must be on the terms of this
/LFHQVH ZKRVH SHUPLVVLRQV IRU RWKHU OLFHQVHHV H[WHQG WR WKH
entire whole, and thus to each and every part regardless of
who wrote it.
Thus, it is not the intent of this section to claim rights or contest
\RXUULJKWVWRZRUNZULWWHQHQWLUHO\E\\RXUDWKHUWKHLQWHQWLV
WRH[HUFLVHWKHULJKWWRFRQWUROWKHGLVWULEXWLRQRIGHULYDWLYHRU
collective works based on the Program.
,Q DGGLWLRQ PHUH DJJUHJDWLRQ RI DQRWKHU ZRUN QRW EDVHG RQ
the Program with the Program (or with a work based on the
Program) on a volume of a storage or distribution medium does
QRWEULQJWKHRWKHUZRUNXQGHUWKHVFRSHRIWKLV/LFHQVH
<RXPD\FRS\DQGGLVWULEXWHWKH3URJUDPRUDZRUNEDVHG
RQLWXQGHU6HFWLRQLQREMHFWFRGHRUH[HFXWDEOHIRUPXQGHU
the terms of Sections 1 and 2 above provided that you also do
RQHRIWKHIROORZLQJ
a) Accompany it with the complete corresponding machine-
38
Program by all those who receive copies directly or indirectly
through you, then the only way you could satisfy both it and
WKLV /LFHQVH ZRXOG EH WR UHIUDLQ HQWLUHO\ IURP GLVWULEXWLRQ RI
the Program.
b) Accompany it with a written offer, valid for at least three
years, to give any third party, for a charge no more than your
cost of physically performing source distribution, a complete
machine-readable copy of the corresponding source code, to
be distributed under the terms of Sections 1 and 2 above on a
PHGLXPFXVWRPDULO\XVHGIRUVRIWZDUHLQWHUFKDQJHRU
,I DQ\ SRUWLRQ RI WKLV VHFWLRQ LV KHOG LQYDOLG RU XQHQIRUFHDEOH
under any particular circumstance, the balance of the section
is intended to apply and the section as a whole is intended to
apply in other circumstances.
,WLVQRWWKHSXUSRVHRIWKLVVHFWLRQWRLQGXFH\RXWRLQIULQJHDQ\
patents or other property right claims or to contest validity of
DQ\VXFKFODLPVWKLVVHFWLRQKDVWKHVROHSXUSRVHRISURWHFWLQJ
the integrity of the free software distribution system, which is
LPSOHPHQWHG E\ SXEOLF OLFHQVH SUDFWLFHV 0DQ\ SHRSOH KDYH
made generous contributions to the wide range of software
distributed through that system in reliance on consistent
DSSOLFDWLRQ RI WKDW V\VWHP LW LV XS WR WKH DXWKRUGRQRU WR
decide if he or she is willing to distribute software through any
other system and a licensee cannot impose that choice.
c) Accompany it with the information you received as to the
offer to distribute corresponding source code. (This alternative
is allowed only for noncommercial distribution and only if you
UHFHLYHGWKHSURJUDPLQREMHFWFRGHRUH[HFXWDEOHIRUPZLWK
such an offer, in accord with Subsection b above.)
The source code for a work means the preferred form of the
ZRUNIRUPDNLQJPRGL¿FDWLRQVWRLW)RUDQH[HFXWDEOHZRUN
complete source code means all the source code for all modules
LW FRQWDLQV SOXV DQ\ DVVRFLDWHG LQWHUIDFH GH¿QLWLRQ ¿OHV SOXV
the scripts used to control compilation and installation of
WKH H[HFXWDEOH +RZHYHU DV D VSHFLDO H[FHSWLRQ WKH VRXUFH
code distributed need not include anything that is normally
distributed (in either source or binary form) with the major
components (compiler, kernel, and so on) of the operating
V\VWHPRQZKLFKWKHH[HFXWDEOHUXQVXQOHVVWKDWFRPSRQHQW
LWVHOIDFFRPSDQLHVWKHH[HFXWDEOH
,IGLVWULEXWLRQRIH[HFXWDEOHRUREMHFWFRGHLVPDGHE\RIIHULQJ
access to copy from a designated place, then offering equivalent
access to copy the source code from the same place counts as
distribution of the source code, even though third parties are
not compelled to copy the source along with the object code.
<RX PD\ QRW FRS\ PRGLI\ VXEOLFHQVH RU GLVWULEXWH WKH
3URJUDPH[FHSWDVH[SUHVVO\SURYLGHGXQGHUWKLV/LFHQVH$Q\
attempt otherwise to copy, modify, sublicense or distribute
the Program is void, and will automatically terminate your
ULJKWVXQGHUWKLV/LFHQVH+RZHYHUSDUWLHVZKRKDYHUHFHLYHG
FRSLHV RU ULJKWV IURP \RX XQGHU WKLV /LFHQVH ZLOO QRW KDYH
their licenses terminated so long as such parties remain in full
compliance.
<RXDUHQRWUHTXLUHGWRDFFHSWWKLV/LFHQVHVLQFH\RXKDYH
QRWVLJQHGLW+RZHYHUQRWKLQJHOVHJUDQWV\RXSHUPLVVLRQWR
modify or distribute the Program or its derivative works. These
DFWLRQVDUHSURKLELWHGE\ODZLI\RXGRQRWDFFHSWWKLV/LFHQVH
Therefore, by modifying or distributing the Program (or any
work based on the Program), you indicate your acceptance
RI WKLV /LFHQVH WR GR VR DQG DOO LWV WHUPV DQG FRQGLWLRQV IRU
copying, distributing or modifying the Program or works based
on it.
6. Each time you redistribute the Program (or any work based
on the Program), the recipient automatically receives a license
from the original licensor to copy, distribute or modify the
3URJUDPVXEMHFWWRWKHVHWHUPVDQGFRQGLWLRQV<RXPD\QRW
LPSRVH DQ\ IXUWKHU UHVWULFWLRQV RQ WKH UHFLSLHQWV
H[HUFLVH RI
the rights granted herein.
<RX DUH QRW UHVSRQVLEOH IRU HQIRUFLQJ FRPSOLDQFH E\ WKLUG
parties to
WKLV/LFHQVH
,I DV D FRQVHTXHQFH RI D FRXUW MXGJPHQW RU DOOHJDWLRQ
of patent infringement or for any other reason (not limited
to patent issues), conditions are imposed on you (whether
by court order, agreement or otherwise) that contradict the
FRQGLWLRQV RI WKLV /LFHQVH WKH\ GR QRW H[FXVH \RX IURP WKH
FRQGLWLRQV RI WKLV /LFHQVH ,I \RX FDQQRW GLVWULEXWH VR DV WR
VDWLVI\VLPXOWDQHRXVO\\RXUREOLJDWLRQVXQGHUWKLV/LFHQVHDQG
any other pertinent obligations, then as a consequence you
PD\QRWGLVWULEXWHWKH3URJUDPDWDOO)RUH[DPSOHLIDSDWHQW
license would not permit royalty-free redistribution of the
This section is intended to make thoroughly clear what is
EHOLHYHGWREHDFRQVHTXHQFHRIWKHUHVWRIWKLV/LFHQVH
,IWKHGLVWULEXWLRQDQGRUXVHRIWKH3URJUDPLVUHVWULFWHGLQ
certain countries either by patents or by copyrighted interfaces,
the original copyright holder who places the Program under this
/LFHQVHPD\DGGDQH[SOLFLWJHRJUDSKLFDOGLVWULEXWLRQOLPLWDWLRQ
H[FOXGLQJWKRVHFRXQWULHVVRWKDWGLVWULEXWLRQLVSHUPLWWHGRQO\
LQ RU DPRQJ FRXQWULHV QRW WKXV H[FOXGHG ,Q VXFK FDVH WKLV
/LFHQVHLQFRUSRUDWHVWKHOLPLWDWLRQDVLIZULWWHQLQWKHERG\RI
WKLV/LFHQVH
9. The Free Software Foundation may publish revised and/
RU QHZ YHUVLRQV RI WKH *HQHUDO 3XEOLF /LFHQVH IURP WLPH WR
time. Such new versions will be similar in spirit to the present
version, but may differ in detail to address new problems or
concerns.
(DFKYHUVLRQLVJLYHQDGLVWLQJXLVKLQJYHUVLRQQXPEHU,IWKH
3URJUDP VSHFL¿HV D YHUVLRQ QXPEHU RI WKLV /LFHQVH ZKLFK
applies to it and "any later version", you have the option of
following the terms and conditions either of that version or of
any later version published by the Free Software Foundation.
,I WKH 3URJUDP GRHV QRW VSHFLI\ D YHUVLRQ QXPEHU RI WKLV
/LFHQVH \RX PD\ FKRRVH DQ\ YHUVLRQ HYHU SXEOLVKHG E\ WKH
Free Software
Foundation.
,I\RXZLVKWRLQFRUSRUDWHSDUWVRIWKH3URJUDPLQWRRWKHU
free programs whose distribution conditions are different, write
to the author to ask for permission. For software which is
copyrighted by the Free Software Foundation, write to the
)UHH6RIWZDUH)RXQGDWLRQZHVRPHWLPHVPDNHH[FHSWLRQVIRU
this. Our decision will be guided by the two goals of preserving
the free status of all derivatives of our free software and of
promoting the sharing and reuse of software generally.
12:$55$17<
%(&$86(7+(352*5$0,6/,&(16(')5((2)&+$5*(
7+(5( ,6 12 :$55$17< )25 7+( 352*5$0 72 7+(
(;7(17 3(50,77(' %< $33/,&$%/( /$: (;&(37 :+(1
27+(5:,6(67$7(',1:5,7,1*7+(&23<5,*+7+2/'(56
$1'25 27+(5 3$57,(6 3529,'( 7+( 352*5$0 $6 ,6
:,7+287:$55$17<2)$1<.,1'(,7+(5(;35(66('25
,03/,(' ,1&/8',1* %87 127 /,0,7(' 72 7+( ,03/,('
:$55$17,(6 2) 0(5&+$17$%,/,7< $1' ),71(66 )25
$ 3$57,&8/$5 385326( 7+( (17,5( 5,6. $6 72 7+(
48$/,7< $1' 3(5)250$1&( 2) 7+( 352*5$0 ,6 :,7+
<286+28/'7+(
352*5$03529('()(&7,9(<28$6680(7+(&2672)$//
1(&(66$5<6(59,&,1*5(3$,525&255(&7,21
,112(9(1781/(665(48,5('%<$33/,&$%/(/$:25
39
English
readable source code, which must be distributed under the
terms of Sections
1 and 2 above on a medium customarily used for software
LQWHUFKDQJHRU
English
$*5(('72,1:5,7,1*:,//$1<&23<5,*+7+2/'(525
$1<27+(53$57<:+20$<02',)<$1'255(',675,%87(
7+(352*5$0$63(50,77('$%29(%(/,$%/(72<28)25
'$0$*(6,1&/8',1*$1<*(1(5$/63(&,$/,1&,'(17$/
25 &216(48(17,$/ '$0$*(6 $5,6,1* 287 2) 7+( 86(
25 ,1$%,/,7< 72 86( 7+( 352*5$0 ,1&/8',1* %87
127/,0,7('72/2662)'$7$25'$7$%(,1*5(1'(5('
,1$&&85$7( 25 /266(6 6867$,1(' %< <28 25 7+,5'
3$57,(625$)$,/85(2)7+(352*5$07223(5$7(:,7+
$1<27+(5352*5$06(9(1,)68&++2/'(52527+(5
3$57< +$6 %((1 $'9,6(' 2) 7+( 3266,%,/,7< 2) 68&+
'$0$*(6
(1'2)7(506$1'&21',7,216
+RZWR$SSO\7KHVH7HUPVWR<RXU1HZ3URJUDPV
,I\RXGHYHORSDQHZSURJUDPDQG\RXZDQWLWWREHRIWKH
greatest possible use to the public, the best way to achieve this
is to make it free software which everyone can redistribute and
change under these terms.
7RGRVRDWWDFKWKHIROORZLQJQRWLFHVWRWKHSURJUDP,WLV
VDIHVWWRDWWDFKWKHPWRWKHVWDUWRIHDFKVRXUFH¿OHWRPRVW
HIIHFWLYHO\ FRQYH\ WKH H[FOXVLRQ RI ZDUUDQW\ DQG HDFK ¿OH
should have at least the "copyright" line and a pointer to where
the full notice is found.
RQHOLQHWRJLYHWKHSURJUDP
VQDPHDQGDEULHILGHDRI
ZKDWLWGRHV!
&RS\ULJKW&\HDU!QDPHRIDXWKRU!
7KLVSURJUDPLVIUHHVRIWZDUH\RXFDQUHGLVWULEXWHLWDQGRU
PRGLI\LWXQGHUWKHWHUPVRIWKH*18*HQHUDO3XEOLF/LFHQVHDV
SXEOLVKHGE\WKH)UHH6RIWZDUH)RXQGDWLRQHLWKHUYHUVLRQRI
WKH/LFHQVHRUDW\RXURSWLRQDQ\ODWHUYHUVLRQ
This program is distributed in the hope that it will be useful,
EXW :,7+287 $1< :$55$17< ZLWKRXW HYHQ WKH LPSOLHG
ZDUUDQW\RI0(5&+$17$%,/,7<RU),71(66)25$3$57,&8/$5
385326( 6HH WKH *18 *HQHUDO 3XEOLF /LFHQVH IRU PRUH
details.
<RXVKRXOGKDYHUHFHLYHGDFRS\RIWKH*18*HQHUDO3XEOLF
/LFHQVH DORQJ ZLWK WKLV SURJUDP LI QRW ZULWH WR WKH )UHH
6RIWZDUH)RXQGDWLRQ,QF
)UDQNOLQ6WUHHW)LIWK)ORRU%RVWRQ0$86$
Also add information on how to contact you by electronic and
paper mail.
,IWKHSURJUDPLVLQWHUDFWLYHPDNHLWRXWSXWDVKRUWQRWLFHOLNH
this
ZKHQLWVWDUWVLQDQLQWHUDFWLYHPRGH
Gnomovision version 69, Copyright (C) year name of author
*QRPRYLVLRQFRPHVZLWK$%62/87(/<12:$55$17<IRU
GHWDLOVW\SHCVKRZZ
This is free software, and you are welcome to redistribute it
XQGHUFHUWDLQFRQGLWLRQVW\SHCVKRZF
IRUGHWDLOV
7KH K\SRWKHWLFDO FRPPDQGV CVKRZ Z
DQG CVKRZ F
VKRXOG
VKRZWKHDSSURSULDWHSDUWVRIWKH*HQHUDO3XEOLF/LFHQVH2I
course, the commands you use may be called something other
WKDQCVKRZZ
DQGCVKRZF
WKH\FRXOGHYHQEHPRXVHFOLFNV
or menu items--whatever suits your program.
<RXVKRXOGDOVRJHW\RXUHPSOR\HULI\RXZRUNDVDSURJUDPPHU
or your school, if any, to sign a "copyright disclaimer" for the
SURJUDPLIQHFHVVDU\+HUHLVDVDPSOHDOWHUWKHQDPHV
<R\RG\QH,QFKHUHE\GLVFODLPVDOOFRS\ULJKWLQWHUHVWLQWKH
SURJUDP C*QRPRYLVLRQ
ZKLFK PDNHV SDVVHV DW FRPSLOHUV
ZULWWHQE\-DPHV+DFNHU
VLJQDWXUHRI7\&RRQ!$SULO
40
Ty Coon, President of Vice
7KLV*HQHUDO3XEOLF/LFHQVHGRHVQRWSHUPLWLQFRUSRUDWLQJ\RXU
SURJUDPLQWRSURSULHWDU\SURJUDPV,I\RXUSURJUDPLVDVXEroutine library, you may consider it more useful to permit linkLQJSURSULHWDU\DSSOLFDWLRQVZLWKWKHOLEUDU\,IWKLVLVZKDW\RX
ZDQWWRGRXVHWKH*18/HVVHU*HQHUDO3XEOLF/LFHQVHLQVWHDG
RIWKLV/LFHQVH
GPLv3
*18 *(1(5$/ 38%/,& /,&(16( 9HUVLRQ -XQH &RS\ULJKW & )UHH 6RIWZDUH )RXQGDWLRQ ,QF KWWS
IVIRUJ! (YHU\RQH LV SHUPLWWHG WR FRS\ DQG GLVWULEXWH
verbatim copies of this license document, but changing it is
not allowed.
3UHDPEOH7KH*18*HQHUDO3XEOLF/LFHQVHLVDIUHHFRS\OHIW
license for software and other kinds of works. The licenses for
most software and other practical works are designed to take
away your freedom to share and change the works. By
FRQWUDVW WKH *18 *HQHUDO 3XEOLF /LFHQVH LV LQWHQGHG WR
guarantee your freedom to share and change all versions of a
program--to make sure it remains free software for all its users.
:HWKH)UHH6RIWZDUH)RXQGDWLRQXVHWKH*18*HQHUDO3XEOLF
/LFHQVHIRUPRVWRIRXUVRIWZDUHLWDSSOLHVDOVRWRDQ\RWKHU
ZRUNUHOHDVHGWKLVZD\E\LWVDXWKRUV<RXFDQDSSO\LWWR\RXU
SURJUDPV WRR :KHQ ZH VSHDN RI IUHH VRIWZDUH ZH DUH
UHIHUULQJ WR IUHHGRP QRW SULFH 2XU *HQHUDO 3XEOLF /LFHQVHV
are designed to make sure that you have the freedom to
distribute copies of free software (and charge for them if you
wish), that you receive source code or can get it if you want it,
that you can change the software or use pieces of it in new free
programs, and that you know you can do these things. To
protect your rights, we need to prevent others from denying
you these rights or asking you to surrender the rights.
Therefore, you have certain responsibilities if you distribute
FRSLHV RI WKH VRIWZDUH RU LI \RX PRGLI\ LW UHVSRQVLELOLWLHV WR
UHVSHFWWKHIUHHGRPRIRWKHUV)RUH[DPSOHLI\RXGLVWULEXWH
copies of such a program, whether gratis or for a fee, you must
pass on to the recipients the same freedoms that you received.
<RX PXVW PDNH VXUH WKDW WKH\ WRR UHFHLYH RU FDQ JHW WKH
source code. And you must show them these terms so they
NQRZWKHLUULJKWV'HYHORSHUVWKDWXVHWKH*18*3/SURWHFW
\RXUULJKWVZLWKWZRVWHSVDVVHUWFRS\ULJKWRQWKHVRIWZDUH
DQG RIIHU \RX WKLV /LFHQVH JLYLQJ \RX OHJDO SHUPLVVLRQ WR
FRS\ GLVWULEXWH DQGRU PRGLI\ LW )RU WKH GHYHORSHUV
DQG
DXWKRUV
SURWHFWLRQ WKH *3/ FOHDUO\ H[SODLQV WKDW WKHUH LV QR
ZDUUDQW\IRUWKLVIUHHVRIWZDUH)RUERWKXVHUV
DQGDXWKRUV
VDNH WKH *3/ UHTXLUHV WKDW PRGL¿HG YHUVLRQV EH PDUNHG DV
changed, so that their problems will not be attributed
erroneously to authors of previous versions. Some devices are
GHVLJQHG WR GHQ\ XVHUV DFFHVV WR LQVWDOO RU UXQ PRGL¿HG
versions of the software inside them, although the manufacturer
can do so. This is fundamentally incompatible with the aim of
SURWHFWLQJ XVHUV
IUHHGRP WR FKDQJH WKH VRIWZDUH 7KH
systematic pattern of such abuse occurs in the area of products
for individuals to use, which is precisely where it is most
unacceptable. Therefore, we have designed this version of the
*3/ WR SURKLELW WKH SUDFWLFH IRU WKRVH SURGXFWV ,I VXFK
problems arise substantially in other domains, we stand ready
WRH[WHQGWKLVSURYLVLRQWRWKRVHGRPDLQVLQIXWXUHYHUVLRQVRI
WKH*3/DVQHHGHGWRSURWHFWWKHIUHHGRPRIXVHUV)LQDOO\
every program is threatened constantly by software patents.
States should not allow patents to restrict development and
use of software on general-purpose computers, but in those
that do, we wish to avoid the special danger that patents
applied to a free program could make it effectively proprietary.
7RSUHYHQWWKLVWKH*3/DVVXUHVWKDWSDWHQWVFDQQRWEHXVHGWR
render the program non-free. The precise terms and conditions
IRUFRS\LQJGLVWULEXWLRQDQGPRGL¿FDWLRQIROORZ7(506$1'
&21',7,216'H¿QLWLRQV7KLV/LFHQVHUHIHUVWRYHUVLRQ
RI WKH *18 *HQHUDO 3XEOLF /LFHQVH &RS\ULJKW DOVR PHDQV
copyright-like laws that apply to other kinds of works, such as
semiconductor masks.
"The Program" refers to any
FRS\ULJKWDEOHZRUNOLFHQVHGXQGHUWKLV/LFHQVH(DFKOLFHQVHHLV
WKDW\RXFRPSO\ZLWKWKHWHUPVRIWKLV/LFHQVHLQFRQYH\LQJDOO
material for which you do not control copyright. Those thus
making or running the covered works for you must do so
H[FOXVLYHO\RQ\RXUEHKDOIXQGHU\RXUGLUHFWLRQDQGFRQWURORQ
terms that prohibit them from making any copies of your copyrighted material outside their relationship with you. Conveying
under any other circumstances is permitted solely under the
FRQGLWLRQVVWDWHGEHORZ6XEOLFHQVLQJLVQRWDOORZHGVHFWLRQ
10 makes it unnecessary.
3URWHFWLQJ 8VHUV
/HJDO 5LJKWV )URP $QWL&LUFXPYHQWLRQ
/DZ 1R FRYHUHG ZRUN VKDOO EH GHHPHG SDUW RI DQ HIIHFWLYH
WHFKQRORJLFDO PHDVXUH XQGHU DQ\ DSSOLFDEOH ODZ IXO¿OOLQJ
REOLJDWLRQV XQGHU DUWLFOH RI WKH :,32 FRS\ULJKW WUHDW\
adopted on 20 December 1996, or similar laws prohibiting
RU UHVWULFWLQJ FLUFXPYHQWLRQ RI VXFK PHDVXUHV :KHQ \RX
convey a covered work, you waive any legal power to forbid
FLUFXPYHQWLRQ RI WHFKQRORJLFDO PHDVXUHV WR WKH H[WHQW VXFK
FLUFXPYHQWLRQLVHIIHFWHGE\H[HUFLVLQJULJKWVXQGHUWKLV/LFHQVH
with respect to the covered work, and you disclaim any intention
WR OLPLW RSHUDWLRQ RU PRGL¿FDWLRQ RI WKH ZRUN DV D PHDQV RI
HQIRUFLQJDJDLQVWWKHZRUN
VXVHUV\RXURUWKLUGSDUWLHV
OHJDO
rights to forbid circumvention of technological measures. 4.
&RQYH\LQJ9HUEDWLP&RSLHV<RXPD\FRQYH\YHUEDWLPFRSLHV
RIWKH3URJUDP
VVRXUFHFRGHDV\RXUHFHLYHLWLQDQ\PHGLXP
provided that you conspicuously and appropriately publish
RQ HDFK FRS\ DQ DSSURSULDWH FRS\ULJKW QRWLFH NHHS LQWDFW
DOO QRWLFHV VWDWLQJ WKDW WKLV /LFHQVH DQG DQ\ QRQSHUPLVVLYH
WHUPVDGGHGLQDFFRUGZLWKVHFWLRQDSSO\WRWKHFRGHNHHS
LQWDFWDOOQRWLFHVRIWKHDEVHQFHRIDQ\ZDUUDQW\DQGJLYHDOO
UHFLSLHQWVDFRS\RIWKLV/LFHQVHDORQJZLWKWKH3URJUDP<RX
may charge any price or no price for each copy that you convey,
and you may offer support or warranty protection for a fee. 5.
&RQYH\LQJ0RGL¿HG6RXUFH9HUVLRQV<RXPD\FRQYH\DZRUN
EDVHGRQWKH3URJUDPRUWKHPRGL¿FDWLRQVWRSURGXFHLWIURP
the Program, in the form of source code under the terms of
VHFWLRQSURYLGHGWKDW\RXDOVRPHHWDOORIWKHVHFRQGLWLRQV
a) The work must carry prominent notices stating that you
PRGL¿HGLWDQGJLYLQJDUHOHYDQWGDWH
b) The work must carry prominent notices stating that it is
UHOHDVHG XQGHU WKLV /LFHQVH DQG DQ\ FRQGLWLRQV DGGHG XQGHU
VHFWLRQ 7KLV UHTXLUHPHQW PRGL¿HV WKH UHTXLUHPHQW LQ
VHFWLRQWRNHHSLQWDFWDOOQRWLFHVF<RXPXVWOLFHQVH
WKHHQWLUHZRUNDVDZKROHXQGHUWKLV/LFHQVHWRDQ\RQHZKR
FRPHVLQWRSRVVHVVLRQRIDFRS\7KLV/LFHQVHZLOOWKHUHIRUH
apply, along with any applicable section 7 additional terms, to
the whole of the work, and all its parts, regardless of how they
DUHSDFNDJHG7KLV/LFHQVHJLYHVQRSHUPLVVLRQWROLFHQVH
the work in any other way, but it does not
invalidate such
SHUPLVVLRQLI\RXKDYHVHSDUDWHO\UHFHLYHGLWG,IWKHZRUN
has interactive user interfaces, each must display Appropriate
/HJDO1RWLFHVKRZHYHULIWKH3URJUDPKDVLQWHUDFWLYH
LQWHUIDFHVWKDWGRQRWGLVSOD\$SSURSULDWH/HJDO1RWLFHV\RXU
work need not make them do so. A compilation of a covered
work with other separate and independentworks, which are
QRWE\WKHLUQDWXUHH[WHQVLRQVRIWKHFRYHUHGZRUNDQGZKLFK
are not combined with it such as to form a larger program, in
or on a volume of a storage or distribution medium, is called
an "aggregate" if the compilation and its resulting copyright
are not used to limit the access or legal rights of the
FRPSLODWLRQ
VXVHUVEH\RQGZKDWWKHLQGLYLGXDOZRUNVSHUPLW
,QFOXVLRQRIDFRYHUHGZRUNLQDQDJJUHJDWHGRHVQRWFDXVH
WKLV/LFHQVHWRDSSO\WRWKHRWKHUSDUWVRIWKHDJJUHJDWH
&RQYH\LQJ1RQ6RXUFH)RUPV<RXPD\FRQYH\DFRYHUHG
work in object code form under the terms of sections 4 and 5,
provided that you also convey the machine-readable
&RUUHVSRQGLQJ6RXUFHXQGHUWKHWHUPVRIWKLV/LFHQVHLQRQH
RIWKHVHZD\VD&RQYH\WKHREMHFWFRGHLQRUHPERGLHG
in, a physical product (including a physical distribution
PHGLXPDFFRPSDQLHGE\WKH&RUUHVSRQGLQJ6RXUFH¿[HG
on a durable physical medium customarily used for software
interchange. b) Convey the object code in, or embodied in,
a physical product (including a physical distribution medium),
accompanied by a written offer, valid for at least three years
and valid for as long as you offer spare parts or customer
41
English
DGGUHVVHG DV \RX /LFHQVHHV DQG UHFLSLHQWV PD\ EH
individuals or organizations. To "modify" a work means to copy
from or adapt all or part of the work in a fashion requiring
FRS\ULJKWSHUPLVVLRQRWKHUWKDQWKHPDNLQJRIDQH[DFWFRS\
7KHUHVXOWLQJZRUNLVFDOOHGDPRGL¿HGYHUVLRQRIWKHHDUOLHU
work or a work "based on" the earlier work. A "covered work"
PHDQVHLWKHUWKHXQPRGL¿HG3URJUDPRUDZRUNEDVHGRQWKH
Program. To "propagate" a work means to do anything with it
that, without permission, would make you directly or secondarily
OLDEOHIRULQIULQJHPHQWXQGHUDSSOLFDEOHFRS\ULJKWODZH[FHSW
H[HFXWLQJ LW RQ D FRPSXWHU RU PRGLI\LQJ D SULYDWH FRS\
Propagation includes copying, distribution (with or without
PRGL¿FDWLRQ PDNLQJ DYDLODEOH WR WKH SXEOLF DQG LQ VRPH
countries other activities as well. To "convey" a work means
any kind of propagation that enables other parties to make or
UHFHLYH FRSLHV 0HUH LQWHUDFWLRQ ZLWK D XVHU WKURXJK D
computer network, with no transfer of a copy, is not conveying.
$Q LQWHUDFWLYH XVHU LQWHUIDFH GLVSOD\V $SSURSULDWH /HJDO
1RWLFHV WR WKH H[WHQW WKDW LW LQFOXGHV D FRQYHQLHQW DQG
prominently visible feature that (1) displays an appropriate
copyright notice, and (2) tells the user that there is no warranty
IRUWKHZRUNH[FHSWWRWKHH[WHQWWKDWZDUUDQWLHVDUHSURYLGHG
WKDW OLFHQVHHV PD\ FRQYH\ WKH ZRUN XQGHU WKLV /LFHQVH DQG
KRZWRYLHZDFRS\RIWKLV/LFHQVH,IWKHLQWHUIDFHSUHVHQWVD
list of user commands or options, such as a menu, a prominent
item in the list meets this criterion. 1. Source Code. The
"source code" for a work means the preferred form of the work
IRUPDNLQJPRGL¿FDWLRQVWRLW2EMHFWFRGHPHDQVDQ\QRQ
VRXUFH IRUP RI D ZRUN $ 6WDQGDUG ,QWHUIDFH PHDQV DQ
LQWHUIDFH WKDW HLWKHU LV DQ RI¿FLDO VWDQGDUG GH¿QHG E\ D
recognized standards body, or, in the case of interfaces
VSHFL¿HG IRU D SDUWLFXODU SURJUDPPLQJ ODQJXDJH RQH WKDW LV
widely used among developers working in that language. The
6\VWHP /LEUDULHV RI DQ H[HFXWDEOH ZRUN LQFOXGH DQ\WKLQJ
other than the work as a whole, that (a) is included in the
QRUPDOIRUPRISDFNDJLQJD0DMRU&RPSRQHQWEXWZKLFKLVQRW
SDUWRIWKDW0DMRU&RPSRQHQWDQGEVHUYHVRQO\WRHQDEOH
XVHRIWKHZRUNZLWKWKDW0DMRU&RPSRQHQWRUWRLPSOHPHQWD
6WDQGDUG,QWHUIDFHIRUZKLFKDQLPSOHPHQWDWLRQLVDYDLODEOHWR
WKHSXEOLFLQVRXUFHFRGHIRUP$0DMRU&RPSRQHQWLQWKLV
FRQWH[WPHDQVDPDMRUHVVHQWLDOFRPSRQHQWNHUQHOZLQGRZ
V\VWHPDQGVRRQRIWKHVSHFL¿FRSHUDWLQJV\VWHPLIDQ\RQ
ZKLFKWKHH[HFXWDEOHZRUNUXQVRUDFRPSLOHUXVHGWRSURGXFH
the work, or an object code interpreter used to run it. The
"Corresponding Source" for a work in object code form means
all the source code needed to generate, install, and (for an
H[HFXWDEOHZRUNUXQWKHREMHFWFRGHDQGWRPRGLI\WKHZRUN
LQFOXGLQJ VFULSWV WR FRQWURO WKRVH DFWLYLWLHV +RZHYHU LW GRHV
QRW LQFOXGH WKH ZRUN
V 6\VWHP /LEUDULHV RU JHQHUDOSXUSRVH
tools or generally available free programs which are used
XQPRGL¿HGLQSHUIRUPLQJWKRVHDFWLYLWLHVEXWZKLFKDUHQRWSDUW
RI WKH ZRUN )RU H[DPSOH &RUUHVSRQGLQJ 6RXUFH LQFOXGHV
LQWHUIDFH GH¿QLWLRQ ¿OHV DVVRFLDWHG ZLWK VRXUFH ¿OHV IRU WKH
work, and the source code for shared libraries and dynamically
OLQNHG VXESURJUDPV WKDW WKH ZRUN LV VSHFL¿FDOO\ GHVLJQHG WR
require, such as by intimate data communication or control
ÀRZEHWZHHQWKRVHVXESURJUDPVDQGRWKHUSDUWVRIWKHZRUN
The Corresponding Source need not include anything that
users can regenerate automatically from other parts of the
Corresponding Source. The Corresponding Source for a work
in source code form is thatsame work. 2. Basic Permissions.
$OOULJKWVJUDQWHGXQGHUWKLV/LFHQVHDUHJUDQWHGIRUWKHWHUPRI
copyright on the Program, and are irrevocable provided the
VWDWHGFRQGLWLRQVDUHPHW7KLV/LFHQVHH[SOLFLWO\DI¿UPV\RXU
XQOLPLWHG SHUPLVVLRQ WR UXQ WKH XQPRGL¿HG 3URJUDP 7KH
RXWSXWIURPUXQQLQJDFRYHUHGZRUNLVFRYHUHGE\WKLV/LFHQVH
only if the output, given its content, constitutes a covered
ZRUN 7KLV /LFHQVH DFNQRZOHGJHV \RXU ULJKWV RI IDLU XVH RU
RWKHUHTXLYDOHQWDVSURYLGHGE\FRS\ULJKWODZ<RXPD\PDNH
run and propagate covered works that you do not convey,
without conditions so long as your license otherwise remains in
IRUFH<RXPD\FRQYH\FRYHUHGZRUNVWRRWKHUVIRUWKHVROH
SXUSRVHRIKDYLQJWKHPPDNHPRGL¿FDWLRQVH[FOXVLYHO\IRU\RX
or provide you with facilities for running those works, provided
English
support for that product model, to give anyone who
possesses the object code either (1) a copy of the
Corresponding Source for all the software in the product
WKDWLVFRYHUHGE\WKLV/LFHQVHRQDGXUDEOHSK\VLFDO
medium customarily used for software interchange, for a price
no more than your reasonable cost of physically performing
this conveying of source, or (2) access to copy the
Corresponding Source from a network server at no charge.
c) Convey individual copies of the object code with a copy of
the written offer to provide the Corresponding Source. This
alternative is allowed only occasionally and noncommercially,
and only if you received the object code with such an offer,
in accord with subsection 6b. d) Convey the object code
by offering access from a designated place (gratis or for a
charge), and offer equivalent access to the Corresponding
Source in the same way through the same place at no
IXUWKHUFKDUJH<RXQHHGQRWUHTXLUHUHFLSLHQWVWRFRS\WKH
&RUUHVSRQGLQJ6RXUFHDORQJZLWKWKHREMHFWFRGH,IWKHSODFH
to copy the object code is a network server, the
Corresponding Source may be on a different server
(operated by you or a third party) that supports equivalent
copying facilities, provided you maintain clear directions
QH[WWRWKHREMHFWFRGHVD\LQJZKHUHWR¿QGWKH
Corresponding Source. Regardless of what server hosts the
Corresponding Source, you remain obligated to ensure that it
is available for as long as needed to satisfy these
requirements. e) Convey the object code using peer-to-peer
transmission, provided you inform other peers where the
object code and Corresponding Source of the work are
being offered to the general public at no charge under
subsection 6d. A separable portion of the object code, whose
VRXUFHFRGHLVH[FOXGHGIURPWKH&RUUHVSRQGLQJ6RXUFHDVD
6\VWHP/LEUDU\QHHGQRWEHLQFOXGHGLQFRQYH\LQJWKHREMHFW
code work. A "User Product" is either (1) a "consumer
product", which means any tangible personal property which
is normally used for personal, family, or household purposes,
or (2) anything designed or sold for incorporation into a
GZHOOLQJ,QGHWHUPLQLQJZKHWKHUDSURGXFWLVDFRQVXPHU
product, doubtful cases shall be resolved in favor of coverage.
For a particular product received by a particular user,
"normally used" refers to a typical or common use of that
class of product, regardless of the status of the particular user
or of the way in which the particular user actually uses, or
H[SHFWVRULVH[SHFWHGWRXVHWKHSURGXFW$SURGXFWLVD
consumer product regardless of whether the product has
substantial commercial, industrial or non-consumer uses,
XQOHVVVXFKXVHVUHSUHVHQWWKHRQO\VLJQL¿FDQWPRGHRIXVHRI
WKHSURGXFW,QVWDOODWLRQ,QIRUPDWLRQIRUD8VHU3URGXFW
means any methods, procedures, authorization keys, or other
LQIRUPDWLRQUHTXLUHGWRLQVWDOODQGH[HFXWHPRGL¿HGYHUVLRQV
RIDFRYHUHGZRUNLQWKDW8VHU3URGXFWIURPDPRGL¿HG
version of its Corresponding Source. The information must
VXI¿FHWRHQVXUHWKDWWKHFRQWLQXHGIXQFWLRQLQJRIWKH
PRGL¿HGREMHFWFRGHLVLQQRFDVHSUHYHQWHGRULQWHUIHUHGZLWK
VROHO\EHFDXVHPRGL¿FDWLRQKDVEHHQPDGH,I\RXFRQYH\DQ
REMHFWFRGHZRUNXQGHUWKLVVHFWLRQLQRUZLWKRUVSHFL¿FDOO\
for use in, a User Product, and the conveying occurs as part of
a transaction in which the right of possession and use of the
User Product is transferred to the recipient in perpetuity or for
D¿[HGWHUPUHJDUGOHVVRIKRZWKHWUDQVDFWLRQLV
characterized), the Corresponding Source conveyed under this
VHFWLRQPXVWEHDFFRPSDQLHGE\WKH,QVWDOODWLRQ,QIRUPDWLRQ
But this requirement does not apply if neither you nor any
WKLUGSDUW\UHWDLQVWKHDELOLW\WRLQVWDOOPRGL¿HGREMHFWFRGHRQ
WKH8VHU3URGXFWIRUH[DPSOHWKHZRUNKDVEHHQLQVWDOOHGLQ
5207KHUHTXLUHPHQWWRSURYLGH,QVWDOODWLRQ,QIRUPDWLRQ
does not include a requirement to continue to provide support
service, warranty, or updates for a work that has been
PRGL¿HGRULQVWDOOHGE\WKHUHFLSLHQWRUIRUWKH8VHU3URGXFW
LQZKLFKLWKDVEHHQPRGL¿HGRULQVWDOOHG$FFHVVWRD
QHWZRUNPD\EHGHQLHGZKHQWKHPRGL¿FDWLRQLWVHOIPDWHULDOO\
and adversely affects the operation of the network or violates
the rules and protocols for communication across the network.
&RUUHVSRQGLQJ6RXUFHFRQYH\HGDQG,QVWDOODWLRQ,QIRUPDWLRQ
42
provided, in accord with this section must be in a format that
is publicly documented (and with an implementation available
to the public in source code form), and must require no
special password or key for unpacking, reading or copying. 7.
Additional Terms. "Additional permissions" are terms that
VXSSOHPHQWWKHWHUPVRIWKLV/LFHQVHE\PDNLQJH[FHSWLRQV
from one or more of its conditions. Additional permissions that
are applicable to the entire Program shall be treated as
WKRXJKWKH\ZHUHLQFOXGHGLQWKLV/LFHQVHWRWKHH[WHQWWKDW
WKH\DUHYDOLGXQGHUDSSOLFDEOHODZ,IDGGLWLRQDOSHUPLVVLRQV
apply only to part of the Program, that part may be used
separately under those permissions, but the entire Program
UHPDLQVJRYHUQHGE\WKLV/LFHQVHZLWKRXWUHJDUGWRWKH
DGGLWLRQDOSHUPLVVLRQV:KHQ\RXFRQYH\DFRS\RIDFRYHUHG
work, you may at your optionremove any additional
permissions from that copy, or from any part of it. (Additional
permissions may be written to require their own removal in
FHUWDLQFDVHVZKHQ\RXPRGLI\WKHZRUN<RXPD\SODFH
additional permissions on material, added by you to a covered
work, for which you have or can give appropriate copyright
SHUPLVVLRQ1RWZLWKVWDQGLQJDQ\RWKHUSURYLVLRQRIWKLV
/LFHQVHIRUPDWHULDO\RXDGGWRDFRYHUHGZRUN\RXPD\LI
authorized by the copyright holders of that material)
VXSSOHPHQWWKHWHUPVRIWKLV/LFHQVHZLWKWHUPVD
Disclaiming warranty or limiting liability differently from the
WHUPVRIVHFWLRQVDQGRIWKLV/LFHQVHRUE5HTXLULQJ
SUHVHUYDWLRQRIVSHFL¿HGUHDVRQDEOHOHJDOQRWLFHVRUDXWKRU
DWWULEXWLRQVLQWKDWPDWHULDORULQWKH$SSURSULDWH/HJDO
1RWLFHVGLVSOD\HGE\ZRUNVFRQWDLQLQJLWRUF3URKLELWLQJ
misrepresentation of the origin of that material, or requiring
WKDWPRGL¿HGYHUVLRQVRIVXFKPDWHULDOEHPDUNHGLQ
UHDVRQDEOHZD\VDVGLIIHUHQWIURPWKHRULJLQDOYHUVLRQRUG
/LPLWLQJWKHXVHIRUSXEOLFLW\SXUSRVHVRIQDPHVRIOLFHQVRUV
RUDXWKRUVRIWKHPDWHULDORUH'HFOLQLQJWRJUDQWULJKWV
under trademark law for use of some trade names,
WUDGHPDUNVRUVHUYLFHPDUNVRUI5HTXLULQJ
LQGHPQL¿FDWLRQRIOLFHQVRUVDQGDXWKRUVRIWKDWPDWHULDOE\
DQ\RQHZKRFRQYH\VWKHPDWHULDORUPRGL¿HGYHUVLRQVRI
it) with contractual assumptions of liability to the recipient, for
any liability that these contractual assumptions directly impose
on those licensors and authors. All other non-permissive
additional terms are considered "furtherrestrictions" within the
PHDQLQJRIVHFWLRQ,IWKH3URJUDPDV\RXUHFHLYHGLWRU
any part of it, contains a notice stating that it is governed by
WKLV/LFHQVHDORQJZLWKDWHUPWKDWLVDIXUWKHUUHVWULFWLRQ\RX
PD\UHPRYHWKDWWHUP,IDOLFHQVHGRFXPHQWFRQWDLQVD
further restriction but permits relicensing or conveying under
WKLV/LFHQVH\RXPD\DGGWRDFRYHUHGZRUNPDWHULDO
governed by the terms of that license document, provided
that the further restriction does not survive such relicensing or
FRQYH\LQJ,I\RXDGGWHUPVWRDFRYHUHGZRUNLQDFFRUGZLWK
WKLVVHFWLRQ\RXPXVWSODFHLQWKHUHOHYDQWVRXUFH¿OHVD
VWDWHPHQWRIWKHDGGLWLRQDOWHUPVWKDWDSSO\WRWKRVH¿OHVRU
DQRWLFHLQGLFDWLQJZKHUHWR¿QGWKHDSSOLFDEOHWHUPV
Additional terms, permissive or non-permissive, may be stated
in the form of a separately written license, or stated as
H[FHSWLRQVWKHDERYHUHTXLUHPHQWVDSSO\HLWKHUZD\
7HUPLQDWLRQ<RXPD\QRWSURSDJDWHRUPRGLI\DFRYHUHG
ZRUNH[FHSWDVH[SUHVVO\SURYLGHGXQGHUWKLV/LFHQVH$Q\
attempt otherwise to propagate or modify it is void, and will
DXWRPDWLFDOO\WHUPLQDWH\RXUULJKWVXQGHUWKLV/LFHQVH
(including any patent licenses granted under the third
SDUDJUDSKRIVHFWLRQ+RZHYHULI\RXFHDVHDOOYLRODWLRQ
RIWKLV/LFHQVHWKHQ\RXUOLFHQVHIURPDSDUWLFXODUFRS\ULJKW
holder is reinstated (a) provisionally, unless and until the
FRS\ULJKWKROGHUH[SOLFLWO\DQG¿QDOO\WHUPLQDWHV\RXUOLFHQVH
and (b) permanently, if the copyright holder fails to notify you
of the violation by some reasonable means prior to 60 days
DIWHUWKHFHVVDWLRQ0RUHRYHU\RXUOLFHQVHIURPDSDUWLFXODU
copyright holder is reinstated permanently if the copyright
KROGHUQRWL¿HV\RXRIWKHYLRODWLRQE\VRPHUHDVRQDEOH
PHDQVWKLVLVWKH¿UVWWLPH\RXKDYHUHFHLYHGQRWLFHRI
YLRODWLRQRIWKLV/LFHQVHIRUDQ\ZRUNIURPWKDWFRS\ULJKW
holder, and you cure the violation prior to 30 days after your
use of the covered work in a country, would infringe one or
PRUHLGHQWL¿DEOHSDWHQWVLQWKDWFRXQWU\WKDW\RXKDYHUHDVRQ
WREHOLHYHDUHYDOLG,ISXUVXDQWWRRULQFRQQHFWLRQZLWKD
single transaction orarrangement, you convey, or propagate by
procuring conveyance of, a covered work, and grant a patent
license to some of the parties receiving the covered work
authorizing them to use, propagate, modify or convey a
VSHFL¿FFRS\RIWKHFRYHUHGZRUNWKHQWKHSDWHQWOLFHQVH\RX
JUDQWLVDXWRPDWLFDOO\H[WHQGHGWRDOOUHFLSLHQWVRIWKHFRYHUHG
work and works based on it. A patent license is
"discriminatory" if it does not include within the scope of its
FRYHUDJHSURKLELWVWKHH[HUFLVHRIRULVFRQGLWLRQHGRQWKH
QRQH[HUFLVHRIRQHRUPRUHRIWKHULJKWVWKDWDUHVSHFL¿FDOO\
JUDQWHGXQGHUWKLV/LFHQVH<RXPD\QRWFRQYH\DFRYHUHG
work if you are a party to an arrangement with a third party
that is in the business of distributing software, under which
\RXPDNHSD\PHQWWRWKHWKLUGSDUW\EDVHGRQWKHH[WHQWRI
your activity of conveying the work, and under which the third
party grants, to any of the parties who would receive the
covered work from you, a discriminatory patent license (a) in
connection with copies of the covered work conveyed by you
(or copies made from those copies), or (b) primarily for and in
FRQQHFWLRQZLWKVSHFL¿FSURGXFWVRUFRPSLODWLRQVWKDWFRQWDLQ
the covered work, unless you entered into that arrangement,
RUWKDWSDWHQWOLFHQVHZDVJUDQWHGSULRUWR0DUFK
1RWKLQJLQWKLV/LFHQVHVKDOOEHFRQVWUXHGDVH[FOXGLQJRU
limiting any implied license or other defenses to infringement
that may otherwise be available to you under applicable patent
ODZ1R6XUUHQGHURI2WKHUV
)UHHGRP,IFRQGLWLRQVDUH
imposed on you (whether by court order, agreement or
RWKHUZLVHWKDWFRQWUDGLFWWKHFRQGLWLRQVRIWKLV/LFHQVHWKH\
GRQRWH[FXVH\RXIURPWKHFRQGLWLRQVRIWKLV/LFHQVH,I\RX
cannot convey a covered work so as to satisfy simultaneously
\RXUREOLJDWLRQVXQGHUWKLV/LFHQVHDQGDQ\RWKHUSHUWLQHQW
obligations, then as a consequence you may not convey it at
DOO)RUH[DPSOHLI\RXDJUHHWRWHUPVWKDWREOLJDWH\RXWR
collect a royalty for further conveying from those to whom you
convey the Program, the only way you could satisfy both those
WHUPVDQGWKLV/LFHQVHZRXOGEHWRUHIUDLQHQWLUHO\IURP
FRQYH\LQJWKH3URJUDP8VHZLWKWKH*18$IIHUR*HQHUDO
3XEOLF/LFHQVH1RWZLWKVWDQGLQJDQ\RWKHUSURYLVLRQRIWKLV
/LFHQVH\RXKDYHSHUPLVVLRQWROLQNRUFRPELQHDQ\FRYHUHG
ZRUNZLWKDZRUNOLFHQVHGXQGHUYHUVLRQRIWKH*18$IIHUR
*HQHUDO3XEOLF/LFHQVHLQWRDVLQJOHFRPELQHGZRUNDQGWR
FRQYH\WKHUHVXOWLQJZRUN7KHWHUPVRIWKLV/LFHQVHZLOO
continue to apply to the part which is the covered work, but
WKHVSHFLDOUHTXLUHPHQWVRIWKH*18$IIHUR*HQHUDO3XEOLF
/LFHQVHVHFWLRQFRQFHUQLQJLQWHUDFWLRQWKURXJKDQHWZRUN
will apply to the combination as such. 14. Revised Versions of
WKLV/LFHQVH7KH)UHH6RIWZDUH)RXQGDWLRQPD\SXEOLVK
UHYLVHGDQGRUQHZYHUVLRQVRIWKH*18*HQHUDO3XEOLF/LFHQVH
from time to time. Such new versions will be similar in spirit
to the present version, but may differ in detail to address new
problems or concerns. Each version is given a distinguishing
YHUVLRQQXPEHU,IWKH3URJUDPVSHFL¿HVWKDWDFHUWDLQ
QXPEHUHGYHUVLRQRIWKH*18*HQHUDO3XEOLF/LFHQVHRUDQ\
later version" applies to it, you have the option of following the
terms and conditions either of that numbered version or of any
ODWHUYHUVLRQSXEOLVKHGE\WKH)UHH6RIWZDUH)RXQGDWLRQ,I
WKH3URJUDPGRHVQRWVSHFLI\DYHUVLRQQXPEHURIWKH*18
*HQHUDO3XEOLF/LFHQVH\RXPD\FKRRVHDQ\YHUVLRQHYHU
SXEOLVKHGE\WKH)UHH6RIWZDUH)RXQGDWLRQ,IWKH3URJUDP
VSHFL¿HVWKDWDSUR[\FDQGHFLGHZKLFKIXWXUHYHUVLRQVRIWKH
*18*HQHUDO3XEOLF/LFHQVHFDQEHXVHGWKDWSUR[\
VSXEOLF
statement of acceptance of a version permanently authorizes
\RXWRFKRRVHWKDWYHUVLRQIRUWKH3URJUDP/DWHUOLFHQVH
versions may give you additional or different permissions.
+RZHYHUQRDGGLWLRQDOREOLJDWLRQVDUHLPSRVHGRQDQ\DXWKRU
or copyright holder as a result of your choosing to follow a
ODWHUYHUVLRQ'LVFODLPHURI:DUUDQW\7+(5(,612
:$55$17<)257+(352*5$0727+((;7(173(50,77('
%<$33/,&$%/(/$:(;&(37:+(127+(5:,6(67$7(',1
:5,7,1*7+(&23<5,*+7+2/'(56$1'2527+(5
3$57,(63529,'(7+(352*5$0$6,6:,7+287
43
English
receipt of the notice. Termination of your rights under this
section does not terminate thelicenses of parties who have
UHFHLYHGFRSLHVRUULJKWVIURP\RXXQGHUWKLV/LFHQVH,I\RXU
rights have been terminated and not permanently reinstated,
you do not qualify to receive new licenses for the same
PDWHULDOXQGHUVHFWLRQ$FFHSWDQFH1RW5HTXLUHGIRU
+DYLQJ&RSLHV<RXDUHQRWUHTXLUHGWRDFFHSWWKLV/LFHQVHLQ
order to receive or run a copy of the Program. Ancillary
propagation of a covered work occurring solely as a
consequence of using peer-to-peer transmission to receive a
FRS\OLNHZLVHGRHVQRWUHTXLUHDFFHSWDQFH+RZHYHUQRWKLQJ
RWKHUWKDQWKLV/LFHQVHJUDQWV\RXSHUPLVVLRQWRSURSDJDWHRU
modify any covered work. These actions infringe copyright if
\RXGRQRWDFFHSWWKLV/LFHQVH7KHUHIRUHE\PRGLI\LQJRU
propagating acovered work, you indicate your acceptance of
WKLV/LFHQVHWRGRVR$XWRPDWLF/LFHQVLQJRI'RZQVWUHDP
Recipients. Each time you convey a covered work, the
recipient automatically receives a license from the original
licensors, to run, modify and propagate that work, subject to
WKLV/LFHQVH<RXDUHQRWUHVSRQVLEOHIRUHQIRUFLQJFRPSOLDQFH
E\WKLUGSDUWLHVZLWKWKLV/LFHQVH$QHQWLW\WUDQVDFWLRQLVD
transaction transferring control of an organization, or
substantially all assets of one, or subdividing an organization,
RUPHUJLQJRUJDQL]DWLRQV,ISURSDJDWLRQRIDFRYHUHGZRUN
results from an entity transaction, each party to that
transaction who receives a copy of the work also receives
ZKDWHYHUOLFHQVHVWRWKHZRUNWKHSDUW\
VSUHGHFHVVRULQ
interest had or could give under the previous paragraph, plus
a right to possession of the Corresponding Source of the work
from the predecessor in interest, if the predecessor has it or
FDQJHWLWZLWKUHDVRQDEOHHIIRUWV<RXPD\QRWLPSRVHDQ\
IXUWKHUUHVWULFWLRQVRQWKHH[HUFLVHRIWKHULJKWVJUDQWHGRU
DI¿UPHGXQGHUWKLV/LFHQVH)RUH[DPSOH\RXPD\QRW
LPSRVHDOLFHQVHIHHUR\DOW\RURWKHUFKDUJHIRUH[HUFLVHRI
ULJKWVJUDQWHGXQGHUWKLV/LFHQVHDQG\RXPD\QRWLQLWLDWH
litigation (including a cross-claim or counterclaim in a lawsuit)
alleging that any patent claim is infringed by making, using,
selling, offering for sale, or importing the Program or any
portion of it. 11. Patents. A "contributor" is a copyright
KROGHUZKRDXWKRUL]HVXVHXQGHUWKLV/LFHQVHRIWKH3URJUDP
or a work on which the Program is based. The work thus
OLFHQVHGLVFDOOHGWKHFRQWULEXWRU
VFRQWULEXWRUYHUVLRQ$
FRQWULEXWRU
VHVVHQWLDOSDWHQWFODLPVDUHDOOSDWHQWFODLPV
owned or controlled by the contributor, whether already
acquired or hereafter acquired, that would be infringed by
VRPHPDQQHUSHUPLWWHGE\WKLV/LFHQVHRIPDNLQJXVLQJRU
selling its contributor version, but do not include claims that
would be infringed only as a consequence of further
PRGL¿FDWLRQRIWKHFRQWULEXWRUYHUVLRQ)RUSXUSRVHVRIWKLV
GH¿QLWLRQFRQWUROLQFOXGHVWKHULJKWWRJUDQWSDWHQW
sublicenses in a manner consistent with the requirements of
WKLV/LFHQVH(DFKFRQWULEXWRUJUDQWV\RXDQRQH[FOXVLYH
ZRUOGZLGHUR\DOW\IUHHSDWHQWOLFHQVHXQGHUWKHFRQWULEXWRU
V
essential patent claims, to make, use, sell, offer for sale,
import and otherwise run, modify andpropagate the contents
RILWVFRQWULEXWRUYHUVLRQ,QWKHIROORZLQJWKUHHSDUDJUDSKVD
SDWHQWOLFHQVHLVDQ\H[SUHVVDJUHHPHQWRUFRPPLWPHQW
however denominated, not to enforce a patent (such as an
H[SUHVVSHUPLVVLRQWRSUDFWLFHDSDWHQWRUFRYHQDQWQRWWRVXH
for patent infringement). To "grant" such a patent license to a
party means to make such an agreement or commitment not
WRHQIRUFHDSDWHQWDJDLQVWWKHSDUW\,I\RXFRQYH\D
covered work, knowingly relying on a patent license, and the
Corresponding Source of the work is not available for anyone
WRFRS\IUHHRIFKDUJHDQGXQGHUWKHWHUPVRIWKLV/LFHQVH
through a publicly available network server or other readily
accessible means, then you must either (1) cause the
Corresponding Source to be so available, or (2) arrange to
GHSULYH\RXUVHOIRIWKHEHQH¿WRIWKHSDWHQWOLFHQVHIRUWKLV
particular work, or (3) arrange, in a manner consistent with
WKHUHTXLUHPHQWVRIWKLV/LFHQVHWRH[WHQGWKHSDWHQWOLFHQVH
WRGRZQVWUHDPUHFLSLHQWV.QRZLQJO\UHO\LQJPHDQV\RX
have actual knowledge that, but for the patent license, your
FRQYH\LQJWKHFRYHUHGZRUNLQDFRXQWU\RU\RXUUHFLSLHQW
V
English
:$55$17<2)$1<.,1'(,7+(5(;35(66('25,03/,('
,1&/8',1*%87127/,0,7('727+(,03/,('
:$55$17,(62)0(5&+$17$%,/,7<$1'),71(66)25$
3$57,&8/$5385326(7+((17,5(5,6.$6727+(
48$/,7<$1'3(5)250$1&(2)7+(352*5$0,6:,7+
<286+28/'7+(352*5$03529('()(&7,9(<28
$6680(7+(&2672)$//1(&(66$5<6(59,&,1*5(3$,5
25&255(&7,21/LPLWDWLRQRI/LDELOLW\,112(9(17
81/(665(48,5('%<$33/,&$%/(/$:25$*5(('72,1
:5,7,1*:,//$1<&23<5,*+7+2/'(525$1<27+(5
3$57<:+202',),(6$1'25&219(<67+(352*5$0$6
3(50,77('$%29(%(/,$%/(72<28)25'$0$*(6
,1&/8',1*$1<*(1(5$/63(&,$/,1&,'(17$/25
&216(48(17,$/'$0$*(6$5,6,1*2872)7+(86(25
,1$%,/,7<7286(7+(352*5$0,1&/8',1*%87127
/,0,7('72/2662)'$7$25'$7$%(,1*5(1'(5('
,1$&&85$7(25/266(66867$,1('%<<28257+,5'
3$57,(625$)$,/85(2)7+(352*5$07223(5$7(
:,7+$1<27+(5352*5$06(9(1,)68&++2/'(525
27+(53$57<+$6%((1$'9,6('2)7+(3266,%,/,7<2)
68&+'$0$*(6,QWHUSUHWDWLRQRI6HFWLRQVDQG
,IWKHGLVFODLPHURIZDUUDQW\DQGOLPLWDWLRQRIOLDELOLW\SURYLGHG
above cannot be given local legal effect according to their
terms, reviewing courts shall apply local law that most closely
DSSUR[LPDWHVDQDEVROXWHZDLYHURIDOOFLYLOOLDELOLW\LQ
connection with the Program, unless a warranty or assumption
of liability accompanies a copy of the Program in return for a
IHH(1'2)7(506$1'&21',7,216+RZWR$SSO\7KHVH
7HUPVWR<RXU1HZ3URJUDPV,I\RXGHYHORSDQHZSURJUDP
and you want it to be of the greatest possible use to the
public, the best way to achieve this is to make it free software
which everyone can redistribute and change under these
terms. To do so, attach the following notices to the program.
,WLVVDIHVWWRDWWDFKWKHPWRWKHVWDUWRIHDFKVRXUFH¿OHWR
PRVWHIIHFWLYHO\VWDWHWKHH[FOXVLRQRIZDUUDQW\DQGHDFK¿OH
should have at least the "copyright" line and a pointer to
ZKHUHWKHIXOOQRWLFHLVIRXQGRQHOLQHWRJLYHWKHSURJUDP
V
QDPHDQGDEULHILGHDRIZKDWLWGRHV!&RS\ULJKW&\HDU!
QDPHRIDXWKRU!7KLVSURJUDPLVIUHHVRIWZDUH\RXFDQ
UHGLVWULEXWHLWDQGRUPRGLI\LWXQGHUWKHWHUPVRIWKH*18
*HQHUDO3XEOLF/LFHQVHDVSXEOLVKHGE\WKH)UHH6RIWZDUH
)RXQGDWLRQHLWKHUYHUVLRQRIWKH/LFHQVHRUDW\RXURSWLRQ
any later version.This program is distributed in the hope that
LWZLOOEHXVHIXOEXW:,7+287$1<:$55$17<ZLWKRXWHYHQ
WKHLPSOLHGZDUUDQW\RI0(5&+$17$%,/,7<RU),71(66)25$
3$57,&8/$5385326(6HHWKH*18*HQHUDO3XEOLF/LFHQVH
IRUPRUHGHWDLOV<RXVKRXOGKDYHUHFHLYHGDFRS\RIWKH*18
*HQHUDO3XEOLF/LFHQVH
DORQJZLWKWKLVSURJUDP,IQRWVHHKWWSZZZJQXRUJ
OLFHQVHV!$OVRDGGLQIRUPDWLRQRQKRZWRFRQWDFW\RXE\
HOHFWURQLFDQGSDSHUPDLO,IWKHSURJUDPGRHVWHUPLQDO
interaction, make it output a short notice like this when it
VWDUWVLQDQLQWHUDFWLYHPRGHSURJUDP!&RS\ULJKW&
\HDU!QDPHRIDXWKRU!7KLVSURJUDPFRPHVZLWK
$%62/87(/<12:$55$17<IRUGHWDLOVW\SHCVKRZZ
7KLV
is free software, and you are welcome to redistribute it under
FHUWDLQFRQGLWLRQVW\SHCVKRZF
IRUGHWDLOV7KHK\SRWKHWLFDO
FRPPDQGVCVKRZZ
DQGCVKRZF
VKRXOGVKRZWKH
DSSURSULDWHSDUWVRIWKH*HQHUDO3XEOLF/LFHQVH2IFRXUVH
\RXUSURJUDP
VFRPPDQGVPLJKWEHGLIIHUHQWIRUD*8,
LQWHUIDFH\RXZRXOGXVHDQDERXWER[<RXVKRXOGDOVR
get your employer (if you work as a programmer) or school, if
any, to sign a "copyright disclaimer" for the program, if
necessary. For more information on this, and how to apply
DQGIROORZWKH*18*3/VHHKWWSZZZJQXRUJ
OLFHQVHV!7KH*18*HQHUDO3XEOLF/LFHQVHGRHVQRWSHUPLW
LQFRUSRUDWLQJ\RXUSURJUDPLQWRSURSULHWDU\SURJUDPV,I\RXU
program is a subroutine library, you may consider it more
useful to permit linking proprietary applications with the
OLEUDU\,IWKLVLVZKDW\RXZDQWWRGRXVHWKH*18/HVVHU
*HQHUDO3XEOLF/LFHQVHLQVWHDGRIWKLV/LFHQVH%XW¿UVW
SOHDVHUHDGKWWSZZZJQXRUJSKLORVRSK\ZK\QRWOJSO
KWPO!
HarfBuzz
44
+DUI%X]]ZDVSUHYLRXVO\OLFHQVHGXQGHUGLIIHUHQWOLFHQVHV7KLV
ZDV FKDQJHG LQ-DQXDU\ ,I \RX QHHG WR UHOLFHQVH \RXU
old copies, consult the announcement of the license change on
WKHLQWHUQHW2WKHUWKDQWKDWHDFKFRS\RI+DUI%X]]LVOLFHQVHG
XQGHU WKH &23<,1* ¿OH LQFOXGHG ZLWK LW 7KH DFWXDO OLFHQVH
IROORZV
Permission is hereby granted, without written agreement and
without license or royalty fees, to use, copy, modify, and distribute this software and its documentation for any purpose,
provided that the above copyright notice and the following two
paragraphs appear in all copies of this software.
,112(9(176+$//7+(&23<5,*+7+2/'(5%(/,$%/(72
$1< 3$57< )25 ',5(&7 ,1',5(&7 63(&,$/ ,1&,'(17$/
25 &216(48(17,$/ '$0$*(6 $5,6,1* 287 2) 7+( 86(
2)7+,662)7:$5($1',76'2&80(17$7,21(9(1,)7+(
&23<5,*+7+2/'(5+$6%((1$'9,6('2)7+(3266,%,/,7<
2)68&+'$0$*(
7+( &23<5,*+7 +2/'(5 63(&,),&$//< ',6&/$,06 $1<
:$55$17,(6 ,1&/8',1* %87 127 /,0,7(' 72 7+(
,03/,(' :$55$17,(6 2) 0(5&+$17$%,/,7< $1' ),71(66
)25 $ 3$57,&8/$5 385326( 7+( 62)7:$5( 3529,'('
+(5(81'(5,621$1$6,6%$6,6$1'7+(&23<5,*+7
+2/'(5 +$6 12 2%/,*$7,21 72 3529,'( 0$,17(1$1&(
683325783'$7(6(1+$1&(0(1762502',),&$7,216
LGPLv2.1
*18/(66(5*(1(5$/38%/,&/,&(16(
Version 2.1, February 1999 Copyright (C) 1991, 1999
)UHH6RIWZDUH)RXQGDWLRQ,QF)UDQNOLQ6WUHHW)LIWK)ORRU
%RVWRQ0$86$(YHU\RQHLVSHUPLWWHGWRFRS\
and distribute verbatim copies of this license document, but
FKDQJLQJ LW LV QRW DOORZHG >7KLV LV WKH ¿UVW UHOHDVHG YHUVLRQ
RI WKH /HVVHU *3/ ,W DOVR FRXQWV DV WKH VXFFHVVRU RI WKH
*18 /LEUDU\ 3XEOLF /LFHQVH YHUVLRQ KHQFH WKH YHUVLRQ
number 2.1.] Preamble The licenses for most software are
designed to take away your freedom to share and change it.
%\ FRQWUDVW WKH *18 *HQHUDO 3XEOLF /LFHQVHV DUH LQWHQGHG WR
guarantee your freedom to share and change free software--to
make sure the software is free for all its users. This license,
WKH /HVVHU *HQHUDO 3XEOLF /LFHQVH DSSOLHV WR VRPH VSHFLDOO\
designated software packages--typically libraries--of the Free
Software Foundation and other authors who decide to use it.
<RXFDQXVHLWWRREXWZHVXJJHVW\RX¿UVWWKLQNFDUHIXOO\DERXW
ZKHWKHU WKLV OLFHQVH RU WKH RUGLQDU\ *HQHUDO 3XEOLF /LFHQVH LV
the better strategy to use in any particular case, based on
WKH H[SODQDWLRQV EHORZ :KHQ ZH VSHDN RI IUHH VRIWZDUH
we are referring to freedom of use, not price. Our General
3XEOLF /LFHQVHV DUH GHVLJQHG WR PDNH VXUH WKDW \RX KDYH WKH
freedom to distribute copies of free software (and charge for
WKLVVHUYLFHLI\RXZLVKWKDW\RXUHFHLYHVRXUFHFRGHRUFDQ
JHWLWLI\RXZDQWLWWKDW\RXFDQFKDQJHWKHVRIWZDUHDQGXVH
SLHFHVRIELWLQQHZIUHHSURJUDPVDQGWKDW\RXDUHLQIRUPHG
that you can do these things.
To protect your rights, we
need to make restrictions that forbid distributors to deny you
these rights or to ask you to surrender these rights. These
restrictions translate to certain responsibilities for you if you
GLVWULEXWHFRSLHVRIWKHOLEUDU\RULI\RXPRGLI\LW)RUH[DPSOH
if you distribute copies of the library, whether gratis or for a
fee, you must give the recipients all the rights that we gave
\RX<RXPXVWPDNHVXUHWKDWWKH\WRRUHFHLYHRUFDQJHWWKH
VRXUFHFRGH,I\RXOLQNRWKHUFRGHZLWKWKHOLEUDU\\RXPXVW
SURYLGHFRPSOHWHREMHFW¿OHVWRWKHUHFLSLHQWVVRWKDWWKH\FDQ
relink them with the library after making changes to the library
and recompiling it. And you must show them these terms so
WKH\ NQRZ WKHLU ULJKWV :H SURWHFW \RXU ULJKWV ZLWK D WZR
VWHSPHWKRGZHFRS\ULJKWWKHOLEUDU\DQGZHRIIHU\RX
this license, which gives you legal permission to copy, distribute
and/or modify the library.
To protect each distributor, we
want to make it very clear that there is no warranty for the
IUHHOLEUDU\$OVRLIWKHOLEUDU\LVPRGL¿HGE\VRPHRQHHOVHDQG
passed on, the recipients should know that what they have is
DOOPRGXOHVLWFRQWDLQVSOXVDQ\DVVRFLDWHGLQWHUIDFHGH¿QLWLRQ
¿OHVSOXVWKHVFULSWVXVHGWRFRQWUROFRPSLODWLRQDQGLQVWDOODWLRQ
of the library. Activities other than copying, distribution and
PRGL¿FDWLRQDUHQRWFRYHUHGE\WKLV/LFHQVHWKH\DUHRXWVLGH
LWVVFRSH7KHDFWRIUXQQLQJDSURJUDPXVLQJWKH/LEUDU\LVQRW
restricted, and output from such a program is covered only if its
FRQWHQWVFRQVWLWXWHDZRUNEDVHGRQWKH/LEUDU\LQGHSHQGHQW
RIWKHXVHRIWKH/LEUDU\LQDWRROIRUZULWLQJLW:KHWKHUWKDWLV
WUXHGHSHQGVRQZKDWWKH/LEUDU\GRHVDQGZKDWWKHSURJUDP
WKDWXVHVWKH/LEUDU\GRHV
<RXPD\FRS\DQGGLVWULEXWHYHUEDWLPFRSLHVRIWKH/LEUDU\
V
complete source code as you receive it, in any medium,
provided that you conspicuously and appropriately publish on
each copy an appropriate copyright notice and disclaimer of
ZDUUDQW\NHHSLQWDFWDOOWKHQRWLFHVWKDWUHIHUWRWKLV/LFHQVH
DQGWRWKHDEVHQFHRIDQ\ZDUUDQW\DQGGLVWULEXWHDFRS\RI
WKLV/LFHQVHDORQJZLWKWKH/LEUDU\<RXPD\FKDUJHDIHHIRU
the physical act of transferring a copy, and you may at your
RSWLRQRIIHUZDUUDQW\SURWHFWLRQLQH[FKDQJHIRUDIHH<RX
PD\PRGLI\\RXUFRS\RUFRSLHVRIWKH/LEUDU\RUDQ\SRUWLRQ
RILWWKXVIRUPLQJDZRUNEDVHGRQWKH/LEUDU\DQGFRS\DQG
GLVWULEXWHVXFKPRGL¿FDWLRQVRUZRUNXQGHUWKHWHUPVRI6HFWLRQ
DERYHSURYLGHGWKDW\RXDOVRPHHWDOORIWKHVHFRQGLWLRQVD
7KHPRGL¿HGZRUNPXVWLWVHOIEHDVRIWZDUHOLEUDU\E<RXPXVW
FDXVHWKH¿OHVPRGL¿HGWRFDUU\SURPLQHQWQRWLFHVVWDWLQJWKDW
\RXFKDQJHGWKH¿OHVDQGWKHGDWHRIDQ\FKDQJHF<RXPXVW
cause the whole of the work to be licensed at no charge to all
WKLUGSDUWLHVXQGHUWKHWHUPVRIWKLV/LFHQVHG,IDIDFLOLW\LQ
WKHPRGL¿HG/LEUDU\UHIHUVWRDIXQFWLRQRUDWDEOHRIGDWDWREH
supplied by an application program that uses the facility, other
than as an argument passed when the facility is invoked, then
you must make a good faith effort to ensure that, in the event
an application does not supply such function or
table, the
facility still operates, and performs whatever part of its purpose
UHPDLQV PHDQLQJIXO )RU H[DPSOH D IXQFWLRQ LQ D OLEUDU\ WR
compute square roots has a purpose that is entirely wellGH¿QHGLQGHSHQGHQWRIWKHDSSOLFDWLRQ7KHUHIRUH6XEVHFWLRQ
2d requires that any application-supplied function or table used
E\ WKLV IXQFWLRQ PXVW EH RSWLRQDO LI WKH DSSOLFDWLRQ GRHV QRW
supply it, the square root function must still compute square
URRWV 7KHVH UHTXLUHPHQWV DSSO\ WR WKH PRGL¿HG ZRUN DV D
ZKROH,ILGHQWL¿DEOHVHFWLRQVRIWKDWZRUNDUHQRWGHULYHGIURP
WKH/LEUDU\DQGFDQEHUHDVRQDEO\FRQVLGHUHGLQGHSHQGHQWDQG
VHSDUDWHZRUNVLQWKHPVHOYHVWKHQWKLV/LFHQVHDQGLWVWHUPV
do not apply to those sections when you distribute them as
separate works. But when you distribute the same sections
DV SDUW RI DZKROH ZKLFK LV D ZRUN EDVHG RQ WKH /LEUDU\ WKH
GLVWULEXWLRQRIWKHZKROHPXVWEHRQWKHWHUPVRIWKLV/LFHQVH
ZKRVH SHUPLVVLRQV IRU RWKHU OLFHQVHHV H[WHQG WR WKH HQWLUH
whole, and thus to each and every part regardless of who
wrote it. Thus, it is not the intent of this section to claim rights
RUFRQWHVW\RXUULJKWVWRZRUNZULWWHQHQWLUHO\E\\RXUDWKHU
WKHLQWHQWLVWRH[HUFLVHWKHULJKWWRFRQWUROWKHGLVWULEXWLRQRI
GHULYDWLYHRUFROOHFWLYHZRUNVEDVHGRQWKH/LEUDU\,QDGGLWLRQ
PHUH DJJUHJDWLRQ RI DQRWKHU ZRUN QRW EDVHG RQ WKH /LEUDU\
ZLWK WKH /LEUDU\ RU ZLWK D ZRUN EDVHG RQ WKH /LEUDU\ RQ D
volume of a storage or distribution medium does not bring the
RWKHUZRUNXQGHUWKHVFRSHRIWKLV/LFHQVH<RXPD\RSWWR
DSSO\ WKH WHUPV RI WKH RUGLQDU\ *18 *HQHUDO 3XEOLF /LFHQVH
LQVWHDGRIWKLV/LFHQVHWRDJLYHQFRS\RIWKH/LEUDU\7RGRWKLV
\RXPXVWDOWHUDOOWKHQRWLFHVWKDWUHIHUWRWKLV/LFHQVHVRWKDW
WKH\UHIHUWRWKHRUGLQDU\*18*HQHUDO3XEOLF/LFHQVHYHUVLRQ
LQVWHDGRIWRWKLV/LFHQVH,IDQHZHUYHUVLRQWKDQYHUVLRQ
RI WKH RUGLQDU\ *18 *HQHUDO 3XEOLF /LFHQVH KDV DSSHDUHG
then you can specify that version instead if you wish.) Do not
make any other change in these notices. Once this change
is made in a given copy, it is irreversible for that copy, so the
RUGLQDU\*18*HQHUDO3XEOLF/LFHQVHDSSOLHVWRDOOVXEVHTXHQW
copies and derivative works made from that copy. This option
LVXVHIXOZKHQ\RXZLVKWRFRS\SDUWRIWKHFRGHRIWKH/LEUDU\
LQWR D SURJUDP WKDW LV QRW D OLEUDU\ <RX PD\ FRS\ DQG
GLVWULEXWH WKH /LEUDU\ RU D SRUWLRQ RU GHULYDWLYH RI LW XQGHU
6HFWLRQLQREMHFWFRGHRUH[HFXWDEOHIRUPXQGHUWKHWHUPV
of Sections 1 and 2 above provided that you accompany it with
the complete corresponding machine-readable source code,
45
English
QRWWKHRULJLQDOYHUVLRQVRWKDWWKHRULJLQDODXWKRU
VUHSXWDWLRQ
will not be affected by problems that might be introduced by
others. Finally, software patents pose a constant threat to
WKH H[LVWHQFH RI DQ\ IUHH SURJUDP :H ZLVK WR PDNH VXUH
that a company cannot effectively restrict the users of a free
program by obtaining a restrictive license from a patent holder.
Therefore, we insist that any patent license obtained for a
version of the library must be consistent with the full freedom
RIXVHVSHFL¿HGLQWKLVOLFHQVH0RVW*18VRIWZDUHLQFOXGLQJ
VRPHOLEUDULHVLVFRYHUHGE\WKHRUGLQDU\*18*HQHUDO3XEOLF
/LFHQVH7KLVOLFHQVHWKH*18/HVVHU*HQHUDO3XEOLF/LFHQVH
applies to certain designated libraries, and is quite different
IURPWKHRUGLQDU\*HQHUDO3XEOLF/LFHQVH:HXVHWKLVOLFHQVH
for certain libraries in order to permit linking those libraries into
QRQIUHHSURJUDPV:KHQDSURJUDPLVOLQNHGZLWKDOLEUDU\
whether statically or using a shared library, the combination
of the two is legally speaking a combined work, a derivative
RI WKH RULJLQDO OLEUDU\ 7KH RUGLQDU\ *HQHUDO 3XEOLF /LFHQVH
therefore permits such linking only if the entire combination
¿WVLWVFULWHULDRIIUHHGRP7KH/HVVHU*HQHUDO3XEOLF/LFHQVH
SHUPLWVPRUHOD[FULWHULDIRUOLQNLQJRWKHUFRGHZLWKWKHOLEUDU\
:HFDOOWKLVOLFHQVHWKH/HVVHU*HQHUDO3XEOLF/LFHQVHEHFDXVH
LW GRHV /HVV WR SURWHFW WKH XVHU
V IUHHGRP WKDQ WKH RUGLQDU\
*HQHUDO 3XEOLF /LFHQVH ,W DOVR SURYLGHV RWKHU IUHH VRIWZDUH
GHYHORSHUV /HVV RI DQ DGYDQWDJH RYHU FRPSHWLQJ QRQIUHH
programs. These disadvantages are the reason we use the
RUGLQDU\ *HQHUDO 3XEOLF /LFHQVH IRU PDQ\ OLEUDULHV +RZHYHU
WKH /HVVHU OLFHQVH SURYLGHV DGYDQWDJHV LQ FHUWDLQ VSHFLDO
circumstances.
)RUH[DPSOHRQUDUHRFFDVLRQVWKHUHPD\EHDVSHFLDOQHHG
to encourage the widest possible use of a certain library, so
that it becomes a de-facto standard. To achieve this, nonfree programs must be allowed to use the library. A more
frequent case is that a free library does the same job as
ZLGHO\ XVHG QRQIUHH OLEUDULHV ,Q WKLV FDVH WKHUH LV OLWWOH
to gain by limiting the free library to free software only, so
ZH XVH WKH /HVVHU *HQHUDO 3XEOLF /LFHQVH ,Q RWKHU FDVHV
permission to use a particular library in non-free programs
enables a greater number of people to use a large body of free
VRIWZDUH)RUH[DPSOHSHUPLVVLRQWRXVHWKH*18&/LEUDU\
in non-free programs enables many more people to use the
ZKROH*18RSHUDWLQJV\VWHPDVZHOODVLWVYDULDQWWKH*18
/LQX[RSHUDWLQJV\VWHP$OWKRXJKWKH/HVVHU*HQHUDO3XEOLF
/LFHQVHLV/HVVSURWHFWLYHRIWKHXVHUV
IUHHGRPLWGRHVHQVXUH
WKDWWKHXVHURIDSURJUDPWKDWLVOLQNHGZLWKWKH/LEUDU\KDV
the freedom and the wherewithal to run that program using a
PRGL¿HGYHUVLRQRIWKH/LEUDU\
The precise terms and conditions for copying, distribution
DQGPRGL¿FDWLRQIROORZ3D\FORVHDWWHQWLRQWRWKHGLIIHUHQFH
between a "work based on the library" and a "work that uses
the library". The former contains code derived from the
library, whereas the latter must be combined with the library
LQ RUGHU WR UXQ *18 /(66(5 *(1(5$/ 38%/,& /,&(16(
7(506 $1' &21',7,216 )25 &23<,1* ',675,%87,21
$1' 02',),&$7,21 7KLV /LFHQVH $JUHHPHQW DSSOLHV
to any software library or other program which contains
a notice placed by the copyright holder or other authorized
party saying it may be distributed under the terms of this
/HVVHU *HQHUDO 3XEOLF /LFHQVH DOVR FDOOHG WKLV /LFHQVH
Each licensee is addressed as "you".
A "library" means a
collection of software functions and/or data prepared so as to
be conveniently linked with application programs (which use
VRPHRIWKRVHIXQFWLRQVDQGGDWDWRIRUPH[HFXWDEOHV7KH
/LEUDU\ EHORZ UHIHUV WR DQ\ VXFK VRIWZDUH OLEUDU\ RU ZRUN
which has been distributed under these terms. A "work based
RQWKH/LEUDU\PHDQVHLWKHUWKH/LEUDU\RUDQ\GHULYDWLYHZRUN
XQGHU FRS\ULJKW ODZ WKDW LV WR VD\ D ZRUN FRQWDLQLQJ WKH
/LEUDU\RUDSRUWLRQRILWHLWKHUYHUEDWLPRUZLWKPRGL¿FDWLRQV
and/or translated straightforwardly into another language.
+HUHLQDIWHU WUDQVODWLRQ LV LQFOXGHG ZLWKRXW OLPLWDWLRQ LQ WKH
WHUP PRGL¿FDWLRQ 6RXUFH FRGH IRU D ZRUN PHDQV WKH
SUHIHUUHGIRUPRIWKHZRUNIRUPDNLQJPRGL¿FDWLRQVWRLW)RU
a library, complete source code means all the source code for
English
which must be distributed under the terms of Sections 1 and 2
above on a medium customarily used for software interchange.
,I GLVWULEXWLRQ RI REMHFW FRGH LV PDGH E\ RIIHULQJ DFFHVV WR
copy from a designated place, then offering equivalent access
WR FRS\ WKH VRXUFH FRGH IURP WKH VDPH SODFH VDWLV¿HV WKH
requirement to distribute the source code, even though third
parties are not compelled to copy the source along with the
object code. 5. A program that contains no derivative of any
SRUWLRQRIWKH/LEUDU\EXWLVGHVLJQHGWRZRUNZLWKWKH/LEUDU\
by being compiled or linked with it, is called a "work that uses
WKH /LEUDU\ 6XFK D ZRUN LQ LVRODWLRQ LV QRW D GHULYDWLYH
ZRUN RI WKH /LEUDU\ DQG WKHUHIRUH IDOOV RXWVLGH WKH VFRSH RI
WKLV /LFHQVH +RZHYHU OLQNLQJ D ZRUN WKDW XVHV WKH /LEUDU\
ZLWK WKH /LEUDU\ FUHDWHV DQ H[HFXWDEOH WKDW LV D GHULYDWLYH RI
WKH/LEUDU\EHFDXVHLWFRQWDLQVSRUWLRQVRIWKH/LEUDU\UDWKHU
WKDQDZRUNWKDWXVHVWKHOLEUDU\7KHH[HFXWDEOHLVWKHUHIRUH
FRYHUHGE\WKLV/LFHQVH6HFWLRQVWDWHVWHUPVIRUGLVWULEXWLRQ
RI VXFK H[HFXWDEOHV :KHQ D ZRUN WKDW XVHV WKH /LEUDU\
XVHV PDWHULDO IURP D KHDGHU ¿OH WKDW LV SDUW RI WKH /LEUDU\
the object code for the work may be a derivative work of the
/LEUDU\ HYHQ WKRXJK WKH VRXUFH FRGH LV QRW :KHWKHU WKLV LV
WUXHLVHVSHFLDOO\VLJQL¿FDQWLIWKHZRUNFDQEHOLQNHGZLWKRXW
WKH/LEUDU\RULIWKHZRUNLVLWVHOIDOLEUDU\7KHWKUHVKROGIRU
WKLVWREHWUXHLVQRWSUHFLVHO\GH¿QHGE\ODZ,IVXFKDQREMHFW
¿OH XVHV RQO\ QXPHULFDO SDUDPHWHUV GDWD VWUXFWXUH OD\RXWV
and accessors, and small macros and small inline functions
WHQ OLQHV RU OHVV LQ OHQJWK WKHQ WKH XVH RI WKH REMHFW ¿OH
is unrestricted, regardless of whether it is legally a derivative
ZRUN([HFXWDEOHVFRQWDLQLQJWKLVREMHFWFRGHSOXVSRUWLRQVRI
WKH/LEUDU\ZLOOVWLOOIDOOXQGHU6HFWLRQ2WKHUZLVHLIWKHZRUN
LVDGHULYDWLYHRIWKH/LEUDU\\RXPD\GLVWULEXWHWKHREMHFWFRGH
IRU WKH ZRUN XQGHU WKH WHUPV RI 6HFWLRQ $Q\ H[HFXWDEOHV
containing that work also fall under Section 6, whether or
QRW WKH\ DUH OLQNHG GLUHFWO\ ZLWK WKH /LEUDU\ LWVHOI $V DQ
H[FHSWLRQWRWKH6HFWLRQVDERYH\RXPD\DOVRFRPELQHRUOLQN
D ZRUN WKDW XVHV WKH /LEUDU\ ZLWK WKH /LEUDU\ WR SURGXFH D
ZRUN FRQWDLQLQJ SRUWLRQV RI WKH /LEUDU\ DQG GLVWULEXWH WKDW
work under terms of your choice, provided that the terms
SHUPLW PRGL¿FDWLRQ RI WKH ZRUN IRU WKH FXVWRPHU
V RZQ XVH
DQGUHYHUVHHQJLQHHULQJIRUGHEXJJLQJVXFKPRGL¿FDWLRQV<RX
must give prominent notice with each copy of the work that the
/LEUDU\LVXVHGLQLWDQGWKDWWKH/LEUDU\DQGLWVXVHDUHFRYHUHG
E\ WKLV /LFHQVH <RX PXVW VXSSO\ D FRS\ RI WKLV /LFHQVH ,I
WKH ZRUN GXULQJ H[HFXWLRQ GLVSOD\V FRS\ULJKW QRWLFHV \RX
PXVWLQFOXGHWKHFRS\ULJKWQRWLFHIRUWKH/LEUDU\DPRQJWKHP
as well as a reference directing the user to the copy of this
/LFHQVH$OVR\RXPXVWGRRQHRIWKHVHWKLQJV
a) Accompany the work with the complete corresponding
PDFKLQHUHDGDEOH VRXUFH FRGH IRU WKH /LEUDU\ LQFOXGLQJ
whatever changes were used in the work (which must be
GLVWULEXWHG XQGHU 6HFWLRQV DQG DERYH DQG LI WKH ZRUN
LV DQ H[HFXWDEOH OLQNHG ZLWK WKH /LEUDU\ ZLWK WKH FRPSOHWH
PDFKLQHUHDGDEOHZRUNWKDWXVHVWKH/LEUDU\DVREMHFWFRGH
DQGRU VRXUFH FRGH VR WKDW WKH XVHU FDQ PRGLI\ WKH /LEUDU\
DQG WKHQ UHOLQN WR SURGXFH D PRGL¿HG H[HFXWDEOH FRQWDLQLQJ
WKHPRGL¿HG/LEUDU\
,W LV XQGHUVWRRG WKDW WKH XVHU ZKR FKDQJHV WKH FRQWHQWV RI
GH¿QLWLRQV ¿OHV LQ WKH /LEUDU\ ZLOO QRW QHFHVVDULO\ EH DEOH WR
UHFRPSLOH WKH DSSOLFDWLRQ WR XVH WKH PRGL¿HG GH¿QLWLRQV
b) Use a suitable shared library mechanism for linking with
WKH /LEUDU\$ VXLWDEOH PHFKDQLVP LV RQH WKDW XVHV DW
UXQ WLPH D FRS\ RI WKH OLEUDU\ DOUHDG\ SUHVHQW RQ WKH XVHU
V
computer system, rather than copying library functions into
WKHH[HFXWDEOHDQGZLOORSHUDWHSURSHUO\ZLWKDPRGL¿HG
version of the library, if the user installs one, as long as the
PRGL¿HGYHUVLRQLVLQWHUIDFHFRPSDWLEOHZLWKWKHYHUVLRQWKDW
the work was made with.c) Accompany the work with a written
offer, valid for at least three years, to give the same user
WKHPDWHULDOVVSHFL¿HGLQ6XEVHFWLRQDDERYHIRUDFKDUJH
QR PRUH WKDQ WKH FRVW RI SHUIRUPLQJ WKLV GLVWULEXWLRQ G ,I
distribution of the work is made by offering access to copy
from a designated place, offer equivalent access to copy the
DERYHVSHFL¿HGPDWHULDOVIURPWKHVDPHSODFHH9HULI\WKDW
the user has already received a copy of these materials or
WKDW\RXKDYHDOUHDG\VHQWWKLVXVHUDFRS\)RUDQH[HFXWDEOH
46
WKH UHTXLUHG IRUP RI WKH ZRUN WKDW XVHV WKH /LEUDU\ PXVW
include any data and utility programs needed for reproducing
WKHH[HFXWDEOHIURPLW+RZHYHUDVDVSHFLDOH[FHSWLRQWKH
materials to be distributed need not include anything that is
normally distributed (in either source or binary form) with
the major components (compiler, kernel, and so on) of the
RSHUDWLQJ V\VWHP RQ ZKLFK WKH H[HFXWDEOH UXQV XQOHVV WKDW
FRPSRQHQWLWVHOIDFFRPSDQLHVWKHH[HFXWDEOH,WPD\KDSSHQ
that this requirement contradicts the license restrictions of
other proprietary libraries that do not normally accompany the
operating system. Such a contradiction means you cannot use
ERWKWKHPDQGWKH/LEUDU\WRJHWKHULQDQH[HFXWDEOHWKDW\RX
GLVWULEXWH <RX PD\ SODFH OLEUDU\ IDFLOLWLHV WKDW DUH D ZRUN
EDVHG RQ WKH /LEUDU\ VLGHE\VLGH LQ D VLQJOH OLEUDU\ WRJHWKHU
ZLWK RWKHU OLEUDU\ IDFLOLWLHV QRW FRYHUHG E\ WKLV /LFHQVH DQG
distribute such a combined library, provided that the separate
GLVWULEXWLRQRIWKHZRUNEDVHGRQWKH/LEUDU\DQGRIWKHRWKHU
library facilities is otherwise permitted, and provided that you
GRWKHVHWZRWKLQJVD$FFRPSDQ\WKHFRPELQHGOLEUDU\ZLWK
D FRS\ RI WKH VDPH ZRUN EDVHG RQ WKH /LEUDU\ XQFRPELQHG
with any other library facilities. This must be distributed under
the terms of the Sections above. b) Give prominent notice with
the combined library of the fact that part of it is a work based
RQWKH/LEUDU\DQGH[SODLQLQJZKHUHWR¿QGWKHDFFRPSDQ\LQJ
uncombined form of the same work.
<RXPD\QRWFRS\PRGLI\VXEOLFHQVHOLQNZLWKRUGLVWULEXWH
WKH /LEUDU\ H[FHSW DV H[SUHVVO\ SURYLGHG XQGHU WKLV /LFHQVH
Any attempt otherwise to copy, modify, sublicense, link with, or
GLVWULEXWHWKH/LEUDU\LVYRLGDQGZLOODXWRPDWLFDOO\WHUPLQDWH
\RXU ULJKWV XQGHU WKLV /LFHQVH +RZHYHU SDUWLHV ZKR KDYH
UHFHLYHG FRSLHV RU ULJKWV IURP \RX XQGHU WKLV /LFHQVH ZLOO
not have their licenses terminated so long as such parties
UHPDLQ LQ IXOO FRPSOLDQFH <RX DUH QRW UHTXLUHG WR DFFHSW
WKLV/LFHQVHVLQFH\RXKDYHQRWVLJQHGLW+RZHYHUQRWKLQJ
HOVHJUDQWV\RXSHUPLVVLRQWRPRGLI\RUGLVWULEXWHWKH/LEUDU\
or its derivative works. These actions are prohibited by law
LI\RXGRQRWDFFHSWWKLV/LFHQVH7KHUHIRUHE\PRGLI\LQJRU
GLVWULEXWLQJ WKH /LEUDU\ RU DQ\ ZRUN EDVHG RQ WKH /LEUDU\
\RXLQGLFDWH\RXUDFFHSWDQFHRIWKLV/LFHQVHWRGRVRDQGDOO
its terms and conditions for copying, distributing or modifying
WKH/LEUDU\RUZRUNVEDVHGRQLW(DFKWLPH\RXUHGLVWULEXWH
WKH/LEUDU\RUDQ\ ZRUN EDVHG RQ WKH /LEUDU\ WKH UHFLSLHQW
automatically receives a license from the original licensor to
FRS\ GLVWULEXWH OLQN ZLWK RU PRGLI\ WKH /LEUDU\ VXEMHFW WR
WKHVHWHUPVDQGFRQGLWLRQV<RXPD\QRWLPSRVHDQ\IXUWKHU
UHVWULFWLRQV RQ WKH UHFLSLHQWV
H[HUFLVH RI WKH ULJKWV JUDQWHG
KHUHLQ <RX DUH QRW UHVSRQVLEOH IRU HQIRUFLQJ FRPSOLDQFH E\
WKLUG SDUWLHV ZLWK WKLV /LFHQVH ,I DV D FRQVHTXHQFH RI D
court judgment or allegation of patent infringement or for
any other reason (not limited to patent issues), conditions
are imposed on you (whether by court order, agreement or
RWKHUZLVHWKDWFRQWUDGLFWWKHFRQGLWLRQVRIWKLV/LFHQVHWKH\
GRQRWH[FXVH\RXIURPWKHFRQGLWLRQVRIWKLV/LFHQVH,I\RX
cannot distribute so as to satisfy simultaneously your obligations
XQGHU WKLV /LFHQVH DQG DQ\ RWKHU SHUWLQHQW REOLJDWLRQV WKHQ
DV D FRQVHTXHQFH \RX PD\ QRW GLVWULEXWH WKH /LEUDU\ DW DOO
)RUH[DPSOHLIDSDWHQWOLFHQVHZRXOGQRWSHUPLWUR\DOW\IUHH
UHGLVWULEXWLRQ RI WKH /LEUDU\ E\ DOO WKRVH ZKR UHFHLYH FRSLHV
directly or indirectly through you, then the only way you could
VDWLVI\ERWKLWDQGWKLV/LFHQVHZRXOGEHWRUHIUDLQHQWLUHO\IURP
GLVWULEXWLRQRIWKH/LEUDU\,IDQ\SRUWLRQRIWKLVVHFWLRQLVKHOG
invalid or unenforceable under any particular circumstance, the
balance of the section is intended to apply, and the section
DV D ZKROH LV LQWHQGHG WR DSSO\ LQ RWKHU FLUFXPVWDQFHV ,W LV
not the purpose of this section to induce you to infringe any
patents or other property right claims or to contest validity of
DQ\VXFKFODLPVWKLVVHFWLRQKDVWKHVROHSXUSRVHRISURWHFWLQJ
the integrity of the free software distribution system which is
LPSOHPHQWHG E\ SXEOLF OLFHQVH SUDFWLFHV 0DQ\ SHRSOH KDYH
made generous contributions to the wide range of software
distributed through that system in reliance on consistent
DSSOLFDWLRQ RI WKDW V\VWHP LW LV XS WR WKH DXWKRUGRQRU WR
decide if he or she is willing to distribute software through any
other system and a licensee cannot impose that choice. This
section is intended to make thoroughly clear what is believed
*HQHUDO 3XEOLF /LFHQVH DORQJ ZLWK WKLV OLEUDU\ LI QRW ZULWH WR
WKH )UHH 6RIWZDUH )RXQGDWLRQ ,QF )UDQNOLQ 6WUHHW )LIWK
)ORRU%RVWRQ0$86$$OVRDGGLQIRUPDWLRQRQ
KRZWRFRQWDFW\RXE\HOHFWURQLFDQGSDSHUPDLO<RXVKRXOG
also get your employer (if you work as a programmer) or your
school, if any, to sign a "copyright disclaimer" for the library, if
QHFHVVDU\+HUHLVDVDPSOHDOWHUWKHQDPHV<R\RG\QH,QF
KHUHE\GLVFODLPVDOOFRS\ULJKWLQWHUHVW LQWKHOLEUDU\C)URE
D
OLEUDU\IRUWZHDNLQJNQREVZULWWHQE\-DPHV5DQGRP+DFNHU
VLJQDWXUH RI 7\ &RRQ! $SULO 7\ &RRQ 3UHVLGHQW RI
9LFH7KDW
VDOOWKHUHLVWRLW
libcurl
&23<5,*+7 $1' 3(50,66,21 127,&( &RS\ULJKW F 'DQLHO6WHQEHUJGDQLHO#KD[[VH!$OOULJKWVUHVHUYHG
Permission to use, copy, modify, and distribute this software for
any purpose with or without fee is hereby granted, provided
that the above copyright notice and this permission notice
DSSHDU LQ DOO FRSLHV 7+( 62)7:$5( ,6 3529,'(' $6 ,6
:,7+287 :$55$17< 2) $1< .,1' (;35(66 25 ,03/,('
,1&/8',1* %87 127 /,0,7(' 72 7+( :$55$17,(6 2)
0(5&+$17$%,/,7<),71(66)25$3$57,&8/$5385326($1'
121,1)5,1*(0(172)7+,5'3$57<5,*+76,112(9(17
6+$// 7+( $87+256 25 &23<5,*+7 +2/'(56 %( /,$%/(
)25$1<&/$,0'$0$*(62527+(5/,$%,/,7<:+(7+(5
,1$1$&7,212)&2175$&772572527+(5:,6($5,6,1*
)5202872)25,1&211(&7,21:,7+7+(62)7:$5(25
7+( 86( 25 27+(5 '($/,1*6 ,1 7+( 62)7:$5( ([FHSW
as contained in this notice, the name of a copyright holder
shall not be used in advertising or otherwise to promote the
sale, use or other dealings in this Software without prior written
authorization of the copyright holder.
libjpeg-7.txt
/(*$/,668(6
============
,QSODLQ(QJOLVK
:HGRQ¶WSURPLVHWKDWWKLVVRIWZDUHZRUNV%XWLI\RX¿QG
DQ\EXJVSOHDVHOHWXVNQRZ
<RXFDQXVHWKLVVRIWZDUHIRUZKDWHYHU\RXZDQW<RXGRQ¶W
have to pay us.
<RXPD\QRWSUHWHQGWKDW\RXZURWHWKLVVRIWZDUH,I\RX
use it in a program, you must acknowledge somewhere in your
GRFXPHQWDWLRQWKDW\RX¶YHXVHGWKH,-*FRGH
,QOHJDOHVH
7KH DXWKRUV PDNH 12 :$55$17< RU UHSUHVHQWDWLRQ HLWKHU
H[SUHVV RU LPSOLHG ZLWK UHVSHFW WR WKLV VRIWZDUH LWV TXDOLW\
DFFXUDF\ PHUFKDQWDELOLW\ RU ¿WQHVV IRU D SDUWLFXODU SXUSRVH
7KLV VRIWZDUH LV SURYLGHG ³$6 ,6´ DQG \RX LWV XVHU DVVXPH
the entire risk as to its quality and accuracy. This software is
FRS\ULJKW&7KRPDV*/DQH*XLGR9ROOEHGLQJ
$OO 5LJKWV 5HVHUYHG H[FHSW DV VSHFL¿HG EHORZ 3HUPLVVLRQ
is hereby granted to use, copy, modify, and distribute this
software (or portions thereof) for any purpose, without fee,
subject to these
FRQGLWLRQV
,IDQ\SDUWRIWKHVRXUFHFRGHIRUWKLVVRIWZDUHLVGLVWULEXWHG
WKHQ WKLV 5($'0( ¿OH PXVW EH LQFOXGHG ZLWK WKLV FRS\ULJKW
DQGQRZDUUDQW\QRWLFHXQDOWHUHGDQGDQ\DGGLWLRQVGHOHWLRQV
RU FKDQJHV WR WKH RULJLQDO ¿OHV PXVW EH FOHDUO\ LQGLFDWHG LQ
accompanying documentation.
,IRQO\H[HFXWDEOHFRGHLVGLVWULEXWHGWKHQWKHDFFRPSDQ\LQJ
documentation must state that “this software is based in part
RQWKHZRUNRIWKH,QGHSHQGHQW-3(**URXS´
(3) Permission for use of this software is granted only if the user
DFFHSWV IXOO UHVSRQVLELOLW\ IRU DQ\ XQGHVLUDEOH FRQVHTXHQFHV
WKHDXWKRUVDFFHSW12/,$%,/,7<IRUGDPDJHVRIDQ\NLQG
These conditions apply to any software derived from or based
RQWKH,-*FRGHQRWMXVWWRWKHXQPRGL¿HGOLEUDU\,I\RXXVH
RXU ZRUN \RX RXJKW WR DFNQRZOHGJH XV 3HUPLVVLRQ LV 127
JUDQWHGIRUWKHXVHRIDQ\,-*DXWKRU¶VQDPHRUFRPSDQ\QDPH
in advertising or publicity relating to this software or products
derived from it. This software may be referred to only as “the
,QGHSHQGHQW-3(**URXS¶VVRIWZDUH´:HVSHFL¿FDOO\SHUPLWDQG
encourage the use of this software as the basis of commercial
47
English
WR EH D FRQVHTXHQFH RI WKH UHVW RI WKLV /LFHQVH ,I WKH
GLVWULEXWLRQ DQGRU XVH RI WKH /LEUDU\ LV UHVWULFWHG LQ FHUWDLQ
countries either by patents or by copyrighted interfaces, the
RULJLQDO FRS\ULJKW KROGHU ZKR SODFHV WKH /LEUDU\ XQGHU WKLV
/LFHQVHPD\DGGDQH[SOLFLWJHRJUDSKLFDOGLVWULEXWLRQOLPLWDWLRQ
H[FOXGLQJWKRVHFRXQWULHVVRWKDWGLVWULEXWLRQLVSHUPLWWHGRQO\
LQ RU DPRQJ FRXQWULHV QRW WKXV H[FOXGHG ,Q VXFK FDVH WKLV
/LFHQVHLQFRUSRUDWHVWKHOLPLWDWLRQDVLIZULWWHQLQWKHERG\RI
WKLV /LFHQVH 7KH )UHH 6RIWZDUH )RXQGDWLRQ PD\ SXEOLVK
UHYLVHGDQGRUQHZYHUVLRQVRIWKH/HVVHU*HQHUDO3XEOLF/LFHQVH
from time to time. Such new versions will be similar in spirit to
the present version, but may differ in detail to address new
problems or concerns. Each version is given a distinguishing
YHUVLRQ QXPEHU ,I WKH /LEUDU\ VSHFL¿HV D YHUVLRQ QXPEHU RI
WKLV /LFHQVH ZKLFK DSSOLHV WR LW DQG DQ\ ODWHU YHUVLRQ \RX
have the option of following the terms and conditions either
of that version or of any later version published by the Free
6RIWZDUH)RXQGDWLRQ,IWKH/LEUDU\GRHVQRWVSHFLI\DOLFHQVH
version number, you may choose any version ever published by
WKH )UHH 6RIWZDUH )RXQGDWLRQ ,I \RX ZLVK WR LQFRUSRUDWH
SDUWVRIWKH/LEUDU\LQWRRWKHUIUHHSURJUDPVZKRVHGLVWULEXWLRQ
conditions are incompatible with these, write to the author
to ask for permission. For software which is copyrighted by
the Free Software Foundation, write to the Free Software
)RXQGDWLRQ ZH VRPHWLPHV PDNH H[FHSWLRQV IRU WKLV 2XU
decision will be guided by the two goals of preserving the free
status of all derivatives of our free software and of promoting
the sharing and reuse of software generally.
12:$55$17<%(&$86(7+(/,%5$5<,6
/,&(16(' )5(( 2) &+$5*( 7+(5( ,6 12 :$55$17< )25
7+( /,%5$5< 72 7+( (;7(17 3(50,77(' %< $33/,&$%/(
/$: (;&(37 :+(1 27+(5:,6( 67$7(' ,1 :5,7,1* 7+(
&23<5,*+7+2/'(56$1'2527+(53$57,(63529,'(7+(
/,%5$5<$6,6:,7+287:$55$17<2)$1<.,1'(,7+(5
(;35(66(' 25 ,03/,(' ,1&/8',1* %87 127 /,0,7('
72 7+( ,03/,(' :$55$17,(6 2) 0(5&+$17$%,/,7< $1'
),71(66 )25 $ 3$57,&8/$5 385326( 7+( (17,5( 5,6.
$6727+(48$/,7<$1'3(5)250$1&(2)7+(/,%5$5<,6
:,7+ <28 6+28/' 7+( /,%5$5< 3529( '()(&7,9( <28
$66807+( &267 2) $// 1(&(66$5< 6(59,&,1* 5(3$,5
25 &255(&7,21] ,1 12 (9(17 81/(66 5(48,5(' %<
$33/,&$%/( /$: 25 $*5((' 72 ,1 :5,7,1* :,// $1<
&23<5,*+7 +2/'(5 25 $1< 27+(5 3$57< :+2 0$<
02',)<$1'255(',675,%87(7+(/,%5$5<$63(50,77('
$%29(%(/,$%/(72<28)25'$0$*(6,1&/8',1*$1<
*(1(5$/ 63(&,$/ ,1&,'(17$/ 25 &216(48(17,$/
'$0$*(6$5,6,1*2872)7+(86(25,1$%,/,7<7286(
7+( /,%5$5< ,1&/8',1* %87 127 /,0,7(' 72 /266 2)
'$7$ 25 '$7$ %(,1* 5(1'(5(' ,1$&&85$7( 25 /266(6
6867$,1('%<<28257+,5'3$57,(625$)$,/85(2)7+(
/,%5$5<7223(5$7(:,7+$1<27+(562)7:$5((9(1
,) 68&+ +2/'(5 25 27+(5 3$57< +$6 %((1 $'9,6(' 2)
7+(3266,%,/,7<2)68&+'$0$*(6 (1'
2) 7(506 $1' &21',7,216 +RZ WR $SSO\ 7KHVH 7HUPV WR
<RXU1HZ/LEUDULHV,I\RXGHYHORSDQHZOLEUDU\DQG\RXZDQWLW
to be of the greatest possible use to the public, we recommend
making it free software that everyone can redistribute
DQG FKDQJH <RX FDQ GR VR E\ SHUPLWWLQJ UHGLVWULEXWLRQ
under these terms (or, alternatively, under the terms of the
RUGLQDU\*HQHUDO3XEOLF/LFHQVH7RDSSO\WKHVHWHUPVDWWDFK
WKHIROORZLQJQRWLFHVWRWKHOLEUDU\,WLVVDIHVWWRDWWDFKWKHP
WRWKHVWDUWRIHDFKVRXUFH¿OHWRPRVWHIIHFWLYHO\FRQYH\WKH
H[FOXVLRQ RI ZDUUDQW\ DQG HDFK ¿OH VKRXOG KDYH DW OHDVW WKH
"copyright" line and a pointer to where the full notice is found.
RQHOLQHWRJLYHWKHOLEUDU\
VQDPHDQGDEULHILGHDRIZKDWLW
GRHV!&RS\ULJKW&\HDU!QDPHRIDXWKRU!
7KLV OLEUDU\ LV IUHH VRIWZDUH \RX FDQ UHGLVWULEXWH LW DQGRU
PRGLI\LWXQGHUWKHWHUPVRIWKH*18/HVVHU*HQHUDO3XEOLF
/LFHQVHDVSXEOLVKHGE\WKH)UHH6RIWZDUH)RXQGDWLRQHLWKHU
YHUVLRQRIWKH/LFHQVHRUDW\RXURSWLRQDQ\ODWHUYHUVLRQ
This library is distributed in the hope that it will be useful, but
:,7+287$1<:$55$17<ZLWKRXWHYHQWKHLPSOLHGZDUUDQW\
RI 0(5&+$17$%,/,7< RU ),71(66 )25 $ 3$57,&8/$5
385326(6HHWKH*18/HVVHU*HQHUDO3XEOLF/LFHQVHIRUPRUH
GHWDLOV <RX VKRXOG KDYH UHFHLYHG D FRS\ RI WKH *18 /HVVHU
products, provided that all warranty or liability claims are
assumed by the product vendor. ansi2knr.c is included in this
English
GLVWULEXWLRQE\SHUPLVVLRQRI/3HWHU'HXWVFKVROHSURSULHWRURILWV
FRS\ULJKWKROGHU$ODGGLQ(QWHUSULVHVRI0HQOR3DUN&$
DQVLNQUF LV 127 FRYHUHG E\ WKH DERYH FRS\ULJKW DQG FRQGLWLRQV
but instead by the usual distribution terms of the Free Software
)RXQGDWLRQ SULQFLSDOO\ WKDW \RX PXVW LQFOXGH VRXUFH FRGH LI \RX
UHGLVWULEXWH LW 6HH WKH ¿OH DQVLNQUF IRU IXOO GHWDLOV +RZHYHU
since ansi2knr.c is not needed as part
RI DQ\ SURJUDP JHQHUDWHG IURP WKH ,-* FRGH WKLV GRHV QRW OLPLW
\RXPRUHWKDQWKHIRUHJRLQJSDUDJUDSKVGR7KH8QL[FRQ¿JXUDWLRQ
VFULSW³FRQ¿JXUH´ZDVSURGXFHGZLWK*18$XWRFRQI,WLVFRS\ULJKW
by the Free Software Foundation but is freely distributable. The same
KROGVIRULWVVXSSRUWLQJVFULSWVFRQ¿JJXHVVFRQ¿JVXEOWPDLQVK
$QRWKHUVXSSRUWVFULSWLQVWDOOVKLVFRS\ULJKWE\;&RQVRUWLXPEXWLV
DOVRIUHHO\GLVWULEXWDEOH7KH,-*GLVWULEXWLRQIRUPHUO\LQFOXGHGFRGH
WRUHDGDQGZULWH*,)¿OHV7RDYRLGHQWDQJOHPHQWZLWKWKH8QLV\V
/=:SDWHQW*,)UHDGLQJVXSSRUWKDVEHHQUHPRYHGDOWRJHWKHUDQG
WKH*,)ZULWHUKDVEHHQVLPSOL¿HGWRSURGXFH
³XQFRPSUHVVHG *,)V´ 7KLV WHFKQLTXH GRHV QRW XVH WKH /=:
DOJRULWKP WKH UHVXOWLQJ *,) ¿OHV DUH ODUJHU WKDQ XVXDO EXW DUH
UHDGDEOHE\DOOVWDQGDUG*,)GHFRGHUV
:HDUHUHTXLUHGWRVWDWHWKDW
³7KH *UDSKLFV ,QWHUFKDQJH )RUPDWF LV WKH &RS\ULJKW SURSHUW\ RI
&RPSX6HUYH,QFRUSRUDWHG*,)VPLVD6HUYLFH0DUNSURSHUW\RI
&RPSX6HUYH,QFRUSRUDWHG´
KWPO!
KHDG!
WLWOH!5XQWLPH(UURUWLWOH!
VW\OH!
ERG\^IRQWIDPLO\´9HUGDQD´IRQWZHLJKWQRUPDO
IRQWVL]HHPFRORUEODFN`
S^IRQWIDPLO\´9HUGDQD´IRQWZHLJKWQRUPDOFRORUEODFN
PDUJLQWRSS[`
E ^IRQWIDPLO\´9HUGDQD´IRQWZHLJKWEROGFRORUEODFNPDUJLQWRS
S[`
+^IRQWIDPLO\´9HUGDQD´IRQWZHLJKWQRUPDO
IRQWVL]HSWFRORUUHG`
+^IRQWIDPLO\´9HUGDQD´IRQWZHLJKWQRUPDO
IRQWVL]HSWFRORUPDURRQ`
SUH^IRQWIDPLO\´/XFLGD&RQVROH´IRQWVL]HHP`
PDUNHU^IRQWZHLJKWEROGFRORUEODFNWH[WGHFRUDWLRQQRQH`
YHUVLRQ^FRORUJUD\`
HUURU^PDUJLQERWWRPS[`
H[SDQGDEOH^WH[WGHFRUDWLRQXQGHUOLQHIRQWZHLJKW
EROGFRORUQDY\FXUVRUKDQG`
VW\OH!
KHDG!
ERG\EJFRORU ´ZKLWH´!
VSDQ!+!6HUYHU(UURULQµ¶$SSOLFDWLRQKUZLGWK VL]H FRORU VLOYHU!+!
K!L!5XQWLPH(UURUL!K!VSDQ!
IRQW IDFH ´$ULDO +HOYHWLFD *HQHYD 6XQ6DQV5HJXODU VDQVVHULI
³!
E!'HVFULSWLRQE!$QDSSOLFDWLRQHUURURFFXUUHGRQWKHVHUYHU
The current custom error settings for this application prevent the
details of the application error from being viewed remotely (for
VHFXULW\UHDVRQV,WFRXOGKRZHYHUEHYLHZHGE\EURZVHUVUXQQLQJ
on the local server machine.
EU!EU!
E!'HWDLOVE! 7R HQDEOH WKH GHWDLOV RI WKLV VSHFL¿F HUURU
message to be viewable on remote machines, please create
D OWFXVWRP(UURUVJW WDJ ZLWKLQ D TXRWZHEFRQ¿JTXRW
FRQ¿JXUDWLRQ ¿OH ORFDWHG LQ WKH URRW GLUHFWRU\ RI WKH FXUUHQW ZHE
DSSOLFDWLRQ 7KLV OWFXVWRP(UURUVJW WDJ VKRXOG WKHQ KDYH LWV
TXRWPRGHTXRWDWWULEXWHVHWWRTXRW2IITXRWEU!EU!
WDEOHZLGWK EJFRORU ´IIIIFF´!
WU!
WG!
FRGH!SUH!
OW:HE&RQ¿J&RQ¿JXUDWLRQ)LOHJW
OWFRQ¿JXUDWLRQJW
OWV\VWHPZHEJW
OWFXVWRP(UURUVPRGH TXRW2IITXRWJW
OWV\VWHPZHEJW
OWFRQ¿JXUDWLRQJWSUH!FRGH!
WG!
WU!
WDEOH!
EU!
E!1RWHVE! 7KH FXUUHQW HUURU SDJH \RX DUH VHHLQJ
48
can be replaced by a custom error page by modifying the
TXRWGHIDXOW5HGLUHFWTXRW DWWULEXWH RI WKH DSSOLFDWLRQ¶V
OWFXVWRP(UURUVJW FRQ¿JXUDWLRQ WDJ WR SRLQW WR D FXVWRP HUURU
SDJH85/EU!EU!
WDEOHZLGWK EJFRORU ´IIIIFF´!
WU!
WG!
FRGH!SUH!
OW:HE&RQ¿J&RQ¿JXUDWLRQ)LOHJW
OWFRQ¿JXUDWLRQJW
OWV\VWHPZHEJW
OWFXVWRP(UURUV PRGH TXRW5HPRWH2QO\TXRW GHIDXOW5HGLUHFW
TXRWP\FXVWRPSDJHKWPTXRWJW
OWV\VWHPZHEJW
OWFRQ¿JXUDWLRQJWSUH!FRGH!
WG!
WU!
WDEOH!
Unicode_Bidirectional_Algorithm
81,&2'( ,1& /,&(16( $*5((0(17 '$7$ ),/(6 $1'
62)7:$5(
8QLFRGH 'DWD )LOHV LQFOXGH DOO GDWD ¿OHV XQGHU WKH GLUHFWRULHV
KWWSZZZXQLFRGHRUJ3XEOLF KWWSZZZXQLFRGHRUJUHSRUWV
DQGKWWSZZZXQLFRGHRUJFOGUGDWD8QLFRGH6RIWZDUHLQFOXGHV
any source code published in the Unicode Standard or under the
GLUHFWRULHV KWWSZZZXQLFRGHRUJ3XEOLF KWWSZZZXQLFRGH
RUJUHSRUWVDQGKWWSZZZXQLFRGHRUJFOGUGDWD
127,&(7286(5&DUHIXOO\UHDGWKHIROORZLQJOHJDODJUHHPHQW
%<'2:1/2$',1*,167$//,1*&23<,1*2527+(5:,6(86,1*
81,&2'(,1&
6'$7$),/(6'$7$),/(6$1'2562)7:$5(
62)7:$5( <28 81(48,92&$//< $&&(37 $1' $*5(( 72
%( %281' %< $// 2) 7+( 7(506 $1' &21',7,216 2) 7+,6
$*5((0(17,)<28'2127$*5(('2127'2:1/2$',167$//
&23<',675,%87(2586(7+('$7$),/(62562)7:$5(
&23<5,*+7$1'3(50,66,21127,&(
&RS\ULJKWF8QLFRGH,QF$OOULJKWVUHVHUYHG'LVWULEXWHG
XQGHUWKH7HUPVRI8VHLQKWWSZZZXQLFRGHRUJFRS\ULJKWKWPO
Permission is hereby granted, free of charge, to any person
REWDLQLQJ D FRS\ RI WKH 8QLFRGH GDWD ¿OHV DQG DQ\ DVVRFLDWHG
documentation (the ""Data Files"") or Unicode software and any
associated documentation (the ""Software"") to deal in the Data Files
or Software without restriction, including without limitation the rights
to use, copy, modify, merge, publish, distribute, and/or sell copies of
the Data Files or Software, and to permit persons to whom the Data
Files or Software are furnished to do so, provided that (a) the above
copyright notice(s) and this permission notice appear with all copies
of the Data Files or Software, (b) both the above copyright notice(s)
and this permission notice appear in associated documentation, and
FWKHUHLVFOHDUQRWLFHLQHDFKPRGL¿HG'DWD)LOHRULQWKH6RIWZDUH
as well as in the documentation associated with the Data File(s) or
6RIWZDUHWKDWWKHGDWDRUVRIWZDUHKDVEHHQPRGL¿HG
7+( '$7$ ),/(6 $1' 62)7:$5( $5( 3529,'(' $6 ,6
:,7+287 :$55$17< 2) $1< .,1' (;35(66 25 ,03/,('
,1&/8',1* %87 127 /,0,7(' 72 7+( :$55$17,(6 2)
0(5&+$17$%,/,7< ),71(66 )25 $ 3$57,&8/$5 385326( $1'
121,1)5,1*(0(17 2) 7+,5' 3$57< 5,*+76 ,1 12 (9(17
6+$//7+(&23<5,*+7+2/'(525+2/'(56,1&/8'(',17+,6
127,&( %( /,$%/( )25 $1< &/$,0 25 $1< 63(&,$/ ,1',5(&7
25 &216(48(17,$/ '$0$*(6 25 $1< '$0$*(6 :+$762(9(5
5(68/7,1*)520/2662)86('$7$25352),76:+(7+(5,1
$1 $&7,21 2) &2175$&7 1(*/,*(1&( 25 27+(5 7257,286
$&7,21$5,6,1*2872)25,1&211(&7,21:,7+7+(86(25
3(5)250$1&(2)7+('$7$),/(62562)7:$5(
([FHSWDVFRQWDLQHGLQWKLVQRWLFHWKHQDPHRIDFRS\ULJKWKROGHU
shall not be used in advertising or otherwise to promote the sale, use
or other dealings in these Data Files or Software without prior written
authorization of the copyright holder."
Blu-ray DiscTM-Player
BDX1250KE
Bedienungsanleitung
Inhalt
Wichtig . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3-4
Sicherheit und wichtige Hinweise . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3
Entsorgung des alten Produkts und der Batterien . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3-4
2
Produktüberblick.
Regionalcodes . . . .
Produktüberblick . . .
Fernbedienung . . . .
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
. 5-7
.. 5
.. 6
.. 7
3
Anschlüsse. . . . . . . . . . . . . . . . . .
Anschluss an ein TV-Gerät . . . . . . . .
Optionaler Anschluss . . . . . . . . . . . .
Anschluss eines USB-Datenspeichers.
Netzanschluss. . . . . . . . . . . . . . . . .
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
. 8-9
.. 8
.. 8
.. 9
.. 9
4
Vorbereitung . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 10
Vorbereitung der Fernbedienung. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 10
Einrichtung des Players . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 10
5
Wiedergabe . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 11-13
Wiedergabe-Funktionen. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 11-13
6
Individuelle Anpassung.
Allgemeine Einstellungen . .
Anzeige-Einstellungen . . . .
Audio-Einstellungen. . . . . .
System-Informationen . . . .
7
Technische Daten . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 21
8
Fehlerbeseitigung . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 22-23
9
Glossar. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 24-25
D
1
2
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
14-20
14-18
18-19
. . 20
. . 20
Entsorgung des alten Produkts und der
Batterien
Sicherheit und wichtige Hinweise
Warnung:
‡ hEHUKLW]XQJVJHIDKU6WHOOHQ6LHGDV3URGXNW
niemals in einem beengten Raum auf. Für die
Belüftung sollte immer mindestens 10 cm
Freiraum auf allen Seiten bestehen.
Stellen Sie sicher, dass niemals Gardinen oder
andere Objekte die Belüftungsschlitze des
Produkts abdecken.
‡ %ULQJHQ6LHGDV3URGXNWGLH)HUQVWHXHUXQJ
oder Batterien niemals in die Nähe von
offenem Feuer oder anderen Wärmequellen,
einschließlich direktem Sonnenlicht.
‡ 9HUZHQGHQ6LHGLHVHV3URGXNWQXULQ
Innenräumen. Halten Sie dieses Produkt von
:DVVHU)HXFKWLJNHLWXQGÀVVLJNHLWVJHIOOWHQ
Gegenständen fern.
‡ 6WHOOHQ6LHGLHVHV3URGXNWQLHPDOVDXIDQGHUH
Elektrogeräte.
‡ +DOWHQ6LHZlKUHQG*HZLWWHUQ$EVWDQGYRP
Gerät.
‡ :HQQGHU1HW]VWHFNHURGHUHLQH
Gerätekupplung als Netztrenngerät verwendet
wird, muss dieses Netztrenngerät immer
leicht zugänglich sein.
LASER
VORSICHT:
WENN ANDERE ALS DIE HIERIN ANGEGEBENEN
BEDIENUNGS- UND VERFAHRENSWEISEN
$86*()h+57:(5'(1.$11',(6=8
GEFÄHRLICHER STRAHLUNGSEXPOSITION
)h+5(1
VORSICHT:
SICHTBARE UND UNSICHTBARE
LASERSTRAHLUNG BEI ÖFFNUNG UND
BESCHÄDIGTEN VERRIEGELUNGEN. NICHT IN
DEN STRAHL SEHEN.
ORT:
INNEN, IN DER NÄHE DER LAUFWERKMECHANIK.
Hinweis zur Einhaltung der EU-Richtlinien
Dieses Produkt ist mit der „CE”-Kennzeichnung
markiert und entspricht den zutreffenden
harmonisierten europäischen Normen, der
Niederspannungsrichtlinie 2006/95/EC und der
EMC-Richtlinie 2004/108/EC. ErP-Richtlinie
2009/125/EC
Verantwortlich für die CE-Markierung ist
TOSHIBA EUROPE GMBH
Hammfelddamm 8, D-41460 Neuss, Deutschland.
Pb,Hg,Cd
Folgende Informationen sind nur für
EU-Mitgliedstaaten gültig:
Entsorgung des Produkts
Das durchgestrichene Mülltonnensymbol zeigt
an, dass die Produkte gesammelt und separat
vom Hausmüll entsorgt werden müssen.
Integrierte Batterien und Akkus können mit
dem Produkt entsorgt werden. Sie werden in
den Recycling-Zentren getrennt.
Der schwarze Balken zeigt an, dass die
Produktmarkteinführung nach dem 13. August
2005 stattgefunden hat.
Durch die Mitwirkung an der separaten
Sammlung von Produkten und Batterien
unterstützen Sie die korrekte Entsorgung der
Produkte und Batterien und helfen somit,
mögliche negative Auswirkungen auf die
Umwelt und die menschliche Gesundheit zu
vermeiden.
Für detailliertere Informationen über
Abfallsammlung und Recyclingprogramme,
die in Ihrem Land zur Verfügung stehen,
kontaktieren Sie den Händler, bei dem Sie das
Produkt erworben haben.
Entsorgung von Batterien und/oder
Akkus
Das durchgestrichene Mülltonnensymbol
zeigt an, dass die Batterien und/oder Akkus
gesammelt und separat vom Hausmüll
entsorgt werden müssen.
Wenn die Batterie oder der Akku mehr als die
angegebenen Werte von Blei (Pb), Quecksilber
(Hg) und/oder Kadmium (Cd) enthalten, die in
der Batterie-Richtlinie (2006/66/EC) definiert
werden, dann erscheinen die chemischen
Symbole für Blei (Pb), Quecksilber (Hg)
und/oder Kadmium (Cd) unter dem
durchgestrichenen Mülltonnensymbol.
Durch die Mitwirkung an der separaten
Sammlung von Batterien unterstützen Sie
die korrekte Entsorgung der Produkte und
Batterien und helfen somit, mögliche negative
Auswirkungen auf die Umwelt zu verhindern.
Für detailliertere Informationen über
Abfallsammlung und Recyclingprogramme,
die in Ihrem Land zur Verfügung stehen
kontaktieren Sie den Händler, bei dem Sie das
Produkt erworben haben.
Copyright-Hinweis
Dieses Produkt enthält Copyright-geschützte
Technologie, die durch US-Patente und andere
Rechte für geistiges Eigentum geschützt sind.
Die Nutzung dieser Copyright-geschützten
Technologie muss von der Rovi Corporation
autorisiert sein und ist nur für die
Heimanwendung und andere eingeschränkte
Vorführanwendungen bestimmt, sofern keine
anderslautende Autorisierung durch die Rovi
Corporation vorliegt. Reverse Engineering und
Demontage sind verboten.
3
D
1 Wichtig
Hinweis zu Markenzeichen
D
+'0,GDV+'0,/RJRXQG+LJK'H¿QLWLRQ
Multimedia Interface sind Warenzeichen oder
eingetragene Warenzeichen der HDMI Licensing
LLC in den Vereinigten Staaten und anderen
Ländern.
BONUSVIEW ™
Blu-ray DiscTM, Blu-rayTM, BD-LiveTM,
BONUSVIEWTM und die Logos sind Warenzeichen
der Blu-ray Disc Association.
Hergestellt unter Lizenz von Dolby Laboratories.
Dolby und das Doppel-D-Symbol sind
Warenzeichen von Dolby Laboratories.
Oracle und Java sind eingetragene Warenzeichen
von Oracle und/oder dessen
Tochtergesellschaften. Andere Namen können
Warenzeichen ihrer jeweiligen Eigentümer sein.
h%(5',9;9,'(2
DivX® ein digitales Videoformat, das von DivX,
,QFHQWZLFNHOWZXUGH'LHVLVWHLQRI¿]LHOO
DivX®]HUWL¿]LHUWHV*HUlWGDV'LY;9LGHRV
wiedergibt. Besuchen Sie www.divx.com für
weitere Informationen und Software, um Ihre
Dateien in DivX-Videodateien umzuwandeln.
h%(5',9;9,'(221'(0$1'),/0($8)
ABRUF:
'LHVHV'LY;&HUWL¿HG®-Gerät muss registriert
werden, um erworbene DivX Video-on-Demand
(VOD)-Filme wiederzugeben. Um Ihren
Registriercode zu erhalten, suchen Sie den
DivX-VOD-Abschnitt im Einrichtungsmenü des
Geräts. Weitere Informationen zur Registrierung
¿QGHQ6LHXQWHUZZZYRGGLY[FRP
DivX®'LY;&HUWL¿HG® und zugehörige Logos sind
Markenzeichen von DivX, Inc. und werden
lizenziert verwendet.
Hergestellt unter Lizenz unter
U.S.-Patentnummern: 5,956,674; 5,974,380;
6,226,616; 6,487,535; 7,392,195; 7,272,567;
7,333,929; 7,212,872 und andere.
USA und weltweite Patente sind ausgestellt und
angemeldet. DTS-HD, das Symbol und DTS-HD
und das Symbol zusammen sind eingetragene
Warenzeichen und DTS-HD Master
Audio | Essential ist ein Warenzeichen von DTS,
Inc. Das Produkt umfasst Software. © DTS, Inc.
Alle Rechte vorbehalten.
'AVCHD' und das 'AVCHD'-Logo sind
Warenzeichen der Panasonic Corporation und
der Sony Corporation.
'DVD Video' ist ein Warenzeichen der DVD
Format/Logo Licensing Corporation.
4
Für den HD-Test-Kit 1080p v1.1 sowie spätere
Versionen:
'LY;&HUWL¿HG® zur Wiedergabe von DivX®
9LGHR'DWHLHQELV]XU+'$XÀ|VXQJS
inklusive Premium Inhalten.
Region
Regionalcodes
Sowohl der Blu-ray Disc -Player, als auch die
Discs sind nach Regionen codiert.
Diese Regionalcodes müssen übereinstimmen,
damit die Disc wiedergegeben werden kann.
Wenn die Codes nicht übereinstimmen, wird die
Disc nicht wiedergegeben.
Die Regionalnummer dieses Blu-ray DiscTMPlayers ist auf der Rückseite des Blu-ray
DiscTM-Players angegeben.
TM
Region
$
$!
$
"&'
%!
$"#!
$"
#!
Wiedergebbare
DVDs
ALL
1
ALL
2
ALL
3
ALL
4
$""$
ALL
5
""
"$$#$
"
ALL
6
Wiedergebbare
Blu-rayTM
Nordamerika,
Mittelamerika,
Südamerika,
Korea, Japan,
Taiwan, Hongkong
und Südostasien
Europa,
Griechenland,
Französische Gebiete,
Mittlerer Osten,
Afrika, Australien
und Neuseeland
D
2 Produktüberblick
Indien, China,
Russland,
Mittel- und Südasien
Besondere Ausstattungsmerkmale
Unterhaltung im HD-Format.
Genießen Sie HD-Discs mit HDTV
+LJK'H¿QLWLRQ7HOHYLVLRQ$QVFKOXVVEHU
Hochgeschwindigkeits-HDMI-Kabel. Genießen Sie
GLHH[]HOOHQWH%LOGTXDOLWlWPLWHLQHU$XÀ|VXQJ
von bis zu 1080p und 24 Bildern pro Sekunde im
Progressiv-Scan-Verfahren.
BD-LiveTM
Sie können mit diesem Player verschiedene
aktuelle Inhalte (z. B. aktualisierte
Filmvorschauen und exklusives Bonusmaterial)
über den LAN-Anschluss auf den Webseiten der
Filmstudios aufrufen.
Blu-ray DiscTM Java
Blu-ray DiscTM Java (BD-J) Anwendung
Das BD-ROM-Format unterstützt Java für
interaktive Funktionen. „BD-J” bietet
Inhaltsanbietern fast unbegrenzte
Funktionalitäten beim Erstellen von interaktiven
BD-ROM-Titeln.
5
Produktüberblick
Hauptgerät
6
7
5
4
3
2
1
D
NR.
Element
Funktion
a
Einschalten des Geräts oder Wechseln in den Stand-by-Modus.
b
#9
Wiedergabe/Pause.
c
Y
Wiedergabestopp.
d
;
Öffnen oder Schließen der Disc-Lade.
e
Displayfenster
Zeigt Informationen zum aktuellen Status des Geräts an.
f
IR-Sensor
Richten Sie die Fernbedienung auf den IR-Sensor.
g
Disc-Lade
Lädt eine Disc in das Disc-Laufwerk.
1
NR.
6
2
3
4
5
Element
Funktion
a
AC-Netzkabel
Anschluss an Standard-Netzsteckdose.
b
COAXIAL-Buchse
Ausgang von digitalen Audiosignalen, wenn ein Koaxial-Digitalkabel angeschlossen ist.
c
HDMI OUTPUT-Buchse
d
LAN-Buchse
Für den Anschluss an ein Netzwerk mit immer eingeschalteter Breitbandverbindung.
Dieser ist reserviert für die zukünftige Verwendung von BD-Live™.
e
USB-Buchse
Schließen Sie einen USB-Datenspeicher an.
Ausgang für Video/Audio-Signale zum Anschluss von TV-Gerät, Monitor oder
AV-Verstärker.
Anschluss für TV-Gerät, Monitor oder AV-Verstärker mit HDMI-Eingang.
Fernbedienung
OPEN/CLOSE
57!!) )#'$ 6 ) ,
$-
FERNBEDIENUNGSSIGNAL SENDER
5 ,) $ )/)"/! ) )-*,/! ,
,*).+'.. ,$#. )
ON/STANDBY
5:,$ /-1#'0*) 3$!! ,. )' ( ). )$( ):
5:,$ $, &. $)" 0*),&+$. '$. '
#' )--1*,.
OSC
5:, )/",$!!/!-$'-#$,(( ):
CLEAR
5:,-9-# ) $) -$).,"-* , $)" -. ''. ) - 3 $# )-/),*",((MC( $ ). ,)
5:,7
- $ ). ,
POP MENU/MENU
5:,$ )3 $" $) -/!0$ ' )'/,2
$-
$ *
$-- ).#'. ) ) ):OK
5 -.8.$" ) , ):/-1#'
50$".$*)/,-*,-. )!:,'$)&-, #.-/!
3$ # )
5
,:& )$ 18#, ) ,$ ,"
0*)/($ &./ '' #*.*'$-. 3/
,*.$ , )
$ $ ," 0*)1$,
% *#)" #'. )
RETURN
5/,:&3/' .3. ( ):
TOP MENU
5:,$ )3 $" -
$-$. '- $
$ ,"
PROGRAM
5:,-7!!) ) ,,*",(('$-.
DIGEST
5($ *,-#/)3 $" 18#, ) ,
$ ," 3/9!!) )
SUBTITLE
5:,$ /-1#' ,). ,.$. '1$ ,#*'.,:& )/(
0 ,-#$ ) /! ,
$-0 ,!:",
). ,.$. '3/18#' )
AUDIO
5:,$ /-1#' ,*)-+/,1$ ,#*'.,:& )/(
0 ,-#$ ) /! ,
$-0 ,!:", *)-+/, )3/
18#' )
ANGLE
5(-#'. ) -( ,1$)& '- $ ,$ ,"
<C2%"3*/3$)"-4&/0%&2%"3$)"-4&/*/%&/
4"/%#80%53%&3-52"8*3$>-"8&23
SETUP
D
Zahlen-Tasten
<@''/&40%&2#&&/%&4%"3834&.*/2*$)45/(3.&/C
REPEAT A-B
5:,$ $ ,#*'/)"0*)A $-
REPEAT
5:,$ /-1#'0 ,-#$ ) ,$ ,#*'(*$
SEARCH
5:,$ /# $)$. '+$. ')#,&
* ,$ ," 3 $.
DISPLAY
5:,)3 $" $) - )-. ,-/($. '+$. '
* ,,&3/4) )
5*!*,.$ ,#*'/)"*!*,./#
F.R & F.F
5#) '',:&18,.-#) ''0*,18,.PLAY/PAUSE
5.,.)#'. ) ,$ ,"
PREV & NEXT
5+,$)" )3/' .3. ()8#-. (+$. '$. ',&
STOP
5$ ," -.*++
5$ . . $) )')"-( )*,-+,/)"
$)*,(' ,$ ,"
5#'. .$(/- */-0*)
$'3/$'1 $. ,
ZOOM
<C2%"3&2(2B=&2/&2,-&*/&2/
BOOKMARK
<C2%"3*/'C(&/&*/&3&3&9&*$)&/3"/&*/&.
#&-*&#*(&/ *&%&2("#&9&*415/,4
PIP (Picture in Picture)
<*/0%&2533$)"-4&/%&397&*4&/*-%3
PIP AUDIO
<*/0%&2533$)"-4&/%&3
5%*040/3%&3
*-%3&*/0%&2"53
HDMI
<C2?/%&25/(%&25;B35/(%&3*%&0"53("/(3
952/1"335/("/TV&2A491*537
7
3 Anschlüsse
Die folgenden Anschlüsse sind für die Benutzung
dieses Produkts herzustellen:
Optionaler Anschluss
Option 1:
Anschluss an Digitalverstärker/
Empfänger
Anschluss an Netzwerk
Anschluss an ein TV-Gerät
Option 2:
Schließen Sie das Gerät an ein TV-Gerät an, um
die Disc wiederzugeben.
Option 1:
Anschluss an eine HDMI-Buchse
Leitet Ton von diesem Player an anderes Gerät
weiter, um die Audioausgabe zu verbessern.
Anschluss an Digitalverstärker/
Empfänger
DIGITAL AUDIO
INPUT
D
COAXIAL
HDMI IN
1. Schließen Sie ein HDMI-Kabel von der
HDMI-Ausgangsbuchse an diesem Produkt an
die HDMI-Eingangsbuchse des TV-Geräts an.
Hinweis: Ͳ ŝĞsŝĚĞŽĂƵƐŐĂďĞŬĂŶŶŽƉƟŵŝĞƌƚǁĞƌĚĞŶ͕
ŝŶĚĞŵĚŝĞdĂƐƚĞ,D/ǁŝĞĚĞƌŚŽůƚŐĞĚƌƺĐŬƚ
ǁŝƌĚ͕ƵŵĚŝĞďĞƐƚĞƵŇƂƐƵŶŐnjƵǁćŚůĞŶ͕ĚŝĞ
ǀŽŵdsͲ'ĞƌćƚƵŶƚĞƌƐƚƺƚnjƚǁŝƌĚ͘
1. Schließen Sie ein Koaxialkabel von der
COAXIAL-Buchse an diesem Gerät an die
COAXIAL-Buchse des anzuschließenden
Geräts an.
Option 2: Anschluss an Netzwerk
Schließen Sie das Gerät an das Netzwerk an,
um zusätzliche BD-LiveTM-Inhalte genießen zu
können und um das Software-Upgrade über das
Netzwerk ausführen zu können.
1. Schließen Sie ein Netzwerkkabel von der
LAN-Buchse am Produkt an die LAN-Buchse
des Netzwerkes an.
8
Anschluss des USB-Datenspeichers
D
Ein USB-Datenspeicher bietet zusätzlichen
Speicherplatz für Software-Upgrades und
BD-LiveTM-Bonus-Inhalte.
Zudem können Sie die auf dem USB-Gerät
gespeicherten MP3/JPEG/MPEG4/DivX®-Dateien
wiedergeben.
1. Schließen Sie das USB-Flash-Gerät an die
USB-Buchse dieses Geräts an.
Hinweise:
Ͳ ^ĐŚůŝĞƘĞŶ^ŝĞŶƵƌĞŝŶh^Ͳ&ůĂƐŚͲ'ĞƌćƚĂŶĚŝĞ
h^ͲƵĐŚƐĞĚŝĞƐĞƐ'ĞƌćƚƐĂŶ͘
Ͳ tĞŶŶ^ŝĞͲ>ŝǀĞΡͲŽŶƵƐͲ/ŶŚĂůƚĞŐĞŶŝĞƘĞŶ
ŵƂĐŚƚĞŶ͕ǀĞƌǁĞŶĚĞŶ^ŝĞĂůƐůŽŬĂůĞŶ^ƉĞŝĐŚĞƌ
einen USB-­‐Datenspeicher mit mindestens 1GB͘
Ͳ ĞŝĞŝŶŝŐĞŶůƵͲƌĂLJdDͲŝƐĐƐŵŝƚͲ>ŝǀĞdD-­‐
&ƵŶŬƟŽŶŵƺƐƐĞŶ^ŝĞĞǀƚů͘ĚĂƐh^Ͳ'ĞƌćƚǀŽƌ
ĚĞŵ>ĂĚĞŶĚĞƌŝƐĐĂŶƐĐŚůŝĞƘĞŶ͘^ŽŶƐƚǁŝƌĚ
Ğǀƚů͘ĚŝĞŝƐĐŶŝĐŚƚǁŝĞĚĞƌŐĞŐĞďĞŶ͘
Ͳ dK^,/ŐĂƌĂŶƟĞƌƚŬĞŝŶĞϭϬϬйŝŐĞ
<ŽŵƉĂƟďŝůŝƚćƚŵŝƚĂůůĞŶh^Ͳ&ůĂƐŚͲ'ĞƌćƚĞŶ͘
Netzanschluss
1. Anschließen des Netzkabels:
- an der Netzsteckdose.
‡ 'DV*HUlWNDQQMHW]WIUGLH%HQXW]XQJ
eingerichtet werden.
Hinweise: -­‐ sŽƌĚĞŵŶƐĐŚůƵƐƐĚĞƐEĞƚnjŬĂďĞůƐƐƚĞůůĞŶ^ŝĞ
ďŝƩĞƐŝĐŚĞƌ͕ĚĂƐƐĂůůĞĂŶĚĞƌĞŶŶƐĐŚůƺƐƐĞ
ĂƵƐŐĞĨƺŚƌƚǁƵƌĚĞŶ͘
-­‐ 'ĞĨĂŚƌǀŽŶ^ĐŚćĚĞŶĂŵ'Ğƌćƚ͊^ƚĞůůĞŶ^ŝĞ
ƐŝĐŚĞƌ͕ĚĂƐƐĚŝĞEĞƚnjƐƉĂŶŶƵŶŐŵŝƚĚĞƌĂƵĨĚĞƌ
'ĞƌćƚĞƌƺĐŬƐĞŝƚĞĂƵĨŐĞĚƌƵĐŬƚĞŶ^ƉĂŶŶƵŶŐ
ƺďĞƌĞŝŶƐƟŵŵƚ͘
-­‐ ĂƐdLJƉĞŶƐĐŚŝůĚďĞĮŶĚĞƚƐŝĐŚĂƵĨĚĞƌ
'ĞƌćƚĞƌƺĐŬƐĞŝƚĞ͘
9
4 Vorbereitung
Folgen Sie immer den Anweisungen dieses
Kapitels genau nach ihrer Reihenfolge.
Hinweis:
Ͳ tĞŶŶĂŶĚĞƌĞĂůƐĚŝĞŚŝĞƌŝŶĂŶŐĞŐĞďĞŶĞŶ
ĞĚŝĞŶƵŶŐƐͲƵŶĚsĞƌĨĂŚƌĞŶƐǁĞŝƐĞŶĂƵƐŐĞĨƺŚƌƚ
ǁĞƌĚĞŶ͕ŬĂŶŶĚŝĞƐnjƵŐĞĨćŚƌůŝĐŚĞƌ
^ƚƌĂŚůƵŶŐƐĞdžƉŽƐŝƟŽŶŽĚĞƌĂŶĚĞƌĞŶŐĞĨćŚƌůŝĐŚĞŶ
ĞƚƌŝĞďƐnjƵƐƚćŶĚĞŶĨƺŚƌĞŶ͘
Vorbereitung der Fernbedienung
D
1. Öffnen Sie den Batteriefachdeckel.
2. Setzen Sie eine R03-Batterie mit der korrekten
Polarität (+/-), wie angezeigt, ein.
3. Schließen Sie den Batteriefachdeckel.
Hinweise: Ͳ tĞŶŶ^ŝĞĚŝĞ&ĞƌŶďĞĚŝĞŶƵŶŐůćŶŐĞƌĞĞŝƚŶŝĐŚƚ
ďĞŶƵƚnjĞŶ͕ĞŶƞĞƌŶĞŶ^ŝĞĚŝĞĂƩĞƌŝĞŶ͘
Ͳ džƉůŽƐŝŽŶƐŐĞĨĂŚƌ͊,ĂůƚĞŶ^ŝĞĂƩĞƌŝĞŶǀŽŶ
,ŝƚnjĞ͕^ŽŶŶĞŶůŝĐŚƚƵŶĚ&ĞƵĞƌĨĞƌŶ͘ŶƚƐŽƌŐĞŶ
^ŝĞĂƩĞƌŝĞŶŶŝĞŵĂůƐŝŵ&ĞƵĞƌ͘
‡ 'LHPD[LPDOHQ)XQNWLRQVEHUHLFKHIU
das Gerät sind Folgende:
- Sichtlinie: ca. 10 m
- Nach jeder Seite von der Mitte aus:
ca. 7 m innerhalb 30°
- Oberhalb: ca. 7 m innerhalb 30°
- Unterhalb: ca. 7 m innerhalb 30°
7m
10
10 m
7m
Einrichtung des Players
Suchen Sie den korrekten
Wiedergabeeingan
1. Drücken Sie auf , um dieses Gerät
einzuschalten.
2. Schalten Sie das TV-Gerät ein und wechseln
Sie zum korrekten Video-Eingang (siehe
Bedienungsanleitung des TV-Geräts zur
Auswahl des korrekten Eingangs).
Ersteinstellung
Wenn Sie dieses Gerät zum ersten Mal
einschalten, befolgen Sie bitte die folgenden
Schritte:
1. Nach dem Einschalten des Produkts erscheint
ein Begrüßungsbildschirm.
2. Drücken Sie auf OK, um die Spracheinstellung
zu öffnen.
3. Wählen Sie die gewünschte Sprache, die
$XÀ|VXQJXQGGDV%LOGVHLWHQYHUKlOWQLVPLW
S/T aus und drücken Sie anschließend auf
OK.
4. Drücken Sie auf SETUP, um das Menü
„Einstellungen” zu schließen.
Menü EINSTELLUNGEN verwenden
1. Drücken Sie auf SETUP, um das Menü
„Einstellungen” bei Wiedergabe vom Blu-ray
DiscTM-Player oder ohne Disc anzuzeigen.
Drücken Sie auf SETUP, um das Menü
„Einstellungen” zu schließen.
dŝƉƉ͗
Ͳ ĞŝĚĞƌtŝĞĚĞƌŐĂďĞǀŽŶ,ŝŐŚͲĞĮŶŝƟŽŶͲYƵĞůůĞŶ
ŵƺƐƐĞŶ^ŝĞĂƵĨSTOP „ ĚƌƺĐŬĞŶ͕ƵŵĚŝĞ
^ĐŚŶŝƩƐƚĞůůĞĞŝŶƐƚĞůůƵŶŐĞŶ ĂƵĨnjƵƌƵĨĞŶ͘
Auswahl der Menü-Anzeigesprache
1. Drücken Sie auf SETUP, dann wird das Menü
[Allgemeine Einstellungen] angezeigt.
2. Wählen Sie [Sprache], dann drücken
Sie auf X.
3. Wählen Sie [OSD], dann drücken Sie auf X.
- Die Sprachoptionen sind je nach Region
unterschiedlich.
4. Drücken Sie auf S/T, um die Sprache zu
wählen, dann drücken Sie auf OK.
Hinweis:
Ͳ tĞŶŶĚŝĞƐĞƌŝƐĐͲWůĂLJĞƌĂŶĞŝŶ,D/ͲͲ
ŬŽŵƉĂƚŝďůĞƐdsͲ'ĞƌćƚĂŶŐĞƐĐŚůŽƐƐĞŶŝƐƚ͕
ƺďĞƌƐƉƌŝŶŐĞŶ^ŝĞĚŝĞƐĞŝŶƐƚĞůůƵŶŐ͘ƐǁŝƌĚ
ĂƵƚŽŵĂƚŝƐĐŚĚŝĞŐůĞŝĐŚĞK^ͲŽĚĞƌ
ŝůĚƐĐŚŝƌŵŵĞŶƺƐƉƌĂĐŚĞǁŝĞŝŶĚĞŶ dsͲ'ĞƌćƚĞĞŝŶƐƚĞůůƵŶŐĞŶǀĞƌǁĞŶĚĞƚ͘
Wiedergabe-Funktionen
Normale Wiedergabe
1. Drücken Sie auf den Schalter an der
Frontplatte oder auf der Fernbedienung, dann
schaltet sich Ihr Blu-ray Disc™-Player ein.
Das Gerät benötigt 20 Sekunden für das
Aufwärmen.
2. Schalten Sie das TV-Gerät ein, dann wählen
Sie die Eingangseinstellung auf dem TV-Gerät,
die der Anschlussmethode entspricht, mit
welcher der Player angeschlossen ist.
3. Drücken Sie auf OPEN/CLOSE ;, um die
Disc-Lade zu öffnen.
4. Legen Sie eine Disc in die Lade mit der
Beschriftung nach oben ein und drücken Sie
dann auf OPEN/CLOSE ;, um die Lade wieder
zu schließen.
Die Disc-Ladezeit ist abhängig vom
eingelegten Disc-Typ und das Laden einer
Blu-ray DiscTM-Disc dauert länger.
5. Wenn die automatische Disc-Wiedergabe
nicht startet, drücken Sie bitte auf #9, um
die Wiedergabe zu starten.
6. Wenn ein Blu-ray DiscTM- oder DVD-Menü
angezeigt wird, verwenden Sie den Cursor,
um PLAY zu wählen. Drücken Sie dann zum
Bestätigen auf OK.
7. Für den Auswurf der Disc drücken Sie auf
OPEN/CLOSE ;.
Wiedergabe pausieren.
1. Drücken Sie auf #9, um die Wiedergabe zu
unterbrechen. Der Ton wird stumm geschaltet.
2. Drücken Sie #9, um die normale Wiedergabe
fortzusetzen.
Wiedergabe stoppen
1. Drücken Sie einmal auf die Taste STOP „, um
in den Wiederaufnahme-Modus zu schalten,
auf dem TV-Bildschirm wird das
Wiederaufnahme-Logo angezeigt.
2. Drücken Sie zweimal auf STOP „, um die
Wiedergabe vollständig abzubrechen.
3. Drücken Sie auf #9, um die Wiedergabe am
Stopppunkt der Wiedergabe oder ab dem
Anfang wieder aufzunehmen, nachdem die
Wiedergabe vollständig abgebrochen wurde.
Nicht alle Blu-rayTM-Discs unterstützen die
Wiederaufnahme-Funktion.
2. Drücken Sie #9, um die normale Wiedergabe
fortzusetzen.
3. Drücken Sie für den schnellen Rückwärtslauf
durch die Disc auf F. R N. Die RückwärtsGeschwindigkeit ändert sich je nachdem, wie
oft die Taste gedrückt wird. Die
Geschwindigkeit wird in folgender Reihenfolge
gesteigert:
2X, 4X, 8X, 16X, 32X
4. Drücken Sie #9, um die normale Wiedergabe
fortzusetzen.
Sofort-Suche und Sofort-Wiederholung
1. Wenn Sie während der Wiedergabe die Taste
. drücken und halten, können Sie den
Suchlauf 30 Sekunden vorwärts starten.
2. Drücken und halten Sie bei der Wiedergabe
die Taste N, dann werden die letzten
10 Sekunden wiederholt.
Zurück und Weiter
Drücken Sie bei der Wiedergabe auf die Taste
PREV , dann können Sie zum letzten Kapitel
oder Track zurückspringen. Jeder Druck dieser
Taste gestattet den Sprung zu einem Kapitel
oder Track bis zum Anfang der Disc.
Drücken Sie bei der Wiedergabe auf die Taste
NEXT , dann können Sie zum nächsten
Kapitel oder Track vorwärts springen.
Langsam vorwärts
1. Drücken Sie während der normalen
Wiedergabe auf #. Die Geschwindigkeit des
langsamen Vorwärtslaufs ist standardmäßig
1/16.
2. Um die langsame Vorwärtsgeschwindigkeit zu
ändern, drücken Sie wiederholt auf #, dann
ändert sich die Vorwärtsgeschwindigkeit in
der folgenden Reihenfolge: 1/16, 1/8, 1/4,
1/2, Normal.
3. Um den langsamen Vorwärts-Modus zu
beenden und zur normalen Wiedergabe
zurückzukehren, drücken Sie auf #9.
Schritt vorwärts
Verwenden Sie diese Funktion, um ein Video Bild
für Bild zu genießen.
1. Drücken Sie bei normaler Wiedergabe auf
#9, dann schaltet die Wiedergabe in den
Pause-Status um.
2. Drücken Sie wiederholt auf #, um von Bild
zu Bild vorwärts zu wechseln.
3. Drücken Sie auf #9, um die normale
Wiedergabe fortzusetzen.
Schnell vorwärts und schnell rückwärts
HDMI
1. Drücken Sie auf F.F . für den schnellen
Vorwärtslauf durch die Disc. Die VorwärtsGeschwindigkeit ändert sich je nachdem, wie
oft die Taste gedrückt wird. Die
Geschwindigkeit wird in folgender Reihenfolge
gesteigert:
2X, 4X, 8X, 16X, 32X
Bei der Wiedergabe einer Datei oder einer Disc
GDUIGLH$XÀ|VXQJQLFKWEHUGLH+'0,7DVWHDXI
der Fernbedienung umgeschaltet werden.
11
D
5 Wiedergabe
D
Erweiterte Wiedergabe
DISPLAY
Durch Drücken dieser Taste zeigt der Bildschirm,
wie folgt, einige Informationen zur Disc an:
Titelnummer, Abschnittsnummer, Track-Nummer,
Vergangene Zeit, Modus, Audio, Winkel und
Untertitelsprachen. Drücken Sie diese Taste
erneut, um die Informationsanzeige
auszuschalten.
REPEAT
Drücken Sie wiederholt auf REPEAT, um die
unterschiedlichen Wiederholungsmodi
auszuwählen.
DVD: Kapitel wiederholen, Titel wiederholen und
Alle.
VCD PBC Aus/CD/JPEG/MP3: Track wiederholen
und Alle.
A-B
Für die Wiederholung eines bestimmten
Abschnitts im Video oder im Titel drücken Sie auf
die Taste A-B, um den Startpunkt festzulegen.
Erneutes Drücken von A-B legt den Endpunkt fest
und beendet die Einstellung. Der ausgewählte
Abschnitt wird wiederholt.
Drücken Sie die Taste A-B ein drittes Mal, um die
Funktion abzubrechen.
Der Endpunkt muss mindestens 5 Sekunden nach
dem Startpunkt festgelegt werden.
SEARCH
Bei der Wiedergabe drücken Sie auf die Taste
SEARCH, um Titel, Abschnitt und Zeit zu
bearbeiten.
Drücken Sie auf W/X und auf OK auf der
Fernbedienung, um Titel, Abschnitt oder Zeit
auszuwählen. Drücken Sie dann auf die ZahlenTasten oder auf S/T und dann auf OK. Die
Wiedergabe springt an die gewünschte Stelle.
Für die Zeitsuche drücken Sie auf S/T, um die
Titel- oder Kapitelsuche auszuwählen.
SUBTITLE
Nach wiederholtem Drücken dieser Taste wird
„X/XX XXX” oder „Aus” angezeigt. Das „X” zeigt
die aktuelle Nummer in dieser Sprache an; „XX”
zeigt die Gesamtzahl in der Sprache an; „XXX”
zeigt die Sprache an.
Die Zahl der verfügbaren Sprachen ist von der
Disc abhängig.
RETURN
Drücken Sie auf diese Taste, um zum letzten
Bildschirmmenü im Setup-Menü zurückzukehren,
z. B. Ext. Speicher-Information, Kinderschutz,
Länder Code usw.
Drücken Sie ein Mal RETURN während der MP3/
JPEG/VIDEO-Wiedergabe, dann kehrt der Player
zur Seite Medienzentrum zurück.
Bei der Wiedergabe einer VCD-Disc, wenn PBC
Ein gewählt ist, drücken Sie auf die Taste, um
zum PBC-Menü zurückzukehren.
ANGLE
Bei der Wiedergabe drücken Sie auf diese Taste,
um den Bildwinkel zu ändern. Auf dem Bildschirm
wird „Winkel X/X” angezeigt. Das erste „X” zeigt
die aktuelle Winkelnummer an und das zweite
„X” zeigt die Gesamtzahl der Winkel an.
Nicht alle Blu-rayTM oder DVDs besitzen die
Mehrfach-Winkelfunktion. Das Gerät benötigt ca.
5 Sekunden für das Wechseln.
TOP MENU
Diese Taste kann jederzeit gedrückt werden,
dann wird bei der Blu-ray DiscTM- oder DVDVideowiedergabe das Disc-Menü angezeigt.
12
POP MENU/MENU
Drücken Sie während der Blu-ray-DiscTMWiedergabe auf POP MENU/MENU, um den
Disc-Titel im Menü auf dem Bildschirm
anzuzeigen, ohne die Wiedergabe zu stoppen.
1. Drücken Sie die Tasten S/T/W/X, um eine
Option auszuwählen und drücken Sie zum
Bestätigen auf OK.
2. Drücken Sie auf POP MENU/MENU, um das
Menü zu schließen.
Bei der DVD-Wiedergabe drücken Sie auf POP
MENU/MENU, um das Disc-Menü zu öffnen.
Bei der VCD-Wiedergabe drücken Sie auf POP
MENU/MENU, um PBC ein- bzw. auszuschalten.
Bei der Anzeige von USB-Datenspeichern- und
Daten-Disc-Dateiinhalten im Medienzentrum
drücken Sie auf POP MENU/MENU, um Foto/Musik/
Video-Dateien zur Wiedergabeliste hinzuzufügen.
1. Drücken Sie S/T/W/X, um eine Option aus
den Foto/Musik/Video-Dateien zu wählen.
2. Drücken Sie im Dateibrowser auf X, um die
Dateien auszuwählen, die zur Wiedergabeliste
KLQ]XJHIJWZHUGHQVROOHQÄ¥´HUVFKHLQW
neben den ausgewählten Dateien.
3. Drücken Sie die Taste POP MENU/MENU. Ein
Pop-Up-Menü erscheint. Drücken Sie
anschließend S/T und auf die Taste OK, um
„Zur Wiedergabeliste hinzufügen”
auszuwählen und die Dateien zur
Wiedergabeliste hinzuzufügen. Die Optionen
„Alle auswählen” und „Alle entfernen” sind
ebenfalls verfügbar. Wählen Sie „Abbruch”,
um das Pop-Up-Menü zu schließen.
Alle gewählten Dateien werden zum Ordner
„Wiedergabeliste” hinzugefügt. Die Dateien in
der Wiedergabeliste können entweder
wiedergegeben oder gelöscht werden.
Drücken Sie POP MENU/MENU, um die
ausgewählten Dateien in der
„Wiedergabeliste” zu löschen.
SETUP
Drücken Sie auf die Taste SETUP, dann werden
einige Informationen, wie folgt, über den Player
angezeigt:
‡ Allgemeine Einstellungen
‡ Anzeige-Einstellungen
‡ Audio-Einstellungen
‡ System-Informationen
PROGRAM
Bei der CD/DVD/VCD-Wiedergabe können Sie auf
diese Taste drücken, um die Reihenfolge der
Wiedergabeliste zu bearbeiten.
BOOKMARK
Bei der Wiedergabe einer VCD/DVD/DivX®-Disc
drücken Sie die Taste BOOKMARK, um ein
Lesezeichen hinzuzufügen und halten Sie diese
einige Sekunden, um die bereits bestehende
Lesezeichenliste anzuzeigen, dann können Sie
auf die Taste OK drücken, um das Lesezeichen
auszuwählen oder auf die Taste CLEAR, um das
Lesezeichen zu löschen.
AUDIO
Drücken Sie auf die Taste AUDIO auf der
Fernbedienung, um die Audiospuren zu wählen,
die auf der Blu-rayTM- oder DVD-Disc vorhanden
sind.
Der Bildschirm zeigt Folgendes an:
AUDIO: X/XX XXX XXXX
„X” - Die aktuelle Audiospurnummer
„XX” - Die Gesamtzahl der Audiospuren
„XXX” - Audio-Sprache
„XXXX” - Audio-Technologie
[Subtitle-Stil]: Bei der Wiedergabe von Blu-ray
DiscTM-Discs oder DVDs, wenn sie externe
Untertitel enthalten, werden diese im OSC- oder
Bildschirmmenü angezeigt.
[Bitrate]: Verwenden Sie S/T, um die
gewünschte Bitrate zu wählen.
[Weiterhin Aus]: Beenden der Standbild-Funktion
der DVD-Disc.
Bei einigen DVD-Discs werden bestimmte
Videobilder während der Wiedergabe als
Standbilder angezeigt, damit der Zuschauer ein
einzelnes Bild besser sehen kann. Um die
Wiedergabe fortzusetzen, wählen Sie Weiterhin
Aus.
[Schnelle Suche]: Sofortige Suche um
30 Sekunden vorwärts.
[Schneller Rücklauf]: Wiederholung der letzten
10 Sekunden.
dŝƉƉƐ͗
Ͳ ŝĞĂŶŐĞŐĞďĞŶĞ&ƵŶŬƟŽŶǀĂƌŝŝĞƌƚĨƺƌũĞĚĞƐůĞŵĞŶƚ
ũĞŶĂĐŚŝƐĐͲdLJƉ͘ŝŶŝŐĞůĞŵĞŶƚĞƐŝŶĚŶƵƌǀĞƌĨƺŐďĂƌ͕
ǁĞŶŶƐŝĞǀŽŶĚĞƌŝƐĐƵŶƚĞƌƐƚƺƚnjƚǁĞƌĚĞŶ͘
Ͳ ĞƌŝǀyΠͲhŶƚĞƌƟƚĞůĚĂƚĞŝŶĂŵĞ;͘ƐƵďͿŵƵƐƐƵŶƚĞƌ
ĚĞŵŐůĞŝĐŚĞŶĂƚĞŝŶĂŵĞŶǁŝĞĚĞƌ&ŝůŵ;͘ĂǀŝͿŝŵ
ƐĞůďĞŶKƌĚŶĞƌ;nj͘͘KƌĚŶĞƌ͗ĂďĐ͘ĂǀŝƵŶĚĂďĐ͘ƐƵďͿ
ŐĞƐƉĞŝĐŚĞƌƚǁĞƌĚĞŶ͘
Blu-ray DiscTM BONUSVIEWTM
Die Funktion zum Abspielen des 2. Videos
(Bild-in-Bild) und des 2. Audiotons ist nur für
Blu-ray DiscTM-Discs verfügbar. Das 2. Video kann
von einer Disc wiedergegeben werden, die mit der
Bild-in-Bild-Funktion kompatibel ist. Details zur
Wiedergabemethode siehe Anweisungen der Disc.
1. Schalten Sie das 2. Video ein, indem Sie die
Taste PIP drücken.
2. Drücken Sie auf die Taste PIP AUDIO, um den 2.
Audioton zu wählen und wählen Sie eine der
Optionen außer Aus. Der 2. Audioton wird geöffnet
und Sie hören den Ton zum 2. Bild der Disc.
Um den 2. Audioton zu hören, muss die
PIP-Funktion der Disc eingeschaltet sein.
3. Drücken Sie die PIP-Taste erneut, um das 2.
Video auszuschalten.
Hauptvideo
Bild-in-Bild Video
Diese Funktion ist nicht verfügbar, wenn das 1.
Video in den Modi Suche, Zeitlupe oder Bild-für-Bild
oder Schnell Vor-/Rückwärts wiedergegeben wird.
Um den 2. Audioton zu hören, muss der digitale
Audioausgang auf „Bitstream”, „Neu kodieren”
oder „PCM” eingestellt sein. Sonst kann nur der 1.
Audioton gehört werden.
Hinweise:
Ͳ EŝĐŚƚĂůůĞůƵͲƌĂLJdDͲŝƐĐƐƵŶƚĞƌƐƚƺƚnjĞŶĚŝĞƐĞ
&ƵŶŬƟŽŶ͘
Ͳ ,ŝŐŚĞĮŶŝƟŽŶͲW/W;Ϯ͘sŝĚĞŽͿǁŝƌĚŶŝĐŚƚƵŶƚĞƌƐƚƺƚnjƚ͘
13
D
MC
Drücken Sie auf diese Taste, um Mediendateien
auf dem USB-Datenspeicher wiederzugeben.
ZOOM
Drücken Sie wiederholt auf ZOOM, um das Bild
bei der Wiedergabe zu vergrößern/verkleinern.
Zoom-Modus: Zoom 2x -> Zoom 3x -> Zoom 4x ->
Zoom 1/2 -> Zoom 1/3 -> Zoom 1/4.
DIGEST
Bei der Wiedergabe einer JPEG-Disc drücken Sie
auf DIGEST, um eine Seite mit 12 Vorschaubildern
anzuzeigen.
- Verwenden Sie S/T/W/X, um eine Option zu
wählen. Drücken Sie auf OK, um das
ausgewählte Bild in Vollbildschirmanzeige zu
sehen, die folgenden Bilder werden
automatisch nacheinander angezeigt.
- Drücken Sie auf PREV
/NEXT
, um den
letzten oder nächsten Vorschaubildschirm
anzuzeigen.
PIP AUDIO
Drücken Sie auf die Taste PIP AUDIO, um den 2.
Audioton des 2. Bilds aufzurufen (PIP-Video 2. Bild).
OSC
Drücken Sie auf OSC, um das Bildschirmmenü bei
der Wiedergabe zu öffnen. In diesem Menü
können Sie einige Steuerbefehle in Bezug auf die
Wiedergabe wählen.
Das Bildschirmmenü enthält die folgenden Elemente:
[Titel]: Der Titel der aktuellen Wiedergabe/alle
Titel. Wählen Sie den gewünschten Titel für die
Wiedergabe.
[Abschnitt]: Das Kapitel der aktuellen
Wiedergabe/alle Kapitel. Wählen Sie das
gewünschte Kapitel für die Wiedergabe.
[Zeit]: Anzeige der vergangenen/verbleibenden
Wiedergabezeit von Titel/Kapitel. Verwenden Sie
S/T, um Folgendes anzuzeigen: die vergangene
Wiedergabezeit des Titels, die verbleibende
Wiedergabezeit des Titels, die vergangene
Wiedergabezeit des Kapitels, die verbleibende
Wiedergabezeit des Kapitels.
[Modus]: Wiedergabemodus unter Mischen,
Zufall und Normal auswählen.
[Audio]: Die Blu-ray DiscTM/DVD-SoundtrackSprache. Verwenden Sie S/T, um die
verfügbaren Audiosprachen der Disc anzuzeigen
und den gewünschten Audiotyp zu wählen.
[Winkel]: Die Winkelansicht der aktuellen
Wiedergabe/alle Winkel. Weitere Details siehe
Wiedergabe > Angle.
Verwenden Sie S/T, um die gewünschte
Winkelansicht zu wählen.
[Untertitel]: Die Untertitel der aktuellen
Wiedergabe. Verwenden Sie S/T, um die
verfügbaren Untertitelsprachen der Disc anzuzeigen
und den gewünschten Typ zu wählen oder die
Untertitel auszuschalten.
Hinweis:
Ͳ ĞŝƵŶƚĞƌƐĐŚŝĞĚůŝĐŚĞŶŝƐĐƐƐŝŶĚƵŶƚĞƌƐĐŚŝĞĚůŝĐŚĞ
hŶƚĞƌƟƚĞůĞŶƚŚĂůƚĞŶ͘ĞŝƐƉŝĞůƐǁĞŝƐĞ͗
DŝƩĞůĞƵƌŽƉĂ
<LJƌŝůůŝƐĐŚ
>ĂƚĞŝŶŝƐĐŚ/
'ƌŝĞĐŚŝƐĐŚ
dƺƌŬŝƐĐŚ
,ĞďƌćŝƐĐŚ
6 Individuelle Anpassung
Dieser Abschnitt beschreibt die verschiedenen
Einstelloptionen dieses Blu-ray DiscTM-Players.
Wenn diese Einstelloption grau unterlegt ist,
bedeutet dies, dass die Einstellung im aktuellen
Status nicht geändert werden kann.
Allgemeine Einstellungen
D
1. Drücken Sie die SETUP-Taste auf der
Fernbedienung.
Das Einstellungsmenü erscheint.
2. Drücken Sie auf T drücken, um eine Option
zu wählen, dann drücken Sie auf X, um sie
zu öffnen.
3. Drücken Sie auf S/T, um eine Option zu
wählen, dann drücken Sie auf X.
4. Wählen Sie die Einstellung, die geändert werden
soll und drücken Sie zum Bestätigen auf OK.
- Drücken Sie auf W, um zum letzen Menü
zurückzukehren.
[System]
Für die Änderung der folgenden Systemoptionen,
um Ihren Blu-ray DiscTM-Player einzurichten.
‡ [Bildschirmschoner]
Ein- oder Ausschalten des Bildschirmschoners.
Er schützt den TV-Bildschirm.
{Ein} - Aktiviert den Bildschirmschoner nach
ca. 5 Minuten ohne Betrieb. Drücken Sie die
Taste SETUP, um den Bildschirmschoner
auszuschalten.
- Der Blu-ray DiscTM-Player schaltet in den
Stand-by-Modus, wenn nach Einschalten des
Bildschirmschoners ca. 10 Minuten lang kein
Betrieb erfolgt ist.
{Aus} - Ausschalten des BildschirmschonerModus.
‡ [Automatische Wiedergabe]
Für das Ein- oder Ausschalten des
automatischen Disc-Wiedergabemodus.
{Ein} - Die Disc-Wiedergabe startet
automatisch nach dem Laden.
{Aus} - Ausschalten des automatischen
Wiedergabemodus.
‡ [CEC]
Dieser Player unterstützt REGZA-LINK, der
das HDMI-CEC-Protokoll (Consumer
Electronics Control) verwendet. Eine einzige
Fernbedienung kann zur Steuerung aller
REGZA-LINK-kompatiblen Geräte verwendet
werden, die über HDMI-Stecker
angeschlossen sind.
14
{Ein} - Schaltet die REGZA-LINK-Funktionen
ein.
- Bei eingeschaltetem CEC-Modus drücken Sie
auf SETUP, während sich das TV-Gerät im
6WDQGE\0RGXVEH¿QGHWXQGGHU%OXUD\
DiscTM-Player eingeschaltet ist, dann wird
durch Drücken von SETUP, PLAY/PAUSE das
TV-Gerät eingeschaltet. Wenn Sie das
TV-Gerät ausschalten, schaltet sich
automatisch auch dieses Gerät aus.
{Aus} - Schaltet die REGZA-LINK-Funktionen
aus.
‡ [Standardeinstellungen laden]
Setzt alle Einstellungen des Blu-ray DiscTMPlayer auf die Werkseinstellungen zurück.
- Folgen Sie den Anweisungen auf dem
TV-Bildschirm, um die Wiederherstellung
der Werkseinstellungen zu bestätigen.
1. Wählen Sie Standardeinstellungen
laden.
2. Ein Dialogfeld öffnet sich, wie unten
gezeigt. Wählen Sie OK.
3. Es dauert eine gewisse Zeit, bis das Laden
der Werkseinstellungen startet. Bitte
warten...
4. Das TV-Gerät zeigt Folgendes an:
5. Drücken Sie auf OK, um die
Spracheinstellung zu öffnen. Drücken Sie
auf S/T, um eine Sprachoption zu wählen.
Drücken Sie auf S/T, um eine Option zu
wählen. Drücken Sie auf OK.
Wählen Sie „Ja” oder „Nein” mit S/T.
7. Drücken Sie auf OK, um die Einstellung des
Bildseitenverhältnisses zu öffnen.
Drücken Sie auf S/T, um eine Option zu
wählen. Drücken Sie auf OK.
8. Drücken Sie auf OK, um das Menü
[Allgemeine Einstellungen] zu öffnen.
‡ [Aktualisieren]
Für Software-Upgrades zur
Leistungsverbesserung können Sie die
folgende Upgrade-Methode verwenden und
das Upgrade starten.
{Disk}/{USB-Speicherung}/{Netzwerk}
Software-Upgrade über Disc/USBSpeicherung
Upgrade der Software von der Disc oder dem
USB-Datenspeicher aus.
1. Disc einlegen oder den USB-Datenspeicher
mit dem Upgrade-Dateipaket anschließen.
2. Folgen Sie den Anweisungen auf dem
TV- Bildschirm, um die Ausführung des
Upgrades zu bestätigen.
- Das System startet nach 5 Sekunden
neu, außer die OK-Taste wird gedrückt.
Hinweise:
Ͳ tĞŶŶ΀ƵƚŽŵĂƟƐĐŚĞtŝĞĚĞƌŐĂďĞ΁ĂƵĨ΀ƵƐ΁
ŐĞƐĞƚnjƚŝƐƚ͕ŵƵƐƐŶĂĐŚĚĞŵŝŶůĞŐĞŶĚĞƌŝƐĐ
ŵŝƚĚĞŶ/ŶĨŽƌŵĂƟŽŶĞŶĨƺƌĚĞŶ^LJƐƚĞŵͲhƉŐƌĂĚĞ
ĚĂƐhƉŐƌĂĚĞŵŝƚĚŝĞƐĞƌKƉƟŽŶĂƵƐĚĞŵDĞŶƺ
ĞŝŶƐƚĞůůƵŶŐĞŶŐĞƐƚĂƌƚĞƚǁĞƌĚĞŶ͘
Ͳ tĞŶŶĚĂƐhƉŐƌĂĚĞͲĂƚĞŝƉĂŬĞƚĚŝĞ
mďĞƌƉƌƺĨƵŶŐŶŝĐŚƚďĞƐƚĂŶĚĞŶŚĂƚ͕ǁŝƌĚĞŝŶĞ
&ĞŚůĞƌŵĞůĚƵŶŐĂŶŐĞnjĞŝŐƚ͕ĚĂŶŶŵƵƐƐĚĂƐ
WĂŬĞƚŶŽĐŚŵĂůƐƺďĞƌƉƌƺŌǁĞƌĚĞŶ;nj͘͘ŽďĚĂƐ
WĂŬĞƚǀŽůůƐƚćŶĚŝŐŝƐƚͿ͘
Ͳ ĐŚƚĞŶ^ŝĞĚĂƌĂƵĨ͕ĚĂƐƐĚŝĞ&ŝƌŵǁĂƌĞͲsĞƌƐŝŽŶ
ŬĞŝŶĞĂůƚĞsĞƌƐŝŽŶŝƐƚ͘
Ͳ Ğŝŵ^LJƐƚĞŵͲhƉŐƌĂĚĞŵŝƩĞůƐĞŝŶĞƐh^Ͳ'ĞƌćƚƐ
ƐŽůůĞŶ^ŝĞĞŝŶĞŶŶĞƵĞŶKƌĚŶĞƌĞƌƐƚĞůůĞŶƵŶĚŝŚŶ
hW'ͺ>>ŶĞŶŶĞŶƵŶĚĚŝĞhƉŐƌĂĚĞͲĂƚĞŝĞŶ
ŚŝŶĞŝŶŬŽƉŝĞƌĞŶ͘
Software-Upgrade über Netzwerk
Es gibt die zwei folgenden Methoden für das
Upgrade über das Internet: Automatischer
Modus und Interaktiver Modus.
Automatischer Modus:
Der Player kontrolliert automatisch beim Einschalten,
ob eine Verbindung zum Internet besteht.
Wenn eine Verbindung besteht, versucht der
Player, die Verbindung zum Toshiba-Server
herzustellen, um zu kontrollieren, ob neue
Firmware für den Player vorhanden ist.
Falls dies zutrifft, zeigt der Player eine Meldung
auf dem Bildschirm an, die Sie informiert, dass
ein Firmware-Upgrade im Internet zur Verfügung
steht. Sie können wählen, ob der Upgrade
ausgeführt werden soll.
Interaktiver Modus:
Das Netzwerk-Upgrade kann auch über das
Menü Einstellungen ausgeführt werden.
Achten Sie darauf, dass der Player vorher bereits
mit dem Internet verbunden ist.
Drücken Sie auf der Fernbedienung auf die Taste
„SETUP”, wählen Sie dann „System -> Aktualisieren
-> Netzwerk” und drücken Sie auf „OK”. Dann
stellt der Player die Verbindung zum ToshibaServer her, um zu kontrollieren, ob neue
Firmware für den Player vorhanden ist.
15
D
6. Drücken Sie auf OK, um die
Auflösungseinstellung zu öffnen.
Falls dies zutrifft, zeigt der Player auf dem
Bildschirm eine Meldung an und Sie können
wählen, ob der Upgrade ausgeführt werden soll.
3. Drücken Sie auf OK, um „Löschen” zu
wählen, dann werden die Daten im Ordner
BUDA gelöscht.
[Sprache]
Wählen Sie das OSD/Bildschirmmenü, Menü,
Audio und die Standardsprache für die Untertitel
des Players.
Falls keine neue Firmware vorhanden ist, zeigt
der Player auf dem Bildschirm eine Meldung an,
dass keine neue Firmware für den Player
vorhanden ist.
D
ŶŵĞƌŬƵŶŐ͗
tĞŶŶĚĂƐŶĞƵĞ&ŝƌŵǁĂƌĞͲhƉŐƌĂĚĞĂƵƐŐĞǁćŚůƚǁŝƌĚ͕
ϭ͘ ^ƚĂƌƚĞƚĚĞƌWůĂLJĞƌĚĞŶŽǁŶůŽĂĚĚĞƌhƉŐƌĂĚĞͲĂƚĞŝ
ƵŶĚnjĞŝŐƚĞŝŶĞDĞůĚƵŶŐƺďĞƌĚĞŶ&ŽƌƚƐĐŚƌŝƚƚĂŶ͘
Ϯ͘ tĞŶŶĚĞƌŽǁŶůŽĂĚďĞĞŶĚĞƚŝƐƚ͕njĞŝŐƚĚĞƌWůĂLJĞƌ
ĞŝŶĞDĞůĚƵŶŐĂŶƵŶĚ^ŝĞŬƂŶŶĞŶǁćŚůĞŶ͕ ŽďĚĞƌ
hƉŐƌĂĚĞĂƵƐŐĞĨƺŚƌƚǁĞƌĚĞŶƐŽůůŽĚĞƌŶŝĐŚƚ͘tĞŶŶ
^ŝĞĚĂƐhƉŐƌĂĚĞǁćŚůĞŶ͕ďĞŐŝŶŶƚĚĞƌWůĂLJĞƌŵŝƚ
ĚĞŵhƉŐƌĂĚĞƵŶĚnjĞŝŐƚĞŝŶĞDĞůĚƵŶŐƺďĞƌĚĞŶ
&ŽƌƚƐĐŚƌŝƚƚĂŶ͘EĂĐŚďƐĐŚůƵƐƐĚĞƐhƉŐƌĂĚĞƐ
ƐƚĂƌƚĞƚĚĞƌWůĂLJĞƌŶĞƵ͘
$FKWXQJ6FKDOWHQ6LHZlKUHQGGHP
Firmware-Upgrade NICHT die Stromzufuhr
DXV'LHVNDQQ]XU)XQNWLRQVXQWFKWLJNHLWGHV
Player führen.
‡ >([W6SHLFKHU@
Der ext. Speicher wird bei der BD-LiveTMFunktion verwendet. Beim Anschließen eines
USB-Datenspeichers mit mindestens 1GB
freiem Speicherplatz für die Wiedergabe der
BD-LiveTM-Funktion wird automatisch vom
Blu-ray DiscTM-System ein Verzeichnis mit der
Bezeichnung BUDA erstellt.
Daten-Info zeigt die freie Speicherkapazität an.
1. Drücken Sie auf OK.
2. Folgen Sie den Anweisungen auf dem
TV-Bildschirm, um {Daten-Info} zu wählen.
16
‡ [OSD]
Wählen Sie die StandardBildschirmmenüsprache.
‡ [Menü]
Wählen Sie die Standardsprache für das
Menü.
‡ [Audio]
Wählen Sie die Standard-Audiosprache.
‡ [Untertitel]
Wählen Sie die Standard-Untertitelsprache.
[Wiedergabe]
‡ [Kamerawinkel Option]
Einige Blu-rayTM-Discs/DVDs enthalten
Szenen, die mit mehreren Winkeln
aufgenommen wurden, wodurch Sie diese
Videos in den gewünschten Aufnahmewinkeln
genießen können. Deshalb wird das WinkelSymbol nur angezeigt, wenn die Blu-ray
Disc™/DVD mehrere Winkel unterstützt und
die Kamerawinkel Option auf EIN gesetzt ist.
{Ein} - Zeigt die Kamerawinkel-Option an.
{Aus} - Verbirgt die Kamerawinkel-Option.
‡ [BiB Option]
Der Bild-in-Bild-Modus (PIP) zeigt gleichzeitig
zwei Bilder auf dem TV-Bildschirm an, das
Vollbild wird 1. Bild genannt und das kleine
Bildfenster wird 2. Bild genannt. Das PIPZeichen wird angezeigt, wenn der PIP-Modus
aktiv ist und die BiB-Option auf EIN gesetzt ist.
{Ein} - Zeigt die BiB-Option an.
{Aus} - Verbirgt die BiB-Option.
Hinweis:
Ͳ ,ŝŐŚĞĮŶŝƟŽŶͲW/W;Ϯ͘sŝĚĞŽͿǁŝƌĚŶŝĐŚƚƵŶƚĞƌƐƚƺƚnjƚ͘
ͻ [Sekundäre Audiooption]
{Ein} - Zeigt die Sekundäre Audiooption an.
{Aus} - Verbirgt die Sekundäre Audiooption.
‡ [Passwort ändern]
Folgen Sie den Hinweisen auf dem
TV-Bildschirm oder ändern Sie das Passwort
für gesperrte Discs und geben Sie gesperrte
DVD-Discs wieder.
1. Verwenden Sie die ZAHLEN-Tasten, um das
alte 4-stellige Passwort einzugeben. Das
Standardpasswort ist „0000”.
2. Geben Sie das neue Passwort ein.
3. Geben Sie das neue Passwort erneut zur
Bestätigung ein.
‡ [Länder Code]
Dies stellt sicher, dass alle Szenen
wiedergegeben werden, die für Ihr/e
momentane/s Land/Region gedacht sind.
Verwenden Sie die Zahlen-Tasten, um Ihr
Passwort einzugeben, dann können Sie Ihr/e
Land/Region wählen.
‡ [Kinderschutz]
Verhindert den Zugriff von Kindern auf Discs,
die für sie nicht geeignet sind. Diese Discs
müssen mit einer Alterskennzeichnung
aufgezeichnet worden sein.
1. Drücken Sie auf OK.
2. Verwenden Sie die ZAHLEN-Tasten, um das
Passwort einzugeben.
3. Wählen Sie eine Altersfreigrenze und
drücken Sie dann auf OK.
17
D
‡ [Letzte Speicherung]
Wenn die Disc-Lade geöffnet wird oder der
Blu-ray Disc™-Player bei normaler
Wiedergabe in den Stand-by-Modus
geschaltet wird, kann der Blu-ray Disc™Player den Wiedergabeendpunkt speichern,
der Player startet das nächste Mal die
Wiedergabe ab dem gespeicherten Punkt.
{Ein} - Aktive Funktion Letzte Speicherung.
{Aus} - Desaktivierte Funktion Letzte
Speicherung.
Hinweis:
Ͳ EŝĐŚƚĂůůĞůƵͲƌĂLJdDͲŝƐĐƐƵŶƚĞƌƐƚƺƚnjĞŶĚŝĞƐĞ
&ƵŶŬƟŽŶ͘
ͻ [PBC]
VCD2.0 hat ein PBC-Wiedergabe-Steuermenü,
über das man das System interaktiv steuern kann.
{Ein} - Wiedergabesteuermenü wird
angezeigt, ZAHLEN-Tasten für Auswahl der
gewünschten Option verwenden.
{Aus} - Wiedergabesteuermenü verbergen
und Wiedergabe von Track 1 automatisch
starten.
‡ [Mit Untertiteln]
Ermöglicht Hörgeschädigten, TV-Sendungen
zu verfolgen, indem der Audioton einer
Sendung als Text auf dem Bildschirm
angezeigt wird.
{Ein} - Anzeige Mit Untertiteln.
{Aus} - Keine Anzeige Mit Untertiteln.
‡ [DivX(R) VOD DRM]
DivX(R) VOD DRM bedeutet DivX(R) Video on
Demand Digital Right Management Kopierschutzsystem.
DivX® ist der Name eines revolutionären
neuen Video-Codecs auf Basis des neuen
MPEG-4-Kompressionsstandards für Video.
Sie können mit diesem Player DivX®-Filme
wiedergeben.
Sie können mit diesem Geräts nur gemietete
und gekaufte DivX®-Videos wiedergeben, die
mit dem DivX®-Registriercode ausgestattet
sind.
Wählen Sie die DivX(R) VOD DRM-Option,
GDQQ¿QGHQ6LHGHQ3URGXNWUHJLVWULHUFRGH
Weitere Informationen unter
http://www.divx.com/vod.
[Sicherheit]
Elemente Beschreibung
Frei ab 6
Ohne Altersbeschränkung
G
Geeignet für Kinder mit Anleitung
PG
Elterliche Anleitung
PG-13
Elterliche Anleitung für Kinder unter 13
PGR
Elterliche Anleitung empfohlen
R
Eingeschränkt
NC-17
Nicht unter 17 Jahre
Ab 18
Ab 18 Jahre
D
Hinweise: Ͳ ŝƐĐƐ͕ĚŝĞĞŝŶĞůƚĞƌƐĨƌĞŝŐƌĞŶnjĞƺďĞƌĚĞƌƵŶƚĞƌ
΀<ŝŶĚĞƌƐĐŚƵƚnj΁ĞŝŶŐĞƐƚĞůůƚĞŶ&^<Ͳ'ƌĞŶnjĞŚĂďĞŶ͕
ĞƌĨŽƌĚĞƌŶĚŝĞŝŶŐĂďĞĚĞƐWĂƐƐǁŽƌƚƐ͘
Ͳ ŝĞ&^<Ͳ'ƌĞŶnjĞŶƐŝŶĚůćŶĚĞƌĂďŚćŶŐŝŐ͘hŵĚŝĞ
tŝĞĚĞƌŐĂďĞĂůůĞƌŝƐĐƐnjƵĞƌůĂƵďĞŶ͕ǁćŚůĞŶ^ŝĞΖƵƐΖ͘
[Netzwerk]
ͻ [IP-Einstellungen]
{Auto} - Automatische Abfrage der
Netzwerkinformationen.
{Manuell} - Manuelle Einrichtung der
Netzwerk-Information.
‡ [Verbindungstest]
Zeigt die Statusinformationen der
Netzwerkverbindung an.
‡ [BD-Live Verbindung]
{Erlaubt} - Bei der Wiedergabe einer
BD-Live™-Disc kann die Disc alle
Informationen vom zugewiesenen
Netzwerk automatisch herunterladen.
{Teilweise erlaubt} - Bei der Wiedergabe
einer BD-Live™-Disc kann die Disc einen Teil
der Informationen vom zugewiesenen
Netzwerk automatisch herunterladen.
{Verwehrt} - Herunterladen von
Informationen aus Netzwerk desaktiviert.
‡ [Information]
Zeigt alle Netzwerkinformationen an.
Anzeige-Einstellungen
18
Um BD-Live™-Bonus-Inhalte zu genießen, muss
eine Netzwerkverbindung eingerichtet werden.
Hinweis:
Ͳ ^ƚĞůůĞŶ^ŝĞƐŝĐŚĞƌ͕ĚĂƐƐĚĂƐEĞƚnjǁĞƌŬŬĂďĞů
ŬŽƌƌĞŬƚĂŶŐĞƐĐŚůŽƐƐĞŶŝƐƚƵŶĚĚĞƌZŽƵƚĞƌ
ĞŝŶŐĞƐĐŚĂůƚĞƚŝƐƚ͘
1. Schließen Sie den Blu-ray Disc™-Player an
ein Breitbandmodem oder einen Router an.
2. Wählen Sie im Menü Einstellungen die
Option [Netzwerk] und drücken Sie
anschließend auf X.
3. Wählen Sie im Menü dann
[IP-Einstellungen] und drücken Sie danach
auf OK, um [Auto] zu wählen. Eine
IP-Adresse wird automatisch bezogen.
Wenn keine IP-Adresse bezogen wird,
wählen Sie [Manuell], um IP-Adresse,
Subnet-Maske, Standard-Gateway, DNS1/
DNS2 einzugeben und drücken Sie auf OK,
um die Verbindung zum Netzwerk
wiederherzustellen. Er wird erneut
versuchen, die IP-Adresse zu erhalten.
4. Drücken Sie auf RETURN oder OK zum
Beenden.
Hinweise:
Ͳ /ŵDŽĚƵƐ΀DĂŶƵĞůů΁ĚƌƺĐŬĞŶ^ŝĞĂƵĨd͕ƵŵĚŝĞ
EƵŵŵĞƌnjƵůƂƐĐŚĞŶ͕ĨĂůůƐƐŝĞĨĂůƐĐŚĞŝŶŐĞŐĞďĞŶ
ǁƵƌĚĞ͘
Ͳ &ƺƌĚŝĞsĞƌďŝŶĚƵŶŐnjƵŵ/ŶƚĞƌŶĞƚŝƐƚĞŝŶsĞƌƚƌĂŐ
ŵŝƚĞŝŶĞŵ/ŶƚĞƌŶĞƚƉƌŽǀŝĚĞƌŶƂƟŐ͘
Ͳ ŝĞƐĞƌWůĂLJĞƌƵŶƚĞƌƐƚƺƚnjƚĚŝĞĂƵƚŽŵĂƟƐĐŚĞ
ƌŬĞŶŶƵŶŐǀŽŶƌŽƐƐĞĚͲŽǀĞƌͲ<ĂďĞůŶŶŝĐŚƚ͘
sĞƌǁĞŶĚĞŶ^ŝĞĞŝŶŶŽƌŵĂůĞƐ^ƚĂŶĚĂƌĚͲ>EͲ
<ĂďĞů͘
Ͳ ĂƐ>ĂĚĞŶǀŽŶͲ>ŝǀĞΡͲ/ŶŚĂůƚĞŶĂƵƐĚĞŵ
/ŶƚĞƌŶĞƚŬĂŶŶ͕ĂďŚćŶŐŝŐǀŽŶĚĞƌĂƚĞŝŐƌƂƘĞ
ƵŶĚĚĞƌ/ŶƚĞƌŶĞƚǀĞƌďŝŶĚƵŶŐƐŐĞƐĐŚǁŝŶĚŝŐŬĞŝƚ͕
ĞƚǁĂƐĚĂƵĞƌŶ͘
1. Drücken Sie auf SETUP, das Menü
[Allgemeine Einstellungen] wird
angezeigt.
2. Drücken Sie auf X, um
[Anzeige-Einstellungen] zu wählen, und
drücken Sie anschließend T.
3. Wählen Sie eine Option, drücken Sie auf X
zum Öffnen.
4. Drücken Sie auf S/T, um eine Einstellungsoption
zu wählen und drücken Sie auf X.
5. Wählen Sie die Einstellung, die geändert
werden soll, und drücken Sie zum Bestätigen
auf OK.
- Drücken Sie auf W, um zum letzen Menü
zurückzukehren.
- Drücken Sie auf SETUP, um das Menü zu
beenden.
[TV]
‡ [TV Bildschirm]
Wählen Sie das Bildschirmformat je nach
gewünschter Bilddarstellung auf dem TVGerät.
{16:9 Vollbild} - Für Disc mit
Bildseitenverhältnis von 4:3, das
Ausgabevideo wird auf 16:9 Vollbildschirm
gestreckt.
{16:9 Normal} - Für Disc mit
Bildseitenverhältnis von 4:3, das
Ausgabevideo wird vertikal an den Bildschirm
angepasst.
{4:3 Pan&Scan} - Für Standard-TV, zeigt
ein breites Bild auf dem gesamtem Bildschirm
an und beschneidet redundante Bereiche.
‡
‡
‡
[Video Prozess]
‡ [Video Anpassung]
:lKOHQ6LHHLQHYRUGH¿QLHUWH
Videoeinstellung.
1. Drücken Sie auf OK.
2. Drücken Sie auf W/X, um Helligkeit,
Kontrast, Farbton und Farbsättigung
einzustellen.
{Helligkeit} - Drücken Sie auf W/X, um
die Anzeigehelligkeit einzustellen, links
bedeutet dunkler und rechts heller.
{Kontrast} - Drücken Sie auf W/X, um
den Anzeigekontrast einzustellen, nach
links bedeutet niedriger und nach rechts
hoher Kontrast.
{Farbton} - Drücken Sie auf W/X, um den
Anzeigefarbton einzustellen, links bedeutet
geringere und rechts höhere Farbstärke.
{Farbsättigung} - Drücken Sie auf W/X,
um die Anzeigesättigung einzustellen, nach
links bedeutet geringere und nach rechts
höhere Sättigung.
3. Drücken Sie auf RETURN zum Beenden.
‡ [Schärfe]
Auswahl des Schärfegrads: Hoch, Mittel,
Niedrig.
{Hoch} - Wählt einen hohen Schärfegrad.
{Mittel} - Wählt einen mittleren
Schärfegrad.
{Niedrig} - Wählt einen niedrigen
Schärfegrad.
19
D
‡
{/HWWHUER[} - Für Standard-TV, zeigt ein
breites Bild mit zwei schwarzen Streifen oben
und unten auf dem 4:3-Bildschirm an.
>$XÀ|VXQJ@
:lKOHQ6LHHLQH9LGHRDXVJDEHDXÀ|VXQJGLH
mit der TV-Bilddarstellungsfähigkeit
kompatibel ist.
{Auto} - Wählt die am besten geeignete
$XÀ|VXQJIUGDV79*HUlW
{480i/576i}, {480p/576p}, {720p},
{1080i}, {1080p}
- Wählen Sie die beste
9LGHRDXÀ|VXQJVHLQVWHOOXQJIUGDV
79*HUlW:HLWHUH'HWDLOVGD]X¿QGHQ6LH
in der TV-Bedienungsanleitung.
[Farbraum]
:lKOWHLQHQYRUGH¿QLHUWHQ)DUEUDXPIUGDV
Bild.
{RGB} - Wählt RGB-Farbraum.
{YCbCr} - Wählt YCbCr-Farbraum.
{YCbCr422} - Wählt YCbCr422-Farbraum.
{Volle RGB} - Wählt vollen RGB-Farbraum.
[HDMI Deep Color]
Diese Funktion ist nur verfügbar, wenn das
Anzeigegerät über ein HDMI-Kabel
angeschlossen ist und die Funktion Deep
Color unterstützt.
{30 bits} - Ausgabe 30-bit Farbe.
{36 bits} - Ausgabe 36-bit Farbe.
{Aus} - Ausgabe Standard 24-bit Farbe.
Hinweis:
Ͳ tĞŶŶĚĞƌ&ĂƌďƌĂƵŵͣzďƌϰϮϮ͟ŝƐƚ͕ŐŝďƚĞƐ
ŬĞŝŶĞĞĞƉŽůŽƵƌͲƵƐŐĂďĞͲĂƵĐŚǁĞŶŶ,D/
ĞĞƉŽůŽƌĂƵĨϯϬͬϯϲďŝƚƐŐĞƐĞƚnjƚŝƐƚ͘
[HDMI 1080/24p]
{Ein} - Aktiviert 1080/24p
9LGHRDXÀ|VXQJVHLQVWHOOXQJ
{Aus} - Desaktiviert 1080/24p
9LGHRDXÀ|VXQJVHLQVWHOOXQJ
,ŝŶǁĞŝƐĞnjƵ,D/ϭϬϴϬͬϮϰƉ͗
tĞŶŶĚŝĞϮϰͲ,njͲƵƐŐĂďĞĞŝŶŐĞƐƚĞůůƚǁĞƌĚĞŶƐŽůů͕
ŵƺƐƐĞŶϯƵŶƚĞŶƐƚĞŚĞŶĚĞĞĚŝŶŐƵŶŐĞŶĞƌĨƺůůƚ
ǁĞƌĚĞŶ͗
ϭ͘ dsͲ'ĞƌćƚƵŶƚĞƌƐƚƺƚnjƚĚŝĞϮϰͲ,njͲŶnjĞŝŐĞ͖
Ϯ͘ /ŵWůĂLJĞƌŵƵƐƐŝŵ^ĞƚƵƉͬŝŶƌŝĐŚƚƵŶŐƐŵĞŶƺĚŝĞ
ϮϰͲ,njͲKƉƟŽŶĞŝŶŐĞƐƚĞůůƚƐĞŝŶ͖
ϯ͘ DĞĚŝƵŵŵƵƐƐϮϰͲ,njͲsŝĚĞŽƐĞŝŶ͘
Hinweise:
Ͳ ŝĞƐĞƵŇƂƐƵŶŐǁŝƌĚŶƵƌǁŝƌŬƐĂŵ͕ǁĞŶŶĚŝĞ
ǁŝĞĚĞƌŐĞŐĞďĞŶĞŶůƵͲƌĂLJŝƐĐΡͲ/ŶŚĂůƚĞ
&ŝůŵƋƵĞůůĞŶƐŝŶĚ͘
Ͳ ĞŝĚĞƌ,D/ϭϬϴϬͬϮϰƉͲtŝĞĚĞƌŐĂďĞƐƚĞŚƚŬĞŝŶĞ
ŽŵƉŽƐŝƚĞͲƵƐŐĂďĞnjƵƌsĞƌĨƺŐƵŶŐ͘
Audio-Einstellungen
1. Drücken Sie auf SETUP, das Menü
[Allgemeine Einstellungen] wird
angezeigt.
2. Drücken Sie auf X, um [AudioEinstellungen] zu wählen, und drücken Sie
anschließend auf T.
3. Wählen Sie eine Option, drücken Sie auf X
zum Öffnen.
‡ [Dolby DRC]
Wählt den Dynamiksteuermodus, damit bei
einen mit geringer Lautstärke
wiedergegebenen Film keine
Klangqualitätsverluste auftreten.
{Aus} - Keine Dynamikkompression.
{Ein} - Dynamikkompression.
{Auto} - Wählt DRC gemäß
Eingangsaudioton.
Die Einstellung von 'Auto' ist für Dolby
TrueHD geeignet.
System-Informationen
D
4. Drücken Sie auf S/T, um eine
Einstellungsoption zu wählen und drücken Sie
auf X.
5. Wählen Sie die Einstellung, die geändert
werden soll, und drücken Sie zum Bestätigen
auf OK.
- Drücken Sie auf W, um zum letzen Menü
zurückzukehren.
- Drücken Sie auf SETUP, um das Menü zu
beenden.
[Audio Ausgang]
‡ [Spdif]
Wählt den Ausgangsmodus für KOAXIALBuchse, Optionen umfassen Bitstream, PCM,
Neu kodieren und Aus.
{Bitstream} - Ausgangsdigitalsignal ohne
Verarbeitung.
{PCM} - Ausgangsdigitalsignal mit
Verarbeitung, nur zwei Exportkanäle.
{Neu kodieren} - Automatische Auswahl des
Signaltyps von KOAXIAL-Buchse gemäß
Audioton auf Disc.
{Aus} - Keine Ausgabe für S/PDIF.
‡ [HDMI]
Wählt den Ausgangsmodus für HDMI OutBuchse, Optionen umfassen Bitstream, PCM,
Neu kodieren und Aus.
{Bitstream} - HDMI-Digitalsignal-Ausgabe
ohne Verarbeitung.
{PCM} - HDMI-Digitalsignal-Ausgabe mit
Verarbeitung, nur zwei Kanäle werden
gesendet.
{Neu-kodieren} - Automatische Auswahl
des Signaltyps von HDMI-Ausgangsbuchse
gemäß Audioton auf Disc.
{Aus} - Keine Ausgabe für HDMI.
‡ [Down_samp]
Wählt die Digitalaudiosignal-SamplingFrequenz.
{48K} - Für Disc, die mit Sampling-Rate von
48 kHz aufgenommen wurde.
{96K} - Für Disc, die mit Sampling-Rate von
96 kHz aufgenommen wurde.
{192K} - Für Disc, die mit Sampling-Rate von
192 kHz aufgenommen wurde.
20
1. Drücken Sie auf SETUP, das Menü
[Allgemeine Einstellungen] wird
angezeigt.
2. Drücken Sie auf X, um
[System-Informationen] auszuwählen.
- Die aktuelle Softwareversion und MACAdresse werden angezeigt.
- Drücken Sie auf W, um zum letzen Menü
zurückzukehren.
- Drücken Sie auf SETUP, um das Menü zu
beenden.
7 Technische Daten
Video
Signalsystem: PAL/NTSC
HDMI-Ausgang: 480i/576i, 480p/576p, 720p,
1080i, 1080p, 1080/24p.
Audio
‡ 'LJLWDODXVJDQJ.RD[LDO
0,5 Vp-p (75 Ohm)
‡ +'0,$XVJDQJ
LAN
‡ LAN-Anschluss 10BASE-T/100BASE-TX
USB
‡ 86%86%)XOOVSHHG86%
High-speed
‡ 8QWHUVWW]WH%HUHLFKH)ODVK'DWHQVSHLFKHU
Kartenlesegeräte, USB-HUB mit 4 Ports,
USB-Massenspeichergerät.
‡ 8QWHUVWW]WH'DWHLV\VWHPH)$7
‡ 8QWHUVWW]WHPD[LPDOH*U|‰H*%
‡ ([WHUQH)HVWSODWWHRKQHHLJHQH
Stromversorgung wird nicht unterstützt.
<ŽŵƉĂƟďůĞĂƚĞŝĨŽƌŵĂƚĞ
MP3-Tracks
‡ 8QWHUVWW]WH'DWHLHUZHLWHUXQJ
PS
‡ 8QWHUVWW]WHU$XGLR&RGHF03
‡ ,62)RUPDW
‡ 8QWHUVWW]WHHQWVSUHFKHQGH%LWUDWH
8kbps - 320kbps
‡ 8QWHUVWW]WH6DPSOLQJ)UHTXHQ]HQN+]
44,1kHz, 48kHz
JPEG
‡ 8QWHUVWW]WH'DWHLHUZHLWHUXQJ
MSJ
RU
MSHJ
‡ -3(*,62IRUPDW
‡ )RWR&'ZLUGQLFKWXQWHUVWW]W
DivX®
‡ 8QWHUVWW]WH'DWHLHUZHLWHUXQJ
',9;
‡ 'LY;+'
MKV
‡ 8QWHUVWW]WH'DWHLHUZHLWHUXQJ
0.9
‡ 8QWHUVWW]WH9LGHR&RGHFV+03+3
DivX, MPEG4 SP/ASP, MPEG1, MPEG2
‡ 8QWHUVWW]WH$XGLR&RGHFV$$&.DQDOX
5.1-Kanal, MP3, AC3, DTS, LPCM
‡ 8QWHUVWW]WH8QWHUWLWHO7H[W87)66$60,
SUB, SRT, ASS
‡ :LHGHUJDEHYRQ0.9'DWHLHQLQ&'55:LVW
eventuell nicht möglich
‡ (LQLJH'LVFVLP0.9)RUPDWN|QQHQHYHQWXHOO
DEKlQJLJYRQGHU9LGHRDXÀ|VXQJXQG%LOGUDWH
nicht wiedergegeben werden.
Andere Formate
‡ 03
PS
PRY
$9,
DYL
MPEG ('.mpg', '.mpeg')
Hauptgerät
‡ 6WURPYHUVRUJXQJ
200V-240V 50/60Hz
‡ 6WURPYHUEUDXFK:
‡ 6WURPYHUEUDXFKLP6WDQGE\0RGXV:
‡ $EPHVVXQJHQ%[+[7
360 x 38,5 x 205 (mm)
‡ 1HWWRJHZLFKWNJ
‡ %HWULHEVWHPSHUDWXUƒ&ELVƒ&
‡ %HWULHEVIHXFKWLJNHLW:HQLJHUDOV
(ohne Kondensation)
0LWJHOLHIHUWHV=XEHK|U
‡ )HUQEHGLHQXQJ
‡ 1 R03 (Größe AAA) Batterie
‡ (LQIDFKH%$
21
D
Wiedergebbare Medien
Dieses Produkt kann Folgendes wiedergeben:
‡ %OXUD\'LVFŒ9LGHR%'55(%'$9
‡ '9' '9'9LGHR '9'55: '9'55:
DVD+R/-R DL (Dual Layer/Doppelschicht)
‡ 9LGHR&'69&'
‡ $XGLR&'&'5&'5:
‡ $9&+'
‡ 86%)ODVK'DWHQVSHLFKHU
8 Fehlerbeseitigung
Wenn eine der folgenden Störungen bei der Benutzung dieses Geräts auftritt, suchen Sie in der folgenden
Liste nach einer Lösung, bevor Sie den nächstgelegenen TOSHIBA-Händler befragen.
Störung
Tipp
Keine Reaktion von der
Fernbedienung.
Schließen Sie das Gerät an die Netzsteckdose an.
Richten Sie die Fernbedienung auf das Gerät.
Setzen Sie die Batterie korrekt ein.
Setzen Sie eine neue Batterie in die Fernbedienung ein.
D
Kein Videosignal auf dem
Anzeigegerät.
Schalten Sie das TV-Gerät ein.
Stellen Sie das TV-Gerät auf den korrekten externen Eingang ein.
:lKOHQ6LHGLHNRUUHNWH9LGHRDXÀ|VXQJ
Stellen Sie das TV-System korrekt ein.
Falsches oder fehlendes
Audio/Videosignal auf dem
Verstärker/Anzeigegerät
über HDMI-Kabel.
Wenn das Gerät über das HDMI-Kabel an ein nicht dafür
ausgerüstetes Anzeigegerät angeschlossen ist, kann möglicherweise
kein Audio/Video-Signal ausgegeben werden.
.HLQ+LJK'H¿QLWLRQ
Videosignal auf dem
TV-Gerät.
(QWKlOWGLH'LVF+LJK'H¿QLWLRQ9LGHR"+LJK'H¿QLWLRQ9LGHRLVWQLFKW
verfügbar, wenn die Disc dieses nicht enthält.
Kein Audiosignal aus den
Lautsprechern der
Audioanlage.
Schalten Sie die Audioanlage ein.
Disc kann nicht
wiedergegeben werden.
Stellen Sie sicher, dass der Blu-ray Disc™-Player die Disc unterstützt.
Stellen Sie sicher, dass die Einstellungen am Verstärker/Anzeigegerät
zu jenen vom Blu-ray Disc™-Player passen.
8QWHUVWW]WGDV79*HUlW+LJK'H¿QLWLRQ9LGHR"+LJK'H¿QLWLRQ9LGHR
ist nicht verfügbar, wenn das TV-Gerät dieses nicht unterstützt.
Stellen Sie die Audioanlage auf den korrekten externen Eingang ein.
Erhöhen Sie die Lautstärke der Audioanlage.
Stellen Sie sicher, dass der Blu-ray Disc™-Player den Regionalcode der
DVD oder Blu-ray Disc™ unterstützt.
Bei DVD+RW/+R oder DVD-RW/-R stellen Sie sicher, dass die Disc
beim Brennen korrekt fertig gestellt wurde.
Reinigen Sie die Disc.
JPEG-Dateien von einer Disc Stellen Sie sicher, dass die Disc in JPG/ISO-Format aufgenommen
können nicht
wurde.
wiedergegeben werden.
DivX®-Dateien können nicht
wiedergegeben werden.
Stellen Sie sicher, dass die Disc in H.264 oder MPEG-4-Format
aufgenommen wurde.
MP3-Dateien von einer Disc
können nicht
wiedergegeben werden.
Stellen Sie sicher, dass die Disc in ISO-Format aufgenommen wurde.
Stellen Sie sicher, dass die Bitrate der MP3-Dateien zwischen 8 und
320kbps liegt.
Stellen Sie sicher, dass die Sampling-Rate der MP3-Dateien 32kHz,
44,1kHz oder 48kHz beträgt.
22
Störung
Tipp
JPEG-Datei wird nicht
gefunden.
Stellen Sie sicher, dass die ausgewählte Gruppe (Ordner) nicht mehr
als 9.999 Dateien bei DVDs und mehr als 999 Dateien bei CDs enthält.
Stellen Sie sicher, dass die Dateierweiterung .jpg, .JPG, .jpeg oder
.JPEG ist.
MP3-Datei wird nicht
gefunden.
Stellen Sie sicher, dass der ausgewählte Ordner nicht mehr als 9.999
Dateien bei DVDs und nicht mehr als 999 Dateien bei CDs enthält.
Wenn zur System-Aktualisierung ein USB-Datenspeicher verwendet
wird, sollte ein neuer Ordner namens UPG_ALL angelegt werden und
die Aktualisierungsdatei in diesen Ordner kopiert werden.
Achten Sie beim Upgrade der Software des Systems über das
Netzwerk darauf, dass der Player vorher bereits mit dem Internet
verbunden ist.
Manchmal können die
Optionen des
Einrichtungsmenüs nicht
ausgewählt werden.
Bei der Wiedergabe einer DVD- oder Blu-ray Disc™ drücken Sie ein
Mal auf STOP, dann schaltet der Player in den StoppWiederaufnahme-Modus, in dem einige Einstellungen im
Einrichtungsmenü wie Sprachmenü, Audio, Untertitel usw. nicht
vorgenommen werden können.
Wenn Sie diese ändern wollen, drücken Sie zwei Mal auf STOP, dann
schaltet der Player in den vollständigen Stopp-Modus, in dem diese
Änderungen vorgenommen werden können.
23
D
Stellen Sie sicher, dass die Dateierweiterung .mp3 oder .MP3 ist.
Software-Upgrade kann
nicht ausgeführt werden.
9 Glossar
AVI
Audio Video Interleave, bekannt unter der
Abkürzung AVI, ist ein MultimediaContainerformat. AVI-Dateien können sowohl
Audio- als auch Video-Dateien in einem Container
aufnehmen, wodurch die synchrone Wiedergabe
von Audio und Video möglich ist.
D
Bildseitenverhältnis
Bildseitenverhältnis bezieht sich auf das
Verhältnis Länge zu Höhe der
TV-Bildschirmanzeige. Das Verhältnis eines
normalen TV-Geräts ist 4:3, während das
9HUKlOWQLVHLQHV+LJK'H¿QLWLRQRGHU%UHLWELOG
TV-Geräts 16:9 beträgt. Der Letterbox-Modus
macht es möglich, dass Sie ein breiteres Bild auf
dem Standard-4:3-Bildschirm genießen können.
Blu-ray-DiscTM
Blu-ray-DiscTM ist die nächste Generation der
optischen Video-Disc, die fünf Mal mehr Daten
als eine konventionelle DVD speichern kann. Die
große Speicherfähigkeit macht es möglich,
EHVRQGHUH)HDWXUHVZLH+LJK'H¿QLWLRQRGHU
HD-Videos, Mehrkanal-Surround-Sound,
interaktive Menüs usw. zu genießen.
BONUSVIEWTM
Dies ist ein Blu-ray Disc™-Video (Final Standard
3UR¿OHRGHU3UR¿OHGDVLQWHUDNWLYH,QKDOWH
unterstützt, die auf der Disc vorhanden sind, z.
B. Bild-in-Bild. Dieses Gerät kann somit das erste
und das zweite Video gleichzeitig wiedergeben.
Digital-Audio
Digital-Audio ist ein Tonsignal, das in numerische
Werte konvertiert wurde.
Digitaler Ton kann über mehrere Kanäle
übertragen werden. Analoger Ton kann nur über
zwei Kanäle übertragen werden.
DivX®
DivX® ist ein Codec (Komprimierung/
Dekomprimierung), der Bilder auf sehr geringe
Datenmengen komprimieren kann.
'LY;&HUWL¿HG® zur Wiedergabe von DivX®Video
'DWHLHQELV]XU+'$XÀ|VXQJSLQNOXVLYH
Premium Inhalten.
h%(5',9;9,'(2
DivX® ein digitales Videoformat, das von DivX, Inc.
HQWZLFNHOWZXUGH'LHVLVWHLQRI¿]LHOOHV'LY;
&HUWL¿HG® Gerät, welches DivX-Videos wiedergibt.
Besuchen Sie www.divx.com für weitere
Informationen und Software, um Ihre Dateien in
DivX-Videodateien umzuwandeln.
24
h%(5',9;9,'(221'(0$1'),/0($8)
ABRUF:
'LHVHV'LY;&HUWL¿HG®-Gerät muss registriert
werden, um erworbene DivX Video-on-Demand
(VOD)-Filme wiederzugeben. Um Ihren
Registriercode zu erhalten, suchen Sie den
DivX-VOD-Abschnitt im Einrichtungsmenü des
Geräts. Weitere Informationen zur Registrierung
¿QGHQ6LHXQWHUZZZYRGGLY[FRP
Dolby® Digital
Dies ist ein von Dolby Laboratories entwickeltes
System, um Digitalton zu komprimieren. Es bietet
Stereo-(2-Kanal) oder Multikanal-Audio.
Dolby® Digital Plus
Dolby Digital Plus ist die nächste Generation
digitaler Audiokompressionstechnologie, die als
Erweiterung von Dolby Digital entwickelt wurde.
Blu-ray-Disc™ unterstützen 7.1 MultikanalSurround-Sound-Ausgabe.
Dolby® TrueHD
Dolby TrueHD ist eine verlustlose
Codiertechnologie, die für die nächste Generation
der optischen Discs entwickelt wurde. Blu-rayDisc™ unterstützen 7.1 Multikanal-SurroundSound-Ausgabe.
DTS®
DTS ist ein Multikanal-Surround-Soundsystem.
Durch Anschluss an einen DTS-Decoder können
Sie Filme wie im Kino mit dynamischen und
realistischen Ton genießen, DTS SurroundSound-Technologien wurden entwickelt von DTS,
Inc.
DTS-HD®
DTS-HD ist eine verlustlose Codiertechnologie,
die als Erweiterung zum ursprünglichen DTS
Coherent Acoustics-Format entwickelt wurde.
Blu-ray-Disc™ unterstützen 7.1 MultikanalSurround-Sound-Ausgabe.
DTS-HD Master AudioTM
Eine mit DTS-HD Master Audio aufgezeichnete
Disc bietet ALLE Informationen der originalen
Master-Aufnahmen - Bit für Bit ist sie identisch
mit den Originalaufnahmen der Toningenieure.
Besser kann Audio nicht werden.
MP3
Ein Dateiformat mit einem TondatenKomprimierungssystem. MP3 ist die Abkürzung
von Motion Picture Experts Group 1 (oder
MPEG-1) Audio-Schicht 3. Mit dem MP3-Format
kann eine CD-R oder CD-RW 10 Mal mehr Daten
als eine herkömmliche CD enthalten.
HDMI®
+LJK'H¿QLWLRQ0XOWLPHGLD,QWHUIDFH+'0,LVW
eine digitale Hochgeschwindigkeitsschnittstelle,
die nicht komprimierte, hoch aufgelöste Videos
und digitalen Multikanal-Audioton überträgt. Sie
bietet qualitativ hochwertige Bilder und
Tonaufzeichnungen. HDMI ist vollständig
rückwärts kompatibel mit DVI. Wie vom HDMIStandard gefordert, führt der Anschluss von
HDMI- oder DVI-Geräten ohne HDCP (High
bandwidth Digital Content Protection) dazu, dass
weder Bild noch Ton ausgegeben werden.
MP4
Das MP4-Dateiformat ist ein MultimediaContainer-Format und Bestandteil von MPEG-4.
Es wird meist zur Speicherung von digitalen
Video- und Audiostreams verwendet
(insbesondere von MPEG (MPEG4, H264…), kann
jedoch auch zur Speicherung von anderen Daten
wie Untertiteln und einzelnen Bildern verwendet
werden.
JPEG
Ein weit verbreitetes digitales Fotobildformat.
Ein Standbild-Datenkomprimierungssystem, das
von der Joint Photographic Expert Group
vorgeschlagen wurde, das sich trotz der hohen
Komprimierungsrate durch eine geringe
Verminderung der Bildqualität auszeichnet.
Dateien sind an ihrer Dateierweiterung '.jpg' oder
'.jpeg' zu erkennen.
LAN (Local Area Network)
Eine Gruppe von miteinander verbundenen
Geräten in einer Firma, einer Schule oder einem
Haus. Zeigt die Grenzen eines Netzwerks an.
Lokaler Speicher
Dieser Speicherbereich wird als Speicherort für
die Speicherung von zusätzlichen Inhalten von
Blu-ray Disc™-Videos mit aktiviertem BD-Live™
verwendet.
PBC
Wiedergabesteuerung. Ein System, bei dem Sie
durch eine Video-CD/Super- VCD mit
Bildschirmmenüs navigieren, die auf der Disc
aufgezeichnet sind. Sie können die interaktive
Wiedergabe und Suche nutzen.
PCM
Impuls-Code-Modulation. Ein digitales
Audiocodierungssystem.
Regionalcode
Ein System, wodurch die Disc nur in der
zugewiesenen Region wiedergegeben werden
kann. Dieses Gerät gibt nur Discs wieder, die
einen kompatiblen Regionalcode haben. Sie
¿QGHQGHQ5HJLRQDOFRGHDXIGHP*HUlWHVFKLOG
Einige Discs sind auch mit mehreren Regionen
kompatibel (oder mit ALLEN Regionen).
MKV
Der Matroska-Multimedien-Container ist ein
kostenloses Container-Format mit offenen
Standards und kann eine unbegrenzte Anzahl
von Video-, Audio-, Bild- oder Untertitel-Tracks in
einer einzelnen Datei speichern. Es soll als
universelles Format für die Speicherung von
klassischen Multimedia-Inhalten dienen, wie
beispielsweise Filmen oder TV-Sendungen.
25
D
HDCP
High-bandwidth Digital Content Protection
High-bandwidth Digital Content Protection ist ein
Verschlüsselungssystem. Diese Merkmale
HUP|JOLFKHQHLQHVLFKHUHhEHUWUDJXQJYRQ
digitalen Inhalten zwischen verschiedenen
Geräten (um unerlaubte Kopien zu verhindern.)

advertisement

Related manuals

advertisement

Languages