GE | PGP9830DJBB | Instructions / Assembly | GE PGP9830DJBB Instructions / Assembly

Gas Downdraft
Cooktop
GEAppliances.com
For a Spanish version of this
manual, visit our Website at
GEAppliances.com.
Para consultar una version
en español de este manual
de instrucciones, visite
nuestro sitio de internet
GEAppliances.com.
Safety Information . . . . . . . . . . . . 2
Warranty . . . . . . . . . . . . . . . . . . . . . . . . 8
Assistance /
Parts and Accessories . . . . . . . . . 9
Owner’s Manual &
Installation Instructions
PGP9830
PGP989
Using The Cooktop
Cooktop Features . . . . . . . . . . . . . . . . .10
Surface Burners . . . . . . . . . . . . . . . . . . .11
Using The Downdraft
Vent System. . . . . . . . . . . . . . . . . . . . .12
Care and Cleaning
Cleaning The Cooktop . . . . . . . . . . . . .13
Cleaning the Glass Cooktop. . . . . . . .15
Installation Instructions . . . . . .17
Troubleshooting Tips . . . . . . . . .35
Write the model and serial
numbers here:
Model # ______________________
Serial # _______________________
Find these numbers on a label
under the cooktop, on the side
of the vent chamber.
49-80516-3 02-15 GE
SAFETY INFORMATION
IMPORTANT SAFETY INFORMATION.
READ ALL INSTRUCTIONS BEFORE USING.
WARNING
For your safety, the information in this manual must be followed to minimize the risk of fire or explosion,
electric shock, or to prevent property damage, personal injury or loss of life.
WARNING: If the information in
this manual is not followed exactly, a fire
or explosion may result, causing property
damage, personal injury or death.
— Do not store or use gasoline or other
flammable vapors and liquids in the
vicinity of this or any other appliance.
—
WHAT TO DO IF YOU
SMELL GAS
Ŷ Do not try to light any appliance.
Ŷ Do not touch any electrical switch; do
not use any phone in your building.
Ŷ Immediately call your gas supplier
from a neighbor’s phone. Follow the
gas supplier’s instructions.
Ŷ If you cannot reach your gas supplier,
call the fire department.
— Installation and service must be
performed by a qualified installer, service
agency or the gas supplier.
2
SAVE THESE INSTRUCTIONS
49-80516-3
The California Safe Drinking Water and Toxic Enforcement Act requires the Governor of California to
publish a list of substances known to the state to cause cancer, birth defects or other reproductive harm,
and requires businesses to warn customers of potential exposure to such substances.
WARNING
This product contains one or more chemical known to the Sate of California to
cause cancer, birth defects or other reproductive harm.
Self-clean ovens can cause low-level exposure to some of these substances, including carbon monoxide,
during the cleaning cycle. Exposure can be minimized by venting with an open window or using a
ventilation fan or hood.
SAFETY INFORMATION
STATE OF CALIFORNIA PROPOSITION 65 WARNING
WARNING GENERAL SAFETY INSTRUCTIONS
Have the installer show you the location of the cooktop gas shut-off valve and how to shut it off if necessary.
Ŷ +DYH\RXUFRRNWRSLQVWDOOHGDQGSURSHUO\
grounded by a qualified installer, in accordance
with the Installation Instructions. Any adjustment
and service should be performed only by
qualified gas cooktop installers or service
technicians.
Ŷ 'RQRWDWWHPSWWRUHSDLURUUHSODFHDQ\
part of your cooktop unless it is specifically
recommended in this manual. All other service
should be referred to a qualified technician.
Ŷ /RFDWHWKHFRRNWRSRXWRINLWFKHQWUDIILFSDWKDQG
out of drafty locations to prevent poor burner
performance.
Ŷ 3OXJ\RXUFRRNWRSLQWRDYROWJURXQGHGRXWOHW
only. Do not remove the round grounding prong
from the plug. If in doubt about the grounding
of the home electrical system, it is your
personal responsibility and obligation to have
an ungrounded outlet replaced with a properly
grounded, three-prong outlet in accordance with
the National Electrical Code. Do not use an
extension cord with this appliance.
Ŷ /HWWKHEXUQHUJUDWHVDQGRWKHUVXUIDFHVFRRO
before touching them or leaving them where
children can reach them.
Ŷ %HVXUHDOOSDFNDJLQJPDWHULDOVDUHUHPRYHG
from the cooktop before operating it to prevent
fire or smoke damage should the packaging
material ignite.
Ŷ %HVXUH\RXUFRRNWRSLVFRUUHFWO\DGMXVWHGE\
a qualified service technician or installer for
WKHW\SHRIJDVQDWXUDORU/3ZKLFKLVWREH
used. Your cooktop can be converted for use
with either type of gas. See the Installation
,QVWUXFWLRQVLQWKH/3&RQYHUVLRQ.LW
Ŷ
WARNING: These adjustments must
be made by a qualified service technician in
accordance with the manufacturer’s instructions
and all codes and requirements of the authority
having jurisdiction. Failure to follow these
instructions could result in serious injury
or property damage. The qualified agency
performing this work assumes responsibility for
the conversion.
Ŷ 'RQRWOHDYHFKLOGUHQDORQHRUXQDWWHQGHGZKHUH
a cooktop is hot or in operation. They could be
seriously burned.
Ŷ 'RQRWDOORZDQ\RQHWRFOLPEVWDQGRUKDQJRQ
the cooktop.
Ŷ 'RQRWRSHUDWHRUFOHDQ\RXUFRRNWRSLIWKHJODVV
is broken or cracked. Cleaning solutions and
spillovers could penetrate the broken cooktop and
create a risk of electric shock. Call for service
immediately if the cooktop glass breaks or cracks.
SAVE THESE INSTRUCTIONS
49-80516-3
3
SAFETY INFORMATION
IMPORTANT SAFETY INFORMATION.
READ ALL INSTRUCTIONS BEFORE USING.
WARNING GENERAL SAFETY INSTRUCTIONS
CAUTION : Items of interest to children
Ŷ $YRLGVFUDWFKLQJWKHFRRNWRSZLWKVKDUS
instruments, or with rings and other jewelry.
should not be stored in cabinets above a
Ŷ 1HYHUXVHWKHFRRNWRSDVDFXWWLQJERDUG
cooktop—children climbing on the cooktop to
Ŷ 'RQRWXVHZDWHURQJUHDVHILUHV1HYHUSLFNXS
reach items could be seriously injured.
a flaming pan. Turn the controls off. Smother a
Ŷ $OZD\VNHHSZRRGHQDQGSODVWLFXWHQVLOVDQG
flaming pan on a surface burner by covering the
canned food a safe distance away from your
pan completely with a well-fitting lid, cookie sheet
cooktop.
or flat tray. Use a multi-purpose dry chemical or
Ŷ $OZD\VNHHSFRPEXVWLEOHZDOOFRYHULQJVFXUWDLQV
foam-type fire extinguisher.
or drapes a safe distance from your cooktop.
Flaming grease outside a pan can be put out by
Ŷ 'RQRWREVWUXFWWKHIORZRIFRPEXVWLRQDQG
covering it with baking soda or, if available, by
ventilation air.
using a multi-purpose dry chemical or foam-type
Ŷ /HDNWHVWLQJRIWKHDSSOLDQFHVKDOOEHFRQGXFWHG
fire extinguisher.
according to the manufacturer’s instructions.
: To reduce the risk of fire,
Ŷ
Ŷ 1HYHUZHDUORRVHILWWLQJRUKDQJLQJJDUPHQWV
electrical shock or injury to persons, observe the
ZKLOHXVLQJWKHDSSOLDQFH%HFDUHIXOZKHQ
following:
reaching for items stored in cabinets over the
A. Use this unit only in the manner intended
cooktop. Flammable material could be ignited if
by the manufacturer. If you have questions,
brought in contact with flame or hot surfaces and
contact the manufacturer.
may cause severe burns.
B. %HIRUHVHUYLFLQJRUFOHDQLQJWKHXQLWVZLWFK
Ŷ 7HDFKFKLOGUHQQRWWRSOD\ZLWKWKHFRQWUROVRU
power off at service panel.
any other part of the cooktop.
C. When cutting or drilling into wall or ceiling, do
not damage electrical wiring and other hidden
: NEVER use this appliance
utilities.
as a space heater to heat or warm the room.
D. Ducted fans must always be vented to the
Doing so may result in carbon monoxide
outdoors.
poisoning and overheating of the oven.
E. To reduce the risk of fire, use only metal
ductwork.
Ŷ $OZD\VNHHSGLVKWRZHOVGLVKFORWKVSRWKROGHUV
F.
Do not flame foods on the cooktop. If you do
and other linens a safe distance from your
flame foods under the hood, turn the fan on.
cooktop.
G. Sufficient air is needed for proper combustion
Ŷ 'RQRWVWRUHIODPPDEOHPDWHULDOVQHDUDFRRNWRS
and exhausting of gases through the flue
Ŷ 'RQRWVWRUHRUXVHFRPEXVWLEOHPDWHULDOV
FKLPQH\RIIXHOEXUQLQJHTXLSPHQWWR
gasoline or other flammable vapors and liquids in
prevent back drafting. Follow the heating
the vicinity of this or any other appliance.
equipment manufacturer’s guidelines and
Ŷ 'RQRWOHWFRRNLQJJUHDVHRURWKHUIODPPDEOH
safety standards, such as those published
materials accumulate on or near the cooktop.
E\WKH1DWLRQDO)LUH3URWHFWLRQ$VVRFLDWLRQ
Ŷ 'RQRWRSHUDWHWKHEXUQHUZLWKRXWDOOEXUQHUSDUWV
1)3$WKH$PHULFDQ6RFLHW\IRU+HDWLQJ
in place.
Refrigeration and Air Conditioning Engineers
$6+5$(DQGWKHORFDOFRGHDXWKRULWLHV
Ŷ 'RQRWSODFHKRWFRRNZDUHRQWKHJODVVFRRNWRS
When applicable, install any make up
This could cause glass to break.
UHSODFHPHQWDLUV\VWHPLQDFFRUGDQFH
Ŷ 'RQRWFOHDQWKHFRRNWRSZLWKIODPPDEOHRU
with local building code requirements. Visit
volatile cleaning fluids.
GEAppliances.com for available makeup
Ŷ '
RQRWFOHDQWKHFRRNWRSZKHQWKHDSSOLDQFHLV
air solutions.
in use.
Ŷ
WARNING
WARNING
4
SAVE THESE INSTRUCTIONS
49-80516-3
WARNING: To reduce the risk of a
Ŷ
cooktop grease fire:
A. .HHSIDQILOWHUVDQGJUHDVHODGHQVXUIDFHV
clean.
B. Always turn vent ON when cooking at high
heat.
C. Use high settings on cooktop only when
necessary. Heat oil slowly on low to medium
setting.
D. Don’t leave the cooktop unattended when
cooking.
E. Always use cookware and utensils
appropriate for the type and amount of food
being prepared.
Ŷ
CAUTION
: For general ventilating
use only. Do not use to exhaust hazardous or
explosive materials and vapors.
SAFETY INFORMATION
WARNING GENERAL SAFETY INSTRUCTIONS
WARNING GLASS COOKTOP SURFACE
Use care when touching the glass cooktop surface. The glass surface of the cooktop will retain heat after
the controls have been turned off.
Ŷ $YRLGVFUDWFKLQJWKHJODVVFRRNWRSVXUIDFH7KH
glass surface can be scratched with items such
as sharp instruments, rings or other jewelry and
rivets on clothing.
Ŷ /DUJHVFUDWFKHVRULPSDFWVWRJODVVFRRNWRSVFDQ
lead to broken or shattered glass.
Ŷ 'RQRWRSHUDWHWKHFRRNWRSLIWKHJODVVLVEURNHQ
Spillovers or cleaning solution may penetrate
a broken cooktop and create a risk of electrical
shock. Contact a qualified technician immediately
should your glass cooktop surface become broken.
Ŷ 1HYHUXVHWKHJODVVFRRNWRSVXUIDFHDVDFXWWLQJ
board.
Ŷ 'RQRWSODFHRUVWRUHLWHPVWKDWFDQPHOWRUFDWFK
fire on the glass cooktop surface, even when it is
not being used.
Ŷ %HFDUHIXOZKHQSODFLQJVSRRQVRURWKHUVWLUULQJ
utensils on glass cooktop surface when it is in use.
They may become hot and could cause burns.
Ŷ &OHDQWKHFRRNWRSVXUIDFHZLWKFDXWLRQ,IDZHW
sponge or cloth is used to wipe spills on a hot
surface, be careful to avoid steam burns. Some
cleaners can produce noxious fumes if applied to
a hot surface. NOTE: We recommend that you
avoid wiping any surface unit areas until they
have cooled and the indicator light has gone off.
Sugar spills are the exception to this3OHDVH
see Cleaning the Glass Cooktop in the Care and
Cleaning section.
Ŷ :KHQWKHFRRNWRSLVFRROXVHRQO\
&(5$0$%5<7(® Ceramic Cooktop Cleaner
DQGWKH&(5$0$%5<7(®&OHDQLQJ3DGWR
clean the cooktop.
Ŷ 7RDYRLGSRVVLEOHGDPDJHWRWKHFRRNLQJ
surface, do not apply cleaning cream to the glass
surface when it is hot.
Ŷ $IWHUFOHDQLQJXVHDGU\FORWKRUSDSHUWRZHOWR
remove all cleaning cream residue.
Ŷ 5HDGDQGIROORZDOOLQVWUXFWLRQVDQGZDUQLQJVRQ
the cleaning cream labels.
SAVE THESE INSTRUCTIONS
49-80516-3
5
SAFETY INFORMATION
6
IMPORTANT SAFETY INFORMATION.
READ ALL INSTRUCTIONS BEFORE USING.
WARNING SURFACE BURNERS
Use proper pan size—avoid pans that are unstable or easily tipped. Select cookware having flat bottoms
large enough to cover burner grates. To avoid spillovers, make sure cookware is large enough to contain
the food properly. This will both save cleaning time and prevent hazardous accumulations of food,
since heavy spattering or spillovers left on cooktop can ignite. Use pans with handles that can be easily
grasped and remain cool.
Ŷ $OZD\VXVHWKH/,7(SRVLWLRQZKHQLJQLWLQJWKHWRS
burners and make sure the burners have ignited.
Ŷ 1HYHUOHDYHWKHVXUIDFHEXUQHUVXQDWWHQGHGDW
KLJKIODPHVHWWLQJV%RLORYHUVFDXVHVPRNLQJDQG
greasy spillovers that may catch on fire.
Ŷ 8VHRQO\GU\SRWKROGHUV²PRLVWRUGDPSSRW
holders on hot surfaces may result in burns from
steam. Do not let pot holders come near open
flames when lifting cookware. Do not use a towel
or other bulky cloth in place of a pot holder. Such
cloths can catch fire on a hot burner.
Ŷ :KHQXVLQJJODVVFRRNZDUHPDNHVXUHLWLV
designed for cooktop cooking.
Ŷ 7RPLQLPL]HWKHSRVVLELOLW\RIEXUQVLJQLWLRQRI
flammable materials and spillage, turn cookware
handles toward the side or center of the cooktop
without extending over adjacent burners.
Ŷ $OZD\VWXUQWKHVXUIDFHEXUQHUFRQWUROVRIIEHIRUH
removing cookware.
Ŷ &DUHIXOO\ZDWFKIRRGVEHLQJIULHGDWDKLJKIODPH
setting.
Ŷ $OZD\VKHDWIDWVORZO\DQGZDWFKDVLWKHDWV
Ŷ 'RQRWOHDYHDQ\LWHPVRQWKHFRRNWRS7KHKRW
air from the vent may ignite flammable items and
will increase pressure in closed containers, which
may cause them to burst.
Ŷ ,IDFRPELQDWLRQRIRLOVRUIDWVZLOOEHXVHGLQIU\LQJ
stir together before heating or as fats melt slowly.
Ŷ 'RQRWXVHDZRNRQWKHFRRNLQJVXUIDFHLIWKH
wok has a round metal ring that is placed over
the burner grate to support the wok. This ring
acts as a heat trap, which may damage the
burner grate and burner head. Also, it may cause
the burner to work improperly. This may cause
a carbon monoxide level above that allowed by
current standards, resulting in a health hazard.
Ŷ )RRGVIRUIU\LQJVKRXOGEHDVGU\DVSRVVLEOH
Frost on frozen foods or moisture on fresh foods
can cause hot fat to bubble up and over the
sides of the pan.
Ŷ 8VHWKHOHDVWSRVVLEOHDPRXQWRIIDWIRUHIIHFWLYH
shallow or deep-fat frying. Filling the pan too full
of fat can cause spillovers when food is added.
Ŷ 8VHDGHHSIDWWKHUPRPHWHUZKHQHYHUSRVVLEOHWR
prevent overheating fat beyond the smoking point.
Ŷ 1HYHUWU\WRPRYHDSDQRIKRWIDWHVSHFLDOO\D
deep fat fryer. Wait until the fat is cool.
Ŷ 'RQRWIODPHIRRGVRQWKHFRRNWRS,I\RXGR
flame foods under the hood, turn the fan on.
SAVE THESE INSTRUCTIONS
49-80516-3
Adjust the burner flame size so it does not extend beyond the edge of the cookware. Excessive flame is
hazardous.
Ŷ 'RQRWOHDYHSODVWLFLWHPVRQWKHFRRNWRS²WKH\
may melt if left too close to the vent.
Ŷ .HHSDOOSODVWLFVDZD\IURPWKHVXUIDFHEXUQHUV
Ŷ ,I\RXVPHOOJDVWXUQRIIWKHJDVWRWKHFRRNWRS
and call a qualified service technician. Never use
an open flame to locate a leak.
Ŷ 7RDYRLGWKHSRVVLELOLW\RIDEXUQDOZD\VEH
certain that the controls for all burners are at
the off position and all grates are cool before
attempting to remove them.
Ŷ 1HYHUFOHDQWKHFRRNWRSVXUIDFHZKHQLWLVKRW
Some cleaners produce noxious fumes and wet
cloths could cause steam burns if used on a hot
surface.
Ŷ 1HYHUOHDYHMDUVRUFDQVRIIDWGULSSLQJVRQRU
near your cooktop.
Ŷ 'RQRWXVHDOXPLQXPIRLOXQGHUEXUQHUJUDWHV
Misuse could result in a fire hazard or damage to
the cooktop.
Ŷ 'RQRWFRYHURUEORFNWKHDUHDDURXQGWKH
cooktop knobs. This area must be kept clear for
proper ventilation and burner performance.
Ŷ &OHDQRQO\SDUWVOLVWHGLQWKLV2ZQHU¶V0DQXDO
SAFETY INFORMATION
WARNING SURFACE BURNERS
WARNING COOK MEAT AND POULTRY THOROUGHLY
&RRNPHDWDQGSRXOWU\WKRURXJKO\²PHDWWRDWOHDVWDQ,17(51$/WHPSHUDWXUHRIƒ)DQGSRXOWU\WR
DWOHDVWDQ,17(51$/WHPSHUDWXUHRIƒ)&RRNLQJWRWKHVHWHPSHUDWXUHVXVXDOO\SURWHFWVDJDLQVW
foodborne illness.
TO LP GAS
WARNING CONVERTING
(or converting back to natural gas from LP)
This cooktop leaves the factory set for use with natural gas.
,I\RXZDQWWRFRQYHUWWR/3JDVWKHFRQYHUVLRQPXVWEHSHUIRUPHGE\DTXDOLILHG/3JDVLQVWDOOHU
7KHFRQYHUVLRQLQVWUXFWLRQVFRQYHUVLRQVWLFNHUDQG/3RULILFHVFDQEHIRXQGDWWDFKHGWRWKHSUHVVXUH
regulator.
There is a second set of instructions included in the envelope containing the product wiring diagrams
RQWKHVLGHRIWKHFRRNWRS.HHSWKHVHLQVWUXFWLRQVDQGWKHRULILFHVLQFDVH\RXZDQWWRFRQYHUWEDFNWR
natural gas.
SAVE THESE INSTRUCTIONS
49-80516-3
7
WARRANTY
Thank You! ... for your purchase of a GE Brand appliance.
Register Your Appliance: Register your new appliance on-line at your convenience!
www.geappliances.com/service_and_support/register/
Timely product registration will allow for enhanced communication and prompt service under the terms of your warranty,
should the need arise. You may also mail in the pre-printed registration card included in the packing material.
GE Gas Cooktop Warranty
GEAppliances.com
All warranty service is provided by our Factory Service Centers, or an authorized Customer Care® technician.
7RVFKHGXOHVHUYLFHRQOLQHYLVLWXVDWZZZJHDSSOLDQFHVFRPVHUYLFHBDQGBVXSSRUWRUFDOO*(&$5(6
3OHDVHKDYHVHULDOQXPEHUDQGPRGHOQXPEHUDYDLODEOHZKHQFDOOLQJIRUVHUYLFH
Servicing your appliance may require the use of the onboard data port for diagnostics. This gives a GE factory
service technician the ability to quickly diagnose any issues with your appliance and helps GE improve its products
by providing GE with information on your appliance. If you do not want your appliance data to be sent to GE, please
advise your technician not to submit the data to GE at the time of service.
For the period of one year from the date of the original purchase. GE will provide any part of the cooktop which
fails due to a defect in materials or workmanship. During this limited one-year warranty, GE will also provide, free of
charge, all labor and in-home service to replace the defective part.
6WDSOH\RXUUHFHLSWKHUH3URRIRIWKHRULJLQDOSXUFKDVH
date is needed to obtain service under the warranty.
What GE will not cover:
Ŷ Service trips to your home to teach you how to use
the product.
Ŷ Improper installation, delivery or maintenance.
Ŷ Failure of the product if it is abused, misused,
modified or used for other than the intended purpose
or used commercially.
Ŷ Replacement of house fuses or resetting of circuit
breakers.
Ŷ Damage to the product caused by accident, fire,
floods or acts of God.
Ŷ Incidental or consequential damage caused by
possible defects with this appliance.
Ŷ Damage caused after delivery.
Ŷ 3URGXFWQRWDFFHVVLEOHWRSURYLGHUHTXLUHGVHUYLFH
Ŷ Service to repair or replace light bulbs, except for
/('ODPSV
Ŷ ,QVWDOODWLRQRUVHUYLFHIRUDPDNHXSUHSODFHPHQW
air system.
EXCLUSION OF IMPLIED WARRANTIES
<RXUVROHDQGH[FOXVLYHUHPHG\LVSURGXFWUHSDLUDVSURYLGHGLQWKLV/LPLWHG:DUUDQW\$Q\LPSOLHGZDUUDQWLHV
including the implied warranties of merchantability or fitness for a particular purpose, are limited to one year or the
shortest period allowed by law.
This warranty is extended to the original purchaser and any succeeding owner for products purchased for home use
within the USA. If the product is located in an area where service by a GE Authorized Servicer is not available, you
may be responsible for a trip charge or you may be required to bring the product to an Authorized GE Service location
for service. In Alaska, the warranty excludes the cost of shipping or service calls to your home.
Some states do not allow the exclusion or limitation of incidental or consequential damages. This warranty gives you
specific legal rights, and you may also have other rights which vary from state to state. To know what your legal rights
are, consult your local or state consumer affairs office or your state’s Attorney General.
Warrantor: General Electric Company. Louisville, KY 40225
Extended Warranties:3XUFKDVHD*(H[WHQGHGZDUUDQW\DQGOHDUQDERXWVSHFLDOGLVFRXQWVWKDWDUHDYDLODEOHZKLOH
your warranty is still in effect. You can purchase it on-line anytime
www.geappliances.com/service_and_support/shop-for-extended-service-plans.htm
RUFDOOGXULQJQRUPDOEXVLQHVVKRXUV*(&RQVXPHU+RPH6HUYLFHVZLOOVWLOOEHWKHUHDIWHU\RXU
warranty expires.
8
49-80516-3
Try the GE Appliances Website (www.geappliances.com/service_and_support/KRXUVDGD\DQ\GD\RIWKH
year! For greater convenience and faster service, you can now download Owner’s Manuals, order parts or even
schedule service on-line.
Schedule Service: Expert GE repair service is only one
Real Life Design Studio: GE supports the Universal
step away from your door. Get on-line and schedule your
Design concept of products, services and environments
service at www.geappliances.com/service_and_support/
that can be used by people of all ages, sizes and
2UFDOO*(&$5(6GXULQJQRUPDO
capabilities. We recognize the need to design for a wide
business hours.
range of physical and mental abilities and impairments.
For details of GE’s Universal Design applications,
Parts and Accessories: Individuals qualified to service
their own appliances can have parts or accessories sent including kitchen design ideas for people with disabilities,
check out our Website today. For the hearing impaired,
directly to their homes (VISA, MasterCard and Discover
SOHDVHFDOO7''*($&
FDUGVDUHDFFHSWHG2UGHURQOLQHWRGD\KRXUV
HYHU\GD\RUE\SKRQHDWGXULQJQRUPDO
Contact Us: If you are not satisfied with the service you
business hours.
receive from GE, contact us on our Website with all the
Instructions contained in this manual cover procedures
details including your phone number, or write to:
to be performed by any user. Other servicing generally
General Manager, Customer Relations
should be referred to qualified service personnel. Caution GE Appliances, Appliance Park Louisville, KY 40225
must be exercised, since improper servicing may cause
unsafe operation.
Parts and Accessories
To place an order visit us online at:
www.GEApplianceParts.com86RUwww.GEAppliances.ca&DQDGD
or call 800.626.200286800.661.1616&DQDGD
The following parts are available:
Parts
&DVW,URQ%XUQHU*UDWHSN
9HQW*ULOOH
0HGLXP%XUQHU&DS/HIW)URQWDQG5LJKW)URQW
6PDOO%XUQHU&DS/HIW5HDU
/DUJH%XUQHU&DS5LJKW)URQW
%XUQHU&RQWURO.QRE
9HQW&RQWURO.QRE
9HQW)LOWHU
5XEEHU*UDWH)HHW
:%;
:%;
:%;
:%;
:%;
:%;
:%;
:%;
:%7
ASSISTANCE / PARTS AND ACCESSORIES
Have a question or need assistance with your appliance?
Accessories
1*+LJK$OWLWXGH2ULILFH.LW
/3+LJK$OWLWXGH2ULILFH.LW
/32ULILFH/HIW)URQWDQG/HIW5HDU
/32ULILFH5LJKW5HDU
/32ULILFH5LJKW)URQW
:%;
:%;
:%;
:%;
:%;
Cleaning Supplies
&LWUX6KLQH6WDLQOHVV6WHHO:LSHV
&(5$0$%5<7(®6WDLQOHVV6WHHO$SSOLDQFH&OHDQHU
&(5$0$%5<7(®&OHDQLQJ3DGVIRU&HUDPLF&RRNWRSV
&(5$0$%5<7(®&HUDPLF&RRNWRS&OHDQHU
&(5$0$%5<7(®&HUDPLF&RRNWRS6FUDSHU
.LW.LWLQFOXGHVFUHDPDQGFRRNWRSVFUDSHU
:;;
30;
:;;
:;;
:;;
:%;
How to Remove Protective Shipping Film and Packaging Tape
Carefully grasp a corner of the protective shipping film
with your fingers and slowly peel it from the appliance
surface. Do not use any sharp items to remove the film.
Remove all of the film before using the appliance for the
first time.
49-80516-3
To assure no damage is done to the finish of the
product, the safest way to remove the adhesive from
packaging tape on new appliances is an application of
a household liquid dishwashing detergent. Apply with a
soft cloth and allow to soak.
NOTE: The adhesive must be removed from all parts. It
cannot be removed if it is baked on.
9
USING THE COOKTOP: Cooktop Features
Cooktop Features
Throughout this manual, features and appearance may vary from your model.
4
8
4
10
1
2
7
3
6
5
9
1. Vent Grille:6HHSDJH
2. Vent Filter (located under the vent grille):6HHSDJH
3. Simmer Spillproof Burner:6HHSDJHVDQG
4. Spillproof Burners:6HHSDJHVDQG
5. High Power Spillproof Burner:6HHSDJHVDQG
6. Vent Control:6HHSDJH
7. Surface Burner Controls:6HHSDJH
8. Glass Cooktop Surface:6HHSDJHVDQG
9. Cast-Iron Burner Grates:6HHSDJH
10. Vent Grille Gasket:6HHSDJHV
10
49-80516-3
Throughout this manual, features and appearance may vary from your model.
How to Light a Gas Surface Burner
3XVKWKHFRQWURONQREGRZQDQGWXUQLWWRWKHLITE
position.
You will hear a little clicking noise—the sound of the
electric spark igniting the burner.
Turn the knob to adjust the flame size. If the knob stays
at LITE, it will continue to click.
When one burner is turned to LITE, all the burners
spark. Do not attempt to disassemble or clean around
any burner while another burner
is on. An electric shock may
result, which could cause you to
knock over hot cookware.
If the burner has not been used
recently, the flames may make
an excessive noise. This is
normal, and it should dissipate
DIWHUWRPLQXWHV
Push the control knob down
and turn it to the LITE position.
Sealed Gas Burners
7KHVPDOOHUEXUQHUULJKWUHDUSRVLWLRQZLOOJLYHWKHEHVW
simmer results. It offers precise cooking performance for
delicate foods, such as sauces or foods which need to
cook over low heat for a long time. It can be turned down
to a very low simmer setting.
The other burners are higher powered and will bring
liquids to a boil quicker, especially with the use of a lid.
How to Select Flame Size
For safe handling of cookware, never let the flames
extend up the sides of the cookware.
Watch the flame, not the knob, as you reduce heat. The
flame size on a gas burner should match the cookware
you are using.
Any flame larger than
the bottom of the
cookware is wasted
and only serves to
heat the handle.
USING THE COOKTOP: Surface Burners
Surface Burners
In Case of Power Failure
In case of a power failure, you can light the gas surface
burners on your cooktop with a match. Hold a lit match
to the burner, then push in and turn the control knob to
the LITE position. Use extreme caution when lighting
burners this way.
Surface burners in use when an electrical power failure
occurs will continue to operate normally.
IN CASE OF A POWER FAILURE, THE VENTILATION
SYSTEM WILL NOT OPERATE.
Before Lighting a Gas Burner
After Lighting a Gas Burner
Ŷ 0
DNHVXUHDOOEXUQHUKHDGVEXUQHUFDSVDQGJUDWHV
DUHLQWKHLUSURSHUORFDWLRQVVHH%XUQHU&DSV+HDGV
and Electrodes in the Care and cleaning of the
FRRNWRSVHFWLRQ
Ŷ '
RQRWRSHUDWHWKHEXUQHUIRUDQH[WHQGHGSHULRGRI
time without cookware on the grate. The finish on the
grate may chip without cookware to absorb the heat.
Ŷ %HVXUHWKHEXUQHUVDQGJUDWHVDUHFRROEHIRUH\RX
place your hand, a pot holder, cleaning cloths or other
materials on them.
49-80516-3
11
USING THE COOKTOP: Surface Burners / Using The Downdraft Vent System
Wok This Way
We recommend that you use a flat-bottomed wok,
available at your local retail store.
Only a flat-bottomed wok should be used. Do not use a
flat-bottomed wok with a wok holder.
Do not use a flat-bottomed wok on a support ring.
3ODFLQJWKHULQJRYHUWKHEXUQHURUJUDWHPD\FDXVHWKH
burner to work improperly, resulting in carbon monoxide
levels above allowable current standards. This could be
dangerous to your health.
Use a flat-bottomed wok.
Cookware
Aluminum: Medium-weight cookware is recommended
because it heats quickly and evenly. Most foods brown
evenly in an aluminum skillet. Use saucepans with tightfitting lids when cooking with minimum amounts of water.
Stainless Steel: This metal alone has poor heating
properties and is usually combined with copper,
aluminum or other metals for improved heat distribution.
Combination metal skillets usually work satisfactorily if
they are used with medium heat as the manufacturer
recommends.
Cast-Iron: If heated slowly, most skillets will give
satisfactory results.
Enamelware: Under some conditions, the enamel of some
cookware may melt. Follow cookware manufacturer’s
recommendations for cooking methods.
Glass: There are two types of glass cookware—those
for oven use only and those for top-of-range cooking
VDXFHSDQVFRIIHHDQGWHDSRWV*ODVVFRQGXFWVKHDW
very slowly.
Heatproof Glass Ceramic: Can be used for either surface
or oven cooking. It conducts heat very slowly and cools very
slowly. Check cookware manufacturer’s directions to be
sure it can be used on a gas cooktop.
Stove Top Grills
Do not use stove top grills on your sealed gas burners. If
you use the stove top grill on the sealed gas burner it will
cause incomplete combustion and can result in exposure
to carbon monoxide levels above allowable current
standards. This can be hazardous to your health.
Using The Downdraft Vent System
How to Operate the Downdraft Vent System
The built-in vent system helps remove cooking vapors,
odors and smoke from foods prepared on the cooktop.
Turn the vent fan speed control knob to HI, MED or LO,
as needed.
Continuous use of the vent system while cooking helps
keep the kitchen comfortable and less humid, reducing
cooking odors and soiling moisture that normally creates
a frequent need for cleaning.
The appearance of the burner flames may be affected
when the vent fan is operating. At the high fan speed
setting, it is normal for the nearby burner flames to be
drawn toward the vent grille. If cooking performance is
affected, use a lower fan speed setting.
IN CASE OF A POWER FAILURE, THE VENTILATION
SYSTEM WILL NOT OPERATE.
OFF H
I
MED
12
Surface Burners (Cont.)
LO
49-80516-3
%HVXUHHOHFWULFDOSRZHULVRIIDQGDOOVXUIDFHVDUHFRROEHIRUHFOHDQLQJDQ\SDUWRIWKHFRRNWRS
Sealed Burner Assemblies
Turn all controls OFF before
removing the burner parts.
The burner grates, caps and
burner heads can be lifted off,
making them easy to clean.
Grate
Electrode
CAUTION
Do not
operate the burner without all
burner parts in place.
Burner cap
Electrode
Burner head
Burner base
When one burner is turned to LITE, all the
burners spark. Do not attempt to disassemble or
clean around any burner while another burner
is on. An electric shock may result, which could
cause you to knock over hot cookware.
Burner Caps, Heads and Electrodes
Burner Caps
/LIWRIIZKHQFRRO7RFOHDQWKHEXUQHUFDSVZDVKLQKRW
soapy water and rinse with clean water. You may scour
with a plastic scouring pad to remove burned-on food
particles.
Burner Heads
The slits in the burner heads of your cooktop must be
kept clean at all times for an even, unhampered flame.
You should clean the surface burners routinely,
especially after bad spillovers, which could clog these
RSHQLQJV/LIWRIIZKHQFRRO
To clean the burner heads, wash in hot, soapy water and
rinse with clean water.
To remove burned-on food, soak the burner heads in a
VROXWLRQRIPLOGOLTXLGGHWHUJHQWDQGKRWZDWHUIRU±
minutes. For more stubborn stains, use a toothbrush.
Use a small sewing needle or paper clip to remove any
clogs in the slits.
Electrodes
This small metal rod produces the spark and must be
kept clean and dry to properly ignite the gas.
To clean the electrodes, use a dry paper towel or
scrub pad.
After Cleaning
%HIRUHSXWWLQJWKHEXUQHUFDSVDQGKHDGVEDFNVKDNH
out excess water and then dry them thoroughly by
VHWWLQJLQDZDUPRYHQIRUPLQXWHV&KHFNWRPDNH
sure the electrodes remain seated down in burner head.
Replacement
7KHEXUQHUKHDGVDQGEXUQHUEDVHVDUHODEHOHG$%
and C to aid reassembly.
Replace the burner heads on the bases matching the
letters. Replace the caps on the heads. Make sure that
the caps and heads are replaced in the correct location.
7KHUHLVRQHVPDOO$WZRPHGLXP%DQGRQHODUJH
&KHDGDQGFDS,IWKHFDSVRUKHDGVDUHQRWUHSODFHG
in the correct locations, burners may not ignite or
perform properly.
After cleaning, make sure the notch in the burner head is positioned
toward the electrode. Rotate the burner head around the burner base
until it is level and securely seated.
NOTE: Before removing the burner caps and heads, remember their
size and location. Replace them in the same location after cleaning. The
burner heads and burner bases are labeled A, B and C to aid reassembly.
Medium Head
and Cap
Small Head
and Cap
B
B
B
B
A
A
C
Front of Cooktop
Medium Head
and Cap
49-80516-3
CARE AND CLEANING: Cleaning The Cooktop
Cleaning The Cooktop
C
Large Head
and Cap
13
CARE AND CLEANING: Cleaning The Cooktop
Cleaning The Cooktop
Burner Grates, Vent Grille and Gasket
/LIWRIIZKHQFRRO*UDWHVJULOOHDQGJDVNHWVKRXOGEH
washed regularly and, of course, after spillovers.
To clean, wash them in hot, soapy water and rinse with
clean water.
Discoloration on the grates may also be removed by
using the provided cooktop cleaning cream. Apply a drop
or two on a damp cloth and rub across the discolored
area. Rinse and dry. After cleaning, replace the burner
grates and make sure they are positioned securely over
the burners.
To remove burned-on food,
use a soap-filled scouring pad.
Although they are durable, the
grates will gradually lose their
shine, regardless of the best
care you can give them. This is
due to their continual exposure
to high temperatures. You will
notice this sooner with lighter
color grates.
Do not operate a burner for
an extended period of time
Appearance may vary.
without cookware on the
The grate legs have four rubber
burner grate. The finish on
feet. To order replacement rubber
grate feet, see the Assistance /
the grate may chip without
Parts and Accessories section.
cookware to absorb the heat.
Replacement
%HIRUHUHSODFLQJWKHYHQWJULOOHPDNHVXUHWKHJULOOH
gasket is properly installed around the downdraft vent
opening, with the word “FRONT” toward the knobs.
Replace the vent grille carefully over the gasket.
When replacing the grates, make sure the curved sides
of the grates are toward the center.
Grille
Vent Grille Gasket
Vent Filter
Curved Side
of Grate
NOTE: Do not clean the grates, grille or grille gasket in a
self-cleaning oven.
The grates, grille and grille gasket may be cleaned in a
dishwasher.
Vent Filter and Chamber
Remove the vent grille and vent grille gasket. The filter is
KHOGLQSODFHDWDQDQJOHZLWKDKROGEXPS/LIWWKHILOWHU
up and out of the vent opening diagonally.
To clean the filter, swish it in hot, soapy water. Rinse
well with clean water and dry thoroughly.
Do not operate the vent without the filter in place.
Grille
Vent Grille
Gasket
Vent Filter
Vent
Chamber
When replacing the filter, make sure it
rests, at an angle, on the supports in
the vent opening.
To clean the vent chamber, use hot, soapy water. Rinse
with clean water and dry thoroughly. Do not use abrasive
cleaners; they will damage the finish.
Remove and replace the filter diagonally
through the vent opening.
To order replacement filters, see the
Assistance / Parts and Accessories section.
14
Replacement
Replace the filter after it is cleaned and dry. Replace the
vent grille gasket by forming it around the vent opening
and make sure the word “FRONT” is toward the knobs.
Replace the grille.
49-80516-3
Control Knobs
The control knobs may be removed for easier cleaning.
Make sure the knobs are in the OFF positions and pull
them straight off the stems for cleaning.
To clean the knobs, place them in a dishwasher or wash
with soap and water. Rinse with clean water. Make sure
the insides of the knobs are dry before replacing.
Replace the knobs in the OFF position to ensure proper
placement.
Molded flat area
Flat
The control knobs may be removed
for easier cleaning.
Stainless Steel Surfaces (on some models)
Do not use a steel wool pad; it will scratch the surface.
To clean the stainless steel surface, use warm sudsy
water or a stainless steel cleaner or polish. Always wipe
the surface in the direction of the grain. Follow the cleaner
instructions for cleaning the stainless steel surface.
To inquire about purchasing cleaning products including
stainless steel appliance cleaner or polish read the
$VVLVWDQFH3DUWVDQG$FFHVVRULHVVHFWLRQVDWWKH
beginning of this manual.
Cleaning the Glass Cooktop
Normal Daily Use Cleaning
21/<XVH&(5$0$%5<7(® Ceramic Cooktop
Cleaner on the glass cooktop. Other creams may not
be as effective.
To maintain and protect the surface of your glass
cooktop, follow these steps:
%HIRUHXVLQJWKHFRRNWRSIRUWKHILUVWWLPHFOHDQLW
ZLWK&(5$0$%5<7(® Ceramic Cooktop Cleaner.
This helps protect the top and makes cleanup easier.
'DLO\XVHRI&(5$0$%5<7(® Ceramic Cooktop
Cleaner will help keep the cooktop looking new.
5HPRYHWKHEXUQHUJUDWHVYHQWJULOOHDQGYHQWJULOOH
gasket.
6KDNHWKHFOHDQLQJFUHDPZHOO$SSO\DIHZGURSVRI
&(5$0$%5<7(® Ceramic Cooktop Cleaner directly
to the cooktop.
8VHDSDSHUWRZHORU
&(5$0$%5<7(® Cleaning
3DGIRU&HUDPLF&RRNWRSV
to clean the entire cooktop
surface.
8VHDGU\FORWKRUSDSHUWRZHO
to remove all cleaning residue.
No need to rinse.
NOTE: It is very important that
you DO NOT heat the cooktop
Clean your cooktop after each
until it has been cleaned
spill. Use CERAMA BRYTE®
thoroughly.
Ceramic Cooktop Cleaner.
Burned-On Residue
NOTE: DAMAGE to your glass surface may occur if you
use scrub pads other than those recommended.
$OORZWKHFRRNWRSWRFRRO
5HPRYHWKHEXUQHUJUDWHVYHQWJULOOHDQGYHQWJULOOH
JDVNHW6SUHDGDIHZGURSVRI&(5$0$%5<7(®
Ceramic Cooktop Cleaner to the entire burned
residue area.
8VLQJWKHLQFOXGHG&(5$0$%5<7(®&OHDQLQJ3DG
for Ceramic Cooktops, rub the residue area, applying
pressure as needed.
,IDQ\UHVLGXHUHPDLQVUHSHDWWKHVWHSVOLVWHGDERYH
as needed.
49-80516-3
)RUDGGLWLRQDOSURWHFWLRQDIWHUDOOUHVLGXHKDV
been removed, polish the entire surface with
&(5$0$%5<7(® Ceramic Cooktop Cleaner
and a paper towel.
CARE AND CLEANING: Cleaning The Cooktop / Cleaning the Glass Cooktop
Cleaning The Cooktop
Use a CERAMA BRYTE® Cleaning
Pad for Ceramic Cooktops.
15
CARE AND CLEANING: Cleaning the Glass Cooktop
16
Cleaning the Glass Cooktop
Heavy, Burned-On Residue
$OORZWKHFRRNWRSWRFRRO
5HPRYHWKHEXUQHUJUDWHVYHQWJULOOHDQGYHQWJULOOH
gasket.
8VHDVLQJOHHGJHUD]RUEODGHVFUDSHUDWDSSUR[LPDWHO\
DƒDQJOHDJDLQVWWKHJODVVVXUIDFHDQGVFUDSHWKH
soil. It will be necessary to apply pressure to the razor
scraper in order to remove the residue.
$IWHUVFUDSLQJZLWKWKHUD]RUVFUDSHUVSUHDGDIHZGURSV
RI&(5$0$%5<7(® Ceramic Cooktop Cleaner on the
HQWLUHEXUQHGUHVLGXHDUHD8VHWKH&(5$0$%5<7(®
&OHDQLQJ3DGWRUHPRYHDQ\UHPDLQLQJUHVLGXH
)RUDGGLWLRQDOSURWHFWLRQDIWHUDOOUHVLGXHKDVEHHQ
removed, polish the entire surface with CERAMA
%5<7(® Ceramic Cooktop Cleaner and a paper towel.
The CERAMA BRYTE® Ceramic Cooktop Scraper and all recommended
supplies are available through our Parts Center. See Assistance / Parts
And Accessories section.
NOTE: Do not use a dull or nicked blade.
Metal Marks and Scratches
%HFDUHIXOQRWWRVOLGHSRWVDQGSDQVDFURVV\RXUFRRNWRS
It will leave metal markings on the cooktop surface.
7KHVHPDUNVDUHUHPRYDEOHXVLQJWKH&(5$0$%5<7(®
&HUDPLF&RRNWRS&OHDQHUZLWKWKH&(5$0$%5<7(®
&OHDQLQJ3DGIRU&HUDPLF&RRNWRSV
NOTE: Carefully check the bottom of pans for roughness
that would scratch the cooktop.
Damage from Sugary Spills and Melted Plastic
Special care should be taken when removing hot substances to avoid permanent damage of the glass surface.
6XJDU\VSLOORYHUVVXFKDVMHOOLHVIXGJHFDQG\V\UXSVRUPHOWHGSODVWLFVFDQFDXVHSLWWLQJRIWKHVXUIDFHRI\RXU
FRRNWRSQRWFRYHUHGE\WKHZDUUDQW\XQOHVVWKHVSLOOLVUHPRYHGZKLOHVWLOOKRW6SHFLDOFDUHVKRXOGEHWDNHQZKHQ
removing hot substances.
%HVXUHWRXVHDQHZVKDUSUD]RUVFUDSHU
Do not use a dull or nicked blade.
7
XUQRIIDOOVXUIDFHEXUQHUVDQGZLWKDQRYHQPLWW
$
Q\UHPDLQLQJVSLOORYHUVKRXOGEHOHIWXQWLOWKHVXUIDFH
remove hot pans and grates.
of the cooktop has cooled.
:
HDULQJDQRYHQPLWW
'
RQ¶WXVHWKHVXUIDFHXQLWVDJDLQXQWLODOORIWKH
residue
has been completely removed.
a. Use a single-edge razor blade scraper
®
&(5$0$%5<7( &HUDPLF&RRNWRS6FUDSHUWR NOTE: If pitting or indentation in the glass surface has
move the spill to a cool area on the cooktop.
already occurred, the cooktop glass will have to be
replaced. In this case, service will be necessary.
b. Remove the spill with paper towels.
49-80516-3
PGP9830
“If you have questions, call 800.GE.CARES or visit our website at: GEAppliances.com”
IN THE COMMONWEALTH OF MASSACHUSETTS:
TOOLS AND MATERIALS YOU WILL NEED
• This product must be installed by a licensed plumber or
• Saw
• Duct tape
• Measuring tape or scale
• Carpenter’s square
• Adjustable wrench or socket set (7/16” socket and ratchet)
• Drill and drill bit
• 1/4” nut driver
• Sheet metal screws
• Pipe wrench
• Manual gas line shut-off valve
• Pipe joint sealant that resists action of LP gas
• Ductwork to suit the installation
For rigid connection:
• Shut-off valve
• Union
• Pipe fittings as required
For flexible connection where local codes permit:
• Flexible metal tubing (same 3/4” or 1/2” I.D. as gas
supply line)
gas fitter.
• When using ball-type gas shut-off valves, they shall be
the T-handle type.
• A flexible gas connector, when used, must not exceed
3 feet.
BEFORE YOU BEGIN
Read these instructions completely and carefully.
•
•
IMPORTANT – Save these instructions for local
inspector’s use.
IMPORTANT –
Observe all governing codes
and ordinances.
• Note to Installer – Be sure to leave these instructions
with the Consumer.
• Note to Consumer – Keep these instructions for future
reference.
• Unless very knowledgeable in the installation of this
product, engage a professional installer.
• Proper installation is the responsibility of the installer.
• Product failure due to improper installation is not
covered under the Warranty.
FOR YOUR SAFETY
If You Smell Gas:
1. Open windows.
2. Don’t touch any electrical switches.
3. Extinguish any open flame.
4. Immediately call your gas supplier.
Do not store or use gasoline or other flammable vapors
and liquids in the vicinity of this or any other appliance.
INSTALLATION INSTRUCTIONS
Installation Gas Downdraft Cooktop
Instructions
HIGH ALTITUDE ORIFICE CONVERSION KIT
Use for cooktop operation at elevations above 5000 ft.
(1500m).
Specify kit for Natural Gas or LP Gas when ordering:
Natural Gas High Altitude
Orifice Conversion Kit . . . . . . . . . . . . . . . . . . . . . . . .WB28X10114
LP High Altitude Orifice Conversion Kit . . . . . . .WB28X10115
To order, please call our toll-free number:
National Parts Center. . . . . . . . . . . . . 800.626.2002
WARNING –
Before beginning the installation,
switch power off at the service panel and lock the service
disconnecting means to prevent power from being switched
on accidentally. When the service disconnecting means
cannot be locked, securely fasten a prominent warning
device, such as a tag, to the service panel.
49-80516-3
17
INSTALLATION INSTRUCTIONS
Installation Instructions
IMPORTANT SAFETY INSTRUCTIONS
IMPORTANT SAFETY INSTRUCTIONS
The cooktop has been design certified by Underwriters
Laboratories (UL). As with any appliance using gas and
generating heat, there are certain safety precautions you
should follow. You’ll find these precautions in the Important
Safety Information section in the front of this Owner’s Manual.
Read them carefully.
• Be sure your cooktop is installed properly by a qualified
installer or service technician.
• The cooktop must be electrically grounded in accordance
with local codes, or in their absence, with the National
Electrical Code ANSI/NFPA No. 70 – Latest Edition.
• Installation of this cooktop must conform with local codes,
or in the absence of local codes, with the National Fuel Gas
Code ANSI Z223.1/NFPA 54 – Latest Edition.
• Improper installation, adjustment, alteration, service or
maintenance can cause injury or property damage. Refer to
this manual. For assistance or additional information, consult
a qualified installer, service agency, manufacturer (dealer) or
the gas supplier.
• Disconnect electrical supply before servicing.
• Never reuse old flexible connectors. The use of old flexible
connectors can cause gas leaks and personal injury. Always
use NEW flexible connectors when installing a gas appliance.
• Make sure the wall coverings around the cooktop can
withstand heat generated by the cooktop up to 200°F.
• Avoid placing cabinets above the cooktop.
• If cabinets are placed above the cooktop, allow a minimum
clearance of 30" between the cooking surface and the
bottom of unprotected cabinets.
• If cabinets are placed above the cooktop, use cabinets no
more than 13" deep.
• If a 30" clearance between cooking surface and overhead
combustible material or metal cabinets cannot be
maintained, protect the underside of the cabinets above
the cooktop with not less than 1/4" insulating millboard or
gypsum board at least 3/16" thick covered with 28 gauge
sheet steel or 0.020" thick copper.
• Clearance between the cooking surface and protected
cabinets MUST NEVER BE LESS THAN 24” The vertical
distance from the plane of the cooking surface to the bottom
of adjacent overhead cabinets extending closer than 1" to
the plane of the cooktop sides must not be less than 18”
EXHAUST BLOWER RATINGS
EXHAUST BLOWER SAFETY WARNING
Sufficient air is needed for proper combustion and exhausting of gases through the flue (chimney) of fuel burning equipment to
prevent back drafting. Follow the heating equipment manufacturer’s guide lines and safety standards, such as those published by
the National Fire Protection Association (NFPA), the American Society for Heating, Refrigeration and Air Conditioning (ASHRAE) and
the local code authorities. when applicable, install any make up (replacement) air system in accordance with local building code
requirements. Visit GEAppliances.com for available makeup air solutions.
18
49-80516-3
PARTS INCLUDED
Check to be sure that all packing materials and
tape have been removed. This will include tape on
control knobs (if applicable), adhesive tape, wire
ties, cardboard and protective plastic. Failure to
remove these materials could result in damage to
the appliance once the appliance has been turned
on and surfaces have heated.
CAUTION:
GLASS IS FRAGILE
DO NOT BUMP EDGE
OF GLASS DURING
INSTALLATION
Reflective
Tape
Sheet Metal Screws (9)
(8-18 x 3/8”)
Cleaning Cream
Scrub Sponge
Vent Grille
Burner Grate (2)
Regulator
Burner Caps and Burner Heads
Burner Cap and
Burner Head
CAUTION:
DO NOT LIFT
FROM VENT
OPENING OR
BUMP GLASS
INSTALLATION INSTRUCTIONS
Installation Instructions
Blower Plenum
Burner Cap and
Burner Head
Vent Filter
Blower Assembly and (4) Mounting
Nuts (10-32 keps – nuts with lock
washers attached)
Vent Grille Gasket
Foam Gasket Tape
30" COOKTOP (DIMENSIONS FOR REFERENCE ONLY)
Unit shown fully assembled.
217ø8”
(2115ø16”SS)
2923ø32”
(2913ø16”SS)
23ø16”
(21ø4”SS)
22"
201ø2”
283ø4”
Unit must be vented to the outside!
49-80516-3
19
INSTALLATION INSTRUCTIONS
Installation Instructions
CABINET PREPARATION
1 PREPARING FOR INSTALLATION
Positioning the cooktop
The cooktop is designed to look best when centered in a
cabinet at least 30" wide.
The exhaust vent beneath the cooktop must be located
between wall studs or floor joists so that the ductwork may
be installed properly.
13" max.
depth of
unprotected
overhead
cabinets
30" min. clearance
from countertop
to unprotected
overhead surface
18" min. height
from countertop to
nearest cabinet on
either side of the unit
5" min. clearance
from cutout to
side walls
The downdraft system with blower, motor and ductwork will
occupy the cabinet below the cooktop. Drawers cannot be
installed below this cooktop.
Avoid placing cabinets above the cooktop unit, if possible,
in order to reduce the hazards caused by reaching over
heated surface units.
If the cabinetry is used above the cooktop, allow a minimum
30" clearance between the cooking surface and the bottom
of the unprotected cabinet.
If the clearance between the cooktop and the cabinetry is
less than 30", the cabinet bottom must be protected with
a flame retardant millboard at least 1/4" thick, or gypsum
board at least 3/16" thick, covered with 28 gauge sheet steel
or 0.020" thick copper. Clearance between the cooktop and
the protected cabinetry MUST NEVER BE LESS THAN 24 ".
EXCEPTION: Installation of a listed microwave oven or
cooking appliance over the cooktop shall conform to the
installation instructions packed with that appliance.
Working areas adjacent to the cooktop should have an
18" minimum clearance between the countertop and the
bottom of the cabinet. If the clearance is less than 18”, the
adjacent cabinets should be at least 5” from the side edge
of the cooktop.
20
2 PREPARING THE BASE CABINET
This cooktop is designed to fit easily into a variety of
cabinets. However, the combined installation of a downdraft
vent and a cooktop require careful consideration.
Some cabinets may require modifications.
This installation requires a 24” min. deep cabinet base.
The cabinet must be at least 30” wide.
Preparing a cabinet that is against a wall
In some cabinets, the sides may need to be scooped or cut
down 53ø4” as shown, and the corner braces removed in
order to accommodate the unit.
In 75 cm and 90 cm frameless European cabinets,
the back panel may need to be cut down 53ø4” to
accommodate the unit.
Preparing a peninsula or island-type cabinet
In a peninsula or island type cabinet, the sides may need to
be scooped or cut down, and the corner braces removed in
order to accommodate the unit.
53ø4” Approx.
for European
cabinets
53ø4”
Approx.
49-80516-3
CABINET PREPARATION CUTOUTS
3 PREPARING THE COUNTERTOP
4 PREPARING FOR DUCTWORK
The countertop must have a deep flat surface to
accommodate the cooktop and the vent. Countertops
with a rolled front edge and backsplash may not provide
the flat surface area required.
25” min. flat surface area required
Clearance between inside front of cabinet and rear of
countertop cutout must be 205ø8” in order to accommodate
cooktop depth.
205ø8”
23ø8” min.
NOTE: Ductwork MUST be vented to outside. DO NOT vent
into a wall, ceiling, crawlspace, attic or any concealed space.
Cut hole in cabinet wall or floor as appropriate for your
installation. Make sure exhaust duct is located between wall
studs or floor joists.
NOTE: When cutting or drilling into wall or ceiling, do
not damage electrical wiring and other hidden utilities.
Make sure that any opening/cutout in the wall behind
the appliance and in the floor under the appliance are
sealed properly.
91ø8”
101ø8”
17ø8” min.
Downward Venting
Rear Wall Venting
A 1/2” wide flat area is required around the edge of opening
for support of the unit. The cooktop unit must be level and
sit squarely into countertop opening.
Carefully cut countertop opening according to the
dimensions shown in the illustration. Be sure that opening
is cut squarely, with sides parallel to each other and rear
exactly perpendicular to sides.
205ø8”
25”
61ø8”
183ø4”
INSTALLATION INSTRUCTIONS
Installation Instructions
287ø8”
1 ø ” min.
78
5 BLOWER TO DUCTWORK ALIGNMENT
In general, the use of flexible ducting is discouraged
because it can cause severely restricted airflow. However,
if the blower outlet and the floor or wall duct location do
NOT align well, then flexible METAL ducting can be used to
adapt to an offset. Good alignment without use of flexible
ducting is best.
NOTE:
• Do not exceed the maximum recommended offset of 6”.
• Do not allow the flexible ducting to kink or collapse.
• Do stretch the flexible ducting as much as possible to
eliminate as much of the corrugation as possible.
For island installation, maintain 1 7/8” minimum from cutout
to front edge; 2 3/8” minimum from cutout to back edge; and
5” minimum from cutout to side edges of countertop.
6" Max.
Centerline
to
Centerline
Offset
Bottom Venting
Back Venting
(Requires 31ø4” x 10")
A 31ø4” x 10” rectangle to 6” round transition duct is available
at your local building supply store.
NOTE: Illustrations are for planning purposes only.
49-80516-3
21
INSTALLATION INSTRUCTIONS
Installation Instructions
DESIGN INFORMATION
6 PREPARE FOR DUCTWORK
Determine the best route for ductwork; it can be routed in a
variety of ways depending on the kitchen layout.
IMPORTANT: The downdraft air discharge outlet for this unit is
øµ[µUHFWDQJXODU3ODQGXFWLQJDFFRUGLQJO\
Typical duct arrangement countertop series.
Outside wall
cabinet
Inside wall
cabinet
To maximize the ventilation performance of the vent system:
1. Minimize the duct run length and number of transitions
and elbows.
2. Maintain a constant duct size.
3. Seal all joints with duct tape to prevent any leaks.
4. Do not use any type of flexible ducting.
Up inside wall to roof or
overhang
Directly to outside
Peninsula
Peninsula or island
If needed, install any make up (replacement) air system in
accordance with local building code requirements. Visit
GEAppliances.com for available makeup air solutions.
Between floor joists
Through cabinet toe space
Optional duct arrangement under concrete slab.
PVC duct should be used if installing under a
poured concrete slab.
NOTE: PVC sewer pipe type PSM 12454-B
Schedule 40 ASTM D1785.
6″ (15 cm)
Dia. 90°
Metal Elbow
Wall Cap
6″ (15 cm) Dia.
Metal Duct
16″
(40.6 cm)
Max.
12″
(30 cm)
Min.
6″ (15 cm)
Dia. PVC
Sewer Pipe
6″
(15 cm)
Dia.
PVC
Coupling
6″
(15 cm)
Dia. PVC
Coupling
6″ (15 cm) Dia.
PVC Sewer Pipe
Elbow
3-1/4″ x 10″ Rectangular
to 6″ Round Transition
6″ (15 cm)
Dia. Metal
Duct
Concrete
Slab
30′-0″ (9.14 m) Max.
Pack tightly with gravel
or sand completely
around pipe
• Install ductwork so the piece of duct nearest the downdraft
unit slots INTO the next piece of the duct. Secure the joints
with self-tapping screws and apply duct tape around the
joints to ensure an airtight seal.
6″ (15 cm) Dia.
PVC Sewer Pipe
Elbow
6″ (15 cm)
Dia. PVC
Sewer
Pipe
Duct Tape
Over Seam and Screw
Air
Flow
Screw
22
49-80516-3
POWER SUPPLY LOCATIONS
7 GAS SUPPLY:
These cooktops are designed to operate on natural gas at
4” of water column pressure or on LP gas at 10” of water
column pressure.
• These cooktops are shipped from the factory set for
natural gas. If you decide to use this cooktop with LP
gas, conversion adjustments must be made by a service
technician or other qualified person.
• The pressure regulator must be connected in series with
the manifold of the cooktop and must remain in series
with the supply line regardless of type of gas being used.
For proper operation, the maximum inlet pressure to
the regulator must be no more than 10” water column
pressure for natural gas and 14” water column pressure
for LP gas.
• When checking the regulator, the inlet pressure must be
at least 1” greater than the regulator output setting. If
the regulator is set for 4” of water column pressure, the
inlet pressure must be at least 5”. If the regulator is set
for 10” of water column pressure, the inlet pressure must
be at least 11”. For ease of installation, and if local codes
permit, the gas supply line into the cooktop should be 1/2”
or 3/4” ID flexible metal appliance connector, three to five
feet long.
NOTE: Purchase a new flexible line. DO NOT USE AN OLD
PREVIOUSLY USED LINE.
• Make gas connection through rear wall, or on cabinet floor
at rear, as illustrated.
49-80516-3
8 ELECTRICAL SUPPLY:
29 1ø2”
2”
min
3”
min
CL
Gas pipe
location
Electrical
outlet 12”
above cabinet
floor (mount
on side or
back cabinet
wall 2” min.
from
centerline)
INSTALLATION INSTRUCTIONS
Installation Instructions
4" (to clear toe kick area)
The built-in gas downdraft cooktop features pilotless electric
ignition for energy savings and reliability. It operates on a
120-volt, 60-Hz power supply. A separate circuit, protected
by a 15-amp time-delay fuse or circuit breaker, is required.
• A properly grounded 3-prong receptacle should be located
within reach of cooktop’s four foot power cord.
IMPORTANT: (Please read carefully.) FOR PERSONAL
SAFETY, THIS APPLIANCE MUST BE PROPERLY GROUNDED.
The power cord of this appliance is equipped with a
three-prong (grounding) plug which mates with a standard
three-prong grounding wall receptacle to minimize the
possibility of electric shock hazard from this appliance.
The customer should have the wall receptacle and circuit
checked by a qualified electrician to make sure the
receptacle is properly grounded and has correct polarity.
Where a standard two-prong wall receptacle is
encountered, it is the personal responsibility and obligation
of the customer to have it replaced with a properly
grounded three-prong wall receptacle.
Do Not, Under Any Circumstances, Cut Or Remove The
Third (ground) Prong From The Power Cord.
Do not use an extension cord.
23
INSTALLATION INSTRUCTIONS
Installation Instructions
UNPACKING THE COOKTOP/INSTALLING THE GASKET
9 INSTALLING THE FOAM GASKET AND
REFLECTIVE TAPE
CAUTION:
Potential risk of fire – reflective tape
must be secured around countertop opening as shown.
Do not install the cooktop into the countertop without
installing the foam gasket as shown. It protects the bottom
edge of the glass from the countertop and seals the cooktop
against spills.
Remove the cooktop along with its shipping pad from
the shipping box. Remove the shipping block from the
downdraft vent opening and place it under the shipping pad
to provide level support.
Foam Gasket Installation Notes:
• The foam gasket tape should be installed within 1/8” of
the edge of the glass. Do not stretch or twist the foam
gasket tape.
CAUTION:
Failure to install foam gasket tape
greatly increases the potential of breaking the cooktop
glass when installing, especially in Corian® or granite
countertops.
• Use care not to stretch the foam gasket tape while it is
installed or it will not stay in place.
• Do not place foam gasket tape over the metal flanges.
• But the foam gasket tape ends together at each corner
without overlapping.
• Trim the foam gasket tape to length without stretching.
• Mitre cut outside corners of foam gasket tape slightly if
necessary for appearance.
Center vent shipping block –
place under the shipping pad to
provide level support
CAUTION:
GLASS IS FRAGILE. DO NOT BUMP
EDGE OF GLASS DURING INSTALLATION.
Locate the reflective tape and foam gasket tape included
with your cooktop.
Underside
of Glass
Foam
Gasket
Tape
1ø8” max. to
Glass Edge
Smooth rough edges of the cutout. Install reflective tape to
the opening, along the inside and 3/8” to 1/2” of the opening
edge.
• Do not scratch the glass while cutting the foam gasket tape.
Place reflective tape
within 1/2" of cutout
Reflective tapetop
and vertical sides
Peel off the white backing to install the foam gasket tape on
the bottom side of the cooktop glass as shown.
24
49-80516-3
INSTALLING THE COOKTOP
10 INSTALLING THE COOKTOP:
CAUTION:
DO NOT LIFT FROM
VENT OPENING.
11 INSTALLING THE OPTIONAL
INSTALLATION BRACKETS
NOTE: Check for glass flatness in Step 9 before installing
optional installation brackets.
Optional installation
bracket and thumb
screw (not included)
Lift the cooktop by the glass side edges as shown.
NOTE: Do not use the glass top vent opening to lift or move
the cooktop into position.
Lower the cooktop into the countertop opening, guiding it
LQWRSRVLWLRQ*ODVVLVIUDJLOH³GRQRWDOORZLWWRGURSRQWRWKH
countertop. Support from the underside and lower slowly.
Carefully remove your fingers one corner at a time to lower
the cooktop into position.
NOTE: Do not use Silicone RTV or caulk to bond cooktop
glass to countertop.
Once the unit is placed in countertop; visually inspect the
cooktop and counter, appearance or alignment concerns.
49-80516-3
Cooktop
Screws supplied with
cooktop
Countertop
Thumb screw
INSTALLATION INSTRUCTIONS
Installation Instructions
To order optional installation brackets/thumb screws, call the
National Parts Center at 800.626.2002.
Order two of each part: WB02X11331 Bracket
WB01X10353 Screw
To install optional installation brackets:
Remove 2 screws on both sides under cooktop.
Align optional installation bracket under cooktop and reinstall
screws through the slot in the bracket. Do this on both sides of
the cooktop.
Thread the thumb screw through the hole in the bracket and
tighten to secure the cooktop to the countertop. Repeat on the
other side.
IMPORTANT: Turn thumb screw until it touches the bottom of
the countertop. Do not overtighten.
25
INSTALLATION INSTRUCTIONS
Installation Instructions
INSTALLING THE COOKTOP
12 INSTALLING THE BLOWER PLENUM
13 INSTALLING THE BLOWER
Slide the plenum, with the blower opening on the left, into
the opening in the bottom of the cooktop. Push up on the
plenum until the stops on the plenum contact the bottom of
the cooktop, and snap the plenum into place. (You may have
to move the plenum back and forth to work it into place.)
Orient the blower discharge opening to match the ductwork
in Steps 5 and 6. Slide the four threaded studs on the side
of the blower housing into the four holes on the side of the
plenum.
NOTE: See Step 13 for installing the transition duct to the
blower. It may be easier to install the transition duct to the
blower before installing the blower to the plenum.
TO THE COOKTOP
Install 2 screws
TO THE PLENUM
Install 4 screws
Secure the plenum to the bottom of the cooktop, on each
side, using the four (4) screws provided. Further secure the
plenum to the cooktop, from the top side, using the two
screws (2) provided.
From the vent opening in the top of the cooktop, fasten the
blower assembly securely to the plenum with four (4) nuts.
4 Nuts
(7/16”
socket
required)
26
49-80516-3
INSTALLING THE COOKTOP
14 ATTACHING A BLOWER
• Connect the 5-pin plug on the blower assembly to the
matching 5-pin receptacle on the bottom of the cooktop.
TRANSITION DUCT
Use a blower transition duct for all downward duct
installations to connect to 6” round standard ductwork. This
31ø4” x 10” rectangle to 6” round transition duct is available at
your local building supply store.
Screws
5-pin
connectors
Screw
(on other
side)
Install the transition duct to the blower outlet. Secure all
joints with duct tape to assure an airtight seal.
• Fold all wires into the electrical enclosure. Secure the
enclosure with the screws removed earlier, making sure
that no wires are trapped.
5-pin
connectors
15 BLOWER ELECTRICAL CONNECTIONS
Electrical
enclosure
• Loosen the two screws and remove and discard the sheet
metal strap covering the 5-pin connector on the cooktop
bottom. Save the screws for reinstallation later.
Remove
screws and
discard strap
49-80516-3
INSTALLATION INSTRUCTIONS
Installation Instructions
Flexible
conduit
16 CONNECTING THE DUCTWORK
Connect the ductwork prepared in Steps 5 and 6
to the blower.
27
INSTALLATION INSTRUCTIONS
28
Installation Instructions
INSTALLING THE COOKTOP
17 INSTALL THE PRESSURE REGULATOR
Regulator
Solid piping or
flexible connector
Union
Solid piping
or flexible
connector
Shut-off
valve
Pipe stub
• For all connections, use a pipe sealant approved by local
codes and resistant to the activity of LP gas.
• Install the pressure regulator in the gas line as close to the
cooktop inlet as possible to allow clearance for ventilation
ducting.
• Make sure the arrow on the body of the regulator is
pointing straight up and toward the cooktop. Any other
position will affect the output pressure of the regulator. This
arrow indicates correct flow of gas.
• Install a manual gas line shut-off valve in an easily
accessible location.
NOTE: Instead of using solid piping to connect to pressure
regulator, an approved flexible metal appliance connector
may be used between the shut-off valve and the pressure
regulator, if local codes permit.
Appropriate flare nuts and adapters are required at each
end of the flexible connector.
TEST FOR LEAKS
WARNING:
DO NOT USE A FLAME TO
CHECK FOR GAS LEAKS! Do not use the cooktop until all
connections have been leak tested.
Perform leak test per the following instructions:
1. Purchase a liquid leak detector or prepare a soap solution
of one part water, one part liquid detergent.
2. When all connections have been made, make sure all
cooktop controls are turned to OFF and turn the gas supply
valve to ON.
3. Apply the liquid leak detector or the soap solution around
all connections from the shut-off valve to the cooktop.
4. A leak is identified by a flow of bubbles from the area of
the leak.
5. If a leak is detected, turn the gas supply off. Tighten the
fitting. Turn the gas on and test again.
If the leak persists, turn the gas supply off and contact
your dealer for assistance. Do not attempt to operate the
cooktop if a leak is present.
IMPORTANT: Disconnect the cooktop and the individual
shut-off valve from the gas supply piping system during any
pressure testing of that system at test pressures greater
than 1/2 psig. Isolate the cooktop from the gas supply piping
system by closing the individual manual shut-off valve to the
cooktop during any pressure testing of the gas supply piping
system at test pressures equal to or less than 1/2 psig.
49-80516-3
INSTALLING THE COOKTOP
18 ELECTRICAL REQUIREMENTS
120-volt, 60-Hertz, properly grounded branch circuit
protected by a 15-amp or 20-amp circuit breaker or
time-delay fuse.
EXTENSION CORD CAUTIONS
Because of potential safety hazards associated with certain
conditions, we strongly recommend against the use of an
extension cord. However, if you still elect to use an extension
cord, it is absolutely necessary that it be a UL-listed, 3-wire
grounding-type appliance extension cord and that the
current carrying rating of the cord in amperes be equivalent
to, or greater than, the branch circuit rating.
An adapter may be used only on a 15-amp circuit. Do not use
an adapter on a 20-amp circuit. Where local codes permit,
a TEMPORARY CONNECTION may be made to a properly
grounded two-prong wall receptacle by the use of a UL-listed
adapter, available at most hardware stores. The larger slot in
the adapter must be aligned with the larger slot in the wall
receptacle to provide proper polarity in the connection of the
power cord.
Temporary Method
(Adapter plugs not permitted in Canada)
GROUNDING
,03257$17³(Please read carefully.)
Align large prongs/slots
INSTALLATION INSTRUCTIONS
Installation Instructions
FOR PERSONAL SAFETY, THIS APPLIANCE MUST BE
PROPERLY GROUNDED.
Preferred Method
Ensure proper ground
and firm connection
before use
Ensure proper ground
exists before use
The power cord of this appliance is equipped with a
three-prong (grounding) plug which mates with a standard
three-prong grounding wall receptacle to minimize the
possibility of electric shock hazard from this appliance.
The customer should have the wall receptacle and circuit
checked by a qualified electrician to make sure the
receptacle is properly grounded.
Where a standard two-prong wall receptacle is encountered,
it is the personal responsibility and obligation of the customer
to have it replaced with a properly grounded three-prong
wall receptacle.
CAUTION:
Attaching the adapter ground
terminal to the wall receptacle cover screw does not
ground the appliance unless the cover screw is metal, not
insulated, and the wall receptacle is grounded through
the house wiring. The customer should have the circuit
checked by a qualified electrician to make sure the
receptacle is properly grounded.
When disconnecting the power cord from the adapter,
always hold the adapter with one hand. If this is not done, the
adapter ground terminal is very likely to break with repeated
use. Should this happen, DO NOT USE the appliance until a
proper ground has again been established.
DO NOT, UNDER ANY CIRCUMSTANCES, CUT OR
REMOVE THE THIRD (GROUND) PRONG FROM THE
POWER CORD.
49-80516-3
29
INSTALLATION INSTRUCTIONS
Installation Instructions
FINAL ASSEMBLY
19 ASSEMBLE BURNERS, CHECK IGNITION
Assemble burner as shown.
Grate
• Check to determine if your burner flames are normal. If
your burner flames look like A, turn off the burner and
make sure all parts are assembled correctly. Reassemble
and check. Normal burner flames should look like B or C
depending on the type of gas you use. With LP gas, some
yellow tipping on the outer cones is normal.
Curved side
toward the
center
Burner cap
Electrode
A–Yellow flames
Call for service
Burner head
Burner base
CAUTION: Do not operate the burner without all
B–Yellow tips
on outer cones
Normal for LP gas
C–Soft blue
flames Normal
for natural gas
• Turn knob to OFF.
• Repeat the procedure for each burner.
burner parts in place.
Medium
Head
and Cap
Small
Head
and Cap
Medium
Head
and Cap
Front of Cooktop
Large
Head
and Cap
Place the burner heads on the burner bases matching the
letters. Place the caps on the heads. Make sure that the
heads and caps are placed on the correct size burner. The
burner heads and burner
bases are labeled A, B and C
to aid reassembly. There is one
small (A), two medium (B) and
one large (C) head and cap.
Make sure the notch in the
burner head is positioned
toward the electrode. Rotate
the burner head around the burner base until it is level and
securely seated.
Place the grates over the burners.
Check for proper ignition:
• Push in one control knob and turn to LITE position.
• The igniter will spark and the burner will light; the igniter
will cease sparking when the burner is lit.
• First test may require some time, while air is flushed out of
the gas line.
30
49-80516-3
FINAL ASSEMBLY
20 INSTALL DOWNDRAFT FILTER, VENT
GASKET AND VENT GRILLE
Do not operate the vent without the filter in place.
• Place the filter diagonally through the vent opening.
Vent Filter
Vent
Chamber
INSTALLATION INSTRUCTIONS
Installation Instructions
• Make sure it rests, at an angle, on the supports in the vent
opening.
• Fit the vent grille gasket around the edge of the downdraft
vent opening. Make sure the front of the gasket is installed
toward the front of the cooktop.
• Carefully place the vent grille onto the gasket on the
downdraft opening.
Grille
Vent Grille
Gasket
CHECK OPERATION OF DOWNDRAFT
• Turn the vent fan speed control to HI, MED and LO to
make sure all speeds operate correctly.
49-80516-3
31
Notes
32
49-80516-3
Notes
49-80516-3
33
Notes
34
49-80516-3
Save time and money! Review the charts on the following pages first and you may not need to call for service.
Problem
Possible Cause
Water won’t boil
Burners have yellow
or yellow-tipped
flames
What To Do
Cover pan with a lid. Turn the downdraft fan OFF until the
water begins to boil.
The combustion quality of burner
flames needs to be determined
visually.
Use the illustrations below to determine if your burner
flames are normal. If burner flames look like A, call for
VHUYLFH1RUPDOEXUQHUIODPHVVKRXOGORRNOLNH%RU&
GHSHQGLQJRQWKHW\SHRIJDV\RXXVH:LWK/3JDVVRPH
yellow tipping on outer cones is normal.
A–Yellow flames
Call for service
B–Yellow tips
on outer cones
Normal for LP gas
C–Soft blue
flames Normal
for natural gas
Burner parts not replaced correctly.
See Care and cleaning of the cooktop section.
Plug on cooktop is not completely
inserted in the electrical outlet.
Make sure electrical plug is plugged into a live, properly
grounded outlet.
Gas supply not connected or
turned on.
See the Installation Instructions section.
A fuse in your home may be blown
or the circuit breaker tripped.
Replace the fuse or reset the circuit breaker.
Igniter orifice in burner body may
be clogged.
Remove the obstruction.
Burner parts not replaced correctly.
6HH%XUQHU&DSV+HDGVDQG(OHFWURGHVLQWKH&DUHDQG
cleaning of the cooktop section.
Notch in burner head may be
clogged.
Use a small sewing needle or paper clip to unplug.
Sparking sound
persists after burner is
turned off
Be sure the knob is in the OFF
position.
Remove knob by pulling it straight off the stem and check
the bottom of the knob for any buildup of soil.
Occasional sparking
sound
Changing blower speed.
This is a typical electrical switching noise. This is normal.
Burner flames very
large or yellow
Improper air to gas ratio.
,IFRRNWRSLVFRQQHFWHGWR/3JDVFRQWDFWWKHSHUVRQZKR
installed your cooktop or made the conversion.
Notch in burner head may be
clogged.
Use a small sewing needle or paper clip to unplug.
Burner flames make
excessive noise
Burner has not been used recently.
A “cold” burner ignited in the HI setting may have some
IODPH³URDU´RU³OLIWLQJ´7KLVVKRXOGGLVVLSDWHDIWHUWR
minutes.
Burner flames pulled
toward vent grille
Vent fan set at high speed.
This is normal. If cooking performance is affected, change
to a lower fan speed setting.
Burners do not light
49-80516-3
TROUBLESHOOTING TIPS
Troubleshooting tips ... Before you call for service
35
TROUBLESHOOTING TIPS
Troubleshooting tips ... Before you call for service
Problem
Possible Cause
What To Do
Control knobs will not
turn
Controls improperly set.
To turn from the OFF position, push the knob in and then
turn. The knob can only be turned in a counterclockwise
direction. When the knob is at any other position, it can
be turned in either direction without being pushed in.
Fan does not work
Poor venting
Tiny scratches or
metal marks (may
appear as cracks) or
abrasions on radiant
cooktop glass surface
The fan control knob is improperly set.
Turn knob in clockwise direction to turn fan on.
Cord improperly connected or power
turned off.
Check connections. Turn on power at the fuse box.
Clogged filter.
Clean filter per instructions.
House too airtight.
Open a window slightly to provide fresh air source.
Wall cap obstructed.
Remove blockage from exterior wall cap.
Wall cap damper door stuck.
Check exterior wall cap damper door for free
movement or obstruction.
Duct length exceeds recommended 100
equivalent foot maximum.
Reduce number of elbows to simplify duct run.
Incorrect cleaning methods being used.
See the Cleaning the glass cooktop section.
Cookware with rough bottoms being
used or coarse particles (salt or sand)
were between the cookware and the
surface of the cooktop.
%HVXUHFRRNZDUHERWWRPVDQGFRRNZDUHDUHFOHDQ
before use. Use cookware with smooth bottoms. Tiny
scratches are not removable but will become less
visible in time as a result of cleaning.
Cookware has been slid across the
cooktop surface.
Areas of discoloration
or dark streaks on the
cooktop
36
Improper cookware being used.
Marks from aluminum and copper pans as well as
mineral deposits from water or food can be removed
with the cleaning cream.
Hot surface on a model with a lightcolored cooktop.
This is normal. The surface may appear discolored
when it is hot. This is temporary and will disappear as
the glass cools.
Food spillovers not cleaned before next
use.
See the Cleaning the glass cooktop section.
Incorrect cleaning methods being used.
Use recommended cleaning procedures.
Hot sugar mixtures or
plastic melted to the
surface
Hot cooktop came into contact with these
substances.
See the Glass surface—potential for permanent damage
section in the Cleaning the glass cooktop section.
Pitting (or indentation)
of the cooktop
Hot sugar mixture spilled or plastic melted
on the cooktop.
Call a qualified technician for replacement.
49-80516-3
de gas de ventilación descendente (downdraft)
Estufa
GEAppliances.com
Información De Seguridad . . . . 2
Garantía . . . . . . . . . . . . . . . . . . . . . . . . . . 8
Asistencia /
Piezas y Accesorios . . . . . . . . . . . . . 9
Manual del propietario
e instalación
PGP9830
PGP989
Uso de la placa de cocción
Funciones de la Placa de Cocción . . . 10
Quemadores . . . . . . . . . . . . . . . . . . . . . . . 11
Cómo Usar El Sistema
De Ventilación Descendente . . . . . . 12
Cuidado Y Limpieza
Limpieza de la Placa de Cocción . . . . 13
Cómo Limpiar la Estufa de Vidrio. . . . 15
Instrucciones de Instalación. . 17
Consejos para la Solución
de Problemas . . . . . . . . . . . . . . . . . 35
Escriba el modelo y los números de
serie a continuación:
Modelo No: ___________________
Serie No: ______________________
Encuentre estos números en una
etiqueta debajo de la estufa, en el
lado de la cámara de ventilación.
49-80516-3 02-15 GE
INFORMACIÓN DE SEGURIDAD
INFORMACIÓN IMPORTANTE DE SEGURIDAD
LEA TODAS LAS INSTRUCCIONES ANTES DE USAR
ADVERTENCIA
Lea todas las instrucciones de seguridad antes de utilizar este producto. No seguir estas instrucciones puede
generar un incendio, una descarga eléctrica, lesiones corporales o la muerte.
ADVERTENCIA: Si no se sigue
con precisión la información en este manual,
un incendio o explosión puede resultar
causando daños a la propiedad, heridas
personales o muerte.
— No guarde ni use gasolina u otros vapores
o líquidos inflamables cerca de este o
cualquier otro aparato.
—
SI HUELE A GAS
Ŷ No trate de encender ningún aparato.
Ŷ No toque ningún interruptor eléctrico; no
use ningún teléfono en su edificio.
Ŷ Llame inmediatamente a su abastecedor
de gas del teléfono de su vecino. Siga las
instrucciones del abastecedor de gas.
Ŷ Si no puede comunicarse con su
abastecedor de gas, llame al cuerpo de
bomberos.
— La instalación y el servicio deben ser
efectuados por un instalador calificado, la
agencia de servicio o el abastecedor de gas.
2
GUARDE ESTAS INSTRUCCIONES
49-80516-3
La Ley sobre Agua Potable Inocua y Tratamiento de Residuos Tóxicos de California (California Safe Drinking Water
and Toxic Enforcement Act) solicita al Gobernador de California que publique una lista de sustancias que el estado
reconoce que producen cáncer, defectos de nacimiento u otros daños reproductivos y solicita a los empresarios que
adviertan a sus clientes sobre la posible exposición a tales sustancias.
ADVERTENCIA
Este producto contiene uno o más químicos que el Estado de California entiende
que producen cáncer, defectos en el nacimiento u otros daños reproductivos.
Los hornos con limpieza automática pueden ocasionar exposiciones de bajo nivel a algunas de estas sustancias,
incluyendo monóxido de carbono, durante el ciclo de limpieza. La exposición puede ser minimizada si se ventila con
una ventana abierta o si se usa un ventilador o campana.
ADVERTENCIA INSTRUCCIONES GENERALES DE SEGURIDAD
Cuando reciba su estufa pídale al técnico que le muestre la localización de la llave de paso y cómo se cierra en
caso de necesidad.
Ŷ 6XHVWXIDGHEHUiVHULQVWDODGD\FRQHFWDGDDWLHUUD
correctamente por un técnico calificado, de acuerdo
a las Instrucciones de instalación. Cualquier ajuste
o servicio deberán realizarlo únicamente técnicos
calificados en instalación de estufas de gas o técnicos
calificados en servicio.
Ŷ 1RWUDWHGHUHSDUDURUHHPSOD]DUFXDOTXLHUSDUWH
de su estufa a menos que se recomiende en forma
específica en este manual. Cualquier otro tipo de
servicio deberá confiársele a un técnico calificado.
Ŷ &RORTXHODHVWXIDIXHUDGHODUXWDGHOWUiILFRGHOD
cocina y de las corrientes de aire para evitar un
desempeño deficiente de los quemadores.
Ŷ &RQHFWHVXHVWXID~QLFDPHQWHDXQDWRPDGH
corriente de 120 voltios que esté conectada a tierra.
No quite la pata de conexión a tierra de la clavija.
Si tiene alguna duda sobre el sistema eléctrico
redondeada de conexión a tierra de su casa, es su
responsabilidad y obligación personal cambiar la toma
de corriente que no esté conectada a tierra por una
toma de corriente adecuada para tres patas que esté
conectada a tierra de acuerdo con los requerimientos
del Código Eléctrico Nacional. No utilice un cable de
extensión para este aparato.
Ŷ 3HUPLWDTXHODVSDUULOODVGHORVTXHPDGRUHV\RWUDV
superficies se enfríen antes de tocarlas o dejarlas
donde los niños las puedan alcanzar.
Ŷ $VHJ~UHVHGHTXLWDUWRGRHOPDWHULDOGHHPSDTXH
de la estufa antes de utilizarla para evitar riesgos de
incendio o lesiones por fuego o humo en caso de que
se incendie el material de empaque.
Ŷ &HUFLyUHVHGHTXHVXHVWXIDVHDDMXVWDGD
correctamente por parte de un técnico de servicio o
instalador para el tipo de estufa de gas (gas natural
o LP) que su estufa ha de usar. Su estufa se puede
convertir para ser usada con cualquiera de los dos
tipos de gas. Ver las Instrucciones de instalación en
el Kit de Conversión a LP.
Ŷ
ADVERTENCIA
: Estos ajustes deben
hacerse por un técnico calificado de acuerdo con
las instrucciones del fabricante y todos los códigos y
requisitos de las autoridades que tengan jurisdicción.
No seguir estas instrucciones podría traer como
resultado lesiones serias o daño a la propiedad. La
agencia calificada que se encuentre ejecutando este
trabajo asume la responsabilidad de la conversión.
Ŷ 1RGHMHDORVQLxRVVRORVRVLQDWHQFLyQVLODHVWXIDVH
encuentra caliente o funcionando. Podrían quemarse
gravemente.
Ŷ 1RSHUPLWDTXHQDGLHVHVXEDVHSDUHRVHFXHOJXH
de la estufa.
Ŷ 1RRSHUHROLPSLHVXHVWXIDVLHOYLGULRHVWiURWRR
agrietado. Las soluciones de limpieza y los derrames
podrían penetrar la estufa rota y crear el riesgo de
un cortocircuito eléctrico. Llame para solicitar servicio
inmediatamente si el vidrio de la estufa se rompe o
se agrieta.
GUARDE ESTAS INSTRUCCIONES
49-80516-3
INFORMACIÓN DE SEGURIDAD
ADVERTENCIA DE LA PROPOSICIÓN 65 DEL ESTADO DE CALIFORNIA
3
INFORMACIÓN DE SEGURIDAD
INFORMACIÓN IMPORTANTE DE SEGURIDAD
LEA TODAS LAS INSTRUCCIONES ANTES DE USAR
Ŷ
Ŷ
Ŷ
Ŷ
Ŷ
Ŷ
Ŷ
ADVERTENCIA INSTRUCCIONES GENERALES DE SEGURIDAD
PRECAUCION: No deberán guardarse Ŷ (YLWHUDVJXxDUODHVWXIDGHYLGULR/DHVWXIDSXHGH
rasguñarse con objetos como instrumentos filosos,
objetos que puedan ser de interés para los niños en
los gabinetes que se encuentran sobre la cubierta.
Los niños que se suban a la estufa para alcanzar
algún artículo pueden lesionarse gravemente.
6LHPSUHPDQWHQJDORVXWHQVLOLRVGHPDGHUDRGH
plástico y los alimentos enlatados a una distancia
segura de la estufa.
6LHPSUHPDQWHQJDODVSDUHGHVFRPEXVWLEOHVTXH
se puedan incendiar), cortinas o cubiertas a una
distancia segura de la estufa.
1RREVWUX\DHOIOXMRGHFRPEXVWLyQ\HODLUHGHOD
ventilación.
/DSUXHEDGHJRWHUDVGHOHOHFWURGRPpVWLFRVH
deberá realizar de acuerdo con las instrucciones del
fabricante.
1XQFDXVHURSDGHPDVLDGRIORMDRTXHWHQJD
piezas que le cuelguen mientras está usando
electrodoméstico. Los materiales inflamables se
podrían incendiar si se ponen en contacto con las
unidades de superficie calientes y podrían causar
quemaduras severas.
(QVHxHDORVQLxRVDQRMXJDUFRQORVFRQWUROHVR
cualquier otra parte de la estufa.
ADVERTENCIA
: NUNCA
use este electrodoméstico como calefactor para
calentar la habitación. Hacerlo podría provocar
envenenamiento por monóxido de carbono y el
sobrecalentamiento del horno.
Ŷ 6LHPSUHPDQWHQJDODVWRDOODVGHOLPSLDUSODWRVORV
guantes de agarrar sartenes calientes y cualquier
otro tipo de material que se pueda quemar, a una
distancia segura de su estufa.
Ŷ 1RDOPDFHQHODVPDWHULDOHVLQIODPDEOHVHQODV
proximidades de su estufa.
Ŷ 1RDOPDFHQHRXVHPDWHULDOHVFRPEXVWLEOHV
gasolina u otros vapores inflamables y líquidos
en las proximidades de este o cualquier otro
electrodoméstico.
Ŷ 1RSHUPLWDTXHJUDVDGHFRFLQDUXRWURVPDWHULDOHV
inflamables se acumulen sobre la estufa.
Ŷ 1RRSHUHHOTXHPDGRUVLQWRGDVODVSDUWHVGHO
quemador colocadas en su lugar.
Ŷ 1RFRORTXHVDUWHQHVFDOLHQWHVHQHOYLGULRGHOD
estufa. Esto podría causar que el vidrio se agriete.
Ŷ 1ROLPSLHODHVWXIDFRQIOXLGRVGHOLPSLH]DYROiWLOHVR
inflamables.
Ŷ 1ROLPSLHODHVWXIDFXDQGRHOHOHFWURGRPpVWLFRHVWi
en uso.
4
anillos u otras joyas y remaches en ropa o tela.
Ŷ 1XQFDXVHXQDHVWXIDGHVXSHUILFLHFRPRXQD
superficie de corte.
Ŷ 1RXVHDJXDVREUHIXHJRVGHJUDVD1XQFDDJDUUH
una sartén que se encuentre en llamas. Apague los
controles. Ahogue una sartén en llamas sobre una
unidad de superficie cubriendo la sartén completamente
con una tapa que le encaje bien, con una parrilla de
hacer dulces o con una bandeja plana. Use un químico
seco multipropósitos o un extintor tipo espuma.
La grasa en llamas fuera de una sartén se puede
apagar cubriéndola con bicarbonato o, si lo tiene
disponible, usando un químico seco multipropósitos o
un extintor tipo espuma.
Ŷ
ADVERTENCIA
: Para reducir el
riesgo de incendio, choque electrico o lesiones a las
personas, vigile lo siguiente:
A. Use esta unidad solamente en la manera en que
el fabricante anticipó que se utilice. Si tiene alguna
pregunta, póngase en contacto con el fabricante.
B. Antes de proporcionar servicio a la unidad, desconecte
el suministro eléctrico en el panel de servicio.
C. Cuando se encuentre cortando o taladrando en
la pared o en el techo, no dañe los alambrados
eléctricos u otras utilidades escondidas.
D. Los ventiladores conectados a conductos deben
siempre estar ventilados hacia el exterior.
E. Para reducir el riesgo de incendios, use solamente
conductos metálicos.
F. No queme alimentos sobre la estufa. Si quema
alimentos bajo la campana, encienda el ventilador.
G. Es necesario contar con suficiente cantidad de aire
para una combustión y salida de gases adecuadas
a través del conducto (chimenea) del equipo de
consumo de combustible, a fin de evitar descargas.
Siga las pautas del fabricante del equipo de
calefacción y los estándares de seguridad, tales como
aquellos publicados por la Asociación Nacional de
Protección contra Incendios (National Fire Protection
Association, NFPA), la Sociedad Estadounidense
para la Calefacción (American Society for Heating),
los Ingenieros de Refrigeración y Acondicionadores
de Aire (Refrigeration and Air Conditioning Engineers,
ASHRAE) y las autoridades de los códigos locales.
Cuando corresponda, instale un sistema de reposición
(reemplazo) de aire de acuerdo con los requisitos
del código local de construcción”. Para acceder a
soluciones relacionadas con la reposición de aire,
visite GEAppliances.com.
GUARDE ESTAS INSTRUCCIONES
49-80516-3
de incendio debido a la presencia de grasa en la estufa:
A. Mantenga el ventilador, los filtros y la superficies
expuestas a aceite limpias.
B. Siempre encienda (ON) el ventilador cuando
cocine en calor alto.
C. Use las selecciones altas en su estufa solamente
cuando sea necesario. Caliente los aceites
lentamente en selecciones de medias a bajas.
el tipo de alimento que se encuentra preparando.
Ŷ
PRECAUCION
: Para ventilación
general solamente. No use para deshacerse de
materiales explosivos peligrosos y vapores.
ADVERTENCIA UNIDADES DE SUPERFICIE RADIANTE
Sea cuidadoso cuando toque la estufa. La superficie de vidrio de la estufa se mantendrá caliente después de que
los controles se hayan apagado.
Ŷ (YLWHUDVJXxDUODHVWXIDGHYLGULR/DHVWXIDSXHGH
rasguñarse con objetos como instrumentos filosos,
anillos u otras joyas y remaches en ropa o tela.
Ŷ 5DVJXxDGXUDVJUDQGHVRLPSDFWRVDODHVWXIDGH
vidrio puede terminar en vidrio roto.
Ŷ 1RRSHUDODVXQLGDGHVGHYLGULRGHODHVWXIDVLHOYLGULR
está roto. Derrames o solución de limpieza podría
penetrar el vidrio roto y causar riesgos de una descarga
eléctrica. Póngase en contacto con un técnico calificado
inmediatamente si el vidrio de su estufa se rompe.
Ŷ 1XQFDXVHXQDHVWXIDGHVXSHUILFLHFRPRXQD
superficie de corte.
Ŷ 1RLQWHQWHFRORFDURDOPDFHQDUDUWtFXORVTXHVH
puedan derretir o encenderse en la superficie de vidrio
de la estufa, aún cuando ésta no está siendo usada.
Ŷ 6HDFXLGDGRVRFXDQGRFRORTXHFXFKDUDVXRWURV
utensilios sobre la estufa de superficie de vidrio
cuando no esté en uso. Se podrían calentar y causar
quemaduras.
Ŷ /LPSLHODHVWXIDFRQSUHFDXFLyQ6LXQDHVSRQMD
húmeda o un trapo es usado para limpiar derrames
en unidades de superficies calientes, tenga cuidado
de evitar quemaduras causadas por el vapor.
Algunos limpiadores pueden causar gases nocivos
si son aplicados a superficies calientes. NOTA:
Recomendamos que evite limpiar la superficie de
cualquiera de las áreas hasta haberse enfriado y
que el indicador se haya apagado. Los derrames
de azúcar son una excepción a esto. Lea Cómo
Limpiar la Superficie de Cocción de Vidrio en la
sección de Cuidado y Limpieza.
Ŷ &XDQGRODHVWXIDHVWpIUtDXVHVRODPHQWHHOOLPSLDGRU
para cerámicas de estufas CERAMA BRYTE® y la
almohadilla de limpieza CERAMA BRYTE® para
limpiar la estufa.
Ŷ 3DUDHYLWDUSRVLEOHVGDxRVDODVXSHUILFLHGH
cocinado, no aplique cremas de limpieza cuando la
superficie de vidrio esté caliente.
Ŷ 'HVSXpVGHODOLPSLH]DXVHXQWUDSRVHFRRXQD
toalla de papel para remover todos los residuos de la
crema de limpieza.
Ŷ /HD\VLJDWRGDVODVLQVWUXFFLRQHV\ODVDGYHUWHQFLDV
en las etiquetas de la crema de limpieza.
GUARDE ESTAS INSTRUCCIONES
49-80516-3
INFORMACIÓN DE SEGURIDAD
Ŷ
ADVERTENCIA INSTRUCCIONES GENERALES DE SEGURIDAD
D. No deje la estufa sin la atención.
ADVERTENCIA: Para reducir el riesgo
E. Siempre use sartenes y utensilios apropiados para
5
INFORMACIÓN DE SEGURIDAD
6
INFORMACIÓN IMPORTANTE DE SEGURIDAD
LEA TODAS LAS INSTRUCCIONES ANTES DE USAR
ADVERTENCIA QUEMADORES DE SUPERFICIE
Use sartenes de tamaño apropiado—evite sartenes que no sean estables o que se volteen fácilmente. Seleccione
sartenes que tengan el fondo lo suficientemente plano como para cubrir las parrillas. Para evitar derrames,
cerciórese que su sartén es lo suficientemente grande para contener sus alimentos. Setos le ahorrará tiempo de
limpieza y evitará acumulaciones peligrosas de alimentos, ya que salpiqueos pesados o derrames dejados en la
estufa se podrían incendiar. Use sartenes que se puedan agarrar fácilmente y que permanezcan frías.
Ŷ 6LHPSUHXVHODSRVLFLyQ/,7(FXDQGRHQFLHQGDORV
quemadores superiores y cerciórese de que los
quemadores se han encendido.
Ŷ 1XQFDGHMHORVTXHPDGRUHVGHVXSHUILFLHGHVDWHQGLGRV
en las selecciones altas. Los derrames debido a que
un alimento hierva y se derrame podrían causar humo
y derrames de grasa que podrían encenderse.
Ŷ 8VHVRODPHQWHVRVWHQHGRUHVGHVDUWHQHVVHFRV²ORV
húmedos o mojados cuando entran en contacto con
superficies calientes podrían causar quemaduras debido
al vapor. No deje que los sostenedores de sartenes
entren en contacto con las unidades de superficie
calientes de la unidad. No use una toalla u otras telas
voluminosas. Estas telas se podrían encender al entrar
en contacto con las superficies de la unidad.
Ŷ &XDQGRXVHVDUWHQHVGHYLGULRFHUFLyUHVHGHTXH
estén diseñados para cocinar en estufas.
Ŷ 3DUDPLQLPL]DUODSRVLELOLGDGGHTXHPDGXUDVGH
ignición de materiales inflamables y de derrames,
la manija de la sartén u olla debe voltearse hacia el
centro de la estufa sin extenderla sobre cualquier otra
unidad de superficie cercana.
Ŷ 6LHPSUHDSDJXHORVFRQWUROHVGHORVTXHPDGRUHVGH
superficie antes de remover las sartenes.
Ŷ 2EVHUYHFRQFXLGDGRORVDOLPHQWRVTXHVHHQFXHQWUD
friendo a selecciones de calor altas.
Ŷ 6LHPSUHFDOLHQWHJUDVDOHQWDPHQWH\YLJtOHODPLHQWUDV
se calienta.
Ŷ 1RGHMHQLQJ~QDUWtFXORVREUHODHVWXID(ODLUH
caliente de la ventilación podría encender artículos
inflamables y aumentará la presión en envases
cerrados, que podrían explotar.
Ŷ 6LVHGLVSRQHDXVDUXQDFRPELQDFLyQGHDFHLWHV\
grasas para cocinar, mézclelos antes de calentarlos,
o derrita las grasas lentamente.
Ŷ 1RXVHXQZRNHQODVXSHUILFLHGHFRFLQDGRVLHOZRN
tiene un aro metálico redondo que está colocado
VREUHODSDUULOODGHOTXHPDGRUSDUDVRSRUWDUHOZRN
Este aro actúa como una trampa de calor, la que
podría dañar la parrilla del quemador y la cabeza
del quemador. Además, éste puede causar que el
quemador no funcione apropiadamente. Esto podría
causar niveles de monóxido de carbono mayores de
los permitidos por los estándares actuales, resultando
en un peligro para la salud.
Ŷ /RVDOLPHQWRV\ODVVDUWHQHVGHIUHtUGHEHUtDQHVWDU
tan secos como sea posible. El hielo y la humedad en
comidas frescas pueden causar un derrame de aceite.
Ŷ 8VHSRFRDFHLWHSDUDXQDIULWXUDHIHFWLYDQRPX\
profunda. Llenar la sartén con demasiado aceite
podría causar que ocurran derrames cuando los
alimentos sean agregados.
Ŷ 8VHXQWHUPyPHWURGHJUDVDGHSURIXQGLGDGVLHPSUH
que sea posible para prevenir que la grasa se
sobrecaliente más allá del punto de inflamación.
Ŷ 1XQFDWUDWHGHPRYHUXQDVDUWpQTXHFRQWHQJD
grasa caliente, especialmente una sartén que
contenga mucha grasa caliente. Espere hasta que la
grasa se enfríe.
Ŷ 1RTXHPHDOLPHQWRVVREUHODHVWXID6LTXHPD
alimentos bajo la campana, encienda el ventilador.
GUARDE ESTAS INSTRUCCIONES
49-80516-3
Ajuste el tamaño de la llama del quemador de forma que no se extienda más allá del extremo de la pieza de cocina.
Las llamas excesivas son peligrosas.
Ŷ 1RGHMHDUWtFXORVSOiVWLFRVVREUHODHVWXID²VH
podrían derretir si se dejan demasiado cerca de la
ventana de ventilación.
Ŷ 0DQWHQJDWRGRVORVREMHWRVGHSOiVWLFRDOHMDGRVGH
los quemadores de superficie.
Ŷ 6LKXHOHJDVVXVSHQGDHOJDVKDFLDODHVWXID\OODPH
a un técnico de servicio calificado. Nunca use una
llama abierta para localizar una fuga.
Ŷ 3DUDHYLWDUODSRVLELOLGDGGHXQDTXHPDGXUDVLHPSUH
esté seguro de que los controles de todos los
quemadores están en la posición de apagado (OFF)
y de que todas las parrillas están frías antes de
removerlas.
Ŷ 1XQFDOLPSLHODVXSHUILFLHGHODHVWXIDFXDQGR
está caliente. Algunos limpiadores pueden causar
Ŷ
Ŷ
Ŷ
Ŷ
gases nocivos y trapos húmedos podrían causar
quemaduras de vapor si son usados en superficies
calientes.
1XQFDGHMHODWDVRHQYDVHVGHJUDVDUHERVDQGRSRU
los bordes encima o próximo a su estufa.
1RXVHSDSHODOXPLQLRGHEDMRGHODVSDUULOODVGHO
quemador. El mal uso podría resultar en peligros de
incendios o daños a la estufa.
1RFXEUDREORTXHHHOiUHDDOUHGHGRUGHORVERWRQHV
de la estufa. Esta área debe permanecer libre para
tener la ventilación apropiada y para el rendimiento
del quemador.
/LPSLHVRODPHQWHODVSDUWHVLQGLFDGDVHQHO0DQXDO
del propietario.
INFORMACIÓN DE SEGURIDAD
ADVERTENCIA QUEMADORES DE SUPERFICIE
ADVERTENCIA COCINE BIEN LAS CARNES Y LAS CARNES DE AVE
Cocine totalmente las carnes y las carnes de ave—cocine la carne a una temperatura INTERNA de por lo menos
160°F y las carnes de ave a una temperatura INTERNA de 180°F. Cocinar a estas temperaturas generalmente lo
protege contra enfermedades contenidas en las carnes.
ADVERTENCIA CÓMO CONVERTIR LA ESTUFA A GAS LP
(o convertir de vuelta a gas natural de LP)
Esta estufa deja la factoría lista para ser usada con gas natural.
Si usted quiere convertir a gas LP, la conversión debe ser llevada a cabo por un técnico de gas LP calificado.
Las instrucciones de conversión, la etiqueta de conversión y los orificios LP pueden encontrarse pegados en la
estufa próximo al regulador de presión.
Existe un segundo juego de instrucciones incluidas en el sobre conteniendo los diagramas de alambrado del
producto en el lado de la estufa. Mantenga estas instrucciones en los orificios en caso de que desee convertir la
estufa otra vez a gas natural.
GUARDE ESTAS INSTRUCCIONES
49-80516-3
7
GARANTÍA
¡Gracias! ... por su compra de un electrodoméstico de la Marca GE
Registre su Electrodoméstico: ¡Registre su electrodoméstico nuevo a través de Internet, según su conveniencia!
ZZZJHDSSOLDQFHVFRPVHUYLFHBDQGBVXSSRUWUHJLVWHU
Un registro puntual de su producto permitirá una mejor comunicación y un servicio más puntual de acuerdo con los términos de su
JDUDQWtDHQFDVRGHVXUJLUODQHFHVLGDG7DPELpQSXHGHHQYLDUXQDFDUWDHQODWDUMHWDGHLQVFULSFLyQSUHLPSUHVDTXHVHLQFOX\HFRQ
el material embalado.
Garantía de la Cocina a Gas de GE
GEAppliances.com
Todo el servicio de garantía es provisto por nuestros Centros de Servicio de Fabricación, o un técnico autorizado de Servicio al
&OLHQWH&XVWRPHU&DUHŠ3DUDSURJUDPDUXQDYLVLWDGHOVHUYLFLRWpFQLFRDWUDYpVGH,QWHUQHWYLVtWHQRVHQZZZJHDSSOLDQFHV
com/service_and_support/, o llame al 800.GE.CARES (800.432.2737). Cuando llame para solicitar el servicio, tenga los números
de serie y de modelo disponibles.
Para realizar el servicio técnico de su electrodoméstico se podrá requerir el uso de datos del puerto de abordaje para su
diagnóstico. Esto da al técnico del servicio de fábrica de GE la habilidad de diagnosticar de forma rápida cualquier problema con
su electrodoméstico, y de ayudar a GE a mejorar sus productos al brindarle a GE la información sobre su electrodoméstico. Si no
desea que los datos de su electrodoméstico sean enviados a GE, solicitamos que le indique a su técnico no entregar los datos a
GE en el momento del servicio.
Durante el período de un año desde la fecha original de compra. GE le brindará cualquier parte de la placa de cocción que falle
debido a un defecto en los materiales o la fabricación. Durante esta garantía limitada de un año, GE también proveerá, sin costo,
todo el trabajo y el servicio en el hogar relacionado con el reemplazo de la parte que presente defectos.
Abroche su recibo aquí. Para acceder al servicio técnico de acuerdo con
la garantía deberá contar con la prueba de la fecha original de compra.
Qué no cubrirá GE:
Ŷ 9LDMHVGHOWpFQLFRGHOVHUYLFLRDVXKRJDUSDUDHQVHxDUOH
sobre cómo usar el producto.
Ŷ ,QVWDODFLyQHQWUHJDRPDQWHQLPLHQWRLQDGHFXDGRV
Ŷ )DOODVGHOSURGXFWRHQFDVRGHDEXVRPDOXVRPRGLILFDFLyQ
o uso para propósitos diferentes al original o uso comercial.
Ŷ 5HHPSOD]RGHIXVLEOHVGHODFDVDRUHLQLFLRGHGLV\XQWRUHV
Ŷ 'DxRVRFDVLRQDGRVVREUHHOSURGXFWRSRUDFFLGHQWH
incendio, inundaciones o catástrofes naturales.
Ŷ 'DxRVLQFLGHQWDOHVRFRQVHFXHQWHVFDXVDGRVSRUSRVLEOHV
defectos sobre este producto.
Ŷ 'DxRFDXVDGRGHVSXpVGHODHQWUHJD
Ŷ 3URGXFWRQRDFFHVLEOHSDUDEULQGDUHOVHUYLFLRUHTXHULGR
Ŷ 6ROLFLWHHOVHUYLFLRWpFQLFRSDUDUHSDUDURUHHPSOD]DUODV
lámparas, excepto las lámparas LED.
Ŷ ,QVWDODFLyQRVHUYLFLRWpFQLFRSDUDVLVWHPDVGHUHSRVLFLyQ
(reemplazo) de aire.
EXCLUSIÓN DE GARANTÍAS IMPLÍCITAS
Su única y exclusiva alternativa es la reparación del producto, como se indica en la Garantía Limitada. Las garantías implícitas,
incluyendo garantías implícitas de comerciabilidad o conveniencia sobre un propósito particular, se limitan a un año o al período
más corto permitido por la ley.
Esta garantía se extiende al comprador original y a cualquier dueño subsiguiente de productos comprados para uso hogareño
dentro de EE.UU. Si el producto está en un área donde no se encuentra disponible un Proveedor Autorizado del Servicio Técnico
de GE, usted será responsable por el costo de un viaje o se podrá requerir que traiga el producto a una ubicación del Servicio
Técnico de GE Autorizado para recibir el servicio. En Alaska, la garantía excluye el costo de envío o llamadas del servicio a su
hogar.
Algunos estados no permiten la exclusión o limitación de daños fortuitos o consecuentes. Esta garantía le da derechos legales
específicos y es posible que tenga otros derechos legales que varían entre un estado y otro. Para conocer cuáles son sus
derechos legales, consulte a la oficina de asuntos del consumidor local o estatal o al Fiscal de su estado.
Garante: General Electric Company. Louisville, KY 40225
Garantías Extendidas: Adquiera una garantía extendida de GE y aprenda sobre descuentos especiales que están disponibles
mientras su garantía aún está vigente. La puede adquirir en cualquier momento a través de Internet en
ZZZJHDSSOLDQFHVFRPVHUYLFHBDQGBVXSSRUWVKRSIRUH[WHQGHGVHUYLFHSODQVKWP
o llamando al 800.626.2224 durante el horario comercial habitual. Los Servicios para el Consumidor Hogareño de GE aún estarán
allí cuando su garantía caduque.
8
49-80516-3
¡Consulte el Sitio Web de Electrodomésticos de GE (www.geappliances.com/service_and_support/) durante las 24 horas, cual
quier día del año! Para mayor conveniencia y un servicio más rápido, ahora puede descargar el Manual del Propietario, ordenar
piezas o incluso programar el servicio técnico a través de Internet.
Servicio Programado: El servicio de reparación de expertos de
GE está a sólo un paso de su puerta. Entre a Internet y programe
VXVHUYLFLRHQZZZJHDSSOLDQFHVFRPVHUYLFHBDQGBVXSSRUWR
llame al 800.GE.CARES (800.432.2737) durante el horario de
atención comercial.
Piezas y Accesorios: Aquellas personas calificadas para realizar
el servicio técnico sobre sus propios electrodomésticos podrán
solicitar el envío de piezas o accesorios directamente a sus
hogares (se aceptan las tarjetas VISA; MasterCard y Discover).
Ordene a través de Internet hoy, durante las 24 horas o en forma
telefónica al 800.626.2002 durante el horario de atención comercial.
Las instrucciones que figuran en este manual cubren los
procedimientos que serán realizados por cualquier usuario.
Otros servicios técnicos generalmente deberían ser
derivados a personal calificado del servicio. Se deberá tener
cuidado, ya que una reparación indebida podrá hacer que el
funcionamiento no sea seguro.
Estudio de Diseño de la Vida Real: GE apoya el concepto
de Diseño Universal en productos, servicios y ambientes que
pueden ser usados por personas de todas las edades, tamaños
y capacidades. Reconocemos la necesidad de realizar diseños
para una amplia gama de habilidades e incapacidades físicas y
mentales. Para más detalles sobre las aplicaciones de Diseño
Universal de GE, incluyendo ideas de diseño de cocinas para
SHUVRQDVFRQLQFDSDFLGDGHVYLVLWHQXHVWURVLWLRZHEKR\6REUH
casos de incapacidad auditiva, comuníquese al 800.TDD.GEAC
(800.833.4322).
Contáctenos: Si no se encuentra satisfecho con el servicio
que recibió de GE, comuníquese con nosotros a través de
QXHVWURVLWLRZHEFRQWRGRVORVGHWDOOHVLQFOX\HQGRVXQ~PHUR
telefónico, o escriba a:
General Manager, Customer Relations
GE Appliances, Appliance Park Louisville, KY 40225
Piezas y Accesorios
Para realizar una orden, visítenos a través de Internet en:
www.GEApplianceParts.com (EE.UU.) o en www.GEAppliances.ca (Canadá)
o llame al 800.626.2002 (EE.UU.) 800.661.1616 (Canadá)
Las siguientes piezas están disponibles:
Piezas
Rejillas de Quemadores de Hierro Forjado (2/pk)
Rejilla de Ventilación
Tapa del Quemador del Medio, Frontal Izquierdo y Frontal Derecho
Tapa del Quemador Trasero Izquierdo Pequeño
Tapa del Quemador Frontal Izquierdo Grande
Perilla de Control del Quemador
Perillo de Control de Ventilación
Filtro de la Ventilación
Patas de parrilla de goma
ASISTENCIA / PIEZAS Y ACCESORIOS
¿Desea realizar una consulta o necesita ayuda con su electrodoméstico?
WB31X24784
WB34X24785
WB29X24783
WB29X24781
WB29X24782
WB03X10122
WB03X10322
WB02X10651
WB02T10101
Accesorios
Kit del Orificio para Altitud Elevada con gas NG
Kit del Orificio para Altitud Elevada con gas LP
Orificio Frontal Izquierdo y Frontal Derecho con gas LP
Orificio Trasero Derecho con gas LP
Orificio Frontal Derecho con gas LP
WB28X10114
WB28X10115
WB06X10277
WB06X10278
WB06X10279
Suministros de Limpieza
Limpiadores de Acero Inoxidable CitriShine
Limpiador de Electrodomésticos de Acero Inoxidable CERAMA BRYTE®
Almohadillas de Limpieza CERAMA BRYTE® para Placas de Cocción Cerámicas
Limpiador de la Placa de Cocción de Cerámica CERAMA BRYTE®
Espátula para Placa de Cocción Cerámica CERAMA BRYTE®
Kit (el kit incluye crema y espátula para placa de cocción)
WX10X10007
PM10X311
WX10X350
WX10X300
WX10X0302
WB64X5027
Cómo Retirar la Película Protectora de Envío y la Cinta de Embalaje
Con cuidado tome un extremo de la película protectora de envío
con los dedos y lentamente retire la misma de la superficie del
electrodoméstico. No utilice ningún producto filoso para retirar la
película. Retire toda la película antes de usar el electrodoméstico
por primera vez.
Para asegurar que no haya daños sobre el acabado del
producto, la forma más segura de retirar el adhesivo de la cinta
de embalaje en electrodomésticos nuevos es aplicando un
detergente líquido hogareño para lavar platos. Aplique con una
tela suave y deje que se seque.
NOTA: El adhesivo deberá ser eliminado de todas las partes.
No se puede retirar si se hornea con éste dentro.
49-80516-3
9
USO DE LA PLACA DE COCCIÓN: Funciones de la Placa de Cocción
10
Funciones de la Placa de Cocción
Es posible que las funciones y apariencias varíen con relación a su modelo a lo largo del manual.
4
8
4
10
1
2
7
3
6
5
9
1. Parrilla de ventilación: Consulte la página 14.
2. Filtro de ventilación (localizado debajo de la parrilla de ventilación): Consulte la página 14.
3. Cocinador a velocidad lenta a prueba de derramaduras: Consulte la páginas 11 y 13.
4. Quemadores a prueba de derramaduras: Consulte la páginas 11 y 13.
5. Quemador a prueba de derramaduras de alto poder: Consulte la páginas 11 y 13.
6. Control de ventilación: Consulte la página 12.
7. Controles de quemador de superficie: Consulte la página 11.
8. Superficie de cocinado de vidrio: Consulte la páginas 15 y 16.
9. Parrillas quemadoras de fundición de hierro: Consulte la página 14.
10. Junta de la parrilla de ventilación:&RQVXOWHODSiJLQDV
49-80516-3
A través de este manual, las características y la apariencia podría variar de acuerdo al modelo.
Cómo encender un quemador de superficie de gas
Empuje el botón de control hacia abajo girándolo hasta la
posición LITE (ENCENDIDO).
Usted escuchará un pequeño ruido que hace clic—el sonido
de la chispa eléctrica encendiendo el quemador.
Gire el botón para ajustar el tamaño de la llama. Si el botón
permanece en LITE, continuará haciendo clic.
Cuando un quemador sea movido a LITE, todos los
quemadores chispean. No intente desensamblar o limpiar
alrededor de ninguno de los quemadores mientras otro
quemador está encendido. Una
descarga eléctrica podría resultar,
lo que podría causar que usted
voltee la sartén.
Si el quemador no se usó
recientemente, es posible que las
llamas produzcan un ruido fuerte.
Esto es normal, y se debería
disipar luego de 4 o 5 minutos.
Empuje el botón de control
hacia abajo girándolo hasta la
posición LITE (ENCENDIDO).
Quemadores de gas sellados
El quemador más pequeño (posición posterior derecha) le
darán los mejores resultados para hervir a fuego lento. Este le
ofrece rendimiento de cocción preciso para comidas delicadas,
tales como salsas o comidas que necesitan cocinarse en calor
lento y bajo. Este puede reducirse a una selección de cocción
a fuego lento muy baja.
Los otros quemadores tienen mayor poder y harán que los
líquidos hiervan mucho más rápidamente, especialmente con
el uso de una tapa.
Cómo seleccionar el tamaño de la llama
Para un manejo seguro de sus piezas de cocina o sartenes,
nunca permita que las llamas se extiendan más allá de los
lados de la sartén.
Vigile las llamas, no el botón, cuando reduzca el calor. El
tamaño de la llama en un quemador de gas debe ajustarse a
la sartén que se encuentre usando.
Cualquier llama
mayor que el fondo
de la sartén se está
desperdiciando y
solamente sirve para
calentar la manija de
la sartén.
USO DE LA PLACA DE COCCIÓN: Quemadores
Quemadores
En caso de una interrupción en el suministro eléctrico
En caso de una interrupción en el suministro eléctrico, usted
puede encender los quemadores de la superficie de gas de
su estufa con un fósforo. Sostenga un fósforo encendido
en el quemador, entonces empuje y gire el botón a la
posición LITE. Use precaución extrema cuando encienda los
quemadores de esta forma.
Los quemadores de superficie en uso cuando suceda una
interrupción en el suministro eléctrico continuarán operando
normalmente.
EN CASO DE UNA INTERRUPCIÓN EN EL SUMINISTRO
ELÉCTRICO, EL SISTEMA DE VENTILACIÓN NO OPERARÁ.
Antes de encender un quemador de gas
Después de encender un quemador de gas
Ŷ $
VHJ~UHVHTXHWRGDVODVFDEH]DVWDSDV\UHMLOODVGHORV
quemadores se encuentren en las ubicaciones adecuadas
(lea Tapas, Cabezas y Electrodos de Quemadores en la
sección de Cuidado y Limpieza de la Cocina).
Ŷ 1
RRSHUHHOTXHPDGRUSRUXQSHUtRGRGHWLHPSRH[WHQGLGRVLQ
haber colocado una sartén sobre la parrilla. El acabado de la
parrilla podría desportillar sin una sartén que absorba el calor.
Ŷ &HUFLyUHVHGHTXHORVTXHPDGRUHV\ODVSDUULOODVHVWiQIUtDV
antes de colocar sus manos, un guante de sartenes, un
trapo o cualquier otro material sobre ellos.
49-80516-3
11
USO DE LA PLACA DE COCCIÓN: Quemadores / Cómo usar el sistema de ventilación descendente
Use El Wok De Esta Forma
5HFRPHQGDPRVTXHXVHXQZRNGHIRQGRSODQRGLVSRQLEOHHQ
su ferretería más cercana.
6RODPHQWHXVHZRNVGHIRQGRSODQRV1RXVHXQZRNGHIRQGR
DSODQDGRFRQXQVRVWHQHGRUGHZRNV
1RXVHXQZRNGHIRQGRDSODQDGRVREUHXQDURGHVRSRUWH
Colocar el aro sobre el quemador o sobre la parrilla podría
causar que el quemador no funcione apropiadamente,
resultando en niveles de monóxido de carbono más altos que
los permitidos por los estándares presentes. Esto podría ser
peligroso para su salud.
Use un wok de fondo plano.
Sartenes
Aluminio: Se recomiendan las sartenes de peso medio porque
se calientan más rápida y uniformemente. La mayoría de los
alimentos se doran uniformemente en una cacerola pequeña
con un mango largo de aluminio. Use cacerolas con tapas que
ajusten bien cuando cocine con cantidades mínimas de agua.
Acero inoxidable: Este metal solo tiene propiedades de
calentamiento pobres y es usualmente combinado con cobre,
aluminio u otros metales para mejorar su distribución de calor.
Estas cacerolas cuando están fabricadas de una combinación
de metales generalmente funcionan satisfactoriamente si se
usan con calor medio como el fabricante lo recomienda.
Hierro fundido: Si es calentado lentamente, la mayoría de
las cacerolas pequeñas con mangos largos darán resultados
satisfactorios.
Piezas de cocina esmaltadas: Bajo algunas condiciones, el
esmalte de algunas piezas de cocina podría fundirse. Siga las
recomendaciones del fabricante de la sartén para los métodos
de cocción.
Vidrio: Hay dos tipos de piezas de cocina de vidrio: aquellos
que son para ser usados en horno solamente y aquellos que
son para cocinar en estufas (cacerolas, cafeteras o ollas de
té). Los conductos de vidrio se calientan muy lentamente.
Vidrio-cerámica a prueba de calor: Puede usarse para
hornear o para cocinar en las superficies. Estas conducen el
calor muy lentamente y se enfrían muy lentamente. Revise
las direcciones del fabricante de estas piezas de cocina para
cerciorarse de que las puede usar en una estufa de gas.
Parrillas para la superficie de la estufa
No use parrillas para la superficie de la estufa en su quemador
de gas sellado. Si usted usa estas parrillas en el quemador
de gas sellado causará una combustión incompleta y podría
resultar en la producción de monóxido de carbono en niveles
mayores de los permitidos por los estándares actuales. Esto
podría ser peligroso para la salud.
Cómo Usar El Sistema De Ventilación Descendente
Como Operar El Sistema De Ventilación Descendente
El sistema de ventilación incorporado ayuda
a remover los vapores producidos por los alimentos al ser
cocinados en la estufa, además de los olores y el humo.
Gire el botón de control de velocidad del ventilador de
ventilación a HI (ALTO), MED (MEDIO) o LO (BAJO), según
sea necesario.
El uso continuo del sistema de ventilación mientras cocina
ayuda a mantener la cocina cómoda y menos húmeda,
reduciendo los olores de cocina y la humedad que
normalmente crea la necesidad frecuente de limpieza.
La apariencia de las llamas del quemador podría ser afectada
cuando el ventilador está en operación. En la configuración
de velocidad alta del ventilador, es normal que las llamas
del quemador se muevan en dirección hacia la rejilla de
ventilación. Si la cocción se ve afectada, use una configuración
de velocidad inferior del ventilador.
IN CASO DE UNA INTERRUPCIÓN EN EL SUMINISTRO
ELÉCTRICO, EL SISTEMA DE VENTILACIÓN NO
FUNCIONARÁ.
OFF H
I
MED
12
Quemadores (Cont.)
LO
49-80516-3
Cerciórese de que el suministro eléctrico está suspendido y que todas las superficies están frías antes de limpiar cualquiera de
las partes de la estufa.
Ensambladuras del quemador sellado
Apague (OFF) todos los controles
antes de remover las partes del
quemador.
Las parrillas del quemador, las
tapas y las cabezas del quemador
se pueden levantar, lo que hace
que su limpieza sea fácil.
PRECAUCIÓN
No opere el quemador sin
todas las partes del quemador
en su lugar.
Parrilla
Electrodo
Electrodo
Tapa del
quemador
Cabeza del
quemador
Base del
quemador
Cuando un quemador es girado hacia LITE
(ENCENDIDO), todos los quemadores chispean. No
intente desensamblar o limpiar alrededor de ninguno de
los quemadores mientras uno de ellos está encendido.
Podría resultar una descarga eléctrica, lo que a su vez
podría causar que usted voltee una sartén caliente.
Tapas, Cabezas y Electrodos de Quemadores
Tapas del quemador
Levántelas cuando estén frías. Lave las tapas del quemador
con agua de jabón caliente y enjuáguela con agua limpia.
Usted la puede restregar con un restregador para remover las
partículas de comidas quemadas que se le hayan adherido.
Cabezas del quemador
Las rendijas en las cabezas del quemador de su estufa deben
mantenerse limpias en todo momento para lograr llamas
uniformes y constantes.
Usted debería limpiar los quemadores de la superficie de manera
rutinaria, especialmente después de derrames serios, los que
podrían obstruir las aberturas. Levante cuando estén fríos.
Lave las cabezas del quemador con agua de jabón caliente y
enjuáguela con agua limpia.
Para remover alimentos quemados encima de la estufa, moje la
cabeza del quemador en una solución de líquido detergente suave
y agua caliente de 20 a 30 minutos. Para manchas más fuertes,
use un cepillo. Use una pequeña aguja de coser o un sujetador de
papeles para quitar cualquier obstrucción de las hendiduras.
Electrodos
Esta vara de metal pequeña del quemador produce la chispa y
se debe mantener limpia y seca para encender el gas de forma
adecuada
Para limpiar los electrodos, use una toalla de papel o un
estropajo.
Después de la limpieza
Antes de regresar las tapas y las cabezas de vuelta a su lugar,
sacuda el agua excesiva y entonces séquelos cuidadosamente
colocándolos en el horno caliente por 30 minutos. Asegúrese
que los electrodos se mantengan apoyados sobre la cabeza
del quemador.
Reemplazo
Las cabezas y las bases del quemador están etiquetadas A, B
y C para ayudar en la reensambladura.
Reemplace las cabezas del quemador en las bases
combinando las letras. Reemplace las tapas sobre las cabezas.
Cerciórese de que las tapas y las cabezas son colocadas en
el orden correcto. De cada uno hay uno pequeño (A), dos
medios (B) y uno grande (C). Si las tapas o cabezas no son
reemplazadas en las ubicaciones correctas, es posible que los
quemadores no se enciendan ni funcionen correctamente.
Después de la limpieza, cerciórese de que la ranura en la cabeza
del quemador está colocada hacia el electrodo. Rote la cabeza del
quemador alrededor de la base del quemador hasta que esté nivelada y
asentada con seguridad.
NOTA: Antes de remover las tapas y las cabezas del quemador, recuerde
su tamaño y localización. Reemplácelas en la misma localización
después de la limpieza. Las cabezas del quemador y las bases del
quemador están etiquetadas A, B y C para ayudarle en la ensambladura.
Tapa y cabeza
medias
B
Tapa y cabeza
pequeñas
B
B
B
Tapa y cabeza
medias
49-80516-3
CUIDADO Y LIMPIEZA: Limpieza de la Placa de Cocción
Limpieza de la Placa de Cocción
A
A
C
Frente de la
Superficie de
Cocción
C
Tapa y cabeza
grandes
13
CUIDADO Y LIMPIEZA: Limpieza de la Placa de Cocción
Limpieza de la Placa de Cocción
Las Rejillas Del Quemador, La Parrilla De Ventilación y La Junta
Levántelas cuando estén frías. Las rejillas, la parrilla y la junta
se deberían lavar de forma regular y, por supuesto, luego de
derrames.
Para limpiarlas, lávelas en agua caliente con jabón y enjuague
con agua limpia.
La decoloración en las parrillas podrían también removerse
usando la crema de limpieza de estufas proporcionada.
Aplique una o dos gotas en un trapo húmedo y restriegue a
través del área descolorada. Enjuague y seque. Después de la
limpieza, reemplace las parrillas de quemador y cerciórese de
que están colocadas con seguridad sobre los quemadores.
Para remover comida quemada
encima de la estufa, use una
almohadilla con jabón para
restregarla.
Aunque son duraderas, las
parrillas eventualmente perderán
su brillo, sin importar cuánto
cuidado usted les proporcione.
Este se debe a su exposición
continua a altas temperaturas.
Usted notará esto con parrillas de
colores más claros.
No opere el quemador por un
La apariencia podría variar.
período de tiempo extendido
Las patas de la parrilla tiene un pie
sin haber colocado una sartén
sobre la parrilla. El acabado de la de latón y tres pies de goma. Para
parrilla podría desportillar sin una ordenar reemplazos de las patas de
parrillas de goma, lea las secciones
sartén que absorba el calor.
de Asistencia / Piezas y Accesorios.
Reemplazo
Antes de reemplazar la rejilla de ventilación, cerciórese de que
la junta de la rejilla está instalada apropiadamente alrededor
de la abertura de ventilación descendente, con la palabra
FRENTE (FRONT) hacia los botones. Reemplace la rejilla
cuidadosamente sobre la junta.
Cuando se encuentre remplazando parrillas, cerciórese de
que están colocadas con su localizador de pata de latón hacia
el centro.
Rejilla
Junta de la rejilla
de ventilación
Filtro de
ventilación
Localizador
de la pata de latón
NOTA: No limpie las parrillas, la rejilla o la junta de la rejilla en
un horno de limpieza automática.
Las parrillas, rejilla y la junta de la rejilla se pueden limpiar en
un lavaplatos.
Cámara y filtro de ventilación
Remueva la rejilla de ventilación y la junta de la rejilla de
ventilación. El filtro se mantiene en su lugar por un tope
de ángulo. Levante el filtro y extráigalo de la abertura de
ventilación diagonalmente.
Para limpiar el filtro, agítelo en agua caliente con jabón.
Enjuáguelo bien con agua caliente y séquelo cuidadosamente.
No opere la ventilación sin el filtro en su lugar.
Rejilla
Cámara de
ventilación
Filtro de ventilación
Junta de
la rejilla de
ventilación
Cuando reemplace el filtro, cerciórese
de que descansa en un ángulo en los
apoyos en la abertura de ventilación.
Para limpiar la cámara de ventilación, use agua caliente
enjabonada. No use limpiadores abrasivos; dañarán el
acabado.
Remueva y reemplace el filtro diagonalmente
a través de la abertura de ventilación.
Para ordenar filtros de reemplazo, lea las
secciones de Asistencia / Piezas y Accesorios.
14
Reemplazo
Reemplace el filtro después de limpiarlo y secarlo. Reemplace
la junta de la rejilla de ventilación formándola alrededor
de la abertura de ventilación y cerciorándose de que la
palabra FRENTE (FRONT) está colocada hacia los botones.
Reemplace la rejilla.
49-80516-3
Botones de control
Área plana moldeada
Las perillas de control pueden quitarse para limpiarse.
Para limpiar las perillas, cerciórese de que estén en la posición
de apagado (OFF). Hale cada perilla hacia fuera del vástago.
Para limpiar las perillas, colóquelos en un lavaplatos o realice
la limpieza con agua y jabón. Enjuague con agua limpia.
Asegúrese que los interiores de las perillas estén secos antes
de volver a colocarlas.
Cuando reemplace las perillas, revise que estén en la posición
de apagado (OFF) para garantizar la colocación correcta.
Área plana
Los botones de control se pueden remover
para hacer su limpieza más fácil.
Superficies de Acero Inoxidable (en algunos modelos)
No use virutas de acero; éstas dañarán la superficie.
Para limpiar la superficie de acero inoxidable, use agua tibia
con jabón o un limpiador o pulidor para acero inoxidable.
Siempre limpie la superficie en la dirección del veteado. Siga
las instrucciones del limpiador para limpiar la superficie de
acero inoxidable.
Para realizar consultas sobre la adquisición de productos,
incluyendo limpiadores o pulidores para electrodomésticos de
acero inoxidable, lea las secciones de Asistencia / Piezas y
Accesorios, en el comienzo de este manual.
Cómo Limpiar la Estufa de Vidrio
Limpieza normal de uso diario
SÓLO utilice el limpiador de estufas cerámicas CERAMA
BRYTE® en la estufa de vidrio. Otras cremas pueden no ser
tan efectivas.
Para mantener y proteger la superficie de su estufa de vidrio,
siga estos pasos:
1. Antes de usar la estufa por primera vez, límpiela con el
limpiador de estufas cerámicas CERAMA BRYTE®. Esto
ayuda a proteger la estufa y hace la limpieza más sencilla.
2. El uso diario del limpiador de estufas cerámicas CERAMA
BRYTE® ayudará a que la estufa quede como nueva.
3. Remueva las parrillas del quemador, la rejilla de ventilación
y la junta de la rejilla de ventilación.
4. Agite bien la crema de limpieza. Aplique unas gotas
del limpiador de estufas cerámicas CERAMA BRYTE®
directamente sobre la estufa.
5. Utilice una toalla de papel o
un paño de limpieza CERAMA
BRYTE® para estufas cerámicas
para limpiar toda la superficie de la
estufa.
6. Use un paño seco o una toalla de
papel para quitar los restos del
limpiador. No hace falta enjuagar.
NOTA: Es muy importante que NO
CALIENTE la estufa hasta que la
Limpie la estufa después
haya limpiado por completo.
de cada derrame. Utilice
el limpiador de estufas
cerámicas CERAMA BRYTE®.
Residuos pegados
NOTA: Se podrán producir DAÑOS sobre la superficie de
vidrio si utiliza estropajos que no sean los recomendados.
1. Deje enfriar la estufa.
2. Remueva las parrillas del quemador, la rejilla de ventilación
y la junta de la rejilla de ventilación. Riegue algunas gotas
del limpiador de estufas de cerámica CERAMA BRYTE® en
el área entera donde se encuentra el residuo.
3. Utilizando el paño de limpieza CERAMA BRYTE® para
estufas cerámicas incluido, frote el área sucia aplicando
presión según sea necesario.
4. Si quedan restos, repita los pasos indicados con
anterioridad.
49-80516-3
5. Para protección adicional, después de haber quitado todos
los restos, pula toda la superficie con limpiador de estufas
cerámicas CERAMA BRYTE® y una toalla de papel.
Utilice un paño de limpieza CERAMA BRYTE®
para estufas cerámicas.
CUIDADO Y LIMPIEZA: Limpieza de la Placa de Cocción / Cómo Limpiar la Estufa de Vidrio
Limpieza de la Placa de Cocción
15
CUIDADO Y LIMPIEZA: Cómo Limpiar la Estufa de Vidrio
16
Cómo Limpiar la Estufa de Vidrio
Residuos pegados rebeldes
1. Deje enfriar la estufa.
2. Remueva las parrillas del quemador, la rejilla de ventilación
y la junta de la rejilla de ventilación.
3. Utilice el raspador de filo único a un ángulo aproximado
de 45 degrees contra la superficie del vidrio y raspe la
suciedad. Puede ser necesario aplicar presión al raspador
para quitar la suciedad.
4. Después de utilizar el raspador, coloque unas gotas de
limpiador de estufas cerámicas CERAMA BRYTE® sobre
toda el área de suciedad quemada. Utilice el paño de
limpieza CERAMA BRYTE® para quitar la suciedad restante.
5. Para protección adicional, después de haber quitado todos
los restos, pula toda la superficie con limpiador de estufas
cerámicas CERAMA BRYTE® y una toalla de papel.
El raspador de estufas cerámicas CERAMA BRYTE® y todos los insumos
recomendados se encuentran disponibles en nuestro Centro de
Repuestos. Lea las secciones de Asistencia / Piezas y Accesorios.
NOTA: No utilice hojas desafiladas o dañadas.
Metal Marks and Scratches
Tenga cuidado de no deslizar ollas o sartenes a través de su
estufa. Ellas dejarán marcas sobre la superficie de su estufa.
Estas marcas son removibles usando el limpiador de estufas
de cerámica CERAMA BRYTE® con la almohadilla de limpiar
estufas de cerámica CERAMA BRYTE®.
NOTA: Con mucho cuidado inspeccione el fondo de las sartenes
en búsqueda de protuberancias que puedan rasguñar la estufa.
Daños por derrames azucarados y plástico derretido
Se deberá tener especial cuidado al eliminar sustancias calientes, a fin de evitar daños permanentes sobre la superficie de
vidrio. Los derrames azucarados (como gelatinas, dulce, caramelo, jarabes) o plásticos derretidos pueden marcar la superficie
de la estufa (no cubierto por la garantía) a menos que el derrame se quite mientras está caliente. Debe tenerse mucho cuidado al
remover sustancias calientes.
Asegúrese de utilizar un raspador nuevo y afilado.
No utilice hojas desafiladas o dañadas.
1. Apague todas las unidades de superficie. Remueva las
3. Cualquier derrame restante debe dejarse hasta que la
sartenes calientes.
superficie de la estufa se haya enfriado.
2. Utilizando un guante de cocina:
4. No use las unidades de superficie de nuevo hasta que
todos los restos se hayan eliminado por completo.
a. Use un raspador de filo único (raspador para estufas
®
cerámicas CERAMA BRYTE ) para desplazar el
NOTA: Si la superficie de vidrio ya ha sufrido marcas o
derrame a un área fría de la estufa.
hendiduras, el vidrio de la estufa deberá cambiarse. En ese
caso, será necesaria la atención de un técnico.
b. Quite el derrame con toallas de papel.
49-80516-3
Estufa à gas ventilación descendente
PGP9830
“Si tiene alguna pregunta, llame al 800.GE.CARES o visite nuestro sitio Web en: GEAppliances.com”
EN EL ESTADO DE MASSACHUSETTS:
HERRAMIENTAS QUE NECESITARÁ
• Este producto lo debe instalar un plomero con licencia
• Sierra
• Cinta adhesiva de conductos
• Cinta métrica o escala
• Escuadra de carpintero
• Llave ajustable o juego de cubos (7/16” cubo
de y trinquete)
• Taladradora y broca
• Llave de tuercas de 1/4”
• Tornillos para hojas metálicas
• Llave de tubos
• Válvula de cierre de línea de gas manual
• Sello de juntas de tubos que resista la acción
de gas LP
• Trabajo de conductos que es apropiado para
la instalación
Para conexiones rígidas:
• Válvula de cierre
• Unión
• Accesorios de tubería según sea necesario
Para conexiones flexibles donde los códigos
locales lo permitan:
• Tubería metálica flexible (el mismo 3/4” ó 1/2” I.D.
que la línea de gas de suministro)
o un instalador de gas.
• Al usar válvulas de cierre de gas de tipo esfera, no
deben ser del tipo de manija en T.
• Un conector de gas flexible, cuando se utilice, no debe
superar los 3 pies.
ANTES DE COMENZAR
Lea estas instrucciones completa y cuidadosamente.
•
•
IMPORTANTE –
Guarde estas instrucciones para
ser usadas por el inspector local.
IMPORTANTE – Observe todos los códigos y
ordenanzas aplicables.
• Nota al instalador – Cerciórese de dejar estas instrucciones
con el Consumidor.
• Nota al consumidor – Guarde estas instrucciones para
referencia futura.
• A menos que posea un gran nivel de conocimiento sobre la
instalación de este producto, contrate a un instalador profesional.
• La instalación apropiada es la responsabilidad del instalador.
• Si este producto falla por una instalación inapropiada, la
Garantía no cubrirá este producto.
POR SU SEGURIDAD
Si percibe olor a gas:
1. Abra las ventanas.
2. No toque los interruptores eléctricos.
3. Apague cualquier llama abierta.
4. Llame de inmediato a su abastecedor de gas.
No almacene o use gasolina u otros vapores y líquidos
inflamables en la cercanía de este o cualquier otro
aparato.
ADVERTENCIA –
Antes de comenzar la
instalación, desconecte el interruptor de suministro eléctrico
en el panel de servicio y cierre el mecanismo de seguridad
para evitar que alguien lo conecte accidentalmente. Cuando
no exista un dispositivo de cierre de seguridad, amarre
un aviso visible, como una etiqueta al panel de servicio
haciendo la advertencia.
49-80516-3
INSTRUCCIONES DE INSTALACIÓN
Instrucciones
de Instalación
KIT DE CONVERSIÓN CON ORIFICIO PARA
ALTITUD ELEVADA
Se utiliza para el funcionamiento de la cocina en
elevaciones que superan los 5000 pies (1500 m).
Especifique si el kit es para Gas Natural o LP al ordenar:
Kit de Conversión con Orificio
para Altitud Elevada a gas Natural . . . . . . . . . .WB28X10114
Kit de Conversión con Orificio
para Altitud Elevada a gas LP . . . . . . . . . . . . . . .WB28X10115
Para ordenar, llame a nuestro número gratuito:
Centro partes de nacional. . . . . . . . . 800.626.2002
17
INSTRUCCIONES DE INSTALACIÓN
Instrucciones de Instalación
INSTRUCCIONES DE SEGURIDAD IMPORTANTES
INSTRUCCIONES IMPORTANTES DE SEGURIDAD
La estufa es un diseño que ha sido certificado por la Asociación
Norteamericana de Gas. Como sucede con cualquier aparato que
utilice gas y genere calor, hay ciertas precauciones de seguridad
que debe seguir. Encontrará estas precauciones en la sección
Instrucciones importantes de seguridad en esta manual. Léala
detenidamente.
• Asegúrese de que la estufa sea instalada adecuadamente por un
técnico calificado o un técnico en servicio.
• La estufa debe tener conexión a tierra de acuerdo con los códigos
locales, o en ausencia de éstos, con el Código Eléctrico Nacional
$16,1)3$1R³~OWLPDHGLFLyQ
• La instalación de esta estufa debe realizarse de acuerdo con los
códigos locales, o en la ausencia de códigos locales, con el Código
GH*DV&RPEXVWLEOH1DFLRQDO$16,=1)3$³~OWLPD
edición.
• La instalación, el ajuste, la alteración, el servicio o mantenimiento
incorrectos pueden causar lesiones o daños a la propiedad.
Consulte este manual. Para asistencia o información adicional,
consulte a un instalador calificado, agente de servicio, fabricante
(distribuidor) o al abastecedor de gas.
• Desconecte el suministro eléctrico antes de dar servicio al
aparato.
• Nunca reutilice conectores flexibles viejos. Usarlos podría causar
fugas de gas y lesiones personales. Siempre use conectores
flexibles NUEVOS al instalar un electrodoméstico a gas.
• Asegúrese de que los recubrimientos de las paredes que están
alrededor de la estufa resistan el calor generado por la estufa
hasta 200 °F (93 °C).
• Evite colocar gabinetes encima de la estufa.
• Si se colocan gabinetes encima de la estufa, permita una
tolerancia mínima de 30” entre la superficie de cocción y el fondo
del gabinete no protegido.
• Si los gabinetes están colocados por encima de la estufa, use
gabinetes de no más de 13” de profundidad.
• Si una tolerancia de 30” entre la superficie de cocina y el material
combustible encima de la estufa o los gabinetes metálicos no
pueden mantenerse, proteja la parte de abajo de los gabinetes
que se encuentran en la parte superior de la estufa con no menos
GHøµPPGHFDUWyQ\DLVODQWHROiPLQDGH\HVRGHDO
PHQRVøµPPFXELHUWDFRQXQDKRMDGHPHWDOGHFDOLEUH
28 o de cobre 0,020” (0,5 mm) de espesor.
• La distancia entre la superficie para cocinar y los gabinetes
protegidos NUNCA DEBE SER MENOR QUE 24 PULGADAS (61
cm). La distancia vertical desde la superficie para cocinar hasta
la parte inferior de los gabinetes adyacentes superiores que se
extienden más de 1” (2,5 cm) a los lados del plano de la estufa no
debe ser menor de 18” (45,72 cm).
RANGOS DEL SOPLADOR DE ESCAPE
ADVERTENCIA DE SEGURIDAD DEL SOPLADOR DE ESCAPE
Es necesario contar con suficiente cantidad de aire para una combustión y salida de gases adecuadas a través del
conducto (chimenea) del equipo de consumo de combustible, a fin de evitar descargas. Siga las pautas del fabricante
del equipo de calefacción y los estándares de seguridad, tales como aquellos publicados por la Asociación Nacional de
Protección contra Incendios (National Fire Protection Association, NFPA), la Sociedad Estadounidense para la Calefacción
(American Society for Heating), los Ingenieros de Refrigeración y Acondicionadores de Aire (Refrigeration and Air Conditioning
Engineers, ASHRAE) y las autoridades de los códigos locales. Cuando corresponda, instale un sistema de reposición
(reemplazo) de aire de acuerdo con los requisitos del código local de construcción. Para acceder a soluciones relacionadas
con la reposición de aire, visite GEAppliances.com.
18
49-80516-3
PARTES INCLUIDAS
Asegúrese que todos los materiales de empaque y cintas
se hayan retirado. Esto incluye cintas sobre las perillas de
control (si corresponde), cinta adhesiva, cintas de ajuste,
cartón y plástico protector. Si estos materiales no se
retiran se puede producir como resultado un daño sobre
el electrodoméstico, una vez que el mismo fue encendido
y las superficies se calientan.
PRECAUCIÓN:
EL VIDRIO ES FRÁGIL NO
CHOQUE LA ESQUINAS
DEL VIDRIO DURANTE
LA INSTALACIÓN
Cinta
reflectante
Tornillos para plancha
metálica (9) (8-18 x 3/8”)
Crema de
limpieza
Esponja de
restriegue
Rejilla de
ventilación
Parrillas del
quemador (2)
Regulador
Tapas y cabezas del quemador
Tapa y cabeza
del quemador
PRECAUCIÓN:
NO LEVANTE POR
LA ABERTURA DE
VENTILACIÓN O
CHOQUE EL VIDRIO
INSTRUCCIONES DE INSTALACIÓN
Instrucciones de Instalación
Cámara del soplador
Tapa y cabeza
del quemador
Filtro del
ventilador
Ensambladura del soplador y
tuercas de montaje (4)
(10-32 tuercas – con sus
arandelas de cierre pegadas)
Junta de la rejilla
de ventilación
Cinta de junta
de espuma
ESTUFA DE 30” (DIMENSIONES PARA REFERENCIA SOLAMENTE)
La unidad se muestra totalmente ensamblada.
217ø8
(2115ø16”SS)
2923ø32”
(2913ø16”SS)
23ø16”
(21ø4”SS)
22"
201ø2”
283ø4”
La unidad debe tener ventilación hacia el exterior!
49-80516-3
19
INSTRUCCIONES DE INSTALACIÓN
Instrucciones de Instalación
PREPARACIÓN DEL GABINETE
1 PREPARACIÓN PARA LA INSTALACIÓN
Posición de su estufa
La estufa está diseñada para lucir mejor cuando está centrada
en un gabinete de por lo menos 30” de ancho.
La ventanilla de escape debajo de la estufa debe estar
localizada entre los bajantes de la pared o entre las vigas del
piso de forma que el trabajo de conductos pueda ser instalado
apropiadamente.
La profundidad
del área
elevada de
los gabinetes
debe ser de un
máximo de 13"
Tolerancia mínima
de 30" a partir de la
encimera hasta la
superficie elevada
no protegida.
11ø2" min.
Altura mínima
de 18" desde la
encimera hasta
el gabinete más
cercano en
cualquiera de
los lados de la
unidad.
Tolerancia
mínima de 5"
a partir del
corte hasta
las paredes
laterales.
El sistema de ventilación descendente con soplador, motor
y trabajo de conductos ocupará el gabinete debajo de la
estufa. Usted no debe instalar gavetas debajo de esta estufa.
Evite colocar gabinetes encima de la unidad, si es posible, para
reducir los peligros causados por tener que intentar alcanzar
sobre unidades de superficie calentadas.
Si se usan gabineterías encima de la estufa, deje una tolerancia
mínima de 30” entre la superficie de cocina y el fondo de
cualquier gabinete no protegido.
Si la tolerancia entre la estufa y la gabinetería es menor de
30”, el gabinete debe protegerse con una plancha retardante
de llamas de por lo menos 1/4” de grueso, cubierta con una
plancha metálica de acero calibre 28 o con una plancha de
cobre de 0.020”. La tolerancia entre la estufa y la gabinetería
protegida NUNCA DEBE SER MENOR DE 24”.
EXCEPCIÓN: La instalación de un horno de microondas
especificado o de un electrodoméstico de cocina sobre una
estufa debe conformarse a las instrucciones de instalación
empacadas con ese electrodoméstico.
Áreas de trabajo adyacentes debe mantener una tolerancia por
lo menos de 18” entre la encimera y el fondo del gabinete. Si la
tolerancia es menor de 18”, los gabinetes adyacentes deben ser
de por lo menos 5” desde el lado extremo de la estufa.
20
2 PREPARACIÓN DEL GABINETE
DE LA BASE
Esta estufa está diseñada para ajustar fácilmente en una
variedad de gabinetes. Sin embargo, la instalación combinada
de una estufa y ventilación descendente requiere consideración
cuidadosa.
Algunos gabinetes podrían requerir modificaciones.
Esta instalación requiere un gabinete de base de una
profundidad mínima de 24”. El gabinete debe ser de por lo
menos 30” de ancho.
Preparando un gabinete que ajuste contra la pared
En algunos gabinetes, los lados podrían necesitar ser rebajados
o cortados 53ø4” como se muestra en la figura, y las abrazaderas
de las esquinas removidas para acomodar la unidad.
En gabinetes europeos sin forma de 75 cm y 90 cm, el panel
posterior podría necesitar ser rebajado hasta 53ø4” para
acomodar la unidad.
Preparando un gabinete tipo península o tipo isla
En gabinetes tipo península o isla, los lados podrían necesitar
ser rebajados o cortados, y las abrazaderas de las esquinas
removidas para acomodar la unidad.
Aprox. 53ø4"
Para gabinetes
europeos aprox.
53ø4"
49-80516-3
CORTES DE PREPARACIÓN DEL GABINETE
3 PREPARANDO LA ENCIMERA
4 PREPARACIONES PARA LOS CONDUCTOS
La encimera debe tener una superficie plana profunda
para acomodar la estufa y la ventilación. Las encimeras
con un extremo frontal rodado y “backsplash” puede no
proporcionar el área de superficie plana requerida.
Área de superficie plana de un
mínimo requerido de 25”
La tolerancia entre el frente interno del gabinete y la parte
posterior del corte en la encimera debe ser de 205ø8” para
poder acomodar la profundidad de la estufa.
205ø8”
23ø8” min.
NOTA: El trabajo de conductos DEBE tener ventilación hacia el
exterior. NO VENTILE hacia las paredes, techo, esquinas, áticos o
cualquier otro lugar cerrado.
Corte un agujero en la pared del gabinete o en el piso del gabinete
según sea apropiado para su instalación. Cerciórese de que los
tubos de escape están localizados entre los bajantes de la pared o
las vigas del piso.
NOTA: Cuando se encuentre cortando o taladrando en la
pared o en el techo, no dañe los alambrados eléctricos u otras
utilidades escondidas. Asegúrese de que cualquier abertura
en la pared detrás del electrodoméstico y en el piso debajo del
electrodoméstico esté sellada de forma apropiada.
91ø8”
61ø8”
183ø4”
101ø8”
17ø8” min.
Ventilación de la pared posterior
Un área plana de 1/2” de ancho se requiere alrededor del
extremo de la abertura para soportar la unidad. La unidad
debe ser nivelada y sentarse derecha en la abertura de la
encimera.
Con cuidado corte la abertura de la encimera de acuerdo
con las dimensiones mostradas en la ilustración. Cerciórese
de que la abertura es cortada derecha, con los lados
paralelos entre sí y con la parte posterior exactamente
perpendicular a los lados.
205ø8”
25”
INSTRUCCIONES DE INSTALACIÓN
Instrucciones de Instalación
5 ALINEACIÓN DE LOS CONDUCTOS DEL SOPLADOR
En general, no instamos al uso de conductos flexibles porque éste
puede causar severas restricciones del flujo de aire. Sin embargo,
si la salida del soplador y la localización en la pared o en el piso
representa un problema de alineación, entonces usted puede usar
conductos METÁLICOS para adaptar la compensación. Un buen
centramiento sin necesidad de conductos flexibles es lo preferido.
NOTA:
• No exceda la adaptación máxima recomendada de 6d.
• No permita que el conducto flexible se doble o que colapse.
• Alargue el conducto flexible tanto como sea posible para evitar la
corrugación tanto como sea posible.
6"Máximas
desde la línea
central hasta la
línea
central de
adaptación
287ø8”
17ø8” min.
Para la instalación de la isla, deje un espacio mínimo de 1
7/8” desde la abertura hasta el extremo frontal, un espacio
mínimo de 2 3/8” desde la abertura hasta el extremo trasero,
y un espacio mínimo de 5” desde la abertura hasta los
extremos laterales de la encimera.
Ventilación vertical
Ventilación de fondo
Ventilación trasera
(Requiere 31ø4" x 10")
Un rectángulo de 31ø4” x 10” a una transición de conducto
redondo de 6” está disponible en su tienda de suministros para
construcción local.
NOTA: Las ilustraciones son simplemente para que usted planifique.
49-80516-3
21
INSTRUCCIONES DE INSTALACIÓN
Instrucciones de Instalación
INFORMACIÓN SOBRE EL DISEÑO
6 PREPARACIÓN DEL CONDUCTO
Determine el mejor recorrido para el conducto; el mismo
puede ser conducido de diferentes formas dependiendo del
esquema de la cocina.
IMPORTANTE: La salida de la descarga de aire descendente
para esta unidad es rectangular, y con una medida de
3 1/4” x 10”. Planifique el recorrido de forma consecuente.
Serie de mesadas con distribución típica de tuberías.
A fin de maximizar el rendimiento de la ventilación del sistema
de ventilación:
1. Minimice la longitud del conducto y el número de
transiciones y codos.
2. Mantenga un tamaño de tubería constante.
3. Selle todas las juntas con cinta para conductos a fin de
evitar pérdidas.
4. No utilice tuberías flexibles de ningún tipo.
Pared externa
del gabinete
Pared interna
del gabinete
Pared interna hacia arriba
hasta el techo o parte saliente
Directamente hacia el exterior
Península
Península o isla
De ser necesario, instale un sistema de reposición (reemplazo)
de aire de acuerdo con los requisitos del código local de
construcción. Para acceder a soluciones relacionadas con la
reposición de aire, visite GEAppliances.com.
Entre vigas del piso
A través del espacio de las
patas del gabinete
Arreglo opcional del conducto bajo una losa de
concreto Se deberá usar un conducto de PVC si se
instalará bajo una losa de concreto.
NOTA: Tubería de PVC tipo cloaca PSM 12454-B
Lista 40 ASTM D1785.
Transición Rectangular de
Codo Metálico
3 ¼” x 10” a Circular de 6”
de 90º de 6”
(15 cm.) de Diá.
Conducto Metálico de
Tapa de
6” (15 cm.) de Diá.
Losa de
Pared
Concreto
6” (15 cm.) Diá.
Conducto Metálico
Tubería para
16”
Cloaca de
(40.6 cm.) PVC de 6”
de Máx. (15 cm.) de Diá.
12”
(30 cm.)
Mín.
Unión de
PVC de 6”
(15 cm) de Diá.
Unión de
PVC de 6”
(15 cm.) Diá.
Codo para Tubería
de Cloaca de PVC
de 6” (15 cm.) de Diá.
Tubería de
Cloaca
de PVC de
6” (15 cm.)
Codo para Tubería
de Diá.
Embale de forma bien
de
Cloaca
de
ajustada con grava o arena
6”
(15
cm.)
de
Diá.
completamente
alrededor de la tubería.
• Instale la tubería de modo que el trozo de conducto más
cercano a la unidad descendente encaje DENTRO DE la
siguiente pieza del conducto. Asegure las uniones con
tornillos autorroscantes y coloque cinta para conductos
alrededor de las uniones, a fin de sellar la salida de aire.
22
30’-0” (9.14 m.) Max.
Cinta para Conducto sobre
la Unión y el Tornillo
Aire
Flujo
Tornillo
49-80516-3
LOCALIZACIÓN DEL SUMINISTRO ELÉCTRICO
7 SUMINISTRO DE GAS:
Estas estufas están diseñadas para operar con gas natural
a una presión de columna de agua de 4” o en gas LP a una
presión de columna de agua de 10”.
• Estas estufas son enviadas desde la factoría preparadas
para gas natural. Si usted decide usar esta estufa con gas
LP, los ajustes de conversión deben ser hechos por un
técnico de servicio u otra persona calificada.
• El regulador de presión debe estar conectado en serie con
el múltiple o manifold de la estufa y debe permanecer en
serie con la línea de suministro sin importar el tipo de gas
que se esté usando.
Para una operación apropiada, la presión de entrada
máxima hacia al regulador no debe ser mayor de 10” de
presión de columna de agua para gas natural y de 14”
para gas LP.
• Cuando se encuentre inspeccionando el regulador, la
presión de entrada debe ser por lo menos de 1” mayor
que la del ajuste de salida del regulador. Si el regulador
está ajustado para una presión de columna de agua
de 4”, la presión de entrada debe ser de por lo menos
5”. Si el regulador está ajustado para una presión de
columna de agua de 10”, la presión de entrada debe
ser de por lo menos 11”. Para facilitar la instalación, y si
los códigos locales lo permiten, la línea de suministro de
gas hacia la estufa debe contar con un conectador de
electrodomésticos de metal flexible de 1/2” ó 3/4” ID, de tres
a cuatro pies de longitud.
NOTA: Compre una línea flexible nueva. NO USE UNA
LÍNEA USADA ANTERIORMENTE.
• Haga la conexión de gas a través de la pared posterior, o
a través el piso del gabinete en la parte posterior, como
se ilustra.
49-80516-3
8 SUMINISTRO ELÉCTRICO:
29 1ø2"
CL
2"
Mín
3"
Mín
Localización
de la línea
de gas
4" (para compensar el área
de protección de los pies)
El
tomacorriente
eléctrico a 12"
por encima
del piso del
gabinete
(montado en
el lado o en la
parte posterior
de la pared del
gabinete a 2"
mínimo de la
línea central)
INSTRUCCIONES DE INSTALACIÓN
Instrucciones de Instalación
La estufa de gas con ventilación descendente
incorporada tiene una ignición eléctrica sin piloto para
ahorro de energía y confiabilidad. Funciona con un
suministro energético de 60-Hz, 120 voltios. Un circuito
separado protegido por un fusible de dilatación de tiempo
de 15 amperios o un interruptor de circuito es necesario.
• Un receptáculo de tres clavijas conectado a tierra debe
estar localizado al alcance del cable eléctrico de cuatro
pies de la estufa.
IMPORTANTE: (Por favor lea cuidadosamente.) EN POS
DE LA SEGURIDAD PERSONAL, ESTE ELECTRODOMÉSTICO
DEBE ESTAR CONECTADO A TIERRA.
El cable eléctrico de este electrodoméstico está equipado
con un enchufe de tres clavijas (conexión a tierra) que
encajan con el receptáculo estándar de la pared de tres
clavijas para minimizar la posibilidad del peligro de una
descarga eléctrica en este electrodoméstico. El cliente debe
hacer que un técnico inspeccione el enchufe y el circuito
para cerciorarse de que están conectados apropiadamente
a tierra y de que tienen la polaridad correcta.
Donde se encuentre un enchufe de dos clavijas, es
responsabilidad y obligación personal del cliente hacer
que este enchufe sea reemplazado por uno de tres
clavijas apropiadamente conectado a tierra.
Bajo ninguna circunstancia corte o remueva la tercer
clavija del cable eléctrico. ¡No lo haga!
No use un cable de extensión.
23
INSTRUCCIONES DE INSTALACIÓN
Instrucciones de Instalación
CÓMO DESEMPACAR LA ESTUFA / INSTALAR LA JUNTA
9 CÓMO INSTALAR LA JUNTA DE ESPUMA
Y CINTA REFLECTANTE
PRECAUCIÓN: Riesgo potencial de incendio.
La cinta reflectante se debe asegurar alrededor de la
apertura en la encimera como se muestra.
No instale la estufa en la encimera sin haber instalado
la junta de espuma como se muestra. Esta protege el
extremo inferior del vidrio de la encimera y sella la estufa
contra derrames.
Remueva la estufa junto a sus almohadillas de empaque de
la caja de envío. Remueva el bloque de envío de la abertura
de ventilación descendente (downdraft) y colóquela debajo
de la almohadilla de envío para proporcionar apoyo de nivel.
Centre el bloque de envío de
la ventilación debajo de la
almohadilla de envío para
proporcionar apoyo de nivel.
Notas sobre la instalación de la junta de
espuma:
• La cinta de junta de espuma debería ser instalada dentro
de 1/8” del extremo del vidrio. No alargue o doble la cinta
de junta de espuma.
PRECAUCIÓN:
No instalar la cinta de
junta de espuma aumenta el potencia de que el vidrio
de la estufa se rompa cuando se esté instalando,
especialmente en encimeras Corian® o de granito.
• Use cuidado extremo de no alargar la cinta de junta de
espuma mientras la instala o no permanecerá en su lugar.
• No coloque la cinta de junta de espuma sobre los bordes
metálicos.
• Empalme los extremos de la cinta de junta de espuma en
cada esquina sin que una quede encima de la otra.
• Cubra todo el marco con la cinta de junta de espuma sin
alargarla.
• Corte las esquinas externas de la cinta de junta de espuma
ligeramente si fuera necesario para que luzca bien.
PRECAUCIÓN:
EL VIDRIO ES FRÁGIL. NO
GOLPEE LOS EXTREMOS DEL VIDRIO DURANTE LA
INSTALACIÓN.
Localice cinta reflectante y cinta de junta de espuma
incluida con su estufa.
Lado
inferior del
vidrio
Cinta de
junta de
espuma
1ø8d máximo al
extremo del vidrio
Pula los extremos ásperos en el corte. Instale la cinta
reflectante en la apertura, a lo largo del interior y de 3/8” a
1/2” del extremo de la apertura.
• No rasguñe el vidrio mientras corta la cinta de junta de
espuma.
Coloque la cinta
reflectante dentro
de 1/2” del corte
Lados superior y
vertical de la cinta reflectante
Pele la parte posterior blanca para instalar
la cinta de la junta de espuma en el lado del fondo del vidrio
de la estufa como se muestra.
24
49-80516-3
CÓMO INSTALAR LA ESTUFA
10 CÓMO INSTALAR LA ESTUFA
PRECAUCIÓN:
NO LEVANTE POR
LA ABERTURA DE
VENTILACIÓN.
Levante la estufa por los extremos del lado del vidrio como
se muestra.
NOTA: No use la abertura de ventilación para levantar o
mover la estufa de posición.
Baje la estufa hacia la abertura en la encimera, guiándola
KDVWDOOHJDUDVXSRVLFLyQ(OYLGULRHVIUiJLO³QRSHUPLWDTXH
se caiga sobre la encimera. Apoye desde el lado inferior y
baje con cuidado.
Cuidadosamente remueva sus dedos de una esquina a la
vez para bajar la estufa hasta su posición.
NOTA: No use RTV de silicona o masilla para unir el vidrio de
la estufa a la encimera.
Una vez ubicada la unidad en la mesada, inspeccione
visualmente el aspecto o la alineación de la superficie de
cocción y la mesada.
49-80516-3
11 CÓMO COLOCAR LOS SOPORTES DE
INSTALACIÓN OPCIONALES
NOTA: Verifique que el vidrio esté plano en el paso 9 antes de
colocar los soportes de instalación opcionales.
Soporte de
instalación opcional
y tornillo de apriete
manual (no incluido)
Estufa
Tornillos provistos
con la estufa
Mostrador de encimera
Tornillo de apriete
manual
Para solicitar soportes de instalación opcionales/tornillos de
apriete, llame al Centro Nacional de Piezas al 800.626.2002.
Solicite dos de cada pieza: WB02X11331 Soporte
WB01X10353 Tornillo
Para colocar soportes de instalación opcionales:
Quite los 2 tornillos a ambos lados bajo la estufa.
Alinee el soporte de instalación opcional bajo la estufa y
reinstale los tornillos a través de la ranura del soporte.
Haga esto en ambos lados de la estufa.
Introduzca el tornillo de apriete a través del orificio del soporte
y ajuste para fijar la estufa al mostrador de encimera. Repita
en el otro lado.
IMPORTANTE: Gire el tornillo de apriete hasta que toque la
parte inferior de la estufa. No ajuste de más.
INSTRUCCIONES DE INSTALACIÓN
Instrucciones de Instalación
25
INSTRUCCIONES DE INSTALACIÓN
Instrucciones de Instalación
CÓMO INSTALAR LA ESTUFA
12 CÓMO INSTALAR LA CÁMARA DEL
13 CÓMO INSTALAR LA CÁMARA
Deslice la cámara, con la abertura del soplador del lado
izquierdo, en la abertura en el fondo de la estufa. Empuje
la cámara hasta que se detenga cuando la cámara haga
contacto con el fondo de la estufa, y la cámara encaje en
su lugar. (Es posible que usted tenga que mover la cámara
hacia adelante y hacia atrás para encontrar su lugar exacto.)
Oriente la abertura de descarga del soplador hasta que
iguale el conducto en los Pasos 5 y 6. Deslice las cuatro
tachuelas roscadas en el lado del alojamiento del soplador
en los cuatro agujeros en el lado de la cámara.
NOTA: Ver el Paso 13 para la instalación del conducto de
transición del soplador. Es posible que sea más fácil instalar
el conducto de transición al soplador antes de instalar el
soplador a la cámara.
SOPLADOR DE LA ESTUFA
Instale 2 tornillos
DEL SOPLADOR
Instale 4 tornillos
Asegure la cámara al fondo de la estufa, en cada lado,
usando los cuatro (4) tornillos proporcionados. Luego
asegure la cámara a la estufa, a partir del lado superior,
usando los dos (2) tornillos proporcionados.
A partir de la abertura de ventilación en la parte superior de
la estufa, apriete la ensambladura del soplador de manera
firme a la cámara con cuatro (4) tuercas.
4 tuercas
(se necesita
un cubo de
tuercas de
7/16”)
26
49-80516-3
CÓMO INSTALAR LA ESTUFA
14 CÓMO PEGAR UNA
TRANSICIÓN DE SOPLADOR
Use un conducto de transición de soplador para todas las
instalaciones de conductos de flujo de aire descendente
para conectar las piezas de conducto de 6” redondas.
Este rectángulo de 31ø4” x 10” a conducto de 6” redondo de
transición está disponible en su ferretería local.
Tornillo
(en el otro lado)
• Conecte el tapón de 5 pasadores en la ensambladura
para combinar con el receptáculo de 5 pasadores en el
fondo de la estufa.
Conectores
de 5
pasantes
Tornillos
Instale el conducto de transición a la salida del soplador.
Asegure toda las juntas con cinta adhesiva de conducto
para asegurar hermeticidad.
15 CONEXIONES ELÉCTRICAS DEL SOPLADOR
• Afloje los dos tornillos y remueva y descarte la cubierta del
conectador metálico en el fondo de la estufa. Guarde los
tornillos para la reinstalación que vendrá más tarde.
• Doble todos los alambres en el alojamiento eléctrico.
Asegure el alojamiento con los tornillos removidos
anteriormente, cerciorándose de que no quedaron
alambres atrapados.
INSTRUCCIONES DE INSTALACIÓN
Instrucciones de Instalación
Conectores
de 5
pasantes
Alojamiento
eléctrico
Conducto
flexible
16 CÓMO CONECTAR LOS CONDUCTOS
Conecte la tubería preparada en los Pasos 5 y 6 al extractor.
Quite los tornillos y
descarte la cinta
49-80516-3
27
INSTRUCCIONES DE INSTALACIÓN
28
Instrucciones de Instalación
CÓMO INSTALAR LA ESTUFA
17 INSTALACIÓN DEL REGULADOR DE PRESIÓN
Regulador
Tubería sólida
o conectador
flexible
Unión
Tubería sólida
o conectador
flexible
Válvula de
cierre
Cabo de tubo
• Para todas las conexiones, use un sellador para tubos
aprobado por los códigos locales y que sea resistente a la
actividad del gas LP.
• Instale el regulador de presión en la tubería de gas lo más
cerca posible de la entrada de la cocina para permitir el
despeje del conducto de ventilación.
• Asegúrese que la flecha sobre el cuerpo del regulador esté
apuntando en forma directa hacia la cocina. Cualquier otra
posición afectará la presión de salida del regulador. Esta
flecha indica que el flujo de gas es correcto.
• Instale una válvula de cierre manual de la tubería de gas en
una ubicación de fácil acceso.
NOTA: En vez de usar tubería sólida para conectar el
regulador de presión, un conectador de electrodomésticos
metálico flexible podría usarse entre la válvula de cierre y el
regulador de presión, si los códigos locales lo permiten.
Se requieren tuercas abocinadas apropiadas y
adaptadores en cada extremo del conectador flexible.
PRUEBA DE FUGAS
ADVERTENCIA:
¡NO USE UNA LLAMA PARA
PROBAR SI EXISTE ALGUNA FUGA DE GAS! No use la estufa
hasta que todas las conexiones hayan sido probadas en
busca de fugas.
Lleve a cabo una prueba de fugas conforme a las
instrucciones siguientes:
1. Compre un detector de fugas líquido o prepare una
solución de jabón y agua. Una parte de agua una parte
detergente líquido.
2. Cuando todas las conexiones hayan sido hechas,
cerciórese de que todos los controles de la estufa están
apagados (OFF) y de que la válvula de suministro de gas a
la estufa está accionado (ON).
3. Aplique el detector de fugas o la solución jabonosa
alrededor de todas las conexiones a partir de la válvula de
cierre hasta la estufa.
4. Un fuga es identificada por un flujo de burbujas del área
de fuga.
5. Si usted detecta una fuga, suspenda el suministro de
gas. Apriete la conexión. Conecte el gas otra vez y
pruebe de nuevo.
Si la fuga persiste, suspenda el suministro de gas y póngase
en contacto con su distribuidor en busca de asistencia. No
intente operar la estufa si la fuga persiste.
IMPORTANTE: Desconecte la estufa y la válvula de cierre de
la tubería de suministro de gas durante cualquier prueba
de presión de ese sistema a presiones mayores de 1/2 psig.
Aísle la estufa de su sistema de tubería de suministro de
gas cerrando la válvula de cierre de gas individual manual
hacia la estufa durante cualquier prueba del sistema de
presión de las tuberías de presión de gas a una prueba de
presión igual o menor de 1/2 psig.
49-80516-3
CONEXIONES ELÉCTRICAS
18 REQUISITOS ELÉCTRICOS
Un ramal de circuito de 120 voltios y 60 Hertz protegido por
un interruptor de circuito de 15 ó 20 amperios o un fusible de
dilatación de tiempo.
PRECAUCIONES SOBRE EL USO DE CABLES
DE EXTENSIÓN
Debido a los riesgos de seguridad potenciales asociados
con ciertas condiciones, recomendamos enérgicamente
que no use un cable de extensión. Sin embargo, si decide
usar un cable de extensión, es absolutamente necesario que
este cable esté clasificado UL, con 3 conductores y que sea
certificado para ser usado en electrodomésticos para cargar
corriente equivalentes en amperios iguales o mayores que
las del ramal del circuito.
Un adaptador podría usarse solamente con un circuito
de 15 amperios. No use un adaptador con un circuito de
20 amperios. Cuando los códigos locales lo permitan, una
CONEXIÓN TEMPORAL podría hacerse a un tomacorriente
apropiadamente conectado a tierra de dos clavijas si
el tomacorriente está autorizado por UL, los que están
disponibles en casi todas las ferreterías. La ranura mayor
en el adaptador debe ser alineada con la ranura mayor en
el tomacorriente de la pared para proporcionar polaridad
apropiada en la conexión del cable eléctrico.
Método temporal
(Los enchufes adaptadores no son permitidos en Canadá)
CONEXIÓN A TIERRA
,03257$17(³(Por favor, lea
Alinee las clavijas/ranuras grandes
cuidadosamente.)
PARA SEGURIDAD PERSONAL, ESTE
ELECTRODOMÉSTICO DEBE ESTAR CONECTADO A
TIERRA APROPIADAMENTE.
INSTRUCCIONES DE INSTALACIÓN
Instrucciones de Instalación
Asegúrese de la
conexión a tierra
antes de usar
Método preferido
PRECAUCIÓN:
Cerciórese de que existe
una conexión apropiada
a tierra antes del uso
El cable eléctrico de este electrodoméstico está equipado con
un enchufe de tres clavijas (conexión a tierra) que combina
con el receptáculo o tomacorriente para tres clavijas para
minimizar la posibilidad del peligro de una descarga eléctrica
en este electrodoméstico.
El cliente debe hacer que un técnico calificado inspeccione el
tomacorriente de pared y el circuito para cerciorarse de que
el tomacorriente está conectado a tierra apropiadamente.
Cuando un tomacorriente de pared estándar de dos clavijas
es encontrado, es su responsabilidad y obligación personal
hacer que sea reemplazado con un tomacorriente de tres
clavijas conectado a tierra apropiadamente.
Pegar el adaptador
de la terminal de tierra al tornillo de la cubierta del
tomacorriente de la pared el electrodoméstico no conecta
a tierra a no ser que el tornillo sea metálico, que no esté
aislado, y que el tomacorriente esté conectado a tierra a
través del alambrado de la casa. El cliente debe hacer que
un técnico calificado inspeccione el circuito de la residencia
para cerciorarse que el tomacorriente está conectado a
tierra de manera apropiada.
Cuando desconecte el cable eléctrico del adaptador, siempre
sostenga el adaptador con las manos. Si no lo hace, la
terminal de conexión a tierra del adaptador se podría romper
a través del uso constante. Si esto sucediera, NO USE el
electrodoméstico hasta que la conexión a tierra apropiada
haya sido restablecida.
BAJO NINGUNA CIRCUNSTANCIA CORTE O REMUEVA
LA TERCER CLAVIJA DEL CABLE ELÉCTRICO. ¡NO LO
HAGA!
49-80516-3
29
INSTRUCCIONES DE INSTALACIÓN
Instrucciones de Instalación
ENSAMBLAJE FINAL
19 ENSAMBLADURA DE LOS QUEMADORES,
INSPECCIONE LA IGNICIÓN
Ensamble los quemadores como se muestra.
Parrilla
Lado curvado
hacia el centro
• Realice un control para determinar si las llamas de los
quemadores son normales. Si las llamas del quemador
se ven como en A, apague el quemador y asegúrese de
que todas las piezas estén ensambladas correctamente.
Vuelva a realizar el ensamble y haga un control. El
aspecto normal de las llamas debería ser como en B o
C, dependiendo del tipo de gas que use. Con gas LP, es
normal que haya algunas puntas amarillas en los conos
externos.
Tapa del quemador
Electrodo
Cabeza del quemador
Llamas amarillas – A Puntas amarillas en los
Llame en busca
conos exteriores – B.
de servicio
Normal para gas LP.
Base del quemador
PRECAUCIÓN:
No opere el quemador sin
todas las partes del quemador en su lugar.
Llamas suaves
azules – C. Normal
para gas natural.
• Gire el botón a OFF (APAGADO).
• Repita el procedimiento para cada quemador.
Tapa y
cabeza
pequeñas
Tapa y
cabeza
medias
Tapa y
cabeza
medias
Frente de la estufa
Tapa y
cabeza
grandes
Coloque las cabezas del quemador sobre las bases del
quemador combinando las letras. Coloque las tapas en
las cabezas. Cerciórese de que las cabezas y las tapas
están colocadas en el quemador de tamaño correcto. Las
cabezas del quemador y las
bases del quemador están
etiquetadas A, B y C para
ayudar en la ensambladura.
Hay una cabeza y una tapa
pequeña (A), dos medias (B) y
una grande (C).
Cerciórese de que la ranura
en el quemador de la cabeza está colocada hacia el
electrodo. Rote la cabeza del quemador alrededor de la
base del quemador hasta que esté nivelada y asentada con
seguridad.
Coloque las parrillas sobre los quemadores.
Inspeccione la ignición:
• Empuje hacia adentre un botón de control y gírele a la
posición LITE (ENCENDIDO).
• El encendedor chispeará y que quemador se
encenderá; el encendedor dejará de chispear cuando
el quemador se encienda.
• La primera prueba podría requerir algún tiempo,
mientras el aire circula a través de la línea de gas.
30
49-80516-3
ENSAMBLAJE FINAL
20 INSTALE EL FILTRO DE VENTILACIÓN
DESCENDENTE, LA JUNTA DE
VENTILACIÓN Y LA REJILLA DE
VENTILACIÓN
No opere la ventilación si el filtro en su lugar.
• Coloque el filtro diagonalmente a través de la abertura
de ventilación.
Filtro de ventilación
Cámara de
ventilación
INSTRUCCIONES DE INSTALACIÓN
Instrucciones de Instalación
• Cerciórese de que descansa en un ángulo, sobre los
apoyos en la abertura de ventilación.
• Ajuste la junta de la rejilla de ventilación alrededor del
extremo de la abertura de ventilación descendente.
Cerciórese de que el frente de la junta está instalado hacia
el frente de la estufa.
• Con cuidado, coloque la rejilla de ventilación sobre la junta
en la abertura de ventilación descendente.
Rejilla
Junta de rejilla de
ventilación
INSPECCIONES LA OPERACIÓN DE VENTILACIÓN
DESCENDENTE
• Gire el control de velocidad del ventilador de ventilación a
HI (ALTO), MED (MEDIO) y LO (BAJO) para cerciorarse de
que todas las velocidades operan correctamente.
49-80516-3
31
Notas
32
49-80516-3
Notas
49-80516-3
33
Notas
34
49-80516-3
¡Ahorre tiempo y dinero! Primero revise los cuadros que aparecen en las siguientes páginas y es posible que no necesite
solicitar reparaciones.
Problema
Causa Posible
El agua no hierve
Los quemadores
amarillas o
amarillentas
Qué Hacer
Cubra la sartén con una tapa. Apague el ventilador
(Posición OFF) hasta que el agua comience a hervir.
La calidad de combustión de las
llamas de los quemadores necesita
ser determinada visualmente.
Use la ilustración más adelante para determinar si la
tienen llamas llama de su quemador es normal. Si las
llamas del con puntas quemador lucen como A, llame al
técnico de servicio. Las llamas normales deben lucir como
las B o las C, dependiendo del tipo de gas que usted use.
Con gas LP, las puntas de color amarillento en los conos
exteriores son normales.
Llamas amarillas – A Puntas amarillas en los
Llame en busca
conos exteriores – B.
Normal para gas LP.
de servicio
Llamas suaves
azules – C. Normal
para gas natural.
Las partes del quemador no han
sido reemplazadas correctamente.
Ver la sección de Cuidado y limpieza de la estufa.
El enchufe de la estufa no está
completamente insertado en el
tomacorriente eléctrico.
Cerciórese de que el enchufe eléctrico está conectado
en un tomacorriente que tenga corriente, y que esté
conectado apropiadamente a tierra.
El suministro de gas no está
conectado o no está abierta la línea.
Ver la sección sobre Instrucciones de instalación.
El fusible en su residencia podría
haberse quemado o elinterruptor de
circuito se voló.
Reemplace el fusible o reajuste el interruptor de circuito.
El orificio de ignición en el cuerpo
del quemador está obstruido.
Remueva la obstrucción.
Las partes del quemador no han
sido reemplazadas correctamente.
Ver Tapas, cabezas y electrodos de quemadores en la
sección de Cuidado y limpieza.
Las hendiduras en la cabeza del
quemador se pueden atascar.
Use una aguja de coser pequeña o un sujetapapeles para
desenchufar.
El sonido chispeante
persiste aún cuando
el quemador está
apagado
Cerciórese de que el botón está en
la posición OFF (apagado).
Remueva el botón empujándolo directamente hacia afuera
del vástago e inspeccione el fondo del botón por si existe
acumulación de suciedad.
Sonido chispeante
ocasional
Cambiando la velocidad del
soplador.
Este es el sonido típico en el cambio eléctrico. Esto es
normal.
Las llamas del
quemador son
grandes o amarillas
Proporción de aire a gas no es
apropiada.
Si la estufa está conectada a gas LP, póngase en
contacto con la persona que hizo la conversión o la
persona que hizo la instalación de la estufa.
Las hendiduras en la cabeza del
quemador se pueden atascar.
Use una aguja de coser pequeña o un sujetapapeles para
desenchufar.
Las llamas del
quemador producen
un ruido excesivo
El quemador no se usó en forma
reciente.
Si el quemador está “frío” y se lo enciende en la
configuración ALTA (HI), es posible que se produzcauna
especie de “rugido” o “elevación” de la llama. Es posible
que esto se disipe en 4 o 5 minutos.
Las llamas del
quemador se mueven
en dirección a la
parrilla de ventilación
Ventilador configurado en velocidad
alta.
Esto es normal. Si la cocción se ve afectada, cambie a
una configuración de velocidad inferior del ventilador.
Los quemadores no
encienden
49-80516-3
CONSEJOS PARA LA SOLUCIÓN DE PROBLEMAS
Consejos para la Solución de Problemas... Antes de solicitar el servicio técnico
35
CONSEJOS PARA LA SOLUCIÓN DE PROBLEMAS
36
Consejos para la Solución de Problemas... Antes de solicitar el servicio técnico
Problema
Causa Posible
Qué Hacer
Los botones de control
no gira
Los controles de la estufa están
ajustados inapropiadamente.
Cuando el botón está en la posición OFF (apagado),
el botón debe empujarse hacia abajo antes de ser
girado. El botón solamente se puede girar en sentido
opuesto a la dirección de las agujas del reloj. Cuando
el botón está en cualquier otra posición, puede girarse
sin empujarse.
El ventilador no
funciona
El botón de control del ventilador no
está ajustado apropiadamente.
Gire el botón en la dirección de las agujas del reloj
para encender el ventilador.
El cable no está conectado
apropiadamente o el suministro
eléctrico está suspendido.
Inspeccione las conexiones. Restablezca el
suministro eléctrico en la caja de fusibles.
Ventilación deficiente
El filtro está obstruido.
Limpie el filtro de acuerdo a las instrucciones.
La casa no tiene buena circulación de aire.
Abra una ventana levemente para proporcionar una
fuente de aire.
La tapa de la pared está obstruida.
Remueva el bloqueo de la tapa de la pared exterior.
La tapa del regulador de tiro de la pare
está atascada.
Inspeccione la tapa de la pared exterior del
regulador de tiro para movimiento libre u
obstrucción.
La longitud del conducto excede el
máximo de 100 pies recomendado.
Reduzca el número de codos para simplificar la
trayectoria del conducto.
Pequeñas rayas o
marcas sobre el metal
pueden aparecer como
fisuras y abrasiones
sobre la superficie
de vidrio de la cocina
radiante
Uso de métodos incorrectos de limpieza.
Lea la sección de Limpieza de la cocina de vidrio.
Se usaron utensilios con partes
inferiores ásperas o partículas ásperas
(sal o arena) entre el utensilio y la
superficie de la cocina.
Asegúrese que las partes inferiores de los utensilios
estén limpias antes de su uso. Use utensilios con
partes inferiores lisas. Las rayas pequeñas no se
pueden eliminar pero serán menos visibles con el
tiempo como resultado de la limpieza.
Áreas de decoloración
o rayas oscuras en la
estufa
Se usaron utensilios inadecuados.
Las marcas de cacerolas de aluminio y cobre, como
también depósitos de minerales de agua o comida
se pueden eliminar con la crema de limpieza.
Superficies calientes en un modelo con
una estufa de color pálido.
Esto es normal. La superficie podría parecer
decolorada cuando está caliente. Esto es temporal
y desaparecerán conforme el vidrio se enfría.
Derrames de comida que no se
limpiaron hasta el siguiente uso.
Lea la sección de Limpieza de la cocina de vidrio.
Uso de métodos incorrectos de limpieza.
Use los procedimientos de limpieza recomendados.
Plástico fundido sobre la
superficie
La estufa caliente se puso en contacto
con un instrumento plástico colocado
sobre la estufa caliente.
Ver la sección de Superficie de vidrio – potencial de
daño permanente en la sección de Limpieza de la
estufa de vidrio.
Indentaciones sobre la
estufa
Derrame de una mezcla de azúcar sobre
la estufa.
Llame a un técnico clasificado para reemplazo.
El utensilio fue deslizado sobre la
superficie de la cocina.
49-80516-3
Download PDF