EM-3000 Series Meter Installation and Operation Manual

EM-3000 Series Meter Installation and Operation Manual
Code No. LIT-12011874
Issued July 21, 2014
EM-3000 Series Meter Installation
and Operation Manual
This page intentionally left blank.
EM-3000 Series Meter Installation and Operation Manual
Published by:
Johnson Controls, Inc.
Building Efficiency
507 E. Michigan Street, Milwaukee, WI 53202
All rights reserved. No part of this publication may be reproduced or transmitted in
any form or by any means, electronic or mechanical, including photocopying, recording, or information storage or retrieval systems or any future forms of duplication, for
any purpose other than the purchaser's use, without the expressed written permission
of Johnson Controls, Inc.
Metasys® and Johnson Controls® are registered trademarks of Johnson Controls,
Inc. All other marks herein are the marks of their respective owners.
© 2014 Johnson Controls, Inc.
EM-3000 Series Meter Installation and Operation Manual
i
This page intentionally left blank.
EM-3000 Series Meter Installation and Operation Manual
ii
Use Of Product for Protection
Our products are not to be used for primary over-current protection. Any protection
feature in our products is to be used for alarm or secondary protection only.
Statement of Calibration
Our instruments are inspected and tested in accordance with specifications published
by Johnson Controls, Inc. The accuracy and a calibration of our instruments are traceable to the National Institute of Standards and Technology through equipment that is
calibrated at planned intervals by comparison to certified standards. For optimal
performance, Johnson Controls, Inc. recommends that any meter be verified for
accuracy on a yearly interval using NIST traceable accuracy standards.
Disclaimer
The information presented in this publication has been carefully checked for
reliability; however, no responsibility is assumed for inaccuracies. The information
contained in this document is subject to change without notice.
Safety Symbols
In this manual, this symbol indicates that the operator must refer to
an important WARNING or CAUTION in the operating instructions.
Please see Chapter 4 for important safety information regarding
installation and hookup of the meter.
Dans ce manuel, ce symbole indique que l’opérateur doit se référer à un important
AVERTISSEMENT ou une MISE EN GARDE dans les instructions opérationnelles. Veuillez consulter le chapitre 4 pour des informations importantes relatives à l’installation
et branchement du compteur.
The following safety symbols may be used on the meter itself:
This symbol alerts you to the presence of high voltage, which can
cause dangerous electrical shock.
Ce symbole vous indique la présence d’une haute tension qui peut
provoquer une décharge électrique dangereuse.
EM-3000 Series Meter Installation and Operation Manual
iii
This symbol indicates the field wiring terminal that must be connected
to earth ground before operating the meter, which protects against
electrical shock in case of a fault condition.
Ce symbole indique que la borne de pose des canalisations in-situ qui doit être
branchée dans la mise à terre avant de faire fonctionner le compteur qui est protégé
contre une décharge électrique ou un état défectueux.
This symbol indicates that the user must refer to this manual for
specific WARNING or CAUTION information to avoid personal injury or
damage to the product.
Ce symbole indique que l'utilisateur doit se référer à ce manuel pour AVERTISSEMENT
ou MISE EN GARDE l'information pour éviter toute blessure ou tout endommagement
du produit.
FCC Information
Regarding the wireless module:
• This device complies with Part 15 of the FCC rules. Operation is subject to the
following two conditions: 1) this device may not cause harmful interference, and
2) this device must accept any interference received, including interference that
may cause undesired operation.
• The antenna provided must not be replaced with a different type. Attaching a
different antenna will void the FCC approval and the FCC ID can no longer be
considered.
EM-3000 Series Meter Installation and Operation Manual
iv
Table of Contents
Table of Contents
Use Of Product for Protection
iii
Statement of Calibration
iii
Disclaimer
iii
Safety Symbols
iii
FCC Information
iv
1: Three-Phase Power Measurement
1-1
1.1: Three-Phase System Configurations
1-1
1.1.1: Wye Connection
1-1
1.1.2: Delta Connection
1-4
1.1.3: Blondel’s Theorem and Three Phase Measurement
1-6
1.2: Power, Energy and Demand
1-8
1.3: Reactive Energy and Power Factor
1-12
1.4: Harmonic Distortion
1-14
1.5: Power Quality
1-17
2: EM-3000 Series Meter Overview and Specifications
2-1
2.1: Hardware Overview
2-1
2.1.1: Model Number plus Option Numbers
2-3
2.1.2: Measured Values
2-4
2.1.3: Utility Peak Demand
2-5
2.2: Specifications
2-5
2.3: Compliance
2-10
2.4: Accuracy
2-11
EM-3000 Series Meter Installation and Operation Manual
TOC-1
Table of Contents
3: Mechanical Installation
3-1
3.1: Overview
3-1
3.2: Install the Base
3-2
3.2.1:Mounting Diagrams
3-3
3.3: Secure the Cover
3-7
4: Electrical Installation
4-1
4.1: Considerations When Installing Meters
4-1
4.2: Electrical Connections
4-5
4.3: Ground Connections
4-6
4.4: Voltage Fuses
4-7
4.5: Electrical Connection Diagrams
4-7
5: Communication Installation
5-1
5.1: EM-3000 Series Meter Communication
5-1
5.1.1: IrDA Port (Com 1)
5-1
5.1.2: KYZ Output
5-2
5.1.3: Ethernet Connection
5-4
6: Ethernet Configuration
6-1
6.1: Introduction
6-1
6.2: Factory Default Settings
6-2
6.2.1: Modbus/TCP to RTU Bridge Setup
6-3
6.3: Configure Network Module
6-4
6.3.1: Configuration Requirements
6-4
6.3.2: Configuring the Ethernet Adapter
6-5
EM-3000 Series Meter Installation and Operation Manual
TOC-2
Table of Contents
6.3.3: Detailed Configuration Parameters
6-8
6.3.4: Setup Details
6-9
6.4: Network Module Hardware Initialization
6-14
6.5: Integrating the EM-3000 Series Meter into a WLAN
6-15
7: Using the Submeter
7-1
7.1: Introduction
7-1
7.1.1: Understanding Submeter Face Elements
7-1
7.1.2: Understanding Submeter Face Buttons
7-2
7.2: Using the Front Panel
7-3
7.2.1: Understanding Startup and Default Displays
7-3
7.2.2: Using the Main Menu
7-4
7.2.3: Using Reset Mode
7-5
7.2.4: Entering a Password
7-6
7.2.5: Using Configuration Mode
7-7
7.2.5.1: Configuring the Scroll Feature
7-9
7.2.5.2: Configuring CT Setting
7-10
7.2.5.3: Configuring PT Setting
7-11
7.2.5.4: Configuring Connection Setting
7-13
7.2.5.5: Configuring Communication Port Setting
7-13
7.2.6: Using Operating Mode
7-15
7.3: Understanding the % of Load Bar
7-16
7.4: Performing Watt-Hour Accuracy Testing (Verification)
7-17
A: EM-3000 Series Meter’s Navigation Maps
A-1
EM-3000 Series Meter Installation and Operation Manual
TOC-3
Table of Contents
A.1: Introduction
A-1
A.2: Navigation Maps (Sheets 1 to 4)
A-1
B: EM-3000 Series Meter’s Modbus Map
B-1
B.1: Introduction
B-1
B.2: Modbus Register Map Sections
B-1
B.3: Data Formats
B-1
B.4: Floating Point Values
B-2
B.5: Modbus Register Map
B-3
EM-3000 Series Meter Installation and Operation Manual
TOC-4
1: Three Phase Power Measurement
1: Three-Phase Power Measurement
This introduction to three-phase power and power measurement is intended to
provide only a brief overview of the subject. The professional meter engineer or meter
technician should refer to more advanced documents such as the EEI Handbook for
Electricity Metering and the application standards for more in-depth and technical
coverage of the subject.
1.1: Three-Phase System Configurations
Three-phase power is most commonly used in situations where large amounts of
power will be used because it is a more effective way to transmit the power and
because it provides a smoother delivery of power to the end load. There are two
commonly used connections for three-phase power, a wye connection or a delta
connection. Each connection has several different manifestations in actual use.
When attempting to determine the type of connection in use, it is a good practice to
follow the circuit back to the transformer that is serving the circuit. It is often not
possible to conclusively determine the correct circuit connection simply by counting
the wires in the service or checking voltages. Checking the transformer connection
will provide conclusive evidence of the circuit connection and the relationships
between the phase voltages and ground.
1.1.1: Wye Connection
The wye connection is so called because when you look at the phase relationships and
the winding relationships between the phases it looks like a Y. Figure 1.1 depicts the
winding relationships for a wye-connected service. In a wye service the neutral (or
center point of the wye) is typically grounded. This leads to common voltages of 208/
120 and 480/277 (where the first number represents the phase-to-phase voltage and
the second number represents the phase-to-ground voltage).
EM-3000 Series Meter Installation and Operation Manual
1-1
1: Three Phase Power Measurement
VC
Phase 3
N
Phase 1
Phase 2
VB
VA
Figure 1.1: Three-phase Wye Winding
The three voltages are separated by 120o electrically. Under balanced load conditions
the currents are also separated by 120o. However, unbalanced loads and other
conditions can cause the currents to depart from the ideal 120oseparation. Threephase voltages and currents are usually represented with a phasor diagram. A phasor
diagram for the typical connected voltages and currents is shown in Figure 1.2.
VC
IC
N
IA
VB
IB
VA
Figure 1.2: Phasor Diagram Showing Three-phase Voltages and Currents
EM-3000 Series Meter Installation and Operation Manual
1-2
1: Three Phase Power Measurement
The phasor diagram shows the 120o angular separation between the phase voltages.
The phase-to-phase voltage in a balanced three-phase wye system is 1.732 times the
phase-to-neutral voltage. The center point of the wye is tied together and is typically
grounded. Table 1.1 shows the common voltages used in the United States for wyeconnected systems.
Phase to Ground Voltage
Phase to Phase Voltage
120 volts
208 volts
277 volts
480 volts
2,400 volts
4,160 volts
7,200 volts
12,470 volts
7,620 volts
13,200 volts
Table 1: Common Phase Voltages on Wye Services
Usually a wye-connected service will have four wires: three wires for the phases and
one for the neutral. The three-phase wires connect to the three phases (as shown in
Figure 1.1). The neutral wire is typically tied to the ground or center point of the wye.
In many industrial applications the facility will be fed with a four-wire wye
service
but only three wires will be run to individual loads. The load is then often referred to
as a delta-connected load but the service to the facility is still a wye service; it
contains four wires if you trace the circuit back to its source (usually a transformer).
In this type of connection the phase to ground voltage will be the phase-to-ground
voltage indicated in Table 1, even though a neutral or ground wire is not physically
present at the load. The transformer is the best place to determine the circuit
connection type because this is a location where the voltage reference to ground can
be conclusively identified.
EM-3000 Series Meter Installation and Operation Manual
1-3
1: Three Phase Power Measurement
1.1.2: Delta Connection
Delta-connected services may be fed with either three wires or four wires. In a threephase delta service the load windings are connected from phase-to-phase rather than
from phase-to-ground. Figure 1.3 shows the physical load connections for a delta
service.
VC
Phase 2
VB
Phase 3
Phase 1
VA
Figure 1.3: Three-phase Delta Winding Relationship
In this example of a delta service, three wires will transmit the power to the load. In a
true delta service, the phase-to-ground voltage will usually not be balanced because
the ground is not at the center of the delta.
Figure 1.4 shows the phasor relationships between voltage and current on a threephase delta circuit.
In many delta services, one corner of the delta is grounded. This means the phase to
ground voltage will be zero for one phase and will be full phase-to-phase voltage for
the other two phases. This is done for protective purposes.
EM-3000 Series Meter Installation and Operation Manual
1-4
1: Three Phase Power Measurement
VBC
VCA
IC
IA
IB
VAB
Figure 1.4: Phasor Diagram, Three-Phase Voltages and Currents, Delta-Connected
Another common delta connection is the four-wire, grounded delta used for lighting
loads. In this connection the center point of one winding is grounded. On a 120/240
volt, four-wire, grounded delta service the phase-to-ground voltage would be 120
volts on two phases and 208 volts on the third phase. Figure 1.5 shows the phasor
diagram for the voltages in a three-phase, four-wire delta system.
VC
VCA
VBC
N
VA
VAB
VB
Figure 1.5: Phasor Diagram Showing Three-phase Four-Wire Delta-Connected System
EM-3000 Series Meter Installation and Operation Manual
1-5
1: Three Phase Power Measurement
1.1.3: Blondel’s Theorem and Three Phase Measurement
In 1893 an engineer and mathematician named Andre E. Blondel set forth the first
scientific basis for polyphase metering. His theorem states:
If energy is supplied to any system of conductors through N wires, the total power in
the system is given by the algebraic sum of the readings of N wattmeters so arranged
that each of the N wires contains one current coil, the corresponding potential coil
being connected between that wire and some common point. If this common point is
on one of the N wires, the measurement may be made by the use of N-1 Wattmeters.
The theorem may be stated more simply, in modern language:
In a system of N conductors, N-1 meter elements will measure the power or energy
taken provided that all the potential coils have a common tie to the conductor in
which there is no current coil.
Three-phase power measurement is accomplished by measuring the three individual
phases and adding them together to obtain the total three phase value. In older
analog meters, this measurement was accomplished using up to three separate elements. Each element combined the single-phase voltage and current to produce a
torque on the meter disk. All three elements were arranged around the disk so that
the disk was subjected to the combined torque of the three elements. As a result the
disk would turn at a higher speed and register power supplied by each of the three
wires.
According to Blondel's Theorem, it was possible to reduce the number of elements
under certain conditions. For example, a three-phase, three-wire delta system could
be correctly measured with two elements (two potential coils and two current coils) if
the potential coils were connected between the three phases with one phase in
common.
In a three-phase, four-wire wye system it is necessary to use three elements. Three
voltage coils are connected between the three phases and the common neutral
conductor. A current coil is required in each of the three phases.
In modern digital meters, Blondel's Theorem is still applied to obtain proper metering.
The difference in modern meters is that the digital meter measures each phase voltage and current and calculates the single-phase power for each phase. The meter
then sums the three phase powers to a single three-phase reading.
EM-3000 Series Meter Installation and Operation Manual
1-6
1: Three Phase Power Measurement
Some digital meters measure the individual phase power values one phase at a time.
This means the meter samples the voltage and current on one phase and calculates a
power value. Then it samples the second phase and calculates the power for the
second phase. Finally, it samples the third phase and calculates that phase power.
After sampling all three phases, the meter adds the three readings to create the
equivalent three-phase power value. Using mathematical averaging techniques, this
method can derive a quite accurate measurement of three-phase power.
More advanced meters actually sample all three phases of voltage and current
simultaneously and calculate the individual phase and three-phase power values. The
advantage of simultaneous sampling is the reduction of error introduced due to the
difference in time when the samples were taken.
C
B
Phase B
Phase C
Node "n"
Phase A
A
N
Figure 1.6: Three-Phase Wye Load Illustrating Kirchhoff’s Law and Blondel’s Theorem
Blondel's Theorem is a derivation that results from Kirchhoff's Law. Kirchhoff's Law
states that the sum of the currents into a node is zero. Another way of stating the
same thing is that the current into a node (connection point) must equal the current
out of the node. The law can be applied to measuring three-phase loads. Figure 1.6
shows a typical connection of a three-phase load applied to a three-phase, four-wire
service. Kirchhoff's Law holds that the sum of currents A, B, C and N must equal zero
or that the sum of currents into Node "n" must equal zero.
If we measure the currents in wires A, B and C, we then know the current in wire N by
Kirchhoff's Law and it is not necessary to measure it. This fact leads us to the
conclusion of Blondel's Theorem- that we only need to measure the power in three of
EM-3000 Series Meter Installation and Operation Manual
1-7
1: Three Phase Power Measurement
the four wires if they are connected by a common node. In the circuit of Figure 1.6 we
must measure the power flow in three wires. This will require three voltage coils and
three current coils (a three-element meter). Similar figures and conclusions could be
reached for other circuit configurations involving Delta-connected loads.
1.2: Power, Energy and Demand
It is quite common to exchange power, energy and demand without differentiating
between the three. Because this practice can lead to confusion, the differences
between these three measurements will be discussed.
Power is an instantaneous reading. The power reading provided by a meter is the
present flow of watts. Power is measured immediately just like current. In many
digital meters, the power value is actually measured and calculated over a one second
interval because it takes some amount of time to calculate the RMS values of voltage
and current. But this time interval is kept small to preserve the instantaneous nature
of power.
Energy is always based on some time increment; it is the integration of power over a
defined time increment. Energy is an important value because almost all electric bills
are based, in part, on the amount of energy used.
Typically, electrical energy is measured in units of kilowatt-hours (kWh). A kilowatthour represents a constant load of one thousand watts (one kilowatt) for one hour.
Stated another way, if the power delivered (instantaneous watts) is measured as
1,000 watts and the load was served for a one hour time interval then the load would
have absorbed one kilowatt-hour of energy. A different load may have a constant
power requirement of 4,000 watts. If the load were served for one hour it would
absorb four kWh. If the load were served for 15 minutes it would absorb ¼ of that
total or one kWh.
Figure 1.7 shows a graph of power and the resulting energy that would be transmitted
as a result of the illustrated power values. For this illustration, it is assumed that the
power level is held constant for each minute when a measurement is taken. Each bar
in the graph will represent the power load for the one-minute increment of time. In
real life the power value moves almost constantly.
The data from Figure 1.7 is reproduced in Table 2 to illustrate the calculation of
energy. Since the time increment of the measurement is one minute and since we
EM-3000 Series Meter Installation and Operation Manual
1-8
1: Three Phase Power Measurement
specified that the load is constant over that minute, we can convert the power reading
to an equivalent consumed energy reading by multiplying the power reading times 1/
60 (converting the time base from minutes to hours).
80
70
kilowat t s
60
50
40
30
20
10
0
1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
Time (minutes)
Figure 1.7: Power Use over Time
EM-3000 Series Meter Installation and Operation Manual
1-9
1: Three Phase Power Measurement
Time
Interval
(minute)
Power
(kW)
Energy
(kWh)
Accumulated
Energy
(kWh)
1
30
0.50
0.50
2
50
0.83
1.33
3
40
0.67
2.00
4
55
0.92
2.92
5
60
1.00
3.92
6
60
1.00
4.92
7
70
1.17
6.09
8
70
1.17
7.26
9
60
1.00
8.26
10
70
1.17
9.43
11
80
1.33
10.76
12
50
0.83
12.42
13
50
0.83
12.42
14
70
1.17
13.59
15
80
1.33
14.92
Table 1.2: Power and Energy Relationship over Time
As in Table 1.2, the accumulated energy for the power load profile of Figure 1.7 is
14.92 kWh.
Demand is also a time-based value. The demand is the average rate of energy use
over time. The actual label for demand is kilowatt-hours/hour but this is normally
reduced to kilowatts. This makes it easy to confuse demand with power, but demand
is not an instantaneous value. To calculate demand it is necessary to accumulate the
energy readings (as illustrated in Figure 1.7) and adjust the energy reading to an
hourly value that constitutes the demand.
In the example, the accumulated energy is 14.92 kWh. But this measurement was
made over a 15-minute interval. To convert the reading to a demand value, it must be
normalized to a 60-minute interval. If the pattern were repeated for an additional
three 15-minute intervals the total energy would be four times the measured value or
EM-3000 Series Meter Installation and Operation Manual
1 - 10
1: Three Phase Power Measurement
59.68 kWh. The same process is applied to calculate the 15-minute demand value.
The demand value associated with the example load is 59.68 kWh/hr or 59.68 kWd.
Note that the peak instantaneous value of power is 80 kW, significantly more than the
demand value.
Figure 1.8 shows another example of energy and demand. In this case, each bar represents the energy consumed in a 15-minute interval. The energy use in each interval
typically falls between 50 and 70 kWh. However, during two intervals the energy rises
sharply and peaks at 100 kWh in interval number 7. This peak of usage will result in
setting a high demand reading. For each interval shown the demand value would be
four times the indicated energy reading. So interval 1 would have an associated
demand of 240 kWh/hr.
Interval 7 will have a demand value of 400 kWh/hr. In the
data shown, this is the peak demand value and would be the number that would set
the demand charge on the utility bill.
100
kilowat t-hours
80
60
40
20
0
1
2
3
4
5
6
Intervals (15 mins.)
7
8
Figure 1.8: Energy Use and Demand
As can be seen from this example, it is important to recognize the relationships
between power, energy and demand in order to control loads effectively or to monitor
use correctly.
EM-3000 Series Meter Installation and Operation Manual
1 - 11
1: Three Phase Power Measurement
1.3: Reactive Energy and Power Factor
The real power and energy measurements discussed in the previous section relate to
the quantities that are most used in electrical systems. But it is often not sufficient to
only measure real power and energy. Reactive power is a critical component of the
total power picture because almost all real-life
applications have an impact on
reactive power. Reactive power and power factor concepts relate to both load and
generation applications. However, this discussion will be limited to analysis of reactive
power and power factor as they relate to loads. To simplify the discussion, generation
will not be considered.
Real power (and energy) is the component of power that is the combination of the
voltage and the value of corresponding current that is directly in phase with the
voltage. However, in actual practice the total current is almost never in phase with the
voltage. Since the current is not in phase with the voltage, it is necessary to consider
both the inphase component and the component that is at quadrature (angularly
rotated 90o or perpendicular) to the voltage. Figure 1.9 shows a single-phase voltage
and current and breaks the current into its in-phase and quadrature components.
IR
V
0
IX
I
Figure 1.9: Voltage and Complex Current
The voltage (V) and the total current (I) can be combined to calculate the apparent
power or VA. The voltage and the in-phase current (IR) are combined to produce the
real power or watts. The voltage and the quadrature current (IX) are combined to
calculate the reactive power.
The quadrature current may be lagging the voltage (as shown in Figure 1.9) or it may
lead the voltage. When the quadrature current lags the voltage the load is requiring
both real power (watts) and reactive power (VARs). When the quadrature current
EM-3000 Series Meter Installation and Operation Manual
1 - 12
1: Three Phase Power Measurement
leads the voltage the load is requiring real power (watts) but is delivering reactive
power (VARs) back into the system; that is VARs are flowing in the opposite direction
of the real power flow.
Reactive power (VARs) is required in all power systems. Any equipment that uses
magnetization to operate requires VARs. Usually the magnitude of VARs is relatively
low compared to the real power quantities. Utilities have an interest in maintaining
VAR requirements at the customer to a low value in order to maximize the return on
plant invested to deliver energy. When lines are carrying VARs, they cannot carry as
many watts. So keeping the VAR content low allows a line to carry its full capacity of
watts. In order to encourage customers to keep VAR requirements low, some utilities
impose a penalty if the VAR content of the load rises above a specified value.
A common method of measuring reactive power requirements is power factor. Power
factor can be defined in two different ways. The more common method of calculating
power factor is the ratio of the real power to the apparent power. This relationship is
expressed in the following formula:
Total PF = real power / apparent power = watts/VA
This formula calculates a power factor quantity known as Total Power Factor. It is
called Total PF because it is based on the ratios of the power delivered. The delivered
power quantities will include the impacts of any existing harmonic content. If the
voltage or current includes high levels of harmonic distortion the power values will be
affected. By calculating power factor from the power values, the power factor will
include the impact of harmonic distortion. In many cases this is the preferred method
of calculation because the entire impact of the actual voltage and current are
included.
A second type of power factor is Displacement Power Factor. Displacement PF is based
on the angular relationship between the voltage and current. Displacement power
factor does not consider the magnitudes of voltage, current or power. It is solely
based on the phase angle differences. As a result, it does not include the impact of
EM-3000 Series Meter Installation and Operation Manual
1 - 13
1: Three Phase Power Measurement
harmonic distortion. Displacement power factor is calculated using the following
equation:
Displacement PF = cos 
where  is the angle between the voltage and the current (see Fig. 1.9).
In applications where the voltage and current are not distorted, the Total Power Factor
will equal the Displacement Power Factor. But if harmonic distortion is present, the
two power factors will not be equal.
1.4: Harmonic Distortion
Harmonic distortion is primarily the result of high concentrations of non-linear loads.
Devices such as computer power supplies, variable speed drives and fluorescent light
ballasts make current demands that do not match the sinusoidal waveform of AC
electricity. As a result, the current waveform feeding these loads is periodic but not
sinusoidal. Figure 1.10 shows a normal, sinusoidal current waveform. This example
has no distortion.
1000
0
Amps
500
Time
– 500
– 1000
Figure 1.10: Nondistorted Current Waveform
Figure 1.11 shows a current waveform with a slight amount of harmonic distortion.
The waveform is still periodic and is fluctuating at the normal 60 Hz frequency.
However, the waveform is not a smooth sinusoidal form as seen in Figure 1.10.
EM-3000 Series Meter Installation and Operation Manual
1 - 14
1: Three Phase Power Measurement
1500
Current (amps)
1000
500
t
0
a
2a
–500
–1000
–1500
Figure 1.11: Distorted Current Waveform
The distortion observed in Figure 1.11 can be modeled as the sum of several
sinusoidal waveforms of frequencies that are multiples of the fundamental 60 Hz
frequency. This modeling is performed by mathematically disassembling the distorted
waveform into a collection of higher frequency waveforms.
These higher frequency waveforms are referred to as harmonics. Figure 1.12 shows
the content of the harmonic frequencies that make up the distortion portion of the
waveform in Figure 1.11.
1000
0
Amps
500
Time
3rd harmonic
5th harmonic
– 500
7th harmonic
Total
fundamental
Figure 1.12: Waveforms of the Harmonics
EM-3000 Series Meter Installation and Operation Manual
1 - 15
1: Three Phase Power Measurement
The waveforms shown in Figure 1.12 are not smoothed but do provide an indication of
the impact of combining multiple harmonic frequencies together.
When harmonics are present it is important to remember that these quantities are
operating at higher frequencies. Therefore, they do not always respond in the same
manner as 60 Hz values.
Inductive and capacitive impedance are present in all power systems. We are
accustomed to thinking about these impedances as they perform at 60 Hz. However,
these impedances are subject to frequency variation.
XL = jL
and
XC = 1/jC
At 60 Hz,  = 377; but at 300 Hz (5th harmonic)  = 1,885. As frequency changes
impedance changes and system impedance characteristics that are normal at 60 Hz
may behave entirely differently in the presence of higher order harmonic waveforms.
Traditionally, the most common harmonics have been the low order, odd frequencies,
such as the 3rd, 5th, 7th, and 9th. However newer, new-linear loads are introducing
significant quantities of higher order harmonics.
Since much voltage monitoring and almost all current monitoring is performed using
instrument transformers, the higher order harmonics are often not visible. Instrument
transformers are designed to pass 60 Hz quantities with high accuracy. These devices,
when designed for accuracy at low frequency, do not pass high frequencies with high
accuracy; at frequencies above about 1200 Hz they pass almost no information. So
when instrument transformers are used, they effectively filter out higher frequency
harmonic distortion making it impossible to see.
However, when monitors can be connected directly to the measured circuit (such as
direct connection to a 480 volt bus) the user may often see higher order harmonic
distortion. An important rule in any harmonics study is to evaluate the type of
equipment and connections before drawing a conclusion. Not being able to see
harmonic distortion is not the same as not having harmonic distortion.
It is common in advanced meters to perform a function commonly referred to as
waveform capture. Waveform capture is the ability of a meter to capture a present
picture of the voltage or current waveform for viewing and harmonic analysis.
EM-3000 Series Meter Installation and Operation Manual
1 - 16
1: Three Phase Power Measurement
Typically a waveform capture will be one or two cycles in duration and can be viewed
as the actual waveform, as a spectral view of the harmonic content, or a tabular view
showing the magnitude and phase shift of each harmonic value. Data collected with
waveform capture is typically not saved to memory. Waveform capture is a real-time
data collection event.
Waveform capture should not be confused with waveform recording that is used to
record multiple cycles of all voltage and current waveforms in response to a transient
condition.
1.5: Power Quality
Power quality can mean several different things. The terms "power quality" and
"power quality problem" have been applied to all types of conditions. A simple
definition of "power quality problem" is any voltage, current or frequency deviation
that results in mis-operation or failure of customer equipment or systems. The causes
of power quality problems vary widely and may originate in the customer equipment,
in an adjacent customer facility or with the utility.
In his book Power Quality Primer, Barry Kennedy provided information on different
types of power quality problems. Some of that information is summarized in Table
1.3.
EM-3000 Series Meter Installation and Operation Manual
1 - 17
1: Three Phase Power Measurement
Cause
Disturbance Type
Source
Impulse transient
Transient voltage disturbance,
sub-cycle duration
Lightning
Electrostatic discharge
Load switching
Capacitor switching
Oscillatory
transient with decay
Transient voltage, sub-cycle
duration
Line/cable switching
Capacitor switching
Load switching
Sag/swell
RMS voltage, multiple cycle
duration
Remote system faults
Interruptions
RMS voltage, multiple
seconds or longer duration
System protection
Circuit breakers
Fuses
Maintenance
Under voltage/over voltage
RMS voltage, steady state,
multiple seconds or longer
duration
Motor starting
Load variations
Load dropping
Voltage flicker
RMS voltage, steady state,
repetitive condition
Intermittent loads
Motor starting
Arc furnaces
Harmonic distortion
Steady state current or voltage, long-term duration
Non-linear loads
System resonance
Table 1.3: Typical Power Quality Problems and Sources
It is often assumed that power quality problems originate with the utility. While it is
true that many power quality problems can originate with the utility system, many
problems originate with customer equipment. Customer-caused problems may
manifest themselves inside the customer location or they may be transported by the
utility system to another adjacent customer. Often, equipment that is sensitive to
power quality problems may in fact also be the cause of the problem.
If a power quality problem is suspected, it is generally wise to consult a power quality
professional for assistance in defining the cause and possible solutions to the
problem.
EM-3000 Series Meter Installation and Operation Manual
1 - 18
2: Meter Overview and Specifications
2: EM-3000 Series Meter Overview and
Specifications
2.1: Hardware Overview
The EM-3000 Series multifunction submeter is designed
to measure revenue grade electrical energy usage and
communicate that information via various communication media. The unit supports RJ45 wired Ethernet or
IEEE 802.11 WiFi Ethernet connections. This allows the
EM-3000 Series meter to be placed anywhere within an
industrial or commercial facility and still communicate
quickly and easily back to central software. The unit
also has a front IrDA port that can be read and configured with an IrDA-equipped device, such as a laptop
PC.
The unit is designed with advanced measurement
capabilities, allowing it to achieve high performance accuracy. The EM-3000 Series
meter is specified as a 0.2% class energy meter for billing applications. To verify the
meter’s performance and calibration, power providers use field test standards to verify that the unit’s energy measurements are correct. The EM-3000 Series meter is a
traceable revenue meter and contains a utility grade test pulse to verify rated accuracy.
EM-3000 Series meter features detailed in this manual are:
• 0.2% Class Revenue Certifiable Energy and Demand Submeter
• Meets ANSI C12.20 (0.2%) and IEC 62053-22 (0.2%) Classes
• Multifunction Measurement including Voltage, Current, Power, Frequency, Energy,
etc.
• Power quality measurements (% THD and alarm limits)
• Three line 0.56” bright red LED display
• Percentage of Load bar for Analog meter perception
EM-3000 Series Meter Installation and Operation Manual
2-1
2: Meter Overview and Specifications
• Modbus TCP
• Ethernet and wireless Ethernet (WiFi)
• Easy to use faceplate programming
• IrDA port for laptop PC remote read
• Direct interface with most Building Management systems
The EM-3000 Series meter uses standard 5 or 1 Amp CTs (either split or donut). It
surface mounts to any wall and is easily programmed. The unit is designed specifically for easy installation and advanced communication.
EM-3000 Series Meter Installation and Operation Manual
2-2
2: Meter Overview and Specifications
2.1.1: Model Number plus Option Numbers
Product
Series
Network
Protocol
EM-3
EM3000
Series
Meter
8
WiFi
Freq.
50
50 Hz
System
60
60 Hz
System
Power
Supply
-0
(90-400)
VAC
(100-370)
VDC
Current
Class
5
5 Amp
Secondary
1
1 Amp
Secondary
Mounting
-W
Default
VSwitchTM
Pack
0
0
E
Default with
Energy
Counters
F
Above with
Harmonics
and Limits
Example:
EM-3860-05-WE00
which translates to an EM-3000 Series meter with a 60Hz system, default power supply, 5 Amp Secondary current class, default mounting, and default V-Switch key. The
last two options do not pertain to the EM-3000 Series meter, so the ordering code
contains 0s for them.
EM-3000 Series Meter Installation and Operation Manual
2-3
2: Meter Overview and Specifications
2.1.2: Measured Values
The EM-3000 Series meter provides the following measured values all in real time and
some additionally as average, maximum and minimum values.
EM-3000 Series Meter Measured Values
Measured Values
Real Time
Average
Maximum
Minimum
Voltage L-N
X
X
X
Voltage L-L
X
X
X
Current per Phase
X
X
X
X
Current Neutral
X
Watts
X
X
X
X
VAR
X
X
X
X
VA
X
X
X
X
PF
X
X
X
X
+Watt-hr
X
-Watt-hr
X
Watt-hr Net
X
+VAR-hr
X
-VAR-hr
X
VAR-hr Net
X
VA-hr
X
Frequency
X
X
X
%THD**
X
X
X
Voltage Angles
X
Current Angles
X
% of Load Bar
X
** The EM-3000 Series meter measures harmonics up to the 7th order for Current
and up to the 3rd order for Voltage.
EM-3000 Series Meter Installation and Operation Manual
2-4
2: Meter Overview and Specifications
2.1.3: Utility Peak Demand
The EM-3000 Series meter provides user-configured Block (Fixed) window or Rolling
window Demand. This feature allows you to set up a customized Demand profile.
Block window Demand is Demand used over a user-configured Demand period (usually 5, 15 or 30 minutes). Rolling window Demand is a fixed window Demand that
moves for a user-specified subinterval period.
For example, a 15-minute Demand using 3 subintervals and providing a new Demand
reading every 5 minutes, based on the last 15 minutes.
Utility Demand features can be used to calculate kW, kVAR, kVA and PF readings. All
other parameters offer Max and Min capability over the user-selectable averaging
period. Voltage provides an Instantaneous Max and Min reading which displays the
highest surge and lowest sag seen by the meter
2.2: Specifications
Power Supply
Range:
Universal, (90 to 400)VAC
@50/60Hz or (100 to 370)VDC
Power Consumption:
16 VA Maximum
Voltage Inputs (Measurement Category III)
Range:
Universal, Auto-ranging up to
416VAC L-N, 721VAC L-L
Supported hookups:
3 Element Wye, 2.5 Element Wye,
2 Element Delta, 4 Wire Delta
Input Impedance:
1M Ohm/Phase
Burden:
0.36VA/Phase Max at 600V,
0.0144VA/Phase at 120V
Pickup Voltage:
10VAC
Connection:
Screw terminal - #6 - 32 screws
See Figure 4.1
EM-3000 Series Meter Installation and Operation Manual
2-5
2: Meter Overview and Specifications
Input Wire Gauge:
AWG#16 - 26
Fault Withstand:
Meets IEEE C37.90.1 (Surge
Withstand Capability)
Reading:
Programmable Full Scale to any PT
Ratio
Current Inputs
Class 10:
5A Nominal, 10 Amp Maximum
Class 2:
1A Nominal, 2 Amp Secondary
Burden:
0.005VA Per Phase Max at 11 Amps
Pickup Current:
0.1% of Nominal
Connections:
Screw terminal - #6-32 screws
(Diagram 4.1)
Current Surge Withstand:
100A/10 seconds at 23o C
Reading:
Programmable Full Scale to any CT
Ratio*
*NOTE: Current transformers are not included with EM series electrical power
meters. When selecting current transformers to meet the needs of a metering
application, you need to know the amperage of the current being measured, and
whether the EM series model is a Class 2 - 1A secondary model or a Class 10 - 5A
secondary model. The current ratio required for a metering application is the
maximum measured Amps divided by the secondary Amps which the meter model
supports.
Current transformers can be purchased from the Electro Industries store at
http://www.electroind.com/store/ or from a local distributor.
For Example, an EM-3860-05-WE00 that has a 5 Amp secondary that is used to
measure a 400A load would need current transformers with a 400/5 ratio.
Isolation
All Inputs and Outputs are galvanically isolated and tested to 2500VAC
EM-3000 Series Meter Installation and Operation Manual
2-6
2: Meter Overview and Specifications
Environmental Rating
Storage:
(-20 to +70)o C
Operating:
(-20 to +70)o C
Humidity:
to 95% RH Non-condensing
Faceplate Rating:
NEMA12 (Water Resistant)
Measurement Methods
Voltage, Current:
True RMS
Power:
Sampling at 400+ Samples per
Cycle on All Channels Measured
Readings Simultaneously
Harmonic %THD
% of Total Harmonic Distortion
A/D Conversion:
6 Simultaneous 24 bit Analog to
Digital Converters
Update Rate
Watts, VAR and VA:
Every 6 cycles, e.g., 100
milliseconds (Ten times per
second) @60Hz
All other parameters:
Every 60 cycles, e.g, 1 second
@60Hz
Communication Format
IrDA Port through Face Plate
Protocol:
Modbus ASCII
Com Port Baud Rate:
57600 bps
Com Port Address:
1
EM-3000 Series Meter Installation and Operation Manual
2-7
2: Meter Overview and Specifications
Wireless Ethernet
802.11b Wireless or
WiFi or RJ45 Connection
10/100BaseT Ethernet
Wireless Security
64 bit or 128 bit WEP; WPA; WPA-2
Protocol:
Modbus TCP
Com Port Baud Rate:
9600 to 57600 bps
Com Port Address:
001-247
Data Format:
8 Bit, No Parity
Mechanical Parameters
Dimensions:
(H7.9 x W7.6 x D3.2) inches,
(H200.7 x W193.0 x D81.3) mm
Weight:
4 pounds/1.81 kilograms
KYZ Output - Wh Pulse
KYZ output contacts (and infrared LED light pulses through face plate; see Section 7.4
for Kh values):
Pulse Width:
40ms
Full Scale Frequency:
~6Hz
Contact type:
Solid State – SPDT (NO – C – NC)
Relay type:
Solid state
Peak switching voltage:
DC ±350V
Continuous load current:
120mA
Peak load current:
350mA for 10ms
On resistance, max.:
35Ω
Leakage current:
1µ[email protected]
Isolation:
AC 3750V
EM-3000 Series Meter Installation and Operation Manual
2-8
2: Meter Overview and Specifications
Reset State:
(NC - C) Closed; (NO - C) Open
Infrared LED:
Peak Spectral Wavelength:
940nm
Reset State:
Off
Internal Schematic:
Output Timing:
T [s]
NC
C
ª Watthour
3600 ˜ Kh «
¬ pulse
P [ Watt ]
º
»
¼
P[Watt] - Not a scaled value
Kh – See Section 7-4 for values
IR LED Light Pulses
Through face plate
40ms
NO
LED
OFF
LED
ON
40ms
LED
OFF
LED
OFF
LED
ON
(De-energized state)
KYZ output
Contact States
Through Backplate
NC
NC
NC
NC
NC
C
C
C
C
C
NO
NO
NO
NO
NO
EM-3000 Series Meter Installation and Operation Manual
2-9
2: Meter Overview and Specifications
2.3: Compliance
• IEC 62053-22 (0.2% Accuracy)
• ANSI C12.20 (0.2% Accuracy)
• ANSI (IEEE) C37.90.1 Surge Withstand
• ANSI C62.41 (Burst)
• EN61000-6-2 Immunity for Industrial Environments: 2005
• EN61000-6-4 Emission Standards for Industrial Environments: 2007
• EN61326-1 EMC Requirements: 2006
• UL Listed
• CE Compliant
EM-3000 Series Meter Installation and Operation Manual
2 - 10
2: Meter Overview and Specifications
2.4: Accuracy
For 23oC, 3 Phase balanced Wye or Delta load, at 50 or 60 Hz (as per order), 5A
(Class 10) nominal unit:
Parameter
Accuracy
Accuracy Input Range
Voltage L-N [V]
0.1% of reading2
(69 to 480)V
Voltage L-L [V]
0.1% of reading
(120 to 600)V
Current Phase [A]
0.1% of reading1
(0.15 to 5)A
Current Neutral (calculated) 2.0% of Full Scale1
[A]
Active Power Total [W]
0.2% of reading1,2
Active Energy Total [Wh]
0.2% of reading1,2
Reactive Power Total [VAR] 0.2% of reading1,2
Reactive Energy Total
[VARh]
Apparent Power Total [VA]
0.2% of reading1,2
0.2% of reading1,2
Apparent Energy Total [VAh]0.2% of reading1,2
Power Factor
0.2% of reading1,2
Frequency
+/- 0.01Hz
Total Harmonic Distortion
(%)
5.0%1
Load Bar
+/- 1 segment1
1
(0.15 to 5)A @ (45 to 65)Hz
(0.15 to 5)A @ (69 to 480)V
@ +/- (0.5 to 1) lag/lead PF
(0.15 to 5)A @ (69 to 480)V
@ +/- (0.5 to 1) lag/lead PF
(0.15 to 5)A @ (69 to 480)V
@ +/- (0 to 0.8) lag/lead PF
(0.15 to 5)A @ (69 to 480)V
@ +/- (0 to 0.8) lag/lead PF
(0.15 to 5)A @ (69 to 480)V
@ +/- (0.5 to 1) lag/lead PF
(0.15 to 5)A @ (69 to 480)V
@ +/- (0.5 to 1) lag/lead PF
(0.15 to 5)A @ (69 to 480)V
@ +/- (0.5 to 1) lag/lead PF
(45 to 65)Hz
(0.5 to 10)A or (69 to
480)V, measurement range
(1 to 99.99)%
(0.005 to 6)A
For 2.5 element programmed units, degrade accuracy by an additional 0.5% of
reading.
• For 1A (Class 2) Nominal, degrade accuracy by an additional 0.5% of reading.
• For 1A (Class 2) Nominal, the input current range for Accuracy specification is
20% of the values listed in the table.
2
For unbalanced voltage inputs where at least one crosses the 150V auto-scale
threshold (for example, 120V/120V/208V system), degrade accuracy by additional
0.4%.
EM-3000 Series Meter Installation and Operation Manual
2 - 11
2: Meter Overview and Specifications
This page intentionally left blank.
EM-3000 Series Meter Installation and Operation Manual
2 - 12
3: Mechanical Installation
3: Mechanical Installation
3.1: Overview
The EM-3000 Series meter can be installed on any wall. See Chapter 4 for wiring
diagrams.
Mount the meter in a dry location, which is free from dirt and corrosive substances.
Recommended Tools for EM-3000 Series meter Installation
• #2 Phillips screwdriver
• Wire cutters
WARNING! During normal operation of the EM-3000 Series meter,
dangerous voltages flow through many parts of the meter, including:
Terminals and any connected CTs (Current Transformers) and PTs (Potential Transformers), all I/O Modules (Inputs and Outputs) and their circuits. All Primary and
Secondary circuits can, at times, produce lethal voltages and currents. Avoid contact with
any current-carrying surfaces. Before performing ANY work on the meter, make sure
the meter is powered down and all connected circuits are de-energized.
AVERTISSEMENT! Pendant le fonctionnement normal du compteur EM-3000 Series des
tensions dangereuses suivant de nombreuses pièces, notamment, les bornes et tous les
transformateurs de courant branchés, les transformateurs de tension, toutes les sorties,
les entrées et leurs circuits. Tous les circuits secondaires et primaires peuvent parfois
produire des tensions de létal et des courants. Évitez le contact avec les surfaces sous tensions. Avant de faire un travail dans le compteur, assurez-vous d'éteindre l'alimentation et de mettre tous les circuits branchés hors tension.
WARNING: Risk of Electric Shock.
Ground the meter according to local, national, and regional regulations.
Failure to ground the meter may result in electric shock and severe
personal injury or death.
AVERTISSEMENT : risque de décharge électrique
Effectuer la mise à terre selon les règlements locaux, nationaux et régionaux. La non mise
à la terre du compteur peut provoquer une décharge électrique, des blessures graves ou
provoquer la mort.
EM-3000 Series Meter Installation and Operation Manual
3-1
3: Mechanical Installation
3.2: Install the Base
1. Determine where you want to install the submeter.
2. With the submeter power off, open the top of the submeter. Use the front cover
support to keep the cover open as you perform the installation (see Figure 3.1).
Front
Cover
Support
Figure 3.1: EM-3000 Series Meter with Cover Open: see WARNING! on previous page
CAUTIONS!
• Remove the antenna before opening the unit.
• Only use the front cover support if you are able to open the front cover to the
extent that you can fit the front cover support into its base. DO NOT rest the front
cover support on the inside of the meter, even for a short time - by doing so, you
may damage components on the board assembly.
3. Find the 4 Installation Slots and insert screws through each slot into the wall or
panel.
4. Fasten securely - DO NOT overtighten.
EM-3000 Series Meter Installation and Operation Manual
3-2
3: Mechanical Installation
3.2.1:Mounting Diagrams
v
CM
v
CM
-/5.4).'0,!4%
v
CM
v
CM
v
CM
Figure 3.2: Mounting Plate Dimensions
EM-3000 Series Meter Installation and Operation Manual
3-3
3: Mechanical Installation
v
CM
v
CM
!NTENNA,ENGTHvCM
Figure 3.3: Front Dimensions
EM-3000 Series Meter Installation and Operation Manual
3-4
3: Mechanical Installation
v
CM
Figure 3.4: Side Dimensions
EM-3000 Series Meter Installation and Operation Manual
3-5
3: Mechanical Installation
12”/
30.4cm
Figure 3.5: Open Cover Dimensions
w
DN
$57PMUBHF$POUSPM1PXFS(SPVOE
5ISPVHI)FSF $PNNVOJDBUJPOT,:;5ISPVHI)FSF
Figure 3.6: Bottom View with Access Holes
EM-3000 Series Meter Installation and Operation Manual
3-6
3: Mechanical Installation
3.3: Secure the Cover
1. Close the cover, making sure that power and communications wires exit the
submeter through the openings at the base (see Figure 3.6).
CAUTION! To avoid damaging components on the board assembly, make sure the
front cover support is in the upright position before closing the front cover.
2. Using the 3 enclosed screws, secure the cover to the base in three places - DO
NOT overtighten (you may damage the cover).
3. The unit can be sealed after the front cover is closed. To seal the unit, thread the
seal tag through the housing located between the bottom access holes (see figures
3.6 and 3.7).
4. Reattach the antenna, if applicable.
Closed
Screw
Lockable Revenue Seal
Figure 3.7: Submeter with Closed Cover
EM-3000 Series Meter Installation and Operation Manual
3-7
3: Mechanical Installation
This page intentionally left blank.
EM-3000 Series Meter Installation and Operation Manual
3-8
4: Electrical Installation
4: Electrical Installation
4.1: Considerations When Installing Meters
Installation of the EM-3000 Series meter must be performed only by
qualified personnel who follow standard safety precautions during all
procedures. Those personnel should have appropriate training and
experience with high voltage devices. Appropriate safety gloves,
safety glasses and protective clothing is recommended.
WARNING! During normal operation of the EM-3000 Series meter, dangerous voltages
flow through many parts of the meter, including: Terminals and any connected CTs (Current Transformers) and PTs (Potential Transformers), all I/O Modules (Inputs and Outputs)
and their circuits. All Primary and Secondary circuits can, at times, produce lethal voltages
and currents. Avoid contact with any current-carrying surfaces. Before performing ANY
work on the meter, make sure the meter is powered down and all connected circuits are de-energized.
Do not use the meter or any I/O Output Device for primary protection or in an
energy-limiting capacity. The meter can only be used as secondary protection.
Do not use the meter for applications where failure of the meter may cause harm or death.
Do not use the meter for any application where there may be a risk of fire.
All meter terminals should be inaccessible after installation.
Do not apply more than the maximum voltage the meter or any attached device can withstand. Refer to meter and/or device labels and to the Specifications for all devices before
applying voltages.
Caution: Risk of Property Damage.
Do not apply power to the system before checking all wiring connections. Short circuited or improperly connected wires may result in
permanent damage to the equipment.
EM-3000 Series Meter Installation and Operation Manual
4-1
4: Electrical Installation
Do not HIPOT/Dielectric test any Outputs, Inputs or Communications terminals.
Johnson Controls, Inc. recommends the use of Fuses for voltage leads and power supply
and Shorting Blocks to prevent hazardous voltage conditions or damage to CTs, if the
meter needs to be removed from service. One side of the CT must be grounded.
NOTE: The current inputs are only to be connected to external current transformers provided by the installer. The CT's shall be Approved or Certified and rated for the current of
the meter used.
Caution: Risk of Property Damage.
Ensure that the power source conforms to the requirements of the
equipment. Failure to use a correct power source may result in permanent damage to the equipment.
L'installation des compteurs de EM-3000 Series doit être effectuée
seulement par un personnel qualifié qui suit les normes relatives aux
précautions de sécurité pendant toute la procédure. Le personnel
doit avoir la formation appropriée et l'expérience avec les appareils
de haute tension. Des gants de sécurité, des verres et des vêtements de protection appropriés sont recommandés.
AVERTISSEMENT! Pendant le fonctionnement normal du compteur EM-3000 Series
des tensions dangereuses suivant de nombreuses pièces, notamment, les bornes et
tous les transformateurs de courant branchés, les transformateurs de tension, toutes
les sorties, les entrées et leurs circuits. Tous les circuits secondaires et primaires
peuvent parfois produire des tensions de létal et des courants. Évitez le contact avec les surfaces sous tensions. Avant de faire un travail dans le compteur, assurez-vous d'éteindre l'alimentation et de mettre tous les circuits
branchés hors tension.
Ne pas utiliser les compteurs ou sorties d'appareil pour une protection primaire ou capacité de limite d'énergie. Le compteur peut seulement être
utilisé comme une protection secondaire.
Ne pas utiliser le compteur pour application dans laquelle une panne de compteur
peut causer la mort ou des blessures graves.
EM-3000 Series Meter Installation and Operation Manual
4-2
4: Electrical Installation
Ne pas utiliser le compteur ou pour toute application dans laquelle un risque
d'incendie est susceptible.
Toutes les bornes de compteur doivent être inaccessibles après l'installation.
Ne pas appliquer plus que la tension maximale que le compteur ou appareil relatif
peut résister. Référez-vous au compteur ou aux étiquettes de l'appareil et les spécifications de tous les appareils avant d'appliquer les tensions. Ne pas faire de test
HIPOT/diélectrique, une sortie, une entrée ou un terminal de réseau.
Les entrées actuelles doivent seulement être branchées aux transformateurs externes
actuels.
Johnson Controls recommande d'utiliser les fusibles pour les fils de tension et alimentations électriques, ainsi que des coupe-circuits pour prévenir les tensions dangereuses ou endommagements de transformateur de courant si l'unité EM-3000 Series
doit être enlevée du service. Un côté du transformateur de courant doit être mis à
terre.
NOTE: les entrées actuelles doivent seulement être branchées dans le transformateur
externe actuel par l'installateur. Le transformateur de courant doit être approuvé ou
certifié et déterminé pour le compteur actuel utilisé.
IMPORTANT!
• IF THE EQUIPMENT IS USED IN A MANNER NOT SPECIFIED BY
THE MANUFACTURER, THE PROTECTION PROVIDED BY THE
EQUIPMENT MAY BE IMPAIRED.
• THERE IS NO REQUIRED PREVENTIVE MAINTENANCE OR
INSPECTION NECESSARY FOR SAFETY. HOWEVER, ANY REPAIR
OR MAINTENANCE SHOULD BE PERFORMED BY THE FACTORY.
DISCONNECT DEVICE: The following part is considered the equipment disconnect device. A SWITCH OR CIRCUIT-BREAKER SHALL BE
INCLUDED IN THE END-USE EQUIPMENT OR BUILDING INSTALLATION. THE SWITCH SHALL BE IN CLOSE PROXIMITY TO THE EQUIPMENT AND WITHIN EASY REACH OF THE OPERATOR. THE SWITCH
SHALL BE MARKED AS THE DISCONNECTING DEVICE FOR THE
EQUIPMENT.
EM-3000 Series Meter Installation and Operation Manual
4-3
4: Electrical Installation
IMPORTANT! SI L'ÉQUIPEMENT EST UTILISÉ D'UNE FAÇON
NON SPÉCIFIÉE PAR LE FABRICANT, LA PROTECTION FOURNIE PAR L'ÉQUIPEMENT PEUT ÊTRE ENDOMMAGÉE.
NOTE: Il N'Y A AUCUNE MAINTENANCE REQUISE POUR LA PRÉVENTION OU INSPECTION NÉCESSAIRE POUR LA SÉCURITÉ. CEPENDANT, TOUTE RÉPARATION OU MAINTENANCE DEVRAIT ÊTRE RÉALISÉE PAR LE FABRICANT.
DÉBRANCHEMENT DE L'APPAREIL : la partie suivante est considérée l'appareil de débranchement de l'équipement.
UN INTERRUPTEUR OU UN DISJONCTEUR DEVRAIT ÊTRE INCLUS
DANS L'UTILISATION FINALE DE L'ÉQUIPEMENT OU L'INSTALLATION.
L'INTERRUPTEUR DOIT ÊTRE DANS UNE PROXIMITÉ PROCHE DE
L'ÉQUIPEMENT ET A LA PORTÉE DE L'OPÉRATEUR. L'INTERRUPTEUR DOIT AVOIR LA
MENTION DÉBRANCHEMENT DE L'APPAREIL POUR L'ÉQUIPEMENT.
EM-3000 Series Meter Installation and Operation Manual
4-4
4: Electrical Installation
4.2: Electrical Connections
All wiring for the EM-3000 Series meter is done through the front of the unit (lifting
the cover with the power to the unit OFF) so that the unit can be surface mounted.
Connecting cables exit the unit via two openings in the base plate (see figures 3.6 and
4.1).
WARNING! During normal operation of the EM-3000 Series meter, dangerous voltages flow through many parts of the meter, including:
Terminals and any connected CTs (Current Transformers) and PTs (Potential
Transformers), all I/O Modules (Inputs and Outputs) and their circuits. All
Primary and Secondary circuits can, at times, produce lethal voltages and
currents. Avoid contact with any current-carrying surfaces. Before performing ANY
work on the meter, make sure the meter is powered down and all connected circuits are de-energized.
AVERTISSEMENT! Pendant le fonctionnement normal du compteur EM-3000 Series des
tensions dangereuses suivant de nombreuses pièces, notamment, les bornes et tous les
transformateurs de courant branchés, les transformateurs de tension, toutes les sorties,
les entrées et leurs circuits. Tous les circuits secondaires et primaires peuvent parfois
produire des tensions de létal et des courants. Évitez le contact avec les surfaces sous tensions. Avant de faire un travail dans le compteur, assurez-vous d'éteindre l'alimentation et de mettre tous les circuits branchés hors tension.
CAUTION! DO NOT over-torque screws.
WARNING: Risk of Electric Shock.
Disconnect the power supply before making electrical connections.
Contact with components carrying hazardous voltage can cause electric
shock and may result in severe personal injury or death.
AVERTISSEMENT: risque de décharge électrique
Débranchez l'alimentation électrique avant de faire un branchement électrique. Le contact
avec des composants ayant des tensons importantes peut provoquer une décharge électrique, des blessures personnelles graves ou la mort.
EM-3000 Series Meter Installation and Operation Manual
4-5
4: Electrical Installation
Wireless Ethernet Connection
Current
Inputs
Electronic Circuits
Ethernet, RJ45
Jack
RS485 Output
(Do not put the
Voltage on these
terminals!)
Ia Ia Ib Ib Ic Ic
(+) (-) (+) (-) (+) (-)
Va Vb Vc Vn L1 L2 PE
Z K Y + - SH
RS-485
KYZ Pulse
Output
Voltage
Inputs
Power Supply
Inputs (Inputs
are unipolar)
Access Holes for
Wiring
Do not over-torque screws!
Figure 4.1: Submeter Connections
4.3: Ground Connections
The meter's Ground Terminal (PE) should be connected directly to the installation's
protective earth ground.
WARNING: Risk of electric shock.
Ground the meter according to local, national, and regional regulations.
Failure to ground the meter may result in electric shock and severe
personal injury or death.
AVERTISSEMENT: risque de décharge électrique
Effectuer la mise à terre selon les règlements locaux, nationaux et régionaux. La non mise
à la terre du compteur peut provoquer une décharge électrique, des blessures graves ou
provoquer la mort.
EM-3000 Series Meter Installation and Operation Manual
4-6
4: Electrical Installation
4.4: Voltage Fuses
Johnson Controls, Inc. recommends the use of fuses on each of the sense voltages
and on the control power, even though the wiring diagrams in this chapter do not
show them.
• Use a 0.1 Amp fuse on each Voltage input.
• Use a 3 Amp fuse on the power supply.
4.5: Electrical Connection Diagrams
Choose the diagram that best suits your application. Make sure the CT polarity is
correct.
1. Three Phase, Four-Wire System Wye with Direct Voltage, 3 Element
a. Dual Phase Hookup
b. Single Phase Hookup
2. Three Phase, Four-Wire System Wye with Direct Voltage, 2.5 Element
3. Three-Phase, Four-Wire Wye with PTs, 3 Element
4. Three-Phase, Four-Wire Wye with PTs, 2.5 Element
5. Three-Phase, Three-Wire Delta with Direct Voltage (No PTs, 2 CTs)
6. Three-Phase, Three-Wire Delta with Direct Voltage (No PTs, 3 CTs)
7. Three-Phase, Three-Wire Delta with 2 PTs, 2 CTs
8. Three-Phase, Three-Wire Delta with 2 PTs, 3 CTs
9. Current Only Measurement (Three Phase)
10. Current Only Measurement (Dual Phase)
11. Current Only Measurement (Single Phase)
WARNING: Risk of Electric Shock.
Disconnect the power supply before making electrical connections.
Contact with components carrying hazardous voltage can cause electric
shock and may result in severe personal injury or death.
AVERTISSEMENT: risque de décharge électrique
Débranchez l’alimentation électrique avant de faire un branchement électrique. Le contact
avec des composants ayant des tensons importantes peut provoquer une décharge
électrique, des blessures personnelles graves ou la mort.
EM-3000 Series Meter Installation and Operation Manual
4-7
4: Electrical Installation
1. Service: WYE, 4-Wire with No PTs, 3 CTs
N
LINE
C B
A
Electronic Circuits
CT
Shorting
Block
Ia+ Ia-
Ib+ Ib-
Ic+
Ic-
CN2
Earth Ground
CN1
Va
Vb
Vc
Vref
L1
L2
PE
L2
GND
Vref
L1
Vc
Vb
Va
3A
FUSE
FUSES
3 x 0.1A
N(-)
L(+)
Power
Supply
Connection
N
C B A
LOAD
Select: "3 EL WYE" (3 Element Wye) in Meter Programming setup.
C
A
B
EM-3000 Series Meter Installation and Operation Manual
4-8
4: Electrical Installation
1a. Dual Phase Hookup
N
LINE
C B
A
Electronic Circuits
CT
Shorting
Block
Ia+ Ia-
Ib+ Ib-
Ic+
Ic-
CN2
Earth Ground
CN1
Va
Vb
Vc
Vref
L1
L2
PE
L2
GND
Vref
L1
Vb
Va
3A
FUSE
FUSES
2x 0.1A
N(-)
L(+)
Power
Supply
Connection
N
C B A
LOAD
EM-3000 Series Meter Installation and Operation Manual
4-9
4: Electrical Installation
1b. Single Phase Hookup
N
LINE
C B
A
Electronic Circuits
CT
Shorting
Block
Ia+ Ia-
Ib+ Ib-
Ic+
Ic-
CN2
Earth Ground
CN1
Va
Vb
Vc
Vref
L1
L2
PE
L2
GND
Vref
L1
Vb
Va
3A
FUSE
FUSE
0.1A
N(-)
L(+)
Power
Supply
Connection
N
C B A
LOAD
EM-3000 Series Meter Installation and Operation Manual
4 - 10
4: Electrical Installation
2. Service: 2.5 Element WYE, 4-Wire with No PTs, 3 CTs
N
LINE
C B
A
Electronic Circuits
CT
Shorting
Block
Ia+ Ia-
Ib+ Ib-
Ic+
Ic-
CN2
Earth Ground
CN1
Va
Vb
Vc
Vref
L1
L2
PE
GND
L2
Vref
L1
Vc
Va
3A
FUSE
FUSES
2 x 0.1A
N(-)
L(+)
Power
Supply
Connection
N
C B A
LOAD
Select: "2.5 EL WYE" (2.5 Element Wye) in Meter Programming setup.
C
A
B
EM-3000 Series Meter Installation and Operation Manual
4 - 11
4: Electrical Installation
3. Service: WYE, 4-Wire with 3 PTs, 3 CTs
N
LINE
C B
A
Electronic Circuits
CT
Shorting
Block
Ia+ Ia-
Ib+ Ib-
Ic+
Ic-
CN2
Earth Ground
CN1
Va
Vb
Vc
Vref
L1
L2
PE
L2
GND
Vref
L1
Vc
Vb
Va
3A
FUSE
FUSES
3 x 0.1A
N(-)
L(+)
Power
Supply
Connection
Earth Ground
N
C B A
LOAD
Select: "3 EL WYE" (3 Element Wye) in Meter Programming setup.
C
A
B
EM-3000 Series Meter Installation and Operation Manual
4 - 12
4: Electrical Installation
4. Service: 2.5 Element WYE, 4-Wire with 2 PTs, 3 CTs
N
LINE
C B
A
Electronic Circuits
CT
Shorting
Block
Ia+ Ia-
Ib+ Ib-
Ic+
Ic-
CN2
Earth Ground
CN1
Va
Vb
Vc
Vref
L1
L2
PE
L2
GND
L1
Vref
Vc
Va
3A
FUSE
FUSES
2 x 0.1A
N(-)
L(+)
Power
Supply
Connection
Earth Ground
N
C B A
LOAD
Select: "2.5 EL WYE" (2.5 Element Wye) in Meter Programming setup.
C
C
B
A B
A
Not Connected to Meter
EM-3000 Series Meter Installation and Operation Manual
4 - 13
4: Electrical Installation
5. Service: Delta, 3-Wire with No PTs, 2 CTs
LINE
C B
A
Electronic Circuits
CT
Shorting
Block
Ia+ Ia-
Ib+ Ib-
Ic+
Ic-
CN2
Earth Ground
CN1
Va
Vb
Vc
Vref
L1
L2
PE
GND
L1
L2
Vc
Vb
Va
3A
FUSE
FUSES
3 x 0.1A
N(-)
L(+)
Power
Supply
Connection
C B A
LOAD
Select: "2 Ct dEL" (2 CT Delta) in Meter Programming setup.
C
C
B
A B
A
Not Connected to Meter
EM-3000 Series Meter Installation and Operation Manual
4 - 14
4: Electrical Installation
6. Service: Delta, 3-Wire with No PTs, 3 CTs
LINE
C B A
Electronic Circuits
CT
Shorting
Block
Ia+ Ia-
Ib+ Ib-
Ic+
Ic-
CN2
Earth Ground
CN1
Va
Vb
Vc
Vref
L1
L2
PE
L2
GND
L1
Vc
Vb
Va
3A
FUSE
FUSES
3 x 0.1A
N(-)
L(+)
Power
Supply
Connection
C
B A
LOAD
Select: "2 Ct dEL" (2 CT Delta) in Meter Programming setup.
C
C
B
A B
A
Not Connected to Meter
EM-3000 Series Meter Installation and Operation Manual
4 - 15
4: Electrical Installation
7. Service: Delta, 3-Wire with 2 PTs, 2 CTs
LINE
C B
A
Electronic Circuits
CT
Shorting
Block
Ia+ Ia-
Ib+ Ib-
Ic+
Ic-
CN2
Earth Ground
CN1
Va
Vb
Vc
Vref
L1
L2
PE
L2
GND
L1
Vc
Vb
Va
3A
FUSE
FUSES
2 x 0.1A
N(-)
L(+)
Power
Supply
Connection
Earth Ground
C B A
LOAD
Select: "2 Ct dEL" (2 CT Delta) in Meter Programming setup.
C
C
B
A B
A
Not Connected to Meter
EM-3000 Series Meter Installation and Operation Manual
4 - 16
4: Electrical Installation
8. Service: Delta, 3-Wire with 2 PTs, 3 CTs
LINE
C B
A
Electronic Circuits
CT
Shorting
Block
Ia+ Ia-
Ib+ Ib-
Ic+
Ic-
CN2
Earth Ground
CN1
Va
Vb
Vc
Vref
L1
L2
PE
GND
L1
L2
Vc
Vb
Va
3A
FUSE
FUSES
2 x 0.1A
N(-)
L(+)
Power
Supply
Connection
Earth Ground
C B A
LOAD
Select: "2 Ct dEL" (2 CT Delta) in Meter Programming setup.
C
C
B
A B
A
Not Connected to Meter
EM-3000 Series Meter Installation and Operation Manual
4 - 17
4: Electrical Installation
9. Service: Current Only Measurement (Three Phase)
LINE
N
C
B
A
Electronic Circuits
CT
Shorting
Block
Ia+ Ia-
Ib+ Ib-
Ic+
Ic-
CN2
Earth Ground
CN1
Va
Vb
Vc
L2
PE
L2
GND
Vref
FUSE
3A
20VAC
Minimum
L1
L1
Va
FUSE
0.1A
Vref
N(-)
L(+)
Power
Supply
Connection
N
C B
LOAD
A
Select: "3 EL WYE" (3 Element Wye) in Meter Programming setup.
NOTE: Even if the meter is used for only Amp readings, the unit requires a Volts AN
reference. Please make sure that the Voltage input is attached to the meter. AC Control Power can be used to provide the reference signal.
EM-3000 Series Meter Installation and Operation Manual
4 - 18
4: Electrical Installation
10. Service: Current Only Measurement (Dual Phase)
LINE
N B A
Electronic Circuits
CT
Shorting
Block
Ia+ Ia-
Ib+ Ib-
Ic+
Ic-
CN2
Earth Ground
CN1
Va
Vb
Vc
L2
PE
GND
L2
Vref
FUSE
3A
20VAC
Minimum
L1
L1
Va
FUSE
0.1A
Vref
N(-)
L(+)
Power
Supply
Connection
N
B A
LOAD
Select: "3 EL WYE" (3 Element Wye) in Meter Programming setup.
NOTE: Even if the meter is used for only Amp readings, the unit requires a Volts AN
reference. Please make sure that the Voltage input is attached to the meter. AC Control Power can be used to provide the reference signal.
EM-3000 Series Meter Installation and Operation Manual
4 - 19
4: Electrical Installation
11. Service: Current Only Measurement (Single Phase)
LINE
N A
Electronic Circuits
CT
Shorting
Block
Ia+ Ia-
Ib+ Ib-
Ic+
Ic-
CN2
Earth Ground
CN1
Va
Vb
Vc
L2
PE
L2
GND
Vref
FUSE
3A
20VAC
Minimum
L1
L1
Va
FUSE
0.1A
Vref
N(-)
L(+)
Power
Supply
Connection
N A
LOAD
Select: "3 EL WYE" (3 Element Wye) in Meter Programming setup.
NOTE: Even if the meter is used for only Amp readings, the unit requires a Volts AN
reference. Please make sure that the Voltage input is attached to the meter. AC Control Power can be used to provide the reference signal.
EM-3000 Series Meter Installation and Operation Manual
4 - 20
5: Communication Installation
5: Communication Installation
5.1: EM-3000 Series Meter Communication
The EM-3000 Series meter provides two independent communication ports plus a KYZ
pulse output. The first port, Com 1, is an IrDA Port, which uses Modbus ASCII. The
second port, Com 2, provides RJ45 Ethernet or WiFi Ethernet communication (see
Chapter 6 for Ethernet configuration).
5.1.1: IrDA Port (Com 1)
The Com 1 IrDA port is located on the face of the submeter. The IrDA Port allows the
unit to be set up and programmed with any device capable of IrDA communication,
such as an IrDA-equipped laptop PC or a USB/IrDA converter wand. Note that you do
not need to use the IrDA port to configure the meter - configuration can be done
through the faceplate buttons - see Chapter 7 for instructions.
IrDA port settings are
Address: 1
Baud Rate: 57600 Baud
Protocol: Modbus ASCII
Figure 5.1: IrDA Communication
EM-3000 Series Meter Installation and Operation Manual
5-1
5: Communication Installation
5.1.2: KYZ Output
The KYZ pulse output provides pulsing energy values that verify the submeter's
readings and accuracy. The KYZ Pulse Output is located on the face of the meter,
under the cover (see figure on the next page).
WARNING! During normal operation of the EM-3000 Series meter,
dangerous voltages flow through many parts of the meter, including:
Terminals and any connected CTs (Current Transformers) and PTs
(Potential Transformers), all I/O Modules (Inputs and Outputs) and their
circuits. All Primary and Secondary circuits can, at times, produce lethal voltages and
currents. Avoid contact with any current-carrying surfaces. Before performing ANY
work on the meter, make sure the meter is powered down and all connected
circuits are de-energized.
AVERTISSEMENT! Pendant le fonctionnement normal du compteur EM-3000 Series
des tensions dangereuses suivant de nombreuses pièces, notamment, les bornes et
tous les transformateurs de courant branchés, les transformateurs de tension, toutes
les sorties, les entrées et leurs circuits. Tous les circuits secondaires et primaires
peuvent parfois produire des tensions de létal et des courants. Évitez le contact avec les surfaces sous tensions. Avant de faire un travail dans le compteur, assurez-vous d'éteindre l'alimentation et de mettre tous les circuits
branchés hors tension.
See Section 2.2 for the KYZ output specifications; see Section 7.3.1 for pulse
constants.
EM-3000 Series Meter Installation and Operation Manual
5-2
5: Communication Installation
Wireless Ethernet Connection
Electronic Circuits
Ia Ia Ib Ib Ic Ic
(+) (-) (+) (-) (+) (-)
Va Vb Vc Vn L1 L2 PE
Z K Y + - SH
RS-485
To Other
Devices
Pulse Contacts
EM-3000 Series Meter Installation and Operation Manual
5-3
5: Communication Installation
5.1.3: Ethernet Connection
In order to use the EM-3000 Series meter’s Ethernet, JP2 must be set to positions
2-3. With this setting, you can use either wired Ethernet or WiFi.
• For wired Ethernet, use Standard RJ45 10/100BaseT cable to connect to the
EM-3000 Series meter. The RJ45 line is inserted into the RJ45 port of the meter.
For WiFi connections, make sure you have the correct antenna
attached to the meter.WARNING! During normal operation of the EM3000 Series meter,
dangerous voltages flow through many parts of the meter, including:
Terminals and any connected CTs (Current Transformers) and PTs (Potential Transformers), all I/O Modules (Inputs and Outputs) and their circuits. All Primary and Secondary circuits can, at times, produce lethal voltages and currents. Avoid contact with
any current-carrying surfaces. Before performing ANY work on the meter, make
sure the meter is powered down and all connected circuits are de-energized.
AVERTISSEMENT! Pendant le fonctionnement normal du compteur EM-3000 Series
des tensions dangereuses suivant de nombreuses pièces, notamment, les bornes et
tous les transformateurs de courant branchés, les transformateurs de tension, toutes
les sorties, les entrées et leurs circuits. Tous les circuits secondaires et primaires
peuvent parfois produire des tensions de létal et des courants. Évitez le contact avec les surfaces sous tensions. Avant de faire un travail dans le compteur, assurez-vous d'éteindre l'alimentation et de mettre tous les circuits
branchés hors tension.
EM-3000 Series Meter Installation and Operation Manual
5-4
5: Communication Installation
Wireless Ethernet Connection
Ethernet Module
Electronic Circuits
JP2: Must be in
position 2-3 for
Ethernet (RJ45 or WiFi)
Ia Ia Ib Ib Ic Ic
(+) (-) (+) (-) (+) (-)
Va Vb Vc Vn L1 L2 PE
Z K Y + - SH
**
RS-485
To Other
Devices
•
Refer to Chapter 6 for instructions on how to set up the Network Module.
**See diagram on next page for detailed view
EM-3000 Series Meter Installation and Operation Manual
5-5
5: Communication Installation
JP2
LAN
Setting
EM-3000 Series Meter Installation and Operation Manual
5-6
6: Ethernet Configuration
6: Ethernet Configuration
6.1: Introduction
The EM-3000 Series meter has an option for a WiFi (Wireless) or RJ45 Ethernet connection. The WiFi option lets you set up the submeter for use in a LAN (Local Area
Network), using standard WiFi base stations. Meter configuration for these connections is easily accomplished through your PC using Telnet connections. Then you can
access the submeter to perform meter functions directly through any computer on
your LAN: the EM-3000 Series meter does not need to be directly connected (wired)
to these computers for it to be accessed.
This chapter outlines the procedures you use to set up the EM-3000 Series meter to
function via its Ethernet configuration and instructions for integrating the EM-3000
Series meter into a wireless local area network (WLAN).
WARNING! During normal operation of the EM-3000 Series meter,
dangerous voltages flow through many parts of the meter, including:
Terminals and any connected CTs (Current Transformers) and PTs
(Potential Transformers), all I/O Modules (Inputs and Outputs) and their
circuits. All Primary and Secondary circuits can, at times, produce lethal
voltages and currents. Avoid contact with any current-carrying surfaces. Before
performing ANY work on the meter, make sure the meter is powered down
and all connected circuits are de-energized.
AVERTISSEMENT! Pendant le fonctionnement normal du compteur EM-3000 Series
des tensions dangereuses suivant de nombreuses pièces, notamment, les bornes et
tous les transformateurs de courant branchés, les transformateurs de tension, toutes
les sorties, les entrées et leurs circuits. Tous les circuits secondaires et primaires
peuvent parfois produire des tensions de létal et des courants. Évitez le contact avec les surfaces sous tensions. Avant de faire un travail dans le compteur, assurez-vous d'éteindre l'alimentation et de mettre tous les circuits
branchés hors tension.
EM-3000 Series Meter Installation and Operation Manual
6-1
6: Ethernet Configuration
WARNING: Risk of Electric Shock.
Ground the meter according to local, national, and regional regulations.
Failure to ground the meter may result in electric shock and severe
personal injury or death.
AVERTISSEMENT: risque de décharge électrique
Débranchez l'alimentation électrique avant de faire un branchement électrique. Le contact
avec des composants ayant des tensons importantes peut provoquer une décharge électrique, des blessures personnelles graves ou la mort.
6.2: Factory Default Settings
The settings shown in Section 6.2.1 are the default settings for the EM-3000 Series
meter: they are the settings programmed into your meter when it is shipped to you.
You may need to modify some of these settings when you set up your Ethernet configuration.
NOTES:
• Change Settings 1, 6, and 7 ONLY (these settings are shown in bold). Settings 2, 3,
and 4 MUST be the same as shown in Section 6.2.1. If they are not, reset them to
the values shown in Section 6.2.1, following the Reset procedure in Section 6.4.
• If setting 3 is not CP0..! Defaults (In), the procedure for Network Module Hardware
Initialization (Section 6.4) will not work.
EM-3000 Series Meter Installation and Operation Manual
6-2
6: Ethernet Configuration
6.2.1: Modbus/TCP to RTU Bridge Setup
1) Network/IP Settings:
Network Mode................................Wired Only
IP Address......................................10.0.0.1
Default Gateway.............................--- not set --Netmask.........................................255.255.255.0
2) Serial & Mode Settings:
Protocol...........................................Modbus/RTU,Slave<s> attached
Serial Interface.................................57600,8,N,1,RS232,CH1
3) Modem/Configurable Pin Settings:
CP0..! Defaults <In> Wired
CP1..! GPIO <In>
CP2..! GPIO <In>
CP3..! GPIO <In>
CP4..! GPIO <In>
CP5..! GPIO <In>
CP6..! GPIO <In>
CP7..! GPIO <In>
CP8..! GPIO <In>
CP9..! GPIO <In>
CP10.! GPIO <In>
RTS Output ......................................Fixed High/Active
4) Advanced Modbus Protocol settings:
Slave Addr/Unit Id Source..................Modbus/TCP header
Modbus Serial Broadcasts...................Disabled (Id=0 auto-mapped to 1)
MB/TCP Exception Codes....................Yes (return 00AH and 00BH)
Char, Message Timeout.......................00050msec, 05000msec
6) WLAN Settings:
WLAN...............................................Disabled, network:LTRX_IBSS
Topology..........................................AdHoc, Country: US, Channel: 11
EM-3000 Series Meter Installation and Operation Manual
6-3
6: Ethernet Configuration
Security...........................................none
TX Data rate.....................................54 Mbps auto fallback
Power management.........................Disabled
Soft AP Roaming..............................N/A
Ad-hoc merging................................Enabled
WLAN Max failed packets.................0
7) Security Settings:
SNMP...............................................Enabled
SNMP Community Name..................public
Telnet Setup....................................Enabled
TFTP Download...............................Enabled
Port 77FEh......................................Enabled
Enhanced Password........................Disabled
D)efault settings, S)ave, Q)uit without save
Select Command or parameter set (1..7) to change:
6.3: Configure Network Module
These procedures detail how to set up the EM-3000 Series meter on the Network
Module.
Only one person at a time can be logged into the network port. This eliminates the
possibility of several people trying to configure the Ethernet interface simultaneously.
6.3.1: Configuration Requirements
• You may want to consult your Network Administrator before performing these
procedures, since some functions may be restricted to the Network Administrator.
• If you have only one Ethernet adapter (network card), the screen displays only that
configuration. You will use this Ethernet adapter to access the EM-3000 Series
EM-3000 Series Meter Installation and Operation Manual
6-4
6: Ethernet Configuration
meter's Network Module. You may have to configure the Ethernet adapter in order
to use it with the EM-3000 Series meter's Network Module, using the instructions in
Section 6.4.2.
• If you have multiple Ethernet adapters (network cards) installed on your computer,
you must choose, configure and use the correct one to access the Network Module.
• The Ethernet Adapter must be set up for point-to-point connection in order for it to
connect to the EM-3000 Series meter's Network module, as follows:
IP Address should be 10.0.0.2
Subnet Mask should be 255.255.255.0
These settings can be made in the Ethernet Adapter. Follow the procedure in
Section 6.3.2.
6.3.2: Configuring the Ethernet Adapter
1. From the PC’s Start Menu, select Control Panel>Network Connections or Control Panel>Network and Internet>Network and Sharing Center. You will see
a screen showing your network connections. An example is shown below. Depending on your Operating system, the screen you see may look a bit different.
Local Area
Network
Connection
EM-3000 Series Meter Installation and Operation Manual
6-5
6: Ethernet Configuration
2. Right click on the Local Area Network connection you will be using to connect to the
EM-3000 Series meter, and select Properties from the pull-down menu. You will see
a screen similar to the one shown below.
3. Select Internet Protocol [TCP/IP] from the middle of the screen and click the
Properties button. You will see the screen shown on the next page.
EM-3000 Series Meter Installation and Operation Manual
6-6
6: Ethernet Configuration
4. Click the Use the Following IP Address radio button. The screen changes to allow
you to enter the IP Address and Subnet Mask.
a. Enter 10.0.0.2 in the IP Address field.
b. Enter 255.255.255.0 in the Subnet Mask field.
3. Click the OK button.
4. You can now close the Local Area Connection Properties and Network Connection
windows.
EM-3000 Series Meter Installation and Operation Manual
6-7
6: Ethernet Configuration
6.3.3: Detailed Configuration Parameters
Certain parameters must be configured before the Ethernet interface can function on
a network. The following procedure can be locally or remotely configured.
Use a Telnet connection to configure the unit over the network. The Ethernet interface's configuration is stored in meter memory and is retained without power. The
configuration can be changed at any time. The Ethernet interface performs a reset
after the configuration has been changed and stored.
NOTE: If your PC is running
Windows 7, you need to enable
Telnet before using it.
1. Open the Control Panel.
2. Select Programs and Features.
3. Select Turn Windows features
on or off.
4. Check the box for Telnet Client.
5. Click OK. The Telnet client is
now available.
Establish a Telnet connection to port 9999:
1. From the Windows Start menu, click Run and type 'cmd'.
2. Click the OK button to bring up Windows's Command Prompt window.
3. In the Command Prompt window, type:
telnet 10.0.0.1 9999 and press the Enter key.
NOTE: Be sure to include a space between the IP address and 9999.
You will see the following information.
4. Press Enter.
EM-3000 Series Meter Installation and Operation Manual
6-8
6: Ethernet Configuration
5. You are now in Setup Mode. You can configure the parameters for the software you
are using by either:
• Keying a new value next to a setting and pressing Enter
• Keeping the default value (the value in brackets after a setting) by just pressing
Enter without keying in anything
6. Be sure to press “S” once you are finished, in order to store any new settings. The
Ethernet interface will then perform a power reset.
6.3.4: Setup Details
This section illustrates how each section of settings appears on the screen, when you
select the setting number (1, 6, or 7).
CAUTION! Change Settings 1, 6, and 7 ONLY. Settings 2, 3, and 4 MUST be the same
as shown in Section 8.2.1. If they are not, reset them to the values shown in Section
8.2.1, using the reset instructions in Section 8.4.
Network IP Settings Detail (1) (Set device with static IP Address.)
Network Mode: 0=Wired only, 1=Wireless Only <0> ? Key 1 and press Enter for WiFi
mode.
IP Address <010> 192.<000> 168.<000> .<000> .<001> You can change the IP
address in this setting.
Set Gateway IP Address <N> ? Y (If you want to change the Gateway address.)
Gateway IP Address : <192> .<168> .<000> .<001> (You can change the Gateway
address in this setting.)
Set Netmask <N for default> <Y> ? Y (If you want to change the Netmask.)
<255> .<255> .<255> .<000> (You can change the Netmask in this setting.)
Change telnet config password <N> ? N
WLAN Settings Detail (6) (The settings shown are recommended by for use with
the EM-3000 Series meter. You will only be able to access these settings if you have
set Network Mode to “1” (to select Wireless mode) in the Network IP Settings Detail,
shown previously.)
Topology: 0=Infrastructure, 1=Ad-Hoc <1> ? 0
EM-3000 Series Meter Installation and Operation Manual
6-9
6: Ethernet Configuration
Network Name: MY_NETWORK
Security suite: 0=none, 1=WEP, 2=WPA, 3=WPA2/802.11i <0> ? Enter the number
of the encryption method are using, e.g., 3 for WPA2/802.11i.
• If you select “1” (WEP), you will see the following settings:
Authentication 0=open/none, 1=shared <0> ? (Enter 1 if you want the
encryption key matched with a communication partner before messages are
passed through.)
Encryption 1=WEP64, 2=WEP128 <1> 2
Change Key <N> Y
Display Key <N> N
Key Type 0=hex, 1=passphrase <0> 0
Enter Key:
You can manually enter 26 hexadecimal characters (required for 128-bit
encryption) or you can use a WEP Key provider online (for example: www.powerdog.com/wepkey.cgi). WEP Key providers should note on their website that
their encryption algorithm is for the Wired Equivalent Privacy portion of IEEE
802.11b/g.
WEP Key Provider Steps
1. Input 26 alphanumeric characters as your Passphrase.
IMPORTANT! Remember your Passphrase.
PASSPHRASE TO HEXADECIMAL WEP KEYS
Enter the passphrase below.
1009egbck001036ab
Generate keys
EM-3000 Series Meter Installation and Operation Manual
6 - 10
6: Ethernet Configuration
2. Click the Generate Keys button. Your Hexadecimal WEP Keys display.
PASSPHRASE TO HEXADECIMAL WEP KEYS
The passphrase 1009egbcke001306ab produces the following keys:
64-BIT (40-BIT KEYS)
1. AA43FB768D
2. 637D8DB9CE
3. AFDE50AF61
4. 0c35E73E25
128-BIT (104-BIT) KEY
041D7773D8B2C1D97BE9531DC
3. Enter the 128-bit Key.
TX Key Index <1> ? 1 (The WEP key used for transmissions - must be a value
between 1 and 4.)
TX Data Rate: 0=fixed, 1=auto fallback <1> ? 1
TX Data rate: 0=1, 1=2, 2=5.5, 3=11, 4=18, 5=24, 6=36, 7=54 Mbps <7> ?
Enter data transmission rate, e.g., 7 for 54Mbps.
Minimum Tx Data rate: 0=1, 1=2, 2=5.5, 3=11, 4=18, 5=24, 6=36,
7=54 Mbps <0> ? 0
Enable Power management <N> ? Y
Enable Soft AP Roaming <N> ? N
Max Failed Packets (6-64, 255=disable) <6>? 6
• If you select “2” (WPA), you will make the following settings:
Change Key <N> Y
Display Key <N> N
Key Type 0=hex, 1=passphrase <0> 1
EM-3000 Series Meter Installation and Operation Manual
6 - 11
6: Ethernet Configuration
Enter Key: (The maximum length of the passphrase is 63 characters. We recommend using a passphrase of 20 characters or more for maximum security.)
Encryption: 0=TKIP, 1=TKIP+WEP <0> ? Set the type to the minimum
required security level. The “+” sign indicates that the group (broadcast)
encryption method is different from the pairwise (unicast) encryption (WEP
and TKIP).
TX Data rate: 0=fixed, 1=auto fallback <1> ? 1
TX Data rate: 0=1, 1=2, 2=5.5, 3=11, 4=18, 5=24, 6=36, 7=54 Mbps <7> ?
Enter data transmission rate, e.g., 7 for 54Mbps.
Minimum Tx Data rate: 0=1, 1=2, 2=5.5, 3=11, 4=18, 5=24, 6=36,
7=54 Mbps <0> ? 0
Enable Power management <N> ? Y
Enable Soft AP Roaming <N> ? N
Max Failed Packets (6-64, 255=disable) <6>? 6
• If you select “3” (WPA2/802.11i), you will make the following settings:
Change Key <N> Y
Display Key <N> N
Key Type 0=hex, 1=passphrase <0> 1
Enter Key: (The maximum length of the passphrase is 63 characters. We recommend using a passphrase of 20 characters or more for maximum security.)
Encryption: 0=CCMP, 1=CCMP+TKIP, 2=CCMP+WEP, 3=TKIP, 4=TKIP+WEP
<3> ? (Set the type to the minimum required security level. The “+” sign indicates that the group (broadcast) encryption method is different from the pair-
EM-3000 Series Meter Installation and Operation Manual
6 - 12
6: Ethernet Configuration
wise (unicast) encryption. For example, for CCMP+TKIP, CCMP is the pairwise
encryption and TKIP is the group encryption. CCMP is the default for WPA2.)
TX Data rate: 0=fixed, 1=auto fallback <1> ? 1
TX Data rate: 0=1, 1=2, 2=5.5, 3=11, 4=18, 5=24, 6=36, 7=54 Mbps <7> ?
Enter data transmission rate, e.g., 7 for 54Mbps.
Minimum Tx Data rate: 0=1, 1=2, 2=5.5, 3=11, 4=18, 5=24, 6=36,
7=54 Mbps <0> ? 0
Enable Power management <N> ? Y
Enable Soft AP Roaming <N> ? N
Max Failed Packets (6-64, 255=disable) <6>? 6
Security Settings (7)
Disable SNMP <N> ? N
SNMP Community Name <public>: (You can enter an SNMP community name here.)
Disable Telnet Setup <N> ? N (If you change this setting to Y, you will not be able to
use Telnet to re-configure the Network card once you save the settings, without resetting the Network card, as shown in Section 8.4. However, you may want to disable
Telnet setup and Port 77FEh to prevent users from accessing the setup from the network.)
Disable TFTP Firmware Update <N> ? N
Disable Port 77FEh <N> ? N (For security purposes, you may want to disable Telnet
setup and Port 77FEh to prevent users from accessing the setup from the network.)
Enable Enhanced Password <N> ? N
Exiting the screen
CAUTION! DO NOT PRESS 'D': that will restore the Default Settings.
Press 'S' to Save the settings you've entered.
EM-3000 Series Meter Installation and Operation Manual
6 - 13
6: Ethernet Configuration
6.4: Network Module Hardware Initialization
If you don't know your current Network Module settings, or if the settings are lost,
you can use this method to initialize the hardware with known settings you can then
work with.
Main Board
Reset
Button
JP3
JP2
WARNING! During normal operation of the EM-3000 Series meter,
dangerous voltages flow through many parts of the meter, including:
Terminals and any connected CTs (Current Transformers) and PTs
(Potential Transformers), all I/O Modules (Inputs and Outputs) and
their circuits. All Primary and Secondary circuits can, at times, produce lethal voltages
and currents. Avoid contact with any current-carrying surfaces. Before performing ANY
work on the meter, make sure the meter is powered down and all connected
circuits are de-energized.
AVERTISSEMENT! Pendant le fonctionnement normal du compteur EM-3000 Series des
tensions dangereuses suivant de nombreuses pièces, notamment, les bornes et tous les
EM-3000 Series Meter Installation and Operation Manual
6 - 14
6: Ethernet Configuration
transformateurs de courant branchés, les transformateurs de tension, toutes les sorties,
les entrées et leurs circuits. Tous les circuits secondaires et primaires peuvent parfois
produire des tensions de létal et des courants. Évitez le contact avec les surfaces sous tensions. Avant de faire un travail dans le compteur, assurez-vous d'éteindre l'alimentation et de mettre tous les circuits branchés hors tension.
WARNING: Risk of Electric Shock.
Disconnect the power supply before making electrical connections.
Contact with components carrying hazardous voltage can cause electric
shock and may result in severe personal injury or death.
AVERTISSEMENT: risque de décharge électrique
Débranchez l'alimentation électrique avant de faire un branchement électrique. Le contact
avec des composants ayant des tensons importantes peut provoquer une décharge électrique, des blessures personnelles graves ou la mort.
1. Place a shorting block on JP3 and press the Reset button on the main board.
NOTE: JP3 is located on the right hand side, upper corner of the main board. The
shorting block can be "borrowed" from JP2, located at the middle, right hand side.
See the figure shown on the previous page.
2. After you press the Reset button, move the jumper back to JP2.
3. Make sure your settings are the same as those in Section 6.2.1. Follow the steps in
Section 6.3 to configure the Network Module.
6.5: Integrating the EM-3000 Series Meter into a WLAN
A WLAN uses a controller to manage wireless access points (WAPs), devices that
enable wireless devices, such as the EM-3000 Series meter, to be connected to a wired
network.
To integrate the EM-3000 Series meter into a WLAN, you must first set up the WAP it
will be configured with. For this you will need:
• Two Ethernet cables
• A WAP with port forwarding configuration capabilities
EM-3000 Series Meter Installation and Operation Manual
6 - 15
6: Ethernet Configuration
Follow these steps:
1. Using an Ethernet cable, connect the WAP’s Internet port to an Ethernet hub. The
Ethernet hub must be on the same subnet as the WLAN controller.
2. Connect a PC via wireless mode to the WAP. Using the PC’s web browser, access the
WAP’s online configuration utility.
NOTE: To access this utility, type the WAP’s IP address into the address bar of any
standard web browser. The default IP address for the majority of WAPs is
192.168.0.1. The IP address is typically found on the bottom of the WAP.
3. From the web utility, review the LAN DHCP settings.
a. Find and record the DHCP IP address range.
b. Record the WAP's Internet IP address, SSID, and subnet mask.
c. NOTE: Check with the building's IT department before placing the EM-3000
Series meter on the building's network with a static IP address.
You need to make a DHCP reservation for the EM-3000 Series meter to connect
to the WAP. This reserves a selected IP address within the DHCP range, and
assigns it to any device which associates to the network that has the correct
MAC address. Enter the MAC address of the EM-3000 Series meter for the DHCP
reservation and assign the MAC address to a currently open IP address. (You can
find the MAC address for the EM-3000 Series meter at the beginning of the
telnet procedure - see Section 6.3.3.)
4. Configure the EM-3000 Series meter in the local network by following the procedure given in Section 6.3:
a. Set the meter’s IP address to the IP address used in the DHCP reservation.
b. Set the default gateway address to the WAP’s LAN IP address.
c. Set the subnet mask to the same subnet mask used with the WAP.
d. Set the network name parameter to the SSID of the WAP.
5. The next step in configuration is to configure the proper port forwarding settings.
Initiation of communication comes from the WLAN controller, which will be configured to communicate to the WAP’s Internet IP address. The WAP then needs to
direct all traffic on this port to the EM-3000 Series meter’s LAN address. This mapping is accomplished using the port forwarding settings on the WAP, set through the
WAP's web interface:
EM-3000 Series Meter Installation and Operation Manual
6 - 16
6: Ethernet Configuration
a. Give the port forwarding setting a meaningful name such as "EM-3000 Series
meter’s Port Access" and enter the EM-3000 Series meter’s LAN IP address.
b. Enter port 502 for both TCP and UDP protocols; deactivate any inbound filters.
c. Save these settings using the WAP's web interface.
6. The final step in configuration is on the WLAN controller side. After adding a Modbus TCP Network device, the IP address and port need to be modified to establish a
connection to the EM-3000 Series meter:
a. Set the device IP address to the WAP’s Internet IP address and designate the
port as 502. Note that port 502 is always reserved for Modbus TCP/IP communication.
b. If configuration is successful, the device should appear as online in the WLAN
controller's interface.
EM-3000 Series Meter Installation and Operation Manual
6 - 17
6: Ethernet Configuration
This page intentionally left blank.
EM-3000 Series Meter Installation and Operation Manual
6 - 18
7: Using the Submeter
7: Using the Submeter
7.1: Introduction
The EM-3000 Series meter can be configured and a variety of functions can be accomplished by using the Elements and the Buttons on the submeter face. This chapter
reviews front panel navigation. See Appendix A for complete Navigation maps.
7.1.1: Understanding Submeter Face Elements
Reading
Type
Indicator
MAX
120.0
120.0
120.0
LM2
PRG
IrDA
120%-
% of Load
Bar
ENTER
VOLTS L-N
VOLTS L-N
LM1
%THD
IrDA Com
Port
MENU
MIN
90%60%30%-
%LOAD
AMPS
A
W/VAR/PF
Parameter
Designator
VA/Hz
Wh
VARh
B
VAh
Watt-hour
Test Pulse
C
Wh Pulse
KILO
MEGA
Scaling
Factor
Figure 7.1: Faceplate with Elements
The meter face features the following elements:
• Reading Type Indicator: e.g., Max
• Parameter Designator: e.g., Volts L-N
• Watt-Hour Test Pulse: Energy pulse output to test accuracy
• Scaling Factor: Kilo or Mega multiplier of displayed readings
• % of Load Bar: Graphic Display of Amps as % of the Load (Refer to Section 7.3 for
additional information.)
• IrDA Communication Port: Com 1 port for wireless communication
EM-3000 Series Meter Installation and Operation Manual
7-1
7: Using the Submeter
7.1.2: Understanding Submeter Face Buttons
Menu
MAX
MENU
ENTER
VOLTS L-N
120.0
120.0
120.0
LM1
LM2
%THD
PRG
IrDA
120%-
90%60%30%-
Down
Enter
VOLTS L-N
MIN
%LOAD
AMPS
A
W/VAR/PF
VA/Hz
Wh
VARh
B
VAh
C
Wh Pulse
KILO
MEGA
Right
Figure 7.2: Faceplate with Buttons
The meter face has Menu, Enter, Down and Right buttons, which let you perform
the following functions:
• View Meter Information
• Enter Display Modes
• Configure Parameters (may be Password Protected)
• Perform Resets (may be Password Protected)
• Perform LED Checks
• Change Settings
• View Parameter Values
• Scroll Parameter Values
• View Limit States (V-4)
EM-3000 Series Meter Installation and Operation Manual
7-2
7: Using the Submeter
7.2: Using the Front Panel
You can access four modes using the EM-3000 Series meter’s front panel buttons:
• Operating mode (Default)
• Reset mode
• Configuration mode
• Information mode - Information mode displays a sequence of screens that show
model information, such as Frequency, Amps, V-Switch, etc.
Use the Menu, Enter, Down and Right buttons to navigate through each mode and
its related screens.
NOTE: See Appendix A for the complete display mode Navigation maps.
7.2.1: Understanding Startup and Default Displays
Upon Power Up, the meter displays a sequence of screens:
• Lamp Test screen where all LEDs are lit
• Lamp Test screen where all digits are lit
• Firmware screen showing build number
• Error screen (if an error exists)
After startup, if auto-scrolling is enabled, the EM-3000 Series meter scrolls the
parameter readings on the right side of the front panel. The Kilo or Mega LED lights,
showing the scale for the Wh, VARh and VAh readings. Figure 7.3 shows an example
of a Wh reading.
EM-3000 Series Meter Installation and Operation Manual
7-3
7: Using the Submeter
MENU
MAX
ENTER
VOLTS L-N
MIN
VOLTS L-N
LM1
AMPS
A
LM2
%THD
PRG
IrDA
120%-
90%60%30%-
0000
0.659
W/VAR/PF
VA/Hz
Wh
VARh
B
VAh
C
Wh Pulse
KILO
MEGA
%LOAD
Figure 7.3: Display Showing Watt-hr Reading
The EM-3000 Series meter continues to provide scrolling readings until one of the
buttons on the front panel is pressed, causing the meter to enter one of the other
Modes.
7.2.2: Using the Main Menu
1. Press the Menu button. The Main Menu screen appears.
• The Reset (rStd) mode appears in the A window. Use the Down button to scroll,
causing the Configuration (CFG), Operating (OPr), and Information (InFo) modes to
move to the A window.
• The mode that is currently flashing in the A window is the “Active” mode, which
means it is the mode that can be configured.
MENU
ENTER
MENU
ENTER
MENU
ENTER
-
A
-
A
-
A
-
B
-
B
-
B
-
C
-
C
-
C
For example: Press Down Once - CFG moves to A window. Press Down Once - OPr moves to A
window.
EM-3000 Series Meter Installation and Operation Manual
7-4
7: Using the Submeter
2. Press the Enter button from the Main Menu to view the Parameters screen for the
mode that is currently active.
7.2.3: Using Reset Mode
1. Press the Enter button while rSt is in the A window.
MENU
The “rSt (Reset) ALL? no” screen appears.
• If you press the Enter button again, the Main Menu
appears, with the next mode in the A window. (The
Down button does not affect this screen.)
ENTER
-
A
-
B
-
C
• If you press the Right button, the “rSt ALL? YES”
screen appears. Press Enter to perform a reset.
CAUTION! All Max and Min values will be reset.
NOTE: If Password protection is enabled for reset, you
must enter the four digit password before you can reset
the meter. To enter a password, follow the instructions in
MENU
ENTER
-
A
-
B
-
C
Section 7.2.4.
2. Once you have performed a reset, the screen displays
MENU
“rSt ALL donE” and then resumes auto-scrolling
parameters.
ENTER
-
A
-
B
-
C
EM-3000 Series Meter Installation and Operation Manual
7-5
7: Using the Submeter
7.2.4: Entering a Password
If Password protection has been enabled in the software for reset and/or configuration, a screen appears requesting a password when you try to reset the meter and/or
configure settings through the front panel.
• PASS appears in the A window and 4 dashes appear in the B window. The leftmost
dash is flashing.
1. Press the Down button to scroll numbers from 0 to 9 for the flashing dash. When
the correct number appears for that dash, use the Right button to move to the
next dash.
Example: The left screen, below, shows four dashes. The right screen shows the display after the first two digits of the password have been entered.
MENU
MENU
ENTER
-
A
-
-
B
-
-
C
-
ENTER
PASS
12__
A
B
C
2. When all 4 digits of the password have been selected, press the Enter button.
• If you are in Reset Mode and you enter the correct password, “rSt ALL donE”
appears and the screen resumes auto-scrolling parameters.
• If you are in Configuration Mode and you enter the correct password, the display
returns to the screen that required a password.
• If you enter an incorrect password, “PASS ---- FAIL”
appears and:
• The previous screen is re-displayed, if you are in
Reset Mode.
• The previous Operating mode screen is re-dis-
MENU
ENTER
-
A
-
B
-
C
played, if you are in Configuration mode.
EM-3000 Series Meter Installation and Operation Manual
7-6
7: Using the Submeter
7.2.5: Using Configuration Mode
Configuration mode follows Reset: Energy on the Main Menu.
To access Configuration mode
1. Press the Menu button while the meter is auto-scrolling parameters.
2. Press the Down button until the Configuration Mode option (CFG) is in the A window.
3. Press the Enter button. The Configuration Parameters screen appears.
4. Press the Down button to scroll through the configuration parameters: Scroll
(SCrL), CT, PT, Connection (Cnct) and Port. The parameter currently ‘Active,” i.e.,
configurable, flashes in the A window.
5. Press the Enter button to access the Setting screen for the currently active
parameter.
NOTE: You can use the Enter button to scroll through all of the Configuration parameters and their Setting screens, in order.
MENU
ENTER
MENU
ENTER
-
A
-
A
-
B
-
B
-
C
-
C
Press Enter when CFG is in A window - Parameter screen appears Press Down- Press Enter when
Parameter you want is in A window
6. The parameter screen appears, showing the current settings. To change the
settings:
• Use either the Down button or the Right button to select an option.
EM-3000 Series Meter Installation and Operation Manual
7-7
7: Using the Submeter
• To enter a number value, use the Down button to select the number value for a
digit and the Right button to move to the next digit.
NOTE: When you try to change the current setting and Password protection is
enabled for the meter, the Password screen appears. See Section 7.2.4 for instructions on entering a password.
7. Once you have entered the new setting, press the Menu button twice.
8. The Store ALL YES screen appears. You can either:
• Press the Enter button to save the new setting.
• Press the Right button to access the Store ALL no screen; then press the Enter
button to cancel the Save.
9. If you have saved the settings, the Store ALL done screen appears and the meter
resets.
MENU
MENU
ENTER
MENU
ENTER
ENTER
-
A
-
A
-
A
-
B
-
B
-
B
-
C
-
C
-
C
Press the Enter button to save
the settings. Press the Right
Press the Enter button to
Cancel the Save.
The settings have been
saved.
button for Stor All no screen.
EM-3000 Series Meter Installation and Operation Manual
7-8
7: Using the Submeter
7.2.5.1: Configuring the Scroll Feature
When in Auto Scroll mode, the meter performs a scrolling display, showing each
parameter for 7 seconds, with a 1 second pause between parameters. The parameters
that the meter displays are determined by the following conditions:
• They have been selected through software.
• They are enabled by the ordered V-Switch pack (see Section 2.1.1).
To enable or disable Auto-scrolling:
1. Press the Enter button when SCrl is in the A window. The
Scroll YES screen appears.
MENU
2. Press either the Right or Down button if you want to
access the Scroll no screen. To return to the Scroll YES
screen, press either button.
3. Press the Enter button on either the Scroll YES screen (to
ENTER
-
A
-
B
-
C
enable auto-scrolling) or the Scroll no screen (to disable
auto-scrolling).
MENU
4. The CT- n screen appears (this is the next Configuration
mode parameter).
NOTES:
ENTER
-
A
-
B
-
C
• To exit the screen without changing scrolling options, press
the Menu button.
• To return to the Main Menu screen, press the Menu button twice.
• To return to the scrolling (or non-scrolling) parameters display, press the Menu
button three times.
EM-3000 Series Meter Installation and Operation Manual
7-9
7: Using the Submeter
7.2.5.2: Configuring CT Setting
The CT Setting has three parts: Ct-n (numerator), Ct-d (denominator), and Ct-S
(scaling).
1. Press the Enter button when Ct is in the A window. The Ct-n screen appears. You
can either:
• Change the value for the CT numerator.
• Access one of the other CT screens by pressing the Enter button: press Enter
once to access the Ct-d screen, twice to access the Ct-S screen.
NOTE: The Ct-d screen is preset to a 5 amp or 1 amp value at the factory and
cannot be changed.
a. To change the value for the CT numerator:
From the Ct-n screen:
• Use the Down button to select the number value for a digit.
• Use the Right button to move to the next digit.
b. To change the value for CT scaling
From the Ct-S screen:
Use the Right button or the Down button to choose the scaling you want. The
Ct-S setting can be 1, 10, or 100.
NOTE: If you are prompted to enter a password, refer to Section 7.2.4 for instructions on doing so.
2. When the new setting is entered, press the Menu button twice.
3. The Store ALL YES screen appears. Press Enter to save the new CT setting.
Example CT Settings:
200/5 Amps: Set the Ct-n value for 200 and the Ct-S value for 1.
800/5 Amps: Set the Ct-n value for 800 and the Ct-S value for 1.
EM-3000 Series Meter Installation and Operation Manual
7 - 10
7: Using the Submeter
2,000/5 Amps: Set the Ct-n value for 2000 and the Ct-S value for 1.
10,000/5 Amps: Set the Ct-n value for 1000 and the Ct-S value for 10.
NOTES:
• The value for Amps is a product of the Ct-n value and the Ct-S value.
• Ct-n and Ct-S are dictated by primary current; Ct-d is secondary current.
MENU
MENU
ENTER
ENTER
MENU
ENTER
MENU
ENTER
-
A
-
A
-
A
-
A
-
B
-
B
-
B
-
B
-
C
-
C
-
C
-
C
Press Enter
Use buttons to set Ct-n
Ct-d cannot be changed
Use buttons to select
scaling
7.2.5.3: Configuring PT Setting
The PT Setting has three parts: Pt-n (numerator), Pt-d (denominator), and Pt-S (scaling).
1. Press the Enter button when Pt is in the A window. The PT-n screen appears. You
can either:
• Change the value for the PT numerator.
• Access one of the other PT screens by pressing the Enter button: press Enter
once to access the Pt-d screen, twice to access the Pt-S screen.
a. To change the value for the PT numerator or denominator:
From the Pt-n or Pt-d screen:
• Use the Down button to select the number value for a digit.
• Use the Right button to move to the next digit.
EM-3000 Series Meter Installation and Operation Manual
7 - 11
7: Using the Submeter
b. To change the value for the PT scaling:
From the Pt-S screen:
Use the Right button or the Down button to choose the scaling you want. The
Pt-S setting can be 1, 10, 100, or 1000.
NOTE: If you are prompted to enter a password, refer to Section 7.2.4 for instructions on doing so.
2. When the new setting is entered, press the Menu button twice.
3. The STOR ALL YES screen appears. Press Enter to save the new PT setting.
Example PT Settings:
277/277 Volts: Pt-n value is 277, Pt-d value is 277, Pt-S value is 1.
14,400/120 Volts: Pt-n value is 1440, Pt-d value is 120, Pt-S value is 10.
138,000/69 Volts: Pt-n value is 1380, Pt-d value is 69, Pt-S value is 100.
345,000/115 Volts: Pt-n value is 3450, Pt-d value is 115, Pt-S value is 100.
345,000/69 Volts: Pt-n value is 345, Pt-d value is 69, Pt-S value is 1000.
NOTE: Pt-n and Pt-S are dictated by primary voltage; Pt-d is secondary voltage.
MENU
ENTER
MENU
ENTER
MENU
ENTER
-
A
-
A
-
A
-
B
-
B
-
B
-
C
-
C
-
C
Use buttons to set Pt-n
Use buttons to set Pt-d
Use buttons to select scaling
EM-3000 Series Meter Installation and Operation Manual
7 - 12
7: Using the Submeter
7.2.5.4: Configuring Connection Setting
1. Press the Enter button when Cnct is in the A window. The Cnct screen appears.
2. Press the Right button or Down button to select a configuration. The choices are:
• 3 Element Wye (3 EL WYE)
• 2.5 Element Wye (2.5EL WYE)
• 2 CT Delta (2 Ct dEL)
NOTE: If you are prompted to enter a password, refer to Section 7.2.4 for instructions on doing so.
3. When you have made your selection, press the Menu button twice.
4. The STOR ALL YES screen appears. Press Enter to save the setting.
MENU
ENTER
-
A
-
B
-
C
Use buttons to select configuration
7.2.5.5: Configuring Communication Port Setting
Port configuration consists of: Address (a three digit number), Baud Rate (9600;
19200; 38400; or 57600), and Protocol (DNP 3.0; Modbus RTU; or Modbus ASCII).
1. Press the Enter button when POrt is in the A window. The Adr (address) screen
appears. You can either:
• Enter the address.
• Access one of the other Port screens by pressing the Enter button: press Enter
once to access the bAUd screen (Baud Rate), twice to access the Prot screen
(Protocol).
EM-3000 Series Meter Installation and Operation Manual
7 - 13
7: Using the Submeter
a. To enter the Address
From the Adr screen:
• Use the Down button to select the number value for a digit.
• Use the Right button to move to the next digit.
b. To select the Baud Rate:
From the bAUd screen:
Use the Right button or the Down button to select the setting you want.
c. To select the Protocol:
From the Prot screen:
Press the Right button or the Down button to select the setting you want.
NOTE: If you are prompted to enter a password, refer to Section 7.2.4 for instructions on doing so.
2. When you have finished making your selections, press the Menu button twice.
3. The STOR ALL YES screen appears. Press Enter to save the settings.
MENU
MENU
ENTER
ENTER
MENU
ENTER
-
A
-
A
-
A
-
B
-
B
-
B
-
C
-
C
-
C
Use buttons to enter Address
Use buttons to select Baud Rate Use buttons to select Protocol
EM-3000 Series Meter Installation and Operation Manual
7 - 14
7: Using the Submeter
7.2.6: Using Operating Mode
Operating mode is the EM-3000 Series meter’s default mode, that is, the standard
front panel display. After starting up, the meter automatically scrolls through the
parameter screens, if scrolling is enabled. Each parameter is shown for 7 seconds,
with a 1 second pause between parameters. Scrolling is suspended for 3 minutes after
any button is pressed.
1. Press the Down button to scroll all the parameters in Operating mode. The
currently “Active,” i.e., displayed, parameter has the Indicator light next to it, on
the right face of the meter.
2. Press the Right button to view additional readings for that parameter. The table
below shows possible readings for Operating mode. Sheet 2 in Appendix A shows
the Operating mode Navigation map.
NOTE: Readings or groups of readings are skipped if not applicable to the meter type
or hookup, or if they are disabled in the programmable settings.
OPERATING MODE PARAMETER READINGS
POSSIBLE READINGS
VOLTS L-N
VOLTS_LN
VOLTS_LN_
MAX
VOLTS_LN_
MIN
VOLTS_LN_
THD
VOLTS L-L
VOLTS_LL
VOLTS_LL_
MAX
VOLTS_LL_
MIN
AMPS
AMPS
AMPS_NEU
TRAL
AMPS_MAX
AMPS_MIN
W/VAR/PF
W_VAR_PF
W_VAR_PF
_MAX_POS
W_VAR_PF
_MIN_POS
W_VAR_PF
_MIN_NEG
VA/Hz
VA_FREQ
VA_FREQ_
MAX
VA_FREQ_
MIN
Wh
KWH_REC
KWH_DEL
KWH_NET
KWH_TOT
VARh
KVARH_PO
S
KVARH_NE
G
KVARH_NE
T
KVARH_TO
T
VAh
KVAH
EM-3000 Series Meter Installation and Operation Manual
AMPS_THD
7 - 15
7: Using the Submeter
7.3: Understanding the % of Load Bar
The 10-segment LED bar graph at the bottom left of the EM-3000 Series meter’s front
panel provides a graphic representation of Amps. The segments light according to the
load, as shown in the table below.
When the Load is over 120% of Full Load, all segments flash “On” (1.5 secs) and “Off”
(0.5 secs).
Segments
Load >= % Full Load
none
no load
1
1%
1-2
15%
1-3
30%
1-4
45%
1-5
60%
1-6
72%
1-7
84%
1-8
96%
1-9
108%
1-10
120%
All Blink
>120%
MAX
MENU
ENTER
VOLTS L-N
MIN
VOLTS L-N
120.0
120.0
120.0
LM1
LM2
%THD
PRG
10
IrDA
120%-
90%60%30%-
1
%LOAD
AMPS
A
W/VAR/PF
VA/Hz
Wh
VARh
B
VAh
C
Wh Pulse
KILO
MEGA
EM-3000 Series Meter Installation and Operation Manual
7 - 16
7: Using the Submeter
7.4: Performing Watt-Hour Accuracy Testing (Verification)
To be certified for revenue metering, power providers and utility companies must
verify that the billing energy meter performs to the stated accuracy. To confirm the
meter’s performance and calibration, power providers use field test standards to
ensure that the unit’s energy measurements are correct. Since the EM-3000 Series
meter is a traceable revenue meter, it contains a utility grade test pulse that can be
used to gate an accuracy standard. This is an essential feature required of all billing
grade meters.
• Refer to Figure 7.5 for an example of how this process works.
• Refer to Table 7.1 for the Wh/Pulse constants for accuracy testing.
MAX
MENU
ENTER
VOLTS L-N
MIN
VOLTS L-N
120.0
120.0
120.0
LM1
LM2
%THD
PRG
IrDA
120%-
90%60%30%-
%LOAD
AMPS
A
W/VAR/PF
VA/Hz
Wh
VARh
B
VAh
C
Wh Pulse
Watt-hour
Test Pulse
KILO
MEGA
Figure 7.4: Watt-hour Test Pulse
EM-3000 Series Meter Installation and Operation Manual
7 - 17
7: Using the Submeter
MENU
MAX
ENTER
VOLTS L-N
MIN
LM1
LM2
VOLTS L-L
-
A
-
B
-
C
AMPS
WNARP
%THD
VA/Hz
PRG
Wh
lrDA
VARh
VAh
Test Pulses
120%90%60%-
Energy Pulses
Wh Pulse
30%-
KILO
Energy
Standard
MEGA
%LOAD
Comparator
Error
Results
Figure 7.5: Using the Watt-hour Test Pulse
Input Voltage Level
Class 10 Models
Class 2 Models
Below 150V
0.2505759630
0.0501151926
Above 150V
1.0023038521
0.2004607704
Table 7.1: Infrared & KYZ Pulse Constants for Accuracy Testing - Kh Watt-hour per pulse
NOTES:
• Minimum pulse width is 40 milliseconds.
• Refer to Chapter 2, Section 2.2, for Wh Pulse specifications.
EM-3000 Series Meter Installation and Operation Manual
7 - 18
A: EM-3000 Series Meter’s Navigation Maps
A: EM-3000 Series Meter’s Navigation Maps
A.1: Introduction
You can configure the EM-3000 Series meter and perform related tasks using the
buttons on the meter face. Chapter 7 contains a description of the buttons on the
meter face and instructions for programming the meter using them.
A.2: Navigation Maps (Sheets 1 to 4)
The EM-3000 Series meter’s Navigation maps begin on the next page. The maps show
in detail how to move from one screen to another and from one display mode to
another using the buttons on the face of the meter. All display modes automatically
return to Operating mode after 10 minutes with no user activity.
EM-3000 Series meter Navigation map titles
• Main Menu Screens (Sheet 1)
• Operating mode screens (Sheet 2)
• Reset mode screens (Sheet 3)
• Configuration mode screens (Sheet 4)
EM-3000 Series Meter Installation and Operation Manual
A-1
A: EM-3000 Series Meter’s Navigation Maps
Main Menu Screens (Sheet 1)
STARTUP
sequence run once at meter startup:
2 lamp test screens, hardware
information screen, firmware version
screen, error screen (conditional)
sequence completed
10 minutes with no user activity
OPERATING MODE
10 minutes with
no user activity
10 minutes with no user activity
grid of meter data screens.
See sheet 2
MENU
MENU
ENTER
MENU
CONFIGURATION MODE*
grid of meter settings screens
with password-protected edit
capability.
See sheet 4
RESET MODE
ENTER
MAIN MENU:
CFG (blinking)
OPR
RST
DOWN
MAIN MENU:
OPR (blinking)
RST
CFG
DOWN
MAIN MENU:
RST (blinking)
CFG
OPR
ENTER
sequence of screens to get
password, if required, and reset
meter data.
See sheet 3
DOWN
* Configuration Mode is
not available during a
Programmable Settings
update via a COM port.
MENU
MAIN MENU Screen
MAIN MENU screen scrolls through 3 choices, showing
all 3 at once. The top choice is always the "active" one,
which is indicated by blinking the legend.
BUTTONS
MENU
Returns to previous menu from any screen in any mode
ENTER
Indicates acceptance of the current screen and advances to the next one
DOWN, RIGHT
Navigation:
Navigation and edit buttons
No digits or legends are blinking. On a menu, down advances to the next menu selection, right does nothing. In a grid of
screens, down advances to the next row, right advances to the next column. Rows, columns, and menus all navigate circularly.
A digit or legend is blinking to indicate that it is eligible for change. When a digit is blinking, down increases the digit value, right
moves to the next digit. When a legend is blinking, either button advances to the next choice legend.
Editing:
single
screen
all screens
for a display
mode
group of
screens
action taken
button
EM-3000 Series Meter Installation and Operation Manual
A-2
A: EM-3000 Series Meter’s Navigation Maps
Operating Mode Screens (Sheet 2)
6HH1RWHV
5,*+7
5,*+7
VOLTS_LN
VOLTS_LN_
MAX
'2:1
IURPDQ\92/76B/1
VFUHHQ
VOLTS_LN_
MIN
5,*+7
96ZLWFK)
2QO\
VOLTS_LN_
THD
5,*+7
'2:1
6HH1RWH
6HH1RWH
5,*+7
VOLTS_LL
5,*+7
VOLTS_LL_
MAX
96ZLWFKHV()
VOLTS_LL_
MIN
5,*+7
'2:1
IURPDQ\92/76B//
VFUHHQ
6HH1RWH
6HH1RWH
5,*+7
AMPS
6HH1RWHV
AMPS_
NEUTRAL
5,*+7
5,*+7
AMPS_MAX
5,*+7
6HH1RWH
AMPS_MIN
5,*+7
96ZLWFK)
2QO\
AMPS_THD
'2:1
IURPDQ\$036VFUHHQ
'2:1
6HH1RWH
5,*+7
'2:1
W_VAR_PF
W_VAR_PF
_MAX_POS
5,*+7
5,*+7
W_VAR_PF
_MIN_POS
5,*+7
W_VAR_PF
_MAX_NEG
W_VAR_PF
_MIN_NEG
5,*+7
'2:1
IURPDQ\:B9$5B3)VFUHHQ
KEY:
6HH1RWH
5,*+7
VA_FREQ
5,*+7
VA_FREQ_
MAX
5,*+7
96ZLWFKHV()
96ZLWFKHV()
96ZLWFKHV
()
VA_FREQ_
MIN
96ZLWFKHV()
96ZLWFK)2QO\
'2:1
IURPDQ\9$B)5(4VFUHHQ
5,*+7
KWH_RE C
5,*+7
KWH_DEL
5,*+7
6HH1RWH
KWH_NET
5,*+7
9
KWH_TOT
'2:1
IURPDQ\.:+VFUHHQ
6HH1RWH
5,*+7
KVARH_POS
5,*+7
KVARH_NEG
5,*+7
KVARH_NET
5,*+7
KVARH_TOT
'2:1
IURPDQ\.9$5+VFUHHQ
6HH1RWH
KVAH
127(6
*URXSLVVNLSSHGLIQRWDSSOLFDEOHWRWKHPHWHUW\SHRUKRRNXSRULIH[SOLFLWO\
GLVDEOHGYLDSURJUDPPDEOHVHWWLQJV
'2:1RFFXUVZLWKRXWXVHULQWHUYHQWLRQHYHU\VHFRQGVLIVFUROOLQJLVHQDEOHG
1R9ROWVB/1VFUHHQVIRU'HOWD&7KRRNXS
6FUROOLQJLVVXVSHQGHGIRUPLQXWHVDIWHUDQ\EXWWRQSUHVV
$036B1(875$/DSSHDUVIRU:<(KRRNXSV
0(18
IURPDQ\
RSHUDWLQJPRGH
VFUHHQ
WR0DLQ0HQX
VHH0DLQ0HQX
IRURYHUYLHZ
EM-3000 Series Meter Installation and Operation Manual
A-3
A: EM-3000 Series Meter’s Navigation Maps
Reset Mode Screens (Sheet 3)
from MAIN MENU
RESET_NO:
RST
ALL?
no (blinking)
RESET_YES:
RST
ALL?
yes (blinking)
RIGHT
RIGHT
ENTER
is password required?
2 sec
yes
no
increment
blinking digit
DOWN
RESET_ENTER_PW:
PASS
#### (one # blinking)
make next digit
blink
RIGHT
ENTER
ENTER
reset all max &
min values
yes
is password
correct?
no
RESET_PW_FAIL:
PASS
####
FAIL
RESET_CONFIRM:
RST
ALL
DONE
2 sec.
to previous operating
mode screen
see sheet 2
MENU
(from any
reset mode
screen)
to Main Menu
see sheet 1
EM-3000 Series Meter Installation and Operation Manual
A-4
A: EM-3000 Series Meter’s Navigation Maps
Configuration Mode Screens (Sheet 4)
See Note 1
CONFIG_MENU:
SCRL (blinking)
CT
PT
ENTER
DOWN
DOWN or
RIGHT3
toggle
scroll
setting
ENTER
MENU
ENTER
CONFIG_MENU:
CT (blinking)
PT
CNCT
DOWN
SCROLL_EDIT:
SCRL
yes or no
(choice blinking if edit)
ENTER
ENTER
CTN_EDIT:
DOWN
increment
blinking
digit
MENU
CONFIG_MENU:
PT (blinking)
CNCT
PORT
CT-N
####
(one # blinking if edit)
CTD_SHOW:
CT-D
1 or 5
RIGHT
blink
next
digit
ENTER
DOWN
increment
blinking
digit
MENU
ENTER
PTD_EDIT:
PT-N
####
(one # blinking if edit)
RIGHT
blink
next
digit
DOWN
increment
blinking
digit
PT-D
####
(one # blinking if edit)
RIGHT
blink
next
digit
PT_MULT_EDIT:
PT-S
1 or 10 or 100 or 1000
(choice blinking if edit)
DOWN or
RIGHT
show
next
choice
DOWN
MENU
CONFIG_MENU:
CNCT (blinking)
PORT
PASS2
DOWN
CONNECT_EDIT:
CNCT
1 of 3 choices
(choice blinking if edit)
ENTER
MENU2
DOWN
increment
blinking
digit
ADDRESS_EDIT:
ADR
###
(one # blinking if edit)
DOWN
increment
blinking
digit
RIGHT
blink
next
digit
yes
MENU
PASSWORD_EDIT:
PASS
#### (one # blinking)
RIGHT
blink
next
digit
SAVE_YES:
STOR
ALL?
yes (blinking)
RIGHT RIGHT
ENTER
see sheet 1
SAVE_NO:
STOR
ALL?
no (blinking)
PROTOCOL_EDIT:
PROT
1 of 3 choices
(choice blinking if edit)
DOWN or
RIGHT
show
next
choice
Notes:
1. Initial access is view-only. View access shows the existing settings. At the
first attempt to change a setting (DOWN or RIGHT pressed), password is
requested (if enabled) and access changes to edit. Edit access blinks the digit
or list choice eligible for change and lights the PRG LED.
2. Skip over password edit screen and menu selection if access is view-only.
3. Scroll setting may be changed with view or edit access.
4. ENTER accepts an edit; MENU abandons it.
first DOWN or RIGHT in view
access (if password required)
save new
configuration
DOWN
CFG_ENTER_PW:
PASS
### (one # blinking)
increment
blinking
digit
reboot
ENTER
See Note 1
RIGHT
yes
blink
next
digit
ENTER
SAVE_CONFIRM:
STOR
ALL
DONE
2 sec.
MENU
DOWN or
RIGHT
show
next
choice
ENTER2
MENU
(per row of the originating screen)
MENU
to Main Menu
ENTER
BAUD_EDIT:
BAUD
##.#
(choice blinking if edit)
ENTER
CONFIG_MENU screen
scrolls through 6 choices,
showing 3 at a time. The
top choice is always the
"active" one, indicated by
blinking the legend.
no
PROT choices:
RTU, ASCII
ENTER
ENTER
CONFIG_MENU:
PASS2 (blinking)
SCRL
CT
any changes?
CNCT choices:
3 EL WYE,
2 CT DEL,
2.5EL WYE
DOWN or
RIGHT
show
next
choice
MENU
CONFIG_MENU:
PORT (blinking)
PASS2
SCRL
DOWN2
ENTER
ENTER
ENTER
DOWN or
RIGHT
show
next
choice
ENTER
ENTER
PTN_EDIT:
DOWN
CT_MULT_EDIT:
CT-S
1 or 10 or 100
(choice blinking if edit)
is password
correct?
no
to the originating
EDIT screen
to previous operating
mode screen
see sheet 2
EM-3000 Series Meter Installation and Operation Manual
A-5
A: EM-3000 Series Meter’s Navigation Maps
This page intentionally left blank.
EM-3000 Series Meter Installation and Operation Manual
A-6
B: EM-3000 Series Meter’s Modbus Map
B: EM-3000 Series Meter’s Modbus Map
B.1: Introduction
The Modbus Map for the EM-3000 Series Meter gives details and information about
the possible readings of the meter and about the programming of the meter.
The EM-3000 Series can be programmed using the buttons on the face plate of the
meter (Chapter 7).
B.2: Modbus Register Map Sections
The EM-3000 Series meter’s Modbus Register Map includes the following sections:
Fixed Data Section, Registers 1- 47, details the Meter’s Fixed Information described in
Section 8.2.
Meter Data Section, Registers 1000 - 5003, details the Meter’s Readings, including
Primary Readings, Energy Block, Demand Block, Maximum and Minimum Blocks, THD
Block, Phase Angle Block and Status Block. Operating Mode readings are described in
Section 7.2.6.
Commands Section, Registers 20000 - 26011, details the Meter’s Resets Block, Programming Block, Other Commands Block and Encryption Block.
Programmable Settings Section, Registers 30000 - 30067, details the Meter’s Basic
Setups.
Secondary Readings Section, Registers 40001 - 40100, details the Meter’s Secondary
Readings Setups.
B.3: Data Formats
ASCII:
ASCII characters packed 2 per register in high,
low order and without any termination characters.
SINT16/UINT16:
16-bit signed/unsigned integer.
SINT32/UINT32:
32-bit signed/unsigned integer spanning 2
registers. The lower-addressed register is the
high order half.
FLOAT:
32-bit IEEE floating point number spanning 2
EM-3000 Series Meter Installation and Operation Manual
B-1
B: EM-3000 Series Meter’s Modbus Map
registers. The lower-addressed register is the
high order half (i.e., contains the exponent).
B.4: Floating Point Values
Floating Point Values are represented in the following format:
Register
0
Byte
1
0
1
7
6
5
4
3
2
1
0
7
6
Meaning
s
e
e
e
e
e
e
e
e
m m m m m m m m m m m m m m m m m m m m m m m
exponent
4
3
2
1
0
7
6
5
1
Bit
sign
5
0
4
3
2
1
0
7
6
5
4
3
2
1
0
mantissa
The formula to interpret a Floating Point Value is:
-1sign x 2 exponent-127 x 1.mantissa = 0x0C4E11DB9
-1sign x 2 137-127 x 1· 1000010001110110111001
-1 x 210 x 1.75871956
-1800.929
Register
0x0C4E1
Byte
0x01DB9
0x0C4
Bit
Meaning
0x01D
0x0B9v
7
6
5
4
3
2
1
0
7
6
5
4
3
2
1
0
7
6
5
4
3
2
1
0
7
6
5
4
3
2
1
0
1
1
0
0
0
1
0
0
1
1
1
0
0
0
0
1
0
0
0
1
1
1
0
1
1
0
1
1
1
0
0
1
s
e
e
e
e
e
e
e
e
m m m m m m m
m
m m m m m m m m m m m m m m m
sign
1
0x0E1
exponent
mantissa
0x089 + 137
0b011000010001110110111001
Formula Explanation:
C4E11DB9 (hex)
11000100 11100001 00011101 10111001
(binary)
The sign of the mantissa (and therefore the number) is 1, which represents a negative value.
The Exponent is 10001001 (binary) or 137 decimal.
EM-3000 Series Meter Installation and Operation Manual
B-2
B: EM-3000 Series Meter’s Modbus Map
The Exponent is a value in excess 127. So, the Exponent value is 10.
The Mantissa is 11000010001110110111001 binary.
With the implied leading 1, the Mantissa is (1).611DB9 (hex).
The Floating Point Representation is therefore -1.75871956 times 2 to the 10.
Decimal equivalent: -1800.929
NOTES:
• Exponent = the whole number before the decimal point.
• Mantissa = the positive fraction after the decimal point.
B.5: Modbus Register Map
The EM-3000 Series meter's Modbus register map begins on the following page.
EM-3000 Series Meter Installation and Operation Manual
B-3
B: EM-3000 Series Meter’s Modbus Map
This page intentionally left blank.
EM-3000 Series Meter Installation and Operation Manual
B-4
B: Modbus Map
Modbus Address
Hex
Decimal
1
Description
Format
6
Range
Units or
Resolution
#
Reg
Comments
Fixed Data Section
read-only
Identification Block
5HVHUYHG
)
0HWHU6HULDO1XPEHU
$6&,,
FKDU
QRQH
-------t -----vvv W 0HWHU7\SH
8,17
ELWPDSSHG
YYY 9VZLWFK
)LUPZDUH9HUVLRQ
$6&,,
FKDU
QRQH
0DS9HUVLRQ
8,17
WR
QRQH
---------ffffff
0HWHU&RQILJXUDWLRQ
8,17
ELWPDSSHG
IIIIII FDOLEUDWLRQIUHTXHQF\RU
$6,&9HUVLRQ
8,17
QRQH
5HVHUYHG
(
0HWHU1DPH$6&,,FKDUQRQH
%ORFN6L]H
Meter Data Section 2
Primary Readings Block, 6 cycles (IEEE Floating Point)
:DWWV3KWRWDO
9$5V3KWRWDO
9$V3KWRWDO
read-only
)/2$7
)/2$7
)/2$7
0WR0
0WR0
0WR0
ZDWWV
9$5V
9$V
%ORFN6L]H
Primary Readings Block, 60 cycles (IEEE Floating Point)
( ( 9ROWV$1
( ($ 9ROWV%1
(% (& 9ROWV&1
(' (( 9ROWV$%
() )
9ROWV%&
) )
9ROWV&$
) )
$PSV$
) )
$PSV%
) )
$PSV&
) )$ :DWWV3KWRWDO
)% )& 9$5V3KWRWDO
)' )( 9$V3KWRWDO
)) 3RZHU)DFWRU3KWRWDO
)UHTXHQF\
1HXWUDO&XUUHQW
read-only
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
WR0
WR0
WR0
WR0
WR0
WR0
WR0
WR0
WR0
0WR0
0WR0
0WR0
WR
WR
WR0
YROWV
YROWV
YROWV
YROWV
YROWV
YROWV
DPSV
DPSV
DPSV
ZDWWV
9$5V
9$V
QRQH
+]
DPSV
%ORFN6L]H
EM-3000 Series Meter Installation and Operation Manual
MM-1
B: Modbus Map
Modbus Address
Hex
1
Description
Decimal
Format
6
Range
Units or
Resolution
#
Reg
Comments
read-only
:KUHFHLYHGGHOLYHUHGDOZD\VKDYH
RSSRVLWHVLJQV
Primary Energy Block
% & :KRXUV5HFHLYHG
6,17
' (
:KRXUV'HOLYHUHG
6,17
) :KRXUV1HW
:KRXUV7RWDO
9$5KRXUV3RVLWLYH
6,17
6,17
6,17
WRRU :KSHUHQHUJ\IRUPDW
WR
WRRU :KSHUHQHUJ\IRUPDW
WR
WR :KSHUHQHUJ\IRUPDW
WR
:KSHUHQHUJ\IRUPDW
WR
9$5KSHUHQHUJ\IRUPDW
9$5KRXUV1HJDWLYH
6,17
WR
:KUHFHLYHGLVSRVLWLYHIRUYLHZDVORDG
GHOLYHUHGLVSRVLWLYHIRUYLHZDVJHQHUDWRU
WRGLJLWV
GHFLPDOSRLQWLPSOLHGSHUHQHUJ\IRUPDW
9$5KSHUHQHUJ\IRUPDW
9$5KRXUV1HW
6,17
UHVROXWLRQRIGLJLWEHIRUHGHFLPDOSRLQW WR 9$5KSHUHQHUJ\IRUPDW XQLWVNLORRUPHJDSHUHQHUJ\IRUPDW
$
9$5KRXUV7RWDO
6,17
WR
9$5KSHUHQHUJ\IRUPDW
% &
9$KRXUV7RWDO
6,17
WR
9$KSHUHQHUJ\IRUPDW
VHHQRWH
%ORFN6L]H
Primary Demand Block (IEEE Floating Point)
&) ' $PSV$$YHUDJH
' ' $PSV%$YHUDJH
' ' $PSV&$YHUDJH
' ' 3RVLWLYH:DWWV3K$YHUDJH
' ' 3RVLWLYH9$5V3K$YHUDJH
' '$ 1HJDWLYH:DWWV3K$YHUDJH
'% '& 1HJDWLYH9$5V3K$YHUDJH
'' '( 9$V3K$YHUDJH
') ( 3RVLWLYH3)3K$YHUDJH
( ( 1HJDWLYH3)3)$YHUDJH
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
WR0
WR0
WR0
0WR0
0WR0
0WR0
0WR0
0WR0
WR
WR
DPSV
DPSV
DPSV
ZDWWV
9$5V
ZDWWV
9$5V
9$V
QRQH
QRQH
%ORFN6L]H
Primary Minimum Block (IEEE Floating Point)
%% %% 9ROWV$10LQLPXP
%% %%$ 9ROWV%10LQLPXP
%%% %%& 9ROWV&10LQLPXP
%%' %%( 9ROWV$%0LQLPXP
%%) %& 9ROWV%&0LQLPXP
%& %& 9ROWV&$0LQLPXP
%& %& $PSV$0LQLPXP$YJ'HPDQG
%& %& $PSV%0LQLPXP$YJ'HPDQG
%& %& $PSV&0LQLPXP$YJ'HPDQG
%& %&$ 3RVLWLYH:DWWV3K0LQLPXP$YJ'HPDQG
%&% %&& 3RVLWLYH9$5V3K0LQLPXP$YJ'HPDQG
%&' %&( 1HJDWLYH:DWWV3K0LQLPXP$YJ'HPDQG
%&) %' 1HJDWLYH9$5V3K0LQLPXP$YJ'HPDQG
%' %' 9$V3K0LQLPXP$YJ'HPDQG
%' %' 3RVLWLYH3RZHU)DFWRU3K0LQLPXP$YJ'HPDQG
read-only
read-only
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
WR0
WR0
WR0
WR0
WR0
WR0
WR0
WR0
WR0
WR0
WR0
WR0
WR0
0WR0
WR
YROWV
YROWV
YROWV
YROWV
YROWV
YROWV
DPSV
DPSV
DPSV
ZDWWV
9$5V
ZDWWV
9$5V
9$V
QRQH
EM-3000 Series Meter Installation and Operation Manual
MM-2
B: Modbus Map
Modbus Address
Hex
Decimal
%' %'
%' %'
1
Description
1HJDWLYH3RZHU)DFWRU3K0LQLPXP$YJ'HPDQG
)UHTXHQF\0LQLPXP
Format
)/2$7
)/2$7
Units or
Resolution
6
Range
WR
WR
#
Reg
Comments
QRQH
+]
%ORFN6L]H
read-only
Primary Maximum Block (IEEE Floating Point)
&% && 9ROWV$10D[LPXP
&' &( 9ROWV%10D[LPXP
&) & 9ROWV&10D[LPXP
& & 9ROWV$%0D[LPXP
& & 9ROWV%&0D[LPXP
& & 9ROWV&$0D[LPXP
& & $PSV$0D[LPXP$YJ'HPDQG
& &$ $PSV%0D[LPXP$YJ'HPDQG
&% && $PSV&0D[LPXP$YJ'HPDQG
&' &( 3RVLWLYH:DWWV3K0D[LPXP$YJ'HPDQG
&) & 3RVLWLYH9$5V3K0D[LPXP$YJ'HPDQG
& & 1HJDWLYH:DWWV3K0D[LPXP$YJ'HPDQG
& & 1HJDWLYH9$5V3K0D[LPXP$YJ'HPDQG
& & 9$V3K0D[LPXP$YJ'HPDQG
& & 3RVLWLYH3RZHU)DFWRU3K0D[LPXP$YJ'HPDQG
& &$ 1HJDWLYH3RZHU)DFWRU3K0D[LPXP$YJ'HPDQG
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
)/2$7
WR0
WR0
WR0
WR0
WR0
WR0
WR0
WR0
WR0
WR0
WR0
WR0
WR0
0WR0
WR
WR
&% &&
)/2$7
WR
)UHTXHQF\0D[LPXP
YROWV
YROWV
YROWV
YROWV
YROWV
YROWV
DPSV
DPSV
DPSV
ZDWWV
9$5V
ZDWWV
9$5V
9$V
QRQH
QRQH
+]
%ORFN6L]H
THD Block7, 13
)) ))
)$ )$
)$ )$
)$ )$
)$ )$
)$ )$
)$ )$
)$ )$
)$ )$
)$ )$
)$ )$
)$$ )$$
)$% )$%
)$& )$&
)$' )$'
)$( )$(
)$) )$)
)% )%
)% )%
)% )%&
)%' )&
)& )&
read-only
9ROWV$17+'
9ROWV%17+'
9ROWV&17+'
$PSV$7+'
$PSV%7+'
$PSV&7+'
3KDVH$&XUUHQWWKKDUPRQLFPDJQLWXGH
3KDVH$&XUUHQWVWKDUPRQLFPDJQLWXGH
3KDVH$&XUUHQWQGKDUPRQLFPDJQLWXGH
3KDVH$&XUUHQWUGKDUPRQLFPDJQLWXGH
3KDVH$&XUUHQWWKKDUPRQLFPDJQLWXGH
3KDVH$&XUUHQWWKKDUPRQLFPDJQLWXGH
3KDVH$&XUUHQWWKKDUPRQLFPDJQLWXGH
3KDVH$&XUUHQWWKKDUPRQLFPDJQLWXGH
3KDVH$9ROWDJHWKKDUPRQLFPDJQLWXGH
3KDVH$9ROWDJHVWKDUPRQLFPDJQLWXGH
3KDVH$9ROWDJHQGKDUPRQLFPDJQLWXGH
3KDVH$9ROWDJHUGKDUPRQLFPDJQLWXGH
3KDVH%&XUUHQWKDUPRQLFPDJQLWXGHV
3KDVH%9ROWDJHKDUPRQLFPDJQLWXGHV
3KDVH&&XUUHQWKDUPRQLFPDJQLWXGHV
3KDVH&9ROWDJHKDUPRQLFPDJQLWXGHV
8,17
8,17
8,17
8,17
8,17
8,17
8,17
8,17
8,17
8,17
8,17
8,17
8,17
8,17
8,17
8,17
8,17
8,17
WRRU
WRRU
WRRU
WRRU
WRRU
WRRU
WR
QRQH
WR
QRQH
WR
QRQH
WR
QRQH
WR
QRQH
WR
QRQH
WR
QRQH
WR
QRQH
WR
QRQH
WR
QRQH
WR
QRQH
WR
QRQH
VDPHDV3KDVH$&XUUHQWWKWRWKKDUPRQLFPDJQLWXGHV
VDPHDV3KDVH$9ROWDJHWKWRUGKDUPRQLFPDJQLWXGHV
VDPHDV3KDVH$&XUUHQWWKWRWKKDUPRQLFPDJQLWXGHV
VDPHDV3KDVH$9ROWDJHWKWRUGKDUPRQLFPDJQLWXGHV
%ORFN6L]H
EM-3000 Series Meter Installation and Operation Manual
MM-3
B: Modbus Map
Modbus Address
Hex
1
Description
Decimal
Format
6
Range
Units or
Resolution
14
Phase Angle Block
#
Reg
Comments
read-only
3KDVH$&XUUHQW
3KDVH%&XUUHQW
3KDVH&&XUUHQW
$QJOH9ROWV$%
$QJOH9ROWV%&
$QJOH9ROWV&$
6,17
6,17
6,17
6,17
6,17
6,17
WR
WR
WR
WR
WR
WR
GHJUHH
GHJUHH
GHJUHH
GHJUHH
GHJUHH
GHJUHH
%ORFN6L]H
Status Block
0HWHU6WDWXV
8,17
ELWPDSSHG
--exnpch ssssssss
/LPLWV6WDWXV
8,17
ELWPDSSHG
87654321 87654321
$
7LPH6LQFH5HVHW
8,17
WR
PVHF
read-only
H[QSFK ((3520EORFN2.IODJV
H HQHUJ\[ PD[Q PLQ
S SURJUDPPDEOHVHWWLQJVF FDOLEUDWLRQ
K KHDGHU
VVVVVVVV VWDWH 5XQ /LPS
3URJ6HW8SGDWHYLDEXWWRQV 3URJ
6HW8SGDWHYLD,U'$ 3URJ6HW8SGDWH
YLD&20
KLJKE\WHLVVHWSW LQ RXW
ORZE\WHLVVHWSW LQ RXW
ZUDSVDURXQGDIWHUPD[FRXQW
%ORFN6L]H
Commands Section 4
write-only
9
Resets Block
() () ( ( 5HVHW0D[0LQ%ORFNV
5HVHW(QHUJ\$FFXPXODWRUV
8,17
8,17
SDVVZRUG
SDVVZRUG
%ORFN6L]H
Meter Programming Block
() () ) ) ,QLWLDWH3URJUDPPDEOH6HWWLQJV8SGDWH
) ) &DOFXODWH3URJUDPPDEOH6HWWLQJV&KHFNVXP
) ) 3URJUDPPDEOH6HWWLQJV&KHFNVXP
) ) :ULWH1HZ3DVVZRUG
8,17
8,17
7HUPLQDWH3URJUDPPDEOH6HWWLQJV8SGDWH
SDVVZRUG
DQ\YDOXH
PHWHUOHDYHV36XSGDWHPRGHYLDUHVHW
PHWHUFDOFXODWHVFKHFNVXPRQ5$0FRS\
RI36EORFN
UHDGZULWHFKHFNVXPUHJLVWHU36EORFN
VDYHGLQ((3520RQZULWH
8,17
8,17
8,17
read/conditional write
PHWHUHQWHUV36XSGDWHPRGH
WR
ZULWHRQO\UHJLVWHUDOZD\VUHDGV]HUR
' ' ,QLWLDWH0HWHU)LUPZDUH5HSURJUDPPLQJ
8,17
SDVVZRUG
%ORFN6L]H
EM-3000 Series Meter Installation and Operation Manual
MM-4
B: Modbus Map
Modbus Address
Hex
1
Description
Decimal
Format
6
Range
Units or
Resolution
#
Reg
Comments
Other Commands Block
read/write
$ $ )RUFH0HWHU5HVWDUW
8,17
SDVVZRUG
FDXVHVDZDWFKGRJUHVHWDOZD\VUHDGV
%ORFN6L]H
Encryption Block
) $ 3HUIRUPD6HFXUH2SHUDWLRQ
read/write
HQFU\SWHGFRPPDQGWRUHDGSDVVZRUGRU
FKDQJHPHWHUW\SH
%ORFN6L]H
8,17
Programmable Settings Section
Basic Setups Block
) ) &7PXOWLSOLHUGHQRPLQDWRU
8,17
ELWPDSSHG
dddddddd mmmmmmmm
&7QXPHUDWRU
37QXPHUDWRU
37GHQRPLQDWRU
37PXOWLSOLHUKRRNXS
8,17
8,17
8,17
8,17
WR
WR
WR
ELWPDSSHG
QRQH
QRQH
QRQH
mmmmmmmm MMMMhhhh
write only in PS update mode
KLJKE\WHLVGHQRPLQDWRURUUHDG
RQO\
ORZE\WHLVPXOWLSOLHURU
0000PPPPPPPPLV37PXOWLSOLHU
KKKKLVKRRNXSHQXPHUDWLRQ HOHPHQWZ\H>[email protected] GHOWD&7V>[email protected] HOHPHQWZ\H>[email protected]
$YHUDJLQJ0HWKRG
8,17
ELWPDSSHG
--iiiiii b----sss
LLLLLL LQWHUYDO
E EORFNRUUROOLQJ
VVV VXELQWHUYDOV
3RZHU(QHUJ\)RUPDW
8,17
ELWPDSSHG
pppp--nn -eee-ddd
SSSS SRZHUVFDOHXQLWNLORPHJD
DXWR
QQ QXPEHURIHQHUJ\GLJLWV!
HHH HQHUJ\VFDOHXQLWNLORPHJD
GGG HQHUJ\GLJLWVDIWHUGHFLPDOSRLQW
6HHQRWH
2SHUDWLQJ0RGH6FUHHQ(QDEOHV
8,17
ELWPDSSHG
00000000 eeeeeeee
HHHHHHHH RSPRGHVFUHHQURZVRQRU
RIIURZVWRSWRERWWRPDUHELWVORZRUGHU
WRKLJKRUGHU
' 5HVHUYHG
EM-3000 Series Meter Installation and Operation Manual
MM-5
B: Modbus Map
Modbus Address
Hex
1
Description
Decimal
Format
Units or
Resolution
6
Range
#
Reg
Comments
( ( 8VHU6HWWLQJV)ODJV
8,17
ELWPDSSHG
---g--nn srp--wf-
J HQDEOHDOWHUQDWHIXOOVFDOHEDUJUDSK
FXUUHQW RQ RII
QQ QXPEHURISKDVHVIRUYROWDJH
FXUUHQWVFUHHQV $%& $% $
$%&
V VFUROO RQ RII
U SDVVZRUGIRUUHVHWLQXVH RQ RII
S SDVVZRUGIRUFRQILJXUDWLRQLQXVH
RQ RII
Z SZUGLUYLHZDVORDGYLHZDV
JHQHUDWRU
I IOLSSRZHUIDFWRUVLJQ \HV QR
) ) )XOO6FDOH&XUUHQWIRUORDGEDUJUDSK
8,17
WR
QRQH
,IQRQ]HURDQGXVHUVHWWLQJVELWJLVVHW
WKLVYDOXHUHSODFHV&7QXPHUDWRULQWKHIXOO
VFDOHFXUUHQWFDOFXODWLRQ
0HWHU'HVLJQDWLRQ
&20VHWXS
$6&,,
8,17
FKDU
ELWPDSSHG
QRQH
----dddd -0100110
&20VHWXS
8,17
ELWPDSSHG
----dddd -ppp-bbb
$ $ % % &20DGGUHVV
/LPLW,GHQWLILHU
8,17
8,17
WR
WR
QRQH
& & /LPLW2XW+LJK6HWSRLQW
6,17
WR
RIIXOOVFDOH
' ' /LPLW,Q+LJK7KUHVKROG
6,17
WR
RIIXOOVFDOH
( ( /LPLW2XW/RZ6HWSRLQW
6,17
WR
RIIXOOVFDOH
) ) /LPLW,Q/RZ7KUHVKROG
6,17
WR
RIIXOOVFDOH
$
)
(
/LPLW
/LPLW
/LPLW
/LPLW
/LPLW
/LPLW
/LPLW
6,17
6,17
6,17
6,17
6,17
6,17
6,17
(
'
VDPHDV/LPLW
VDPHDV/LPLW
GGGG UHSO\GHOD\PVHF
SSS SURWRFRO0RGEXV5780RGEXV
$6&,,'13
EEE EDXGUDWH
XVH0RGEXVDGGUHVVDVWKHLGHQWLILHUVHH
QRWHV
6HWSRLQWIRUWKHDERYHOLPLW/0VHH
QRWHV
7KUHVKROGDWZKLFKDERYHOLPLWFOHDUV
QRUPDOO\OHVVWKDQRUHTXDOWRWKHDERYH
VHWSRLQWVHHQRWHV
6HWSRLQWIRUWKHEHORZOLPLW/0VHH
QRWHV
7KUHVKROGDWZKLFKEHORZOLPLWFOHDUV
QRUPDOO\JUHDWHUWKDQRUHTXDOWRWKH
EHORZVHWSRLQWVHHQRWHV
VDPHDV/LPLW
%ORFN6L]H
EM-3000 Series Meter Installation and Operation Manual
MM-6
B: Modbus Map
Modbus Address
Hex
1
Description
Decimal
Units or
Resolution
6
Format
Range
#
Reg
Comments
12-Bit Readings Section
12-Bit Block
&
&
&
&
&
&
&
&
&
&
&$
8,17
8,17
8,17
8,17
8,17
8,17
8,17
8,17
8,17
8,17
8,17
RU
WR
WR
WR
WR
WR
WR
WR
WR
WR
WR
QRQH
YROWV
YROWV
YROWV
DPSV
DPSV
DPSV
ZDWWV
9$5V
9$V
QRQH
&% &% )UHTXHQF\
8,17
WR
+]
&&
&'
&(
&)
&
&
&
&
&
&
&
9ROWV$%
9ROWV%&
9ROWV&$
&7QXPHUDWRU
&7PXOWLSOLHU
&7GHQRPLQDWRU
37QXPHUDWRU
37PXOWLSOLHU
37GHQRPLQDWRU
:KRXUV3RVLWLYH
:KRXUV1HJDWLYH
8,17
8,17
8,17
8,17
8,17
8,17
8,17
8,17
8,17
8,17
8,17
WR
WR
WR
WR
RU
WR
WR
WR
WR
YROWV
YROWV
YROWV
QRQH
QRQH
QRQH
QRQH
QRQH
QRQH
:KSHUHQHUJ\IRUPDW
:KSHUHQHUJ\IRUPDW
& &$ 9$5KRXUV3RVLWLYH
8,17
WR
&% && 9$5KRXUV1HJDWLYH
8,17
WR
GHFLPDOSRLQWLPSOLHGSHUHQHUJ\IRUPDW
9$5KSHUHQHUJ\IRUPDW
UHVROXWLRQRIGLJLWEHIRUHGHFLPDOSRLQW XQLWVNLORRUPHJDSHUHQHUJ\IRUPDW
9$5KSHUHQHUJ\IRUPDW
&' &( 9$KRXUV
8,17
WR
9$KSHUHQHUJ\IRUPDW
&) &) & &$ &$ &$ 1HXWUDO&XUUHQW
5HVHUYHG
5HVHW(QHUJ\$FFXPXODWRUV
8,17
1$
8,17
WR
1$
DPSV
QRQH
&&
&'
&(
&)
&
&
&
&
&
&
&
read-only except as noted
LQGLFDWHVSURSHUPHWHURSHUDWLRQ
6\VWHP6DQLW\,QGLFDWRU
9ROWV$1
9ROWV%1
9ROWV&1
$PSV$
$PSV%
$PSV&
:DWWV3KWRWDO
9$5V3KWRWDO
9$V3KWRWDO
3RZHU)DFWRU3KWRWDO
&
&
&
&
&
&
&
&
&
&
&$
SDVVZRUG
YROWV UHJLVWHU
DPSV UHJLVWHU
ZDWWV9$5V9$V UHJLVWHU
SI UHJLVWHU
RUOHVV RUPRUH
IUHT UHJLVWHU
YROWV UHJLVWHU
&7 QXPHUDWRUPXOWLSOLHUGHQRPLQDWRU
37 QXPHUDWRUPXOWLSOLHUGHQRPLQDWRU
WRGLJLWV
VHHQRWH
VHH$PSV$%&DERYH
ZULWHRQO\UHJLVWHUDOZD\VUHDGVDV
%ORFN6L]H
End of Map
EM-3000 Series Meter Installation and Operation Manual
MM-7
B: Modbus Map
6,178,17
)/2$7
Notes
ELWVLJQHGXQVLJQHGLQWHJHUVSDQQLQJUHJLVWHUV7KHORZHUDGGUHVVHGUHJLVWHULVWKHKLJKRUGHUKDOI
ELW,(((IORDWLQJSRLQWQXPEHUVSDQQLQJUHJLVWHUV7KHORZHUDGGUHVVHGUHJLVWHULVWKHKLJKRUGHUKDOILHFRQWDLQVWKHH[SRQHQW
$OOUHJLVWHUVQRWH[SOLFLWO\OLVWHGLQWKHWDEOHUHDGDV:ULWHVWRWKHVHUHJLVWHUVZLOOEHDFFHSWHGEXWZRQ
WDFWXDOO\FKDQJHWKHUHJLVWHUVLQFHLWGRHVQ
WH[LVW
0HWHU'DWD6HFWLRQLWHPVUHDGDVXQWLOILUVWUHDGLQJVDUHDYDLODEOHRULIWKHPHWHULVQRWLQRSHUDWLQJPRGH:ULWHVWRWKHVHUHJLVWHUVZLOOEHDFFHSWHGEXWZRQ
WDFWXDOO\FKDQJHWKHUHJLVWHU
5HJLVWHUYDOLGRQO\LQSURJUDPPDEOHVHWWLQJVXSGDWHPRGH,QRWKHUPRGHVWKHVHUHJLVWHUVUHDGDVDQGUHWXUQDQLOOHJDOGDWDDGGUHVVH[FHSWLRQLIDZULWHLVDWWHPSWHG
0HWHUFRPPDQGUHJLVWHUVDOZD\VUHDGDV7KH\PD\EHZULWWHQRQO\ZKHQWKHPHWHULVLQDVXLWDEOHPRGH7KHUHJLVWHUVUHWXUQDQLOOHJDOGDWDDGGUHVVH[FHSWLRQLIDZULWHLVDWWHPSWHGLQDQLQFRUUHFW
PRGH
,IWKHSDVVZRUGLVLQFRUUHFWDYDOLGUHVSRQVHLVUHWXUQHGEXWWKHFRPPDQGLVQRWH[HFXWHG8VHIRUWKHSDVVZRUGLISDVVZRUGVDUHGLVDEOHGLQWKHSURJUDPPDEOHVHWWLQJV
0GHQRWHVDPXOWLSOLHU
1RWDSSOLFDEOHWR96ZLWFK(
:ULWLQJWKLVUHJLVWHUFDXVHVGDWDWREHVDYHGSHUPDQHQWO\LQ((3520,IWKHUHLVDQHUURUZKLOHVDYLQJDVODYHGHYLFHIDLOXUHH[FHSWLRQLVUHWXUQHGDQGSURJUDPPDEOHVHWWLQJVPRGHDXWRPDWLFDOO\
WHUPLQDWHVYLDUHVHW
5HVHWFRPPDQGVPDNHQRVHQVHLIWKHPHWHUVWDWHLV/,03$QLOOHJDOIXQFWLRQH[FHSWLRQZLOOEHUHWXUQHG
(QHUJ\UHJLVWHUVVKRXOGEHUHVHWDIWHUDIRUPDWFKDQJH
(QWLWLHVWREHPRQLWRUHGDJDLQVWOLPLWVDUHLGHQWLILHGE\0RGEXVDGGUHVV(QWLWLHVRFFXS\LQJPXOWLSOH0RGEXVUHJLVWHUVVXFKDVIORDWLQJSRLQWYDOXHVDUHLGHQWLILHGE\WKHORZHUUHJLVWHUDGGUHVV,IDQ\
RIWKHOLPLWVLVXQXVHGVHWLWVLGHQWLILHUWR]HUR,IWKHLQGLFDWHG0RGEXVUHJLVWHULVQRWXVHGRULVDQRQVHQVLFDOHQWLW\IRUOLPLWVLWZLOOEHKDYHDVDQXQXVHGOLPLW
7KHUHDUHVHWSRLQWVSHUOLPLWRQHDERYHDQGRQHEHORZWKHH[SHFWHGUDQJHRIYDOXHV/0LVWKHWRRKLJKOLPLW/0LVWRRORZ7KHHQWLW\JRHVRXWRIOLPLWRQ/0ZKHQLWVYDOXHLVJUHDWHUWKDQ
WKHVHWSRLQW,WUHPDLQVRXWRIOLPLWXQWLOWKHYDOXHGURSVEHORZWKHLQWKUHVKROG/0ZRUNVVLPLODUO\LQWKHRSSRVLWHGLUHFWLRQ,IOLPLWVLQRQO\RQHGLUHFWLRQDUHRILQWHUHVWVHWWKHLQWKUHVKROGRQWKH
ZURQJVLGHRIWKHVHWSRLQW/LPLWVDUHVSHFLILHGDVRIIXOOVFDOHZKHUHIXOOVFDOHLVDXWRPDWLFDOO\VHWDSSURSULDWHO\IRUWKHHQWLW\EHLQJPRQLWRUHG
FXUUHQW )6
YROWDJH )6
SRZHU )6
IUHTXHQF\ )6
SRZHUIDFWRU )6
SHUFHQWDJH )6
DQJOH )6
&7QXPHUDWRU&7PXOWLSOLHU
37QXPHUDWRU37PXOWLSOLHU
&7QXPHUDWRU&7PXOWLSOLHU37QXPHUDWRU37PXOWLSOLHU>[email protected]
RU
7+'QRWDYDLODEOHVKRZV [))))LQDOO7+'DQGKDUPRQLFPDJQLWXGHUHJLVWHUVIRUWKHFKDQQHOZKHQ9VZLWFK (7+'PD\EHXQDYDLODEOHGXHWRORZ9RU,DPSOLWXGHRUGHOWDKRRNXS9
RQO\
$OOYROWDJHDQJOHVDUHPHDVXUHGIRU:\HDQG'HOWDKRRNXSV)RU(OHPHQW9DFLVPHDVXUHGDQG9DE9EFDUHFDOFXODWHG,IDYROWDJHSKDVHLVPLVVLQJWKHWZRYROWDJHDQJOHVLQZKLFKLW
SDUWLFLSDWHVDUHVHWWR]HUR$DQG&SKDVHFXUUHQWDQJOHVDUHPHDVXUHGIRUDOOKRRNXSV%SKDVHFXUUHQWDQJOHLVPHDVXUHGIRU:\HDQGLV]HURIRURWKHUKRRNXSV,IDYROWDJHSKDVHLVPLVVLQJLWV
FXUUHQWDQJOHLV]HUR
EM-3000 Series Meter Installation and Operation Manual
MM-8
Was this manual useful for you? yes no
Thank you for your participation!

* Your assessment is very important for improving the work of artificial intelligence, which forms the content of this project

Download PDF

advertisement

Languages