SERVICE MANUAL
SERVICE MANUAL
MODEL
KP-41PX1
KP-41PX1K
KP-41PX1R
COMMANDER DEST.
CHASSIS NO.
RM-892
AEP
SCC-P66A-A
RM-892
OIRT
SCC-P68A-A
RM-862
Russian SCC-P67A-A
1
2
3
4
5
6
7
8
9
RE-2A CHASSIS
0
OK
RM-892
PROJECTION TV
KP-41PX1/41PX1K/41PX1R
K
RM-892
RM-892
RM-862
SPECIFICATIONS
TV system
B/G/H, D/K, I, L
Sound output
2 x 30 W (music power)
2 x 15 W (RMS)
Colour system
PAL, SECAM
NTSC 3.58, 4.43 (only Video In)
Centre SP input
30 W (RMS) (using as the centre speaker)
Channel coverage
VHF: E2-E12
UHF: E21-E69
CATV: S1-S20
HYPER: S21-S41
D/K: R1-R12, R21-R69
L:
F2-F10, B-Q, F21-F69
I:
UHF B21-B69
Power consumption
145 W
Standby Power consumption
0.7 W
Dimensions (w x h x d)
Approx. 948 x 992 x 511 mm
Weight
Approx. 43 kg
Projected picture size
41 inches
Approx. 130 measured diagonally
Accessories supplied
1 Remote Control (RM-892) : 41PX1/41PX1K
(RM-862) : 41PX1R
2 Batteries (IEC designated)
Rear Terminals
•
Centre speaker input terminals (2
C
terminals)
•
(L, R) audio outputs (phono jacks)
• i1/
21-pin Euro connector (CENELEC
standard) including audio/video
input, RGB input, TV audio/video
output.
• i2/r 2
21-pin Euro connector (CENELEC
standard) including audio/video
input, S video input, selectable
audio/video output
• i3
21-pin Euro connector (CENELEC
standard) including audio/video
input, selectable audio / video
output (selectable the same output
source as i2/r 2 connector) and
Smartlink interface (41PX1/41PX1R)
(SMARTLINK)
Other features
Digital Comb filter (High resolution)
TELETEXT, Fastext, TOPtext
NICAM
Sleep Timer
Smartlink : 41PX1/41PX1K
Dolby Virtual
Front Terminals
t2 video input - phono jack
2 audio inputs - phono jacks
r 2 S video input - 4 pin DIN
Headphones jack - minijack stereo
Design and specifications are subject to change without notice.
CAUTION
SHORT CIRCUIT THE ANODE OF HTE PICTURE TUBE
AND THE ANODE CAP TO THE METAL CHASSIS, CRT
SHIELD, OR CARBON PAINTED ON THE CRT, AFTER
REMOVING THE ANODE.
SAFETY-RELATED COMPONENT WARNING!!
COMPONENTS IDENTIFIED BY SHADING AND MARK
0 ON THE SCHEMATIC DIAGRAMS, EXPLODED
VIEWS AND IN THE PARTS LIST ARE CRITICAL TO
SAFE OPERATION. REPLACE THESE COMPONENTS
WITH SONY PARTS WHOSE PART NUMBERS APPEAR AS SHOWN IN THIS MANUAL OR IN SUPPLEMENTS PUBLISHED BY SONY.
–2–
KP-41PX1/41PX1K/41PX1R
K
RM-892
RM-892
RM-862
TABLE OF CONTENTS
Section
Title
Page
1. SELF DIAGNOSIS FUNCTION ......................
4
2. GENERAL .................................................................
10
Section
Rear Board Removal .........................................
Chassis Assembly Removal ..............................
Service Position .................................................
Terminal board Removal ..................................
U (UE), A (AE) and D Boards Removal ...........
E Board Removal ...............................................
G Board Removal ...............................................
Speaker Grille and
Resistor Assembly (Focus Pack) Removal ........
3-9. H1 and H2 Boards Removal ..............................
3-10. Mirror Cover and Beznet Assembly Removal ....
3-11. High-Voltage Cable Removal and Installation ...
3-12. Picture Tube Removal ........................................
7-1.
7-2.
7-3.
7-4.
24
24
24
25
25
26
26
(1)
(2)
(3)
(4)
(5)
27
27
28
28
28
(6)
(7)
(8)
4. SET-UP ADJUSTMENTS
Screen Voltage Adjustment
(Rough Alignment) ...........................................
4-2. Focus Rough Adjustment ..................................
4-3. Screen (G2) Adjustment ....................................
4-4. Deflection Yoke Tilt Adjustment ......................
4-5. 2-Pole Magnet Adjustment (Green and Red) ....
4-6. 4-Pole Magnet Adjustment ................................
4-7. Green, Red and Blue Focus Adjustment
4-7-1. Green, Red and Blue Lens Focus
Adjustment ....................................................
4-7-2. Green, Red and Blue Electrical Focus
Adjustment ....................................................
4-1.
(9)
29
29
29
29
30
30
(10)
(11)
(12)
(13)
(14)
(15)
(16)
(17)
(18)
(19)
(20)
(21)
(22)
(23)
30
30
5. SAFETY RELATED ADJUSTMENT
5-1.
HV Hold Down Adjustment .............................
31
6. ELECTRICAL ADJUSTMENTS
6-1. How to Enter the Service Mode
6-1-1. Adjustment Method with Commander ..........
6-1-2. Screen Display on the Test Menu ..................
6-1-3. Service List (Convergence) ...........................
6-2. Registration Adjustment
6-2-1. Registration Adjustment Method ..................
6-2-2. Main Deflection Adjustment .........................
6-2-3. Sub Deflection Adjustment ...........................
6-3. Horizontal Position Adjustment .........................
6-4. Text Position Adjustment ...................................
6-5. White Balance Adjustment ................................
6-6. Sub Brightness Adjustment ................................
6-7. Sub Contrast Adjustment (A or AE Board) .......
(24)
32
32
34
37
37
38
43
43
44
44
44
Page
7. DIAGRAMS
3. DISASSEMBLY
3-1.
3-2.
3-3.
3-4.
3-5.
3-6.
3-7.
3-8.
Title
(25)
(26)
(27)
7-5.
Block Diagrams ..................................................
Frame Schematic Diagram .................................
Circuit Boards Location .....................................
Schematic Diagrams and Printed Wiring
Boards .................................................................
Schematic Diagram of A (1/5) Board
(41PX1/41PX1K) ...............................................
Schematic Diagram of A (2/5) Board
(41PX1/41PX1K) ..............................................
Schematic Diagram of A (3/5) Board
(41PX1/41PX1K) ...............................................
Schematic Diagram of A (4/5) Board
(41PX1/41PX1K) ...............................................
Schematic Diagram of A (5/5) Board
(41PX1/41PX1K) ..............................................
Schematic Diagram of AE (1/5) Board
(41PX1R) ............................................................
Schematic Diagram of AE (2/5) Board
(41PX1R) ...........................................................
Schematic Diagram of AE (3/5) Board
(41PX1R) ...........................................................
Schematic Diagram of AE (4/5) Board
(41PX1R) ...........................................................
Schematic Diagram of AE (5/5) Board
(41PX1R) ...........................................................
Schematic Diagram of D (1/3) Board ................
Schematic Diagram of D (2/3) Board ................
Schematic Diagram of D (3/3) Board ................
Schematic Diagram of E (1/4) Board ................
Schematic Diagram of E (2/4) Board ................
Schematic Diagram of E (3/4) Board ................
Schematic Diagram of E (4/4) Board ................
Schematic Diagram of ZG Board ......................
Schematic Diagram of ZR Board .......................
Schematic Diagram of CR Board ......................
Schematic Diagram of CG Board ......................
Schematic Diagram of CB Board ......................
Schematic Diagram of U Board
(41PX1/41PX1K) ...............................................
Schematic Diagram of UE Board
(41PX1R) ............................................................
Schematic Diagram of H1 Board .......................
Schematic Diagram of H2 Board .......................
Schematic Diagram of G Board .........................
Semiconductors .................................................
45
52
54
54
55
56
57
58
59
64
65
66
67
68
73
74
75
79
80
81
82
85
86
87
88
89
90
91
92
93
94
96
8. EXPLODED VIEWS
8-1.
8-2.
8-3.
8-4.
Screen and Control Panel Block ...................... 97
Cabinet Block .................................................... 98
Main Bracket Block ........................................... 99
Mechaseal Block ................................................ 100
9. ELECTRICAL PARTS LIST ............................ 101
–3–
KP-41PX1/41PX1K/41PX1R
K
RM-892
RM-892
RM-862
SECTION 1
SELF DIAGNOSIS FUNCTION
Diagnostic Errors
The errors indicated below can be read using an Error Reader Display (Part Number S-188-900-10) connected to the service connector.
Once an error has been detected it will then be displayed on the two digit error reader.
During the power up procedure and during normal run time, the micro’s self diagnostic procedures monitor for various errors, as
described in the table below:
Error Number
Error Description
00
No error (TV Error Reader shows 00 in normal condition)
01
Not allowed (may be confused with SIRCS response flash on LED)
02
Protection circuit trip (Any time)
03
Reserved
04
No Vertical Synchronism
05
AKB
06
IIC SCL Low < Power Up Only >
07
IIC SDA Low < Power Up Only >
08
IIC SDA & SCL Low < Power Up Only >
09
Jungle controller no acknowledge < Power Up Only >
10
Video Switch (CXA2040) no acknowledge < Power Up Only >
11
Tuner no acknowledge
12
MSP no acknowledge
13
NVM no acknowledge
14
AV Switch (CXA2089) no acknowledge
15
Digital micro no acknowledge
16
Port Expander (CXA1875) no acknowledge
17
Multiple devices with no acknowledge <Power Up Only>
18
Cannot initialize jungle (after initial power on check OK) - < Chassis Initialization >
19
Jungle controller response failure after power up check (+9V) test
20
Video Switch (CXA2040) cannot power on reset - < Chassis Initialization >
21
Video Switch (CXA2040) response failure after power up check (+9V)
22
NVM acknowledge fail after initialization (STBY +5V)
23
MSP run-time failure < May Not Be Fatal - Display On Error Reader >
24
DSP run-time failure < May Not Be Fatal - Display On Error Reader >
25
M3L bus Clock low time out after data send < Run-Time Failure >
26
M3L bus Clock low time out after data send < At Power Up Check >
27
M3L bus Clock low time out after data send < At Initialization >
28
M3L Txd Low < Power Up Only >
29
M3L Rxd Low < Power Up Only >
30
M3L Enable Low < Power Up Only >
31
Compact Text test fail < Power Up Only >
32
Compact Text does not respond (+5V test)
33
Compact text run-time failure < May Not Be Fatal - Display On Error Reader >
–4–
KP-41PX1/41PX1K/41PX1R
K
RM-892
RM-892
RM-862
Protection Error (Error 2):
Once every main loop (approximately 200ms OSD mode, 50ms text or menu mode), the micro checks the protection pin (pin 66). If the
protection pin is high 6 successive times, a protection error is diagnosed. The protection pin is not checked during the first 3-4 seconds
after AC on.
If this error is diagnosed, the respective NVM register will be updated and the set goes straight into diagnostic standby with 2 flashes
- no reset is attempted.
AKB Error (Error 5):
Once every main loop the micro checks the AKB stability by reading the IKR return from the jungle. IKR=1 means that AKB is stable,
IKR=0 means that AKB is unstable. If the AKB status is unstable for 10 seconds, an AKB error is diagnosed. AKB stability is not
checked during the first 20 seconds after AC on.
If this error is diagnosed, the respective NVM register will be updated and the response LED will flash 5 times continually, but the set
will not go into standby. If the AKB status becomes stable, and remains stable for 10 seconds, the LED will stop flashing.
0
10
20
30
Time/seconds
50
60
40
70
80
90
100
IKR
Return
A
A.
B.
C.
D.
E.
F.
B
C
D
E
F
IKR Return first goes high after 12 seconds
Micro begins checking IKR Return status 20 seconds after power on
Micro detects IKR return=0
Micro detects that IKR has been 0 for 10 seconds; NVM counter is incremented and the LED starts flashing (flashes
5 times, off for 2 seconds, flashes 5 times, etc.)
Micro detects that IKR=1; LED continues to flash
Micro detects that IKR has been high for 10 seconds; LED stops flashing.
Startup Diagnostic Errors (Errors 6-16, 26, 28-31):
These errors are checked for during the power up sequence before attempting to retrieve data from the NVM.
6 - SCL pin low
7 - SDA pin low
8 - Both the SCL and the SDA pin are low
9 - No acknowledge from the jungle (CXA2076)
10 - No acknowledge from the video switch (CXA2040)
11 - No acknowledge from the tuner
12 - No acknowledge from the MSP
13 - No acknowledge from the NVM
14 - No acknowledge from the CXA2089 video switch
16 - No acknowledge from the CXA1875 Port Expander
26 - M3L_TXD pin low after Compact Text RAM test
28 - M3L_TXD pin low
29 - M3L_RXD pin low
30 - M3LEN pin low
31 - Compact Text RAM test fail
If any of these errors are detected, the respective NVM register will be incremented. The software will then carry on with the power up
sequence.
–5–
KP-41PX1/41PX1K/41PX1R
K
RM-892
RM-892
RM-862
General I2C Device Run-time Errors (Errors 18-22):
18 - No acknowledge from Jungle when attempting to initialize
19 - No acknowledge from Jungle when attempting to read registers
20 - AV Switch cannot complete reset during initialization
21 - No acknowledge from AV Switch when attempting to read registers
22 - No acknowledge from NVM when attempting to read or write
If any of these errors are detected, the respective NVM register will be incremented and the software will carry on.
Compact Text Run-time Errors (Errors 25, 27, 32 & 33):
25 - M3L_TXD pin low when checking register 81 (implies that no communication was possible)
27 - M3L_TXD pin low when attempting to initialize (implies that no communication was possible)
32 - Compact Text RAM test fail during initialization of devices
In the case of these errors, the ‘device reset’ pin will be held low for 60ms, causing a hardware reset of Compact Text. Following this
reset, a longer timeout will be allowed for the M3L bus to recover. If the error still exists, the NVM register will be incremented and the
software will carry on.
Device
Rest Pin
A
A.
B.
C.
D.
E.
F.
B
C
IKR Return first goes high after 12 seconds
Micro begins checking IKR Return status 20 seconds after power on
Micro detects IKR return=0
Micro detects that IKR has been 0 for 10 seconds; NVM counter is incremented and the LED starts flashing (flashes
5 times, off for 2 seconds, flashes 5 times, etc.)
Micro detects that IKR=1; LED continues to flash
Micro detects that IKR has been high for 10 seconds; LED stops flashing.
33 - Register 81 check fail, but M3L_TXD pin high (implies that Compact Text has either reset or
become corrupted).
In this case, the ‘device reset’ pin will be held low for 60ms, causing a hardware reset of Compact Text. Compact Text will then be reinitialized and the NVM counter updated. This is the same as for errors 26, 28 and 33 except that the M3L bus timeout is not changed.
Also, during the reset, Compact Text OSD will be disabled (using pin 59 of the micro). Only when the sync registers have been
refreshed twice, will the OSD be enabled.
MSP and DSP Run-time Errors (Errors 23 & 24):
Error 23 can be caused by any of the following:
- After MSP initialization, Scart Prescale Register check fail (implies that the MSP has either reset or become corrupted).
- MSP fails to acknowledge reset instruction
- Scart Prescale Register check fail (implies that the MSP has either reset or become corrupted).
Error 24 is caused by:
- DSP test byte corrupted (implies that the DSP has either reset or become corrupted).
For both of these errors, the software will refresh the MSP and DSP registers. If the errors still exist, the NVM counter will be
incremented, and the software will carry on.
–6–
KP-41PX1/41PX1K/41PX1R
K
RM-892
RM-892
RM-862
Error Display Mode
Error Display Mode is entered by the following sequence of commands:
Standby → Information → Digit 5 → Volume Down → TV
This mode will display a special menu, which will list all possible errors and the number of occurrences of each error (0 – 255, as stored
in the NVM). There will also be a display of the current error (00 if no error). This display mode will appear as follows:
ERROR DISPLAY MODE
Current Error Code = 00
Error Code
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
Occurrences
2
—
—
0
0
0
0
0
0
0
0
0
0
3
0
0
Error Code
18
19
20
21
22
23
24
25
26
27
28
29
30
31
32
33
Occurrences
0
0
0
0
0
0
4
5
89
3
0
0
0
0
3
38
Whilst in this mode, the number of occurrences of each error can be reset to 0 by TT08.
Only AC off or standby off can exit this mode.
The Current Error Code can also be read by using a TV Error Reader (I2C slave address 42H). This device simply receives 1 data byte,
which is the error number in binary coded decimal form.
–7–
KP-41PX1/41PX1K/41PX1R
K
RM-892
RM-892
RM-862
TT command table
TT Mode is available by pressing the test key twice. It is exited by pressing 0 twice, or by pressing the Test key, or by pressing the TV
key or by switching the set into standby.
Pressing the Menu key when in TT mode enters in main Test Menu. Pressing the Menu key again enters in the User Menus.
TT Modes 40-49 require TV to be in program 59 before the command is accepted. Some Test models are dependant upon the model.
Code
Function
Code
<Menu> Enter into Service Menu
00
Exit from TT mode
01
Set Picture Level to Maximum
02
Set Picture Level to Minimum
03
29
Destination E (West Menu / West Text) (41PX1R)
31
32
Set Volume to 30% (41PX1R)
Set Volume to 50%
05
Set Volume to 65%
06
Set Volume to 80%
07
Ageing Mode Enable / Disable
08
Shipping Condition
09
33
34
35
Display TV Status (41PX1/41PX1K)
36
Sub Picture Adjustment (41PX1/41PX1K)
17
37
Sub Colour Adjustment (41PX1/41PX1K)
38
Sub Brightness Adjustment (41PX1/41PX1K)
21
22
39
Text H-Position Adjustment (41PX1/41PX1K)
41
Picture Reset
42
Default Program Info in NVM with Pencoed Factory
43
Channel Setup (41PX1/41PX1K)
Set All Program Labels to Default (41PX1R)
44
Default Favourite Pages to 100, 101, 102, 103
Destination A/D (East Menu / West Text) (41PX1/41PX1K)
45
Switch Off All Channel Locks
Sub Picture Adjustment (41PX1R)
46
Reserved for Dealer Commander
Destination L (West Menu / West Text) (41PX1/41PX1K)
47
Default MSP Settings
Factory Mode Toggle (41PX1/41PX1K)
Default Geometry Settings (41PX1R)
48
Destination E ( West Menu / West Text) (41PX1/41PX1K)
Sub Brightness Adjustment (41PX1R)
25
Destination D (East Menu / Greek Text)
Set NVM as Non-virgin (41PX1/41PX1K)
Restore NVM Test Byte
49
Undo TT49 (41PX1R)
Set NVM as Virgin (41PX1/41PX1K)
Delete NVM Test Byte Sets Virgin NVM (41PX1R)
51
Destination AEP (East Menu / West Text / Greek Text)
No Function (41PX1/41PX1K)
Text Interlace Odd (non interlace mode = 3) (41PX1R)
(41PX1/41PX1K)
52
Destination B (East Menu / West Text) (41PX1R)
28
Default Program Info in NVM with Pencoed Factory
Channel Cetup (41PX1R)
Set Volume to 20% (41PX1/41PX1K)
Destination U (West Menu / West Text)
27
Re-initialize NVM
Re-initialize Geometry Settings (41PX1/41PX1K)
Headphones Volume by Pressing Arrows (41PX1/41PX1K)
24
26
Reserved for Dealer Commander (41PX1/41PX1K)
No Function (41PX1R)
Sub Colour Adjustment (41PX1R)
23
No Function (41PX1/41PX1K)
25'' Reset (41PX1R)
RGB Priority Enable / Disable (41PX1R)
19
No Function (41PX1/41PX1K)
25'' Set (41PX1R)
Set All AV Labels to Default (41PX1R)
18
No Function (41PX1/41PX1K)
Rotation Test (41PX1R)
Display TV Status (41PX1R)
15
No Function (41PX1/41PX1K)
Setup Trap Switch (41PX1R)
Scart 16 : 9 Enable / Disable (41PX1R)
14
No Function (41PX1/41PX1K)
Sub Woofer Disable (41PX1R)
Enable OSD (41PX1R)
13
Toggle Terminal Debug Mode (41PX1/41PX1K)
Sub Woofer Enable (41PX1R)
Clear & Disable OSD (41PX1R)
12
Toggle Bit Error Rate Display (41PX1/41PX1K)
Destination R (Russian Menu / Russian Text) (41PX1R)
Reset Language Select Menu on Power Up (41PX1R)
11
Toggle Auto Shutoff Disable (41PX1/41PX1K)
Destination A (East Menu / West Text) (41PX1R)
Set Volume to 35% (41PX1/41PX1K)
04
Function
No Function (41PX1/41PX1K)
No Function (41PX1/41PX1K)
Text Interlace Even (non interlace mode = 2) (41PX1R)
Destination K (East Menu / East Text)
53
Destination R (Russian Menu / Russian Text) (41PX1/41PX1K)
Destination L (West Menu / West Text) (41PX1R)
–8–
No Function (41PX1/41PX1K)
Auto Picture ON (41PX1R)
KP-41PX1/41PX1K/41PX1R
K
Code
54
Function
Code
No Function (41PX1/41PX1K)
78
Auto Picture OFF (41PX1R)
55
56
79
Wide Setup
81
Velocity Modulation ON
Set Colour to Minimum and Picture to Maximum
82
Velocity Modulation OFF
(41PX1/41PX1K)
83
84
(41PX1/41PX1K)
85
Set Picture Level to 50% (41PX1/41PX1K)
86
87
N Board Reset (41PX1/41PX1K)
88
Toggle the 3.3 V Regulator on A2 Board (41PX1/41PX1K)
89
Toggle Attenuation Switch on Port Expander (41PX1/41PX1K)
91
(41PX1/41PX1K)
92
93
94
Save Geometry (41PX1/41PX1K)
95
96
97
98
99
(41PX1/41PX1K)
No Function (41PX1/41PX1K)
Set Test Menu (41PX1R)
Dual Sound Headphones (v : A, V : B) (41PX1/41PX1K)
Jungle Select (CXA2000 or CXA2076) (41PX1R)
Dual Sound Speakers (v : A, V : B) (41PX1/41PX1K)
Text H-Position Adjustment (41PX1R)
Switch Main Speakers / Center (41PX1/41PX1K)
Picture Reset (41PX1R)
Dolby Enable / Disable Toggle (41PX1/41PX1K)
MSP BG Filter Enabled (41PX1R)
77
No Function (41PX1/41PX1K)
Toggle Compact Text Acquisition Delay Bit 4 (41PX1R)
LumiSponder Curve 2 (41PX1R)
76
Toggle MHEG Mode (41PX1/41PX1K)
Toggle Compact Text Acquisition Delay Bit 3 (41PX1R)
Select Compact Text / Compact Text-2 (41PX1/41PX1K)
Balance Left / Right (b : Left, B : Right, v : Center)
75
Set All Program Labels to Default (41PX1/41PX1K)
Toggle Compact Text Acquisition Delay Bit 2 (41PX1R)
Toggle Partial Digital Off-flag (41PX1/41PX1K)
LumiSponder Curve 1 (41PX1R)
74
Reset Language Select Menu on Power Up (41PX1/41PX1K)
Toggle Compact Text Acquisition Delay Bit 1 (41PX1R)
Pre-set AV Labels (41PX1/41PX1K)
Diagnostics ON (41PX1R)
73
D / K Nicam Disable (41PX1/41PX1K)
Toggle Compact Text Acquisition Delay Bit 0 (41PX1R)
Diagnostics OFF (41PX1R)
72
D / K Nicam Eable (41PX1/41PX1K)
Sound Center Mode PHANTOM (41PX1R)
Restart Digicon (41PX1/41PX1K)
No Function (41PX1R)
71
Eable OSD (41PX1/41PX1K)
Sound Center Mode WIDE (41PX1R)
Active Standby Setup (41PX1/41PX1K)
DSP Bypass (41PX1R)
69
Clear & Disable OSD (41PX1/41PX1K)
Sound Center Mode NORMAL (41PX1R)
Noise Surround (41PX1R)
68
Diagnostics ON (41PX1/41PX1K)
Compact Text Acquisition Eable (41PX1R)
Noise Centre (41PX1R)
67
Diagnostics OFF (41PX1/41PX1K)
Compact Text Acquisition Disable (41PX1R)
Smart Link Test - Toggle the Smart Link Pin 50 Times
66
Auto Cut Off Disable (41PX1/41PX1K)
Select Shop Mode (41PX1R)
Noise Right (41PX1R)
65
Auto Cut Off Enable (41PX1/41PX1K)
Picture Rise OFF (41PX1R)
No Function (41PX1/41PX1K)
Noise Left (41PX1R)
64
Text Interlace Even (non interlace mode=2) (41PX1/41PX1K)
Picture Rise Step 160ms (41PX1R)
Dolby Pro-logic ON (41PX1R)
63
Text Interlace Odd (non interlace mode=3) (41PX1/41PX1K)
Picture Rise Step 80ms (41PX1R)
Auto IF Display (41PX1R)
62
Special Picture Mode (41PX1/41PX1K)
Picture Rise Step 40ms (41PX1R)
AV3 Disable (if TV Text) otherwise AV3 Enable (41PX1R)
61
Function
Auto Cut Off Enable (41PX1R)
AV3 Enable (41PX1R)
59
RM-862
Set Screen Size (41PX1/41PX1K)
No Function (41PX1/41PX1K)
Set Colour & Picture to Minimum and Adjust Sub Brightness
58
RM-892
MSP BG Filter Disabled (41PX1R)
Auto Cut Off Disable (41PX1R)
57
RM-892
Setup Trap Switch (41PX1/41PX1K)
Sound Reset (41PX1R)
–9–
SECTION 2
The operating instructions mentioned here are partial abstracts
from the Operating Instruction
Manual. The page numbers of
the Operating Instruction Manual remein as in the manual.
GENERAL
Getting Started - Overview
Getting Started - Overview
Checking the Accessories Supplied
Overview
of Remote
Control
Buttons
Checking the
Accessories
Supplied
VIDEO
TV
Checking the Accessories Supplied
1
2
3
4
5
6
7
8
9
Displaying the time
0
VIDEO
7KLVEXWWRQGRHVQRWZRUNRQWKLVVHW
3UHVVWRVZLWFKWKHWLPHRQRURII
DYDLODEOHRQO\ZKHQWHOHWH[WLV
EURDGFDVW
VCR operation
PROGR
7ZREDWWHULHV5W\SH
MENU
TV
VTR 1 2 3 4 DVD
)RUPRUHGHWDLOVSOHDVHUHIHUWRWKH
VHFWLRQ5HPRWH&RQWURORIRWKHU
6RQ\(TXLSPHQW
RM 892
CH
S
2QH5HPRWH&RQWURO
50
– 10 –
Muting the Sound
3UHVVWRPXWH79VRXQG
3UHVVDJDLQWRUHVWRUHWKHVRXQG
VIDEO
VCR on/off
3UHVVWRVZLWFK\RXU9&5RQRURII
TV
Selecting TV mode
3UHVVWRVZLWFKRII7HOHWH[WRUYLGHRLQSXW
Overview of Projection TV Buttons
Selecting Teletext
3UHVVWRVZLWFKRQ7HOHWH[W
7KHVHEXWWRQVGRQRWZRUNRQWKLVVHW
Selecting channels
3UHVVWRVHOHFWFKDQQHOV
)RUGRXEOHGLJLWSURJUDPPHQXPEHUVHJ
SUHVVILUVWWKHQWKHEXWWRQVDQG
,I\RXHQWHUDQLQFRUUHFWILUVWGLJLWWKLV
VKRXOGEHFRUUHFWHGE\HQWHULQJDQRWKHUGLJLW
DQGWKHQVHOHFWLQJEXWWRQDJDLQWR
HQWHUWKHSURJUDPPHQXPEHURI\RXUFKRLFH
1
2
3
4
5
6
7
8
9
PROGR
3XVKXSWKHIODSRQWKH
IURQWRIWKHSURMHFWLRQ79
WRUHYHDOWKHIURQWSDQHO
3URJUDPPH
XSRUGRZQ
EXWWRQV
VHOHFWV79
FKDQQHOV
6WDQGE\
LQGLFDWRU
On/Off
6ZLWFK
Selecting Picture mode
3UHVVUHSHDWHGO\WRFKDQJHWKHSLFWXUHPRGH
MENU
Adjusting TV Volume
3UHVVWRDGMXVWWKHYROXPHRIWKH79
RM 892
S
Selecting Input source
3UHVVUHSHDWHGO\XQWLOWKHGHVLUHGLQSXW
V\PERORIWKHVRXUFHDSSHDUVRQWKHVFUHHQ
Selecting Screen format
3UHVVUHSHWHDGO\WRFKDQJHWKHIRUPDWRI
WKHVFUHHQIRUPRUHGHWDLOVSOHDVHUHIHUWR
WKHVHFWLRQ´&KDQJLQJWKH6FUHHQIRUPDWµ
Selecting Sound mode
3UHVVUHSHDWHGO\WRFKDQJHWKHVRXQGPRGH
9ROXPH
FRQWURO
EXWWRQV
Displaying On Screen Information
3UHVVWRGLVSOD\DOORQVFUHHQLQGLFDWLRQV
3UHVVDJDLQWRFDQFHO
Back to the channel last watched
3UHVVWRZDWFKWKHODVWFKDQQHOVHOHFWHG
ZDWFKHGIRUDWOHDVWVHFRQGV
0
K
6HOHFWLQJ
LQSXW
VRXUFH
To Temporarily Switch Off projection
TV
3UHVVWRWHPSRUDULO\VZLWFKRII79WKH
VWDQGE\LQGLFDWRU
RQWKHVHWOLJKWVXSLQ
UHG3UHVVDJDLQWRVZLWFKRQ79IURP
VWDQGE\PRGH
To save energy we recommend switching off
completely when TV is not in use.
$IWHUPLQXWHVZLWKRXWDVLJQDO
DQGZLWKRXWDQ\EXWWRQEHLQJSUHVVHG
WKHVHWVZLWFKHVDXWRPDWLFDOO\LQWR
VWDQGE\PRGH
This button only works in Teletext mode.
Function
associated to this button does not
work with this set.
Joystick for menu selection
4 6FUROO8S
$ 6FUROO'RZQ
Z 3UHYLRXVPHQXRUVHOHFWLRQ
z 1H[WPHQXRUVHOHFWLRQ
OK &RQILUPV\RXUVHOHFWLRQ
Selecting channels
3UHVVWRVHOHFWWKHQH[WRUSUHYLRXVFKDQQHO
Displaying the menu system
3UHVVWRGLVSOD\WKHPHQXRQWKHVFUHHQ
3UHVVDJDLQWRUHPRYHWKHPHQXGLVSOD\
IURPWKHVFUHHQ
+HDGSKRQH
69LGHR 9LGHR
MDFN
,QSXW
,QSXW
MDFN
MDFN
6
Getting Started - Push up
$XGLR
,QSXW
MDFNV
$XWR
6WDUWXS
EXWWRQ
$XWR
&RQYHUJHQFH
EXWWRQ
%HVLGHV79IXQFWLRQVDOOFRORXUHGEXWWRQVDVZHOODVJUHHQ
V\PEROVDUHDOVRXVHGIRU7HOHWH[WRSHUDWLRQ)RUPRUHGHWDLOV
SOHDVHUHIHUWRWKH7HOHWH[WVHFWLRQRIWKLVLQVWUXFWLRQPDQXDO
Getting Started - Overview
7
GB
Getting Started - Installation
Getting Started - First Time Operation
Inserting Batteries into the Remote Control
Selecting Language
8VHWKLVIXQFWLRQWRFKDQJHWKHODQJXDJHRIWKHPHQXVFUHHQV
7KHILUVWWLPHWKDW\RXVZLWFKRQ\RXUSURMHFWLRQ79WKH/DQJXDJHPHQXDSSHDUVDXWRPDWLFDOO\
+RZHYHULI\RXQHHGWRFKDQJHWKHODQJXDJHPHQXDIWHUZDUGVVHOHFWWKHPHQX/DQJXDJHLQWKH
SURFHHGLQWKHVDPHZD\DVGHVFULEHGEHORZ
0DNHVXUH\RXLQVHUWWKHEDWWHULHVXVLQJWKHFRUUHFWSRODULWLHV
$OZD\VUHPHPEHUWRGLVSRVHRIXVHGEDWWHULHVLQDQHQYLURQPHQWDOIULHQGO\ZD\
1 3UHVVWKH
on/offEXWWRQRQ\RXUSURMHFWLRQ79VHWWRVZLWFKRQ\RXU
797KHILUVWWLPH\RXSUHVVWKHRQRIIEXWWRQRQ\RXU79VHWWKH
ODQJXDJHPHQXGLVSOD\VDXWRPDWLFDOO\RQWKH79VFUHHQ
35(6(7PHQXDQG
LANGUAGE
English
Deutsch
Fran ais
Espa ol
Suomi
Nederlands
Portugu s
Suenska
Dansk
Norsk
Italiano
Česki
Magyar
Eλλnvιkά
LANGUAGE
English
Deutsch
Fran ais
Espa ol
Suomi
Nederlands
Portugu s
Suenska
Dansk
Norsk
Italiano
Česki
Magyar
Eλλnvιkά
Select Language:
Confirm: OK
Select Language:
Confirm: OK
Connecting the Aerial and VCR
GB
VIDEO
TV
WKHQSUHVVOKWRFRQILUP\RXUVHOHFWLRQ
– 11 –
9&5
RU
OUT
2 3XVKWKHMR\VWLFNRQWKHUHPRWHFRQWURO$RU4WRVHOHFWWKHODQJXDJH
,I\RXVHOHFW´)UHQFKµODQJXDJHWKH´$XWR7XQLQJµSURFHVV
ZLOOVWDUWVHDUFKLQJ79FKDQQHOVRQ´/µ79V\VWHPIRU)UDQFH
DQGODWHU%*
IN
LANGUAGE
English
Deutsch
Fran ais
Espa ol
Suomi
Nederlands
Portugu s
Suenska
Dansk
Norsk
Italiano
Česki
Magyar
Eλλnvιkά
Select Language:
Confirm: OK
7KH6FDUWOHDGLVRSWLRQDO
,I\RXXVHWKLVRSWLRQDOFRQQHFWLRQLWFDQLPSURYHSLFWXUHDQGVRXQGTXDOLW\ZKHQXVLQJD9&5
,I\RXGRQRWXVHD6&$57OHDGDIWHUDXWRPDWLFDOO\WXQLQJWKHSURMHFWLRQ79UHIHUWRWKH´0DQXDOO\7XQLQJWKH79µVHFWLRQ
RIWKLVLQVWUXFWLRQPDQXDOWRWKHWXQHLQWKHVHWWRWKHRXSXWRI\RX9&5$OVRUHIHUWR\RXU9&5LQVWUXFWLRQPDQXDOWR
ILQGRXWKRZWRILQGWKHRXWSXWFKDQQHORI\RXU9&5
1
2
3
4
5
6
8
9
7
0
The Auto Tuning menu appears on the projection TV screen in the selected
language.
Do you want to start
automatic tuning?
Yes
No
Confirm: OK
Switching on the projection TV
PROGR
MENU
RM 892
S
3XVKLQWKH 2Q2II
VZLWFKRQWKHIURQWRIWKH
SURMHFWLRQ79
&RQQHFWWKHSURMHFWLRQ
79SOXJWRWKH
PDLQVVRFNHW
9$&+]
8
Getting Started - Installation
Getting Started - First Time Operation
9
Getting Started - First Time Operation
Getting Started - First Time Operation
Automatically Tuning the TV using the Remote Control
Changing the Programme Order of the TV channels
<RXQHHGWRWXQHWKHVHWWRUHFHLYHFKDQQHOV79%URDGFDVW%\IROORZLQJWKHLQVWUXFWLRQVEHORZWKLVSURMHFWLRQ79
DXWRPDWLFDOO\VHDUFKHVDQGVWRUHVDOODYDLODEOHFKDQQHOVIRU\RX
$IWHUKDYLQJVHOHFWHGWKHODQJXDJHDQHZPHQXDSSHDUVDXWRPDWLFDOO\RQWKHSURMHFWLRQ79VFUHHQDVNLQJ\RXWR
DXWRPDWLFDOO\WXQHWKH79+RZHYHULI\RXQHHGWRFKDQJHRUUHSHDWWKHWXQLQJDIWHUZDUGVHJZKHQ\RXPRYHKRXVHVHOHFW
WKHPHQX$XWR3URJUDPPHLQWKH 35(6(7PHQXDQGSURFHHGLQWKHVDPHZD\DVGHVFULEHGEHORZRUSOHDVHUHIHUWRWKH
VHFWLRQ$XWRPDWLFDOO\7XQLQJWKH79RIWKLVLQVWUXFWLRQPDQXDO
$IWHUDOODYDLODEOHFKDQQHOV79%URDGFDVWDUHFDSWLRQHGDQGVWRUHGDQHZPHQXDSSHDUVDXWRPDWLFDOO\RQWKHVFUHHQWR
FKDQJHWKHRUGHULQZKLFKWKHFKDQQHOVDSSHDURQWKHVFUHHQ
+RZHYHULI\RXZLVKWRUHDUUDQJHWKHRUGHURIWKHFKDQQHOVDIWHUZDUGVVHOHFWWKHPHQX3URJUDPPH6RUWLQJLQWKH 35(6(7PHQXDQGSURFHHGLQWKHVDPHZD\DVGHVFULEHGLQWKHEVHFWLRQRIWKLVFKDSWHU
a) If you do not wish to change the channel order:
VIDEO
VIDEO
TV
1 3UHVVWKH OKEXWWRQRQWKHUHPRWHFRQWUROWRVHOHFWYES$QHZPHQX
TV
1 3UHVVWKH MENUEXWWRQRQWKHUHPRWHFRQWUROWRH[LWDQGUHWXUQWRWKH
QRUPDO79VFUHHQ
Do you want to start
automatic tuning?
DSSHDUVDXWRPDWLFDOO\RQWKHVFUHHQDVNLQJ\RXWRFKHFNWKDWWKH
DQWHQQDLVFRQQHFWHG
Yes
No
Confirm: OK
PROGRAMME SORTING
PROG
0
1
2
3
4
5
6
7
8
9
SYS CHAN LABEL
B/G C 28 BBC-W
B/G C 40 MV-CH
B/G C 41 TVE-1
B/G C 31 TVE-2
B/G C 34 ANT-3
B/G C 27 TELE 5
B/G C 47 C PLUS
B/G C 44 - - - - B/G C 23 - - - - B/G C 35 CNN -
Select PROG:
Exit: MENU
+ OK
When the automatic tuning is finished, the Programme Sorting menu
appears on the screen.
2 &RQILUPWKDWWKHDQWHQQDLVFRQQHFWHGDQGWKHQSUHVVWKHOKEXWWRQ
Please confirm that
antenna is connected
Confirm: OK
1
2
3
4
5
6
– 12 –
7
8
9
0
7KHDXWRPDWLFWXQLQJVWDUWVDQGWKHPHVVDJH$872
352*5$00(IODVKHVRQWKHVFUHHQ
7KLVSURFHGXUHFRXOGWDNHVRPHPLQXWHV3OHDVHEHSDWLHQWDQG
GRQRWSUHVVDQ\EXWWRQRWKHUZLVHWKHDXWRPDWLFWXQLQJZLOO
QRWEHFRPSOHWHG
SYS
B/G
CH
C 26
2
3
5
6
7
8
9
1 3XVKWKHMR\VWLFNRQWKHUHPRWHFRQWUROWR$RU4WRVHOHFWWKH
LABEL
-----
SURJUDPPHQXPEHUZLWKWKHFKDQQHO79%URDGFDVW\RXZLVKWR
UHDUUDQJHWKHQSUHVVOK
PROGRAMME SORTING
PROGR
When the automatic tuning is finished, the Programme Sorting menu
appears on the screen.
MENU
RM 892
PROGRAMME SORTING
AUTO PROGRAMME
PROG
0
1
2
3
4
5
6
7
8
9
SYS CHAN LABEL
B/G C 28 BBC-W
B/G C 40 MV-CH
B/G C 41 TVE-1
B/G C 31 TVE-2
B/G C 34 ANT-3
B/G C 27 TELE 5
B/G C 47 C PLUS
B/G C 44 - - - - B/G C 23 - - - - B/G C 35 CNN -
Select PROG:
Exit: MENU
GB
b) If you wish to change the channel order:
0
AUTO PROGRAMME
PROG
1
1
4
SYS CHAN LABEL
B/G C 28 BBC-W
B/G C 40 MV-CH
B/G C 41 TVE-1
B/G C 31 TVE-2
B/G C 34 ANT-3
B/G C 27 TELE 5
B/G C 47 C PLUS
B/G C 44 - - - - B/G C 23 - - - - B/G C 35 CNN -
Select PROG:
Exit: MENU
PROGR
+ OK
MENU
2
3XVKWKHMR\VWLFNWR$RU4WRVHOHFWWKHQHZSURJUDPPHQXPEHU
SRVLWLRQIRU\RXUVHOHFWHGFKDQQHO79%URDGFDVWWKHQSUHVVOK
RM 892
7KHVHOHFWHGFKDQQHOQRZPRYHVWRLWVQHZSURJUDPPHSRVLWLRQ
DQGWKHRWKHUFKDQQHOVPRYHDFFRUGLQJO\
S
+ OK
S
Notes: ‡7RVWRSWKHDXWRPDWLFWXQLQJSUHVVWKH0(18EXWWRQ
‡,I\RXVWRSWKHDXWRPDWLFWXQLQJE\SUHVVLQJWKH0(18
EXWWRQWKH3URJUDPPH6RUWLQJPHQXGRHVQRWDSSHDU
DXWRPDWLFDOO\RQWKHVFUHHQ
PROG
0
1
2
3
4
5
6
7
8
9
PROGRAMME SORTING
PROG
0
1
2
3
4
5
6
7
8
9
SYS CHAN LABEL
B/G C 40 MV-CH
B/G C 41 TVE-1
B/G C 31 TVE-2
B/G C 34 ANT-3
B/G C 27 TELE 5
B/G C 47 C PLUS
B/G C 44 - - - - B/G C 23 - - - - B/G C 35 CNN B/G C 28 BBC-W
Select Position:
Confirm: OK
3
5HSHDWVWHSVDQGLI\RXZLVKWRFKDQJHWKHRUGHURIWKHRWKHU
FKDQQHOV
4
3UHVVWKH0(18EXWWRQWRH[LWDQGUHWXUQWRWKHQRUPDO79VFUHHQ
Your projection TV is now ready for use.
10
Getting Started - First Time Operation
Getting Started - First Time Operation
11
Getting Started - First Time Operation
Getting Started - First Time Operation
Adjusting Colour Registration (Convergence)
Adjusting Colour Registration (Convergence)
MENU
'XHWRWKHHDUWK·VPDJQHWLVPWKHSLFWXUHPLJKWEHFRPHXQGHILQHGDQG\RXFRXOGVHHGLIIHUHQWFRORXUVRQWKHRXWOLQHVRIWKH
LPDJHV,QWKDWFDVHSURFHHGDVIROORZV
3UHVVWKH0(18EXWWRQRQWKHUHPRWHFRQWUROWRGLVSOD\WKHPHQXRQWKHVFUHHQ
PICTURE CONTROL
Picture Mode
Contrast
Reset
Format
4:3
SOUND CONTROL
Auto converge the Red, Green, and Blue
Lines
Sound Mode
Balance
Reset
Dolby Virtual
Dual Sound
Volume Offset
Volume
Dual Sound
Speaker
1 3XVKXSWKHIODSRQWKHIURQWRIWKHSURMHFWLRQ79WRUHYHDOWKHIURQW
TV Screen
Output
Off
Mono
0
Mono
Main
[TV - - - - - - -]
[AV1 - - - - - - -]
TV
2 3UHVV
AV1
TIMER
Sleep Timer
– 13 –
Notes:
7KH$XWR&RQYHUJHQFHIXQFWLRQGRHVQRWZRUN
‡ZKHQQRVLJQDOLVLQSXW
‡ZKHQWKHLQSXWVLJQDOLVZHDN
‡ZKHQWKHVFUHHQLVH[SRVHGWRVSRWOLJKWVRUGLUHFWVXQOLJKW
‡ZKHQ\RXZDWFKWKHWHOHWH[WEURDGFDVW
1 3UHVVWKHMENUEXWWRQRQWKHUHPRWHFRQWUROWRGLVSOD\WKHPHQXRQ
WKHVFUHHQ
2 3XVKWKHMR\VWLFNWR$WRVHOHFWWKHV\PERO
WRWKHPRESETPHQX
Personal
4:3
)RUGLIIHUHQWDGMXVWPHQWVSOHDVHUHIHUWR
WKHVHFWLRQ$GMXVWLQJWKH6RXQG
Personal
Off
Mono
0
Mono
Main
)RUPRUHGHWDLOVSOHDVHUHIHUWRWKH
VHFWLRQ6HOHFWLQJWKHRXWSXWVRXUFHIRUWKH
(XUR$9FRQQHFWRUV
VIDEO CONNECTION
TV Screen
Output
[TV - - - - - - -]
[AV1 - - - - - - -]
TV
AV1
TIMER
Off
PRESET
Auto Programme
Manual Programme Preset
Further Programme Preset
AV Label Preset
Programme Sorting
Parental Lock
Language
Convergence
Sleep Timer
)RUPRUHGHWDLOVSOHDVHUHIHUWRWKH
VHFWLRQ8VLQJWKH6OHHS7LPHU
1:00
PRESET
Auto Programme
Manual Programme Preset
Further Programme Preset
AV Label Preset
Programme Sorting
Parental Lock
Language
Convergence
PRESET
If you wish a more accurate
convergence adjustment
TV
Sound Mode
Balance
Reset
Dolby Virtual
Dual Sound
Volume Offset
Volume
Dual Sound
Speaker
EXWWRQRQWKHSURMHFWLRQ79
The Auto Convergence function works for about 30 seconds. When the white
cross disappears from the screen, your projection TV is ready for use.
VIDEO
Picture Mode
Contrast
Reset
Format
SOUND CONTROL
Personal
VIDEO CONNECTION
FRQWUROSDQHO
)RUGLIIHUHQWDGMXVWPHQWVSOHDVHUHIHUWR
WKHVHFWLRQ$GMXVWLQJWKH3LFWXUH
PICTURE CONTROL
Personal
Auto Programme
Manual Programme Preset
Further Programme Preset
AV Label Preset
Programme Sorting
Parental Lock
Language
Convergence
Do you want to start
automatic tuning?
Yes
No
Confirm: OK
MANUAL PROGRAMME PRESET
PROG
0
1
2
3
4
5
6
7
8
9
SYS CHAN LABEL
B/G C 40 MV-CH
B/G C 41 TVE-1
B/G C 31 TVE-2
B/G C 34 ANT-3
B/G C 27 TELE 5
B/G C 47 C PLUS
B/G C 44 - - - - B/G C 23 - - - - B/G C 35 CNN B/G C 28 BBC-W
Picture Mode
Contrast
Reset
Format
Personal
4:3
3 3XVKWKHMR\VWLFNWR$RU4RUWRVHOHFW&RQYHUJHQFHWKHQSXVKWRz
PRESET
Auto Programme
Manual Programme Preset
Further Programme Preset
AV Label Preset
Programme Sorting
Parental Lock
Language
Convergence
FURTHER PROGRAMME PRESET
PROG
0
1
2
3
4
5
6
7
8
9
AFT
On
On
On
On
On
On
On
On
On
On
DECODER
Off
Off
AV1
Off
AV2
Off
Off
Off
Off
Off
PRESET
AV LABEL PRESET
1
2
3
4
5
6
7
8
9
0
OLQHVLQUHGDQGEOXH\RXZDQWWRDGMXVW
UHGYHUWLFDOOLQHOHIWULJKWDGMXVWPHQW
UHGKRUL]RQWDOLQHXSGRZQDGMXVWPHQW
EOXHYHUWLFDOOLQHOHIWULJKWDGMXVWPHQW
EOXHKRUL]RQWDOOLQHXSGRZQDGMXVWPHQW
7KHQSUHVVWKHOKEXWWRQ
5 3XVKWKHMR\VWLFNUHSHDWHGO\WR$4ZRUzWRFRQYHUJHWKHVHOHFWHG
OLQHZLWKWKHJUHHQOLQHLQWKHFHQWUHWKHQSUHVVOKWRFRQILUP
PROGR
6 5HSHDWVWHSVDQGWRDGMXVWWKHRWKHUOLQHVXQWLODOOWKHOLQHVKDYH
PRESET
Auto Programme
Manual Programme Preset
Further Programme Preset
AV Label Preset
Programme Sorting
Parental Lock
Language
Convergence
Auto Programme
Manual Programme Preset
Further Programme Preset
AV Label Preset
Programme Sorting
Parental Lock
Language
Convergence
PRESET
Auto Programme
Manual Programme Preset
Further Programme Preset
AV Label Preset
Programme Sorting
Parental Lock
Language
Convergence
PRESET
Auto Programme
Manual Programme Preset
Further Programme Preset
AV Label Preset
Programme Sorting
Parental Lock
Language
Convergence
INPUT
AV1
RGB
AV2
YC2
AV3
PRESET
<RXUSURMHFWLRQ79LVUHDG\IRUXVH
Your projection TV is ready for use.
Auto Programme
Manual Programme Preset
Further Programme Preset
AV Label Preset
Programme Sorting
Parental Lock
Language
Convergence
PRESET
Auto Programme
Manual Programme Preset
Further Programme Preset
AV Label Preset
Programme Sorting
Parental Lock
Language
Convergence
12
)RUPRUHGHWDLOVSOHDVHUHIHUWRWKH
VHFWLRQ0DQXDOO\7XQLQJWKH79
PROG
0
1
2
3
4
5
6
7
8
9
SYS CHAN LABEL
B/G C 28 BBC-W
B/G C 40 MV-CH
B/G C 41 TVE-1
B/G C 31 TVE-2
B/G C 34 ANT-3
B/G C 27 TELE 5
B/G C 47 C PLUS
B/G C 44 - - - - B/G C 23 - - - - B/G C 35 CNN -
PARENTAL LOCK
PROG
0
1
2
3
4
5
6
7
8
9
SYS CHAN LABEL
B/G C 40 MV-CH
B/G C 41 TVE-1
B/G C 31 TVE-2
B/G C 34 ANT-3
B/G C 27 TELE 5
B/G C 47 C PLUS
B/G C 44 - - - - B/G C 23 - - - - B/G C 35 CNN B/G C 28 - - - - -
)RUPRUHGHWDLOVSOHDVHUHIHUWRWKH
VHFWLRQ8VLQJWKH)XUWKHU3URJUDPPH
3UHVHWIXQFWLRQ
)RUPRUHGHWDLOVSOHDVHUHIHUWRWKH
VHFWLRQ8VLQJWKH$9/DEHO3UHVHW
IXQFWLRQ
)RUPRUHGHWDLOVSOHDVHUHIHUWRWKH
VHFWLRQ&KDQJLQJWKH3URJUDPPH
2UGHURIWKH79FKDQQHOV
)RUPRUHGHWDLOVSOHDVHUHIHUWRWKH
VHFWLRQ/RFNLQJ3URJUDPPHV
RYHUODSSHGWRIRUPDZKLWHFURVV
7 3UHVVWKHMENUEXWWRQWRH[LWDQGUHWXUQWRWKHQRUPDO79VFUHHQ
S
LABEL
---------------------
PROGRAMME SORTING
MENU
RM 892
GB
PICTURE CONTROL
WKHQSXVKWRzWRHQWHU
4 3XVKWKHMR\VWLFNWR$RU4WRVHOHFW´WKHOLQHµYHUWLFDODQGKRUL]RQWDO
)RUPRUHGHWDLOVSOHDVHUHIHUWRWKH
VHFWLRQ$XWRPDWLFDOO\7XQLQJWKH79
XVLQJWKH5HPRWH&RQWURO
Getting Started - First Time Operation
LANGUAGE
English
Deutsch
Français
Italiano
Nederlands
Polski
Česki
Magyar
Eλλnvιkά
)RUPRUHGHWDLOVSOHDVHUHIHUWRWKH
VHFWLRQ6HOHFWLQJ/DQJXDJH
)RUPRUHGHWDLOVSOHDVHUHIHUWRWKH
VHFWLRQ$GMXVWLQJ&RORXU5HJLVWUDWLRQ
&RQYHUJHQFH
Getting Started - First Time Operation
13
Advanced Operation - Advanced Presetting
Advanced Operation - Advanced Presetting
Automatically Tuning the TV
Manually Tuning the TV
%HVLGHVWKHH[SODQDWLRQLQWKHVHFWLRQ´$XWRPDWLFDOO\7XQLQJWKH79XVLQJWKH5HPRWH&RQWURO´E\IROORZLQJWKH
LQVWUXFWLRQVEHORZWKLVSURMHFWLRQ79DOVRVHDUFKHVDQGVWRUHVDXWRPDWLFDOO\DOODYDLODEOHFKDQQHOVXVLQJMXVWRQHEXWWRQRI
WKHSURMHFWLRQ79VHWDQGRQHEXWWRQRIWKHUHPRWHFRQWURO
8VHWKLVIXQFWLRQWRSUHVHWFKDQQHOVRUDYLGHRLQSXWVRXUFHRQHE\RQHWRWKHSURJUDPPHRUGHURI\RXUFKRLFH
1 3UHVVWKHMENUEXWWRQRQWKHUHPRWHFRQWUROWRGLVSOD\WKH
VIDEO
TV
PHQXRQWKHVFUHHQ
PICTURE CONTROL
Picture Mode
Contrast
Reset
Format
1 3XVKXSWKHIODSRQWKHIURQWRIWKHSURMHFWLRQ79WRUHYHDOWKHIURQW
Personal
4:3
FRQWUROSDQHO
2 3XVKWKHMR\VWLFNWR$WRVHOHFWWKH
V\PEROWKHQSXVKWRzWR
HQWHUWRWKHPRESETPHQX
2 3UHVVDQGKROGLQWKH
EXWWRQRQWKH79VHWIRUVRPHVHFRQGVXQWLO
DPHQXDSSHDUVDXWRPDWLFDOO\RQWKHVFUHHQDVNLQJ\RXWRFKHFNWKDW
DQWHQQDLVFRQQHFWHG
Please confirm that
antenna is connected
Confirm: OK
1
2
3
4
5
6
7
8
9
Auto Programme
Manual Programme Preset
Further Programme Preset
AV Label Preset
Programme Sorting
Parental Lock
Language
Convergence
3 3XVKWKHMR\VWLFNWR$RU4WRVHOHFWManual Programme Preset
WKHQSXVKWRz
– 14 –
\RXZDQWWRSUHVHWDFKDQQHOWKHQSXVKWRz
3 &RQILUPWKDWWKHDQWHQQDLVFRQQHFWHGDQGWKHQSUHVVWKHOKEXWWRQ
TV
PROGR
Please confirm that
antenna is connected
RQWKHUHPRWHFRQWURO
MENU
Confirm: OK
RM 892
AUTO PROGRAMME
7KHDXWRPDWLFWXQLQJVWDUWVDQGWKHPHVVDJH$872
352*5$00(IODVKHVRQWKHVFUHHQ
1
2
3
4
5
6
8
9
7
0
7KLVSURFHGXUHFRXOGWDNHVRPHPLQXWHV3OHDVHEHSDWLHQWDQG
GRQRWSUHVVDQ\EXWWRQRWKHUZLVHWKHDXWRPDWLFWXQLQJZLOOQRW
EHFRPSOHWHG
PROG
1
SYS
B/G
CH
C 26
LABEL
-----
AUTO PROGRAMME
S
5 3XVKWKHMR\VWLFNWR$RU4WRVHOHFWWKH79%URDGFDVWV\VWHP%*
IRUZHVWHUQHXURSHDQFRXQWULHV'.IRUHDVWHUQHXURSHDQ
FRXQWULHV/IRU)UDQFHRU,IRU8QLWHG.LQJGRPRUDYLGHRLQSXW
VRXUFH$9$9WKHQSXVKWRz
6 3XVKWKHMR\VWLFNWR$RU4WRVHOHFWWKHFKDQQHOWXQLQJ&IRU
WHUUHVWULDOFKDQQHOVRU6IRUFDEOHFKDQQHOVWKHQSXVKWRz
When the automatic tuning procedure is complete, the Programme
Sorting menu appears on the screen:
‡If you do not wish to change the channel order, press the MENU
button on the remote control to exit and return to the normal TV
screen.
‡If you wish to change the channel order, proceed in the same way as
described in the chapter "Changing the Programme Order of the TV
channels", section b).
7 3UHVVWKHQXPEHUEXWWRQVWRHQWHUWKHFKDQQHOQXPEHURIWKH79
%URDGFDVWRUSXVKWKHMR\VWLFNWR4RU$WRVHDUFKIRUWKHQH[W
DYDLODEOHFKDQQHO
,I\RXGRQRWZLVKWRVWRUHWKLVFKDQQHOSXVKWKHMR\VWLFNWR4RU$
WRFRQWLQXHVHDUFKLQJIRUWKHGHVLUHGFKDQQHO
PROGR
Note: 7RVWRSWKHDXWRPDWLFWXQLQJSUHVVWKHMENUEXWWRQRQWKH
UHPRWHFRQWURO
MENU
PRESET
Auto Programme
Manual Programme Preset
Further Programme Preset
AV Label Preset
Programme Sorting
Parental Lock
Language
Convergence
0
4 3XVKWKHMR\VWLFNWR$RU4WRVHOHFWRQZKLFKSURJUDPPHQXPEHU
VIDEO
PRESET
GB
MANUAL PROGRAMME PRESET
PROG
0
1
2
3
4
5
6
7
8
9
SYS CHAN LABEL
B/G C 40 MV-CH
B/G C 41 TVE-1
B/G C 31 TVE-2
B/G C 34 ANT-3
B/G C 27 TELE 5
B/G C 47 C PLUS
B/G C 44 - - - - B/G C 23 - - - - B/G C 35 CNN B/G C 28 BBC-W
MANUAL PROGRAMME PRESET
PROG
0
1
2
3
4
5
6
7
8
9
SYS CHAN LABEL
B/G C 40 MV-CH
B/G C 41 TVE-1
B/G C 31 TVE-2
B/G C 34 ANT-3
B/G C 27 TELE 5
B/G C 47 C PLUS
B/G C 44 - - - - B/G C 23 - - - - B/G C 35 CNN B/G C 28 BBC-W
MANUAL PROGRAMME PRESET
PROG
0
1
2
3
4
5
6
7
8
9
SYS CHAN LABEL
B/G C 40 MV-CH
B/G C 41 TVE-1
B/G C 31 TVE-2
B/G C 34 ANT-3
B/G C 27 TELE 5
B/G C 47 C PLUS
B/G C 44 - - - - B/G C 23 - - - - B/G C 35 CNN B/G C 28 BBC-W
MANUAL PROGRAMME PRESET
PROG
0
1
2
3
4
5
6
7
8
9
SYS CHAN LABEL
B/G C 40 MV-CH
B/G C 41 TVE-1
B/G C 31 TVE-2
B/G C 34 ANT-3
B/G C 27 TELE 5
B/G C 47 C PLUS
B/G C 44 - - - - B/G C 23 - - - - B/G C 35 CNN B/G C 28 BBC-W
8 ,IWKLVLVWKHGHVLUHGFKDQQHO\RXZLVKWRVWRUHSUHVVWKHOK EXWWRQ
9 5HSHDWVWHSVWRLI\RXZLVKWRVWRUHPRUHFKDQQHOV
RM 892
10 3UHVVWKHMENUEXWWRQWRH[LWDQGUHWXUQWRWKHQRUPDO79VFUHHQ
S
Your projection TV is now ready for use.
14
Advanced Operation - Advanced Presetting
Advanced Operation - Advanced Presetting
15
Advanced Operation - Advanced Presetting
Advanced Operation - Advanced Presetting
Using the "Further Programme Preset" function
Locking Programmes
:LWKWKLVIHDWXUH\RXFDQ
D(YHQQRUPDOO\WKHDXWRPDWLFILQHWXQLQJ$)7LVRSHUDWLQJKRZHYHU\RXFDQPDQXDOO\ILQHWXQHWKH79WRREWDLQD
EHWWHUSLFWXUHUHFHSWLRQLIWKHSLFWXUHLVGLVWRUWHGRU
ESUHVHWWKH$9RXWSXWIRUWKHSURJUDPPHSRVLWLRQVRIFKDQQHOVZLWKVFUDPEOHGVLJQDOVHJIURPDSD\79GHFRGHU,Q
WKLVZD\DFRQQHFWHG9&5UHFRUGVWKHXQVFUDPEOHGVLJQDO
1
VIDEO
TV
2
1
2
3UHVVWKHMENUEXWWRQRQWKHUHPRWHFRQWUROWRGLVSOD\WKHPHQXRQ
WKHVFUHHQ
3XVKWKHMR\VWLFNWR$WRVHOHFWWKH
WRWKHPRESETPHQX
V\PEROWKHQSXVKWRzWRHQWHU
3
7KLVIHDWXUHHQDEOHV\RXWRSUHYHQWXQGHVLUDEOHEURDGFDVWVDSSHDULQJRQWKHVFUHHQ:HVXJJHVW\RXXVHWKLVIXQFWLRQWR
SUHYHQWFKLOGUHQIURPZDWFKLQJSURJUDPPHV\RXFRQVLGHUXQVXLWDEOH
1
PICTURE CONTROL
Picture Mode
Contrast
Reset
Format
VIDEO
Personal
TV
4:3
2
PRESET
Auto Programme
Manual Programme Preset
Further Programme Preset
AV Label Preset
Programme Sorting
Parental Lock
Language
Convergence
1
2
4
5
6
4
5
6
8
9
7
8
9
3
– 15 –
4
PROGR
3XVKWKHMR\VWLFNWR$RU4WRVHOHFWFurther Programme PresetWKHQ
SXVKWRz
3XVKWKHMR\VWLFNWR$RU4WRVHOHFWWKHUHOHYDQWSURJUDPPHQXPEHU
WKHQSXVKWRzUHSHDWHGO\WRVHOHFW
MENU
DAFTRU
EDECODER
RM 892
PRESET
Auto Programme
Manual Programme Preset
Further Programme Preset
AV Label Preset
Programme Sorting
Parental Lock
Language
Convergence
AFT
On
On
On
On
On
On
On
On
On
On
DECODER
Off
Off
AV1
Off
AV2
Off
Off
Off
Off
Off
7KHVHOHFWHGLWHPFKDQJHVFRORXU
S
5
DAFT
3XVKWKHMR\VWLFNWR$RU4WRILQHWXQHWKHFKDQQHOIUHTXHQF\RYHUD
UDQJHRIWRWKHQSUHVVWKH OKEXWWRQ
5HSHDWVWHSVDQGDLI\RXZLVKWRILQHWXQHRWKHUFKDQQHOV
EDECODER
3XVKWKHMR\VWLFNWR$RU4WRVHOHFWAV3DQGSUHVVWKHOK
6
3
PICTURE CONTROL
Picture Mode
Contrast
Reset
Format
Personal
4:3
PRESET
Auto Programme
Manual Programme Preset
Further Programme Preset
AV Label Preset
Programme Sorting
Parental Lock
Language
Convergence
3XVKWKHMR\VWLFNWR$RU4WRVHOHFWParental LockWKHQSXVKWRz
PRESET
GB
Auto Programme
Manual Programme Preset
Further Programme Preset
AV Label Preset
Programme Sorting
Parental Lock
Language
Convergence
PROGR
4
MENU
3XVKWKHMR\VWLFNWR$RU4WRVHOHFWWKHSURJUDPPHQXPEHUZLWKWKH
FKDQQHO\RXZLVKWREORFNWKHQSUHVVWKHOK EXWWRQ
7KH V\PERODSSHDUVEHIRUHWKHSURJUDPPHSRVLWLRQWRLQGLFDWH
WKLVSURJUDPPHLVQRZEORFNHG
7RXQEORFNWKHSURJUDPPHSUHVVWKH2.EXWWRQDJDLQ7KH V\PEROGLVDSSHDUV
RM 892
PARENTAL LOCK
PROG
0
1
2
3
4
5
6
7
8
9
SYS CHAN LABEL
B/G C 40 MV-CH
B/G C 41 TVE-1
B/G C 31 TVE-2
B/G C 34 ANT-3
B/G C 27 TELE 5
B/G C 47 C PLUS
B/G C 44 - - - - B/G C 23 - - - - B/G C 35 CNN B/G C 28 - - - - -
S
FURTHER PROGRAMME PRESET
PROG
0
1
2
3
4
5
6
7
8
9
AFT
2
On
On
On
On
On
On
On
On
On
DECODER
Off
Off
Off
Off
Off
Off
Off
Off
Off
Off
FURTHER PROGRAMME PRESET
7KHSLFWXUHIURPWKHGHFRGHUFRQQHFWHGWRWKH(XUR$9:RQ
WKHEDFNRIWKHSURMHFWLRQ79ZLOODSSHDURQWKLVSURJUDPPH
QXPEHU
5HSHDWVWHSVDQGEWRSUHVHWWKH$9RXWSXWIRURWKHU
SURJUDPPHSRVLWLRQV
V\PEROWKHQSXVKWRzWRHQWHU
0
FURTHER PROGRAMME PRESET
PROG
0
1
2
3
4
5
6
7
8
9
3XVKWKHMR\VWLFNWR$WRVHOHFWWKH
WRWKHPRESETPHQX
3
7
0
3UHVVWKHMENUEXWWRQRQWKHUHPRWHFRQWUROWRGLVSOD\WKHPHQXRQ
WKHVFUHHQ
PROG
0
1
2
3
4
5
6
7
8
9
AFT
On
On
On
On
On
On
On
On
On
On
DECODER
AV3
Off
Off
Off
Off
Off
Off
Off
Off
Off
5
5HSHDWVWHSLI\RXZLVKWREORFNRWKHUFKDQQHOV
6
3UHVVWKHMENUEXWWRQWRH[LWDQGUHWXUQWRWKHQRUPDO79VFUHHQ
When you select a blocked programme the screen appears in black, with symbol.
3UHVVWKHMENUEXWWRQWRH[LWDQGUHWXUQWRWKHQRUPDO79VFUHHQ
Your projection TV is now ready for use.
16
Advanced Operation - Advanced Presetting
Advanced Operation - Advanced Presetting
17
Advanced Operation - Advanced Presetting
Advanced Operation - Advanced Presetting
Skipping Programme positions
Labelling a channel
<RXFDQSURJUDPPHWKLVSURMHFWLRQ79WRVNLSDQ\XQZDQWHGSURJUDPPHQXPEHUVZKHQWKH\DUHVHOHFWHGZLWKWKH352*5
EXWWRQV7RFDQFHOWKLVIXQFWLRQDIWHUZDUGVSURFHHGLQWKHVDPHZD\DVGHVFULEHGEHORZE\VHOHFWLQJWKHDSSURSULDWH
79V\VWHP%*'./RU,LQVWHDGRILQVWHS
VIDEO
TV
1
2
1
2
3UHVVWKHMENUEXWWRQRQWKHUHPRWHFRQWUROWRGLVSOD\WKHPHQXRQ
WKHVFUHHQ
3XVKWKHMR\VWLFNWR$WRVHOHFWWKH
WRWKHPRESETPHQX
V\PEROWKHQSXVKWRzWRHQWHU
3
1DPHVIRUFKDQQHOV79%URDGFDVWVDUHXVXDOO\WDNHQDXWRPDWLFDOO\IURP7HOHWH[WLIDYDLODEOH<RXFDQKRZHYHUQDPHD
FKDQQHORUDQLQSXWYLGHRVRXUFHXVLQJXSWRILYHFKDUDFWHUVOHWWHUVRUQXPEHUV8VLQJWKLVIXQFWLRQ\RXFDQHDVLO\
LGHQWLI\ZKLFKFKDQQHO79%URDGFDVWVRUYLGHRVRXUFH\RXDUHZDWFKLQJ
PICTURE CONTROL
Picture Mode
Contrast
Reset
Format
1
Personal
VIDEO
TV
PRESET
Auto Programme
Manual Programme Preset
Further Programme Preset
AV Label Preset
Programme Sorting
Parental Lock
Language
Convergence
2
1
2
4
5
6
4
5
6
8
9
7
8
9
– 16 –
PROGR
3
4
MENU
3XVKWKHMR\VWLFNWR$RU4WRVHOHFWManual Programme PresetWKHQ
SXVKWRz
3XVKWKHMR\VWLFNWR$RU4WRVHOHFWWKHSURJUDPPHSRVLWLRQ\RXZDQW
WRVNLSWKHQSXVKWRzWRHQWHUWRWKHSYSFROXPQ
RM 892
S
5
3XVKWKHMR\VWLFNWR$WRVHOHFW´µWKHQSUHVVWKHOKEXWWRQWR
VWRUH
6
5HSHDWVWHSVDQGWRVNLSRWKHUXQXVHGSURJUDPPHSRVLWLRQV
7
3UHVVWKHMENUEXWWRQWRH[LWDQGUHWXUQWRWKHQRUPDO79VFUHHQ
When changing channels (TV Broadcasts) with the PROGR +/- buttons,
the skipped programme positions do not appear. You can, however, still select
them using the number buttons.
PRESET
Auto Programme
Manual Programme Preset
Further Programme Preset
AV Label Preset
Programme Sorting
Parental Lock
Language
Convergence
3
0
MANUAL PROGRAMME PRESET
PROG
0
1
2
3
4
5
6
7
8
9
SYS CHAN LABEL
B/G C 40 MV-CH
B/G C 41 TVE-1
B/G C 31 TVE-2
B/G C 34 ANT-3
B/G C 27 TELE 5
B/G C 47 C PLUS
B/G C 44 - - - - B/G C 23 - - - - B/G C 35 CNN B/G C 28 BBC-W
MANUAL PROGRAMME PRESET
PROG
0
1
2
3
4
5
6
7
8
9
SYS CHAN LABEL
B/G C 40 MV-CH
B/G C 41 TVE-1
B/G C 31 TVE-2
B/G C 34 ANT-3
B/G C 27 TELE 5
B/G C 47 C PLUS
B/G C 44 - - - - B/G C 23 - - - - B/G C 35 CNN --C 28 BBC-W
3XVKWKHMR\VWLFNWR$WRVHOHFWWKH
WRWKHPRESETPHQX
V\PEROWKHQSXVKWRzWRHQWHU
PROGR
Picture Mode
Contrast
Reset
Format
Personal
4:3
PRESET
3XVKWKHMR\VWLFNWR$RU4WRVHOHFWManual Programme PresetWKHQ
SXVKWRz
PRESET
4
3XVKWKHMR\VWLFNWR$RU4WRVHOHFWWKHSURJUDPPHQXPEHUZLWKWKH
FKDQQHO\RXZLVKWRQDPH
MANUAL PROGRAMME PRESET
5
3XVKWKHMR\VWLFNWRzUHSHDWHGO\XQWLOWKHILUVWHOHPHQWRIWKHLABEL
FROXPQLVKLJKOLJKWHG
MANUAL PROGRAMME PRESET
6
3XVKWKHMR\VWLFNWR$RU4WRVHOHFWDOHWWHURUQXPEHUVHOHFW´µIRU
DEODQNWKHQSXVKWRzWRFRQILUPWKLVFKDUDFWHU6HOHFWWKHRWKHUIRXU
FKDUDFWHUVLQWKHVDPHZD\
MANUAL PROGRAMME PRESET
7
$IWHUVHOHFWLQJDOOWKHFKDUDFWHUVSUHVVWKH OKEXWWRQ
8
5HSHDWVWHSVWRLI\RXZLVKWRODEHORWKHUFKDQQHOV
9
3UHVVWKHMENUEXWWRQWRH[LWDQGUHWXUQWRWKHQRUPDO79VFUHHQ
MENU
RM 892
S
PICTURE CONTROL
Auto Programme
Manual Programme Preset
Further Programme Preset
AV Label Preset
Programme Sorting
Parental Lock
Language
Convergence
3
7
0
3UHVVWKHMENUEXWWRQRQWKHUHPRWHFRQWUROWRGLVSOD\WKHPHQXRQ
WKHVFUHHQ
4:3
GB
Auto Programme
Manual Programme Preset
Further Programme Preset
AV Label Preset
Programme Sorting
Parental Lock
Language
Convergence
PROG
0
1
2
3
4
5
6
7
8
9
PROG
0
1
2
3
4
5
6
7
8
9
PROG
0
1
2
3
4
5
6
7
8
9
SYS CHAN LABEL
B/G C 40 - - - - B/G C 41 - - - - B/G C 31 - - - - B/G C 34 - - - - B/G C 27 - - - - B/G C 47 - - - - B/G C 44 - - - - B/G C 23 - - - - B/G C 35 - - - - B/G C 28 - - - - -
SYS CHAN LABEL
B/G C 40 - - - - B/G C 41 - - - - B/G C 31 - - - - B/G C 34 - - - - B/G C 27 - - - - B/G C 47 - - - - B/G C 44 - - - - B/G C 23 - - - - B/G C 35 - - - - B/G C 28 - - - - -
SYS CHAN LABEL
B/G C 40 - - - - B/G C 41 - - - - B/G C 31 - - - - B/G C 34 - - - - B/G C 27 A- - - B/G C 47 - - - - B/G C 44 - - - - B/G C 23 - - - - B/G C 35 - - - - B/G C 28 - - - - -
When you select a named channel, the name appears for a few seconds on the
screen.
18
Advanced Operation - Advanced Presetting
Advanced Operation - Advanced Presetting
19
Advanced Operation - Advanced TV Operation
Advanced Operation - Advanced TV Operation
Adjusting the Picture
Changing the screen mode
$OWKRXJKWKHSLFWXUHLVDGMXVWHGDWWKHIDFWRU\\RXFDQPRGLI\LWWRVXLW\RXURZQWDVWH
1
VIDEO
TV
1
2
3
4
5
6
3UHVVWKHMENUEXWWRQRQWKHUHPRWHFRQWUROWRGLVSOD\WKHPHQX
RQWKHVFUHHQ
2
3XVKWKHMR\VWLFNzWRHQWHUWKHPICTURE CONTROLPHQX
3
3XVKWKHMR\VWLFNWR$RU4WRVHOHFWWKHLWHP\RXZLVKWRFKDQJH
WKHQSXVKWRz
5HIHUWRWKHWDEOHEHORZWRFKRVHWKHLWHPDQGIRUWKHHIIHFWRI
HDFKFRQWURO
8
Picture Mode
Contrast
Reset
Format
9
– 17 –
Contrast
Reset
PROGR
Format
MENU
$Brightness* Z Darker
z Brighter
$ Colour*
z More
Z Less
VIDEO
Personal
PICTURE CONTROL
Picture Mode
Contrast
Reset
Format
2
3XVKWKHMR\VWLFNWRzEXWWRQWRHQWHUWKHPICTURE CONTROL
PHQX
3
3XVKWKHMR\VWLFNWR$WRVHOHFWFormat
4:3
4
3XVKWKHMR\VWLFNWRzUHSHDWHGO\WRVHOHFW
1
2
3
4
5
6
8
9
PICTURE MODE
Picture Mode
Brightness
Colour
Sharpness
Hue
Personal
7
$Sharpness* Z Softer
z Sharper
5
z Reddish
Z Less
K
‡ 4:3:
FRQYHQWLRQDOSLFWXUH
‡ 16:9:
IRUEURDGFDVWV
Resets picture to the factory preset levels.
5
5HSHDWVWHSVDQGWRDOWHUWKHRWKHULWHPV
6
3UHVVWKHMENUEXWWRQWRH[LWDQGUHWXUQWRWKHQRUPDO79VFUHHQ
Personal
4:3
Picture Mode
Contrast
Reset
Format
Personal
4:3
GB
3UHVVWKHMENUEXWWRQWRH[LWDQGUHWXUQWRWKHQRUPDO79VFUHHQ
4:3
PROGR
(for detalis refer to the section "Changing the Screen
Mode")
3XVKWKHMR\VWLFNWRZRUzWRDOWHUWKHVHOHFWHGLWHPWKHQ
SUHVVWKHOKEXWWRQWRVWRUHWKHQHZDGMXVWPHQW
Picture Mode
Contrast
Reset
Format
PICTURE CONTROL
z More
4
PICTURE CONTROL
3UHVVUKHOK EXWWRQ
0
$Hue**
Z Greenish
3UHVVWKHMENUEXWWRQRQWKHUHPRWHFRQWUROWRGLVSOD\WKHPHQX
RQWKHVFUHHQ
Personal
MENU
* Can only be altered if Personal Picture Mode is selected.
** Only avalaible for NTSC colour signal (e.g: USA video tapes).
RM 892
TV
4:3
z Movie (for films)
0
S
1
PICTURE CONTROL
Picture Mode z Picture Mode z Personal (for individual settings)
z Live (for live broadcast programmes)
7
8VLQJWKLV6FUHHQ0RGHIHDWXUH\RXFDQFKDQJHWKHDVSHFWUDWLRRIWKHVFUHHQ
RM 892
Changing the Picture Mode Quickly
16:9
S
<RXFDQTXLFNO\FKDQJHWKH3LFWXUH0RGHZLWKRXWHQWHULQJWKH
3LFWXUH&RQWUROPHQXVFUHHQ
1
3UHVVWKH
EXWWRQRQWKHUHPRWHFRQWUROUHSHDWHGO\WRVHOHFW\RXU
GHVLUHGIRUPDWVFUHHQPRGH4:3RU16:9
Changing the Picture Mode Quickly
<RXFDQTXLFNO\FKDQJHWKH3LFWXUH0RGHZLWKRXWHQWHULQJWKH
3LFWXUH&RQWUROPHQXVFUHHQ
20
1
3UHVVWKH EXWWRQRQWKHUHPRWHFRQWUROWRGLUHFWO\DFFHVVWKH
3LFWXUH0RGH
2
3XVKWKHMR\VWLFNWR$RU4WRVHOHFW\RXUGHVLUHGSLFWXUHPRGH
Personal, MovieRULiveWKHQSUHVVWKHOKEXWWRQWRUHPRYHWKH
GLVSOD\IURPWKHVFUHHQ
Advanced Operation - Advanced TV Operation
Personal
Movie
Live
Advanced Operation - Advanced TV Operation
21
Advanced Operation - Advanced TV Operation
Advanced Operation - Advanced TV Operation
Adjusting the Sound
$OWKRXJKWKHVRXQGLVDGMXVWHGDWWKHIDFWRU\\RXFDQPRGLI\LWWRVXLW\RXURZQWDVWH
1
VIDEO
1
2
TV
3UHVVWKHMENUEXWWRQRQWKHUHPRWHFRQWUROWRGLVSOD\WKHPHQX
RQWKHVFUHHQ
2
3XVKWKHMR\VWLFNWR$WRVHOHFWWKH V\PEROWKHQSXVKWRzWRHQWHU
WRWKHSOUND CONTROL PHQX
3
3XVKWKHMR\VWLFN$RU4WRVHOHFWWKHLWHP\RXZLVKWRFKDQJHWKHQ
SXVKWRz
5HIHUWRWKHWDEOHEHORZWRFKRVHWKHLWHPDQGIRUWKHHIIHFWRI
HDFKFRQWURO
3
Sound Mode
4
7
5
6
8
9
0
– 18 –
Balance
z Mode
$Treble* Z Less
z More
$ Bass*
Z Less
z More
Z Left
z Right
Reset
PROGR
MENU
RM 892
z Personal (for individual settings)
z Rock
z Jazz
z Pop
K
S
•
•
For a stereo broadcast:
z Mono
z Stereo
For a bilingual broadcast:
z Mono (for mono channel if available)
z A (for channel 1)
z B (for channel 2)
Volume Offset Z -12 .......... z +12
The channel volume level can be adjusted over a range
of -12 to +12.
Headphones:
Volume
Z Less
Dual Sound •
•
Speaker
Picture Mode
Contrast
Reset
Format
VIDEO
Personal
4
3XVKWKHMR\VWLFNZRUzWRDOWHUWKHVHOHFWHGLWHPWKHQ
SUHVVWKHOKEXWWRQWRVWRUHWKHQHZDGMXVWPHQW
5
5HSHDWVWHSVDQGWRDOWHUWKHRWKHULWHPV
6
3UHVVWKHMENUEXWWRQWRH[LWDQGUHWXUQWRWKHQRUPDO79VFUHHQ
TV
4:3
SOUND CONTROL
Sound Mode
Balance
Reset
Dolby Virtual
Dual Sound
Volume Offset
Volume
Dual Sound
Speaker
Personal
Off
Mono
0
Mono
Main
1
2
3
4
5
6
8
9
7
**7KLV79KDVEHHQGHVLJQHGWRFUHDWH´'ROE\6XUURXQGµVRXQG
HIIHFWVLPXODWLQJWKHVRXQGRIIRXUVSHDNHUVZLWKWZRVSHDNHUV
LQFDVHWKHEURDGFDVWHGDXGLRVLJQDOLVD'ROE\6XUURXQG
HQFRGHGSURJUDPPH%HVLGHVWKDWWKHVRXQGHIIHFWFDQDOVREH
LPSURYHGE\FRQQHFWLQJ\RXUH[WHUQDODPSOLILHUIRUGHWDLOV
UHIHUWR´&RQQHFWLQJWRH[WHUQDODXGLR(TXLSPHQWµRQSDJH
0
z More
GB
SOUND MODE
Mode
Treble
Bass
Personal
** 0DQXIDFWXUHGXQGHUOLFHQVHIURP'ROE\/DERUDWRULHV´'ROE\µ
´3UR/RJLFµDQGWKHGRXEOH'V\PERO
DUHWUDGHPDUNVRI
'ROE\/DERUDWRULHV
Resets sound to the factory preset levels.
Dolby** Virtual z Off: Normal
z On: Simulates the sound effect of Dolby Pro Logic
surround.
Dual Sound
PICTURE CONTROL
PROGR
MENU
RM 892
Changing Sound Mode Quickly
<RXFDQTXLFNO\FKDQJH6RXQGPRGHZLWKRXWHQWHULQJWKH6RXQG
&RQWUROPHQXVFUHHQ
S
1
3UHVVWKH EXWWRQRQWKHUHPRWHFRQWUROWRGLUHFWO\DFFHVVWRWKH
6RXQG0RGH
2
3XVKWKHMR\VWLFNWR$RU4WRVHOHFW\RXUGHVLUHGVRXQGPRGH
Personal, Rock, Jazz RUPopWKHQSUHVVWKHOKEXWWRQWRUHPRYH
WKHGLVSOD\IURPWKHVFUHHQ
Personal
Rock
Jazz
Pop
For a stereo broadcast:
z Mono
z Stereo
For a bilingual broadcast:
z Mono (for mono channel if available)
z A (for channel 1)
z B (for channel 2)
z Main: sound from projection TV set
z Centre in: sound from external amplifier
* Can be only altered if "Personal" mode is selected.
22
Advanced Operation - Advanced TV Operation
Advanced Operation - Advanced TV Operation
23
Advanced Operation - Advanced TV Operation
Teletext
Using the Sleep Timer
Viewing Teletext
7HOHWH[WLVDQLQIRUPDWLRQVHUYLFHWUDQVPLWWHGE\PRVW79VWDWLRQV
7KLVIXQFWLRQSURYLGHVDQRYHUYLHZRIVRPHRIWKHIHDWXUHVDYDLODEOHRQWKLVVHW
0DNHVXUHWRXVHD79FKDQQHOZLWKDVWURQJVLJQDORWKHUZLVHWHOHWH[WHUURUVPD\RFFXU
1
VIDEO
TV
2
3UHVVWKHMENUEXWWRQRQWKHUHPRWHFRQWUROWRGLVSOD\WKHPHQX
RQWKHVFUHHQ
3XVKWKHMR\VWLFNWR$EXWWRQWRVHOHFWWKHtV\PEROWKHQSXVKWRz
WRHQWHUWRWKHTIMERPHQX
Selecting Teletext
PICTURE CONTROL
Picture Mode
Contrast
Reset
Format
VIDEO
Personal
TV
4:3
TIMER
Sleep Timer
2
5
6
4
5
6
9
7
8
9
TIMER
Sleep Timer
1:00
TELETEXT
25
News
153
Sport
101
Index
3
,QSXWWKUHHGLJLWVIRUWKHSDJHQXPEHUXVLQJWKHQXPEHUHGEXWWRQV
RQWKHUHPRWHFRQWUROLI\RXKDYHPDGHDPLVWDNHW\SHLQDQ\WKUHH
GLJLWVDQGWKHQUHHQWHUWKHFRUUHFWSDJHQXPEHU
4
3UHVVWKH
153
Sport
101
GB
EXWWRQWRVZLWFKRIIWHOHWH[W
– 19 –
PROGR
MENU
5
TO
3UHVVWKHMENUEXWWRQWRH[LWDQGUHWXUQWRWKHQRUPDO79VFUHHQ
Access the next or preceding page
RM 892
RM 892
S
PRESS THE BUTTON
for next page or
for the preceding page
TELETEXT
S
Index
Superimpose teletext on to the TV
Programme
Press
mode.
One minute before the projection TV switches into standby mode, the
indication "0:01" is displayed on the screen automatically.
again to cancel teletext
25
News
153
Sport
101
Weather
98
TELETEXT
Index
Programme
Freeze a teletext page
25
News
153
Sport
101
Weather
98
Press
again to cancel the
freeze.
Notes: ‡:KHQZDWFKLQJWKH79SUHVVWKH EXWWRQRQWKHUHPRWH
FRQWUROWRGLVSOD\WKHWLPHUHPDLQLQJ
‡7RUHWXUQWRQRUPDORSHUDWLRQIURPVWDQGE\PRGHSUHVVWKH
TV
EXWWRQRQWKHUHPRWHFRQWURO
Reveal concealed information
(e.g. answer to a quiz)
Press
again to cancel.
Using Fastext
)DVWH[WOHWV\RXDFFHVVSDJHVZLWKRQHEXWWRQVWURNH
:KHQ)DVWH[WLVEURDGFDVWDFRORXUFRGHGPHQXDSSHDUVDWWKH
ERWWRPRIWKHWHOHWH[WSDJH3UHVVWKHFRORXUEXWWRQUHGJUHHQ
\HOORZRUEOXHRQWKHUHPRWHFRQWUROWRDFFHVVWKHFRUUHVSRQGLQJ
SDJH
24
Advanced Operation - Advanced TV Operation
98
98
Using other Teletext functions
3UHVVWKHOKEXWWRQ
PROGR
MENU
25
News
0
2IIzzKRXUV
4
TELETEXT
Index
Weather
3
4
3XVKWKHMR\VWLFNWRzWKHQSXVKWRZRUzUHSHDWHGO\WRVHWWKHWLPH
SHULRGGHOD\
EXWWRQRQWKHUHPRWHFRQWUROWRVZLWFKRQWKHWHOHWH[W
Weather
1
3
3UHVVWKH
Programme
3
0
2
Off
2
8
6HOHFWWKH79FKDQQHOZKLFKFDUULHVWKHWHOHWH[WVHUYLFH\RXZLVKWR
YLHZ
Programme
1
7
1
Teletext
25
Optional Connections
Optional Connections
Connecting Optional Equipment
Using Optional Equipment
8VLQJWKHIROORZLQJLQVWUXFWLRQV\RXFDQFRQQHFWDZLGHUDQJHRIRSWLRQDOHTXLSPHQWWR\RXUSURMHFWLRQ79
5HDURISURMHFWLRQ79
Additional Information when connecting equipment
)URQWRISURMHFWLRQ79
Connecting a VCR
:HUHFRPPHQG\RXFRQQHFW\RXU9&5WRWKHDRUEVRFNHWXVLQJDVFDUWOHDG,I\RXGRQRWKDYHDVFDUWOHDGXVHWKH´0DQXDOO\
7XQLQJWKH79µVHFWLRQRIWKLVLQVWUXFWLRQPDQXDOWRWXQHLQWKH9&5VLJQDOWR79SURJUDPPHQXPEHU´µ
,I\RXUYLGHRVXSSRUWV6PDUWOLQNSOHDVHUHIHUWKH6PDUWOLQNVHFWLRQRIWKLVLQVWUXFWLRQPDQXDO
Connecting to External Audio Equipment
1 To listen to the audio of your projection TV on the Hi-Fi equipment:
3OXJLQ\RXU'ROE\3URORJLFV\VWHPGHFRGHUDPSOLILHUWRWKHBVRFNHWVRQWKHUHDURIWKHSURMHFWLRQ79LI\RXZLVKWRDPSOLI\
WKHDXGLRRXWSXWIURPWKH79
7KHRXWSXWOHYHOIURPBVRFNHWVFDQEHYDULHGE\DGMXVWLQJWKHYROXPHRIWKHKHDGSKRQHV5HIHUWRWKH´$GMXVWLQJWKHVRXQGµ
VHFWLRQRIWKLVLQVWUXFWLRQPDQXDOWRDGMXVWWKHYROXPHRIWKHKHDGSKRQHV
'HFRGHU
'9'
9&5
E
C
– 20 –
To avoid picture
distortion:
‡ 'RQRWFRQQHFW
HTXLSPHQWWRF
DQGGFRQQHFWRUV
DWWKHVDPHWLPH
‡ 'RQRWFRQQHFWDQ\
HTXLSPHQWRQWKH
IURQWFRQQHFWRUV
WRJHWKHUZLWKD
FRQQHFWRU
69+6+L
FDPFRUGHU
až
GB
2 To listen to the Dolby amplifier equipment on the projection TV speakers:
F
A
B
D
5LJKW+L)L
6SHDNHU
/HIW+L)L
6SHDNHU
To enjoy “Dolby Virtual” sound effect through
your Hi-Fi equipment:
3ODFHWKHVSHDNHUVRI\RXUHTXLSPHQWLQIURQWRI
\RXUVLWWLQJSODFHDQGEHVLGHVWKH79VHWEXW
NHHSLQJDGLVWDQFHRIFPIURPHDFKVSHDNHUWR
WKH79VHW
7KHQE\XVLQJWKHPHQXV\VWHPVHOHFWWKHPHQX´6RXQG
&RQWUROµDQGVHW´'ROE\9LUWXDOµWR´2Qµ
<RXUVLWWLQJSRVLWLRQ
3OXJLQ\RXU+L)LHTXLSPHQWWRWKHAVRFNHWRQWKHUHDURIWKHSURMHFWLRQ79
LI\RXZLVKWROLVWHQWRWKHDXGLRRXWSXWIURP\RXU+L)LRQWKHSURMHFWLRQ79
VSHDNHU,I\RXKDYHD'ROE\DPSOLILHUFRQQHFWWKHFHQWUHRXWSXWIURP\RXUDPSOLILHU
WRWKHAVRFNHWWRXVHWKHSURMHFWLRQ79DVDFHQWUHVSHDNHU5HIHUWRWKH´$GMXVWLQJWKH6RXQGµ
VHFWLRQRIWKLVLQVWUXFWLRQPDQXDODQGVHWWKHRSWLRQ6SHDNHUWR&HQWUHLQ
G
For mono equipment
&RQQHFWWKHSKRQRSOXJWRWKH/*6,VRFNHWRQWKHIURQWRIWKH79DQGVHOHFWWKH
WKLVSDJHEHORZ
H
LQSXWVLJQDOXVLQJWKHLQVWUXFWLRQVRQ
9&5
Select and View the Input Signal
1 &RQQHFW\RXUHTXLSPHQWWRWKHGHVLJQDWHGSURMHFWLRQ79VRFNHWDVLWLVLQGLFDWHGRQWKH
'9'
Acceptable input signal
Available output signal
A &HQWUHVSHDNHULQSXW
6HW´6SHDNHUµRQWKH6281'
&21752/PHQXWR´&HQWUHLQµ
B 1RLQSXWV
C $XGLRYLGHRDQG5*%VLJQDO
D $XGLRYLGHRDQG6YLGHRVLJQDO
E $XGLRYLGHRVLJQDO
1RRXWSXWV
F 69LGHRVLJQDO
G 9LGHRVLJQDO
H $XGLRVLJQDO
VIDEO
$XGLRVLJQDO
9LGHRDXGLRGLVSOD\HGRQ79WXQHU
9LGHRDXGLRIURPVHOHFWHGVRXUFH
9LGHRDXGLRIURPVHOHFWHGVRXUFHWKHVDPHRXWSXWVRXUFHDV
WKH:qFRQQHFWRU
1RRXWSXW
1RRXWSXW
1RRXWSXW
1
2
SUHYLRXVSDJH
TV
PP+L
FDPFRUGHU
+L)L
2
6ZLWFKRQWKHFRQQHFWHGHTXLSPHQW
3
3UHVVWKH
EXWWRQUHSHDWHGO\RQ\RXUUHPRWHFRQWUROXQWLOWKHFRUUHFWLQSXWV\PERO
DSSHDUVRQWKHVFUHHQ
3
4
5
6
Symbol
7
8
9
k
‡ $XGLRYLGHRLQSXWVLJQDOWKURXJKWKH(XUR$9FRQQHFWRUC
K
‡ $XGLR9LGHRLQSXWVLJQDOWKURXJKWKH(XUR$9FRQQHFWRUDRUWKH
SKRQRVRFNHWVHDQGG
q2
‡ $XGLR69LGHRLQSXWVLJQDOWKURXJKWKH(XUR$9FRQQHFWRUDRUWKH
VRFNHWVHDQGF
‡ $XGLR9LGHRLQSXWVLJQDOWKURXJKWKH(XUR$9FRQQHFWRUE
0
Input signals
‡ 5*%LQSXWVLJQDOWKURXJKWKH(XUR$9FRQQHFWRUC
PROGR
MENU
…3
RM 892
4
7RUHWXUQWRWKHQRUPDO79SLFWXUHSUHVVWKH
EXWWRQRQWKHUHPRWHFRQWURO
S
26
Optional Connections
Optional Connections
27
Optional Connections
Optional Connections
Smartlink
Selecting the output source for the Euro AV connectors
6PDUWOLQNLVDGLUHFWOLQNEHWZHHQ\RXUSURMHFWLRQ79VHWDQGD9&5
5HDURISURMHFWLRQ79
For Smartlink you need:
8VLQJWKLVIXQFWLRQ\RXFDQUHFRUGRQ\RXU9&5DQ\VLJQDOFRPLQJIURPDQH[WHUQDOHTXLSPHQWFRQQHFWHGWRWKH(XUR$9
FRQQHFWRUV:qRU:SODFHGRQWKHUHDURIWKHSURMHFWLRQ79
,QWKDWFDVH\RXKDYHWRVHOHFWWKHRXWSXWVRXUFHDVGHVFULEHGEHORZLI\RXU9&5VXSSRUW6PDUWOLQNWKLVSURFHGXUHLVQRW
QHFHVVDU\
‡ $9&5ZKLFKVXSSRUWV6PDUWOLQN1H[W9LHZ/LQN(DV\/LQNRU0HJDORJLF
0HJDORJLFLVDWUDGHPDUNRI*UXQGLJ&RUSRUDWLRQ
(DV\/LQNLVDWUDGHPDUNRI3KLOLSV&RUSRUDWLRQ
VIDEO
TV
1
3UHVVWKHMENUEXWWRQRQWKHUHPRWHFRQWUROWRGLVSOD\WKHPHQXRQ
WKHVFUHHQ
‡ $IXOO\ZLUHGSLQ6&$57FDEOHWRFRQQHFW\RXU9&5WRWKH(XUR$9FRQQHFWRU:
60$57/,1.RQWKHUHDURIWKH3URMHFWLRQ79
The features of Smartlink are:
2
‡ 7XQLQJLQIRUPDWLRQVXFKDVWKHFKDQQHORYHUYLHZDUHGRZQORDGHGIURPWKH3URMHFWLRQ79VHW
WRWKH9&5
1
2
3
4
5
6
8
9
7
‡ 3URMHFWLRQ79LQVWDQGE\PRGH3UHVVWKH3OD\zEXWWRQRQ\RXU9&5WRVZLWFKWKH79
DXWRPDWLFDOO\RQ
3
9&5
– 21 –
4
MENU
Remote Control of other Sony Equipment
S
‡ ,I\RXUYLGHRHTXLSPHQWKDVD&200$1'02'(VHOHFWRUVHWWKLV
VHOHFWRUWRWKHVDPHSRVLWLRQDVWKH975'9'VHOHFWRURQWKH
795HPRWH&RQWURO
TV Screen
Output
[TV - - - - - - -]
[AV1 - - - - - - -]
3XVKWKHMR\VWLFNWR$RU4EXWWRQWRKLJKOLJKW
TV Screen
LQSXWVRXUFHIRUWKH79VFUHHQRU
Output
RXWSXWVRXUFHDYDLODEOHIRU:qDQG:(XUR
$9FRQQHFWRUV
GB
3XVKWKHMR\VWLFNWRZRUzUHSHWHDGO\WRVHOHFWWKHGHVLUHGVRXUFH
796FUHHQ
TV, AV1, RGB, AV2, YC2 RU AV3
2XWSXW
TV, AV1, AV2, YC2, AV3 RUAUTO
7KHQSUHVVWKHOKEXWWRQWRFRQILUP
8VLQJWKHEXWWRQVXQGHUQHDWKWKHFRYHURIWKHUHPRWHFRQWURO\RXFDQ
FRQWURORWKHU6RQ\HTXLSPHQW
8VHWKHEXWWRQVXQGHUQHDWKWKHFRYHURQWKHUHPRWHFRQWUROWRRSHUDWHWKH
HTXLSPHQW
VIDEO CONNECTION
PROGR
RM 892
3
4:3
3XVKWKHMR\VWLFNWRzWRFRQILUP
'HFRGHU
)RUPRUHLQIRUPDWLRQRQ6PDUWOLQNSOHDVHUHIHUWRWKH,QVWUXFWLRQ0DQXDORI\RXU
9&5
2SHQWKHFRYHURIWKH5HPRWH&RQWURO
Personal
AV1
0
,I\RXKDYHFRQQHFWHGDGHFRGHUWRD9&5ZKLFKVXSSRUWV6PDUWOLQNIHDWXUHVHOHFWWKH
PHQX)XUWKHU3URJUDPPH3UHVHWLQWKH
35(6(7PHQXDQGVHOHFWDECODER AV3
WRHDFKFRGLILHGFKDQQHO)RUPRUHGHWDLOVSOHDVHUHIHUWRWKHVHFWLRQ8VLQJWKH)XUWKHU
3URJUDPPH3UHVHWIXQFWLRQRIWKLVLQVWUXFWLRQPDQXDO
6HWWKHVHOHFWRU975'9'DFFRUGLQJWRWKHHTXLSPHQW\RXZDQWWRFRQWURO
975 %HWD9&5
975 PP9&5
975 9+69&5
975 'LJLWDO9LGHR'&59;(9+5
'9'
'LJLWDO9LGHR'LVN
Picture Mode
Contrast
Reset
Format
TV
‡ 'LUHFWSURMHFWLRQ79UHFRUGLQJ:KLOHZDWFKLQJ79\RXQHHGWRSUHVVMXVWRQHEXWWRQRQWKH
9&5WRUHFRUGWKLVSURJUDPPH
1
2
3XVKWKHMR\VWLFNWR$WRVHOHFWWKH V\PEROWKHQSXVKWRzEXWWRQ
WRHQWHUWRWKHVIDEO CONNECTIONPHQXVFUHHQ
PICTURE CONTROL
,I\RXVHOHFW"AUTO"WKHRXWSXWVLJQDOZLOODOZD\VEHWKHVDPH
RQHWKDWLVGLVSOD\HGRQWKHVFUHHQ
VIDEO
,I\RXKDYHFRQQHFWHGDGHFRGHUSOHDVHUHPHPEHUWRFKDQJH
EDFNWKH2XWSXWWR"TV"IRUFRUUHFWXQVFUDPEOLQJ
TV
VTR 1 2 3 4 DVD
5
CH
3UHVVWKHMENUEXWWRQWRH[LWDQGUHWXUQWRWKHQRUPDO79VFUHHQ
VTR 1 2 3 4 DVD
The selected signal is available for your optional equipment connected to
the appropriate Euro AV connector.
CH
‡ ,IWKHHTXLSPHQWGRHVQRWKDYHDFHUWDLQIXQFWLRQWKHFRUUHVSRQGLQJ
EXWWRQRQWKHUHPRWHFRQWUROGRHVQRWZRUN
28
Optional Connections
Optional Connections
29
Optional Connections
Additional Information
Using the AV Label Preset feature
Optimum Viewing Area
7KLVIXQFWLRQHQDEOHV\RXWRGHVLJQDWHDQDPHWRWKHRSWLRQDOHTXLSPHQW\RXKDYHFRQQHFWHGWRWKHVRFNHWVRIWKLV
SURMHFWLRQ797KLVQDPHFDQEHXSWRFKDUDFWHUVOHWWHUVRUQXPEHUV
VIDEO
TV
1
)RUWKHEHVWSLFWXUHTXDOLW\WU\WRSRVLWLRQWKHSURMHFWLRQ79VRWKDW\RXFDQYLHZWKHVFUHHQIURPZLWKLQWKHDUHDV
VKRZQEHORZ
Horizontal viewing area
3UHVVWKHMENUEXWWRQRQWKHUHPRWHFRQWUROWRGLVSOD\WKHPHQXRQ
WKHVFUHHQ
2.1
PICTURE CONTROL
Picture Mode
Contrast
Reset
Format
m
Personal
(M
ini
mu
m
4:3
op
tim
um
dis
tan
ce
2
1
2
3XVKWKHMR\VWLFNWR$WRVHOHFWWKH
HQWHUWRWKHPRESETPHQXVFUHHQ
V\PEROWKHQSXVKWRzWR
3
4
5
6
7
8
9
3
0
)
75º
3XVKWKHMR\VWLFNWR$RU4WRVHOHFWAV Label PresetWKHQSXVK
WRz
PRESET
75º
Auto Programme
Manual Programme Preset
Further Programme Preset
AV Label Preset
Programme Sorting
Parental Lock
Language
Convergence
PRESET
GB
– 22 –
Auto Programme
Manual Programme Preset
Further Programme Preset
AV Label Preset
Programme Sorting
Parental Lock
Language
Convergence
(Optimum viewing position)
PROGR
4
MENU
3XVKWKHMR\VWLFNWR$RU4VHOHFWWKHLQSXWVRXUFH\RXZLVKWRQDPH
HJ$9WKHQSXVKWRzWRKLJKOLJKWWKHILUVWHOHPHQWRIWKHLABEL
FROXPQ
AV LABEL PRESET
INPUT
AV1
RGB
AV2
YC2
AV3
LABEL
---------------------
RM 892
S
5
3XVKWKHMR\VWLFNWR$RU4WRVHOHFWDOHWWHURUQXPEHUVHOHFW´µIRU
DEODQNWKHQSXVKWRzWRFRQILUPWKLVFKDUDFWHU6HOHFWWKHRWKHUIRXU
FKDUDFWHUVLQWKHVDPHZD\
AV LABEL PRESET
INPUT
AV1
RGB
AV2
YC2
AV3
LABEL
--------A- - - ---------
Vertical viewing area
2.1
m
6
$IWHUVHOHFWLQJDOOWKHFKDUDFWHUVSUHVVWKHOKEXWWRQ
7
5HSHDWVWHSVWRLI\RXZLVKWRODEHORWKHULQSXWVRXUFHV
(M
ini
mu
m
op
tim
um
dis
tan
ce
)
27.5°
8
3UHVVWKHMENUEXWWRQWRH[LWDQGUHWXUQWRWKHQRUPDO79VFUHHQ
27.5°
Whenever the equipment with the labeled input is selected for use, the
name appears for a few seconds on the screen.
(Optimum viewing position)
30
Optional Connections
Additional Information
31
Additional Information
Troubleshooting
+HUHDUHVRPHVLPSOHVROXWLRQVWRWKHSUREOHPVZKLFKPD\DIIHFWWKHSLFWXUHDQGVRXQG
– 23 –
Problem
Solution
1RSLFWXUHVFUHHQLVGDUNQRVRXQG
‡ 3OXJWKHSURMHFWLRQ79LQ
‡3UHVVWKH EXWWRQRQWKHIURQWRIWKHSURMHFWLRQ79
‡,IWKH LQGLFDWRULVRQSUHVVTV
EXWWRQRUDSURJUDPPH
QXPEHUEXWWRQRQWKHUHPRWHFRQWURO
‡&KHFNWKHDHULDOFRQQHFWLRQ
‡ 7XUQWKHSURMHFWLRQ79RIIIRURUVHFRQGVDQGWKHQWXUQLW
RQDJDLQXVLQJWKH EXWWRQRQWKHIURQWRIWKHSURMHFWLRQ
79
3RRURUQRSLFWXUHVFUHHQLVGDUN
EXWJRRGVRXQG
‡8VLQJWKH0(18V\VWHPVHOHFWWKH3LFWXUH$GMXVWPHQW
GLVSOD\
$GMXVWWKHEULJKWQHVVSLFWXUHDQGFRORXUEDODQFHOHYHOV
‡)URPWKH3LFWXUH$GMXVWPHQWGLVSOD\VHOHFWResetWRUHWXUQ
WRWKHIDFWRU\VHWWLQJV
3RRUSLFWXUHTXDOLW\ZKHQZDWFKLQJD
5*%YLGHRVRXUFH
‡3UHVVWKH
EXWWRQUHSHDWHGO\RQWKHUHPRWHFRQWUROXQWLO
WKH5*%V\PERO
LVGLVSOD\HGRQWKHVFUHHQ
*RRGSLFWXUHQRVRXQG
‡3UHVVWKH EXWWRQRQWKHUHPRWHFRQWURO
‡,I LVGLVSOD\HGRQWKHVFUHHQSUHVVWKH EXWWRQRQWKH
FRQWURO
‡&KHFNWKDW"Main"VSHDNHULVVHOHFWHGRQWKH6281'
&21752/PHQX
1RFRORXURQFRORXUSURJUDPPHV
‡ 8VLQJWKH0(18V\VWHPVHOHFWWKH3LFWXUH$GMXVWPHQW
GLVSOD\$GMXVWWKHFRORXUEDODQFH
‡ )URPWKH3LFWXUH$GMXVWPHQWGLVSO\VHOHFW5HVHWWRUHWXUQWR
WKHIDFWRU\VHWWLQJV
'LVWRUWHGSLFWXUHZKHQFKDQJLQJ
SURJUDPPHVRUVHOHFWLQJWHOHWH[W
‡7XUQRIIDQ\HTXLSPHQWFRQQHFWHGWRWKHSLQ(XUR
FRQQHFWRUVRQWKHUHDURIWKH79
1RLV\SLFWXUHZKHQYLHZLQJ79FKDQQHO
‡ $GMXVW)LQH7XQLQJ$)7WRREWDLQEHWWHUSLFWXUHUHFHSWLRQ
)RUGHWDLOVSOHDVHUHIHUWRWKHVHFWLRQ8VLQJWKH)XUWKHU
3URJUDPPH3UHVHWIXQFWLRQ
5HPRWHFRQWUROGRHVQRWIXQFWLRQ
‡5HSODFHWKHEDWWHULHV
7KHVWDQGE\LQGLFDWRU
IODVKHV
‡&RQWDFW\RXUQHDUHVW6RQ\VHUYLFHFHQWUH
RQWKHVHW
• If you continue to have these problems, have your TV serviced by qualified personnel.
• NEVER open the casing yourself.
Additional Information
33
GB
KP-41PX1/41PX1K/41PX1R
K
RM-892
RM-892
SECTION 3
DISASSEMBLY
3-1. REAR BOARD REMOVAL
3-3. SERVICE POSITION
1 Ten screws
(+BVTP4 × 16)
Chassis assembly
2 Rear board
1 Five screws
(+BVTP4 × 16)
3-2. CHASSIS ASSEMBLY REMOVAL
1 Light shield
2 Two screws
(Hexagon head)
3 Chassis assembly
– 24 –
RM-862
KP-41PX1/41PX1K/41PX1R
K
RM-892
RM-892
3-4. TERMINAL BOARD REMOVAL
3 Terminal board (euro)
1 Four screws
(+BVTP4 × 16)
2 Two screws
(+BVTP3 × 12)
1 Two screws
(+BVTP4 × 16)
3-5. U (UE), A (AE) AND D BOARDS REMOVAL
2 Bracket (A)
6 A board (41PX1/41PX1K)/
AE board (41PX1R)
3 Two claws
5 Claw
7 Four screws
(+BVTP3 × 12)
4 U board (41PX1/41PX1K)/
UE board (41PX1R)
9 D board
1 Claw
8 Two claws
– 25 –
RM-862
KP-41PX1/41PX1K/41PX1R
K
3-6. E BOARD REMOVAL
1 Five screws
(+BVTP3 × 12)
2 E board
3-7. G BOARD REMOVAL
1 Four claws
2 G board
– 26 –
RM-892
RM-892
RM-862
KP-41PX1/41PX1K/41PX1R
K
RM-892
3-8. SPEAKER GRILLE AND RESISTOR ASSEMBLY (FOCUS PACK) REMOVAL
5 Resistor assembly
(Focus Pack)
4 Screw
(+BVTP4 × 16)
1 Four screws
(Hexagon head)
2 Three strike
3 Speaker grille assembly
3-9. H1 AND H2 BOARDS REMOVAL
qa H2 board
8 Screw
(+BVTP3 × 12)
2 Screw
(+BVTP3 × 12)
3 Harness
9 Two claws
7 Two screw
(+BVTP4 × 16)
6 H1 board
1 Two screw
(+BVTP4 × 16)
9 Claw
0 H bracket
4 Three claws
5 H1 bracket
– 27 –
RM-892
RM-862
KP-41PX1/41PX1K/41PX1R
K
RM-892
RM-892
RM-862
3-10. MIRROR COVER AND BEZNET ASSEMBLY REMOVAL
1 Five screws
(+BVTP4 × 16)
1 Six screws
(+BVTP4 × 16)
2 Mirror cover
4 Beznet assembly
3 Four screws
(Hexagon head)
3-11. HIGH-VOLTAGE
CABLE REMOVAL
AND INSTALLATION
3-12. PICTURE TUBE REMOVAL
Removing the arrow-marked screw is strictly inhibited.
If removed, it may cause liquid spill.
(1) Removal
6 Four screws
(+BVTP 4 x 16)
1 Four screws
(+BVTP 4 x 16)
1 Rubber cap
2 HV cable
turn 90°
2 Lens
7 Picture
tube
(2) Installation
5 Deflection
yoke
2 Rubber cap
4 Neck
assembly
1 HV cable
Hook
3 CR board
Gutter
– 28 –
KP-41PX1/41PX1K/41PX1R
K
RM-892
RM-892
RM-862
SECTION 4
SET-UP ADJUSTMENTS
4-1. SCREEN VOLTAGE ADJUSTMENT
(ROUGH ALIGNMENT)
4-3. SCREEN (G2) ADJUSTMENT
1. Receive the Monoscope signal.
2. Select VIDEO1 mode without signals.
3. Connect JIG to the TP701(KR), TP731(KG) or TP761(KB)
1. Connect JIG (A) to 200 V and GND.
2. Set 50% BRIGHTNESS and minimum PICTURE.
3. Turn the red VR on the focus pack all the way to the left and
then gradually turn it to the right until the point where you
can see the retrace line.
of CR board, CG board and CB board.
4. Adjust R, G and B screen voltage to until retrace line disappears with screen VR on the focus pack.
4. Next gradually turn it to the left to the position where the
retrace line disappears.
R
G
KR, KG, KB
5.6K/3W X3
GND
B
SCREEN
R
G
B
FOCUS
<2.2K/3W>
(A)
200V
Focus Pack
Fig. 4-1
Fig. 4-5
4-2. FOCUS ROUGH ADJUSTMENT
1. Loose the lens screw.
4-4. DEFLECTION YOKE TILT ADJUSTMENT
2. Set in the service mode. (Refer to SECTION 6.)
3. Place the caps on the red and blue lens so that only the green
1. Receive the Monoscope signal.
color is shown.
4. Press “MENU” on the Commander and select Convergence
and OSD CHSW = “00” to display the test signal (crosshatch)
on the screen.
5. Rotate the green lens and align to obtain the best lens focus
at the center area.
6. Rotate the green focus VR on the focus pack and align to
obtain the best electrical focus at the center area.
2. Place the caps on the red and blue lens so that only the green
color.
3. Loosen the deflection yoke setscrew and align the tilt of the
Deflection yoke so that the bars at the center of the monoscope
pattern are horizontal.
4. After aligning the deflection yoke, fasten it securely to the
funnel-shaped portion (neck) of the CRT.
5. The tilt of the deflection yoke for red and blue is aligned the
same as was done for green.
7. Perform the same alignment for red and blue lenses and electric focus.
8. Fix lens screw.
4-pole magnet
2-pole magnet
Deflection yoke
Test signal
Fig. 4-2
Neck Assy
Anode cap
Make sure deflection yoke is
touching CRT closely.
A
Lens
Fig. 4-3
Fig. 4-6
Minimize both A and B.
B
Fig. 4-4
– 29 –
KP-41PX1/41PX1K/41PX1R
K
RM-892
RM-892
RM-862
4-5. 2-POLE MAGNET ADJUSTMENT
(GREEN AND RED)
4-7. GREEN, RED AND BLUE FOCUS
ADJUSTMENT
1. Receive the Dot signal and set PICTURE to 80%, BRIGHTNESS to 50%.
2. Place the caps on the red and blue lens so that only the green
color is shown.
3. Turn the green focus VR on the focus pack to the right and
set to over focus to enlarge the spot.
4. Now align the 2-Pole Magnet so that the enlarged spot is in
the center of the just focus spot.
(Center of the dot does not move)
5. Align the green focus VR and set for just (precise) focus.
6. Perform the same alignment for red.
4-7-1. Green, Red and Blue Lens Focus Adjustment
1. Receive the Monoscope signal and set PICTURE to minimum,
BRIGHTNESS to 50%.
2. Place the caps on the red and blue lens so that only the green
color is shown.
3. Rotate the green lens and adjust to obtain the best lens focus
in all areas.
4. Fix lens screw.
5. Repeat above process for red and blue.
Use the center dot
4-7-2. Green, Red and Blue Electrical Focus
Adjustment
1. Receive the Monoscope signal and set PICTURE to minimum,
BRIGHTNESS to 50%.
2. Place the caps on the red and blue lens so that only the green
color is shown.
3. Rotate the green focus VR on the focus pack and adjust to
obtain the best electrical focus in all areas.
4. Repeat above process for red and blue.
Fig. 4-7
4-6. 4-POLE MAGNET ADJUSTMENT
1. Receive the Dot signal and set PICTURE to 80%, BRIGHTNESS to 50%.
2. Place the caps on the red and blue lens so that only the green
color is shown.
3. Turn the green focus VR on the focus pack to the left and set
to under focus to enlarge the spot.
4. Now align the 4-Pole Magnet so that the enlarged spot becomes a perfect circle for green and red.
5. Perform the same alignment for red and blue.
[GREEN and RED]
Use the center dot
NG
OK
NG
[BLUE]
NG
OK
NG
Fig. 4-8
– 30 –
Adjust Point : Circulars Areas
Fig. 4-9
KP-41PX1/41PX1K/41PX1R
K
RM-892
RM-892
RM-862
SECTION 5
SAFETY RELATED ADJUSTMENT
When replacing the following components marked with ] on
the schematic diagram, always check hold-down voltage and if
necessary re-adjust.
E BOARD
– CONDUCTOR SIDE –
CN810
CN505
Part Replaced ([)
R1
Part Replaced (])
E Board
G Board
C515,
L506,
R517,
C516,
Q502,
T502,
C554, D504,
R1,
R514,
T504 (FBT)
D507,
R516,
Fig. 5-3
IC6005
CN505
5-1. HV HOLD-DOWN ADJUSTMENT
R1
1. Connect HV static voltmeter to HV Block.
Fig. 5-4
2. Remove CN810 and connect External Power Supply to
CN810 2 pin (+135 V) and 1 pin (GND).
Power
Supply
+
2
–
1
CN810
Fig. 5-1
Remove the cap off
from the unused
terminal and connect a
HV static voltmeter
there.
3. Turn on the set.
4. Receive the Dot signal and set PICTURE/BRIGHTNESS
to minimum.
5. Slowly up the supply voltage from 0 V to 135 V until holddown circuit works (picture disappear).
6. Read the HV static voltmeter of peak HV voltage.
Spec : 33.7 to 36.0 KV
7. If Hold-down voltage is less than 33.7 KV then solder
R1 = 820 K and check if the voltage is within the spec.
8. If hold-down voltage is over than 36.0 KV then take-off
R514 and solder R1 = 9.1 K and check if the voltage is
within the spec.
Fig. 5-2
– 31 –
KP-41PX1/41PX1K/41PX1R
K
RM-892
RM-892
RM-862
SECTION 6
ELECTRICAL ADJUSTMENTS
6-1. HOW TO ENTER THE SERVICE MODE
6-1-1. Adjustment Method with Commander
Service adjustment to this model can be performed with the supplied remote commander RM-892 (41PX1/41PX1K) or RM-862
(41PX1R).
MUTE
3. Press “MENU” on the commander to obtain the following
menu on the screen.
(With some models, display items may be different from
the following)
TEST MENU
Picture Adjustment
Geometry
Wide
IC Status
MSP
Dynamic Convergence
Current TV Status
Convergence
TV STANDBY
VIDEO
TV
TV MODE
ON SCREEN
DISPLAY
1
2
3
4
5
6
7
8
9
JOYSTICK
0
4 : 3 / 16 : 9
4. Move to the corresponding adjustment using the joystick
OK
(v or V : up or down) on the commander.
VOLUME +
PROGR
MENU
5. Move the joystick to the right (B) to enter the selected
adjustment.
RM 892
SONY
6. Press “
TV
MENU
7. Before TURN OFF is necessary:
DATA WRITE : Press “ (MUTE)” + “-”
RM-892 : 41PX1/41PX1K
DATA COPY
: Press “ (ON SCREEN DISPLAY)”
+ “-”
8. Turn off the power to quit the service mode when adjustments are completed.
TV STANDBY
MUTE
%
ON SCREEN
DISPLAY
4 : 3 / 16 : 9
TV MODE
1
2
3
4
5
6
8
9
7
MENU
6-1-2. Screen Display on the Test Menu
(With some models, display items and contents may be
different from the following)
10
VOLUME +
(OK)” to exit.
+
—
Picture Adjustment
+
—
PICTURE ADJUSTMENT
RM 862
JOYSTICK
AFC Mode
Ref Position
SCP BGR
SCP BGF
Trap F0
Sub Contrast
Sub Colour
Sub Brightness
Green Drive
Blue Drive
Green Cutoff
Blue Cutoff
Gamma
Pre / Overshoot
Y Delay
D Pic
D Colur
DC Transfer
SONY
TV
RM-862 : 41PX1R
1. Turn on the main power switch of the set and enter into
standby mode.
2. Press the following sequence of buttons on the Remote
Commander.
Enter the
“TT MODE”
5
SCREEN
( ONDISPLAY
)
(DIGIT 5)
(VOLUME +)
(TV MODE)
“TT - -” will appear in the top right corner of the screen.
Other status information will also be displayed.
– 32 –
1
3
1
1
0
11
10
13
51
43
8
10
1
2
3
ON
OFF
ON
0 - 3
0 - 3
0 - 3
0 - 3
0 - 15
0 - 15
0 - 15
0 - 63
0 - 63
0 - 63
0 - 15
0 - 15
0 - 3
0 - 3
0 - 7
ON/OFF
ON/OFF
ON/OFF
KP-41PX1/41PX1K/41PX1R
K
Geometry (* : No need to adjust)
*
*
MSP ADJUSTMENT
SDR
1
CONCCT
4:3
15
47
0
12
40
15
18
12
8
9
1
0
4
1
16:9
15
47
0
12
40
15
20
12
8
9
1
0
6
3
0
0
0
0
0
0
0
0
0
0
0
0
0
0
-
63
63
15
15
63
15
63
15
15
15
3
3
15
15
WIDE ADJUSTMENT
V Aspect
V Scroll
Upper V Lin
Lower V Lin
Left Blanking
Right Blanking
4:3
47
25
0
0
11
11
16:9
47
25
0
0
11
11
0
0
0
0
0
0
-
63
63
15
15
15
15
FAWCTIST
ON
0
36
36
18
36
18
41
10
12
2
10
0
26
HIZ
25
64
127
97
97
97
ON/OFF
0 - 20
0 - 127
0 - 127
0 - 127
0 - 127
0 - 127
0 - 127
0 - 127
0 - 127
0 - 127
0 - 127
0 - 127
0 - 127
ON/HIZ
0 - 127
0 - 127
0 - 127
0 - 127
0 - 127
0 - 127
Dynamic Convergence
DYNAMIC CONVERGENCE
Range
H stat
H amp l
H amp r
Up Y
Low Y
Y up l
Y up r
Y low l
Y low r
Mbow up l
Mbow up r
Mbow low l
Mbow low r
V stat
IC Status
IC STATUS (CXA2076 / CXA2040)
CXA2076
H lock
IKR
V NG
XRAY
Colour System
CV1 Sync
CXA2040
Sync Sep
S1 Mode Pin
S2 Mode Pin
PORT EXPANDER
Power Good
TUNER
Tuner Status
0
AGC On / Off
Constant Gain CDB
FM Prescale FMP
Zwei Mono-St WHI
Zwei St-Mono WLO
Zwei Mono-Bi WMH
Zwei Bi-Mono WLO
Time Zwei WML
FAWCT Limit
FAWCT Soll Init FAW
FAW ER Tol
NICAM Err Max CCT
NICAM Err Min
Time NICAM
Audio Clock ACO
SCART Prescale
SCART Volume
NICAM Prescale I
NICAM Prescale L
NICAM Prescale BG
NICAM Prescale DK
Wide (* : No need to adjust)
*
*
*
*
*
*
RM-892
RM-862
MSP
GEOMETRY ADJUSTMENT
V Size
V Position
S Correction
V Linearity
H Size
H Position
Pin Amp
Pin Phase
AFC Bow
AFC Angle
EHT V
EHT H
Lo Corn Pin
Up Corn Pin
RM-892
1
1
0
0
7
0
1
01
01
0
01111100
– 33 –
0
0
0
0
0
0
0
0
0
0
0
0
0
0
0
0 OFF
OFF
OFF
OFF
OFF
OFF
OFF
OFF
OFF
OFF
OFF
OFF
OFF
OFF
42
- 63
- 63
- 63
- 63
- 63
- 63
- 63
- 63
- 63
- 63
- 63
- 63
- 63
- 63
12
KP-41PX1/41PX1K/41PX1R
K
Current TV Status
RM-892
RM-892
RM-862
Convergence
Depends on the signals
PAL, SECAM : 50
NTSC
: 60
TV STATUS RE-2A(TT09)
Text System
Dolby Enabled
DSP Present
Text Language Set
Menu Language Set
Destination
Ageing
Auto Shut Off
Size
Colour Trap Sw
Velocity Mod
AFT Status
Digital PF
Micro/Jungle
Mode
C Text-2
No
No
East/Greek
East
AEP
Disabled
Enabled
PJ
All
On
Item No.
OSD
CHSW
00
Adjustment Item
50
00
Data
No
SDA5250/CXA2076
6-1-3. Service List (Convergence)
(With some models, contents may be different from the following)
Initial Data
Mode
Item
Number
Adjustment
Item
Data Range
OSD
00
CHSW
00, 01
00
01
02
03
OSH
OSV
VMRK
01 ~ 32
01 ~ 32
00, 01
10
10
00
00
SFTE
00, 01
01
01
SFTF
00, 01
00
00
GSEL
00, 01
00
00
01
02
03
04
05
06
07
08
09
10
11
12
13
14
15
16
CENT
SKEW
BOW
4BOW
SIZE
LIN
MSIZ
MLIN
KEY
SSKW
MPIN
PIN
SBOW
MBOW
4PIN
4SBO
–127 ~ +127
–127 ~ +127
–127 ~ +127
–127 ~ +127
–127 ~ +127
–127 ~ +127
–127 ~ +127
–127 ~ +127
–127 ~ +127
–127 ~ +127
–127 ~ +127
–127 ~ +127
–127 ~ +127
–127 ~ +127
–127 ~ +127
–127 ~ +127
12
–03
00
00
–27
–21
21
–03
00
–12
10
–10
09
00
09
00
12
–03
00
00
–27
–21
21
–03
00
–12
10
–10
09
00
09
00
SFT
GH
16 : 9
Name / Description
4:3
Device
HATCH DISPLAY
00 : Internal Pattern (Crosshatch)
01 : External Pattern
OSD H Position
OSD V Position
V SIZE MARKER
ON / OFF (cannot write to NVM)
SHIFT ENABLE
00 : Disable 01 : Enable
SHIFT FAST
00 : Normal 01 : Quick (cannot write to NVM)
OSD SELECT FOR GH, GV
00 : Green+Red 01 : Green
GREEN H CENTER
GREEN H SKEW
GREEN H BOW
GREEN H 4th BOW
GREEN H SIZE
GREEN H LINEARITY
GREEN H MID SIZE
GREEN H MID LINEARITY
GREEN H KEYSTONE
GREEN H SUB SKEW
GREEN H MID PINCUSHION
GREEN H PINCUSHION
GREEN H SUB BOW
GREEN H MID BOW
GREEN H 4th PINCUSHION
GREEN H 4th SUB BOW
– 34 –
CXP86213
KP-41PX1/41PX1K/41PX1R
K
Item
Mode Number
Adjustment
Item
Data Range
RM-892
RM-892
RM-862
Initial Data
16 : 9
4:3
Name / Description
GV
00
01
02
03
04
05
06
07
08
09
10
11
12
13
CENT
SKEW
BOW
SIZE
LIN
MSIZ
MKEY
KEY
SSKW
MPIN
PIN
SBOW
WAVW
4PIN
–127 ~ +127
–127 ~ +127
–127 ~ +127
–127 ~ +127
–127 ~ +127
–127 ~ +127
–127 ~ +127
–127 ~ +127
–127 ~ +127
–127 ~ +127
–127 ~ +127
–127 ~ +127
–127 ~ +127
–127 ~ +127
03
–17
00
–25
–12
30
00
02
–08
00
37
27
00
03
03
–17
00
–25
–12
30
00
02
–08
00
37
27
00
03
GREEN V CENTER
GREEN V SKEW
GREEN V BOW
GREEN V SIZE
GREEN V LINEARITY
GREEN V MID SIZE
GREEN V MID KEYSTONE
GREEN V KEYSTONE
GREEN V SUB SKEW
GREEN V MID PINCUSHION
GREEN V PINCUSHION
GREEN V SUB BOW
GREEN V WAVE
GREEN V 4th PINCUSHION
RH
00
01
02
03
04
05
06
07
08
09
10
11
12
13
14
15
CENT
SKEW
BOW
4BOW
SIZE
LIN
MSIZ
MLIN
KEY
SSKW
MPIN
PIN
SBOW
MBOW
4PIN
4SBO
–95 ~ +96
–95 ~ +96
–127 ~ +127
–127 ~ +127
–127 ~ +127
–127 ~ +127
–127 ~ +127
–127 ~ +127
–127 ~ +127
–127 ~ +127
–127 ~ +127
–127 ~ +127
–127 ~ +127
–127 ~ +127
–127 ~ +127
–127 ~ +127
–25
–05
08
00
–25
–55
38
–21
–17
–23
03
–02
84
11
13
–03
–25
–05
08
00
–25
–55
38
–21
–17
–23
03
–02
84
11
13
–03
RED H CENTER
RED H SKEW
RED H BOW
RED H 4th BOW
RED H SIZE
RED H LINEARITY
RED H MID SIZE
RED H MID LINEARTIY
RED H KEYSTONE
RED H SUB SKEW
RED H MID PINCUSHON
RED H PINCUSHON
RED H SUB BOW
RED H MID BOW
RED H 4th PINCUSHON
RED H 4th SUB BOW
RV
00
01
02
03
04
05
06
07
08
09
10
11
12
13
14
CENT
SKEW
BOW
SIZE
LIN
MSIZ
MKEY
KEY
SSKW
MPIN
PIN
SBOW
WAVW
4PIN
MWAV
–95 ~ +96
–95 ~ +96
–127 ~ +127
–127 ~ +127
–127 ~ +127
–127 ~ +127
–127 ~ +127
–127 ~ +127
–127 ~ +127
–127 ~ +127
–127 ~ +127
–127 ~ +127
–127 ~ +127
–127 ~ +127
–31 ~ +31
–20
–23
02
13
–03
28
12
–19
02
–02
16
25
36
–02
–07
–20
–23
02
13
–03
28
12
–19
02
–02
16
25
36
–02
–07
RED V CENTER
RED V SKEW
RED V BOW
RED V SIZE
RED V LINEARITY
RED V MID SIZE
RED V MID KEYSTONE
RED V KEYSTONE
RED V SUB SKEW
RED V MID PINCUSHON
RED V PINCUSHON
RED V SUB BOW
RED V WAVE
RED V 4th PINCUSHON
MID WAVE
BH
00
BSEL
00, 01
00
00
01
02
03
04
05
06
07
08
09
10
11
12
13
14
15
16
CENT
SKEW
BOW
4BOW
SIZE
LIN
MSIZ
MLIN
KEY
SSKW
MPIN
PIN
SBOW
MBOW
4PIN
4SBO
–95 ~ +96
–95 ~ +96
–127 ~ +127
–127 ~ +127
–127 ~ +127
–127 ~ +127
–127 ~ +127
–127 ~ +127
–127 ~ +127
–127 ~ +127
–127 ~ +127
–127 ~ +127
–127 ~ +127
–127 ~ +127
–127 ~ +127
–127 ~ +127
10
07
–03
00
–18
11
42
13
–01
–09
–03
–06
–31
–14
15
01
10
07
–03
00
–18
11
42
13
–01
–09
–03
–06
–31
–14
15
01
OSD SELECT FOR BH, BV
00 : Blue + Green 01 : Blue + Red
BLUE H CENTER
BLUE H SKEW
BLUE H BOW
BLUE H 4th BOW
BLUE H SIZE
BLUE H LINEARITY
BLUE H MID SIZE
BLUE H MID LINEARTIY
BLUE H KEYSTONE
BLUE H SUB SKEW
BLUE H MID PINCUSHON
BLUE H PINCUSHON
BLUE H SUB BOW
BLUE H MID BOW
BLUE H 4th PINCUSHON
BLUE H 4th SUB BOW
– 35 –
Device
CXP86213
KP-41PX1/41PX1K/41PX1R
K
Adjustment
Item
Data Range
BV
00
01
02
03
04
05
06
07
08
09
10
11
12
13
14
CENT
SKEW
BOW
SIZE
LIN
MSIZ
MKEY
KEY
SSKW
MPIN
PIN
SBOW
WAVW
4PIN
MWAV
–95 ~ +96
–95 ~ +96
–127 ~ +127
–127 ~ +127
–127 ~ +127
–127 ~ +127
–127 ~ +127
–127 ~ +127
–127 ~ +127
–127 ~ +127
–127 ~ +127
–127 ~ +127
–127 ~ +127
–127 ~ +127
–31 ~ +31
ACV
00
ART0
01 ~ 08
06
01
02
03
04
05
06
07
08
09
10
11
12
13
14
15
16
17
18
19
20
21
22
AT1T
AT1M
AT1B
AH51
AH52
AV5T
AV5M
AV5B
AH61
AH62
AV6T
AV6M
AV6B
RHCO
BHCO
RVCO
BVCO
RHSO
BHSO
RVSO
BVSO
AERR
00 ~ 255
00 ~ 255
00 ~ 255
01 ~ 255
01 ~ 255
00 ~ 255
00 ~ 255
00 ~ 255
01 ~ 255
01 ~ 255
00 ~ 255
00 ~ 255
00 ~ 255
–127 ~ +127
–127 ~ +127
–127 ~ +127
–127 ~ +127
–127 ~ +127
–127 ~ +127
–127 ~ +127
–127 ~ +127
00 ~ 255
18
132
240
18
130
01
60
130
18
130
01
46
100
–48
15
–04
03
–03
05
09
–07
00
00
01
ACTL
ACTH
00 ~ 255
00 ~ 255
10
00
MSC
RM-892
RM-862
Initial Data
Item
Number
Mode
RM-892
16 : 9
4:3
–19
08
05
–08
–02
28
–12
05
–22
–07
22
29
–31
–12
–03
–19
08
05
–08
–02
28
–12
05
–22
–07
22
29
–31
–12
–03
Name / Description
BLUE V CENTER
BLUE V SKEW
BLUE V BOW
BLUE V SIZE
BLUE V LINEARITY
BLUE V MID SIZE
BLUE V MID KEYSTONE
BLUE V KEYSTONE
BLUE V SUB SKEW
BLUE V MID PINCUSHON
BLUE V PINCUSHON
BLUE V SUB BOW
BLUE V WAVE
BLUE V 4th PINCUSHON
MID WAVE
DATA SAMPLE LENGTH
(1 step = 1 µsec.)
Data Sampling Start Time
from V BLK (50Hz)
(1 step = 64 µsec = approx. 1H)
(1 step = 1 OSD step) OSD H POS 50 (L&R)
OSD H POS 50 (UP&BOTTOM)
(1 step = 2 lines)
OSD V POS 50 (UP)
OSD V POS 50 (L&R)
OSD V POS 50 (BOTTOM)
(1 step = 1 OSD step) OSD H POS 60 (L&R)
OSD H POS 60 (BOTTOM)
(1 step = 2 lines)
OSD V POS 50 (UP)
OSD V POS 50 (L&R)
OSD V POS 50 (BOTTOM)
(8 step = 1 step)
RH CENT ADJ OFFSET
BH CENT ADJ OFFSET
RV CENT ADJ OFFSET
BV CENT ADJ OFFSET
RH SKEW ADJ OFFSET
BH SKEW ADJ OFFSET
RV SKEW ADJ OFFSET
BV SKEW ADJ OFFSET
(Error Code)
Lower byte of counter value
Higher byte of counter value
– 36 –
Device
CXP86213
KP-41PX1/41PX1K/41PX1R
K
RM-892
6-2. REGISTRATION ADJUSTMENT
CENTER ADJUSTMENT
6-2-1. Registration Adjustment Method
1. Adjust H Position and V Position.
1. Turn on the main power switch of the set and enter into
standby mode.
2. Press the following sequence of buttons on the Remote
Commander.
SCREEN
( ONDISPLAY
)
H Position
Enter the
“TT MODE”
5
(DIGIT 5)
(VOLUME +)
RM-892
V Position
(TV MODE)
3. Press “MENU” on the commander.
4. Move to the corresponding adjustment using the joystick
(v or V : up or down) on the commander.
5. Move the joystick to the right (B) to enter the selected
adjustment.
With the joystick
:
SIZE ADJUSTMENT
1.
2.
3.
4.
5.
Make Convergence GH SIZE data “00”.
Adjust Geometry H Size.
Make Convergence GV SIZE data “00”.
Adjust Geometry V Size.
Adjust Geometry S Correction.
v or V Items change
H Size
b or B Data change
In internal pattern :
ITEM : Convergence
OSD CHSW = “00” Internal pattern (crosshatch)
OSD CHSW = “01” External pattern
Color of internal pattern :
ITEM : Convergence
GH GSEL = “00”
GH GSEL = “01”
BH BSEL = “00”
BH BSEL = “01”
V Size
Green + Red
Green
Blue + Green
Blue + Red
Signal : PAL SPCB
16 : 9
4:3
6-2-2. Main Deflection Adjustment
1. Receive the PAL SPCB signal.
2. Select 16 : 9 mode.
Press “ (blue key)” : 4 : 3 b 16 : 9
Need geometry adjustment to 16 : 9 mode and 4 : 3 mode.
Production spec of each mode.
3. Select service mode and enter adjustment item for green signal.
– 37 –
H SIZE
16.6 ±0.2 sq
17.1 ±0.2 sq
V SIZE
12.6 ±0.2 sq
12.4 ±0.2 sq
RM-862
KP-41PX1/41PX1K/41PX1R
K
RM-892
RM-892
RM-862
MAIN DEFLECTION ADJUSTMENT
6-2-3. Sub Deflection Adjustment
1. Adjust V Linearity.
Correct linearity of the horizontal top and bottom lines.
1. Receive the PAL SPCB signal.
2. Select 16 : 9 mode.
Press “ (blue key)” : 4 : 3 b 16 : 9
Need geometry adjustment to 16 : 9 mode and 4 : 3 mode.
Production spec of each mode.
3. Select service mode and enter adjustment item for green signal.
V Linearity
2. Adjust AFC Angle
Correct the vertical center line to be in parallel with the screen
edges and other colors.
AFC Angle
3. Adjust AFC Bow
Correct linearity of the vertical center line.
AFC Bow
4. Adjust PIN Amp
Correct the vertical left and right lines and eliminate pincushion-shaped distortion.
PIN Amp
5. Adjust PIN Phase
Correct the vertical left and right lines to be in parallel with
each other.
PIN Phase
SUB DEFLECTION ADJUSTMENT ITEM
Adjustment
<
: Yes – : No
Adjustment type
Display
Adjustment item
GSEL
BSEL
COL SELECT
COL SELECT
O
–
–
–
–
–
–
–
–
O
–
–
CENT
SKEW
CENT
SKEW
O
O
O
O
O
O
O
O
O
O
O
O
BOW
4BOW
BOW
4TH BOW
O
O
O
–
O
O
O
–
O
O
O
–
SIZE
LIN
SIZE
LIN
O
O
O
O
O
O
O
O
O
O
O
O
MSIZ
MLIN
MID SIZE
MID LIN
O
O
O
–
O
O
O
–
O
O
O
–
MKEY
KEY
MID KEY
KEY
–
O
O
O
–
O
O
O
–
O
O
O
SSKW
MPIN
SUB SKEW
MID PIN
O
O
O
O
O
O
O
O
O
O
O
O
PIN
SBOW
PIN
SUB BOW
O
O
O
O
O
O
O
O
O
O
O
O
WAVW
MBOW
WAVE
MID BOW
–
O
O
–
–
O
O
–
–
O
O
–
4PIN
4SBO
MWAV
4TH PIN
4TH SUB BOW
MID WAVE
O
O
–
O
–
–
O
O
–
O
–
O
O
O
–
O
–
O
6. Adjust Up Corn Pin
Correct the screen top section line bow.
Up Corn Pin
7. Adjust Lo Corn Pin
Correct the screen bottom section line bow.
Lo Corn Pin
– 38 –
GH GV RH
RV
BH BV
KP-41PX1/41PX1K/41PX1R
K
RM-892
RM-892
RM-862
GREEN VERTICAL LINE ADJUSTMENT
GREEN HORIZONTAL LINE ADJUSTMENT
1. Receive the PAL SPCB signal.
2. Carefully watching out for the GH CENT screen center section, adjust GH CENT, GH BOW, GH SKEW.
3. GH 4BOW adjustment. Correct the corner distortion which
could not be adjusted with GH BOW.
1. Receive the PAL SPCB signal.
2. Finely adjust the center position of the vertical line at the
center of the screen with GV CENT.
3. Using GV SKEW and GV BOW, correct the tilt and bow of
the horizontal line at the centre of the screen.
Watch out only for the
GH CENT center point.
Watch the horizontal
center line.
Watch
Watchout
outonly
onlyfor
forthe
theGV
GV CENT
center
CENT
center
point.point.
Watch the vertical center line.
GH CENT
GV CENT
GH BOW
GV SKEW
GH SKEW
GV BOW
GH 4BOW
GREEN SIZE AND LINEARITY ADJUSTMENT
1. Receive the Internal pattern (crosshatch) signal.
2. Balance the sizes at both sides of the center section of the
screen with GH MLIN.
3. Balance the sizes on both end sections of the screen with
GH LIN.
4. While tracking, adjust with GH MLIN and GH LIN so
that the sizes of the horizontal line at the center of the
screen are symmetrical left and right.
MLIN
LIN
– 39 –
KP-41PX1/41PX1K/41PX1R
K
RM-892
RM-892
RM-862
GREEN HORIZONTAL SIZE ADJUSTMENT
GREEN VERTICAL SIZE ADJUSTMENT
1. Receive the Internal pattern (crosshatch) signal.
2. Adjust with GH MSIZ, so that the sizes of both edges and
centre are equal.
3. Adjust with GH SIZE, so that the horizontal sizes of both
edges and centre are equal.
4. While tracking adjust GH MSIZ and GH SIZE so that the
space intervals for the horizontal section of the screen are
equal.
5. Adjust again if M LIN is changed after GH MSIZ
and GH SIZE are complete.
1. Receive the Internal pattern (crosshatch) signal.
2. Adjust GV MSIZ so that the sizes at the top and bottom and
centre are equal.
3. Set the vertical size to correct specification.
4. While tracking adjust GV MSIZ and GV SIZE so that the
space intervals for the vertical line of the screen are equal,
also the vertical size should be within space.
5. Adjust again if GV LIN has been altered after completing
the above adjustments.
MSIZ
MSIZ
SIZE
SIZE
GV LIN
GH MLIN
GH MSIZ
MSIZ
GH
GV SIZE
GH LIN
GV MSIZ
MSIZ
GV
GH SIZE
GREEN HORIZONTAL TRAPEZOIDAL DISTORTION
ADJUSTMENT
GREEN VERTICAL LINEARITY ADJUSTMENT
1. Receive the Internal pattern (crosshatch) signal.
2. Adjust GV LIN so that the vertical lines at the top and bottom of the screen are symmetrical.
1. Receive the Internal pattern (crosshatch) signal.
2. Adjust GH SSKW so that the tilt of the vertical lines at both
edges of the screen are symmetrical left and right.
3. Adjust GH KEY so that there is no tilt in the vertical lines at
both edges of the screen.
4. While tracking adjust GH KEY and GH SSKW.
SS
KW
SSKW
KEY
– 40 –
KP-41PX1/41PX1K/41PX1R
K
GREEN HORIZONTAL QUATERNARY ADJUSTMENT
1. Receive the Internal pattern (crosshatch) signal.
2. Adjust GH 4PIN, to correct the 4th order distortion.
3. Adjust GH 4SBO to balance and correct the 4th order distortion at both edges of the screen.
4. While tracking adjust GH 4PIN and GH 4SBO.
RM-892
RM-892
RM-862
GREEN HORIZONTAL SYMMETRICAL PIN DISTORTION
ADJUSTMENT
1. Receive the Internal pattern (crosshatch) signal.
2. Adjust GH MPIN to correct pin distortion at both edges of
the centre section.
3. Use GH PIN to correct pin distortion at both edges of the
screen.
4. While tracking adjust GH MPIN and GH PIN so that the PIN
of vertical lines on the entire screen have no bowing.
5. If there is asymmetrical distortion after adjustments, readjust GH MBOW and GH SBOW while tracking.
4PIN
4SBO
4SBO
MPIN
PIN
GREEN HORIZONTAL ASYMMETRICAL PIN
DISTORTION ADJUSTMENT
1. Receive the Internal pattern (crosshatch) signal.
2. Adjust GH MBOW, so that the pin asymmetry at both sides
of the centre section are symmetrical left and right.
3. Adjust GH SBOW so that the bow at both edges of the screen
is symmetrical left and right.
4. While tracking adjust GH MBOW and GH SBOW so that
the bow of vertical lines over the entire screen is symmetrical.
GH MBOW
GH PIN
GH SBOW
GH MPIN
GREEN VERTICAL WAVE (3RD-ORDER) DISTORTION
ADJUSTMENT
MBOW
SBOW
1. Receive the Internal pattern (crosshatch) signal.
2. Check the screen at the top & bottom, and look for any 2nd
or 3rd order waveform distortion of horizontal lines. Correct
with GV WAVW.
3. While tracking adjust GV WAVW and GV KEY, if here are
any KEY distortion.
GV WAVW
GV KEY
– 41 –
KP-41PX1/41PX1K/41PX1R
K
RM-892
RM-892
RM-862
GREEN VERTICAL 4TH ORDER DISTORTION
ADJUSTMENT
GREEN VERTICAL ASYMMETRICAL PIN DISTORTION
(2ND-ORDER DISTORTION) ADJUSTMENT
1. Receive the Internal pattern (crosshatch) signal.
2. By using GV 4PIN, 4th-Order distortion of the horizontal
lines at the top & bottom can be corrected.
Since there is no 4SBO for vertical correction, there will be a
slight imbalance, but adjust the registration to eliminate any
distortion.
1. Receive the Internal pattern (crosshatch) signal.
2. Correct the asymmetrical pin distortion at the top and bottom of the screen with GV SBOW.
GV SBOW
GV 4PIN
GREEN VERTICAL ASYMMETRICAL PIN DISTORTION
ADJUSTMENT
GREEN VERTICAL TRAPEZOIDAL DISTORTION
ADJUSTMENT
1. Receive the Internal pattern (crosshatch) signal.
2. Adjust GV SSKW so that the tilt of the horizontal lines at the
top and bottom of the screen are symmetrical.
3. Adjust GV MKEY so that there is no tilt for the middle section.
4. Adjust GV KEY so that there is no tilt at the top and bottom
of the screen.
5. While tracking adjust GV MKEY and GV KEY, so that there
is no tilt over the entire screen.
6. If the tilt is unbalanced after GV MKEY and GV KEY
have been adjusted, readjust GV SSKW.
1. Receive the Internal pattern (crosshatch) signal.
2. Using GV MPIN adjust the pin distortion at both edges of
the screen and at the centre.
3. Using GV PIN, adjust, so that the horizontal lines at the top
& bottom of the screen are straight lines.
4. Adjust GV MPIN & GV PIN so that there is no curve in the
horizontal lines on the entire screen.
5. After adjusting the items above, using tracking with GV
SBOW. GV MPIN, and GV PIN to correct the entire screen.
MPIN
GV SSKW
PIN
GV SBOW
GV MPIN
MKEY
KEY
GV SSKW
GV KEY
GV MKEY
– 42 –
GV PIN
KP-41PX1/41PX1K/41PX1R
K
RM-892
RM-892
RM-862
RED REGISTRATION ADJUSTMENT
AUTO CONVERGENCE PRESET
1. Receive the Internal pattern (crosshatch) signal.
GH GSEL = “00” (Green + Red)
2. Adjust so that the red lines lay on the green lines.
Adjust, using the same procedure as the green sub item
adjustment outline above.
1. Set in the TT mode.
(AUTO CONVERGENCE)” button on front
2. Press “
panel.
3. Confirm convergence is the same condition as before.
4. Press “-” + “-” button on commander to exit from the TT
mode.
TT00 : Exit from the TT mode
Note : Main registration correction should not be while
adjusting Red adjustment.
BEWARE : Not to change green sub items.
It’ s easily done by mistake.
BLUE ADJUSTMENT
1. Receive the Internal pattern (crosshatch) signal.
BH BSEL = “00” (Blue + Green)
2. Adjust so that the blue lines lay on the green lines.
Adjust, using the same procedure as the green sub item
adjustment outline above.
Note : Main registration correction should not be while
adjusting Blue adjustment.
BEWARE : Not to change green and red sub items.
It’ s easily done by mistake.
REGISTRATION DATA WRITE
1. After finish all PAL registration adjustments, write PAL registration data by pressing form the appropriate buttons.
DATA WRITE : Press “
6-3. HORIZONTAL POSITION ADJUSTMENT
1. Receive the PAL SPCB signal.
2. Select 4 : 3 mode.
Press “ (blue key)” : 16 : 9 b 4 : 3
3. Set in the service mode and select “Geometry” .
4. Adjust “H position” so that the picture is displayed in the
horizontal center of screen.
6-4. TEXT POSITION ADJUSTMENT
1. Receive the RF signal with teletext.
Signal must have burst. Select full page text.
2. Set in the TT mode.
3. Press “1” + “4” (41PX1/41PX1K) or “7” + “4” (41PX1R)
button on commander.
TT14 : TEXT H POSITION adjustment (41PX1/41PX1K)
TT74 : TEXT H POSITION adjustment (41PX1R)
4. Adjust H position of text.
5. Push “ (TV MODE)” to exit.
(MUTE)” + “-”
DATA COPY FROM PAL TO NTSC
1. Copy PAL data to NTSC data by pressing form the appropriate buttons.
A = B
: Press “ (ON SCREEN DISPLAY)”
+ “-”
2. Press “ ” + “-” to copy data from PAL to NTSC.
If you press “ ” ,then it appears “Copy 5060” to display.
DATA COPY
A
B
With the joystick
:
b (Move the Left)
B (Move the Right)
∗ Make sure input signal is PAL. If input signal is NTSC
and do this process, NTSC data are copied to PAL data !
4 : 3 MODE ADJUSTMENT
1. Receive the PAL SPCB signal.
2. Select 4 : 3 mode.
Press “ (blue key)” : 16 : 9 b 4 : 3
3. 4 : 3 mode adjustment are the same as 16 : 9 mode.
– 43 –
KP-41PX1/41PX1K/41PX1R
K
6-5. WHITE BALANCE ADJUSTMENT
1. Receive the Monoscope signal.
2. Set in the service mode and select “Picture Adjustment”.
3. Adjust “Sub Brightness” so that the signal 10 IRE section
barely glows.
4. Receive the All-White pattern signal.
5. Adjust the white balance with “Green Cutoff” and “Blue Cutoff”.
6. Adjust “Sub Brightness” so that the signal 100 IRE section
barely glows.
7. Adjust the white balance with “Green Drive” and “Blue Drive”.
8. Repeatedly adjust the white balance for the minimum and
maximum picture setting.
6-6. SUB BRIGHTNESS ADJUSTMENT
1. Receive the Monoscope signal.
2. Set in the TT mode.
3. Press “1” + “3” (41PX1/41PX1K) or “2” + “3” (41PX1R)
button on commander.
TT13 : SUB BRIGHTNESS adjustment (41PX1/41PX1K)
TT23 : SUB BRIGHTNESS adjustment (41PX1R)
4. Adjust sub brightness 0 IRE and 10 IRE border just appear
point by “b ” or “B” key of commander.
With the joystick
RM-892
RM-892
RM-862
6-7. SUB CONTRAST ADJUSTMENT
(A or AE Board)
1. Receive the PAL video color bar signal.
White 100%
1 Vp-p / 75 Ω terminated.
2. Connect the external power supply to “ABL” and ground.
CN1 <Bk pin (ABL) : 41PX1/41PX1K
A board
3.
4.
5.
6.
7.
8.
AE board CN1 rd pin (ABL) : 41PX1R
Connect the oscilloscope between CN301 1 pin (RED DRIVE)
and ground.
Set PICTURE to maximum and COLOUR to minimum.
Set in the service mode and select “Picture Adjustment”.
Supply DC 3.0 V from external power supply to “ABL”.
Adjust “Sub Contrast” so that the level between black and
white is 2.5 ±0.1 Vp-p .
Press “ (MUTE)” + “-” button to write the data.
White
2.5 ±0.1 Vp-p
:
Black
b (Down)
B (Up)
5. Decrease 3 steps from adjusted point.
– 44 –
KP-41PX1/41PX1K/41PX1R
K
RM-892
RM-892
RM-862
SECTION 7
DIAGRAMS
7-1. BLOCK DIAGRAMS
IC103
DIGITAL COMB FILTER
IC201
VIDEO SW
TU101
25
VIDEO
13
BUFFER
Q103,115,116
BUFFER
Q201
CVBS OUT
TV IN
BUFFER
Q104
FL102
IC204
YC SW
25
31
AYO
ADIN
IC301
SHADING
CN301
BUFF
Q107,108
FL103
4
Y BUFFER
Q212
3
5
55
22
SVHS-Y IN
R OUT
24
G OUT
23
INV
Q113,114
AM
BUFFER
Q120,122
QSS
CLAMP
Q105,106
27
V2
Y2
C2
S1
S2
29
1
3
4
6
31
5
7
20
SCL
21
SDA
CVBS
SCL
SCL
SDA
L102
Q121,130,124
SDA
AGC
BUFF
Q109,125
FL104
SYNC IN TV
V1
V3
Y3
C3
CVBS
Y IN
C IN
MODE
MODE
CVBS
Y IN
C IN
39
ACO
SCL
SDA
22
RB
11
OCLK
6
9
8
69
RAT1
70
NTPL
Y
1
Y
C
C
11
57
12
10
IN AV-3
AV-3
AV-3
15
BUFFER
Q217
CVBS OUT AV-2
4
INV
Q211
4FSC
BUFFER
Q202
53
31
32
49
38
33
37
64
10
IC102
4FSC PLL
CVBS OUT
7
V-2
4FSC ADJ
Q101,102
R
26
SVHS-C IN
15
16
17
18
19
12
13
14
11
2
13
IN AV-2
AV-2
AV-2
11
SYNC Y OUT
9
SYNC C OUT
9V
C BUFFER
Q213
1
FSC
B OUT
27
FB2 IN
HB2 IN
R2 IN
G2 IN
B2 IN
R1 IN
G1 IN
B1 IN
FB1 IN
IK IN
46 47
VS HS IN
48
SYNC OUT
5
Y OUT
PAL/NT
IC202
AUDIO PROCESSOR
28
56
L OUT SP
MONO IN
BUFFER
Q204
SP L
BUFFER
Q203
SP R
15
SCL
SW
Q215
14
SDA
SW
Q216
YC/COMB
MODE S
MODE O
SP SW
A REGI
SCL
6
1
2
7
9
12V
SCL
SDA
FS
E
PJE YM
PJE YS
PJE B
PJE G
PJE R
SPSW
50-60
VBLK
1
2
3
4
5
6
7
8
9
10
11
12
13
S300
SW
IC302
IH DELAY LINE
16
14
11
12
5
R-Y IN
B-Y IN
R-Y OUT
B-Y OUT
SSCP
MODE3
CN6
12V
SCL
SDA
SDA
IC303
CHROMA DEC
25
ANA-IN1
57
R OUT SP
ANA-IN2
1/
(AV2)
2/
2
34
L IN AV-1
33
R IN AV-1
L2
R2
31
L IN AV-2
32
R IN AV-2
L3
R3
59
L OUT HP
60
R OUT HP
37
L IN AV-3
36
R IN AV-3
L OUT AV-2
20
50
L OUT AV-1
51
R OUT AV-1
HP L
HP R
IC203
AUDIO SW
R2
G2
B2
3
INV
Q207
P1.5
P3.1
Q20,23
L2
1
BUFFER
Q1,1002
74
10
CVBS IN
I2
TO D BOARD
CN1702
INV
Q309
61
RED
L1
R1
1
IDENT
12
B-Y OUT
11
R-Y OUT
IC1
MICRO
IC1001
TEXT/OSD
5
47
L2
XTAL
19
SSCP
20
CVBS
FB2
6
2
MUTE DRIVE
Q208,209,210
CVBS IN
+9V
62
GREEN
Q21,24
9
P1.2
XTAL2
14
48
R OUT AV-2
21
B1
13
R2
IC4
RESET
1
RST SW
Q1001
17
63
RST
INV
Q18,214
60
BLUE
P0.4
Q22,25
XTAL
R2
X201
18.432M
INV
Q206
64
ANKING
RESET
61
1
IC205
RESET
IC3
PROGRAM ROM
12
6
XTAL1
SW
Q4
X1
11.5MHz
XOUT
X1001
20.48MHz
SW
Q205
7
XIN
59
FB-2
15
16
77
66
USART
67
USART
68
ENABLE
18-35,37
18-35,37
36,38-44
36,38-44
A0-A18
A0-A18
D0-D7
D0-D7
G1
55
VS
L2
R2
(AV1)
AUDIO R OUT
AUDIO R OUT
AUDIO R IN
AUDIO R IN
AUDIO L OUT
AUDIO L OUT
GND
GND
GND
GND
AUDIO L IN
AUDIO L IN
NC
BLUE IN
MODE
MODE
GND
GND
NC
NC
NC
GREEN IN
NC
NC
GND
GND
GND
GND
SVHS-C IN
RED IN
NC
BLANKING
GND
GND
GND
GND
CVBS OUT
CVBS OUT
CVBS/Y IN
CVBS IN
GND
GND
L1
R2
R2
G2
B2
23
CN201
A1
B1
A2
B2
A3
B3
A4
B4
A5
B5
A6
B6
A7
B7
A8
B8
A9
B9
A10
B10
A11
B11
A12
B12
A13
B13
A14
B14
A15
B15
A16
B16
A17
B17
A18
B18
A19
B19
A20
B20
A21
B21
H2
TO CR BOARD
CN703
INV
Q330
51
SCL
50
SDA
28
ABL IN
30
VTIM
62
3.58MHz
3.58MHz 61
30
L2 FIL
3
R-Y OUT
4
B-Y OUT
7
R-Y IN
8
B-Y IN
1
SECAM REF
IC206
BUS SW
4
1
2
3
4
5
6
7
Y BUFFER
Q301-303
6
Y IN
CVBS IN
V- DRIVE
V+ DRIVE
VM
AFC PIN
E-W
H OUT
FISO
SSCP OUT
RED DRIVE
GRN DRIVE
BLUE DRIVE
9V
GND
CUT OFF
GND
4
VS
VS
C2
FB1
V-BUFFER
Q110-112
SCL
SDA
CN1
11
IC2
NVM
VS
INV
Q17
HS
54
HS/SSCP
16
63
RST
10
P1.1
67 P2.0
R1
57
56
P1.4
P3.0
P0.5
P0.6
P2.2
P3.2
P2.1
7
4
61
62
65
80
68
MUTE
E-W
V+
V-
TEST
6
SCL
SCL
VS
HS
AFC PIN
H OUT
STBY
BUFFER
Q331
V1
SP
SP
HP
HP
L
R
L
R
MUTE
CVBS OUT
V3
Y3
C3
L3
R3
L2
R2
MUTE
K1
IR
LED
AE
MODE3
A REGI
TUNER,AUDIO/VIDEO PROCESS,
µ COM,Y/C JUNGLE
(41PX1R)
5V
41
9V
SDA
7
LED
STBY
K1
IR
33V
37
5V
5
SDA
Y2
Y2/V2
V1
33V
PROT
Q507,308
79
5
HS
INV
Q15
P0.1
P0.0
9V
5
46
48
43
45
7
6
9
38
20
13
15
22
21
37
12
24
26
25
28
23
27
30
29
16
32
39
35
42
3
B-SS510.<AEP>-B/D-1
– 45 –
E/W
V+ OUT
V OUT
ABL
V SYNC
HFBP
H DRIVE
PROT
P CONT
VM OUT
SPKR L
SPKR R
H/P L
H/P R
VBS OUT
CVBS OUT
V IN
Y IN
C IN
L IN
R IN
L OUT
R OUT
S3/GND
MUTE
KEY2
SIRCS
STBY LED
MODE3
A REGI
J2
TO D BOARD
CN1801
KP-41PX1/41PX1K/41PX1R
K
RM-892
1
TU101
AMP
Q114
VIDEO
AMP
Q117
AM
MV2
BUFFER
Q120,122
QSS
SDA
SDA
MC2
25
23
BUFFER
Q205,206
29
1
BUFFER
Q207,208
3
CVBS OUT
TV IN
SYNC IN TV
AGC
V1
27
V3
31
AGC MONI
SW
Q81
AGC DEF
V_2
AMP
Q110-112
INV
Q18,214
17
S1
S2
DIS
FS
15
4
6
BUFFER
Q103,
115,116
BUFFER
Q201
13
VIDEO
LPF
FL102
BUFFER
Q104
2
A/D IN
CVBS IN
AV-2
Y IN AV-2
23
26
C IN AV-2
SCL
SCL
IC103
DIGITAL COMB FILTER
IC201
VIDEO SW
DL SW
Q118
CVBS IN
AV-1
CVBS IN
AV-3
SVHS-Y 11
OUT
SVHS-C 9
OUT
IC204
YC SW
LUMINANCE
OUT
9
CHROMA
OUT
7
PNR
NTPL
CLOCK 37
IN
BUFFER
Q107
Y LPF
FL103
BUFFER
Q105,106
108,113
BUFFER
Q109
C BPF
FL104
BUFFER
Q125
SVHS-Y
AMP
Q101,102
4
3
5
6
9
8
1
BUFFER
Q212
2
BUFFER
Q213
3
4
2
13
12
SVHS-Y
SVHS-C
SVHS-C
11
10
IC206
BUS SW
CVBS OUT
AV-2
SDA 21
CVBS OUT
SCL 20
4
10
SPSW
A.REG1
1
7
9
MODE
MODE
PAL/NT
DL
MODE S
SPSW
A-REG1
5
Y/C
COMB
INV
Q211
6
14
SW
Q216
SDA
SCL 15
SW
Q215
SCL
SDA
6
1/
(AV2)
2/
G
TO U BOARD
CN4902
2
GND
L OUT
GND
R OUT
GND
R IN
GND
L IN
CN201
B21
A21
B20
A20
B19
A19
B18
A18
B17
A17
B16
A16
B15
A15
B14
A14
B13
A13
B12
A12
B11
A11
B10
A10
B9
A9
B8
A8
B7
A7
B6
A6
B5
A5
B4
A4
B3
A3
B2
A2
B1
A1
BUFFER
Q304
V1
MV2
BUFFER
Q2412
7
BUFFER
Q2414
V_2
INV
Q209
FRONT-V
R1
28
MONO IN (AM)
SDA
FRONT-C
AMP
Q121,124
130
CF120
L102
G1
23
25
ANA IN2
SCL
F
TO U BOARD
CN4901
BUFFER
Q401,405
LINK OUT
34
33
SDA
9
SCL
20
X201
18.432MHz
LIN AV-1
RIN AV-1
XTAL 21
S1
S2
L2
R2
31
30
L1
L2
LIN AV-2
RIN AV-2
RESET
L3
R3
B1
37
36
61
1
IC4003
VIDEO/AUDIO SELECT
IC205
RESET
LIN AV-3
RIN AV-3
SCL
26
SDA
27
AV2 V OUT
15
AV2 L OUT
16
AV2 R OUT
18
V3
L_1
R_1
50
51
L_2
R_2
47
48
LOUT AV-1
ROUT AV-1
LOUT SP
56
BUFFER
Q204
SPL
BUFFER
Q203
SPR
SCL
SDA
FRONT-L
L_1
L_2
LOUT AV-2
ROUT AV-2
ROUT SP
R_1
R_2
FRONT-R
57
LOUT HP 59
ROUT HP 60
R1
R2
CN4501
8
L OUT
7
6
R OUT
5
4
3
2
1
7
6
5
4
3
2
1
LINK IN
ANA IN1
XTAL
L1
R1
8
HPL
HPR
33
V2 IN
V3 OUT
L2 IN
BUFFER
Q4007
V OUT
30
L OUT
32
R OUT
L3 OUT
R2 IN
R3 OUT
IC202
AUDIO PROCESSOR
40
V3 OUT
V IN
1
L IN
2
R IN
4
BUFFER
Q4003
V3
V3 IN
L3 IN
R3 IN
39
L3
41
R3
L3 OUT
R3 OUT
R IN
6
L IN
MODE3
A
(1/2)(TUNER,AUDIO/VODEO PROCESS)
(41PX1/41PX1K)
CN4502
GND
V IN
GND
V OUT
GND
AV LINK
MODE
BUFFER
Q402-404
MC2
AV2 V OUT
AV2 L OUT
AV2 R OUT
(AV1)
GND
GND
CVBS IN
CVBS/Y IN
CVBS OUT
CVBS OUT
GND
GND
GND
GND
BLANKING
NC
RED IN
SVHS-C IN
GND
GND
GND
GND
NC
NC
GREEN IN
NC
NC
AV LINK
GND
GND
MODE
MODE
BLUE IN
NC
AUDIO L IN
AUDIO L IN
GND
GND
GND
GND
AUDIO L OUT
AUDIO L OUT
AUDIO R IN
AUDIO R IN
AUDIO R OUT
AUDIO R OUT
FB1
RGB-S
V IN
V OUT
8
9
B-SS774.<AEP>-B/D-2
– 46 –
RM-892
RM-862
KP-41PX1/41PX1K/41PX1R
K
IC301
YCJ
1
53
55
2
3
57
4
64
FB1
R1
G1
B1
11
12
13
14
RM-892
CN301
CVBS IN
R OUT
SVHS-Y IN
G OUT
22
BUFFER
Q303
24
BUFFER
Q334
26
BUFFER
Q335
B OUT
SVHS-C IN
IK IN
9V
1
2
3
4
5
6
7
RED DRIVE
GRN DRIVE
BLUE DRIVE
9V
GND
CUT OFF
GND
H1
1
2
3
4
5
6
7
8
9
10
11
12
13
12V
SCL
SDA
FS
GND
PJE YM
PJE YS
PJE B
PJE G
PJE R
SP SW
50-60
VBLK
I1
TO CR BOARD
CN703
27
FSC
X303 500KHz
CERA
FB-1 IN
R-1 IN
G-1 IN
B-1 IN
41
X301 4.43MHz
4.43MHz
61
X302 3.58MHz
3.58MHz
62
5
SDA
51
SCL
50
FB2
COR
R2
G2
B2
15
16
17
18
19
VS IN
HS IN
SYNC OUT
AFC PIN
H OUT
E-W
V+ DRIVE
V- DRIVE
VTIM
ABL IN
SDA
SCL
FB-2 IN
HB-2 IN
R-2 IN
G-2 IN
B-2 IN
6
VM
BUFFER
Q306,331
49
SSCP OUT
L2 FIL
Y OUT
Y IN
R-Y IN
B-Y IN
R-Y OUT
B-Y OUT
SECAM REF
IC1
MICRO PROCESSOR
IC3
PROGRAM
H OUT
E-W
V+
VVBLK
ABL
BUFFER
Q330
10
39
VM
7
6
7
8
46
47
48
38
37
33
32
31
30
28
5
3
IC303
SECAM ID
4
1
1
IDENT
20
A0
A17
D0
D7
2-12,23, 18-35,
37
25-30
13-15,
17-21
36,
38-44
A0
A18
56
SDA
P0.1 57
SCL
P0.0
15
BUFFER
Q2,17
IC2
NVM
P1.7
4
7
CVBS
IC302
SECAM SW
CN6
12
D0
D7
TEST
SDA
SCL
5
6
HFBP
B-Y OUT
B -Y IN
R-Y OUT
R -Y IN
11
SSCP
5
HS
CVBS IN
12
B-Y OUT
16
11
R-Y OUT
19
5
SSCP
AMP
Q1,1002
10
12V
14
X1
11.5MHz
6
14
XTAL2
RED
7
64
66
67
68
4
17
59
75
76
77
64
X IN
BLANKING
USART
USART
ENABLE
VS
RESET
GREEN
BLUE
61
BUFFER
Q20,23
R2
62
BUFFER
Q21,24
G2
63
BUFFER
Q22,25
B2
VBLK
TO D BOARD
CN1702
PROT1
IC4
RESET
16
63
SW
Q4
RST
P0.7
V SYNC
OUT
COR
FB2
B2
G2
R2
SPSW
X OUT
X1001
20.48MHz
SCL
SDA
FS
IC1001
TEXT
SDA
SCL
XTAL1
FB-2
P3.7
P3.6
P3.5
P2.3
Q309
SW
P3.1
P1.5
P1.4
P1.3
P1.1
P0.4
P0.5
P0.6
P2.2
P2.1
P2.0
P3.3
P3.2
2
6
7
8
10
60
61
62
65
66
67
79
80
V-BLK
BUFFER
Q305
HFBP
SW
Q307
33V
9V
5V
MUTE
Q308
H OUT
E-W
V+
VABL
A.REG1
VM
MUTE
K1
LED
STBY
IR
PROT1
V SYNC
HFBP
FB2
AGC DEF
RGB-S
MUTE
V-BLK
LINK OUT
DIS
LED
STBY
K1
PROT1
AGC MONI
LINK IN
IR
SPL
SPR
HPL
HPR
RESET
Q1001
FRONT-V
A(2/2)(µ COM,Y/C JUNGLE)
(41PX1/41PX1K)
8
FRONT-C
FRONT-L
FRONT-R
CN1
A11
B10
B14
A4
A6
A5
B3
B5
B8
A3
A20
B20
B19
B16
B13
B12
A9
B6
A7
A13
A15
A22
A21
A24
B25
A25
B23
A23
B22
A16
B9
33V
9V
5V
H SHIFT
H DRIVE
EAST/WEST DRIVE
V+ DRIVE
V- DRIVE
ABL
A.REGI
VM
AUDIO MUTE
FRONT KEY 1
STANDBY LED
P.CONT
SIRCS
PROT1
V SYNC
H FLYBACK
AUDIO L
AUDIO R
AUDIO L
AUDIO R
CVBS IN
S-VHS Y
S-VHS C
AUDIO L
AUDIO R
S3/GND
LUMISPONDER
MODE3
9
B-SS774.<AEP>-B/D-3
– 47 –
OUT SP
OUT SP
OUT HP
OUT HP
AV-2
IN AV-2
IN AV-2
IN AV-2
IN AV-2
J1
TO D BOARD
CN1801
RM-892
RM-862
KP-41PX1/41PX1K/41PX1R
K
AUDIO AMP,V DEFRECTION,
PJ ENGINE
D
BUFFER
Q1704
34
I-RESETN
O-CLKN
O-YM
O-CEB
O-MUTE
O-DATA
O-YS
HALF TONE
Q1709
33
O-I
32
O-B
31
O-G
30
O-R
BUFFER
Q1701
1703
O-FV
47
I-SCLN1
J2
TO AE BOARD
CN1:41PX1R
C
TO H1 BOARD
CN3001
E
TO H2 BOARD
CN3202
K
TO ZG BOARD
CN1431
7
6
19
I-SENS1
20
I-SENS0
13
O-XTAL
1
2
L
TO E BOARD
CN804
CN1701
I-SDA1I
O-SDA10
INV
Q1707,1708
42
I-FS
IC1703
SENSOR AMP
1
I-VP
10
I-VBLK
9
I-HBLK
49
O-HSHIFT
IC1702
NVM
7
6
1
2
X1701
8.0MHz
+5V
6
BCLK
5
BDAT
LOWER
GND
RIGHT
GND
LEFT
GND
UPPER
GND
14
I-EXTAL
AUDIO+
CN1605
2
AUDIO+
AUDIO-
4
AUDIO-
1
2
3
4
5
6
7
8
TO
PHOTO
SENSOR
M
IC1503
LPF
5
IC1502
V-SIZE COMP
7
3
5
4
1
IC1501
V OUT
1
7
6
FLY
GEN
10
11
5
3
CN1501
1
2
3
PROT
Q1503
V-DEF PROT
Q1501
BUFFER
Q1505
L
R
V3
Y3
C3
V
L3
R3
R OUT
L OUT
-15V
IC1502
11 PIN
RY DRIVE
Q1607
IC1602
AUDIO MAIN AMP
+12V
SW
Q1604
L 6
SW
Q1605
+135V
+9V
+5V
SW
Q1610,1611
+12V
RY DRIVE
Q1608
3
4
MUTE
Q1602
+15V
RY1601
SP SW
Q1609
SP PROT
Q1615-1617
R 8
V DEF
NC
V RET
N
TO ZR BOARD
CN1403
9
L
R
TO G BOARD
CN6010
PROT DELAY
Q1502
RY1602
CN1806
10
9
8
7
6
5
4
3
2
1
HD
GND
HP
GND
PIN
PROT1
ABL
-15V
GND
+15V
CN1604
1
2
3
4
L OUT
GND(AU)
R OUT
GND(AU)
O
TO E BOARD
CN506
L
SPEAKER
R
TB1601
1
(CENTER SP IN)
-5V
STBY 7V
+7V
+12V
+135V
IC1603
HP/VAR AMP
V3
BUFFER
Q1803
MIXING
Q1802
L
6
3
Y3
BUFFER
Q1805
MIXING
Q1804
R
7
1
CN1805
10
9
7
6
4
1
CN1601
1
4
5
J1601
STBY 7V
41PX1R
-5V
P.CONT
STBY 7V
7V
12V
135V
HP R
HP L
NC
C3
SW
Q1614
BUFFER
Q1807
MIXING
Q1806
(AUDIO OUT)
3
L3
R
1
2
FY
6
R3
7
L OUT
5
MUTE
Q1801
FV
D
L
IC1805
MIXING
+5V
FC
P
TO E BOARD
CN652
TO H2 BOARD
CN3204
9V
MUTE
Q1612,1613
MUTE
Q1601,1603
R OUT
CN1807
1
3
5
7
L
R
L
R
CN1808
2
4
6
7
CVBS/Y IN
CVBS OUT
C IN
MODE
CN1606
1
VBLK
IN
IN
OUT
OUT
41PX1R
X
TO UE BOARD
L/R OUT
FL
FR
Y
FL
FR
TO A BOARD
CN1:41PX1/41PX1K
17
I-SENS3
18
I-SENS2
FC
J1
A4
A5
B5
B3
B8
B6
A7
A6
A9
B13
A20
A13
A15
A22
A21
B20
A24
B25
A25
A12
B23
A23
B21
B24
A11
B10
B14
B22
A16
B19
B12
B16
B9
A3
CN1803
LED G 1
LED R 2
GND 3
STBY +5V 4
KEY 5
AUTO REGIS 6
GND 7
SIRCS 8
LUMI 9
+5V 10
CN1802
FRONT Y 1
GND 2
FRONT C 3
GND 4
FRONT V 5
GND 6
FRONT L 7
GND 8
FRONT R 9
GND 10
FRONT S 11
CN1804
135V 1
NC 2
9V 3
GND 4
VM 5
GND
RV WAVE
BV WAVE
GND
CLK
MUTE
DATA
CEB
GND
VP
IC1704
SENSOR AMP
SCL
SDA
BUS SW
Q1710,1711
PJERST
NC
44
45
CN1801
H SHIFT
EAST/WEST DRIVE
V- DRIVE
V+ DRIVE
ABL
V SYNC
H FLYBACK
H DRIVE
PROT1
P CONT
VM
AUDIO L OUT SP
AUDIO R OUT SP
AUDIO L OUT HP
AUDIO R OUT HP
AUDIO MUTE
CVBS IN AV-2
S-VHS Y IN AV-2
S-VHS C IN AV-2
CVBS OUT
AUDIO L IN AV-2
AUDIO R IN AV-2
R OUT
L OUT
33V
9V
5V
S3/GND
LUMI/HP MUTE
FRONT KEY 1
SIRCS
STANDBY LED
POW LED
A.REGI
BUFFER
Q1706
4
5
6
Y
FOR CHECK
11
7
51
O-R WAVE
52
O-B WAVE
48
I-SCLN0
46
I/O-SDA0
25
+5V
C
GND
SCL
SDA
FS
5V
SCL N
SDA N
CN1708
1
2
3
4
5
6
7
35
-
I2
TO AE BOARD
CN6:41PX1R
BUFFER
Q1705
SCL
SDA
5
RESET
FY
TO A BOARD
CN6:41PX1/41PX1K
+12V
IC1706
4
IC1701
PJ ENGINE
FV
I1
12V
SCL
SDA
FS
GND
PJE YM
PJE YS
PJE B
PJE G
PJE R
SP SW
50-60
VBLK
CN1702
1
2
3
4
5
6
7
8
9
10
11
12
13
CN1705
1
2
CN1703
10
9
8
7
6
5
4
3
2
1
RM-892
C
Y
TO UE BOARD
+135V
+9V
VM AMP
Q1808,1809
+7V
IC1804
+5V REG
I
O
+5V
+15V
IC1803
+12V REG
I
O
+12V
+12V
IC1802
+9V REG
I
O
+9V
STBY7V
IC1801
+5V REG
I
O
STBY5V
B-SS774.<AEP>-B/D-4
– 48 –
Q
TO E BOARD
CN651
RM-892
RM-862
KP-41PX1/41PX1K/41PX1R
K
RM-892
RM-892
ZR
(RED DY)
IC814
+12V REG
+12V
I
IC812
+5V REG
O
+15V
+5V
I
IC807
-12V REG
-12V
I
CN1404
O
2
HR.IN
VR.IN
VR.RET
HR.RET
4
R-H(+)
NC
NC
R_H(-)
+15V
IC813
-5V REG
O
-5V
-15V
I
O
1
2
3
4
-15V
CN1405
L
TO D BOARD
CN1703
GND
RV WAVE
BV WAVE
GND
CLK
MUTE
DATA
CEB
GND
VP
CN804
10
9
8
7
6
5
4
3
2
1
IC804
B CONV CORR
P.ON MUTE
Q701,702
D701
IC810
CONV OUT
D702
IC801
V.WAVE GEN
1
V.SAW
V.PARA
V.SIN
V.BLK V.4TH
41
BV OUT
40
BH OUT
5,15
V.SAW
6,16
V.PARA
19
V.SIN
20
V.4TH
4
5
6
7
6
9
7
23
22
31
32
33
34
18
16
3
MUTE
Q810
MUTE
IC806
G CONV CORR
HP SHAPE
Q811
1
4
5
6
7
V.SAW
V.PARA
V.SIN
V.4TH
14
11
41
GV OUT
40
GH OUT
23
MPIN1
22
MPIN2
31
CEB
32
DATA
33
MUTE
34
CLKB
13
9
+12V
7
O
TO D BOARD
CN1806
HD
GND
HP
GND
PIN
PROT
ABL
-15V
GND
+15V
CN506
10
9
8
7
6
5
4
3
2
1
1
2
CLKB
MUTE
DATA
CEB
MPIN1
RV OUT
RH OUT
MPIN2
V.SAW
V.PARA
V.SIN
V.4TH
1,17
H.SAW
2,18
H.PARA
3
H.SIN
4
H.4TH
37
+15V
A2 INP
HR
VR
VR
HR
CN806
1
2
3
+12V
NC
GND
+135V
3
MUTE
Q809
MUTE
10
11
12
13
23
41
40
22
+15V
-15V
IC811
SHADING AMP
IC803(2/2)
SHADING CONT
4
5
OUT
OUT
RET
RET
VM,
GREEN DY
2
S
TO G BOARD
CN6011
11
10
9
3
CN808
1
2
3
4
5
CN502
1
2
3
4
CN503
1
2
3
4
1
6
7
+135V
GND
+15V
GND
-15V
T
TO G BOARD
CN6009
B-H(+)
NC
NC
B-H(-)
1
1
2
3
4
5
6
7
CN1433
HG.IN
VG.IN
VG.RET
HG.RET
1
2
3
4
G-H(+)
NC
NC
G-H(-)
R
TO G BOARD
CN6008
CN807
1
2
3
4
5
6
-5V
P.CONT
GND
STBY 7V
7V
GND
12V
GND
NC
135V
CN652
-5V
10
9
8
STBY 7V
7
+7V
6
5
+12V
4
3
2
+135V
1
CN504
1
2
3
4
3
3
T501
HDT
STBY 7V
HV DRIVE
Q501
H OUT
Q502
TO D BOARD
CN1805
Q
TO D BOARD
CN1606
GND
GND
GND
GND
GND
GND
GND
HV.DET
GND
VBLK
T504
FBT
G-H(+)
NC
NC
G_H(-)
9V
4
CN1434
VM OUT 1
VM.RET 2
VM DRIVE
Q1431,1432
BUFF/AMP
Q1433-1438
IC501(2/2)
PIN MOD/HV PROT
5
13
CN501
1
2
3
4
5
6
7
8
9
10
10
9
8
8
14
PIN AMP
Q505
KEY OFF SET
Q807
11
D515
4
9
1
7
D513
T502
PMT
CN651
10
9
8
7
6
5
4
3
2
1
E(H
11
IC805
DF AMP
13
6
14
9
10
8
DF OUT
Q506,507
7
+7V
1
CN805
4
3
2
1
G2 MUTE
Q503,504
B/S
R/S
NC
H(+)
H(-)
NC
NC
200V
NC
GND
DY
U
(BLUE)
TO CB BOARD
CN766
TO CR BOARD
CN704
TO CG BOARD
CN734
GND
NC
DF
G2
FOCUS
BLOCK
G2
FV
V
TO CB BOARD
CN763
CN507
3
STBY 7V
STBY 7V
GND
HV.REG
STDBY 7V
STDBY 7V
DEFRECTION,HV,DY DRIVE)
4
3
2
1
HV
BLOCK
HV R
HV G
HV B
W
TO PICTURE TUBE
(R/G/B)
B-SS774.<AEP>-B/D-5
– 49 –
CN1464
1
2
3
4
HB.IN
VB.IN
VB.RET
HB.RET
CN1461
1
2
3
V.DEF
V.MID
V.RET
1
2
3
4
HV
FV
D514
2
HB.RET
VB.RET
VB.IN
HB.IN
DY
+7V
IC501(1/2)
HV PROT
P
1
6
7
3
BUFFER
Q802,805,808
R-H(+)
NC
NC
R-H(-)
CN1462
4
3
2
1
(GREEN)
135V
STBY 7V
GND
P.CONT
PROT
GND
+7V
N
CN1432
V.IN
NC
V.OUT
NC
VM.OUT
NC
VM.RET
CN1434
6
V.RET
NC
V.DEF
TO D BOARD
CN1501
ZG
CN801
1
2
3
4
18
31
CEB
32
DATA
33
MUTE
34
CLKB
-15V
1
2
3
4
5
6
7
1
15
IC808
R CONV CORR
5,15
6,16
19
20
OUT
OUT
RET
RET
CN1403
3
2
1
(RED)
6
16
IC803(1/2)
SHADING CONT
HG
VG
VG
HG
V.OUT
NC
V.IN
NC
VM.IN
NC
VM.RET
IC809
CONV OUT
10
CLKB
11
MUTE
12
DATA
13
CEB
1,17
H.SAW
2,18
H.PARA
3
H.SIN
4
H.4TH
HP SHAPE
Q812
CN802
1
2
3
4
DY
CN1401
13
15
A2 INP
H.SAW
H.BLK H.PARA
H.SIN
H.4TH
OUT
OUT
RET
RET
11
MPIN1
MPIN2
CEB
DATA
MUTE
CLKB
37
5,15
6,16
19
20
HB
VB
VB
HB
14
1,17
H.SAW
2,18
H.PARA
3
H.SIN
4
H.4TH
IC802
H.WAVE GEN
CN803
1
2
3
4
1
2
3
4
CN1431
1
2
3
4
135V
NC
9V
GND
5 VM
K
TO D BOARD
CN1804
RM-862
KP-41PX1/41PX1K/41PX1R
K
CR(RED AMP)
CG(GREEN AMP)
RED AMP
Q704,703
RM-892
CB(BLUE AMP)
R
V901
PICTURE TUBE
GREEN AMP
Q733,732
V902
PICTURE TUBE
G
BLUE AMP
Q762,763
B
V903
PICTURE TUBE
SW
Q701
H1
TO A BOARD
CN301:41PX1/41PX1K
H2
FV
HV R
CN706
R
G
B
9V
GND
IK
GND
1
2
3
4
5
6
7
R/S
NC
H(+)
H(-)
NC
NC
200V
NC
GND
G1
H(+)
H(-)
9V
200V
TO AE BOARD
CN301:41PX1R
1
2
3
4
5
6
7
8
9
1
2
3
4
5
6
7
8
9
8
7
6
5
4
3
2
1
8
7
6
5
4
3
2
1
CN702
BUFFER
Q705
MIX
Q706
IKG
IKB
GND
9V
GND
B
G
GND
9V
CN704
G2
1
CN736
CN737
R/S
NC
H(+)
H(-)
NC
NC
200V
NC
GND
R/S
NC
H(+)
H(-)
NC
NC
200V
NC
GND
H(+)
H(-)
200V
SW
Q731
CN733
CN732
IKG
IKB
GND
9V
GND
B
G
GND
IKB
GND
9V
GND
B
9V
HV G
FV
1
2
3
4
5
6
7
8
9
5
4
3
2
1
5
4
3
2
1
1
R/S
NC
H(+)
H(-)
NC
NC
200V
NC
GND
200V
CN762
SW
Q761
IKB
GND
9V
GND
B
H(+)
H(-)
200V
G1
PEAK LIMIT
Q765
CN734
G2
GAMMA AMP
Q764
CN765
1
2
3
4
5
6
7
8
9
CN763
G2
G2
1
G2
B/S
R/S
NC
H(+)
H(-)
NC
NC
200V
NC
GND
FV
CN703
G2
1
2
3
4
5
6
7
8
9
10
CN766
TO FOUCS BLOCK
V
W
TO HV BLOCK
U
TO E BOARD
CN501
IC6002
DC CONTROL
18
D6013,6014
RECT
9
SW
Q6001
7
CN6010
16
VD
VG(H)
1
VSENSE
8
15
17
12
16
VS
VG(L)
PS6001
PS6002
2
F/B
AC(W)
AC(L)
11
1
10
3
12
1
2
F6001
1
T6001
LFT
2
CN6006
A
AC(N)IN
AC(L)IN
D6016
RECT
OCP
CN6005
PS6003
5
4
3
2
1
-15V
GND
+15V
GND
+135V
1
2
3
4
5
6
ST7V
GND
P.CONT
PROT
GND
+7V
T
TO E BOARD
CN808
RY6001
VCC SW
IC6003
2
VCC OUT
IC6004
COLLECT
Q6004
2
T6002
V OUT 1
SEN
IC6005
VCC CONTROLLER
+B COCP
Q6007
1
D6006
RECT
CN6007
AC(L)OUT 1
AC(N)OUT 5
4
D6010
RECT
7
3
5
D6012
RECT
LATCH
Q6005,6006
1 8
S
S
5
C
D6001,6007
RECT
CN6008
4
D6009
D6008
BIAS FEED BACK
D
TO H1 BOARD
CN3004
S
TO E BOARD
CN806
3
4
1
TO H1 BOARD
CN3003
B
M
TO D BOARD
CN1605
D6018,6019
RECT
T6003
PIT
4
GND
+12V
CN6009
15
9
SW,SOFT STAT
Q6008,6009
AUDIOAU GND
AUDIO+
POW MONI
CN6011
3
1
13
D6003
RECT
AC IN
220-240V
50Hz
D6021
RECT
18
14
SW
Q6002
4
3
2
1
D6017
RECT
IC6001
PWM SW
VCC SW
Q6003
VCC
G(POWER SUPPLY)
B-SS774<AEP>-B/D-6
– 50 –
R
TO E BOARD
CN807
HV B
RM-892
RM-862
KP-41PX1/41PX1K/41PX1R
K
41PX1/41PX1K
CN4901
S3006
IC3002
IR RECEIVER
!
CN3003
AC (L) IN
A
TO G BOARD
CN6006
B
AC (N) IN
OUT
2
D3008
1
1
8
CN3001
SIRCS
4
STBY 5V
Q3002
LED SW
CN3004
AC (N) OUT 5
7
6
5
4
3
2
1
4
STBY 5V
J4901
(AV3)
2
LED R
3
(SMART LINK)
RED
F
TO A BOARD
CN4502
CN4902
AC (L) OUT 1
8
7
6
5
4
3
2
1
TO G BOARD
CN6007
C
+
PROGR
S3002 S3001
(PROG+)(PROG-)
TO D BOARD
CN1803
S3005
(TV/VIDEO)
H1
USER CONTROL,
MAIN SWITCH
GND
V IN
GND
V OUT
GND
AV LINK
MODE
5
KEY
6
AUTO REGIS
10
+5V
3
1
AUTO REGIS
KEY
S3003 S3004
(VOL+) (VOL-)
+
GND
L OUT
GND
R OUT
GND
R IN
GND
L IN
G
TO A BOARD
CN4501
U(AV IN/OUT)
(41PX1/41PX1K)
CN3002
-
41PX1R
CN2701
TO D BOARD
CN1601
H2
CN3204
D
HP L
4
HP R
1
1
2
3
4
5
6
7
AV INPUT,
HP OUT,USER CONTROL
1
3
J3202
(HEAD PHONE)
CN2703
(AV3)
CN3201
KEY
AUTO REGIS
CN2702
1
2
3
4
5
6
7
8
S3205
AUTO
CONVER
a
CN3213
(VIDEO IN4)
UE
(AV IN/OUT)
(41PX1R)
CN3202
3
4
V
L
(MONO)
L
R
R
1
FRONT Y
3
FRONT C
5
FRONT V
7
FRONT L
9
FRONT R
11
FRONT S
Y
TO D BOARD
CN1808
3
(SMART LINK)
i
S3206
AUTO
TUNE
GND
CVBS/V IN
GND
CVBS OUT
GND
C IN
MODE
E
TO D BOARD
CN1802
B-SS774.<AEP>-B/D-1
– 51 –
L IN
GND
R IN
GND
L OUT
GND
R OUT
GND
X
TO D BOARD
CN1807
RM-892
RM-892
RM-862
KP-41PX1/41PX1K/41PX1R
K
RM-892
RM-892
7-2. FRAME SCHEMATIC DIAGRAM (1) (41PX1/41PX1K)
PHOTO
SENSOR
1
2
3
4
5
6
7
MODE
AV LINK
GND
V OUT
GND
V IN
GND
CN4502
7P
RED
:S-MICRO
-
SP BOX
(RED AMP)
CN702
8P
WHT
:S-MICRO
CN1
50P
:B-TO-B
FGND
G2
HV
GND
8
9 K
12 11 10 NC
NC G2
CN734
1P
WHT
:MINI
G2
GND
GND
GND
GND
A.REGI
V+ DRIVE
H SHIFT
VERTICAL GND
EAST/WEST DRIVE
V- DRIVE
H DRIVE
V SYNC
H FLYBACK
VERTICAL GND
EHT
ABL
PROT1
MODE3
GND
9V
33V
STANDBY 5V
CVBS OUT
SIRCS
AUDIO L OUT SP
P.CONT
GND
5V
AUDIO R OUT SP
GND
LUMISPONDER
STANDBY LED
GND
GND
GND
GND
GND
FRONT KEY 1
VM
AUDIO MUTE
AUDIO R OUT HP
R OUT
AUDIO L OUT HP
S3/GND
AUDIO R IN AV-2
AUDIO L IN AV-2
CVBS IN AV-2
L OUT
S-VHS C IN AV-2
S-VHS Y IN AV-2
R/S
NC
H(+)
H(-)
NC
NC
200V
NC
GND
CN737
9P
WHT
:S-MICRO
B
GND
9V
GND
IKB
1
2
3
4
5
L OUT
GND(AU)
R OUT
GND(AU)
LOWER
GND
RIGHT
GND
LEFT
GND
UPPER
GND
1
2
3
4
5
6
7
8
CN732
5P
WHT
:S-MICRO
CN1701
8P
RED
:S-MICRO
1
2
3
4
5
6
7
GND
SCL
SDA
FS
5V
SCL N
SDA N
PJERST
GND
(FOR CHECK)
1
2
AUDIO AMP
V DEFRECTION
PJ ENGINE
G2(B)
+15V
GND
-15V
ABL
PROT1
PIN
GND
HP
GND
HD
135V
NC
GND
12V
GND
7V
STBY 7V
GND
P.CONT
-5V
VP
GND
CEB
DATA
MUTE
CLK
GND
BV WAVE
RV WAVE
GND
1
2
3
4
5
6
7
8
9
10
VP
GND
CEB
DATA
MUTE
CLK
GND
BV WAVE
RV WAVE
GND
CN501
10P
WHT
:S-MICRO
T504
FBT
E
CN807
6P
WHT
:S-MICRO
CN504
4P
:VH
CN502
4P
:VH
CN803
4P
BLK
:S-MICRO
CN810
3P
:MINI
R-H(+)
NC
NC
R-H(-)
B-H(+)
NC
NC
B-H(-)
OUT
OUT
RET
RET
HB
VB
VB
HB
GND
+B OUT
+B IN
R1
R1
1
2
3
4
1
2
3
4
1
2
3
4
1
2
3
1
2
HV BLOCK
CN805
4P
:MINI
CN801
4P
RED
:S-MICRO
OUT
OUT
RET
RET
E(HV)
CN503
4P
:VH
HR
VR
VR
HR
HV(R)
FV(B)
G2
DF
NC
GND
CN802
4P
WHT
:S-MICRO
G-H(+)
NC
NC
G-H(-)
DF
1
2
3
4
(H DEFRECTION,HV,DY DRIVE)
CN507
4P
WHT
:S-MICRO
1
2
3
4
E
STDBY 7V
STDBY 7V
HV.REG
GND
OUT
OUT
RET
RET
HV(B)
1
2
3
4
HG
VG
VG
HG
HV REG
1
2
3
4
5
CN1802
11P
RED
:S-MICRO
FRONT Y(NC) 1
2
GND
FRONT C 3
4
GND
FRONT V 5
6
GND
FRONT L 7
8
GND
FRONT R 9
10
GND
FRONT S(NC)11
NC
R.LED
GND
STBY +5V
KEY1
KEY2
GND
SIRCS
NC
+5V
1
2
3
KEY
GND
AUTO REGIS
CN3201
3P
H2
1
KEY
2
GND
AUTO REGIS 3
1
2
3
4
5
HP R
GND
CN3204
5P
GND
:PIN-Z
HP L
MUTE(NC)
1
2
3
4
5
6
7
8
9
10
11
FRONT Y(NC)
GND
FRONT C
GND
FRONT V
CN3202
GND
11P
:S-MICRO
FRONT L
GND
FRONT R
GND
FRONT S(NC)
H1
USER CONTROL,
MAIN SWITCH
CN3002
3P
CN3004
5P
:VH
(AV4 INPUT)
CN3213
CN3003
4P
:VH
R
L
(MONO)
L
(VIDEO)
CN6007
5P
:VH
CN6006
4P
V
(S-VIDEO)
1
2
3
4
S
1
2
3
4
5
6
7
8
9
10
1
2
3
4
5
6
7
8
9
10
1
2
3
4
5
6
7
8
9
10
CN804
10P
:B-TO-B
HV
HV(G)
FV(R) FV(G)
CN652
10P
:B-TO-B
1
2
3
4
FASTON
FASTON
FV
CRT
CHASSIS
CN506
10P
:B-TO-B
CN651
10P
:B-TO-B
FV
G2
1
2
3
4
5
6
7
8
9
10
1
2
3
4
5
6
7
8
9
10
1
GND(ANT)
CN6003
1P
:FASTON
1
2
3
4
POW MONI
AUDIO+
AU GND
AUDIO-
CN6010
4P
:MINI
CN806
3P
CN508
1P
:FASTON
DET
FOCUS
PACK
HP R
GND
GND
HP L
MUTE(NC)
CN1601
5P
BLK
:S-MICRO
CN1605
4P
:MINI
135V
NC
GND
12V
GND
7V
STBY 7V
GND
P.CONT
-5V
B/S
R/S
NC
H(+)
H(-)
NC
NC
200V
NC
GND
CN1703
10P
:BTOB-S
1
2
3
4
G2(R) G2(G)
1
2
3
4
5
6
7
8
9
10
1
2
3
4
5
6
7
8
9
10
CN766
10P
WHT
:S-MICRO
CN1805
10P
:BTOB-S
1
2
3
4
5
6
7
8
9
10
1
CN1804
5P
WHT
:S-MICRO
CN1806
10P
WHT
:BTOB-S
CN1606
10P
:BTOB-S
+15V
GND
-15V
ABL
PROT
PIN
GND
HP
GND
HD
(BLUE AMP)
CN1502
1P
:FASTON
GND
135V
NC
9V
GND
VM
V-BLK
GND
HV DET
GND
GND
GND
GND
GND
GND
GND
1
2
3
4
5
1
2
3
4
5
6
7
8
9
10
R/S
NC
H(+)
H(-)
NC
NC
200V
NC
GND
CN763
1P
WHT
:MINI
1
2
3
4
5
1
2
3
4
5
6
7
8
9
10
DY(B)
G2
CN3001
10P
R
1
2
3
4
5
6
7
8
9
10
1
2
AV INPUT,
HP OUT,
USER CONTROL
L
CN1501
3P
RED
:S-MICRO
1
DY1461
HV
CB
B
GND
9V
GND
IKB
V DEF
NC
V RET
GND
SUB DY
07MAC
8
9 K
12 11 10 NC
GND
NC G2
CN762
5P
WHT
:S-MICRO
2/
ANALOG LINE
D
TB1601
(CENTER SP IN)
(AUDIO OUT)
1
2
3
G.LED
R.LED
GND
STBY +5V
KEY1
KEY2
GND
SIRCS
LUMI
+5V
CN1803
10P
WHT
:S-MICRO
CN1705
2P
RED
:S-MICRO
CN1708
:S-MICRO
7P
WHT
V-BLK
GND
HV DET
GND
GND
GND
GND
GND
GND
GND
H.RET
V.IN
V.RET
H.IN
V.RET
V(MID)
1
DY(V)
H-
V.DEF
H(MID)
H+
DY(H)
VM IN
VM.RET
CN764
FGND
(AV2)
CN1702
13P
WHT
:S-MICRO
J1601
CN765
9P
WHT
:S-MICRO
B/S
R/S
NC
H(+)
H(-)
NC
NC
200V
NC
GND
B
G1
4 5 G1
H(+)
6
7 H(-)
GND 1
CN201
DUAL SCART
J3202
CN1801
50P
:B-TO-B
CN1604
4P
WHT
:S-MICRO
R
CN761
FASTON
CN101
1P
:FASTON
1/
(HEAD PHONE)
1
2
3
4
1
2
3
4
5
6
7
8
9
1
1
2
3
4
5
6
7
8
9
1
2
3
4
5
6
7
8
9
HB.IN
VB.IN
VB.RET
HB.RET
1
2
3
4
CG
CN736
9P
WHT
:S-MICRO
R/S
NC
H(+)
H(-)
NC
NC
200V
NC
GND
(GREEN AMP)
CN1462
4P
BLK
:S-MICRO
HB.IN
VB.IN
VB.RET
HB.RET
V.DEF
V.MID
V.RET
1
2
3
CN1464
4P
BLK
:S-MICRO
1
2
3
4
HG.IN
VG.IN
VG.RET
HG.RET
VM OUT
VM.RET
1
2
3
4
1
2
HV
CN1461
3P
WHT
:S-MICRO
FV
1
(VM,GREEN/BLUE DY)
CN1463 CN1433
2P
4P
RED
WHT
:S-MICRO :S-MICRO
G1
4 5 G1
H(+)
6
7 H(-)
CN735
ZG
07MXC
A1
B1
A2
B2
A3
B3
A4
B4
A5
B5
A6
B6
A7
B7
A8
B8
A9
B9
A10
B10
A11
B11
A12
B12
A13
B13
A14
B14
A15
B15
A16
B16
A17
B17
A18
B18
A19
B19
A20
B20
A21
B21
A22
B22
A23
B23
A24
B24
A25
B25
1
2
3
4
5
6
7
8
CN1431
5P
WHT
:S-MICRO
CN733
8P
WHT
:S-MICRO
GND
G
B
GND
9V
GND
IKB
IKG
CN1434
4P
:VH
CN1432
7P
WHT
:S-MICRO
1
2
3
4
5
6
7
8
5
4
3
2
1
VM
GND
9V
NC
135V
1
2
3
4
G-H(+)
NC
NC
G-H(-)
1
2
3
4
5
6
7
V.IN
NC
V.OUT
NC
VM.OUT
NC
VM.RET
G
CN731
FASTON
CN6
13P
WHT
:S-MICRO
(AV1)
12V
SCL
SDA
FS
GND
PJE YM
PJE YS
PJE B
PJE G
PJE R
SPSW
50-60
VBLK
GND
G
B
GND
9V
GND
IKB
IKG
CN704
1P
WHT
:MINI
G2
1
1
2
3
4
5
6
7
HV
CR
9 K
12 11 10 NC
NC G2
(RED DY)
V.OUT
NC
V.IN
NC
VM.IN
NC
VM.RET
07MXC
GND
1
2
3
4
5
6
7
8
9
NC
BLUE IN
MODE
MODE
GND
GND
AV LINK
NC
NC
GREEN IN
NC
NC
GND
GND
GND
GND
SVHS-C IN
RED IN
NC
BLANKING
GND
GND
GND
GND
CVBS OUT
CVBS OUT
CVBS/Y IN
CVBS IN
GND
GND
1
2
3
4
5
6
7
8
9
10
11
12
13
ZR
CN1401
7P
WHT
:S-MICRO
R/S
NC
H(+)
H(-)
NC
NC
200V
NC
GND
1
2
3
4
5
6
7
8
9
10
11
12
13
8
12V
SCL
SDA
FS
GND
PJE YM
PJE YS
PJE B
PJE G
PJE R
SP SW
50-60
VBLK
1
G1
4 5 G1
H(+)
6
7 H(-)
CN301
7P
WHT
POWER MONI
AUDIO+
AU GND
AUDIO-
FGND
CN706
9P
WHT
:S-MICRO
RED DRIVE
GRN DRIVE
BLUE DRIVE
9V
GND
CUT OFF
GND
1
2
3
4
CN1403
3P
RED
:S-MICRO
CN1405
4P
:VH
1
2
3
4
5
6
7
A1
B1
A2
B2
A3
B3
A4
B4
A5
B5
A6
B6
A7
B7
A8
B8
A9
B9
A10
B10
A11
B11
A12
B12
A13
B13
A14
B14
A15
B15
A16
B16
A17
B17
A18
B18
A19
B19
A20
B20
A21
B21
A22
B22
A23
B23
A24
B24
A25
B25
CN705
CN1404
4P
RED
:S-MICRO
CN703
7P
RED
:S-MICRO
R
G
B
9V
GND
IK
GND
HR.IN
VR.IN
VR.RET
HR.RET
R
CN701
FASTON
GND
GND
GND
GND
A.REGI
V+ DRIVE
H SHIFT
VERTICAL GND
EAST/WEST DRIVE
V- DRIVE
H DRIVE
V SYNC
H FLYBACK
VERTICAL GND
EHT
ABL
PROT1
POW LED
GND
9V
33V
STANDBY 5V
CVBS OUT
SIRCS
AUDIO L OUT SP
P.CONT
GND
5V
AUDIO R OUT SP
GND
LUMI/HP MUTE
STANDBY LED
GND
GND
GND
GND
GND
FRONT KEY 1
VM
AUDIO MUTE
AUDIO R OUT HP
R OUT
AUDIO L OUT HP
S3/GND
AUDIO R IN AV-2
AUDIO L IN AV-2
CVBS IN AV-2
L OUT
S-VHS C IN AV-2
S-VHS Y IN AV-2
1
2
3
V.DEF
NC
V.RET
(µ COM,Y/C JUNGLE,TUNER,AUDIO/VIDEO PROCESS)
1
2
3
4
5
6
7
1
2
3
4
R-H(+)
NC
NC
R-H(-)
1
2
3
4
A
AUDIO L IN
AUDIO L IN
AC(L) IN
NC
NC
AC(N) IN
1
2
3
4
5
6
7
1
2
3
4
MODE
AV LINK
GND
V OUT
GND
V IN
GND
4
3
2
1
CN4901
7P
RED
:S-MICRO
J4901
21P
GND
GND
GND
GND
AC(L) IN
NC
NC
AC(N) IN
(AV IN/OUT)
OUT
OUT
IN
IN
OUT
OUT
CN808
5P
:MINI
CN505
2P
:LARGE
+12V
NC
GND
1
2
3
1
2
3
+12V
NC
GND
STBY 7V
GND
P.CONT
PROT
GND
+7V
1
2
3
4
5
6
1
2
3
4
5
6
ST7V
GND
P.CONT
PROT
GND
+7V
+135V
GND
+15V
GND
-15V
1
2
3
4
5
1
2
3
4
5
+135V
GND
+15V
GND
-15V
G
CN6011
3P
:MINI
(POWER SUPPLY)
CN6009
5P
:MINI
CN6008
6P
WHT
:S-MICRO
CN6002
1P
:FASTON
CN6001 CN6005
1P
2P
:FASTON
AC(W)
AC(L)
1
2
R
R
R
R
L
L
GND(Z)
LOWER
GND
U
CN4501
8P
WHT
:S-MICRO
AUDIO
AUDIO
AUDIO
AUDIO
AUDIO
AUDIO
1
2
1
2
+
FASTON
L
RIGHT
GND
A1
B1
A2
B2
A3
B3
A4
B4
A5
B5
A6
B6
A7
B7
A8
B8
A9
B9
A10
B10
A11
B11
A12
B12
A13
B13
A14
B14
A15
B15
A16
B16
A17
B17
A18
B18
A19
B19
A20
B20
A21
B21
1
SP BOX
L IN
GND
R IN
GND
R OUT
GND
L OUT
GND
AC (L) OUT
NC
NC
NC
AC (N) OUT
-
3
(SMART LINK)
1
2
3
4
5
6
7
8
1
2
3
4
5
(AV3)
1
2
3
4
5
6
7
8
1
2
3
4
5
1
2
+
R
L IN
GND
R IN
GND
R OUT
GND
L OUT
GND
AC (L) OUT
NC
NC
NC
AC (N) OUT
LEFT
GND
CN4902
8P
WHT
:S-MICRO
GND(Z)
1
2
1
UPPER
GND
R1
R
G SHIELD CHASSIS
B-SS774.<AEP>-KESSENZU-05
– 52 –
RM-862
KP-41PX1/41PX1K/41PX1R
K
FRAME SCHEMATIC DIAGRAM (2) (41PX1R)
PHOTO
SENSOR
NC
BLUE IN
MODE
MODE
GND
GND
AV LINK
NC
NC
GREEN IN
NC
NC
GND
GND
GND
GND
SVHS-C IN
RED IN
NC
BLANKING
GND
GND
GND
GND
CVBS OUT
CVBS OUT
CVBS/Y IN
CVBS IN
GND
GND
GND
GND
GND
GND
AUDIO L IN
AUDIO L IN
OUT
OUT
IN
IN
OUT
OUT
AE
(µ COM,Y/C JUNGLE,TUNER,AUDIO/VIDEO PROCESS)
SP BOX
CN101
1P
:FASTON
CN1701
8P
RED
:S-MICRO
GND
SCL
SDA
FS
5V
SCL N
SDA N
CN1803
10P
WHT
:S-MICRO
CN1705
2P
RED
:S-MICRO
CN1708
:S-MICRO
7P
WHT
PJERST
GND
(FOR CHECK)
1
2
G2(B)
+15V
GND
-15V
ABL
PROT1
PIN
GND
HP
GND
HD
135V
NC
GND
12V
GND
7V
STBY 7V
GND
P.CONT
-5V
T504
FBT
VP
GND
CEB
DATA
MUTE
CLK
GND
BV WAVE
RV WAVE
GND
1
2
3
4
5
6
7
8
9
10
E
CN807
6P
WHT
:S-MICRO
CN810
3P
:MINI
B-H(+)
NC
NC
B-H(-)
OUT
OUT
RET
RET
GND
+B OUT
+B IN
R1
R1
HB
VB
VB
HB
1
2
3
4
1
2
3
1
2
HV BLOCK
CN805
4P
:MINI
CN803
4P
BLK
:S-MICRO
1
2
3
4
E(HV)
CN502
4P
:VH
R-H(+)
NC
NC
R-H(-)
HV(R)
FV(B)
CN504
4P
:VH
1
2
3
4
DF
CN503
4P
:VH
CN801
4P
RED
:S-MICRO
OUT
OUT
RET
RET
G2
DF
NC
GND
CN802
4P
WHT
:S-MICRO
HR
VR
VR
HR
1
2
3
4
E
(H DEFRECTION,HV,DY DRIVE)
CN507
4P
WHT
:S-MICRO
G-H(+)
NC
NC
G-H(-)
STDBY 7V
STDBY 7V
HV.REG
GND
1
2
3
4
1
2
3
4
OUT
OUT
RET
RET
HV REG
HV(B)
CN1802
11P
RED
:S-MICRO
FRONT Y(NC) 1
2
GND
FRONT C 3
4
GND
FRONT V 5
6
GND
FRONT L 7
8
GND
FRONT R 9
10
GND
FRONT S(NC)11
1
2
3
4
5
HP R
GND
CN3204
5P
GND
:PIN-Z
HP L
MUTE(NC)
1
2
3
4
5
6
7
8
9
10
11
FRONT Y(NC)
GND
FRONT C
GND
FRONT V
CN3202
11P
GND
:S-MICRO
FRONT L
GND
FRONT R
GND
FRONT S(NC)
USER CONTROL,
MAIN SWITCH
CN3004
5P
:VH
(AV4 INPUT)
CN3213
CN3003
4P
:VH
R
L
(MONO)
L
(VIDEO)
CN6007
5P
:VH
CN6006
4P
V
(S-VIDEO)
1
2
3
4
S
1
2
3
4
5
6
7
8
9
10
1
2
3
4
5
6
7
8
9
10
1
2
3
4
5
6
7
8
9
10
1
2
3
4
5
6
7
8
9
10
1
2
3
4
5
6
7
8
9
10
V-BLK
GND
HV DET
GND
GND
GND
GND
GND
GND
GND
CN501
10P
WHT
:S-MICRO
HV
HV(G)
FV(R) FV(G)
CN804
10P
:B-TO-B
HG
VG
VG
HG
CRT
CHASSIS
CN652
10P
:B-TO-B
1
2
3
4
FASTON
FASTON
FV
CN506
10P
:B-TO-B
CN651
10P
:B-TO-B
FV
G2
1
2
3
4
5
H1
1
GND(ANT)
CN6003
1P
:FASTON
1
2
3
4
POW MONI
AUDIO+
AU GND
AUDIO-
CN6010
4P
:MINI
CN806
3P
CN508
1P
:FASTON
DET
FOCUS
PACK
CN1605
4P
:MINI
VP
GND
CEB
DATA
MUTE
CLK
GND
BV WAVE
RV WAVE
GND
B/S
R/S
NC
H(+)
H(-)
NC
NC
200V
NC
GND
CN1703
10P
:BTOB-S
135V
NC
GND
12V
GND
7V
STBY 7V
GND
P.CONT
-5V
1
2
3
4
5
6
7
8
9
10
CN1805
10P
:BTOB-S
1
2
3
4
G2(R) G2(G)
GND
1
CN766
10P
WHT
:S-MICRO
CN1806
10P
WHT
:BTOB-S
CN1606
10P
:BTOB-S
1
2
3
4
5
6
7
8
9
10
R/S
NC
H(+)
H(-)
NC
NC
200V
NC
GND
(BLUE AMP)
CN1804
5P
WHT
:S-MICRO
CN1502
1P
:FASTON
KEY
GND
AUTO REGIS
CN3002
3P
R
+15V
GND
-15V
ABL
PROT
PIN
GND
HP
GND
HD
DY(B)
CN763
1P
WHT
:MINI
135V
NC
9V
GND
VM
1
2
3
4
5
6
7
8
9
10
HV
G2
1
2
3
4
5
HP R
GND
GND
HP L
MUTE(NC)
CN1601
5P
BLK
:S-MICRO
L
CN1501
3P
RED
:S-MICRO
1
2
3
4
5
6
7
8
9
10
1
1
2
3
4
5
V DEF
NC
V RET
1
DY1461
CB
B
GND
9V
GND
IKB
1
2
3
GND
SUB DY
07MAC
8
9 K
12 11 10 NC
GND
NC G2
CN762
5P
WHT
:S-MICRO
(AUDIO OUT)
V-BLK
GND
HV DET
GND
GND
GND
GND
GND
GND
GND
H.RET
V.IN
V.RET
H.IN
V.RET
V(MID)
1
DY(V)
H-
V.DEF
H(MID)
H+
DY(H)
VM IN
VM.RET
FGND
G1
4 5 G1
H(+)
6
7 H(-)
B/S
R/S
NC
H(+)
H(-)
NC
NC
200V
NC
GND
B
CN764
CN765
9P
WHT
:S-MICRO
H2
1
KEY
2
GND
AUTO REGIS 3
AV INPUT,
HP OUT,
USER CONTROL
AUDIO AMP
V DEFRECTION
PJ ENGINE
J1601
1
2
3
CN3201
3P
D
TB1601
(CENTER SP IN)
R
CN761
FASTON
1
2
3
4
5
6
7
8
9
10
AC(L) IN
NC
NC
AC(N) IN
1
2
3
4
5
6
7
8
9
CN732
5P
WHT
:S-MICRO
1
2
3
4
5
6
7
G.LED
R.LED
GND
STBY +5V
KEY1
KEY2
GND
SIRCS
LUMI
+5V
1
2
3
4
G2
1
LOWER
GND
RIGHT
GND
LEFT
GND
UPPER
GND
1
2
3
4
5
6
7
8
(HEAD PHONE)
50P
:B-TO-B
NC
R.LED
GND
STBY +5V
KEY1
KEY2
GND
SIRCS
NC
+5V
4
3
2
1
CN734
1P
WHT
:MINI
1
2
3
4
5
J3202
AC(L) IN
NC
NC
AC(N) IN
B
GND
9V
GND
IKB
CN737
9P
WHT
:S-MICRO
GND
CVBS/Y IN CN1808
7P
RED
GND
:S-MICRO
CVBS OUT
GND
C IN
MODE
1
2
3
4
5
6
7
8
9
10
CN808
5P
:MINI
CN505
2P
:LARGE
+12V
NC
GND
1
2
3
1
2
3
+12V
NC
GND
STBY 7V
GND
P.CONT
PROT
GND
+7V
1
2
3
4
5
6
1
2
3
4
5
6
ST7V
GND
P.CONT
PROT
GND
+7V
+135V
GND
+15V
GND
-15V
1
2
3
4
5
1
2
3
4
5
+135V
GND
+15V
GND
-15V
G
CN6011
3P
:MINI
(POWER SUPPLY)
CN6009
5P
:MINI
CN6008
6P
WHT
:S-MICRO
CN6002
1P
:FASTON
CN6001 CN6005
1P
2P
:FASTON
AC(W)
AC(L)
(GREEN AMP)
1
2
3
4
5
6
7
1
2
3
4
CN3001
10P
POWER MONI
AUDIO+
AU GND
AUDIO-
CN736
9P
WHT
:S-MICRO
1
2
3
4
5
6
7
8
9
L OUT
GND(AU)
R OUT
GND(AU)
CN1604
4P
WHT
:S-MICRO
1
2
3
4
5
6
7
8
9
HB.IN
VB.IN
VB.RET
HB.RET
1
2
3
4
CG
R/S
NC
H(+)
H(-)
NC
NC
200V
NC
GND
CN1807
8P
WHT
:S-MICRO
1
2
3
4
G2
HV
GND
8
9 K
12 11 10 NC
NC G2
CN1462
4P
BLK
:S-MICRO
HB.IN
VB.IN
VB.RET
HB.RET
V.DEF
V.MID
V.RET
1
2
3
CN1464
4P
BLK
:S-MICRO
1
2
3
4
HG.IN
VG.IN
VG.RET
HG.RET
VM OUT
VM.RET
1
2
3
4
1
2
HV
CN1461
3P
WHT
:S-MICRO
FV
1
(VM,GREEN/BLUE DY)
CN1463 CN1433
2P
4P
RED
WHT
:S-MICRO :S-MICRO
GND
G
B
GND
9V
GND
IKB
IKG
VM
GND
9V
NC
135V
FGND
ZG
07MXC
G1
4 5 G1
H(+)
6
7 H(-)
CN735
CN1431
5P
WHT
:S-MICRO
CN1434
4P
:VH
CN733
8P
WHT
:S-MICRO
R/S
NC
H(+)
H(-)
NC
NC
200V
NC
GND
CN1432
7P
WHT
:S-MICRO
1
2
3
4
5
6
7
8
5
4
3
2
1
1
2
3
4
G-H(+)
NC
NC
G-H(-)
1
2
3
4
5
6
7
V.IN
NC
V.OUT
NC
VM.OUT
NC
VM.RET
G
CN731
FASTON
L IN
GND
R IN
GND
L OUT
GND
R OUT
GND
GND(Z)
1
2
3
4
5
6
7
8
12V
SCL
SDA
FS
GND
PJE YM
PJE YS
PJE B
PJE G
PJE R
SPSW
50-60
VBLK
CN1702
13P
WHT
:S-MICRO
CN1801
1
2
3
4
5
6
7
8
1
2
CN702
8P
WHT
:S-MICRO
1
GND
G
B
GND
9V
GND
IKB
IKG
CN704
1P
WHT
:MINI
G2
1
26
25
AC (L) OUT
NC
NC
NC
AC (N) OUT
(RED DY)
50
1
1
2
3
4
5
6
7
8
9
10
11
12
13
CR
1
2
3
4
5
6
7
HV
8
9 K
12 11 10 NC
NC G2
(RED AMP)
V.OUT
NC
V.IN
NC
VM.IN
NC
VM.RET
07MXC
GND
ANALOG LINE
CN6
13P
WHT
:S-MICRO
CN1
50P
:B-TO-B
1
2
3
4
5
6
7
8
9
1
2
3
4
5
6
7
8
9
10
11
12
13
ZR
CN1401
7P
WHT
:S-MICRO
R/S
NC
H(+)
H(-)
NC
NC
200V
NC
GND
GND 1
12V
SCL
SDA
FS
GND
PJE YM
PJE YS
PJE B
PJE G
PJE R
SP SW
50-60
VBLK
1
GND
GND
GND
GND
A.REGI
V+ DRIVE
H.SHIFT
VERTICAL GND
EAST/WEST DRIVE
V- DRIVE
H DRIVE
V SYNC
H FLYBACK
VERTICAL GND
EHT
ABL
PROT1
MODE3
GND
9V
33V
STANDBY 5V
CVBS OUT
SIRCS
AUDIO L OUT SPEAKER
P.CONT
GND
5V
AUDIO R OUT SPEAKER
GND
LUMISPONDER
STANDBY LED
GND
GND
GND
GND
GND
FRONT KEY 1
VM
AUDIO MUTE
AUDIO R OUT HP
R OUT
AUDIO L OUT HP
AUDIO GND
AUDIO R IN AV-3
AUDIO L IN AV-3
CVBS IN AV-3
L OUT
S-VHS C IN AV-3
S-VHS Y IN AV-3
FGND
CN706
9P
WHT
:S-MICRO
G1
4 5 G1
H(+)
6
7 H(-)
L
+
-
CN301
7P
WHT
1
2
3
4
5
RED DRIVE
GRN DRIVE
BLUE DRIVE
9V
GND
CUT OFF
GND
A1
B1
A2
B2
A3
B3
A4
B4
A5
B5
A6
B6
A7
B7
A8
B8
A9
B9
A10
B10
A11
B11
A12
B12
A13
B13
A14
B14
A15
B15
A16
B16
A17
B17
A18
B18
A19
B19
A20
B20
A21
B21
A22
B22
A23
B23
A24
B24
A25
B25
CN1403
3P
RED
:S-MICRO
CN1405
4P
:VH
R
-
GND
GND
GND
GND
A.REGI
V+ DRIVE
H SHIFT
VERTICAL GND
EAST/WEST DRIVE
V- DRIVE
H DRIVE
V SYNC
H FLYBACK
VERTICAL GND
EHT
ABL
PROT1
POW LED
GND
9V
33V
STANDBY 5V
CVBS OUT
SIRCS
AUDIO L OUT SP
P.CONT
GND
5V
AUDIO R OUT SP
GND
LUMI/HP MUTE
STANDBY LED
GND
GND
GND
GND
GND
FRONT KEY 1
VM
AUDIO MUTE
AUDIO R OUT HP
R OUT
AUDIO L OUT HP
S3/GND
AUDIO R IN AV-2
AUDIO L IN AV-2
CVBS IN AV-2
L OUT
S-VHS C IN AV-2
S-VHS Y IN AV-2
CN705
CN1404
4P
RED
:S-MICRO
CN703
7P
RED
:S-MICRO
R
G
B
9V
GND
IK
GND
HR.IN
VR.IN
VR.RET
HR.RET
R
CN701
FASTON
+
1
2
3
4
5
1
2
3
V.DEF
NC
V.RET
CN201
DUAL SCART
1
2
3
4
5
6
7
1
2
3
4
R-H(+)
NC
NC
R-H(-)
CN2
5P
WHT
SP BOX
1
2
3
4
5
6
7
1
2
3
4
2
AC (L) OUT
NC
NC
NC
AC (N) OUT
FASTON
CN2703
21P
CN2701
7P
RED-L
:S-MICRO
2/
GND(Z)
1
2
(AV2)
1/
1
(AV IN/OUT)
(AV1)
RM-892
FOR CHECK
R
R
R
R
L
L
1
2
3
4
5
6
7
UE
1
2
LOWER
GND
GND
CVBS/Y IN
GND
CVVBS OUT
GND
C IN
MODE
(AV3)
3
(SMART LINK)
RIGHT
GND
1
2
3
4
5
6
7
8
AUDIO
AUDIO
AUDIO
AUDIO
AUDIO
AUDIO
1
2
L IN
GND
R IN
GND
L OUT
GND
R OUT
GND
A1
B1
A2
B2
A3
B3
A4
B4
A5
B5
A6
B6
A7
B7
A8
B8
A9
B9
A10
B10
A11
B11
A12
B12
A13
B13
A14
B14
A15
B15
A16
B16
A17
B17
A18
B18
A19
B19
A20
B20
A21
B21
LEFT
GND
CN2702
8P
WHT-L
:S-MICRO
GND
SCL
SDA
DISABLE
AGC
1
2
1
2
3
4
5
UPPER
GND
RM-892
R1
R
G SHIELD CHASSIS
B-SS800.<RUS>-KESSENZU-05
– 53 –
RM-862
KP-41PX1/41PX1K/41PX1R
K
7-3. CIRCUIT BOARDS LOCATION
7-4. SCHEMATIC DIAGRAMS AND
PRINTED WIRING BOARDS
Reference information
RESISTOR
ZG
Note:
CG
• The parts marked “#” on schematic diagrams are not mounted.
• All capacitors are in µF unless otherwise noted. (pF: µµF)
Capacitors without voltage indication are all 50 V.
• Indication of resistance, which does not have one for rating
electrical power, is as follows.
CR
H2
ZR
H1
A (41PX1/41PX1K),
AE (41PX1R)
CB
U (41PX1/41PX1K),
UE (41PX1R)
D
E
G
COIL
CAPACITOR
Pitch: 5 mm
Rating electrical power 1/4 W (CHIP : 1/10 W)
• All resistors are in ohms.
: nonflammable resistor.
•
• 5 : fusible resistor.
•
: internal component.
: panel designation, and adjustment for repair.
•
• All variable and adjustable resistors have characteristic curve B,
unless otherwise noted.
: earth-ground.
•
: earth-chassis.
•
• All voltages are in V.
• Readings are taken with a 10 M digital multimeter.
• Readings are taken with a color-bar signal input.
• Voltage variations may be noted due to normal production
tolerances.
•
* : Can not be measured.
• NO MARK: Common
• <
> : SECAM
• (
) : NTSC 3.58 MHz
• Circled numbers are waveform references.
V
•
: B + bus.
V
•
: B – bus.
:
:
:
:
:
:
:
:
:
:
:
:
:
:
:
:
:
RN
RC
FPRD
FUSE
RW
RS
RB
LF-8L
TA
PS
PP
PT
MPS
MPP
ALB
ALT
ALR
METAL FILM
SOLID
NONFLAMMABLE CARBON
NONFLAMMABLE FUSIBLE
NONFLAMMABLE WIREWOUND
NONFLAMMABLE METAL OXIDE
NONFLAMMABLE CEMENT
MICRO INDUCTOR
TANTALUM
STYROL
POLYPROPYLENE
MYLAR
METALIZED POLYESTER
METALIZED POLYPROPYLENE
BIPOLAR
HIGH TEMPERATURE
HIGH RIPPLE
RM-892
Device
1
*
Printed symbol
Transistor
Base
2
Transistor
Diode
Emitter
Collector
Base
3
Circuit
Terminal name
Collector
Emitter
Cathode
Anode
Cathode
4
Diode
Anode
(NC)
Cathode
5
Diode
Anode
(NC)
Common
6
Diode
Anode
Diode
Cathode
Common
Anode
Cathode
Common
8
Diode
Anode
Anode
Common
9
Diode
Anode
Anode
Common
0
qa
Diode
Cathode
Cathode
Common
Diode
qs
Diode
qd
Transistor
(FET)
Cathode
Anode
Anode
Cathode
Drain
Cathode
Cathode
Anode
Anode
Source
Gate
D
D
G
•
F
: Signal path.
• The components identified by [ in this basic schematic diagram
have been carefully factory-selected for each set in order to
satisfy regulations regarding X-ray radiation.
Should replacement be required, replace only with the value
originally used.
• When replacing components identified by ] , make the
necessary adjustments indicated. (See page 31)
• When replacing the part in below table, be sure to perform the
related adjustment.
Source
Gate
qf
Transistor
(FET)
qg
Transistor
(FET)
Source
Drain
Gate
qh
Transistor
Emitter
Collector
Base
qj
Transistor
qk
Transistor
Drain
G
S
S
D
D
G
G
S
S
C1
C2
E1
E2
C1
C2
E1
E2
E1
E2
C2 B1 E1
B1
B2
E2 B2 C1
C1 B2 E2
E1 B1 C2
B2
B1
Part Replaced ([)
R1
ql
Transistor
w;
Transistor
wa
G Board
C515,
L506,
R517,
C516,
Q502,
T502,
C554, D504,
R1,
R514,
T504 (FBT)
D507,
R516,
ws
IC6005
• Divided schematic diagram
C1 B2 E2
E1 B1 C2
Part Replaced (])
E Board
RM-862
Terminal name of semiconductors in silk screen
printed circuit ( )
7
Note: The components identified by shading and mark
¡ are critical for safety. Replace only with part
number specified.
RM-892
Transistor
C1 B2 E2
E2 B1 E1
C2
Transistor
Transistor
–
Discrete semiconductot
several pieces. Information to where the line is to be connected is
printed at the end of each line.
For example, [ TO A1/5,A2/5_1 ] means the line is connected to
Ref. No. 1 of A (1/5) and A (2/5) schematic diagrams.
TO A1/5,A2/5_1
Ref. No.
Name of divided schematic diagram
– 54 –
E2
E1(B2)
E2
E2
C1
E1(B2)
C2
C2
C1
C2
B1
C2
(B2)
E2 E1 B1
C2
C2
C2
B1
B1
C1
(Chip semiconductors that are not actually used are included.)
Schematic diagrams of A, AE, D, and E boards are divided into
B2
C1
C1(B2)
C1(B2)
(B2)
B1 E1 E2
C1
wd
B1
E1 B1 C2
Ver.1.5
KP-41PX1/41PX1K/41PX1R
K
RM-892
RM-892
RM-862
CN104
1P
TO CRT BRACKET
GND
GND
1
CN102
1P
:FASTON
TO V.OUT
1
GND
CN101
1P
:FASTON
TO G BOARD CN6003
1
(1) Schematic Diagram of A (1/5) Board (41PX1/41PX1K)
TO A(3/5)
DL
R110
8.2k
:CHIP
C110
47
16V
R81
#
:CHIP
R112
150
:CHIP
R114
150
:CHIP
R121
10k
:CHIP
R115
330
:CHIP
C123
68p
CH:CHIP
L120
8.2µH
:EL0606
C120
100p
CH:CHIP
1.3
C121
68p
CH:CHIP
R123
180
:CHIP
5.1
4.5
2.0
1.4
Q117
2SA1037AK
AMP
Q112
2SC2412K
BUFF
R113
10
:CHIP
R125
22k
:CHIP
C122
680p
CH:CHIP
L121
1µH
:LAV35
9V
GND
5
SVHS-C OUT
6
7
+9V
Y
SVHS-C
4.4
GND
4
4.4
0.1
4.4
MODE
0.1
C IN AV-3
4.4
3
Y IN AV-3
2
MODE
8
4.4
3.8
Q201
2SC2412K
BUFF
C
VIDEO
TO A(4/5)
C
Y
C
C2
S1
Y3
S2
C3
EMI
FL106
EMI
R198
220
:CHIP
R164
47k
:CHIP
VIDEO
C137
47
16V
4.1
2.0
R199
180 1.9
:RN-CP
R166
220
:CHIP
Q104
2SC2412K
BUFF
R167 R168
5.6k
560
:CHIP :CHIP
1
2
3
2.6
1.3
R163
220
:CHIP
2.8
2.1
6
4
C138
10
R169
220
:CHIP
R186
5.6k
:CHIP
R187
1k
:CHIP
1
C140
10
2
3
R250
0
2.3 :CHIP
FL103
R181
47k
:CHIP
Y LPF
R182
220
:RN-CP
6
4
GND
+5V
NTPL 1
5.0
GND
D GND
GND
APCN
+5V
+5V
GND
2
3
CLAMP ENABLE
A GND
1
4
5
6
C108
100
16V
VB
7
8
9 10 11 12
0.9
IRF
C133 C132 C131 C130
0.1
0.1
0.1
0.1
25V
25V
25V
25V
F:CHIP F:CHIP F:CHIP F:CHIP
Q106
R175
2SC2412K 1k
BUFF :CHIP
R171
100
:CHIP
L101
1µH
:CHIP
1.7
C134
100p
CH:CHIP
3
Q108
2SA1037AK
BUFF
1.9
Q113
2SC2412K
BUFF
1.7
1.3
R161
3.3k
R170 R162 :RN-CP
4.7k 2.2k
:RN-CP:RN-CP
5V
R188
2.2k
:CHIP
1.9
1.2
R189
560
:CHIP
1
C141 R177 C136 R179
470
220 16k 10
:CHIP
16V :RN-CP
2
3
2.7
(4.4)
2.1
R191
2.2k
:CHIP
Q126
#
C BPF
6
R176
1k
:CHIP
R190
5.6k
:CHIP
FL104
R172 R174
220
1k
:CHIP :CHIP
Q105
2SC2412K
EQUAL
C126
0.1
25V
F:CHIP
1.5
C129 C128
0.1
0.1
25V
25V
F:CHIP F:CHIP
4
R178
22k
:CHIP 3.2
3.2
R173 C135
#
#
:CHIP CH:CHIP
1.1
R160
0
:CHIP
C125
0.1
25V
F:CHIP
C127
0.1
25V
F:CHIP
4.3
R185
560
:CHIP
TRAP
GND
GND
1.8
+5V
R159
#
:CHIP
R183
330
:RN-CP
4
Q125
2SA1037AK
BUFF
Q109
2SA1037AK
BUFF
KILL
AUDIO L/R
Y
TO A1/5,A3/5_9
TO A1/5,A3/5_8
TO A1/5,A2/5_7
Y/C
TO A1/5,A2/5_6
AUDIO L/R
1.3
0.7
Q107
2SA1037AK
BUFF
DIGITAL COMB FILTER
TO A1/5,A2/5_5
R184
470
:CHIP
DIGITAL COMB FILTER
24
23
22
21
20
19
18
17
16
15
14
13
2
C107
0.1
25V
F:CHIP
R180
47k
:CHIP
C139
0.01
B:CHIP
FL102
VIDEO LPF
R165
47k
:CHIP
A.5V
Q116
Q103
2SA1037AK 2SA1037AK
AMP
BUFF
Q115
2SC2412K
AMP
EMI
GND
D GND
VCO VOLTAGE IN
EMI
FL108
CVBS
R209
1k
:CHIP
IC103
CXD2064Q-T6
A GND
C
TO A1/5,A3/5_11
Y
Y2
C316
33p
CH:CHIP
GND
3.0
1.8
PLL COMP OUT
VIDEO
5V
GND
CLOCK IN
C114
0.1
25V
F:CHIP
TO A1/5,A3/5_10
4.4
4.4
BIAS
SVHS-Y
5V
CLOCK OUT
2.7
1.5
4.4
CVBS IN AV-3
R208
680
:CHIP
VEH 1
VRF
SVHS-Y OUT
GND
VIDEO
PNR
5.0
GND
VG
GND
4.5
5V
V 2
R395
0
:CHIP
C105 C106
0.1 100
25V 16V
F:CHIP
R107
560 C109
:CHIP 0.022
B:CHIP
GND
2.3
PLL CONTROL
A GND
4.4
CVBS IN AV-2
TO
A(3/5,4/5)
CLOCK IN
0.7
CVBS OUT
SCL
EMI
EMI
SDA
TO A1/5,A2/5_2
VIDEO
C111 R108
0.1 56k
25V :CHIP
F:CHIP
37
38
39
40
41
42
43
44
45
46
47
48
LUMINANCE OUT
1
SCL
VIDEO
4.5
16
15
14
13
12
11
10
9
VIDEO
GND
ADR
GND
3.4
SYNC
4.9
SDA
4.5
SCL
4.4
CVBS OUT
GND
GND
GND
FL105
SDA
C206
#
CH:CHIP
5V
TO A1/5,A2/5_3
TO A1/5,A2/5_4
R141
820
:CHIP
+5V
R117
6.8k
:CHIP
C117
0.01
B:CHIP
2.6
R116
470
:CHIP
2.5
(4.4)
AGC
#
4.4
1
AUDIO MONO
C115
0.01
B:CHIP
AGC
4.4
CVBS OUT AV-2
CVBS IN AV-1
C205
22
TO A1/5,A2/5_1
SYNC IN TV
9V
C IN AV-2
VIDEO
TV IN
4.4
VIDEO
25
26
27
28
29
30
31
32
GND
V3
L201
47µH
:LAV35
4.4
Y IN AV-2
V1
C246 R290
220
47
16V :CHIP
R118
47
:CHIP
TO
A(4/5)
Q202
R200
1k
:CHIP
36 35 34 33 32 31 30 29 28 27 26 25
5.9
C231
#
24 23 22 21 20 19 18 17
VIDEO
8.3
FSC
2.4
1.2
IC201
CXA2040AQ-T4
VIDEO SW
5V
3.2
TO A(4/5)
CHROMA OUT
R203
100
:CHIP
DISABLE PJE
U-PC DISABLE
PAL/NT
R158
#
R142
0
A/D REF VOLTAGE
C202
0.1
25V
F:CHIP
C237
2.2
6.3V
F:CHIP
C207
10
FS
R210
#
:CHIP
R204
100
:CHIP
DIS
C203
330
16V
4.6
R157
0
:CHIP
C118
0.1
25V
F:CHIP
R140
470
:CHIP
D GND
9V
5.2
R138
470
:CHIP
R136
220
:CHIP
R143 R156 C119
0.1
#
#
25V
:CHIP :CHIP F:CHIP
Q101
Q102
2SC2412K 2SA1037AK
AMP
AMP
R119
12k
:CHIP
C116
0.22
16V
B:CHIP
AUDIO L/R
VIDEO
R205
22k
:CHIP
9V
R130
3.3k
:CHIP
AUDIO L/R
AUDIO L/R
R206
220
:CHIP
C204
0.1
25V
F:CHIP
9V
VIDEO
9V
CF120
6.5MHz
R129
330
:CHIP
R137
1k
:CHIP
AUDIO L/R
SDA
SCL
C201
0.1
25V
F:CHIP
AUDIO L/R
R126
C104
100
100p
:CHIP CH:CHIP
R128
270
:CHIP
L122
8.2µH
:EL0606
R122
470
:CHIP
8.3
R135 5.3
680
:CHIP
R132
100
:CHIP 1.5
3.2
Q124
2SC2412K
BUFF
Q130
2SA1037AK
AMP
R134
10
:CHIP
8.3
2.2
L102
5.6µH :LAV35
R124
1k
:CHIP
VIDEO
+9V
R133
470
:CHIP
3.8
+5V
R262
100
:CHIP
2.0
R131
10k
:CHIP
C124
0.1
25V
F:CHIP
+5V
R247
470
:CHIP
C112
0.001
CH:CHIP
1.1
AUDIO L/R
4.1
4.1
Q121
2SC2412K
AMP
R127
22k
:CHIP
GND
1.1
R111
150
:CHIP
1.7
9V
R120
6.8k
:CHIP
EMI
0.1
Q118
BSS83
DL SW
Q111
2SA1037AK
AMP
0.5
5V
1.7
R369
#
:CHIP
G
D
L103
C143 18µH 1.1
100p :CHIP C145
CH:CHIP
47p
CH:CHIP
C144
150p
CH:CHIP
R261
R258
470
470
:CHIP
:CHIP
Q110
2SC2412K
AMP
A GND
33V
3.7
Q114
2SC2412K
AMP
FL107 C113 R106
FZ103N 47
10k
16V :CHIP
C146
0.1
16V
F:CHIP
Q122
2SC2412K
BUFF
1.3
C101 C102
0.1 220
25V 16V
F:CHIP
C142
82p
0.5 S
CH:CHIP
R244
470
:CHIP
9V
Q120
2SC2412K
BUFF
5V
R367
1.2k
:CHIP
A/D REF VOLTAGE
R105
470k
:CHIP
FB101 5V
HM102
:CHIP
R366
10k
:CHIP
A/D IN
AGC
D218
UDZ-5.6B
PROT
C103
22
TU101
BTF-FC411
CLAMP OUT
FL101
FZ103N
AGC
D216
UDZ-5.6B
D217
PROT
UDZ-5.6B
PROT
AGC
SCL
SDA
FS
5V
33V
TP1
#
D221
1SS355TE
PROT
Q18
DTA144EKA
Q214 INV
DTC144EKA
INV
R104
10k
:CHIP
D101
MA8330
REG.
D220
1SS355TE
PROT
0
R103
100
:CHIP
R102
100
:CHIP
VIDEO
R101
0
:CHIP
EMI
JR101
#
:CHIP
R280
1k
:CHIP
DIS
2.6
AGC
4.8
CPU
C148
0.01
CH:CHIP
AUDIO MONO
TP2
#
C147
0.0047
AS
SCL
SDA
5V
TP3
#
JR1
0
:CHIP
SCL
SDA
5V
AGC
DISABLE
AUDIO L/R
+33V
L/L
NEG/POS
GND
+5V
AM
QSS
VIDEO
NC
TP4
#
A
(1/5)
(TUNER,DIGITAL COMB FILTER)
B-SS774.<AEP>-A..-P1-05
– 55 –
KP-41PX1/41PX1K/41PX1R
(2) Schematic Diagram of A (2/5) Board (41PX1/41PX1K)
R272
D225
75
UDZ-9.1B
:CHIP
PROT
Q207
Q208
Q206
2SC2142K 2SC2142K 2SC2142K
BUFF
BUFF
BUFF
D226
UDZ-9.1B
PROT
9V
R251
1k
:CHIP
C240
100
16V
5.9
C210
100p
CH:CHIP
A
(2/5)
(AUDIO PROCESSOR)
TO A1/5,A2/5_2
2.0
5.3
AUDIO L
5.9
5.3
2.0
1.3
AV2 L OUT
C208
0.1 R289
25V
220
F:CHIP :CHIP
C2
1.3
R288
1k
:CHIP
AUDIO R
TO A(3/5)
AV2 R OUT
R392
1k
:CHIP
VIDEO
R254
470
:CHIP
AV2 V OUT
RM-892
TO A1/5,A2/5_1
R253
1k
:CHIP
R252
10k
:CHIP
RM-892
R259 C241 R263
3.3k
1k
47
:CHIP 16V :CHIP
R287
470
:CHIP
C248
100p
CH:CHIP
MC2
C247
47
16V
R317
220
:CHIP
Y2
TO A1/5,A2/5_7
Q205
2SC2142K
BUFF
R273
75
:CHIP
TO A1/5,A2/5_6
+9V
TO A1/5,A2/5_5
G
B
R
AV-1
AV-1
AV-1
AV-1
TO A1/5,A2/5_3
TO A1/5,A2/5_4
G
B
R
TO A(3/5) FB
TO A(4/5)
K
D208
UDZ-9.1B
PROT
C227
0.01
B:CHIP
L202
4.7µH
:CHIP
C226 R237
0
47
16V :CHIP
D214
UDZ-9.1B
PROT
EMI
R221
390 :CHIP
L203
4.7µH :CHIP
C217
0.01
B:CHIP
R222
47k
:CHIP
C216 R220
0
47
16V :CHIP
AUDIO R
AUDIO R
R219
22k
:CHIP
L204 4.7µH :CHIP
C215
0.01
CH:CHIP
C214 R218
0.1
100
16V :CHIP
F:CHIP
C232
0
:CHIP
R260
220
:CHIP
L205
4.7µH
:CHIP
VIDEO
L3
AV3 L
AUDIO L
C249
1 10V F:CHIP
R3
AV3 R
AUDIO R
C250
1 10V F:CHIP
D205
UDZ-9.1B
PROT
C225
0.01
CH:CHIP
C224 R235
100
0.1
16V :CHIP
F:CHIP
D213
UDZ-9.1B
PROT
R224 R225
47k
390
:CHIP :CHIP
C219
0.01
B:CHIP
C218 R223
0
47
16V :CHIP
D207
UDZ-9.1B
PROT
R242 R241
47k
390
:CHIP :CHIP
C229
0.01
B:CHIP
C228 R240
0
47
16V :CHIP
D215
UDZ-9.1B
PROT
C3
JR203
#
:CHIP
4.3
R404
27k
:CHIP
D GND
4
1
3
2
2
ADR SEL
D GND
D-CTR0
D-CTR1
NC
D GND
D GND
AUDIO-CLK
2.3
XTAL
2.3
XTAL
STDBY
0.1
ROUT HP
0.1
LOUT HP
VREF2
4.7
C283
0.01
B:CHIP
2
HP R
HP L
9V
9V
C273
C274
0.001 0.001
CH:CHIP CH:CHIP
R394
1k
:RN-CP
R281
47k
:CHIP
5.1
Q203
2SC2412K
BUFFER
AUDIO R
4.5
C277
2.2
C272
6.3V
0.001
CH:CHIP F:CHIP
AUDIO R
SP R
R283
4.7k
:CHIP
R282
68k
:CHIP
TO A(4/5)
9V
9V
D401
D402
UDZ-9.1B 1SS355TE
PROT
AUDIO R
VIDEO/Y
MV2
C239
#
:CHIP
STDBY 5V
R401
220
:CHIP
R406
10k
:CHIP
Q402
2SC2412K
BUFF
4.2
R405
10k
:CHIP
R284
47k
:CHIP
5.0
Q204
2SC2412K
BUFFER
AUDIO L
R285
68k
:CHIP
AUDIO L
SP L
R286
4.7k
:CHIP
AV LINK IN
2.5
R407
10k
:CHIP
Q403
2SC2412K
BUFF
TO A(4/5)
R410
22k
:CHIP
4.6
AV LINK OUT
0
Q401
2SC2412K
BUFF
C278
2.2
C271
6.3V
0.001 F:CHIP
CH:CHIP
R409 R408
1k
1k
:CHIP :CHIP
4.9
5
MC2
0
C209 R202
1k
0
:CHIP :CHIP
IC205
PST593C-MMP-4P
RESET
C282 C281
0.1
22
25V
F:CHIP
C276
1
10V
F:CHIP
STDBY 5V
V3
FRONT-R
FRONT-C
R265
4.7k
:CHIP
2
4.4
Q404
2SA1037AK
BUFF
C2
FRONT-L
C
2
EMI
R393
1k
:RN-CP
4.8
D219
#
FL201
FZ103N
Y3
R243
0
:CHIP
R245
1k
:CHIP
5V
C279
22
C280
0.1 25V F:CHIP
JR204
#
:CHIP
R 2
FRONT-V
C269
C270
390p
390p
CH:CHIP CH:CHIP
SCL
SDA
Y2
R 1
VIDEO
TO
A(4/5)
C266
10
R2
R236
22k
:CHIP
R201
0
:CHIP
TEST
C268
0.1
25V D253 C267
F:CHIP #
22
R1
AUDIO R
AV3 V
FL203
FZ103N
D206
UDZ-9.1B
PROT
AUDIO R
L208 4.7µH :CHIP
2
10
L 1
AUDIO L
TO A(3/5)
D251
BAS216
DROP C265
9V
R256 100 :CHIP
R255 100 :CHIP
C275
1
10V
F:CHIP
44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60
9V
L 2
AUDIO L
A GND
C264
3.3
R239
390
:CHIP
R238
47k
:CHIP
3.8
3.8
A GND (C)
3.8
VREF(A)
3.8
A GND (C)
0.1
0.1
L2
D212
UDZ-9.1B
PROT
A GND (B)
ROUT SP
C263
0.1
25V
F:CHIP
A GND
LOUT SP
C222 R233
100
0.1
16V :CHIP
F:CHIP
C262
470p
CH:CHIP
3.8
3.8
LIN AV-3
TEST
D204
UDZ-9.1B
PROT
AUDIO L
C223
0.01
CH:CHIP
R234
22k
:CHIP
C261
470p
CH:CHIP
L1
RIN AV-3
SCL 9
4.4
SDA 8
4.5
I2S-CLK 7
I2S-WS 6
I2S-DA OUT 5
I2S-DA IN 4
S-DA IN 3
NC 2
S-ID 1
S-CL 68
D 5V 67
D GND 66
S-DA OUT 65
FRAME 64
N-CL 63
N-DA 62
RESET 61
4.7
AUDIO R
C212 R216
100
0.1
16V :CHIP
F:CHIP
A GND
0
0.1
AUDIO L
C213
0.01
CH:CHIP
IC202
MSP3411G-PS-B8
AUDIO PROCESSOR
3.8
LIN AV-1
3.8
AV-CAP
AUDIO R
AUDIO L
RIN AV-1
AV-CAP
R3
L3
S2
A GND
3.8
3.8
D211
UDZ-9.1B
PROT
AUDIO R
AUDIO L
A GND
R231
#
:CHIP
R1
L1
5
3.8
VREF
2.6
RIN AV-2
3.8
LIN AV-2
3.8
ROUT AV-1
R232
1k
L206 :CHIP
4.7µH
:CHIP
B
2
MONO IN(AM)
LOUT AV-1
D203
UDZ-9.1B
PROT
A GND
VREF1
S1
R215
#
:CHIP
27
28
29
30
31
32
33
34
35
36
37
38
39
40
41
42
43
7.2
LOUT AV-2
3.8
ROUT AV-2
3.8
MC2
R214
1k
:CHIP
A 5V
2
1.5
ANA-IN
1.5
ANA-IN2
0.1
C259
0.47
10V
F:CHIP
AUDIO MONO
AUDIO R
R2
AUDIO L
L2
D210
UDZ-9.1B
PROT
ANA-IN1
C260
0.1
C258 25V
10 F:CHIP
D209
UDZ-9.1B
PROT
C
C221 R229
1k
2.2
6.3V :CHIP
F:CHIP
R230
82
:CHIP
R217
22k
:CHIP
C252
4p
CH:CHIP
2
26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 2
D202
UDZ-9.1B
PROT
V 2
C284
470
10V
R372
#
:CHIP
AUDIO L/R
C255
100p
CH:CHIP
C238
#
:CHIP
5V
2
X201
18.432MHz
C251
4p
CH:CHIP
2
2
2
R
G
AUDIO L/R
2
MV2
AUDIO L
AUDIO L OUT
AUDIO L OUT
AUDIO R IN
AUDIO R IN
AUDIO R OUT
AUDIO R OUT
R226
1k
C235 :CHIP
#
:CHIP
R213
75
:CHIP
JR202
#
:CHIP
EMI
AUDIO L
AUDIO R
GND
GND
GND
GND
VIDEO/Y
VIDEO
JR201
0
:CHIP
FL202
FZ103N
L 1
R 1
AUDIO L IN
AUDIO L IN
VIDEO
C254
47p
CH:CHIP
AUDIO L
AUDIO R
2
R228
75
:CHIP
5V
C256
0.1
25V
F:CHIP
C257
22
L 2
R 2
2/
R227
82
:CHIP
C233
#
:CHIP
C253
100p
CH:CHIP
C220
100
16V
C236
100p
CH:CHIP
V1
D201
UDZ-9.1B
PROT
HP-CAP
(AV2)
B21
A21
B20
A20
B19
A19
B18
A18
B17
A17
B16
A16
B15
A15
B14
A14
B13
A13
B12
A12
B11
A11
B10
A10
B9
A9
B8
A8
B7
A7
B6
A6
B5
A5
B4
A4
B3
A3
B2
A2
B1
A1
C230
100p
CH:CHIP
R211
1k
C234 :CHIP
#
:CHIP
7.3
1/
VIDEO
R212
75 C211
:CHIP 22
L207
0
:CHIP
AUDIO R
(AV1)
GND
GND
CVBS IN
CVBS/Y IN
CVBS OUT
CVBS OUT
GND
GND
GND
GND
BLANKING
NC
RED IN
SVHS-C IN
GND
GND
GND
GND
NC
NC
GREEN IN
NC
NC
AV LINK
GND
GND
MODE
MODE
BLUE IN
NC
R271
75
:CHIP
D224
UDZ-9.1B
PROT
8V
CN201
DUAL SCART
R270
75
:CHIP
SP-CAP
R2914
100 :CHIP
D223
UDZ-9.1B
PROT
VIDEO
R2915
100
:CHIP
AUDIO MONO
MV2
R402
10k
:CHIP
R403
22k
:CHIP
Q405
2SA1037AK
BUFF
R411
22k
:CHIP
TO A2/5,A3/5_12
B-SS774.<AEP>-A..-P2-05
– 56 –
RM-862
KP-41PX1/41PX1K/41PX1R
(3) Schematic Diagram of A (3/5) Board (41PX1/41PX1K)
Y
PAL/NT
SDA
SA2
13
SA1
12
0.4 4.2
5
8
R295
1k :CHIP
0.1
GND
TO A(1/5,3/5,4/5)
A.REGI
Q216
2SC2412K
SW
R368
100
:CHIP
DL
R299
#
0.1
C243
47
R257
10k :CHIP
IC206
CXA1315M-T4
BUS-SW
C245
4.7
0.6
9V
11
0.4(8.7)
SPSW
8.9
Q211
DTC144EKA
INV
R266
47k
:CHIP
Q215
2SC2412K 4.2
SW
TO A(1/5)
10
6
SA0
0.4
4.5
SDA
R298
220 :CHIP
0.4
YC/COMB
R296
1k :CHIP
0.4
(8.5)
N-FBAV
4.4
5.0
R267
27k
:CHIP
Q209
2SC2412K
INV
SCL
4.3
14
3
PAL/NT
8.9
(0)
0
16
4.3
R297
220 :CHIP
3.2
KILL
2.7(4.4)
TO A(4/5)
9V
15
1
11
10
9
Q213
2SA1037AK
BUFF
C
SCL
0.1
7
R2402
#
:CHIP
TO A(2/5) FB AV-1
R2438
10k
:CHIP
VSS
MODE-O
KILL
8
0.1
Q212
2SA1037AK
BUFF
VCC
R264
R269 R274
47k 4.3 47k
47k
:CHIP
:CHIP :CHIP
9
FBAV1
MODE-S
Y
2.7(4.4)
7
4.7
5V
3.4
(4.9)
3.1
(4.9)
2.7
(4.4)
2
12
3
4
5
6
8.9
(0)
R2437
10k
:CHIP
4.7
2.7
(4.4)
2.5
R2436
1k
:CHIP
C242
2.5
0.01
B:CHIP (4.4)
TO A(4/5)
R268
47k :CHIP
R292
2.2k
:CHIP
R291
2.2k
:CHIP
4
2
13
R207
47k
:CHIP
4.4
2.5(4.4)
5V
Y
C
9V
C
9V
0.4(8.5)
Q2412
DTC143TKA-T146
BUFF
RM-892
TO A1/5,A3/5_11
TO A1/5,A3/5_10
VDD
1
Y
IC204
MC14066BF
YC-SW
4.4
Q2414
2SA1037AK
BUFF
RM-892
C
SVHS-C
Y
SVHS-Y
Y/C
C
(VIDEO AUDIO SELECT)
14
A(3/5)
TO A1/5,A3/5_9
TO A1/5,A3/5_8
K
C244
0.01
B:CHIP
R249
#
:CHIP
A.REGI
TO A(4/5)
R248
100 :CHIP
SPSW
R293
#
:CHIP
TO A(5/5)
RGB-S
AUDIO R
AUDIO L
R4054
1.2k
:CHIP
C4067
1
10V
R4083
#
:CHIP
6
9 10 11 12
4.3
4.5
3.9
4.5
C4040 0.1 25V F:CHIP
C4048 0.1 25V
C4047 0.1 25V
C4060 0.1 25V F:CHIP
R4078
22k
:CHIP
C4088
470p
:CHIP
R4073
22k
:CHIP
AUDIO L
1
2
3
4
5
6
7
8
L IN
GND
R IN
GND
R OUT
GND
L OUT
GND
1
2
3
4
5
6
7
MODE
AV LINK
GND
V OUT
GND
V IN
GND
6
5
D4008 R4058
1.2k
UDZ-9.1B :CHIP
AUDIO R
D4001
#
4
3
R4059
C4071
1.2k
:CHIP 1 10V F:CHIP
AUDIO
C4062 0.1 25V F:CHIP
L
VIDEO
R4003
75
:CHIP
VIDEO
D4010
UDZ-9.1B
C4066
0.47
C4072
D4007 1 10V F:CHIP
UDZ-9.1B
Q4003
2SC2412K
BUFF
9V
9V
3.6
2.9
C4101
150p
CH:CHIP
VIDEO
R4105
220
:CHIP
C4038
10
R4087
68
:CHIP
AUDIO L
AUDIO R
VIDEO
AV2 L OUT
AV2 R OUT
AV2 V OUT
VIDEO
AV3 V
R4108
220
:CHIP
VIDEO
TO A(2/5)
AUDIO L
AUDIO L
AUDIO R
AUDIO R
AV3 L
AV3 R
R4030
10k
:CHIP
CN4501
8P
WHT
:S-MICRO
TO U BOARD:CN4902
R4065
0
:CHIP
R4011
100
:CHIP
3.9
-
-
-
3.2
C4082
10
C4046 0.1 25V
D4004
D4009
UDZ-9.1B UDZ-9.1B
V3 IN
GND
C4043
0.1
25V
F:CHIP
3.9
C4089
470p
:CHIP
AUDIO R
7
8
7
-
AUDIO R
C4061 0.1 25V F:CHIP
2
-
4.4
4.4
3.9
L2 IN
4.4
V2 IN
4.3
NC
0
S2-2
0
R2 IN
S2-3
NC
4.5
3.9
4.4
NC
-
9V
VCC
NC
Q4007
2SC2412K
BUFF
MODE3
C4045 0.1 25V
9V
NC
0
0
4.4
R3 IN
4.5
3.9
L3 IN
4.5
-
40
41
42
43
F:CHIP
44
45
F:CHIP
46
F:CHIP
47
F:CHIP
48
4.2
4.3
4.5
3.6
R3 OUT
4.5
V3 OUT
4.2
L3 OUT
4.5
4.4
L3 OUT
4.5
V3 OUT
3.6
R3 OUT
4.5
C4042 0.1 25V F:CHIP
DV3 IN
3.9
IC4003
CXA2089Q-T6
VIDEO AUDIO SELECT
-
TO A2/5,A3/5_12
C4041 0.1 25V F:CHIP
DL3 IN
-
NC
AUDIO L
C4059
0.1
25V
F:CHIP
4.4
C4039 10
3.6
C4036
10
D4013
#
R4053 0 :CHIP
DR3 IN
-
R4089
6.8k
:CHIP
R4088
3.3k
:CHIP
R4066 0 :CHIP
-
7.8
4.4
SDA
4.5
BIAS
R4107
100
:CHIP
C4035
10
R4084
10k
:CHIP
D4011
UDZ-5.6B
R4111
1k
:CHIP
R4029
10k
:CHIP
R4052 0 :CHIP
SCL
37
38
SDA
ADR
C4044 0.1 25V F:CHIP
39
C4032 10
TO
SCL
A(1/5,3/5,4/5)
DV4 IN
R4047
10k
:CHIP
36 35 34 33 32 31 30 29 28 27 26 25
R4106
100
:CHIP
C4091
0.01
B:CHIP
F:CHIP
D4015
UDZ-5.6B
VIDEO
C4058 0.1 25V F:CHIP
C4057 0.1 25V F:CHIP
AUDIO R
R4076
#
:CHIP
24
23
22
21
20
19
18
17
16
15
14
13
9V
C4055
0.1
25V
F:CHIP
C4031
0.01
B:CHIP
C4068
1
10V
F:CHIP
C4064
10
C4090
0.01
B:CHIP
D4006
UDZ-9.1B
R4055
1.2k
:CHIP
1
VIDEO
9V
R4067 0 :CHIP
C4033
100
16V
C4056 0.1 25V F:CHIP
C4017 39p CH:CHIP
AUDIO L
R4075
470
:CHIP
R4032
10k
:CHIP
B-SS774.<AEP>-A..-P3-05
– 57 –
CN4502
7P
RED
:S-MICRO
TO U BOARD:CN4901
RM-862
KP-41PX1/41PX1K/41PX1R
K
(4) Schematic Diagram of A (4/5) Board (41PX1/41PX1K)
U-PC DISABLE
AGC
15
R
C320
22
AUDIO L
AUDIO R
AUDIO L
HP
HP
SP
SP
C318
33p
CH:CHIP
B
L
R
L
R
1.1
Q334
2SA1037AK
BUFF
G
Q335
2SA1037AK
BUFF
FB2
SDA
SCL
C338 3.3
C329 # B:CHIP
C336 0.001 B:CHIP
C332 0.01 B:CHIP
C337 0.001 B:CHIP
CVBS
R341 100 :CHIP
VIDEO
R340 100 :CHIP
C333 100 16V
9V
C380
0.1
25V
F:CHIP
4.0
5.0
CVBS IN
4.0
BL HOLD
4.0
DC TRAN
SVHS-Y IN
NC
4.2
SYNC IN
9V
C334
0.01
B:CHIP
C367
#
CH:CHIP
9V
R328 R346 R318
#
#
#
:CHIP :CHIP :CHIP
R329
47k
:CHIP
R2
L2
AUDIO
AUDIO L HP L
K1
VM
MUTE
R HP R
R381
#
:CHIP
C369
#
CH:CHIP R384
#
:CHIP
Q502
#
R324 R319 C319
#
#
#
:CHIP :CHIP :CHIP
Q501
#
R385
#
:CHIP
R386
#
:CHIP
Q503
#
R388
#
:CHIP
R387
#
:CHIP
R359
0
:CHIP
R325
47k
Q307 :CHIP
DTC144EKA
SW
3.5
0
R332
1k
:CHIP
C335
0.47
10V
F:CHIP
D229 D230
#
#
R390
#
:CHIP
Q308
DTC144EKA
MUTE
4.2
D303
1SS355TE
RECT
R389
#
:CHIP
0
R355 C347
68k 4.7
:CHIP
D304
1SS355TE
PROT
A
(4/5)
(Y/C JUNGLE)
R97
100
:CHIP
– 58 –
R380
#
:CHIP
R306
#
:CHIP
D15 #
CN1
50P
TO D(1/3)BOARD
CN1801
R383
#
:CHIP
Q332
#
C327 C326
0.047 0.001
:PT CH:CHIP
D222
UDZ-TE17-5.6B
R382
#
:CHIP
9V
R
LED
C21
0.01
B:CHIP
H 9V
9V
D320
UDZ-9.1B
PROT
AUDIO R
AUDIO L
VIDEO/Y
C95
#
:CHIP
AUDIO R SP R
AFC
IR
STBY
5V
9V
33V
AUDIO L SP L
STDBY 5V
HFBP
HFBP
EHT
ABL
PROT1
E-W
VH OUT
V SYNC
V+
C9
#
C20
0.01
B:CHIP
Q309
DTC144EKA
SW
16
R323
220
:CHIP
AUDIO R
C5
#
R300
100
:CHIP
R330
100
:CHIP
C325
10
16V
F:CHIP
SP R
TO A(3/5) A.REGI
0 FV
R331
2.7k
:CHIP
R27 R320 R321 R322
#
100
100
100
:CHIP :CHIP :CHIP :CHIP
1.4
3.5
17
C321 C322 C323 C324
0.01 0.1
0.1
0.1
B:CHIP 25V
25V
25V
F:CHIP F:CHIP F:CHIP
Q333
2SA1037AK
BUFF
1.2
1.8
L2
R2
B
HP L
HP R
SP L
C349
33p
CH:CHIP
G
AUDIO L
AUDIO R
FRONT-L
FRONT-R
R364
1k
:CHIP
18
R361
2.2M
:CHIP
EHT
L304
1µH
:CHIP
R365
#
:CHIP
22
R356
3.3M
:CHIP
R333
5.6k
:CHIP
HFBP
FRONT-C
TO A(2/5)
C361
33p
CH:CHIP
1.8
X303 B500F63
503.5kHz
R360
2.2M
:CHIP
H OUT
V2
C2
R336 330k :CHIP
9V
R334 470 :CHIP
3.9
B
2.1
R363
#
:CHIP
R335 10k :RN-CP
R304
2.2M
:CHIP
IK
L303 R362
1k
1µH
:CHIP :CHIP
E-W
C339 0.01 B:CHIP
C341
0.47 10V F:CHIP
PROT1
C315
0
:CHIP
G
R
VIDEO/Y
C
4.7
V AGC
4.0
C340 100 16V
R339
1k
:CHIP
C342 1 10V F:CHIP
R337 100 :CHIP
C331 0.1 100V :MPP
14
9V
L302
R80
1µH
1k
:CHIP :CHIP
FRONT-V
SAW OSC
C344 100p CH:CHIP
R338 1k :CHIP
C343 0.0047 B:CHIP
VBLK
NC/5V
GND
8
V 9V
5.2
R343 3.3k :CHIP
E-W
NC/GND
NC
7
9V
HFBP
R-Y
VCO/NC OUT
6
9V
CERA
2.4
4.2
L2 FIL
4.7
AFC PIN
3.4
H OUT
3.2
AFC FIL
RGB 9V
C310 1 10V F:CHIP
H 9V9V
Q330
2SA1037AK
BUFF
C330 0.1 63V :PT
C309 1 10V F:CHIP
VM
R342 R345
0
1k
:CHIP :CHIP
4.5
33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51
R310 220 :CHIP
GND
4.8
R OUT
1.4
GSH
5.3
G OUT
1.2
BSH
5.3
B OUT
1.1
IK IN
4.5
ABL IN
1.7
ABL FIL
7.2
VTIM
0.4
V- DRIVE
2.9
V+ DRIVE
3.1
6
7
R309 220 :CHIP
IC301
CXA2076Q-TL
YCJ
0.8
FB-1 IN
0.1
R-1 IN
5.5
G-1 IN
5.5
B-1 IN
5.5
FB-2 IN
0.1
HB-2 IN
0
R-2 IN
5.5
G-2 IN
5.5
B-2 IN
5.5
RSH
3.0
SSCP
5
B-Y
OUT
4
C375
#
C307 0.01 B:CHIP
H 9V
IREF
SSCP OUT
5.7
0
TO A4/5,A4/5_17
SDA
4.5
SCL
4.4
VM
6.4
SYNC OUT
4.5
HS IN
3.1
VS IN
4.0
VS FIL
2.5
VV+
C313
0.001
CH:CHIP
3.0
1.5
NC
R-Y
IN
3
Q306
DTC144EKA
BUFF
21
1.8
9
2
5V
C312
2.2
6.3V
F:CHIP
10
C348
470p
R354
CH:CHIP
0
:CHIP 0.1
C350
4.7
R358
# :CHIP
GND
C
IK
11
4
L305
1µH
20
21
22
23
24
25
26
27
28
C328 22
29
R305 220 :CHIP
30
R327 100 :CHIP
31
R326 100 :CHIP
32
D302
#
PROT
12
C306 0.01 B:CHIP
C311 1 10V F:CHIP
1
5V
B
13
0.8
B
14
R
G
B
R308 100 :CHIP
C308 0.01 B:CHIP
FB2
COR
R2
G2
B2
C346
#
:CHIP
NC/GND
R
G
G
15
C345
#
:CHIP
B-Y
NC/GND IN
1
2
3
4
5
6
7
16
C303
0.001
CH:CHIP
FB1
R1
G1
B1
C317
0.1
25V
F:CHIP
AB/NC
R
C305 0.1 25V F:CHIP
A1
B1
A2
B2
A3
B3
A4
B4
A5
B5
A6
B6
A7
B7
A8
B8
A9
B9
A10
B10
A11
B11
A12
B12
A13
B13
A14
B14
A15
B15
A16
B16
A17
B17
A18
B18
A19
B19
A20
B20
A21
B21
A22
B22
A23
B23
A24
B24
A25
B25
RED DRIVE
GRN DRIVE
BLUE DRIVE
9V
GND
CUT OFF
GND
9V
R302 R303
0
0
:CHIP :CHIP
5V
9V
C304 0.1 25V F:CHIP
20
5.7(2.9)
5.7(2.9)
Y OUT
3.7
Y IN
5.0
R-Y IN
5.5
B-Y IN
5.5
GND
GND
GND
GND
A.REGI
V+ DRIVE
H SHIFT
VERTICAL GND
EAST/WEST DRIVE
V- DRIVE
H DRIVE
V SYNC
H FLYBACK
VERTICAL GND
EHT
ABL
PROT1
MODE3
GND
9V
33V
STANDBY 5V
CVBS OUT
SIRCS
AUDIO L OUT SP
P.CONT
GND
5V
AUDIO R OUT SP
GND
LUMISPONDER
STANDBY LED
GND
GND
GND
GND
GND
FRONT KEY 1
VM
AUDIO MUTE
AUDIO R OUT HP
R OUT
AUDIO L OUT HP
S3/GND
AUDIO R IN AV-2
AUDIO L IN AV-2
CVBS IN AV-2
L OUT
S-VHS C IN AV-2
S-VHS Y IN AV-2
CN301
7P
WHT
IC302
TDA4665T/V5-118
SECAM SW
C301 0.1 25V F:CHIP
8
Q300
DTC144EKA
TRAP
R-Y
B-Y
TRAP
0
(0.5)
C302
0.001
CH:CHIP
TO CR BOARD CN703
B-Y OUT
19
13
1.5
C314
#
CH:CHIP
3
C300
100p
CH:CHIP
R344
#
L300
:CHIP
0
10µH
:CHIP (0.3)
R-Y
R311
#
:CHIP
Y
R-Y
B-Y
NC
R378 C377
#
:RN-CP # R379
#
:CHIP
R377
#
:CHIP
R-Y OUT
Y
Y
B-Y
R374
#
:CHIP
GND
B-Y
R301
220
:CHIP
5
Q302
#
C
12 11
2
1.6(5.0)
R312
0
:CHIP
R373
#
:CHIP
SECAM REF
Y/C 9V
R315 0 :CHIP
7.2
4.9
5.4
0.1
10
APC FIL
20
Y
9V
9V
C351
2.2
6.3V
F:CHIP
0
FB2
R370
0
:CHIP
R-Y
Q301
#
V-BLK
FSC
RGB-S
CVBS
IDENT
0.8
3.8
19
VIDEO
TEST
18
C374
#
:CHIP
C
Q305
2SC2412K
BUFF
TO A4/5,A5/5_13
TO A4/5,A5/5_14
TO A4/5,A5/5_15
TO A4/5,A5/5_16
6.4
R314
0
:CHIP
C353
2.2
6.3V
F:CHIP
C362
33p
R350 C352
470 0.47
:CHIP 10V
F:CHIP
R351
1.5k
:CHIP
4.43MHZ
17
8
SSCP IN
NC
NC
16
X302
3.58MHz
C356
0.01
B:CHIP
3.58MHZ
15
C355
22
R352
15k
:CHIP
1
2
Q331
2SC2412K
BUFF
R357
#
:CHIP
64
63
62
61
60
59
58
57
56
55
54
53
52
14
9
0
GND
13
CVBS IN
NC
NC
8V
NC
GND
NC
12
Q304
2SC2412K
BUFF
1
R307
#
:CHIP
IC303
TDA8395T/N3
SECAM ID
FB1
1
FSC
11
Q303
#
2
3
R376
#
:CHIP
3
X301
4.43MHz
4
R375
#
:CHIP
9V
0
1.6
(5.0)
8.2
5
4
6
C359 C358 C357
15p 0.47 470p
CH:CHIP 10V CH:CHIP
F:CHIP
C354
C360
0.47
15p
10V
CH:CHIP
F:CHIP
R316
19 18 17 16 15 14 13 12 11 10 9
L301
C376
#
#
:CHIP CH:CHIP
R-Y
R371
#
:CHIP
7
NC
9V
8
NC
R-Y OUT
R349 100 :CHIP
9
5.7 CLOCHE
(2.9)
R348 100
5.7
(2.9)PLL REF
G AV-1
B AV-1
9V
10
B-Y OUT
R347 100
TO A(2/5)
R1
G1
B1
B-Y
R AV-1
R
:CHIP G
:CHIP B
3.4
4.3
FB1
R353 1k :CHIP
STDBY 5V
D301
220
#
5.0 :CHIP
D370
BAS216
DC DROP
TO A(3/5)
FBAV1
C370
2.2
C371
6.3V
0.001
CH:CHIP F:CHIP
5.3
9V
NC
Y
C
9V
C372
0.1
C373
25V
0.22
F:CHIP
16V
B:CHIP
NC
CVBS
FSC
Y
C
Y
C
AFC
VIDEO
CVBS
FSC
SVHS-C IN
SCL
Y
SDA
SCL
TO A(1/5,3/5)
TO A(1/5)
RM-862
FS
DISABLE PJE
SDA
V2
ABL
C2
TO A(1/5)
RM-892
LINK IN
LINK OUT
DIS
AGC
AV LINK IN
AV LINK OUT
TO A(2/5)
RM-892
1
2
1
2
B-SS774.<AEP>-A..-P4-05
KP-41PX1/41PX1K/41PX1R
(5) Schematic Diagram of A (5/5) Board (41PX1/41PX1K)
AGC MONI
LED
STBY
RST
VS
K1
PROT1
3
AGC MONI
RST2
RST
AGC
D2
1SS355TE
SW
3.8
R86
1k
:CHIP AGC DEF
Q81
2SC2412K
SW
R41
#
:CHIP
R96
#
:CHIP
TEXT
RST
YS1
MFB2
R79
220
:CHIP
STDBY 5V
5V
FB2
Q21
2SC2412K
BUFF
:CHIP
1
C1021
# :CHIP
1
R1012
470 :CHIP
TO A4/5,A5/5_17
D1010
MA3030H
PROT
A(5/5)
1
1
C1015
0.22
16V
B:CHIP
STANDBY 5V
0.3
R5
10k
:CHIP
#
#
#
#
#
#
#
9 10 11 12 13 14 15 16 17 18 19 20
8
7
6
5
0.1
BLUE
0
GREEN
0
RED
0
BLANKING
CORQ
3.5
USART
4.8
USART
4.9
ENABLE
CLK
INTQ
TCSQ
XIN
D GND
0
D 5V
NC
IC1001
SDA5273CP
TEXT
RESET
0.1
NC
NC
NC
NC
NC
NC
NC
D GND
D 5V
NC
NC
NC
VREF
3.0
NC
NC
D 5V
CASQ
D GND
A8
R1020
100k
:CHIP
C1020
220p
CH:CHIP
1
1
27
28
29
30
31
32
33
34
35
36
37
38
39
40
41
42
43
(MICRO PROCESSOR)
NC
44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60
Q1001
DTC144EKA
RESET
0.1R1017
0
4.5
VBB
D3
Q1003
#
NC
NC
D2
R1007
#
:CHIP
5V
D GND
A GND
D0
1
CTXTPWR
RGB GND
D1
R1014
4.7k
:CHIP
D GND
0.9
D 5V
WEQ
Q25
2SA1037AK
BUFF
R1015 1
#
:CHIP
CVBS IN
A 5V
RASQ
0
R1016
#
:CHIP
27
A11
0.7
0
Q24
2SA1037AK
BUFF
R1006
#
:CHIP
24
TM
C1014
0.1
C1013
22 R1004 R1005 25V
#
# F:CHIP
:CHIP :CHIP
STDBY 5V
R7
470
:CHIP
D1014
D1015
D1016
D1019
D1020
D1017
D1018
A10
R197
1k
:CHIP
R67 2.2k :CHIP
1
A9
Q23
2SA1037AK
BUFF
TO D(3/3)BOARD
CN1702
D1011
#
R39 10k :CHIP
R66 2.2k :CHIP
R58 3.9k :CHIP
R1021
150
:CHIP
26
25
C1010
0.1
25V
F:CHIP
A0
0.7
0
R1024
680
:CHIP
D1013
#
A1
0.7
MG2
D102
1SS355TE
R196
1k
:CHIP
MB2
R195
1k
:CHIP
1
1
D1012
#
5V
FV
VBLK
C61 # :CHIP
D.PWR
EN
RXD
TXD
Q4
2SC2412K
SW
R8
#
:CHIP
1
R1028
100
C1001 :CHIP
22p
CH:CHIP
A2
TO A(3/5)
FL1001
FZ103N
EMI
5V
R151 100 :CHIP
SPSW
JR1010
0
:CHIP
C62 # :CHIP
1
R9
470
:CHIP
R144 R1002
1.2k 100
:CHIP :CHIP
A3
Q1005
#
C60 # :CHIP
D11
UDZ-5.6B
R47
#
:CHIP
R1003
#
:CHIP
X1001
20.48MHz
R391
#
:CHIP
R1010
0
:CHIP
R194
1k
:CHIP
SB
SB
SG
SR
SG
R150 100 :CHIP
G2
R2
R149 100 :CHIP
Q360
#
AMP
0.1
D.PWR
IR
LINK IN
0.1
C1002
22p
C1011
#
:CHIP
SR
R148 100 :CHIP
D.PWR
EN
RXD
TXD
STANDBY 5V
D12
UDZ-5.6B
0.7
R193
1k
:CHIP
C63 # :CHIP
R60 100 :CHIP
R1001
100
:CHIP
1 CH:CHIP
9V
YM1
YS1
R147 100 :CHIP
R100
220
:CHIP
Q17
2SC2412K
AMP
GPO
0.1
R192
1k
:CHIP
IR
LINK IN
Q5
#
1.9
XOUT
1.7
HS
0.7
VS
0.1
0.1
C64 # :CHIP
1
C43
#
CH:CHIP
R139
1k
:CHIP
C28
0.1
25V
F:CHIP
9V
Q22
2SC2412K
BUFF
0.7
C65 # :CHIP
C22
100p
CH:CHIP
C44
R48
#
#
:CHIP :CHIP
R109
1k R152
:CHIP 3.3k
:CHIP 10.6
8.6
1.8
R313
#
:CHIP
C66 # :CHIP
1
1
Q2
2SA1037AK
BUFF
9V
JR7
#
:CHIP
D26
#
C45
0.1
25V
F:CHIP
9V
1
B2
SCL
R145 100 :CHIP SDA
R146 100 :CHIP
FS
MR2
CN6
13P
WHT
:S-MICRO
1
2
3
4
5
6
7
8
9
10
11
12
13
R44
#
:CHIP
A4
0.7
C41
#
:CHIP
R52
22k 0.6
:CHIP
C27
#
JR391
#
:CHIP
Q20
2SC2412K
BUFF
R46
82k
:CHIP
C42 R45
#
# :CHIP
R43
#
:CHIP
R53
1k
JR5
:CHIP
#
:CHIP
R50
#
:CHIP
C67 # :CHIP
D25 #
R42
#
:CHIP
1
Q15
#
BUFF
5V
12V
SCL
SDA
FS
GND
PJE YM
PJE YS
PJE B
PJE G
PJE R
SPSW
50-60
VBLK
C92
#
:CHIP
C68 # :CHIP
D23 #
D24 #
C29
0.001
B:CHIP C40
# 1
:CHIP
R95
220
:CHIP
C69 # :CHIP
STANDBY 5V
A5
YM1
MCOR
8.3
Q1
2SC2412K AMP 5.6
R51
#
JR6
:CHIP
0
:CHIP
R154
0
:CHIP
COR
R40
#
:CHIP
C91
#
3.1
R78
100 :CHIP
:CHIP
TO A4/5,A5/5_13
TO A4/5,A5/5_14
TO A4/5,A5/5_15
TO A4/5,A5/5_16
R153
100
:CHIP
R94
220 :CHIP
R93
220
:CHIP
STDBY 5V
D22 #
C70 # :CHIP
TO A(3/5)
R61 100 :CHIP
R35 100 :CHIP
R84
0
4
R63 100 :CHIP
Q1002
2SA1037AK AMP
C71 # :CHIP
RGB-S
R62 100 :CHIP
9V
C72 # :CHIP
R82
#
:CHIP
R34 100 :CHIP
AGC MONI
68k
100k
D81 :CHIP
:CHIP
#
2.3
NC
R33 100 :CHIP
9V
COIL
LINK OUT
TRAP
V-BLK
MUTE
RGB-S
HREQ
WR
16:9
AGC DEF
R68 100 :CHIP
R64 100 :CHIP
V SYNC
R87
15k
:CHIP
R69 1k :CHIP
R88 100 :CHIP
R32 100 :CHIP
8.2
R85
R1
1k
:CHIP
R70 100 :CHIP
R65 100 :CHIP
A6
IC4
PST593C-MMP-4P
RESET
R71 100 :CHIP
1
CVBS
2
1
R72 100 :CHIP
R59 100 :CHIP
C17 # :CHIP
R83
100
:CHIP
R73 100 :CHIP
R54 100 :CHIP
1
1
R74 100 :CHIP
COIL
LINK OUT
TRAP
V-BLK
MUTE
RGB-S
HREQ
WR
16:9
AGC DEF
9
8
7
6
5
4
3
2
1
68
67
66
65
64
63
62
61
RST
4
1
C16 # :CHIP
R77 # :CHIP
R76 100 :CHIP
MFB2
R31 4.7k :CHIP
C3
33p CH:CHIP
CORQ
R30 4.7k :CHIP
LED
LED
STBY
RST
VS
K1
PROT1
23
1
R1022 150 :CHIP
R29 4.7k :CHIP
5.0
GND
R49 100 :CHIP
C25 47 16V
1
R1023 150 :CHIP
C13 # :CHIP
SDA
R92
100 :CHIP
C14 # F:CHIP
STDBY
5V
DIS
R6 4.7k :RN-CP
SCL
C15 470p CH:CHIP
OUT
D16 1SS355TE PROT
C1 0.1 25V F:CHIP
1
FB-2
MB2
MG2
MR2
MCOR
DIS
DIS
C12 # :CHIP
R91
100 :CHIP
IC2
M24C32-MN6T
NVM
1
R21 100 :CHIP
A7
SDA
4.5
R20 100 :CHIP
R22 # :CHIP
R26 # :CHIP
R28 10k :CHIP
1
R19 # :CHIP
SDA
SCL
26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10
6
GND
CTXTPWR
SDA
SCL
CTXTPWR
R1026 100 :CHIP
R25 4.7k :CHIP
R18 # :CHIP
TEXT
R24 4.7k :CHIP
HS
VS
STDBY 5V
C2 47 16V
C24
C4
0.001
33p
CH:CHIP CH:CHIP
X1 11.5MHz
R4 33 :CHIP
R75 # :CHIP
EN
RXD
TXD
7
SCL
4.4
5
2
3
A2
VS
0
5.0
HS/SSCP
0
VS
5.0
P0.0
4.5
P0.1
4.4
CTXTPWR
0
FB-2
0.3
P0.4
2.5
LC OUT
P0.5
C26
47
16V
R90
#
:CHIP
WR
4
TEST
4.9
HS
C23 # :CHIP
C19 0.0047 B:CHIP
LC IN
R1027 100 :CHIP
C11 # CH:CHIP
STDBY 5V
A1
L10 # :CHIP
STANDBY 5V
P1.0
1.9
P1.1
5.0
P1.2
5.0
P1.3
0
P1.4
0
P1.5
0
P1.6
5.0
P1.7
4.9
P3.0
0
P3.1
0
C6 # :CHIP
D14 #
61
62
63
64
65
66
67
68
69
70
71
72
73
74
75
76
77
78
79
80
A0
C10 # CH:CHIP
C18
0.1
25V
F:CHIP
C90
0.1
25V
F:CHIP
8
1
STANDBY 5V
1
GND
IC1
SDA30C263-GEG
MICRO PROCESSOR
GND
R2 100 :CHIP
3
9 10 11 12 13
VS
8
STANDBY 5V
7
A7
A6
A5
A4
A3
A2
A1
A0
D0
6
C7 # :CHIP
2
R17 # :CHIP
5
STANDBY 5V
4.1
4.0
1
R16 # :CHIP
HS
HS
VS
2.5
4.1
4.0
ALE
RST2
R3 100 :CHIP
1.6
1.1
4.9
P3.6
4.9
P3.5
2.8
P3.4
5.0
P3.3
4.9
P3.2
4.5
R38 # :CHIP
FB-2
CORQ
A18
A16
A17
P3.7
R37 # :CHIP
CVBS IN
R36 # :CHIP
D2
D1
1.2
1
IREF
1
A 5V
1
1.7
0.3
0.3
1
FIL2SLC
1
P4.1
0
A16
3.2
P4.0
0.5
ALE
2.6
RST
5.0
XTAL1
2.5
XTAL2
2.9
2.5
3.4
D2
2.5
D3
2.3
RED OUT
0
GREEN OUT
0
BLUE OUT
0
BLANKING
5.0
COR
0
D4
FIL1SLC
R57 # :CHIP
3.2
D0
2.7
D6
3.3
A0
3.3
D7
3.5
A1
3.1
A2
2.9
A10
1.8
A3
2.7
A4
3.1
A11
1.2
A5
3.1
A9
2.5
A6
3.0
A8
2.1
A7
1.9
A13
3.0
A12
2.5
A14
3.1
A15
3.0
D5
R15 # :CHIP
D1
FIL3SLC
D1
D1
D4
D2
D3
A GND
D2
2.5
A12
Q10
#
0.1
3.3
P0.7
4.5
P2.3
0.1
P2.2
5.0
P2.1
0.3
P2.0
1.4
3.2
3.0
2.5
A15
Q11
#
P0.6
GND
A16
Q12
#
R12 # :CHIP
MB2
60 59 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41
STDBY 5V
R11 # :CHIP
R14 # :CHIP
R56 # :CHIP
TEXT
IC3
M27C2001-12C1-PZ01
PROGRAM
STDBY 5V
D6
D5
D4
D3
20
19
18
17
16
15
14
HFBP
D7
CE
OE
A10
3.5
3.3
D5
3.2
D4
3.4
D3
2.3
0.5
P
A7
A18
A16
A17
ALE
RST2
1.8
A14
A16
A15
A12
D6
A17
1.9
3.0
A5
3.1
A4
3.1
A3
2.7
A2
2.9
A1
3.1
A0
3.3
D0
2.7
CN3
#
:S-MICRO
R55 # :CHIP
MG2
A6
30
31
32
1
2
3
4
3.1
A13
3.0
A8
2.1
A9
2.5
A11
1.2
29 28 27 26 25 24 23 22 21
1
R23
#
:CHIP
1
40
39
38
37
36
35
34
33
32
31
30
29
28
27
26
25
24
23
22
21
R13 # :CHIP
STDBY 5V
1
2
3
4
5
6
7
RM-892
R10 # :CHIP
MR2
C8
0.1
25V
F:CHIP
STDBY 5V
GND
A18
A16
A17
ALE
RESET OUT
RM-892
D5
D0
D6
A0
D7
A1
A2
A10
A3
A4
A11
A5
A9
A6
A8
A7
A13
A12
A14
A15
D7
A10
A14
A13
A8
A9
A11
A17
STDBY 5V
K
B-SS774.<AEP>-A..-P5-05
– 59 –
RM-862
KP-41PX1/41PX1K/41PX1R
K
• A (1/5) BOARD WAVEFORMS (41PX1/41PX1K)
1
PAL/NTSC
1.1 Vp-p (H)
1
SECAM
1.2 Vp-p (H)
2
PAL/NTSC
2
1.6 Vp-p (H)
SECAM
1.8 Vp-p (H)
3
PAL/NTSC
0.9 Vp-p (H)
3
SECAM
1.0 Vp-p (H)
• A (1/5) BOARD
CXD2064Q
4
RM-892
IC103 (41PX1/41PX1K)
VERTICAL
BORDER EMPHA
1.2 Vp-p (H)
• A (2/5) BOARD WAVEFORM (41PX1/41PX1K)
ADIN 2
NTSC:1H
PAL :2H
A/D
NTSC:1H
PAL :2H
5
+
—
DL
CLPO 1
2.5 Vp-p
(18.432 MHz)
+
—
D/A
9 AYO
D/A
7 ACO
CLAMP
ADAPTIVE
FILTER OP
• A (3/5) BOARD WAVEFORMS (41PX1/41PX1K)
6
PAL/NTSC
6
SECAM
7
PAL/NTSC
7
LOGICAL OPERATION
SECAM
4fsc
0.4 Vp-p (H)
0.4 Vp-p (H)
0.2 Vp-p (H)
0.2 Vp-p (H)
• A (4/5) BOARD WAVEFORMS (41PX1/41PX1K)
VCO
8
SECAM
1.3 Vp-p (H)
!\
9
SECAM
1.7 Vp-p (H)
!;
2.5 Vp-p (H)
@-
PAL/NTSC
SECAM
1.5 Vp-p (H)
SECAM
!1.3 Vp-p (H)
!,
!'
2.8 Vp-p (H)
@-
0
1.1 Vp-p (V)
1.1 Vp-p (V)
!=
![
1.0 Vp-p (H)
!.
PAL/NTSC
0.8 Vp-p (H)
1.3 Vp-p (H)
!.
1/4
!]
SECAM
0.9 Vp-p (H)
SW
1/2
3.4 Vp-p (H)
42
44
39
37
38
CPO
VCV
PLSL
FIN
CKSL
@/
• A (3/5) BOARD
CXA1315M
1.2 Vp-p (H)
@=
IC206 (41PX1/41PX1K)
13
12
11
2
LEVEL CONVERTION
1.1 Vp-p (H)
1.5 Vp-p (H)
SDA 14
@[
5.5 Vp-p
(11.5 MHz)
@]
2.1 Vp-p (H)
LATCH
1
9
@]
SECAM
2.9 Vp-p (H)
LEVEL
CONVERTION
SCL 15
@\
2.3 Vp-p (20 MHz)
@;
6.4 Vp-p (H)
2
I C
@'
DECODER
POWER
ON
RESET
3.2 Vp-p (V)
—
+
Vcc 16
8
– 60 –
LATCH
LATCH
LATCH
LATCH
LATCH
DAC
DAC
DAC
DAC
DAC
AMP
AMP
AMP
AMP
AMP
3
4
5
6
7
Vcc
REG
10
LEVEL CONVERTION
6.8 Vp-p (H)
• A (5/5) BOARD WAVEFORMS (41PX1/41PX1K)
PAL/NTSC
SW
PHASE
COMPARATOR
RM-892
RM-862
KP-41PX1/41PX1K/41PX1R
K
IC4003 (41PX1/41PX1K)
VSFIL
VSIN
HSIN
AFCFIL
CERA
AFCPIN/HOFF
L2FIL
48
BLHOLD
56
43 YOUT1
6dB
DCTRAN
36 YIN1
VM
8
V3 15
SCL
V2
40 VOUT1
6dB
51 50
49
54
52
45
46
47
40
41
38
39
SDA
1
SYNCOUT
TV 47
V1
RM-892
RM-862
• A (4/5) BOARD IC301 (41PX1/41PX1K)
CXA2076Q
EXT SYNC IN
• A (3/5) BOARD
CXA2089Q
RM-892
2Vp-p
36 DVCC1
V4 23
42 TRAP1
H SYNC
SEP
VM OFF
6dB
32fH
VCO
PHASE
DET
1/32
PHASE
SHIFT
44 DVCC2
42 DGND
38 CIN1
6dB
33 VOUT2
CVIN
6dB
YIN
55
CIN
57
ACC
TOT
DCOL
γ
fsc B-Y
62 61
64
1
3
4
5
IREF
APCFIL
X358
FSCOUT
SECAMREF
– (R-Y) OUT
– (B-Y) OUT
YOUT
X443
60
6
7
8
HV
COMP
15
16 17 18 19
24 GOUT
27 IKIN
AKB
ABL
CLP
11 12 13 14
BLK
26 BOUT
DIG
CLP
COL
43
41 ROUT1
33 E-WOUT
22 ROUT
CUT
OFF
GB
DRV
BRT
29
28
AKB OFF
EHT H. V
21 23 25
RSH
HUE
COLOR
& AXIS
fsc R-Y
XTAL
6dB
LV4 22
OSD
MIX
ABLIN/VCOMP
VCO
DEM
AXIS
6dB
0dB
GB DRV
HUE
IREF
39 LOUT1
BRT
ABLFIL
9
PIC
B2IN
SGND2
YS/YM
SW
G2IN
35 MUTE
2
YS
SW
Y/C
MIX
fsc
ID
YM
S-3 21
SGND1
PAL
ID
R2IN
25 ADR
20
D-COL γ
WIDE
PARABORA
GEN.
GB CUT
YS2
S-2 14
SVCC2
31 VD–OUT/VRROT
VLIN, SCORR
PIC
B1IN
27 SDA
PAL/
NTSC
32 VD+OUT/VPROT
DEM
59
APC
35 SAWOSC
WIDE
SAWTOOTH
GEN.
COUNT DOWN
525/625
YS1 OFF
G1IN
Logic
7
SVCC1
30 VTIM
VPOSI, VOFF,
VSIZE
INTERLACE
INTERLACE
KILLER
DET
YS1
26 SCL
LV3 16
SCP BGR/BGF
C MODE
GATE
R1IN
S2-3 20
9
50/60 ID
D PIC
PRE/OVER
COLOR SW
28 DC OUT
LTV 46
10 SCPOUT
SAMD
CASTLE
34 VAGCSH
DC
TRAN
CLP
– (B-Y) IN
6
LV2
TOT
SHARP
NESS
H POSI
AFC
V FREQ
D PIC
34 Vcc
S2-2 13
2
TRAP F0
ACC
DET
37 BIAS
BIAS
LV1
TRAP
SUB COLOR
44 GND
C3 19
S-1
37 HD OUT
29 COUT2
C2 12
S2-1
DL
AGING
YRET
5
SUB
CONT
VIDEO
SW
DC
TRAN
SHARP
– (R-Y) IN
C1
53
31 YOUT2
6dB
TRAP OFF DL
SUB CONT
Y3 17
H. DRIVE
2fH
3
Y2 10
GATE
CV/YC
BSH
45 COUT1
PHASE
DET
GSH
6dB
Y1
V SYNC
SEP
EXT
SYNC
0dB
RTV 48
RV1
6dB
30 LOUT2
6dB
32 ROUT2
• A (4/5) BOARD
TDA4665T
4
RV2 11
IC302 (41PX1/41PX1K)
RV3 18
RV4 24
• A (4/5) BOARD IC303 (41PX1/41PX1K)
TDA8395T
DIGITAL
SUPPLY
VP2
16 +
—(R-Y)IN
1
N.C
2
DGND
3
SIGNAL
CLAMPING
LINE
MEMORY
SAMPLE
ANDHOLD
LP
addition
stages
NC
6
CVBS
LINE
MEMORY
SAMPLE
ANDHOLD
6
BANDGAP
TUNING
TUNING
20
ACC
CLOCHE
FILTER
PLL
DE-EMPHASIS
INTERFACE
CONTROL
IDENTIFICATION
OUTPUT
STAGE
12 +
—(B-Y)OUT
LP
2
11 +
—(R-Y)OUT
3MHz shifting clock
FREQUENCY
PHASE
DETECTOR
DIVIDER
BY 192
6MHz
CCO
DIVIDER
BY 2
ANALOG
SUPPLY
8
– 61 –
1
9
11 – (R-Y)
12 – (B-Y)
10 A GND
7
LP
GND
GND TEST
13 NC
SANDCASTLE
DETECTOR
IC
5
output
buffers
SIGNAL
CLAMPING
5
VP
10
14 +
—(B-Y)IN
4
PULSE IN
PLLREF
9
15 NC
pre-amplifiers
GND
CLOCHE
19
VP1
IDENT
SAND
KP-41PX1/41PX1K/41PX1R
K
A
RM-892
µ COM, Y/C JUNGLE, TUNER,
AUDIO/VIDEO PROCESS
• A BOARD SEMICONDUCTOR LOCATION
(Component Side)
— A BOARD (Component Side) — (41PX1/41PX1K)
1
2
3
4
5
IC1
IC2
IC3
IC103
IC201
IC202
IC206
IC301
IC303
IC1001
IC4003
A
Q300
Q308
Q330
Q331
Q333
Q401
Q402
Q403
Q2412
IC
A-1
A-1
A-1
B-3
C-5
B-4
B-3
B-2
B-1
B-1
A-4
B
C
B-1
B-1
B-1
B-1
A-5
A-2
A-2
A-2
A-2
A-3
A-3
B-3
B-3
A-5
A-5
A-4
B-4
B-4
B-4
C-5
C-4
C-4
C-3
C-3
A-5
C-4
2
2
2
2
2
2
2
2
2
DIODE
TRANSISTOR
Q1
Q2
Q4
Q17
Q18
Q21
Q22
Q24
Q25
Q101
Q102
Q104
Q106
Q111
Q114
Q117
Q118
Q203
Q204
Q207
Q208
Q209
Q212
Q213
Q214
Q215
B-2
B-2
B-2
B-3
B-2
A-3
A-3
A-3
A-3
*
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
!\
2
2
2
2
2
2
2
2
2
D202
D210
D216
D217
D218
D220
D221
D223
D224
D225
D226
D251
D303
D304
D370
D401
D402
D4007
D4010
A-5
C-4
A-5
A-5
A-5
A-5
A-5
B-5
B-5
B-5
B-5
B-4
B-2
C-2
B-1
A-3
A-3
B-4
B-4
*
3
3
3
3
3
3
3
3
3
3
3
3
3
3
3
3
3
3
3
CRYSTAL
X1
X201
X301
X302
X303
X1001
A-1
B-4
A-2
A-2
B-3
B-1
*: Refer to Terminal name of semiconductors in silk
screen printed circuit (see page 54)
– 62 –
RM-892
RM-862
KP-41PX1/41PX1K/41PX1R
K
A
µ COM, Y/C JUNGLE, TUNER,
AUDIO/VIDEO PROCESS
• A BOARD SEMICONDUCTOR LOCATION
(Conductor Side)
— A BOARD (Conductor Side) — (41PX1/41PX1K)
1
2
3
4
5
Q1002
Q2414
Q4003
Q4007
IC
IC3
IC4
IC204
IC205
IC302
A-5
A-5
C-2
B-2
B-4
Q20
Q23
Q81
Q103
Q105
Q107
Q108
Q109
Q110
Q112
Q113
Q115
Q116
Q120
Q121
Q122
Q124
Q125
Q130
Q201
Q205
Q206
Q211
Q216
Q304
Q305
Q306
Q307
Q309
Q334
Q335
Q404
Q405
Q1001
B
C
A-3
A-3
A-4
B-3
B-3
B-3
B-2
B-3
A-1
A-1
B-5
B-3
B-3
A-2
A-3
A-3
A-2
B-2
A-2
C-1
C-2
C-2
C-2
C-2
A-4
A-5
B-4
B-3
B-4
B-4
B-4
A-3
A-3
B-5
1
1
1
1
DIODE
TRANSISTOR
A
B-5
A-3
A-2
A-2
*
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
D2
D11
D12
D16
D101
D102
D201
D203
D204
D205
D206
D207
D208
D209
D211
D212
D213
D214
D215
D320
D1010
D4004
D4006
D4008
D4009
D4011
D4015
A-4
A-4
A-4
A-4
A-1
A-3
C-1
C-1
B-2
B-2
B-2
B-2
C-1
B-1
C-1
C-2
C-2
B-2
B-2
B-4
B-5
A-2
B-2
B-2
A-2
B-2
B-1
*
3
3
3
3
3
3
3
3
3
3
3
3
3
3
3
3
3
3
3
3
4
3
3
3
3
3
3
CRYSTAL
X1
X201
X301
X302
X303
X1001
A-4
B-2
B-4
B-4
B-3
B-5
*: Refer to Terminal name of semiconductors in silk
screen printed circuit (see page 54)
– 63 –
RM-892
RM-892
RM-862
KP-41PX1/41PX1K/41PX1R
K
RM-892
RM-892
GND
+5V
AM
QSS
VIDEO
NC
R280
1k
:CHIP
TP2
#
R101
3.3k
:CHIP
D220
1SS355
R104
10k
:CHIP
D101
MA8330
TP1
#
FL101
FZ103N
AGC
0
Q18
DTA144EKA
INV
Q214
DTC144EKA
INV
C112
0.001
CH:CHIP
C113
47
16V
R106
10k
:CHIP
Q112
2SC2412K
V-BUFF
Q113
2SA1037AK
INV
R116
4.7k
:CHIP 2.3
R111
150
:CHIP
4.1
2.3
9V
Q114
2SA1037AK
INV
Q120
2SC2412K
BUFF
R118
8.2k
:CHIP
4.1
D216
UDZ-5.6B
C103
22
D217
UDZ-5.6B
R105
470k
:CHIP
C110
47
16V
R110
10k
:CHIP
R112
150
:CHIP
R114
150
:CHIP
1.9
R119
220
:CHIP
R115
330
:CHIP
C101 C102
0.1
220
25V
16V
F:CHIP
33V
C201
0.1
25V
B:CHIP
R107
0
:CHIP
VIDEO
C115
330p
CH:CHIP
5V
R117 R108
2.2k
#
:CHIP :CHIP
4.5
C121
68p
CH:CHIP
R122
470
:CHIP
R124
1k
:CHIP
C123
68p
CH:CHIP
L120
8.2µH
:EL0606
R121
10k
:CHIP
C124
0.1
25V
F:CHIP
4.1
R123
180
:CHIP
R131
10k
:CHIP
R128
270
:CHIP
R125
22k
:CHIP
C122
680p
CH:CHIP
R129
330
:CHIP
R126
C104
100p
100
:CHIP CH:CHIP
CF120
6.5MHz
AUDIO L/R
R130
3.3k
:CHIP
Q124
2SC2142K
BUFF
8.3
R134
10
:CHIP 5.4
R132
100
:CHIP 1.6
3.5
Q130
2SA1037AK
BUFF
R133
470
:CHIP
8.3
4.1
L102
5.6µH :EL0606
L122
8.2µH
:EL0606
L121
1µH
:EL0606
Q121
2SC2142K
BUFF
5V
R127
22k
:CHIP
C120
100p 5.2
CH:CHIP
1.8
1.7
R113
10
:CHIP 2.6
Q122
2SC2412K
BUFF
R120
6.8k
:CHIP
1.7
D221
1SS355
2.6
R103
100
:CHIP
R102
100
:CHIP
Q110
Q111
2SC2412K 2SA1037AK
V-BUFF
V-BUFF
L111
0
:CHIP
R135
680
:CHIP
R136
220
:CHIP
R137
1k
:CHIP5.4
4.7
AUDIO L/R
R138
470
:CHIP
AUDIO L/R
AUDIO L/R
VIDEO
D218
UDZ-5.6B
5V
SCL
SDA
+9V
SDA
AUDIO L/R
SCL
MONI
33V
AUDIO L/R
9V
9V
R206
220
:CHIP
C204
0.1
25V
F:CHIP
7.3
R205
39k
:CHIP
C203
330
16V
D228
DTZ-6.8B
Q217
2SC2412K
BUFF
R204
100
:CHIP
FS
R258
47
:CHIP
DISABLE PJE
DIS
4.3
C202
0.1
25V
B:CHIP
R203
100
:CHIP
AGC MONI
R210
47
:CHIP
GND
SYNC IN TV
3.2
SYNC
4.6
SDA
4.5
SCL
4.2
ADR
GND
CVBS OUT
24 23 22 21 20 19 18 17
R200
1k
:CHIP
V1
R249
10
:CHIP
Y IN AV-2
V3
C205
22
TO AE1/5,AE2/5_1
1
4.2
GND
C IN AV-2
4.3
MODE
0.2
Y IN AV-3
4.2
MODE
0.2
C IN AV-3
4.3
GND
25 TV IN
GND
4.3
26 9V
CVBS OUT AV-2
4.3
27 CVBS IN AV-1 IC201
GND
4.3
CXA2040AQ-T4
28 GND
CVBS OUT
VIDEO SW
4.3
29 CVBS IN AV-2
GND
4.3
30 GND
SVHS-Y OUT
4.3
31 CVBS IN AV-3
GND
4.3
SVHS-C OUT
32 BIAS
4.3
4.3
C207 10
V2
TO AE(4/5)
MONI
9V
VIDEO
U-PC DISABLE
3.7
R259
470
:CHIP
2
3
4
5
6
7
7.3
16
15
14
13
12
11
10
9
Q202
2SC2412K
BUFF
SDA
C206
0.001
CH:CHIP
4.3
3.7
V 2
C2
S1
Y3
S2
C3
Y2
TO AE(3/5,4/5)
SCL
D227
DTZ-6.8B
VIDEO
VIDEO
R208
470
:CHIP
1
SDA
SCL
CVBS OUT
TO AE(4/5)
CVBS
SVHS-Y
+9V
SVHS-C
Q201
2SC2412K
BUFF
4.2
VIDEO
VIDEO
8
TO AE1/5,AE3/5_7
3.6
C316
33p
CH:CHIP
R209
1k
:CHIP
AUDIO L/R
TO AE1/5,AE2/5_6
(TUNER,VIDEO SW)
TO AE1/5,AE3/5_8
TO AE1/5,AE2/5_5
AE (1/5)
AUDIO L/R
AUDIO MONO
TO AE1/5,AE2/5_2
TO AE1/5,AE2/5_4
DIS
2.6
CPU
TO AE1/5,AE2/5_3
TO G BOARD
CN6003
+9V
5V
AUDIO L/R
1
VIDEO
AUDIO L/R
JR1
0
:CHIP
SCL
SDA
FS
GND
5V
EMI
CN101
1P
:FASTON
AUDIO MONO
1
2
3
4
5
AS
SCL
SDA
+33V
TU101
TVF01-FR
AGC
CN2
5P
WHT
FOR CHECK
GND
SCL
SDA
DISABLE
AGC
(6) Schematic Diagram of AE (1/5) Board (41PX1R)
B-SS510.<AEP>-AE.-P1-05
– 64 –
RM-862
KP-41PX1/41PX1K/41PX1R
K
(7) Schematic Diagram of AE (2/5) Board (41PX1R)
RM-892
RM-892
FB AV-1
TO
AE(4/5)
R AV-1
G AV-1
B AV-1
AE (2/5)
(AUDIO PROCESSOR)
R270
R271
R272
R273
D223
D224
D225
D226
75
75
75
75
UDZ-9.1B :CHIP UDZ-9.1B :CHIP UDZ-9.1B :CHIP UDZ-9.1B :CHIP
TO AE1/5,AE2/5_1
V1
R212
75
:CHIP
C211
22
R211
220
:CHIP
R227
75
:CHIP
C220
22
R226
220
:CHIP
D208
UDZ-9.1B
C208
22
R243
220
:CHIP
D222
UDZ-9.1B
R213
75
:CHIP
D202
UDZ-9.1B
R228
75
:CHIP
D209
UDZ-9.1B
C221 R229
2.2
220
16V :CHIP
F:CHIP
D210
UDZ-9.1B
D201
UDZ-9.1B
TO AE1/5,AE2/5_2
CN201
DUAL SCART
TO AE1/5,AE2/5_6
TO AE1/5,AE2/5_5
AUDIO L/R
AUDIO L/R
AUDIO MONO
TO AE1/5,AE2/5_4
TO AE1/5,AE2/5_3
EMI
S1
R214
100
:CHIP
C253
100p
CH:CHIP
D203
UDZ-9.1B
5V
FL202
FZ103N
2
2
2
2
X201
18.432
D211
UDZ-9.1B
1.6
1.6
0.7
C255
100p
CH:CHIP
2
C251
4p
CH:CHIP
2.3
2.3
S2
R232
100
:CHIP
C252
4p
CH:CHIP
2
2
C217
0.01
B:CHIP
C216 R220
47
0
16V :CHIP
D206
UDZ-9.1B
L 2
R239 R238
390
47k
:CHIP :CHIP
C227
0.01
B:CHIP
C226
47
16V
R237
0
:CHIP
R3
L3
D214
UDZ-9.1B
C215
470p
CH:CHIP
C214 R218
1
100
16V :CHIP
F:CHIP
3.8
3.9
C261
470p
CH:CHIP
C262
470p
CH:CHIP
R1
R219
470k
:CHIP
3.9
3.9
D205
UDZ-9.1B
C263
0.1
25V
F:CHIP
R2
R236
470k
:CHIP
C225
470p
CH:CHIP
C224 R235
1
100
16V :CHIP
F:CHIP
C264
3.3
D213
UDZ-9.1B
D251
BAS216 C265
10
R225
47k
:CHIP
C219
0.01
B:CHIP
C218 R223
47
0
16V :CHIP
C269
C270
390p
390p
CH:CHIP CH:CHIP
R241
47k
:CHIP
C229
0.01
B:CHIP
C228 R240
47
0
16V :CHIP
FL203
FZ103N
D215
UDZ-9.1B
C268
0.1
25V
F:CHIP
AUDIO L
C267
22
FL201
FZ103N
2
EMI
5V
R265
4.7k
:CHIP
2
IC205
PST593C-MMP-4P
RESET
C282 C281
0.1
22
25V
F:CHIP
4.7
2
C283
0.01
B:CHIP
2
HP R
HP L
9V
C276
1
16V
F:CHIP
R 2
R242
390
:CHIP
C279
22
C280
0.1 25V F:CHIP
4.7
C266
10
EMI
D207
UDZ-9.1B
2
R252 100 :CHIP
R251 100 :CHIP
C275
1
16V
F:CHIP
44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60
9V
R 1
R224
390
:CHIP
3.9
3.9
3.9
IC202
MSP3410D-PS-B4
AUDIO PROCESSOR
4
R221 R222
390
47k
:CHIP :CHIP
R1
L1
R254 100 :CHIP
R253 100 :CHIP
3
L 1
R2
L2
R256 100 :CHIP
R255 100 :CHIP
1
D212
UDZ-9.1B
8
7
6
5
I2S-DA IN 4
S-DA IN 3
NC 2
S-ID 1
S-CL 68
D 5V 67
D GND 66
S-DA OUT 65
FRAME 64
N-CL 63
N-DA 62
RESET 61
2
C222 R233
1
100
16V :CHIP
F:CHIP
SCL
SDA
SCL 9
0.2
0.2
C223
470p
CH:CHIP
4.5
4.5
SDA
2.4
I2S-CLK
2.4
I2S-WS
2.5
I2S-DA2.5
OUT
2
0
L2
R234
470k
:CHIP
27 A GND
28 MONO IN(AM)
29 VREF
30 RIN AV-2
31 LIN AV-2
32 A GND
33 RIN AV-1
34 LIN AV-1
35 A GND
36 RIN AV-3
37 LIN AV-3
38 A GND
39 A GND (B)
40 A GND (C)
41 A GND (C)
42 VREF(A)
3.8
43 A GND
ROUT HP
2
3.9
2.7
3.9
3.9
0
AUDIO
4.0
D204
UDZ-9.1B
C259
0.47
25V
MONO F:CHIP
4.0
C260
0.1
C258 25V
10 F:CHIP
4.0
4.0
C212 R216
1
100
16V :CHIP
F:CHIP
ANA-IN1
C213
470p
CH:CHIP
A 5V
26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 2
L1
R217
470k
:CHIP
C273
C274
0.001 0.001
CH:CHIP CH:CHIP
AUDIO R
C277
2.2
16V
F:CHIP
R281
47k
:CHIP
4.5
Q203
2SC2412K
BUFF
AUDIO R
3.8
SP R
AUDIO R
V3
CVBS AV-3
C272
0.001
CH:CHIP
C230 R244
0
220
:CHIP :CHIP
TO AE(4/5)
C278
2.2
16V
F:CHIP
C210 R201
0
220
:CHIP :CHIP
AUDIO R AV-3
R284
47k
:CHIP
4.4
Q204
2SC2412K
BUFF
AUDIO L
3.8
R202
C209 220
10 :CHIP
AUDIO L
C271
0.001
CH:CHIP
L3
R3
JR208
0
:CHIP
R285
68k
:CHIP
SP L
R286
4.7k
:CHIP
R 2
AUDIO L AV-3
TO AE(4/5)
9V
C3
C AV-3
TO AE(4/5)
R283
4.7k
:CHIP
R282
68k
:CHIP
Y3
Y AV-3
L 1
R 1
AUDIO L OUT
AUDIO L OUT
AUDIO R IN
AUDIO R IN
AUDIO R OUT
AUDIO R OUT
C254
47p
CH:CHIP
C256
0.1
25V
F:CHIP
4.0
4.0
GND
GND
GND
GND
C257
22
ANA-IN
ANA-IN2
TEST
XTAL
XTAL
D GND
AUDIO-CLK
NC
D GND
D GND
D-CTR1
D-CTR0
ADR SEL
STDBY
D GND
AUDIO L IN
AUDIO L IN
C2
R230
75
:CHIP
8V
HP-CAP
LOUT AV-2
ROUT AV-2
VREF1
LOUT AV-1
ROUT AV-1
A GND
AV-CAP
AV-CAP
TEST
LOUT SP
ROUT SP
VREF2
LOUT HP
2
JR201
0
:CHIP
SP-CAP
2/
V 2
7.1
(AV2)
Y2
7.2
1/
V2
B21
A21
B20
A20
B19
A19
B18
A18
B17
A17
B16
A16
B15
A15
B14
A14
B13
A13
B12
A12
B11
A11
B10
A10
B9
A9
B8
A8
B7
A7
B6
A6
B5
A5
B4
A4
B3
A3
B2
A2
B1
A1
L 2
(AV1)
GND
GND
CVBS IN
CVBS/Y IN
CVBS OUT
CVBS OUT
GND
GND
GND
GND
BLANKING
NC
RED IN
SVHS-C IN
GND
GND
GND
GND
NC
NC
GREEN IN
NC
NC
NC
GND
GND
MODE
MODE
BLUE IN
NC
R OUT
TO AE(4/5)
JR209
0
:CHIP
L OUT
B-SS510.<AEP>-AE.-P2-05
– 65 –
RM-862
KP-41PX1/41PX1K/41PX1R
(8) Schematic Diagram of AE (3/5) Board (41PX1R)
K
RM-892
PAL/NT
5V
FB101
HM102
:CHIP
C125
0.01
B:CHIP
C126
100
16V
C127
0.01
B:CHIP
R176
C136
0
0.01
:CHIP B:CHIP
5V
R177
1k
:CHIP
R164
47k
:CHIP
R198
220
:CHIP
2.0
R199
220
:CHIP
R168
5.6k
:CHIP
R167
560
:CHIP
4.0
2.2
2.8
FL102
1
2
3
1.2
Q104
2SC2412K
BUFF
2.9
VIDEO
2.3
R165
47k
:CHIP
0
1.1
0.6
VIDEO LPF
6
4
220
:CHIP
R169
1k
:CHIP
C139
0.01
B:CHIP
C146
0.01
B:CHIP
R170
100
:CHIP
3
C144 R175
0.01 1.2k
B:CHIP :RN-CP
VIDEO
A.5V
4.5
4
VIDEO
FB103
HM102
:CHIP
1.2
2.3
5V
C145
0.01
B:CHIP
R174
4.3k
:RN-CP
R171
100k
:CHIP
C138
10
1.4
Q103
2SA1037AK
R163 BUFF
Q106
2SA1037AK
CLAMP
5
Y
C152
0.1
25V
B:CHIP
C150
0.01
B:CHIP
C149
0.01
B:CHIP
FB104
HM102
:CHIP
TO AE1/5,AE3/5_8
41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64
C137
47
16V
VIDEO
TO AE1/5,AE3/5_7
0.5
IC103
CXD2044Q-TL
DIGITAL COMB FILTER
C147
0.01
B:CHIP
R179
1.8k
:RN-CP
1.5
1.5
CVG
1.1
2.0
0.8
2.6
R172
4.7k
:CHIP
Q105
2SC2412K
CLAMP
C133
4.7
R173
100
:CHIP
0.9
C135
0.01
B:CHIP
5V
YVG
YVRF
YIRF
YVSS
VB
CVDD
XACO
ACO
5
2.3
C134
0.01
B:CHIP
2.6
1.5
1.5
Q116
2SA1037AK R166
220
BUFF :CHIP
4
0.7
R162
330k
:CHIP
FB102
HM102
:CHIP
C1
C2
C3
C4
C5
C6
C7
C8
XYOE
TEST
TEST
VDD2
VSS2
Y1
Y2
Y3
Y4
Y5
Y6
Y7
Y8
CVSS
CIRF
CVRF
25
26
27
28
29
30
31
32
33
34
35
36
37
38
39
40
R161
220
:CHIP
3
7
6
C132
0.01
B:CHIP
2
2.0
2.4
R178
0
:CHIP
TOM1 80
BPF 79
TOM3 78
TMD1 77
PMN 76
INIT 75
DIR 74
VDD3 73
VSS3 72
YOT 71
NTPL 70
RAT1 69
APCN 68
XCOE 67
TEST 66
TEST 65
5
V18
V17
V16
V15
V14
V13
V12
V11
ADCO
INSL
OCLK
VSS1
VDD1
CLKO
MCK
ADCK
CLP1
XCPON
VSS4
ICP
CRV
RB
GR
ADVS
ADIN
ADDVD
RT
VDD4
YVDD
XAYO
AYO
1
2
3
6
8
IC102
NJM2240M(TE2)
4FSC-PLL
FSC
Q115
2SC2412K
BUFF
3.4
7
4
8
1
TO AE(4/5)
C131
47
16V
24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9
Q101
2SC2412K
INV
Q102 4.6
2SA1037AK
4FSC.ADJ
C130
0.01
B:CHIP
2.9
0.6
R160
3.3k
:CHIP
4.5
R158
10k
:CHIP
FSC
LPF
E
4FSC
R156 4.6
47k
:CHIP
R
5V
C
R157
47k
:CHIP
C129
6p
CH:CHIP
3.0
C128
0.01
B:CHIP
R159
1k
:CHIP
0.5
4.7
D.5V
R180
C155
0.01
2.2k
:RN-CP B:CHIP
C153
0.1
25V
B:CHIP
C
R181
4.7k
:RN-CP
5V
C148
100
16V
C151
0.01
B:CHIP
C154
0.01
B:CHIP
R182
220
:RN-CP
R184
2.2k
:CHIP
Y
R186
5.6k
:CHIP
FL103
R187
1k
:CHIP
R183
220
:RN-CP
R188
2.2k
:CHIP
Y
R189
560
:CHIP
FL104
R190
5.6k
:CHIP
R191
2.2k
:CHIP
C
C
1.3
R185
560
:CHIP
1
0.7
2
3
Q109
2SA1037AK
BUFF
1.5
6
4
1
0.7
2.2
Y LPF
Q107
2SA1037AK
BUFF
1.4
R250
220
:CHIP
Q108
2SA1037AK
BUFF
2
3
1.7
2.3
C BPF
6
Q125
2SA1037AK
BUFF
4
Y
SVHS-C
SVHS-Y
C
Y
IC204
MC14066BF
YC-SW
R207
47k
:CHIP
0.4
2.3
C
9
Q213
2SA1037AK
C BUFF
PAL/NT
4.8
SCL
R297
220 :CHIP
0.4
R266
22k
:CHIP
Q211
DTC144EKA
INV
R267
4.7k
:CHIP
R296
1k :CHIP
8
7
R295
1k :CHIP
IC206
CXA1315M
BUS-SW
AE (3/5)
Q215
2SC2412K
SW
R299
10k :CHIP
R257
10k :CHIP
D231
UDZ-5.6B
4.3
Q2164.4
2SC2412K
SW
12
SA1
0.5 SA0
YC/COMB
0.5 8.8
SPSW
8.8
GND A.REGI
TO AE(1/5,4/5)
4.3
11
5
8.9
6
C
4.4
SDA
R298
220 :CHIP
8
7
2.3
VSS
C
4.8
10
6
8
Q212
Y 2SA1037AK
Y BUFF
3
8.9
2.3
MODE-S VCC
0.1 4.4
MODE-O SCL
4.3
KILL
SDA
5.0
PAL/NT SA2
R264 R268 R269 R274
47k
47k
47k
47k
:CHIP :CHIP :CHIP :CHIP
16
3.3
2
3.3
2.6
TO AE(4/5)
5V
0
4
10
5
Y
8.9
Y
C
9V
9V
R292
2.2k
:CHIP
15
11
4
C
14
12
3
C242
0.01
B:CHIP 2.6
4.3
2.7
R291
2.2k
:CHIP
13
Y
7
2.7
1
2
13
2.7
9
VSS
C
14
4.3
1
Y
Y
C243
47
C244
0.01
B:CHIP
A.REGI
R248
100 :CHIP
TO AE(4/5)
MODE 3
SPSW
R293
47k
:CHIP
(DIGITAL COMB FILTER)
R294
100k
:CHIP
TO AE(5/5)
C245
0.01
:CHIP
B-SS510.<AEP>-AE.-P3-05
– 66 –
RM-892
RM-862
KP-41PX1/41PX1K/41PX1R
(9) Schematic Diagram of AE (4/5) Board (41PX1R)
K
RM-892
RM-892
U-PC DISABLE
TO AE(1/5)
AGC MONI
SDA
SCL
FS
SDA
TO AE(1/5,3/5)
SCL
TO AE(1/5) DISABLE PJE
TO AE4/5,AE5/5_9
TO AE4/5,AE5/5_10
TO AE4/5,AE5/5_11
TO AE4/5,AE5/5_12
R-Y
5.1
8
B-Y
C303
0.001
CH:CHIP
1
2
9V
R
5V
G
13
3
4
12
11
5
6
10
9
7
8
C307 0.01 B:CHIP
R309 220 :CHIP
R310 220 :CHIP
C309 1 16V F:CHIP
C310 1 16V F:CHIP
C311 1 16V F:CHIP
9V
12
R
13
G
R326
100
:CHIP
C320
22
C315
0
:CHIP
IK
C328
10
C321 C322 C323 C324
0.01 0.1
0.1
0.1
B:CHIP 25V
25V
25V
F:CHIP F:CHIP F:CHIP
R340 100 :CHIP
R341 100 :CHIP
4.5
5.2
R343 3.3k :CHIP
C344 100p CH:CHIP
R339
1k
:CHIP
R338 1k :CHIP
C343 0.0047 B:CHIP
C339 0.01 B:CHIP
C341
0.47 25V F:CHIP
R335 10k :RN-CP
R304
2.2M
:CHIP
R336 330k :CHIP
R360
2.2M
:CHIP
R300
100
:CHIP
R331
2.7k
:CHIP
3.6
(0)
FV
0(4.9)
Q309
DTC144EKA
INV
H 9V
C380
0.1
25V
F:CHIP
C334
0.01
B:CHIP
C325
1
16V
F:CHIP
R329
47k
:CHIP
R323
220
:CHIP
9V
C327 C326
0.047 0.001
CH:CHIP
B
IK
R
HP L
HP R
G
AUDIO R AV-3
HFBP
R359
0
:CHIP
VBLK
R3
L3
AUDIO R
V3
ABL
C3
Y3
VV+
SP R
SP R
H OUT
L SP L
E-W
HP L
HP R
AUDIO
SP L
R356
3.3M
:CHIP
R330
100
:CHIP
R327
100
:CHIP
L3
R3
AUDIO L AV-3
TO AE(2/5)
R333
5.6k
:CHIP
R361
2.2M
:CHIP
R320 R321 R322
100
100
100
:CHIP :CHIP :CHIP
V3
Y3
C3
C AV-3
X303 B500F63
500kHz
R334 470 :CHIP
D320
UDZ-9.1B
CVBS AV-3
Y AV-3
C340 100 16V
C342 1 16V F:CHIP
R337 100 :CHIP
R305
220
:CHIP
C312
C313
2.2
0.001
16V CH:CHIP
F:CHIP
9V
4.5
6.4
B
IC302
TDA4665T/V5-118
IH DELAY LINE
B
FB2
SDA
SCL
CVBS
Y
SYNC OUT
4.4
HS IN
3.2
VS IN
4.0
VS FIL
2.5
H 9V
IREF
1.8
GND
CERA
2.4
AFC FIL
4.2
L2 FIL
4.7
AFC PIN
3.4
H OUT
3.2
V 9V
SAW OSC
4.6
V AGC
4.0
E-W
IC301
CXA2076Q-TL
SHADING
4.4
R
G
B
14
C306 0.01 B:CHIP
C308 0.01 B:CHIP
FB2
COR
R2
G2
B2
10
R308 100 :CHIP
VM
A.REGI
9V
C20
0.01
B:CHIP
5V
L OUT
Q307
DTC144EKA
PROT
AUDIO R
D303
1SS355TE
C21
0.01
B:CHIP
3.4
Q308
DTC144EKA
PROT
C335
0.47
25V
F:CHIP
R355 C347
68k 4.7
:CHIP
D304
1SS355TE
AE
(4/5)
(Y/C JUNGLE)
25
1
50
TO D(1/3) BOARD
CN1801
R332
1k
:CHIP
0
4.2
R97
100
:CHIP
CN1
50P
R325
47k
:CHIP
PROT1
HFBP
HP L
K1
VM
MUTE
HP R
LED
SP R
R OUT
33V
AUDIO L
STDBY 5V
AFC
IR
SP L
STBY
ABL
PROT1
L OUT
R OUT
CVBS OUT
TO AE(2/5)
MODE3
CVBS OUT
L OUT
R OUT
MODE3
TO AE(1/5) CVBS OUT
V+
MODE 3
HFBP
HFBP
TO AE(3/5)
26
GND
GND
GND
GND
A.REGI
V+ DRIVE
H.SHIFT
VERTICAL GND
EAST/WEST DRIVE
V- DRIVE
H DRIVE
V SYNC
H FLYBACK
VERTICAL GND
EHT
ABL
PROT1
MODE3
GND
9V
33V
STANDBY 5V
CVBS OUT
SIRCS
AUDIO L OUT SPEAKER
P.CONT
GND
5V
AUDIO R OUT SPEAKER
GND
LUMISPONDER
STANDBY LED
GND
GND
GND
GND
GND
FRONT KEY 1
VM
AUDIO MUTE
AUDIO R OUT HP
R OUT
AUDIO L OUT HP
AUDIO GND
AUDIO R IN AV-3
AUDIO L IN AV-3
CVBS IN AV-3
L OUT
S-VHS C IN AV-3
S-VHS Y IN AV-3
1
2
3
4
5
6
7
9
E-W
VH OUT
V SYNC
TO CR BOARD
CN703
AB/NC
CN301
7P
WHT
15
5V
R-Y
IN
1.4
16
5V
R-Y
NC/5V
C302
0.001
CH:CHIP
FB1
R1
G1
B1
C317
0.1
25V
F:CHIP
GND
TRAP
0
Q300
DTC144EKA
SW
RED DRIVE
GRN DRIVE
BLUE DRIVE
9V
GND
CUT OFF
GND
B-Y
NC/GND
R-Y
NC
0
B-Y
SSCP
OUT
0.6 3.0
R-Y
VCO/NC OUT
3.1
R378 C377 R379
10 470
16k
:CHIP
:RN-CP
NC
R377
1k
:CHIP
C305 0.1 25V F:CHIP
B-Y
R302 R303
0
0
:CHIP :CHIP
L300
22µH
:CHIP
R374
470
:CHIP
R344
5.6k
:CHIP
C300
47p
CH:CHIP
Q302
2SC2412K
BUFF
3.0
NC/GND
R373
1k
:CHIP
B-Y
NC/GND IN
1.4
3.0
C304 0.1 25V F:CHIP
NC
Q301
2SC2412K
BUFF
7
Y
C301 0.1 25V F:CHIP
SCL
H 9V
C338 3.3
6
Y
SDA
4.4
14
C336 0.001 B:CHIP
3
Y
5.7
5.7
3.6
3.7
B-Y
R301
220 :CHIP
4
L301
C376
10µH
220p
:CHIP CH:CHIP
5
7.5
19 18 17 16 15 14 13 12 11 10 9
Y
SECAM REF
1.6<4.9>
GND
R-Y OUT
5.7<3.0>
B-Y OUT
5.7<3.0>
Y OUT
3.7
Y IN
5.0
R-Y IN
5.5
B-Y IN
5.5
GND
SSCP OUT
0.7
FB-1 IN
0.1
R-1 IN
5.5
G-1 IN
5.5
B-1 IN
5.5
FB-2 IN
0
HB-2 IN
0
R-2 IN
5.5
G-2 IN
5.5
11
B-2 IN
5.5
9V
C337 0.001 B:CHIP
R-Y
R376
22k
:CHIP
R375
1.1k
:RN-CP
2
R315 0 :CHIP
R371
220
:CHIP
Q306
DTC144EKA
SW
Q330
2SA1037AK
INV
C332 0.01 B:CHIP
8
C333 100 16V
R370
0
:CHIP
C331 0.1 100V :MPP
7
B-Y
R345
100
:CHIP
0.2
C330 0.1 63V :PT
R-Y
C355
22
Q305
2SC2412K
BUFF
1
Y
0
FB2
VM
R342
1k
:CHIP
R358
220k :CHIP
33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51
20
C348
470p
CH:CHIP
0
4.1
1.6<4.9>
19
5.7
R354
0
:CHIP
C350
10
C Y
5.0
18
6
R350
470
:CHIP
R351
1.5k
:CHIP
4.0
17
C356
0.01
B:CHIP
4.5
16
X302
3.58MHz
Q331
2SC2412K
BUFF
6.4
C351
2.2
16V
C352 F:CHIP
0.47
25V
F:CHIP VIDEO
R352
15k
:CHIP
4.4
NC
15
Q304
2SC2412K
BUFF
0
Q303
2SC2412K
Y BUFF
X301
4.43MHz
9V
0
FSC 64
5.3
GND 63
3.58MHZ 62
7.4(5.9)
4.43MHZ 61
2.4(7.4)
APC FIL 60
5.5<4.7>
Y/C 9V 59
NC 58
SVHS-C IN 57
4.2
SYNC IN 56
SVHS-Y IN 55
DC TRAN
54
CVBS IN 53
4.1
BL HOLD 52
4.1
NC
NC
14
FB1
1
20 RGB 9V
21 RSH
22 R OUT
1.8<2.0>
23 GSH
24 G OUT
1.7<1.9>
25 BSH
26 B OUT
1.6<1.9>(1.8)
27 IK IN
4.9(4.4)
28 ABL IN
4.4<2.8>(3.5)
29 ABL FIL
8.8
30 VTIM
0.6
31 V- DRIVE
3.0
32 V+ DRIVE
3.0
8V
13
0
2
IC303
TDA8395T/N3
CHROMA DEC.
12
RGB-S
V-BLK
FSC
CVBS
3
9V
9V
R357
1k
:CHIP
C354 C353
0.47 2.2
25V
16V
F:CHIP F:CHIP
VIDEO
4
C360 C359 C358 C357
15p
15p 0.47 470p
CH:CHIPCH:CHIP 25V CH:CHIP
F:CHIP
R316
220
:CHIP
SSCP IN
TEST
CVBS IN
IDENT
3.6
5
NC
11
9V
6
NC
R353 220 :CHIP
7
NC
FB AV-1
8
GND
9
NC
10
NC
R348 100 :CHIP
R349 100 :CHIP
C370
2.2
16V
F:CHIP
NC
TO AE(2/5)
D370
BAS216
NC
G AV-1
B AV-1
C372
0.1
25V
B:CHIP
3.4
R347 100 :CHIP
5.7<3.0>
R1
G1
B1
FB1
R AV-1
C371
0.001
CH:CHIP
4.3
C
9V
C373
0.22
16V
B:CHIP
R-Y OUT
PLL REF
5.7<3.0>
B-Y OUT
CLOCHE
TO AE(3/5)
STDBY 5V
CVBS
Y
C
FSC
Y
Y
C
FSC
C
VIDEO
TO AE(1/5) CVBS
– 67 –
B-SS510.<AEP>-AE.-P4-05
RM-862
KP-41PX1/41PX1K/41PX1R
Schematic Diagram of AE (5/5) Board (41PX1R)
RM-892
RM-892
D5
D0
D6
A0
D7
A1
A2
A10
A3
A4
A11
A5
A9
A6
A8
A7
A13
A12
A14
A15
D7
A10
K
A14
A13
A8
A9
A11
A17
(10)
C13 # :CHIP
SDA
R29 4.7k :CHIP
R92
100 :CHIP
IC2
M24C32-MW6T
NVM
C16 # :CHIP
GND
4
1
5.0
OUT
D16 1SS355
DIS
MONI
9 10 11 12 13 14 15 16 17 18 19 20
A15
2.5
(2.9)
39
38
37
36
35
34
33
32
31
30
29
28
27
26
25
24
23
22
21
8
7
6
R73 100 :CHIP
TRAP
V-BLK
MUTE
RGB-S
STBY5V
5
R72 100 :CHIP
4
R71 100 :CHIP
WR
R70 100 :CHIP
R68 100 :CHIP
R88 100 :CHIP
R32 100 :CHIP
R64 100 :CHIP
R33 100 :CHIP
R63 # :CHIP
R34 100 :CHIP
R62 100 :CHIP
MONI
R35 100 :CHIP
R61 100 :CHIP
1
Q1002
2SA1037AK
BUFF
9V
R93
220
:CHIP
8.2
3.6
Q1
2SC2412K
BUFF
V SYNC
CVBS
RST
R44
6.8k
:CHIP
R42
6.8k
:CHIP
EN
RXD
TXD
R66 2.2k :CHIP
R58 3.9k :CHIP
R67 2.2k :CHIP
C22
100p
CH:CHIP
STDBY 5V
D12
UDZ-5.6B
R48
1
:CHIP
R46
82k
:CHIP
5.3
R95
220
:CHIP
R79
220
:CHIP
TEXT
TO AE4/5,AE5/5_9
TO AE4/5,AE5/5_10
TO AE4/5,AE5/5_11
TO AE4/5,AE5/5_12
R40
5.6k
:CHIP
8.3
3.0
R78
100
:CHIP
D2
1SS355
D10 UDZ-5.6B
DGC
EN
RXD
TXD
R60 100 :CHIP
STDBY 5V
STBY5V
IR
VS
R94
220 :CHIP
VS
RST2
RST
YS1
R74 100 :CHIP
R65 100 :CHIP
R1
1k
:CHIP
YM1
R76 100 :CHIP
R59 100 :CHIP
3
2
COIL
R77 100 :CHIP
R54 100 :CHIP
1
IC4
PST593C-MMP-4P
RESET
C3
33p CH:CHIP
LED
STBY
RST
LS
K1
PROT1
C17 # :CHIP
STDBY
RST
5V
5.0
(2.3)
R49 100 :CHIP
C1 0.1 25V F:CHIP
C25 47 16V
3
R21 100 :CHIP
C24
C4
0.001
33p
CH:CHIP CH:CHIP
X1 11.5MHz
R4 33 :CHIP
2
R20 100 :CHIP
2.3
STDBY 5V
C2 47 16V
1
R19 100 :CHIP
SDA
SCL
R2 100 :CHIP
4.0
ALE
RST2
C43
150p
CH:CHIP
C45
0.1
25V
F:CHIP
D11
UDZ-5.6B
R47
2.2k
:CHIP
MFB2
SDA
5
4
GND
DIS
DIS
LED
LED
STBY
R30 4.7k :CHIP
RST
R31 4.7k :CHIP
LS
C14 0.1 25V F:CHIP K1
C15 470p CH:CHIP
PROT1
R91
4.5 100 :CHIP
R18 100 :CHIP
R6 4.7k :RN-CP
SCL
6
3
SCL
HS
VS
SDA
SCL
CTXTPWR
R25 4.7k :CHIP
C12 # :CHIP
A2
VS
R24 4.7k :CHIP
R26 # :CHIP
R28 10k :CHIP
WR
4.3
HS
4.1
R3 100 :CHIP
FB-2
MB2
MG2
MR2
MCOR
TEST
7
2
4.9
A1
C23 # :CHIP
C19 0.0047 B:CHIP
L10 6.8µH :CHIP
TEXT
8
1
A0 STDBY 5V
C90
0.1
25V
F:CHIP
C11 47p CH:CHIP
EN
RXD
TXD
C26
47
16V
STBY5V
C10 47p CH:CHIP
HS
VS
C18
0.1
25V
F:CHIP
IC1
SDA30C263-GEG
MICRO
A18
A16
A17
5.0
FB-2
9 10 11 12 13
HS
8
2.0
P4.1
0
A16
3.0
P4.0
0
ALE
1.7
RST
4.6(5.0)
XTAL1
15
XTAL2
2.4
STANDBY 5V
GND
P1.0
1.8
P1.1
0
P1.2
0.1
P1.3
0.1
P1.4
0.8
P1.5
0
P1.6
5.0
P1.7
5.0
P3.0
P3.1
0
NC
P0.5
0
P0.6
3.9
P0.7
4.6
P2.3
0.8(0.1)
P2.2
5.0
P2.1
0
P2.0
3.9(2.3)
A GND
FIL3SLC
0
FIL1SLC
0
FIL2SLC
0
A 5V
IREF
4.9
CVBS IN
4.7
P3.7
5.0(4.6)
P3.6
5.0(4.7)
P3.5
5.0(3.0)
P3.4
0
P3.3
0.8
P3.2
7
D2
D1
2.1
D1
0.9(2.1)
D4
5.0(3.0)
D2
2.5(2.1)
D3
4.2(1.7)
RED OUT
GREEN OUT
BLUE OUT
BLANKING
COR
GND
STANDBY 5V
LC IN
0
LC OUT
0
HS/SSCP
1.3
VS
0.8
P0.0
4.5
P0.1
4.4
CTXTPWR
FB-2
0.6(1.3)
P0.4
61
62
63
64
65
66
67
68
69
70
71
72
73
74
75
76
77
78
79
80
6
2.8
1.8
D1
D4
D2
D3
A7
A6
A5
A4
A3
A2
A1
A0
D0
5
2.9
HFBP
*
*
IC3
5V
5V M27C2001-12C1R
PROGRAM ROM
D6
D5
D4
D3
2.7
TEXT
*
D6 20
D5 19
D4 18
D3 17
GND 16
D2 15
D1 14
2.1
A16
A15
A12
30 A17
31 P
32 STDBY
1 STDBY
2 A16
3 A15
4 A12
A7
1.9
A6
*
A5
2.8
A4
2.5
A3
2.2
A2
2.5
A1
2.5
A0
2.5
D0
0
60 59 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41
0.9
A14
A13
*
A8
*
A9
*
A11
*
OE
A10
*
CE
3.0D7
29 28 27 26 25 24 23 22 21
2.8
D0
2.2
D6
2.8
A0
2.5
D7
3.0
A1
2.6
A2
2.6
A10
2.7
A3
2.3
A4
2.6
A11
2.7
A5
2.7
A9
3.5
A6
2.6
A8
2.4
A7
2.0
A13
3.2
A12
3.3
A14
1.0
C8
0.1
25V
F:CHIP
D5 40
STDBY 5V
STDBY 5V
STDBY 5V
STBY5V
Q4
2SC2412K
SW
R1028
100
:CHIP
5V
TO AE(3/5)
FV
VBLK
D102
1SS355TE
C1013
22
R195
1k
:CHIP
0.7
R196
1k
:CHIP
0.7
0
R197
1k
:CHIP
0.7
0
5V
R1014
4.7k
:CHIP
0
Q25
2SA1037AK
BUFF
MB2
Q24
2SA1037AK
BUFF
MG2
0.1
Q23
2SA1037AK
BUFF
TO D(3/3)BOARD
CN1702
R1017
0
:CHIP
4.6
Q1001
DTC144EKA
RESET SW
R1012
470 :CHIP
D1010
MA3030H
AE
(5/5)
(MICRO PROCESSOR)
C1015
0.22
16V
B:CHIP
CVBS IN
1.0
D 5V
A 5V
A GND
NC
NC
D 5V
RESET
0.1
NC
NC
NC
D 5V
NC
VREF
2.9
NC
D 5V
A8
16
IC1001
SDA5273CP
TEXD/OSD
0
1.6
C1014
0.1
25V
F:CHIP
EMI
R151 100 :CHIP
SPSW
FL1001
FZ103N
D GND
RGB GND
D GND
NC
VBB
0
D GND
NC
NC
NC
NC
NC
D GND
NC
NC
NC
CASQ
D GND
44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60
JR1010
0 :CHIP
26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10
R150 100 :CHIP
C1010
0.1
25V
F:CHIP
5V
SB
SG
SR
SB
R149 100 :CHIP
R194
1k
:CHIP
R1010
0
:CHIP
SG
R148 100 :CHIP
G2
R2
R193
1k
:CHIP
YM1
YS1
R147 100 :CHIP
R1021
150
:CHIP
0.2
R192
1k
:CHIP
TM 9
GPO 8
XIN 7
1.8
XOUT 6
HS 5
1.3
VS 4
0.9
TCSQ 3
CLK 2
INTQ 1
ENABLE 68
3.1
USART 67
4.8
66
USART
4.7
CORQ 65
BLANKING 64
0
BLUE 63
0
GREEN 62
0
RED 61
0.2
R5
10k
:CHIP
R1020
100k
:CHIP
C1020
22p
CH:CHIP
27 A7
28 A6
29 A5
30 A4
31 A3
32 A2
33 A1
34 A0
35 A9
36 A10
37 A11
38 RASQ
39 WEQ
40 D1
41 D0
42 D2
43 D3
0.2
0.4
0.7
B2
SCL
R145 100 :CHIP SDA
R146 100 :CHIP FS
MR2
CN6
13P
WHT
:S-MICRO
1
2
3
4
5
6
7
8
9
10
11
12
13
X1001
20.48MHz
Q22
2SC2412K
B BUFF
0.7
SR
12V
SCL
SDA
FS
E
PJE YM
PJE YS
PJE B
PJE G
PJE R
SPSW
50-60
VBLK
Q21
2SC2412K
G BUFF
R1024
680
:CHIP
R1022 150 :CHIP
C1002 C1001
22p
22p
CH:CHIP CH:CHIP
Q17
2SA1037AK
INV
R1023 150 :CHIP
R52
4.7k
:CHIP
Q15
2SA1037AK
INV
R1026 100 :CHIP
R50
4.7k
:CHIP
0.7
R7
470
:CHIP
0.7
5V
Q20
2SC2412K
R BUFF
R9
470
:CHIP
1.4
0.2
FB2
R1001
100
:CHIP
R1002
100
:CHIP
0.8
R154
0
:CHIP
COR
R153
100
:CHIP
R53
2.7k
:CHIP
R1027 100 :CHIP
MFB2
MCOR
0
R51
2.7k
:CHIP
B-SS510.<AEP>-AE.-P5-05
– 68 –
RM-862
KP-41PX1/41PX1K/41PX1R
K
• AE (1/5) BOARD WAVEFORMS (41PX1R)
1
PAL/NTSC
1
• AE (3/5) BOARD
CXD2044Q
SECAM
1.2 Vp-p (H)
1.1 Vp-p (H)
ANALOG VIN 25
RM-892
IC103 (41PX1R)
A/D
NTSC : 1H
PAL : 2H
NTSC : 1H
PAL : 2H
+
DL
D/A
31
A-YOUT
44
ı
51
D-YOUT
8
–
• AE (2/5) BOARD WAVEFORM (41PX1R)
2
DIGITAL VIN
1.6 Vp-p
(18.432 MHz)
1
ı
8
8
ADAPTABLE
FILTER
OPERATION
• AE (3/5) BOARD WAVEFORMS (41PX1R)
3
PAL/NTSC
3
1.7 Vp-p (H)
SECAM
1.8 Vp-p (H)
5
4
1.3 Vp-p (H)
PAL/NTSC
0.5 Vp-p (H)
5
D/A
39 A-C OUT
8
57
ı D-C OUT
64
SECAM
LOGIC OPERATION
0.4 Vp-p (H)
• AE (4/5) BOARD WAVEFORMS (41PX1R)
6
SECAM
7
1.0 Vp-p (H)
!3.6 Vp-p (H)
SECAM
1.5 Vp-p (H)
!=
3.6 Vp-p (H)
8
SECAM
1.2 Vp-p (H)
![
3.4 Vp-p (H)
9
!/
1.3 Vp-p (H)
!]
PAL/NTSC
1.1 Vp-p (H)
1.1 Vp-p (H)
!]
SECAM
• AE (3/5) BOARD
CXA1315M
1.2 Vp-p (H)
IC206 (41PX1R)
13
• AE (5/5) BOARD WAVEFORMS (41PX1R)
12
11
2
LEVEL CONVERTION
LATCH
1
9
!;
!\
3.4 Vp-p
(11.5 MHz)
SDA 14
1.7 Vp-p (20 MHz)
LEVEL
CONVERTION
SCL 15
2
I C
DECODER
POWER
ON
RESET
—
+
Vcc 16
8
– 69 –
LATCH
LATCH
LATCH
LATCH
LATCH
DAC
DAC
DAC
DAC
DAC
AMP
AMP
AMP
AMP
AMP
3
4
5
6
7
Vcc
REG
10
LEVEL CONVERTION
RM-892
RM-862
KP-41PX1/41PX1K/41PX1R
K
SEARCH
CIRCUIT
AFCFIL
CERA
AFCPIN/HOFF
L2FIL
48
HSIN
56
VSIN
R
VSFIL
7
BLHOLD
NC
DCTRAN
8
VM
2
DIVIDER
CIRCUIT
SCL
DET FIL
PHASE
COMPARATOR
RM-892
RM-862
IC301 (41PX1R)
51 50
49
54
52
45
46
47
40
41
38
39
SDA
1
• AE (4/5) BOARD
CXA2076Q
SYNCOUT
FSC OUT
IC102 (41PX1R)
EXT SYNC IN
• AE (3/5) BOARD
NJM2240M
RM-892
2Vp-p
36 DVCC1
H SYNC
SEP
VM OFF
6dB
32fH
VCO
PHASE
DET
1/32
PHASE
SHIFT
44 DVCC2
42 DGND
V SYNC
SEP
EXT
SYNC
PHASE
DET
GATE
DC
TRAN
OSC C
TRAP OFF DL
53
SUB
CONT
VIDEO
SW
ACC
TRAP F0
TOT
SUB COLOR
50/60 ID
D PIC
YS
SW
Y/C
MIX
fsc
ID
VCO
DEM
AXIS
HUE
COLOR
& AXIS
fsc R-Y
fsc B-Y
64
1
3
4
5
DGND
3
FSCOUT
SECAMREF
– (R-Y) OUT
– (B-Y) OUT
YOUT
7
8
NC
6
SIGNAL
CLAMPING
LINE
MEMORY
SAMPLE
ANDHOLD
LP
22 ROUT
CUT
OFF
GB
DRV
BLK
26 BOUT
HV
COMP
27 IKIN
AKB
ABL
15
16 17 18 19
24 GOUT
29
28
AKB OFF
EHT H. V
21 23 25
IC303 (41PX1R)
CLOCHE
PLLREF
VP
9
10
5
GND TEST
6
2
BANDGAP
TUNING
TUNING
ACC
CLOCHE
FILTER
PLL
DE-EMPHASIS
INTERFACE
CONTROL
IDENTIFICATION
OUTPUT
STAGE
14 +
—(B-Y)IN
addition
stages
output
buffers
CVBS
LINE
MEMORY
SAMPLE
ANDHOLD
20
12 +
—(B-Y)OUT
LP
11 +
—(R-Y)OUT
3MHz shifting clock
FREQUENCY
PHASE
DETECTOR
DIVIDER
BY 192
6MHz
CCO
DIVIDER
BY 2
ANALOG
SUPPLY
8
– 70 –
1
9
11 – (R-Y)
12 – (B-Y)
10 A GND
7
LP
GND
BRT
13 NC
SANDCASTLE
DETECTOR
IC
33 E-WOUT
15 NC
SIGNAL
CLAMPING
5
11 12 13 14
16 +
—(R-Y)IN
4
PULSE IN
DCOL
γ
CLP
• AE (4/5) BOARD
TDA8395T
pre-amplifiers
GND
GB DRV
IC302 (41PX1R)
1
2
6
– (B-Y) IN
62 61
YRET
60
– (R-Y) IN
43
DIGITAL
SUPPLY
N.C
OSD
MIX
DIG
CLP
COL
XTAL
VP2
PIC
HUE
IREF
• AE (4/5) BOARD
TDA4665T
YS/YM
SW
B2IN
9
PAL
ID
G2IN
SGND2
BRT
WIDE
PARABORA
GEN.
GB CUT
YM
2
31 VD–OUT/VRROT
DEM
R2IN
SGND1
D-COL γ
PIC
YS2
20
32 VD+OUT/VPROT
VLIN, SCORR
YS1 OFF
B1IN
SVCC2
35 SAWOSC
WIDE
SAWTOOTH
GEN.
INTERLACE
INTERLACE
59
PAL/
NTSC
30 VTIM
VPOSI, VOFF,
VSIZE
COUNT DOWN
525/625
GATE
KILLER
DET
APC
SCP BGR/BGF
C MODE
PRE/OVER
COLOR SW
SVCC1
10 SCPOUT
SAMD
CASTLE
34 VAGCSH
DC
TRAN
CLP
TOT
ACC
DET
H POSI
AFC
V FREQ
D PIC
G1IN
57
TRAP
SHARP
NESS
AGING
YS1
55
DL
SHARP
R1IN
YIN
CIN
37 HD OUT
BSH
SUB CONT
CVIN
X443
5
X358
VCO
APCFIL
4
IREF
OSC OUT
H. DRIVE
2fH
CV/YC
RSH
+V
GSH
6
ABLIN/VCOMP
3
ABLFIL
GND
19
VP1
IDENT
SAND
KP-41PX1/41PX1K/41PX1R
K
AE
RM-892
µ COM, Y/C JUNGLE, TUNER,
AUDIO/VIDEO PROCESS
• AE BOARD SEMICONDUCTOR LOCATION
(Component Side)
— AE BOARD (Component Side) — (41PX1R)
1
2
3
4
5
IC1
IC2
IC3
IC103
IC201
IC202
IC205
IC206
IC301
IC303
IC1001
A
DIODE
IC
A-1
A-1
A-1
B-3
C-5
B-4
A-4
C-3
B-2
B-2
B-1
TRANSISTOR
Q1
Q4
Q17
Q18
Q21
Q22
Q24
Q25
Q104
Q110
Q111
Q112
Q114
Q202
Q203
Q204
Q212
Q213
Q214
Q215
Q217
Q302
Q303
Q331
B
C
B-1
A-1
B-1
A-5
A-2
A-2
A-2
A-2
B-3
A-4
A-5
A-5
C-4
C-5
B-4
B-4
C-3
C-3
A-4
C-4
C-5
A-2
A-2
B-3
*
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
D202
D204
D205
D212
D213
D216
D217
D218
D220
D221
D223
D224
D225
D226
D227
D228
D231
D251
D304
D370
A-5
B-4
B-4
B-4
B-4
A-5
A-5
A-5
A-5
A-5
B-5
B-5
B-5
B-5
C-5
B-5
C-4
B-4
C-2
B-2
*
3
3
3
3
3
3
3
3
3
3
3
3
3
3
3
3
3
3
3
3
CRYSTAL
X1
X201
X301
X302
X303
X1001
A-1
B-4
B-2
B-2
B-3
B-1
*: Refer to Terminal name of semiconductors in silk
screen printed circuit (see page 54)
– 71 –
RM-892
RM-862
KP-41PX1/41PX1K/41PX1R
K
AE
µ COM, Y/C JUNGLE, TUNER,
AUDIO/VIDEO PROCESS
• AE BOARD SEMICONDUCTOR LOCATION
(Conductor Side)
— AE BOARD (Conductor Side) — (41PX1R)
1
2
3
4
5
IC
IC3
IC4
IC102
IC204
IC302
DIODE
A-5
A-5
A-3
C-2
B-4
TRANSISTOR
A
Q15
Q20
Q23
Q101
Q102
Q103
Q105
Q106
Q107
Q108
Q109
Q113
Q115
Q116
Q120
Q121
Q122
Q124
Q125
Q130
Q201
Q211
Q216
Q300
Q301
Q304
Q305
Q306
Q307
Q308
Q309
Q330
Q1001
Q1002
B
C
B-5
A-3
A-3
A-3
B-3
B-3
B-3
B-3
B-3
C-3
B-2
C-1
B-3
B-3
A-2
A-3
A-3
A-2
B-2
A-2
C-1
C-3
C-2
A-4
A-3
A-4
A-5
B-4
B-3
B-3
B-4
B-3
B-5
B-4
*1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
D2
D10
D11
D12
D16
D101
D102
D201
D203
D206
D207
D208
D209
D210
D211
D214
D215
D222
D303
D320
D1010
A-4
A-4
A-4
A-4
A-4
A-1
A-3
C-1
C-1
B-2
B-2
C-1
C-1
C-1
C-1
B-1
B-2
C-1
B-3
B-3
B-5
*
3
3
3
3
3
3
3
3
3
3
3
3
3
3
3
3
3
3
3
3
4
CRYSTAL
X1
X201
X301
X302
X303
X1001
A-4
B-2
B-4
B-4
B-3
B-5
*: Refer to Terminal name of semiconductors in silk
screen printed circuit (see page 54)
– 72 –
RM-892
RM-892
RM-862
KP-41PX1/41PX1K/41PX1R
K
GND
CVBS/Y IN
GND
CVBS OUT
GND
C IN
MODE
8
1
R1825
*
C1825
100p
6
3
5
4
R1828
47k
C1827
47
25V
R1831 R1833
3.9k 470
:CHIP :CHIP
Q1804
2SC2412K
MIXING
R1829
R1827
47k
2.4
1.7
SR
SL
R1801
JW(5)
Q1805
2SC2412K
BUFF
Y3
C1829
47 25V
R1838
470
:CHIP
9V
Q1806
2SC2412K
MIXING
V OUT
SIRCS
L
P.CONT
4.6
R1842
*
:CHIP
AUDIO L
FV
R1839
1k
:CHIP
LED G
R1802
22k 3W :RS
R1835
1k :CHIP
4.7
FR
*
FL
*
R1834
1k
:CHIP
R1836
1k :CHIP
5.4
41PX1R
R1824
5.4
R1837
1k
:CHIP
41PX1R
M3
Ref No.
C1816
C1817
C1822
C1824
L1802
R1806
R1807
R1808
R1810
R1819
R1820
R1824
R1825
R1826
R1829
R1832
R1842
V3
C1828
47 25V
AUDIO R
AUDIO L
ABL
PROT1
* MARK LIST
Q1803
2SC2412K
BUFF
4.0
2.4
1.7
7
2
*
A.REGI/KEY2
VD+
H.SHIFT
R1823
47k
R1832
*
:CHIP
Q1802
2SC2412K 4.6
MIXING
R1826
R1822
47k
PIN
VDHD
VP
HP
R1830
10k
:CHIP
C1826
100
25V
4.6
*
C1823
100p
R1840
1k :CHIP
FY
R1841
1k :CHIP
Q1807
2SC2412K
BUFF
4.0
2.4
1.7
41PX1/41PX1K
JW(5)
JW(5)
0
0
10µH
68
0
0
68
0
0
0
0
0
0
1.2k
1.2k
41PX1R
10µF
10µF
0.47 25V
0.47 25V
JW(5)
82
2.7k
2.7k
82
2.7k
2.7k
47k
47k
47k
47k
1k
1k
C3
C1830
10
R1844
1k
:CHIP
5V
R
R1843
470
:CHIP
AUDIO R
R1845
1k :CHIP
FC
R1846
1k :CHIP
LED R
TO D1/3,D2/3_1
AUDIO L/R
KEY1
AUDIO R
MUTE
HPR
AUDIO L
HPL
R OUT
AUDIO R
AUDIO L
VIDEO/Y
R3
L3
V3
L OUT
C3
Y3
FR
FL
FV
FC
STBY5V
5V
41PX1R
D1802
MTZJ-9.1
D1803
RD9.1EW
D1805
RD9.1EW
D1804
MTZJ-9.1
TO D1/3,D2/3_4
135V
TO D1/3,D2/3_5
TO H2 BOARD CN3202
*
R1811
100
:CHIP
R1812
100
:CHIP
R1815
100
:CHIP
R1816
100
:CHIP
CN1803
10P
WHT
:S-MICRO
TO H1 BOARD CN3001
R1813
1k
:CHIP
L1802
*
D
R1817
100
:CHIP
R1821
100
:CHIP
(1/3)
(VIDEO BUFFER)
1
2
3
4
5
*
C1820
470p
KEY1
A.REGI/KEY2
SIRCS
R1805
470k
C1819
470p
41PXR
L1801
10µH
:EL0606
135V
NC
9V
GND
VM
CN1802
11P
RED
:S-MICRO
LED G
LED R
R1804
470k
R1819 R1820
D1806
MTZJ-9.1
41PX1R
LED G(NC) 1
LED R 2
GND 3
STBY 5V 4
KEY 5
AUTO REGIS 6
GND 7
SIRCS 8
LUMI(NC) 9
+5V 10
R1807 R1808
* :CHIP
*
:CHIP
R1849
470
:CHIP
0.6
5.2
Q1809
2SC2412K
VM AMP
AUDIO R
AUDIO L
C
VIDEO/Y
R1810
*
:CHIP
R1814
82
:CHIP
R1818
2.7k
:CHIP
R1848
1k
:CHIP
C1813 C1814 C1815 C1816 C1817
220 0.01 220
*
*
25V
25V
25V
B:CHIP
R1806 C1818
* 0.01
:CHIP B:CHIP
R1809
100k
:CHIP
TO D1/3,D2/3_3
9V
5.8
0.6
6.4
C1831
0.01
R1803
10k
:CHIP
STBY 5V
Q1808
2SA1037K
VM AMP
9V
R1847
1k
:CHIP
41PX1/
41PX1K
0
0
TO D1/3,D2/3_2
+B
D1801
MTZJ-9.1
Q1801
2SC2412K
MUTE
LUMI/HP MUTE
TO D1/3,D2/3_6
FY
C
FRONT Y(NC) 1
GND 2
FRONT C 3
GND 4
FRONT V 5
GND 6
FRONT L 7
GND 8
FRONT R 9
GND 10
FRONT S(NC) 11
A1
B1
A2
B2
A3
B3
A4
B4
A5
B5
A6
B6
A7
B7
A8
B8
A9
B9
A10
B10
A11
B11
A12
B12
A13
B13
A14
B14
A15
B15
A16
B16
A17
B17
A18
B18
A19
B19
A20
B20
A21
B21
A22
B22
A23
B23
A24
B24
A25
B25
9V
C1824
4.6
*
M3
V OUT
41PX1R
IC1805
LM358D
MIXING
C1822
TO AE(4/5)BOARD
CN1:41PX1R
R3
R OUT
L3
TO A(4/5)BOARD
CN1:41PX1/41PX1K
GND
GND
GND
GND
A.REGI
V+ DRIVE
H SHIFT
VERTICAL GND
EAST/WEST DRIVE
V- DRIVE
H DRIVE
V SYNC
H FLYBACK
VERTICAL GND
EHT
ABL
PROT1
POW LED
GND
9V
33V
STANDBY 5V
CVBS OUT
SIRCS
AUDIO L OUT SP
P.CONT
GND
5V
AUDIO R OUT SP
GND
LUMI/HP MUTE
STANDBY LED
GND
GND
GND
GND
GND
FRONT KEY 1
VM
AUDIO MUTE
AUDIO R OUT HP
R OUT
AUDIO L OUT HP
S3/GND
AUDIO R IN AV-2
AUDIO L IN AV-2
CVBS IN AV-2
L OUT
S-VHS C IN AV-2
S-VHS Y IN AV-2
L OUT
SR
SL
CN1801
50P
:BTOB
CN1808
7P
RED
:S-MICRO
1
2
3
4
5
6
7
CN1807
8P
WHT
:S-MICRO
L IN
GND
R IN
GND
L OUT
GND
R OUT
GND
Schematic Diagram of D (1/3) Board
1
2
3
4
5
6
7
8
(11)
RM-892
41PX1R
B-SS510.<AEP>-D..-P1-05
CN1804
5P
WHT
:S-MICRO
TO ZG BOARD CN1431
– 73 –
RM-892
RM-862
KP-41PX1/41PX1K/41PX1R
(12)
K
Schematic Diagram of D (2/3) Board
RM-892
RM-892
RM-862
R
CN1601
5P
BLK
:S-MICRO
L
TB1601
(CENTER SP IN)
J1601
L
R
TO H2 BOARD CN3204
VARIABLE OUT
1
2
3
4
5
HP R
GND
GND
HP L
MUTE(NC)
(AUDIO OUT)
+
-
0.4
R1603
470
:CHIP
R1604
470k
:CHIP
0
R1602
470
:CHIP
1
2
3
6
0
0
5
L1601
1µH
GND
4
-22.2
C1602
0.001
B:CHIP
41PX1R
R1601
100
:CHIP
C1609
0.0047
D1602
DAN202K
PROT
C1661
0.1
12.6
-VCC
0
0
HEATSINK
0.4
L
MUTE
C1601
0.001
B:CHIP
IC1602
TDA7264
AUDIO MAIN AMP
R
41PX1/41PX1K
0
C1608
0.0047
Q1612
DTC143TKA
MUTE
+VCC
22.5
41PX1/
41PX1K
AUDIO R
7
D1607
DAN202K
PROT
8
D1605
DAN202K
PROT
Q1613
DTC143TKA
MUTE
L1602
1µH
D1617
MA3240-TX
D1621
MA3240-TX
D1620
MA3240-TX
D1622
MA3240-TX
R1605
470k
:CHIP
R1650
220
:CHIP
C1606
0.01
B:CHIP
5.5
0
R1641
4.7k
:CHIP
R1635
1k :CHIP
8
1
C1622
2200p
CH:CHIP
R1634
22k
:CHIP
C1651
100p
CH:CHIP
C1605
22
:BP
D1612
1SS133T
0
TO G BOARD
CN6010
1
2
3
4
0
R1626 2SA1037K R1640
100
3.3k SP PROT :CHIP
:CHIP
13.5
R1633
Q1609
DTC144EKA
SP SW
R1653
1k
:CHIP
AUDIO L
13.6
0.3 R1643
R1654
13.5
1k :CHIP
0
Q1616
D1616 2SC2412K
1SS133T SP PROT
R1655
10k
:CHIP
D1614
1SS133T
CN1606
10P
:BTOB-S
12V
TO E(3/4)BOARD
CN651
RY1602
0.2
AUDIO R
10k
:CHIP
Q1608
2SC2412K
RELAY DRIVE
0
D1615
1SS133T
C1631
2200
R1646
JW(12.5)
C1630
2200
JW1648
#
R1632
47k
:CHIP
JW1901
12.5MM
12V
POWER MONI
AUDIO+
AU GND
AUDIO-
0
C1626
0.1
:PT
10k 13.6
:CHIP
R1642
1k
:CHIP
L OUT
GND(AU)
R OUT
GND(AU)
CN1605
4P
:MINI
RY1601
Q1615
2SC2412K
SP PROT
47k
13.6 :CHIP
C1624
0.1
:PT
AUDIO R
+
C1618
0.1
:PT
C1627
2200p
CH:CHIP
R1625
3.3k
:CHIP
0
HPSW
C1617
0.1
:PT
R1630
22k
:CHIP
0.2
C1628
10
C1633
47
25V
R1629
1k
:CHIP
0
R1615
4.7
1W
:RS
Q1617
R1620
4.7k
:CHIP
AUDIO L/R
R1649
47k
:CHIP
R1614
4.7
1W
:RS
VBLK
HPR
0
0.5
AUDIO R
Q1614
2SA1037K
MUTE SW
HPL
7
R
5.4
R1631
4.7
:FPRD
R1637
1k
:CHIP
Q1602
2SC2412K
MUTE
Q1607
2SC2412K
R1638RELAY DRIVE
R1644
12k :CHIP
R1639
1k :CHIP
C1619
0.1
25V
B:CHIP
R1618
22k
:CHIP
0
R1636
12k :CHIP
6
3
0.5
0
2
C1621
100
25V
Q1611
DTC143TKA
MUTE
R1652
120k
:CHIP
5
4
C1632
47
25V
2.1
0
SPSW
R1651 14.6
10k
:CHIP
C1635
220
25V
12.6
2.7
2.7
2.7
0
MUTE
C1634
2.2
IC1603
TDA2822M
HP/VAR AMP
C1612
1
2.7
HPSW
Q1610
2SA1037K
MUTE DRIVE
AUDIO L
L
D1619
1SS133T
0.3
D1613
MTZJ-13
R1617
6.8k
:CHIP
C1611
1
-
R1645
470
:CHIP
0.1
0
D1618
1SS133T
C1610
1
L
D1611
MTZJ-13
C1614
47
Q1605
DTC143TKA
MUTE
R1610
22k
:CHIP
+
Q1604
DTC143TKA
SW
14.5
C1613
47
Q1603
DTC143TKA
MUTE
C1604
0.1
:PT
SPSW
R1611
4.7k
:FPRD
C1607
0.01
:PT
-
R1609
22k
:CHIP
TO SPEAKER
1
2
3
4
R
AUDIO R
0.1
0
AUDIO L
AUDIO R
AUDIO R
STBY5V
AUDIO L
AUDIO L
D1604
1SS133T
R1607
22
:FPRD
D1601
1SS133T
D1603
1SS133T
C1603
0.1
:PT
AUDIO L/R
Q1601
DTC143TKA
MUTE
R1608
4.7k
:FPRD
D1606
1SS133T
R1606
22
:FPRD
CN1604
4P
WHT
:S-MICRO
C1650
100p
CH:CHIP
41PX1R
R656
0
:CHIP
1
2
3
4
5
6
7
8
9
10
VBLK
GND
HV DET
GND
GND
GND
GND
GND
GND
GND
R1647
JW(12.5)
TO D1/3,D2/3_1
CN1805
10P
:BTOB-S
TO D1/3,D2/3_2
TO E(3/4)BOARD
CN652
AUDIO L/R
5V 5.0
6.8
O
C1808
0.01
B:CHIP
STBY5V
7V
-5V
I
G
C1809
100
25V
IC1804
PQ05RF11
5V REG
C1821
10
STBY5V 5.0
TO D1/3,D2/3_3
7.4
O
9V 9.1
TO D1/3,D2/3_4
13.6
O
C1805
0.01
B:CHIP
+B
12V
C1803
470
16V
I
STBY7V
STBY 7V
G
IC1801
LM2940CT-5.0
STBY 5V REG
C1804
10
7V
I
12V
+12V
G
C1806
100
25V
C1802
0.01
B:CHIP
P.CONT
R1648
1
:FPRD
IC1802
PQ09RF2
9V REG
C1807
10
-5V
TO D1/3,D2/3_5
+B
135V
12V 12.0
12V
14.6
O
C1810
0.01
B:CHIP
5V
C1811
100
25V
10
9
8
7
6
5
4
3
2
1
15V
I
G
IC1803
L7812CV
12V REG
C1812
10
D
TO D2/3,D3/3_12
TO D2/3,D3/3_11
TO D2/3,D3/3_10
TO D2/3,D3/3_9
TO D2/3,D3/3_8
TO D2/3,D3/3_7
TO D1/3,D2/3_6
(2/3)
(AUDIO AMP)
B-SS510.<AEP>-D..-P2-05
– 74 –
-5V
P.CONT
GND
STBY 7V
7V
GND
12V
GND
NC
135V
KP-41PX1/41PX1K/41PX1R
K
RM-892
RM-862
Ref No.
41PX1/41PX1K
41PX1R
R1509
R1527
5.6k
2.2M
6.8k
1M
R1528
2.2M
1M
R1544
R1762
1k
3.9k
JW(5)
4.7k
R1763
3.3k
4.3k
R1764
3.9k
4.7k
TO D2/3,D3/3_12
* MARK LIST
TO D2/3,D3/3_11
TO D2/3,D3/3_10
TO D2/3,D3/3_9
TO D2/3,D3/3_8
Schematic Diagram of D (3/3) Board
TO D2/3,D3/3_7
+15V
C1516 0.1 25V B:CHIP
ABL
H.SHIFT
R1530
100k :CHIP
R1519 10k :CHIP
R1521
100k
:CHIP
R1531 47k :CHIP
R1520 47k :CHIP
R1765 10k :CHIP
FV
0
R1754 10k :CHIP
10k
:CHIP
Q1709
2SC2412K
HALF TONE
R1789
1k
:CHIP
D1706
MTZJ-5.1
YM1
R1522
47k
:CHIP
R1526
27k
:CHIP
R1763
*
:CHIP
:RN-CP
R1708
100
:CHIP
R1543
68k
:CHIP
R1707
100
:CHIP
R1762
*
:CHIP
15V
D1708
MTZJ-5.1
C1718
100
3
3
1
4
C1506
220
C1521
0.01
B:CHIP
2
5
IC1703
LM358D
SENSOR AMP
0
0
C1526
47
25V
R1539
10k
:CHIP
7
R1514
10k
:CHIP
C1721
0.01
B:CHIP
C1525
100
25V
IC1704
LM358D
SENSOR AMP
R1517
22k
:CHIP
R1534
47k
:CHIP
C1507
47p
CH:CHIP
R1513
1k
:CHIP
C1523
47p
CH:CHIP
C1532
1
HD
4
HP
*
C1513
C1514
C1510 0.01 C1511 0.01
1000 B:CHIP 1000 B:CHIP
Q1505
2SC2412K
BUFF
R1507
22k
:CHIP
L1502
JW(5)
R1505
0.47
:FPRD
L1503
JW(5)
R1533
0.47
:FPRD
PIN
PROT1
ABL
R1529
100
:CHIP
14.5
R1532
100
:CHIP
0.1
10
9
8
7
6
5
4
3
2
1
HD
GND
HP
GND
PIN
PROT1
ABL
-15V
GND
+15V
1
2
3
V DEF
NC
V RET
CN1501
3P
RED
:S-MICRO
VP
C1509 R1511
100p
2.2k
CH:CHIP :CHIP
C1512
1
Q1502
2SA1037K
PROT DELAY
TO E(3/4)BOARD
CN506
R1509
*
:RN-CP
R1544
-0.5
D1503
GP08D
R1515
10k
:CHIP
CN1806
10P
WHT
:BTOB-S
R1510 R1527 R1528
10k
* :CHIP
*
:RN-CP :CHIP
R1508
1.5
:FPRD
C1524
1
:MPS
R1516
10k
:CHIP
0.6
5
4
C1726
0.1
Q1501
2SC2412K
V DEF PROT
R1538
27k
:CHIP
0
5
4
R1537
10k
:CHIP
PROT1
R1771
470k
:CHIP
0
0
C1724
0.1
Q1503
2SC2412K
PROT
5
VD+
6
C1508
0.22
100V
:PT
L1501
8.2µH
:LHL08
D1504
1SS133T
8
7
C1716
0.01
B:CHIP
0
0
6
7
6
0
R1772
1k
:CHIP
C1727
0.1
1
8
R1769
560k
:CHIP
R1770
1k
:CHIP R1775
560k 0
:CHIP
C1720
0.01
B:CHIP
2
R1767
470k 0
:CHIP
C1715
0.01
B:CHIP
D1505
1SS1355TE
C1527
1500p
CH:CHIP
C1504
2200p CH:CHIP
R1540
56k
:CHIP
1.1
1.1
C1501
470p C1503
B:CHIP 0.1
100V
:PT
2
0.8
1
14.4
0
0.1
IC1501
STV9379
V OUT
R1502
6.8k
:RN-CP
R1501 R1518
2.2
2.2
1W
1W
:RS
:RS
*
3
R1768
1k
:CHIP
CLK
RMUTE
DATA
CEB
R1541
56k
:CHIP
R1512
33k
:CHIP
D1501
MTZJ-5.6B
TO ZR BOARD
CN1403
15V
-15V
1
R1758
100
:CHIP
+15V
TO E(1/4)BOARD
CN508
-15V
FOR CHECK
R1752
100
:CHIP
FV
D1709
RD4.7ES
SPSW
VBLK
D
(3/3)
(PJ ENGINE,V DEFRECTION)
1
2
3
4
5
6
7
8
9
10
11
12
13
R1741
220
:CHIP
1
2
3
4
5
6
7
8
CN1708
7P
WHT
:S-MICRO
12V
YM
YS
B
G
R
D1711
RD4.7ES
D1712
RD4.7ES
SCL
SDA
FS
R1778
1k
:CHIP
D1710
RD4.7ES
LOWER
GND
RIGHT
GND
LEFT
GND
UPPER
GND
CN1705
2P
RED
:S-MICRO
R1747
100
:CHIP
TO PHOTO SENSOR
CN1701
8P
RED
:S-MICRO
B-SS510.<AEP>-D..-P3-05
12V
SCL
SDA
FS
GND
PJE YM
PJE YS
PJE B
PJE G
PJE R
SP SW
50-60
VBLK
R1791 100 :CHIP
SCLN
SDAN
R1790 100 :CHIP
R1788 100 :CHIP
5V
1
2
3
4
5
6
7
R1787 100 :CHIP
SCL
SDA
FS
R1786 100 :CHIP
C1719
100
12V
TO A(5/5)BOARD CN6:41PX1/41PX1K
TO AE(5/5)BOARD CN6:41PX1R
– 75 –
CN1702
13P
WHT
:S-MICRO
GND
CN1502
1P
:FASTON
-15V
R1748
100
:CHIP
GND
RV WAVE
BV WAVE
GND
CLK
MUTE
DATA
CEB
GND
VP
VD-
FLY
GEN
Q1701
2SC2412K
BUFF
2.9
C1725
0.1
4
10
9
8
7
6
5
4
3
2
1
RW
BW
3.0
3.1
R1525
27k
:CHIP 3.1
3
YM
0
0.1
R1764
D1707
MTZJ-5.1
2.9
2.9
0
0.1
-0.3
2.9
2
5V
IC1706
PST9143NL
RESET
R1746
100
:CHIP
1
R1542
68k
:CHIP
5
VP
R1760 10k :CHIP
1
RESET
6
9
7
R1506
220
2W
:RS
2
R1774
100
:CHIP
5.0
GND
7
IC1503
LM358D
BUFF
0.1 0
R1757 10k :CHIP
3
5
R1773
10k
:CHIP
6
8
C1530 C1531
47
0.01
16V B:CHIP
C1520
10
15V
Q1702
2SC2412K
BUFF
R1709
100
:CHIP
0 R1740
R1739
10k :CHIP
5
R1729
100
:CHIP
YS
Q1703
2SC2412K
BUFF
0
0.1
4
-0.3
R1504
10k
:RN-CP
R1737
220
:CHIP
C1723
22p CH:CHIP
YM1
YS1
R1750 10k :CHIP
R1736
220
:CHIP
IC1702
C1709
M24C08-MN6T(A) 0.01
B:CHIP
NVM
C1711
47p CH:CHIP
R1745 10k :CHIP
BDAT
3
VCC
BCLK
8
VDD
4.7
7
GND
R1766
1k
:CHIP
4
1
3
2
XLC
C1518
100
16V
TO E(1/4)BOARD
CN804
0
D1705
MTZJ-5.1
C1717
0.01
B:CHIP
8
D1502
GP08D
C1710
47p CH:CHIP
L1702 3.9µH :EL0606
9
-13.6
R1743 100 :CHIP
C1708
470 16V
A2
YS1
R1706 4.7k :CHIP
R1792 47k :CHIP
R1705 4.7k :CHIP
C1707
0.01
B:CHIP
A1
4.7
Q1708
DTA144EKA
INV.
0
10
R
0
I-SENS2
0
I-SENS1
0
I-SENS0
0
I-ADR1
0
I-ADR0
0
I-NORM/WIDE
5.0
I-60/MULTI
5.0
O-FV
0
3.3
O-OSC
3.6
O-YM
0
O-YS
0
O-I
0
O-B
0
O-G
0
O-R
0
0
R1735
47k
:CHIP
A0
100
:CHIP
G
I-EOSC
I-SENS3
C1705
100p
CH:CHIP
4.9
Q1707
DTC144EKA
INV.
11
CN1703
10P
:BTOB-S
C1529
2200p CH:CHIP
0
0.1 R1728
D1704
MTZJ-5.6B
VDD
C1704
10
SCLN
FS
SDAN
S0
R1755
100
:CHIP
VSS
C1703
10
2
Q1705
2SC2412K
BUFF
14.5
1.9
R1753 10k :CHIP
3.0
I-EXTAL
2.4
C1702
10
S3
R1751 220 :CHIP
R1756 10k :CHIP
R1759 10k :CHIP
O-XTAL
4.9
12
IC1502
CA0007AM
V-SIZE COMP
1
B
R1749 220 :CHIP
4.9
VSS
C1701
10
R1731 220 :CHIP
R1734 1k :CHIP
Q1704
2SC2412K
BUFF
0
Q1711
2SC2412K
SW
R1727 220 :CHIP
GND
SCL
SDA
FS
5V
SCL N
SDA N
X1701
CST8.0MTW
8MHz
R1744 220 :CHIP
5.0
I-FS
BW
RW
D1703
MTZJ-5.6B
6
R1742 220 :CHIP
S3
S2
S1
S0
7
13
R1711
47k
:CHIP
S2
R1738 100 :CHIP
0.7
I-VBLK
I-RESETN
R1713
47k
:CHIP
6
0.1
I-HBLK
Q1710
2SC2412K
SW
R1715
47k
:CHIP
5
R1733 1k :CHIP
C1706
100p
CH:CHIP
8
8
R1732
1k
:CHIP
26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9
R1725
4.7k
:CHIP
R1730
2.2k
:CHIP
HP
VP
R1717
47k
:CHIP
SDA
4.5
S1
6
7
R1726 0 :CHIP
0.2
R1720 220 :CHIP
R1722 220 :CHIP
SCL
4.4 4.4
1
4
R1719 220 :CHIP
R1721 220 :CHIP
DATA
2.0
1.7
0.5
O-HSHIFT
0.1
I-SCLN0
4.4
I-SCLN1
4.7
IO-SDA0
4.5
O-SDA10
4.7
I-SDA1I
4.7
4.5
4.5
14
10
C1519
100
16V
2
O-VSHIFT
0.1
0
0
O-CEB
4.6
O-MUTE
5.0
O-DATA
0.1
O-CLKN
0.2
L1701
10µH
:EL0606
R1793 R1794 R1795
47k
47k
47k
:CHIP :CHIP :CHIP
3
O-R WAVE
I-NORM/LINE
5
CEB
Q1706
2SC2412K RMUTE
4.7 BUFF
R1714 10k :CHIP
R1716 220 :CHIP
4.5
4
I-50/100
R1712 10k :CHIP
CLK
O-B WAVE
27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52
1
I-VP
2
R1718
2.2k
:CHIP
3
R1710 1k :CHIP
R1704 4.7k :CHIP
IC1701
CXP86213-002S
PJ ENGINE
R1702 4.7k :CHIP
5V
R1703 4.7k :CHIP
R1701 4.7k :CHIP
C1517 10
C1528
1500p CH:CHIP
5V
PJERST 1
NC 2
(13)
RM-892
KP-41PX1/41PX1K/41PX1R
K
RM-892
RM-892
• D (3/3) BOARD WAVEFORMS
1
3
2
57.5 Vp-p (V)
4.7 Vp-p (V)
0.5 Vp-p (V)
0.5 Vp-p (V)
8
7
4
9
4.7 Vp-p (H)
5
4.7 Vp-p (H)
0
1.3 Vp-p (V)
1.3 Vp-p (V)
– 76 –
6
4.7 Vp-p (V)
3.6 Vp-p (8 MHz)
RM-862
KP-41PX1/41PX1K/41PX1R
K
D
RM-892
AUDIO AMP, V DEFRECTION,
PJ ENGINE
— D BOARD (Component Side) —
1
2
3
4
5
• D BOARD SEMICONDUCTOR LOCATION
(Component Side)
IC
IC1501
IC1602
IC1603
IC1701
IC1801
IC1802
IC1803
IC1804
A
D-4
B-4
B-2
D-3
B-5
C-5
C-4
C-4
DIODE
D1501
D1502
D1503
D1504
D1601
D1603
D1604
D1606
D1611
D1612
D1613
D1614
D1615
D1616
D1618
D1619
D1703
D1704
D1705
D1706
D1707
D1708
D1709
D1710
D1711
D1712
D1801
D1802
D1803
D1804
D1805
D1806
B
C
D-4
D-4
D-5
D-5
B-4
B-4
B-4
B-4
B-2
A-5
A-2
A-5
A-5
A-4
B-4
A-4
D-3
D-3
E-2
E-2
E-3
E-3
E-3
E-3
E-3
E-3
E-2
E-2
E-1
E-2
E-1
E-1
CRYSTAL
X1701
D
E
– 77 –
D-2
RM-892
RM-862
KP-41PX1/41PX1K/41PX1R
K
D
RM-892
AUDIO AMP, V DEFRECTION,
PJ ENGINE
— D BOARD (Conductor Side) —
1
2
3
4
5
• D BOARD SEMICONDUCTOR LOCATION
(Conductor Side)
Q1804
Q1805
Q1806
Q1807
Q1808
Q1809
IC
IC1501
IC1502
IC1503
IC1602
IC1603
IC1701
IC1702
IC1703
IC1704
IC1706
IC1801
IC1802
IC1803
IC1804
IC1805
A
D-2
D-2
D-2
B-2
B-4
D-3
D-3
E-4
E-3
D-4
B-1
C-1
C-2
C-1
B-5
B
C
D
D-1
D-1
D-1
D-2
A-4
B-2
A-3
A-2
A-2
A-1
A-1
A-2
B-2
B-2
A-4
A-3
A-4
A-2
A-2
A-2
E-2
E-2
E-2
D-2
D-2
D-4
D-3
D-3
E-3
C-3
D-3
E-4
A-4
A-4
1
1
1
1
1
1
DIODE
TRANSISTOR
Q1501
Q1502
Q1503
Q1505
Q1601
Q1602
Q1603
Q1604
Q1605
Q1607
Q1608
Q1609
Q1610
Q1611
Q1612
Q1613
Q1614
Q1615
Q1616
Q1617
Q1701
Q1702
Q1703
Q1704
Q1705
Q1706
Q1707
Q1708
Q1709
Q1710
Q1711
Q1801
Q1802
Q1803
B-4
B-4
B-4
B-4
C-1
C-1
*
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
D1501
D1502
D1503
D1504
D1505
D1601
D1602
D1603
D1604
D1605
D1606
D1607
D1611
D1612
D1613
D1614
D1615
D1616
D1617
D1618
D1619
D1620
D1621
D1622
D1703
D1704
D1705
D1706
D1707
D1708
D1709
D1710
D1711
D1712
D1801
D1802
D1803
D1804
D1805
D1806
D-1
D-2
D-1
D-1
D-1
B-2
B-2
B-2
B-2
B-2
B-2
B-2
B-4
A-1
A-4
A-1
A-1
A-2
A-3
B-2
A-2
A-3
A-2
A-2
D-3
D-3
E-4
E-4
E-3
E-3
E-3
E-3
E-3
E-3
E-4
E-4
E-5
E-4
E-5
E-5
*–
–
–
–
3
–
8
–
–
8
–
8
–
–
–
–
–
–
4
–
–
4
4
4
–
–
–
–
–
–
–
–
–
–
–
–
–
–
–
–
CRYSTAL
X1701
D-4
*: Refer to Terminal name of semiconductors in silk
screen printed circuit (see page 54)
E
– 78 –
RM-892
RM-862
KP-41PX1/41PX1K/41PX1R
K
(14)
RM-892
RM-892
Schematic Diagram of E (1/4) Board
BV
BH
TO E1/4,E2/4_1
TO E1/4,E2/4_2
H2
TO E1/4,E2/4_3
CN508
1P
:FASTON
5V
TO E1/4,E2/4_4
TO E1/4,E2/4_5
5V
1
R809
4.7k
R823
1k
Q812
2SA1309A
HP SHAPE
DATA
CEB
INJ
42
40
39
MUTE
38
CLKB
0
A2INM
-0.4
0
A2INP
R882
10k
R881
180
0
PCSEL
5.0
37
VEE
C849
100p
36
C827 10
R883
10k
35
C828 470p
C850
100p
0
A1INP
0
-4.9
R884
10k
:RN
0
CLKB
34
HV
R842 100
R868
8.2k
:RN
0
A1INM
TO E1/4,E2/4_6
33
ICADDR
0.2
BH 0UT
TO E1/4,E2/4_7
32
V.PARA
R843 100
R834
100k
41
1
2
3
4
5
R830
560
TO E1/4,E2/4_8
4.7
C842
0.047
:PT
C845
100
16V
MUTE
V.SIN BTMDET
-0.8
V.4TH
0.4
0
VOUT3
0
VCC
31
30
29
R859 27k :RN
R858 27k :RN
0
MPOVT
R847 330k :RN
0
MPIN1
D523
1SS133
R857 100
0
MPIN2
R597
62k
R856 100
0
C835 47
C839
0.047
:PT
10
V.6TH
0
-0.5
21
VEE
V4
C836 0.22 :MPS
11
8
V.5TH
9
PEEKDET
R837
100k
28
V.SIN
0
VOUT2
R902
15k
:RN
R860 27k :RN
27
H.PARA
-0.8
V3
12
7
10
V.4TH PARA.C
-1.0
R816 100
0.2 C837 4.7
R861 27k :RN
26
15
13
-0.8
0
VOUT1
-0.8
R831
560
HOUT3
0
25
V.PARA RET-R
R829
1.2 5.6k
-0.1
24
H.SAW
-1.3 C831 1
GND
9
R862 27k :RN
R879
10k
:RN
R596
150k
23
V.PARA
HOUT2
TO E1/4,E2/4_9
R863 27k :RN
22
15
V.SAW
16
16
V2
HOUT1
-0.1
-2.1
17
4
V.SAW
C826 0.1 :MPS
RETDET
5
V1 R805 100
0
V2 R810 100
RET.C
1.2
V1
CEB
4.6
18
3
VCC
C838
100 25V
17
2
SAW.C
1.2
R841
220
R844
100
19
SWDET
18
1
V.BLK
R838
2.2k
D820
MTZJ-3.6
DATA
0.1
R846
100
-1.6
7
V3 R814 100
0
V4
C834 100
R824
51k
:RN
6
R828
5.6k
C829 0.47
0.1
C809
0.047
:PT
V.SAW
20
D702 6
1SS133
5V
C805
220
16V
H.4TH
-1.0
IC801
PA0053B
V.WAVE-GEN
R822 1k
C810
0.047
:PT
C812
0.22
:MPS
0.1
-5V
14
13
V2
H.SIN
7
15
1.2
BV OUT
R872
4.7k
0
-0.8
-1.7 C832 1
V1
GND
5.0
8
C806
220
16V
H.PARA
H4
R835
100k
0.1
R702 0.6
R703 2.2k
2.2k
C701
100
16V
-5V
H6TH
6
D701
RD3.0ES-T1B2
TO D(3/3)BOARD
CN1703
VEE
H2
H3
Q702
Q701
2SC3311A 2SC3311A
P.ON MUTE P.ON MUTE
0.2
SCL
MUTE
SDA
CEB
C813
0.047
:PT
1.2 C830 470p
Q806
2SA1309A
BUFF
8
9
5
-0.8 BTMDET
0.3
0.1 PARA.C
H.4TH
-0.8
-1.0 PEEKDET
H.5TH
0.5
H.SIN
0
Q804
2SA1309A
BUFF
12
6
R817 100
REF-R
H.PARA
0
-1.5 C833 1
H.SAW
11
4
5
4
R815 100
GND
0
3
R811 100
H.SAW
11
H1
9
3
H4
C803
220
16V
RETDET
R807 100
7
H2
VCC
16
1.2
8
C811
0.001
17
0.3
RET.C
R839
100
10
SAW.C
0
R848 15k :RN
0
0
11
H.BLK SAWDET
2
C807
0.047
:PT
0
18
R1901 C820
68k 0.01
H3
R826
51k
:RN
5V
C841
0.047
:PT
R845
100k
IC804
PM0011AS
B-CONV-CORR
C844
100
16V
V2
TO E1/4,E2/4_10
R832
100k
TO E1/4,E3/4_20
TO E1/4,E3/4_19
TO E1/4,E3/4_18
TO E1/4,E2/4_13
TO E1/4,E3/4_17
TO E1/4,E3/4_15
TO E1/4,E3/4_14
R825
100k
H3
TO E1/4,E2/4_11
TO E1/4,E2/4_12
TO E1/4,E3/4_16
10
9
8
7
6
5
4
3
2
1
R878
100k
R869
4.7k
R529 15k :RN
10
Q811
2SC3311A
HP SHAPE
CN804
10P
:B-TO-B
GND
RV WAVE
BV WAVE
GND
CLK
MUTE
DATA
CEB
GND
VP
0
R819
100
H1
C804
220
16V
0
IC802
PA0053B
H.WAVE-GEN
1
R808
10k
R802
100
12
0.1
C808
0.047
:PT
R801
100
R867
27k
:RN
13
1
0.3
C816
470p
Q803
2SC3311A
BUFF
14
R820
47k
0.6
3.0
R804
4.7k
Q801
2SC3311A
BUFF
R704 33k
14
TO D(3/3)BOARD
CN1502
2
GND
E
(1/4)
(HV WAVE GENERATOR)
B-SS510.<AEP>-E..-P1-05
– 79 –
RM-862
KP-41PX1/41PX1K/41PX1R
K
RM-892
Schematic Diagram of E (2/4) Board
RV
RH
GH
GV
TO E1/4,E2/4_1
TO E1/4,E2/4_2
C880
47
25V
R999
4.7k
R979
4.7k
H2
SUB.
GND
1
TO E1/4,E2/4_3
Q810
2SC3311A
MUTE
2
-5V
R989
4.7k
5V
R706 33k
R701 15k
0
D835 R875
C851
0.047 MTZJ-5.6 100k
:PT PROTECT
V4
V.4TH
VCC
-0.8
0
R912
10k :RN
R943
100k
R947
100k
R939
1.5M
R933
10k
:RN
C861
0.047
:PT
R908
10k
:RN
C862
0.047
:PT
C863
0.047
:PT
C848
100 16V
6
42
7
41
Ch.1
-Vcc
8
9
VB
+Vcc
10
39
38
37
36
HB
35
13
33
1
2
3
4
14
32
C887 100p
C886 100p
TO ZG BOARD
CN1462
15
GV
16
R938
1k
:RN
15V
L801
220µH
R998
4.7k
R852 100
Q809
2SC3311A
MUTE
IC808
PM0011AS
R-CONV-CORR
C885
47
25V
D519
1SS133
C897
100 25V
C884
100 25V
C883
100p
GH
7
R959
3.3k :RN
CN801
4P
RED
:S-MICRO
R957
2.2 1/2W :RN
11
+Vcc
10
PS606
2A
PS607
2A
13
Ch.2
-Vcc
12
VR
R958
2.2 1/2W :RN
9
HG
H2
0.3
TO E2/4,E3/4_21
TO E2/4,E3/4_22
TO E2/4,E3/4_23
R910
1k
:RN
Ch.1
-Vcc
8
H3
H2
0.1
C815
100
25V
R909
1k
:RN
R904
2.2 1/2W :RN
1
2
3
4
R920
2.2 1/2W :RN
C882 100p
R955
3.3k :RN RV
14
0.2
0.2
C881
100p
15
RH
-0.1
R954
3.3k :RN
16
-0.1
R903
1k :RN
R906
2.2 1/2W :RN
18
HR
Ch.3
-Vcc
17
TO E2/4,E4/4_25
TO E2/4,E4/4_24
(CONVERGENCE OUT)
OUT
OUT
RET
RET
TO ZG BOARD
CN1433
C858
100
25V
6
V2
-14.5
0
TO E1/4,E2/4_13
E(2/4)
HG
VG
VG
HG
-15V
-14.5
-13.4
0.1
TO E1/4,E2/4_11
TO E1/4,E2/4_12
1
2
3
4
R961
4.7k
-13.4
TO E1/4,E2/4_10
CN802
4P
WHT
:S-MICRO
R963
2.2 1/2W :RN
R962
2.2 1/2W :RN
PS605
2A
L802
220µH
OUT
OUT
RET
RET
R964
3.3k :RN
Ch.3
-Vcc
17
VG
30
28
27
D522
1SS133
0.1
HB
VB
VB
HB
BH
0.1
IC810
STK392-150
CONV.OUT
0.1
R911
47k :RN
CN803
4P
BLK
:S-MICRO
R965
3.3k :RN
R851 100
-0.5 -0.1
MPIN2
R944
1k
:RN
0.1
R986
15k
:RN
R850 330k :RN
0
MPIN1
R578
150k
R901
15k
:RN
R595
62k
R967 27k :RN
0
MPOUT
R929
2.2 1/2W :RN
0
R968 27k :RN
-0.4
VOUT3
R971 27k :RN
R969 27k :RN
0
VOUT2
R984
10k
:RN
R970 27k :RN
0
VOUT1
R972 27k :RN
29
0.7
PS604
2A
0
CEB
31
CEB
HOUT1
SDA
R966 220
4.6
R975
2.2 1/2W :RN
R973
2.2 1/2W :RN
R930
2.2 1/2W :RN
1
V.SIN
BV
R976
3.3k
:RN
C802
100
25V
SUB.
GND
18
R913 27k :RN
H.PARA
V3
R980 220
26
12
13
14
30
29
R914 27k :RN
DATA
0.2
15
0
C888 100p
PS603
2A
MUTE
25
33
32
31
H.SAW
R981 220
5.0
HOUT3
-0.8
R941
100k
MUTE
SCL
34
CLKB
R987
180
R983 220
R946
1k
:RN
2
MPIN2
0
0.1
V.PARA
0
0
-2.0
-0.4
IC806
PM0011AS
G-CONV-CORR
C846
100 16V
V2
R988
10k
Pre. Pre.
+Vcc -Vcc MUTE
5
4
3
VCC
A2INP
V.SAW
0
R915 27k :RN
0
MPIN1
R948
220
R916 27k :RN
0
MPOUT
R942
2.2k
V1
R917 27k :RN
19
0
VOUT3
0
R918 27k :RN
0.3
0
V1
C852
0.047
:PT
VOUT2
0
-0.5
C853
0.047
:PT
HOUT3
R985
10k
C876
100p
0
A2INM
0.2
C877
100p
0
A1INP
HOUT2
20
V.4TH
4.6
R924
10k
:RN
R997
10k
:RN
R978
8.2k
V1
V3
V4
INJ
0.2
21
15
16
0
17
-0.8
V.SIN
CEB
0
0
18
R896
100k
HOUT2
VOUT1
H.PARA
DATA
-0.1
0
-0.8
V3
HOUT1
V.PARA
H.SAW
4.7
4.6
V.SAW
19
V2
-2.0
20
V1
R898
220
CEB
28
4.6
R895
2.2k
DATA
27
14
INJ
0.1
MUTE
0.2
26
13
CEB
CLKB
5.0
25
TO E1/4,E2/4_9
5.0
VEE
5.0
24
12
DATA
A1INM
4.7
C854
100 16V
23
11
MUTE
TO E1/4,E2/4_8
TO E1/4,E2/4_7
MUTE
0.2
RH OUT
PCSEL
5.0
0
CLKB
RV OUT
40
1
R951
100
22
10
CLKB
4.7
C847
100 16V
4
6
R952
100
R940
100k
4.7
TO E1/4,E2/4_6
5.0
C889
100
25V
C801
100
25V
24
PCSEL
5.0
R926
180
35
VEE
R897
100
HV
R949 100
34
8
HV
9
R885
100k
ICADDR
R950 100
0
R890
100k
5
41
40
R927
10k
5V
7
0
A2INP
-0.4
8
-0.4
ICADDR
V.PARA
9
A2INM
V.PARA
C855
100p
10
0
11
A1INP
0
0
16
5
V.SAW
R928
10k
V.SAW
-1.0
C856
100p
0
6
R887
100
A1INM
7
R888
100
R922
10k :RN
0.1
17
0.1
-1.0
39
4
H.4TH
H.4TH
-15V
-14.5
0.2
0.1 -0.1
H4
38
H4
GH OUT
37
3
H.SIN
36
H3
H.SIN
-0.8
H3
R931
10k
:RN
13
23
0.1
H.PARA
12
GND
H.SAW
0
H2
22
GV OUT
-0.8
H1
2
H.PARA
0
H2
GND
R923
4.7k
3
H.SAW
R982
100k
R993
4.7k
42
1
H1
2
R563 22k :RN
R894 27k
D510
1SS133
-14.5
11
R925
4.7k
R705 33k
-13.5
-13.5
18
-5V
R974
27k
:RN
Ch.2
-Vcc
12
TO E1/4,E2/4_4
TO E1/4,E2/4_5
Pre. Pre.
+Vcc -Vcc MUTE
5
4
3
R995
JW(5)
5V
21
(15)
RM-892
-0.1
IC809
STK392-150
CONV.OUT
PS608
2A
C859
100
25V
R905
2.2 1/2W :RN
B-SS510.<AEP>-E..-P2-05
– 80 –
HR
VR
VR
HR
OUT
OUT
RET
RET
TO ZR BOARD
CN1404
RM-862
KP-41PX1/41PX1K/41PX1R
K
RM-892
1000M
TO PICTURE HV(G)
TUBE G
GND
HV.REG
STDBY 7V
STDBY 7V
TO PICTURE HV(B)
TUBE B
TO E1/4,E3/4_20
TO E1/4,E3/4_19
TO E1/4,E3/4_18
TO E1/4,E3/4_17
TO E1/4,E3/4_16
TO E1/4,E3/4_15
CN507
4P
WHT
:S-MICRO
3000P
TO PICTURE HV(R)
TUBE R
TO E1/4,E3/4_14
Schematic Diagram of E (3/4) Board
1000M
(16)
RM-892
E(3/4) (HV)
4
3
2
1
TO E2/4,E3/4_21
TO E2/4,E3/4_22
TO E2/4,E3/4_23
HV
<HV.BLOCK>
7V
CN506
10P
:B-TO-B
R813
22k
Q802
2SA1309A
BUFF
2.0
-0.3
-0.3
15V
2.5
-15V
IC803
CA0007AD
SHADING CONT
Y X
X Y
MPY
MPY
-0.2
R892
4.7k
14
Q508
#
HV COMP
8
7
13V
R870
47k
0
9
R871
1k
V1
10
5
R865
3.9k
0
R877
27k 4.0
C824
10
0
1.4
6
Q808
DTC144ESA
SW
R866
47k
V1
1.9
1.4
TO E3/4,E4/4_29
Q807
2SC3311A
KEY OFFSET
C857
D850 100
16V
#
11
Q805
2SC3311A
BUFF
4
2.0
2.0
0.3
-5V
14
1
-0.3
R821
15k
12.1
10
9
8
7
6
5
4
3
2
1
C818
100 16V
5V
R806
10k
13
C821
0.1
:PT
TO E3/4,E4/4_27
TO E3/4,E4/4_28
D828
#
-0.3
12
R818
10k
5.6
4.9
2
D829
MTZJ-5.1
R853
220k
3
R803
12k
TO D(3/3)BOARD
CN1806
-5V
P.CONT
GND
STBY 7V
7V
GND
12V
GND
NC
135V
H1
TO E3/4,E4/4_26
10
9
8
7
6
5
4
3
2
1
H3
HD
GND
HP
GND
PIN
PROT
ABL
-15V
GND
+15V
5V
R561
#
C557
#
R587
#
R592
#
TO E3/4,E4/4_30
5V
-5V
-5V
C558
#
R564
#
-15V
R593
#
15V
CN652
10P
:B-TO-B
HD
ABL
R566
JW(5)
12V
+B
C543
#
HP
R505
180k
TO G BOARD
CN6011
15V
8.1
C817
47
25V
R833
82 3W :RS
-7.6
D506
JW(5)
IC813
NJM79M05FA
-5V REG
C823
47
25V
-4.9
R507
2.7k
R572
470k
R571
2.7k
R522
8.2k
-5V
9.9
R527
4.7k
O
R573
56k
C540
0.022
14
13
12
11
10
R574
33k
R504
1.5k
2.3 1.6
9
R525
100
:FPRD
8
17
5
4
3
2
1
C819
47
25V
C867
47
25V
PS602
5.0A
R577
2.7k
1
2
3
4
14.6
-13.6
I
O
C878
47
25V
7
R579
270k
16
IC814
C879 C898
NJM78L12A-T3 47 0.01
25V
:F
+12V REG
D524
1SS133
R523
47k
D527
MTZJ-5.1B
C872
1
R1904
4.7k
R502
27k
2W
:RS
D501
1SS133
C507 R514 R516
22 8.2k 150k
:RN :RN
TO E3/4,E4/4_36
TO E3/4,E4/4_37
249
D507
R517
15k
:RN
O
G
IC807
C874 C875
NJM79L12A-T3 47 0.01
25V
:F
-12V REG
6
6.0 1.8 8.6 7.7
12.1
I
G
15
R503
3.3k
0.1
0.7
-14.7
5
TO E3/4,E4/4_35
-0.6
19
PS601
5.0A
Q501
2SC2688
H DRIVE
C502
0.47 65.0
IC501
µPC339C
PIN MOD/HV PROT
18
C870
0.01
:F
15V
C843
47
25V
R568
1M
R509
47k
G
TO G BOARD
CN6009
EL1Z-V1
9.9
C513
22
R580
47k
S
Q505
2SK2251
PIN AMP
JW503
5MM
L504
JW(5)
D504
MTZJ-7.5B
TO E3/4,E4/4_38
+B
C556
0.1
:PT
L803
:LHL10
R560
1SS133
C506 R581
100 47k
16V
R583
8.2k
C555
1
D502
1SS133
1
2
10
9
8
7
6
5
4
3
2
1
C822
100
160V
B-SS510.<AEP>-E..-P3-05
GND
GND
GND
GND
GND
GND
GND
HV.DET
GND
VBLK
CN810
3P
:MINI
C511
0.0022 R513
:PT 3.3k
C512
0.001
:PP
13V
R827
82 3W :RS
-15V
1
2
3
R518
39k
R575
JW(5)
O
I
CN808
5P
:MINI
GND
+B OUT
+B IN
5V
C518
0.1
:PT
R501
2.2k
L502
47µH
:FLR50
G
R994
82 3W :RS
TO G BOARD
CN6008
-15V
GND
+15V
GND
+135V
5.0
I
6
5
4
3
2
1
C868
0.01
:F
TO E3/4,E4/4_34
C505
1000p C522
#
TO D(2/3)BOARD
CN1606
R1
R1
+7V
GND
PROT
P.CONT
GND
STBY 7V
IC812
NJM78M05FA
+5V REG
R900
82 3W :RS
R893
2.2k
1.8
CN807
6P
WHT
:S-MICRO
C873
10
R582
#
R506
150k
7V
1.7
3
2
1
TO E3/4,E4/4_31
TO E3/4,E4/4_32
TO E3/4,E4/4_33
13V
CN806
3P
GND
NC
+12V
13V
13V
4.4
TO D(2/3)BOARD
CN1805
-15V
TO E(4/4)BOARD T504
CN651
10P
:B-TO-B
CN505
2P
:LARGE
R
R1
9.1k
820K
– 81 –
RM-862
KP-41PX1/41PX1K/41PX1R
TO E2/4,E4/4_25
TO E2/4,E4/4_24
Schematic Diagram of E (4/4) Board
RM-862
7V
CN805
4P
:MINI
R836
100
R586
1k
7.0
0.4
1
TO E3/4,E4/4_29
D840
1SS133
C539
0.0047
2kV
E
6.9
C825
100
25V
R886
8.2k
11
11.8
R553
120k
R552
Q506
2SC3311A 100
DF AMP
R945 R991
68k 10k
SG501
GND
NC
DF
G2
TO E(4/4)BOARD T504
D503
1SS133
R555
100
11.6
R519
10k
DET
9
R550
100
R873
100
C536
0.047
:PT
8
C537
100/50V
R549
15k
R551
47k
IC805
NJM2058D
DF AMP
R548
470
643
R538
4.7k
Q504
2SC4634LS
G2-STOP
R547
100
D512
1SS133
13V
TO E3/4,E4/4_30
FV(B)
TO CG BOARD
CN734
FV(G)
(FOCUS BLOCK)
R591
4.7k
CN504
4P
:VH
13V
1
2
3
4
13V
R-H(+)
NC
NC
R-H(-)
TO ZR BOARD
CN1405
CN503
4P
:VH
1
2
3
4
G-H(+)
NC
NC
G-H(-)
TO ZG BOARD
CN1434
CN502
4P
:VH
1
2
3
4
135V
C
+B
C516
0.015
1.2kV
R512
1.5k
3W
:RS
D509
ERC06-15S
C514
680p
2kV
:B
R511
1.5k
3W
:RS
Q502
2SD2539
H OUT
R510
1.5k
3W
:RS
168 R589
220k
T501 20
HDT
0.1
1
3
C524
C519
0.0047 0.0047
100V
100V
:PT
:PT
4
5
6
1
C523
0.82
250V
:PP
C515
0.033
630V
:PP
C554
0.0056
630V
:PP
4
R528
68 3W :RS
2
H1
R570
68 3W :RS
D511
RGP10G
TO HV BLOCK
TO FOCUS PACK
MV
7
R540
0.47 :FPRD
C528
1
250V
H2
C541
0.047
:PT
3
6
R542
150
1W
:RS
8
7
R545
0.47
:FPRD
5
11
R-BIAS
C550
470
16V
D514
GP08D
R544 C551
470
150 1W :RS16V
D515
GP08D
R543
1 1W :RS
FB501
1.1UH
L503
10µH
:LM
TO HDY(B)
T504
FBT
+B
R567
1.2
C548
220p
500V
B
C508
470p
500V
B
B-H(+)
NC
NC
B-H(-)
+200V
C532
470
9
3
D513
RGP10GPKG23
200V-RECT
L506
2.2mH
:LHL08
R532
82
1/2W
:FPRD
10
HV
4
C533
47
250V
C529
0.68
250V
:PP
C526 R531
470p 680
500V 1/2W
:B :FPRD
T502
PMT
R530
10k
R576
100
D508
ERD29-08J
R508
6.8k
1/2W
:FPRD
C520
680p
2kV
B
R588
22k
R521
JW(7.5)
C509
0.047
200V
:PT
L505
SnS182
R584
10k
C521
680p
2kV
B
1
R536
L508 0.47
JW(5) :FPRD
R535
220k
C531
470
21
9
R546
0.47
:FPRD
8
13
10
R-BIAS
C530
100
160V
R533
91k
1/2W
:RN
R534
270k
:RN
CN501
10P
WHT
:S-MICRO
C535
0.068
200V
:PT
R539
0.47
:FPRD
R537
4.7k
1/2W
:FPRD
NL501
R569
1.2 3W :RS
R541 100
R565 100
TO E3/4,E4/4_38
1
2
3
4
5
6
7
8
9
10
B-SS510.<AEP>-E..-P4-05
– 82 –
FV(R)
TO CR BOARD
CN704
-13V
TO E3/4,E4/4_34
FV
TO CB BOARD
CN763
C864
100
16V
TO E3/4,E4/4_32
TO E3/4,E4/4_33
DF
0
0
-1.1
TO E3/4,E4/4_31
G2
R562
100k
1/2W
:RC
C542
220
16V
6.9
C527 R524
330 4.7k
1.2
0
C869
0.022
:PT
4
3
2
1
1.0
R874
33k
7
D846
1SS133
D845
1SS133
5
R990
15k
0
6
R854 C866 R889
68k
1
10k
:MPS
0
R935
10k
C538
100
R554
100
:FPRD
C840
100
25V
0
0
6
3
-0.2
Q507
2SC5022-02 764
DF OUT
10
0
5
7
2
R936
10k
4
8
1
0.9
-0.2
C860
100
16V
Q503
2SA1309A
G2-STOP/CONTROL
R556
1k
1/2W
6.8
R934
2.7k
-2.9
R956
10k
R585
39k
3W
:RS
12
3
7.4
R953
33k
R559
39k
3W
:RS
R891
3.3k
0
0
R937
27k
R558
39k
3W
:RS
R557
39k
3W
:RS
2W
D517
RGP02-20EL :RS
R919
33k
13
IC811
NJM4560D
SHADING AMP
C899
JW(5)
C865
0.0022
:PT
2
D842
1SS133
R921
10k
14
TO E3/4,E4/4_28
TO E3/4,E4/4_36
TO E3/4,E4/4_37
RM-892
E
TO E3/4,E4/4_27
TO E3/4,E4/4_35
RM-892
(4/4)
(H DEFRECTION, DY)
TO E3/4,E4/4_26
4
(17)
K
B/S
R/S
NC
H(+)
H(-)
NC
NC
200V
NC
GND
TO CB BOARD
CN766
KP-41PX1/41PX1K/41PX1R
K
RM-892
• E (1/4) BOARD WAVEFORMS
1
2
4.7 Vp-p (H)
3
2.5 Vp-p (H)
8
7
2.5 Vp-p (H)
5
2.4 Vp-p (H)
0
9
2.4 Vp-p (V)
2.5 Vp-p (V)
4
2.2 Vp-p (H)
4.7 Vp-p (V)
qa
2.3 Vp-p (V)
2.4 Vp-p (V)
6
2.3 Vp-p (V)
• E (2/4) BOARD WAVEFORMS
qs
qd
1.6 Vp-p (V)
2.3 Vp-p (V)
• E (3/4) BOARD WAVEFORMS
qg
qf
1.4 Vp-p (V)
qh
2.5 Vp-p (H)
89.5 Vp-p (H)
qj
12.4 Vp-p (H)
• E (4/4) BOARD WAVEFORMS
w;
10.9 Vp-p (H)
wa
1100 Vp-p (H)
– 83 –
qk
11.3 Vp-p (H)
ql
4.7 Vp-p (H)
RM-892
RM-862
E
KP-41PX1/41PX1K/41PX1R
NOTE:
The circuit indicated as left contains high voltage of over
600 Vp-p. Care must be paid to prevent an electric shock in
inspection or repairing.
H DEFRECTION,
HV, DY DRIVE
K
— E BOARD —
1
2
3
4
5
6
7
RM-892
• E BOARD SEMICONDUCTOR
LOCATION
IC
IC501
IC801
IC802
IC803
IC804
IC805
IC806
IC807
IC808
IC809
IC810
IC811
IC812
IC813
IC814
A
B-3
B-1
B-2
B-1
D-4
B-3
D-2
A-3
D-1
E-2
E-3
A-3
A-2
A-2
A-3
TRANSISTOR
Q501
Q502
Q503
Q504
Q505
Q506
Q507
Q701
Q702
Q801
Q802
Q803
Q804
Q805
Q806
Q807
B
C
D
E
– 84 –
RM-892
E-5
D-5
A-6
A-6
B-5
A-6
A-6
C-1
C-1
A-1
B-1
A-1
A-1
B-1
A-1
A-2
Q808
Q809
Q810
Q811
Q812
A-1
E-2
E-4
B-2
B-2
DIODE
D501
D502
D503
D504
D507
D508
D509
D510
D511
D512
D513
D514
D515
D517
D519
D522
D523
D524
D527
D560
D701
D702
D820
D829
D835
D840
D842
D845
D846
B-3
C-3
A-5
B-3
B-3
C-5
C-5
E-4
B-5
A-6
C-6
E-7
C-7
B-6
E-2
C-2
D-4
C-4
B-4
C-3
B-1
C-2
C-1
A-1
C-3
A-2
A-2
A-2
A-3
RM-862
KP-41PX1/41PX1K/41PX1R
K
(18)
ZG
Schematic Diagram of ZG Board
CN1434
4P
:VH
VM, GREEN/BLUE DY
— ZG BOARD —
T0 E(4/4)
BOARD CN503
DY(H)
1
2
3
4
H+
H(MID)
HH.IN
V.IN
CN1433
4P
WHT
:S-MICRO
SUB DY
DY(V)
V.RET
H.RET
V.DEF
V(MID)
V.RET
R1435
120
3W
R1436
120
3W
1
2
3
4
R1432
560
R1431
560
C1446
470
16V
CN1461
3P
WHT
:S-MICRO
1
2
3
VM.IN
VM
R1454
33
1/2W
:FPRD
VM.RET
R1455
1.5
:FPRD
(G)
R1440
680
:FPRD
DH(H)
H+
H MID
H+
69.2
D1435
1SS133
6.4
6.4
R1463
10k
R1447
47
5.9
Q1438
2SA1309A
BUFF
1.1
R1458
1.5
:FPRD
V.RET
H.RET
V.DEF
V.MID
V.RET
C1434
0.01
Q1431
200V
2SC4793
:PT
VM.DRIVE2 R1437
680
:FRPD
R1459
33
:FPRD
R1444
100
5.2
C1443
470
16V
R1452
470
3.4
Q1435
2SC3311A
AMP
2.8
2.5
R1445
680
:RN
R1449
47
:RN
R1450 C1441
4.7k 0.47
:PT
CN1432
7P
WHT
:S-MICRO
1
2
3
4
5
6
7
R1453
JW(5)
Q1436
2SC3311A
AMP
R1441
JW(5)
C1440
47
25V
T0 ZR BOARD
CN1401
R1442
100
C1445
470
16V
CN1463
2P
RED
:S-MICRO
R1451
220
(B)
1
2
NOTE:
The circuit indicated as left contains high voltage of over
600 Vp-p. Care must be paid to prevent an electric shock in
inspection or repairing.
VM OUT
VM.RET
T0 VM(B)
ZG
R1468
120
3W
:RS
(VM,GREEN/BLUE DY)
R1465
120
3W
:RS
T0 SUB DY(B)
1
GND
1
1
2
3
4
CN1462 CN1436
4P
#
BLK
:FASTON
:S-MICRO
GND
CN1464
4P
BLK
:S-MICRO
HB.IN
VB.IN
VB.RET
HB.RET
4
3
2
1
DY1461
HB.RET
VB.RET
VB.IN
HB.IN
VM
R1434
680
3W
:RS
V.IN
NC
V.OUT
NC
VM.OUT
NC
VM.RET
D1433
1SS133
SW
R1460
680
3W
:RS
VM.IN
VM.RET
135V
NC
9V
GND
VM
TO D(1/3)
BOARD CN1804
3.1
7.5
CN1431
5P
WHT
:S-MICRO
1
2
3
4
5
D1437
1SS133
5.2
18k
:RN
R1464
JW(5)
C1442
#
D1436
1SS133
Q1433
2SA1309A
BUFF
5.9
R1457
1k
:FPRD
1.6
SUB DY
DY(V)
R1446
47
C1437
0.001
:PT
C1431
10p
:CH
C1432
470
16V
D1434
1SS133
6.9
C1436
D1431
0.001
MTZJ-T-22
:PT
DC.BIAS R1438
H.IN
V.IN
R1448
1k
7.5
V.DEF
V.MID
V.RET
T0 V DY(B)
R1461
560
R1433
L1432 0.47
JW(5) :FPRD
9V
6.9
C1435
2.2
160V
C1433
0.01
200V
:PT
Q1437
2SC3311A
BUFF
134.1 R1439
18k
69.2
D1432
MTZJ-T-22
DC.BIAS
TO E(4/4)
BOARD CN502
Q1434
2SC3311A
BUFF
C1438
0.01
200V
:PT
R1456
JW(10)
Q1432
2SA1837
VM.DRIVE1
C1439
0.0047 L1431 R1443
500V
47µH 0.47
:E
:FLR50 :FPRD
135V
134.6
DY1431
HG.IN
VG.IN
VG.RET
HG.RET
T0 E(2/4)
BOARD CN802
R1462
560
C1444
100
160V
G-H(+)
NC
NC
G-H(-)
CN1437
#
:FASTON
B-SS774.<AEP>-ZG.-05
T0 E(2/4)
BOARD CN803
– 85 –
RM-892
RM-892
RM-862
KP-41PX1/41PX1K/41PX1R
K
(19)
ZR
Schematic Diagram of ZR Board
CN1405
4P
:VH
RED DY
— ZR BOARD —
TO E(4/4)
BOARD CN504
DY(H)
H+
H(MID)
H-
1
2
3
4
H.IN
V.IN
CN1404
4P
RED
:S-MICRO
SUB DY
DY(V)
V.RET
H.RET
V.DEF
V(MID)
V.RET
R-H(+)
NC
NC
R-H(-)
R1415
120
3W
TO E(2/4)
BOARD CN801
R1418
120
3W
1
2
3
4
R1402
560
R1401
560
HR.IN
VR.IN
VR.RET
HR.RET
CN1403
3P
RED
:S-MICRO
TO D(3/3)
BOARD CN1501
VM.IN
1
2
3
VM
VM.RET
V.DEF
NC
V.RET
CN1401
7P
WHT
:S-MICRO
(R)
TO ZG BOARD CN1432
DY1401
R1403
680
3W
:RS
ZR(RED DY)
1
2
3
4
5
6
7
V.OUT
NC
V.IN
NC
VM.IN
NC
VM.RET
CN1402
#
:FASTON
1
GND
B-SS774.<AEP>-ZR.-05
NOTE:
The circuit indicated as left contains high voltage of over
600 Vp-p. Care must be paid to prevent an electric shock in
inspection or repairing.
– 86 –
RM-892
RM-892
RM-862
KP-41PX1/41PX1K/41PX1R
K
CR
(20)
RED AMP
Schematic Diagram of CR Board
G1 G2
4 10
H
G4
1,2
— CR BOARD —
V901
PICTURE
TUBE
(R)
6
7
G3
K 8
G5
HV.BLOCK
TO FOCUS BLOCK
CR
SG703
CN705
(RED AMP)
FGND
1
G1
GND 12
G2
R721
33k
1/2W
:RC
R704
560k
1/2W
G2
6
9 8 7
NC K
1
2
3
4
5
6
7
8
9
G1
5
H(+)
H(-)
R
2
1
C705
1000p
2kV
E
TO FOCUS PACK
SG701
R715
680k
1/2W
C709
330p
2kV
B
SG702
CN701
:FASTON
R/S
NC
H(+)
H(-)
NC
NC
200V
NC
GND
TP701
CN703
7P
RED
:S-MICRO
R701
100
1/2W
:RC
TO A(4/5) BOARD
CN301:41PX1/41PX1K
TO AE(4/5) BOARD
CN301:41PX1R
R
G
B
9V
GND
IK
GND
TO CG BOARD CN736
4
11
NC 10
CN704
1P
WHT
:MINI
CN706
9P
WHT
:S-MICRO
R719
100
1/2W
:RC
R714
1k
1/2W
:RC
1
L701
470µH
:FLR50
200V
D704
1SS133
PROT
R
1
2
3
4
5
6
7
R709
1k
1/2W
R711 R712
12k 12k
3W 3W
:RS :RS
G
R705
#
B
R
C712
22
250V
L702
150µH
:EL0606
C708
47p
R702
#
D705 D706
1SS133 1SS133
PROT PROT
C703
47
25V
R706
4.7k
NOTE:
The circuit indicated as left contains high voltage of over
600 Vp-p. Care must be paid to prevent an electric shock in
inspection or repairing.
144.5
156
CN702
8P
WHT
:S-MICRO
R713
Q702
#
#
GAMMA COMP :RN
C704
#
16V
D708
1SS133
PROT
C710
#
B
9V
TO CG BOARD CN733
IKG
IKB
GND
9V
GND
B
G
GND
8
7
6
5
4
3
2
1
R722
22k
R
R716
220
R718
47k
B
G
2.2
Q705
2SA1309A
BUFF
R
Q703
2SC2611
RED AMP
8.4
R720
#
6.1
R727
JW(5)
D701
1SS133
SW
Q704
2SC3311A
AMP
1.9
1.3
Q706
2SA1309A
MIX
6.3
156
R707 8.4
100
6.3
Q701
2SA10910
SW
C702
330p
B
R708
180
R710
22
2.6
2.6
R723 C713
47k 47
D709 16V
R717
33k
MTZJ-5.1
PROT
B-SS774.<AEP>-CR.-05
• CR BOARD WAVEFORMS
1
3.5 Vp-p (H)
2
94.0 Vp-p (H)
– 87 –
RM-892
RM-892
RM-862
KP-41PX1/41PX1K/41PX1R
K
CG
(21)
GREEN AMP
Schematic Diagram of CG Board
G1 G2
4 10
H
G4
1,2
G3
G5
HV.BLOCK
TO FOCUS BLOCK
CG
(GREEN AMP)CN735
SG733
R740
1k
1/2W
:RC
G1
GND 12
G1
5
6
9 8 7
NC K
G2
R746
33k
1/2W
:RC
TO CB BOARD CN765
4
11
NC 10
R732
560k
1/2W
CN737
9P
WHT
:S-MICRO
FGND
1
G2
V902
PICTURE
TUBE
(G)
6
7
K 8
CN734
1P
WHT
:MINI
— CG BOARD —
1
2
3
4
5
6
7
8
9
H(+)
H(-)
G
2
1
C733
1000p
2kV
E
TO FOCUS PACK
SG731
C736
330p
2kV
B
SG732
CN731
:FASTON
R739
680k
1/2W
R/S
NC
H(+)
H(-)
NC
NC
200V
NC
GND
TP731
TP732
R733 R734
12k 12k
3W 3W
:RS :RS
R731
100
1/2W
:RC
CN732
5P
WHT
:S-MICRO
CN736
9P
WHT
:S-MICRO
G
1
2
3
4
5
6
7
8
9
C738
47p
R736
4.7k
D732 D733
1SS133 1SS133
PROT PROT
9V
D735
1SS133
PROT
CN733
8P
WHT
:S-MICRO
TO CR BOARD CN706
L732
150µH
:EL0606
5
4
3
2
1
B
TP733
8
7
6
5
4
3
2
1
8.4
1.7
B
Q733 1.1
2SC3311A R738
120
AMP
R749 R750
#
#
1
Q735
#
PEAK-LIMIT
D736
1SS133
SW
G
Q731
2SA10910
SW
R742
220
R751
#
6.3
R/S
NC
H(+)
H(-)
NC
NC
200V
NC
GND
NOTE:
The circuit indicated as left contains high voltage of over
600 Vp-p. Care must be paid to prevent an electric shock in
inspection or repairing.
R744
330k
Q732
2SC2611
GREEN AMP
R735 G 8.4
100
G
141
150
150
C739 C740
#
47
25V B
TO CR BOARD CN702
IKG
IKB
GND
9V
GND
B
G
GND
L731
470µH
:EL0606
200V
D731
1SS133
PROT
TO CB BOARD CN762
IKB
GND
9V
GND
B
C735
0.0047 C737
500V
22
E
250V
R737
1k
1/2W
R745
#
R743
#
R748
#
0
C734
470p
B
1.4
R741
22
C741
#
16V
Q734 R747 C732
#
2SA1309A #
GAMMA COMP
B-SS774.<AEP>-CG.-05
• CG BOARD WAVEFORMS
1
3.5 Vp-p (H)
2
126 Vp-p (H)
– 88 –
RM-892
RM-892
RM-862
KP-41PX1/41PX1K/41PX1R
K
CB
BLUE AMP
Schematic Diagram of CB Board
G1 G2
4 10
H
G4
1,2
— CB BOARD —
V903
PICTURE
TUBE
(B)
6
7
G3
K 8
G5
HV.BLOCK
TO FOCUS BLOCK
CB
(BLUE AMP)
G1
GND 12
G2
R762
560k
1/2W
TO E(4/4)BOARD
CN501
4
11
NC 10
5
6
9 8 7
K
G2
R778
33k
1/2W
:RC
R771
100
1/2W
:RC
R769
1k
1/2W
:RC
1
CN763
1P
WHT
:MINI
CN766
10P
WHT
:S-MICRO
SG763
CN764 FGND
NC
C763
1000p
2kV
E
G1
H(+)
H(-)
B
2
TO FOCUS PACK
SG761
C766
330p
2kV
:B
SG762
CN761
:FASTON
B/S
R/S
NC
H(+)
H(-)
NC
NC
200V
NC
GND
1
2
3
4
5
6
7
8
9
10
1
R768
680k
1/2W
TP761
R766
1k
R763 R764
1/2W
12k 12k
3W 3W
:RS :RS 200V
R761
100
1/2W
:RC
C765
0.0047 C767
500V
22
E
250V
L761
470µH
:EL0606
CN765
9P
WHT
:S-MICRO
B
D761
1SS133
PROT
TO CG BOARD CN737
L762
150µH
:EL0606
1
2
3
4
5
6
7
8
9
C768
47p
R767
4.7k
D762
D763
1SS133 1SS133 138.2
PROT
PROT
C769 C770
#
47
25V B
CN762
5P
WHT
:S-MICRO
D765
1SS133
PROT
D766
1SS133 R779
220
SW
B
138.2
140.1
Q761
2SA10910
SW
6.3
R/S
NC
H(+)
H(-)
NC
NC
200V
NC
GND
NOTE:
The circuit indicated as left contains high voltage of over
600 Vp-p. Care must be paid to prevent an electric shock in
inspection or repairing.
R774
#
TO CG BOARD CN732
IKB
GND
9V
GND
B
Q762
2SC2611
BLUEAMP
5
4
3
2
1
9V
8.4
R765
100
B
1
2.6
Q765
2SA1309A
PEAK-LIMIT
R782
22k
1/4W
R775
#
R776
47k
1.6
R773
100
R780 R781
JW(5) 56k
1.6
8.4
(22)
0.8
1.0
Q763
2SC3311A
AMP
C772
47
16V
R770
120
C764
820p
B
0.8
R772
22
Q764 R777 C762
2SA1309A 4.3k 10
50V
GAMMA COMP
B-SS774.<AEP>-CB.-05
• CB BOARD WAVEFORMS
1
3.5 Vp-p (H)
2
117 Vp-p (H)
– 89 –
RM-892
RM-892
RM-862
KP-41PX1/41PX1K/41PX1R
K
U
(23)
AV IN/OUT
Schematic Diagram of U Board (41PX1/41PX1K)
— U BOARD — (41PX1/41PX1K)
AUDIO(R)
L4900
4.7µH
:CHIP
R4901
560
:CHIP
L4901
4.7µH
:CHIP
J4901
21P
L4902
4.7µH
:CHIP
L4903
4.7µH
:CHIP
(AV3)
R4902 C4901
0.01
#
:CHIP
D4901
#
R4904
#
R4906
#
D4903
#
R4908
#
3
(SMART LINK)
D4904
#
R4915
560
:CHIP AUDIO(R)
C4902
470p
:CHIP
D4902
#
R4907
560
:CHIP
CN4902
8P
WHT
:S-MICRO
C4903
0.01
:CHIP
R4903
560
:CHIP
AUDIO(L) AUDIO(L)
1
2
3
4
5
6
7
8
TO A(3/5)
BOARD
CN4501
C4904
470p
:CHIP
CN4901
7P
RED
:S-MICRO
R4910
0
:CHIP
D4905
#
R4912
0
:CHIP
D4906
UDZ-9.1B
R4913
0
:CHIP
VIDEO
D4907
UDZ-9.1B
L IN
GND
R IN
GND
R OUT
GND
L OUT
GND
1
2
3
4
5
6
7
R4914
# VIDEO
MODE
AV LINK
GND
V OUT
GND
V IN
GND
TO A(3/5)
BOARD
CN4502
D4908
UDZ-9.1B
U(AV IN/OUT)
B-SS774.<AEP>-U..-05
U BOARD
Terminal name of semiconductors
in silk screen printed circuit (*)
Ref.
D4906 – D4908
*: Refer to Terminal name of
*
3
semiconductors in silk screen
printed circuit (see page 54)
– 90 –
RM-892
RM-892
RM-862
KP-41PX1/41PX1K/41PX1R
K
UE
(24)
AV IN/OUT
Schematic Diagram of UE Board (41PX1R)
— UE BOARD — (41PX1R)
CN2703
21P
SCART
UE(AV IN/OUT)
CVBS IN
CN2701
7P
RED-L
:S-MICRO
VIDEO/Y
C2705
220
16V
R2706
91
:CHIP
D2701
UDZ-9.1B
TO D BOARD CN1808
VIDEO
CVBS OUT
R2702
75
:CHIP
D2702
UDZ-9.1B
R2707
82
:CHIP
C IN
D2703
UDZ-9.1B
C2706
10
C
(AV3)
3
(SMART LINK)
R2703
220
:CHIP
R2708
#
:CHIP
GND
CVBS/Y IN
GND
CVBS OUT
GND
C IN
MODE
1
2
3
4
5
6
7
D2704
UDZ-9.1B
CN2702
8P
WHT-L
:S-MICRO
AUDIO L
R2709
470k
:CHIP
MODE
R2704
390
:CHIP
L IN
C2701
C2707
470p
10
CH:CHIP
R2715
100
:CHIP
D2705
UDZ-9.1B
R2710
47k
:CHIP
C2702
0.01
B:CHIP
C2708
47
16V
R2716
0
:CHIP
R2711
470k
:CHIP
C2703
C2709
470p
10
CH:CHIP
R2717
100
:CHIP
D2707
UDZ-9.1B
R2712
47k
:CHIP
C2704
0.01
B:CHIP
R2718
0
:CHIP
D2708
UDZ-9.1B
D2706
UDZ-9.1B
AUDIO R
AUDIO L
L OUT
R IN
AUDIO R
R OUT
R2705
390
:CHIP
C2710
47
16V
TO D BOARD CN1807
1
2
3
4
5
6
7
8
B-SS510.<AEP>-UE.-05
L IN
GND
R IN
GND
L OUT
GND
R OUT
GND
UE BOARD
Terminal name of semiconductors
in silk screen printed circuit (*)
Ref.
D2701 – D2708
*: Refer to Terminal name of
*
3
semiconductors in silk screen
printed circuit (see page 54)
– 91 –
RM-892
RM-892
RM-862
KP-41PX1/41PX1K/41PX1R
K
H1
(25)
RM-892
RM-892
USER CONTROL,
MAIN SWITCH
Schematic Diagram of H1 Board
— H1 BOARD —
IC3002
SBX3081-51(20)
IR RECEIVER
H1
GND
4.9
OUT
VCC
3
2
1
USER CONTROL,
MAIN SWITCH
R3004
220 1/10W
STBY 5V
D3002
#
D3003
MTZJ-5.6B
CN3003
4P
:VH
C3003 C3004
#
100
16V
TO G BOARD
CN6006
STBY 5V
4
3
2
1
R3001
22k
1/10W
S3001
Q3002
2SC2412K-T-146
LED SW
C3001
0.01
PROG-
0
R3002
10k
1/10W
S3002
PROG+
0.4
R3010
680
:CHIP
AC(N)IN
NC
NC
AC(L)IN
CN3004
5P
:VH
S3006
R3006
4.7k
1/10W
(POWER)
TO G BOARD
CN6007
S3003
(VOL+)
5
4
3
2
1
R3007
2.7k
1/10W
(STANDBY)
S3004
D3008
SEL1210S-D
LED
CN3001
10P
TO D(1/3)BOARD
CN1803
(VOL-)
AC(N)OUT
NC
NC
NC
AC(L)OUT
S3005
(TV/VIDEO)
LED G(NC) 1
LED R
2
GND
3
STBY 5V
4
KEY
5
AUTO REGIS 6
GND
7
SIRCS
8
LUMI(NC)
9
+5V(NC)
10
CN3002
3P
STBY 5V
C3005
0.001
R3003
470
1/10W
D3001
MTZJ-5.6B
C3002
0.001
50V
B
1
2
3
TO H2 BOARD
CN3201
KEY
GND
AUTO REGIS
C3006
#
B-SS774.<AEP>-H1.-05
H1 BOARD
Terminal name of semiconductors
in silk screen printed circuit (*)
Ref.
Q3002
*: Refer to Terminal name of
*
1
semiconductors in silk screen
printed circuit (see page 54)
– 92 –
RM-862
KP-41PX1/41PX1K/41PX1R
K
H2
Schematic Diagram of H2 Board
AV INPUT, HP OUT,
USER CONTROL
11 FRONT S(NC)
GND
10
FRONT R
9
GND
8
FRONT L
7
GND
6
FRONT V
5
GND
4
FRONT C
3
GND
2
1 FRONT Y(NC)
— H2 BOARD —
D3216
MTZJ-6.8A R3218
#
D3215
MTZJ-6.8A
R3215
#
R3214
100
:CHIP
C
R3213
#
C3217
0.0047
B
L3205
JW(5)
C3202
#
C3204
0.022
B:CHIP
L3203
1.5µH
J3202
R3209
220
:CHIP
R3210
220
:CHIP
L3204
JW(5)
AUDIO(L)
2
1
2
3
4
5
CN3201
3P
R3207
1.3k
:CHIP
S
CN3213
(VIDEO)
L
(MONO)
(AV4 INPUT)
HP R
GND
GND
HP L
MUTE(NC)
TO H1 BOARD
CN3002
1
V
L
TO D(2/3)BOARD
CN1601
R3212
220
:CHIP
AUDIO(R)
(HEAD PHONE)
R3216
100
:CHIP
C3201
#
R
R3211
220
:CHIP
L3202
100µH
R3217
#
CN3204
5P
:PIN-Z
C3205
0.022
B:CHIP
L3201
100µH
4
C3214
0.0047
B
D3214
#
D3202
#
3
D3201
#
AUDIO(R)
D3213
#
AUDIO(L)
TO D(1/3)BOARD
CN1802
VIDEO/Y
CN3202
11P
:S-MICRO
R
(26)
(S-VIDEO)
H2
S3206
S3205
AUTO
TUNE
AUTO
CONVER
1
2
3
KEY
GND
AUTO REGIS
AV INPUT,HP OUT,
USER CONTROL
B-SS774.<AEP>-H2.-05
– 93 –
RM-892
RM-892
RM-862
KP-41PX1/41PX1K/41PX1R
K
(27)
RM-892
RM-892
RM-862
Schematic Diagram of G Board
CN6007
5P
:VH
AC(N)OUT
NC
NC
NC
AC(L)OUT
AC(N)IN
NC
NC
AC(L)IN
CN6006
4P
TO H1 BOARD
CN3004
CN6011
3P
:MINI
5
4
3
2
1
1
2
3
4
TO H1 BOARD
CN3003
+12V
D6017
RBV-406B
T6004
42µH(PFC)
C6002
0.0047
250V
E
R6014
470
1/4W
:FRPD2.2
C6016
0.001
B
CT
VG(H)
258
RT
VS
5
GND
VB
258
NC
13
6
TIMER
11
248
R6034
0.47
:FPRD
VG(L)
15
PS6003 5A
6
13
R6045 # :FPRD
8
VC1 P-GND
9
OCP
VC2
0 10.4
248
Q6002
SPA07N60C2
SW
16
C6033
100p
500V
S
17
R6024
10k
C6029
680p
500V
D6019
S2L40F RECT
R6012
100
:RN
D6004
1SS355TE
C6054
100
25V
C6048
2200
25V
L6009
10µH :LHL08
C6053
100
25V
C6044
220
160V
7V
C6024
47
D6014
D2S4M
+7V RECT
7
C6038
2200
16V
9
R6025
0.05
2W
R6030
0.47 :FPRD
C6043
100
25V
C6045 R6048
0.47 220k
160V :RN
D6013
D2S4M
+7V RECT
R6029
0.47 :FPRD
R6015
0.47
:FPRD
L6011
47µH
:LHL08
R6049
1k C6050
:FPRD 470
6.3V
L6005
10µH
:LHL08
R6005
47k
1
2
3
4
5
C6055
220
160V
R6007
47k
1.7
4
3
1
13.8
2
12.7
135.3
Q6007
2SA1208T-TP
+B-COCP
R6052
220k
:RN
3
IC6005
SE135N
VCC CONTROLER
D6003
ERC04-06SE
C6003
0.0047
500V
FB6001 E
1.1µH
12.0
C6005
0.0047
500V
E
2
1
2
3
4
5
6
R6055
200k
:RN
R6050
100k
R6054
22k
:RN
135
1
VOUT
SENSE
GND
COLLECTOR
STBY 7V
R6002
4.7
:RF
TH6001
T6002
SRT
D6002
D6001
ERC04-06SE
ERC04-06SE
RECT
RECT
0.7
D6006
JW(15)
Q6004
2SD2144S-TP
PROTECT
0.2
2
9
1
8
4
7
3
6
C6028
#
D6005
ST02D-200TA
D6015
1SS133 R6037
4.7k
PROTECT :CHIP
R6042
1k
:CHIP
R6033
4.7k
:CHIP
R6041
10k
:CHIP
L6002
JW(5)
D6010
D1NL20U
RECT
C6007
4.7
450V
D6020
1SS133
PROTECT
7.4
D6012
D1NL20U
STBY RECT
C6032
#
C6030
100
25V
7.4
R6039
10k
:CHIP
Q6006
2SA1037K
LATCH
5
D6008
MTZJ-9.1C
5.8 R6009 BIAS
R6028
1k
:CHIP
6
C
IC6001
TOP209P
PWMSW
4
D
C6015
47
25V
3
5
22
512
15.8
D6009
1SS133
FEED BACK
C6026
10
S
Q6003
2SB734-T-2 15.1 R6027
VCC SW
10k
:CHIP
2
S
1
8
7
C6056
0.1
15.8
C6023
100
25V
15.1
0.7
Q6005
2SC2412K
LATCH
0.2
0.2
R6038
10k
:CHIP
R6040
470
:CHIP
R6046
4.7k
:CHIP
C6037
1
IC6003
ON3171-R
VCC SW
4
1
3
2
7.4
6.3
G(POWER
SUPPLY)
R6026
4.7k
:CHIP
B-SS774.<AEP>-G..-05
– 94 –
TO E(3/4)BOARD
CN808
CN6008
6P
WHT
:S-MICRO
+12V
R6047
470
:FPRD
R6036
1k
IC6004
ON3171-R
VCC OUT
+135V
GND
+15V
GND
-15V
-15V
0
R6003
15
1W
FB6003
1.1µH
CN6009
5P
:MINI
+15V
2.4
Q6009
2SC2412K 0.7
SW
POW MONI
AUDIO + TO D(2/3)BOARD
CN1605
AU GND
AUDIO -
R6053
1k
:FPRD
D6022
MTZJ-13B
+B-OVP
1
TO CRT BRACKET
L6010
10µH :LHL08
R6051
0.56
2W
:RS
8
R6032
0.47 :FPRD
R6016
82
1/4W
Q6008
2SC2412K
SOFT START
FB6002
1.1µH
D6018
S2L40F RECT
R6031
0.47 :FPRD
CN6001
1P
:FASTON
C6049
4700
25V
18
C6034
100p
500V
TO E(3/4)BOARD
CN806
R6056
2.2
1W
:RS
135V
1
TO G BOARD
SHIELD CHASSIS
C6052
100
25V
R6043 # :FPRD
C6019
0.1
25V
C6017
0.001
B
R6044 # :FPRD
14
D6011
UF4005PKG23
R6019
10
15.8
C6051
2200
25V
D6021
D10SC6M
+12V RECT
4
C6039
470p B
1
2
3
4
L6008
10µH
:LHL08
C6046
470p
B
L6006
6.8µH
:LHL08
C6036
470p B
C6035
470p B
12
7
SS
C6040
470p B
C6047
470p
B
R6023
10k
5.1 5.1
4.6
C6020
4.7
RY6001
10
3
C6025
0.1
0
1
C6031
0.039
1kV
S
248
C6021
10
CN6002
1P
:FASTON
GND(Z)
18
R6020
10
R6013
12k
TO A(1/5)BOARD CN101
:41PX1/41PX1K
TO AE(1/5)BOARD CN101
:41PX1R
GND(Z)
NC
2.5
C6014
470
450V
CN6003
1P
:FASTON
GND(ANT)
F/B
2
L6007
6.8µH
:LHL08
R6035
0.47
:FPRD
D6016
D4SBS4
258
C6018
0.001
C6008
0.0047
500V
E
C6027
Q6001
SPA07N60C2 680p
500V
SW
268
L6003
10µH
:LHL08
+12V
NC
GND
CN6010
4P
:MINI
AUDIO-
C6041
1000
135.6
C6009
0.0047
500V
E
VSENSE VD
268
17
2
1
1.9
15
1
C6022 2.4
#
16
D6007
D4SB60L-F
RECT
12
14
C6006
1000p
250V
B
1
11
AC(L)
AC(W)
2
FH6001
F6001
5A
R6011
9.1k
:RN
PS6001
3.15A
R6022
1k
1/4W
10
AC IN
220-240V
50/60Hz
R6004
#
2
R6001
1M 1/2W :RC
CN6005
2P
R6017 R6018 R6021
330k 330k 330k
1/4W 1/4W 1/4W
1
3
C6042
1000
T6003
PIT
JW6004
JW(20)
1
2
3
AUDIO+
L6004
10µH
:LHL08
0.3
4
IC6002
MCZ3001D
DC CONTROL
R6010
0.1
1/2W
JW6003
JW(20)
C6010
1000p
250V
B
2
1
PS6002
3.15A
3
C6004
0.22
250V
:AC
VD6001
C6001
0.22
250V
:AC
R6006
10M
1W
4
3
4
T6001
LFT
ST7V
GND
P.CONT
PROT
GND
+7V
TO E(3/4)BOARD
CN807
KP-41PX1/41PX1K/41PX1R
K
G
RM-892
RM-892
RM-862
POWER SUPPLY
1
2
3
4
5
• G BOARD SEMICONDUCTOR
LOCATION
IC
IC6001
IC6002
IC6003
IC6004
IC6005
A-4
B-3
B-3
B-2
A
TRANSISTOR
Q6001
Q6002
Q6003
Q6004
Q6005
Q6006
Q6007
Q6008
Q6009
A-4
A-4
B-3
B-2
B-1
B-1
B-1
B-3
B-3
*–
–
–
–
1
1
–
1
1
DIODE
B
D6001
D6002
D6003
D6004
D6005
D6007
D6008
D6009
D6010
D6011
D6012
D6013
D6014
D6015
D6016
D6017
D6018
D6019
D6020
D6021
D6022
B
C-5
C-5
C-5
C-3
C-4
B-4
C-4
C-5
C-5
A-4
C-3
B-3
B-3
B-2
A-2
A-2
B-2
B-2
B-1
B-2
B-1
*–
–
–
3
–
–
–
–
–
–
–
–
–
–
–
–
–
–
–
–
–
*: Refer to Terminal name of semiconductors
in silk screen printed circuit (see page 54)
NOTE:
The circuit indicated as left contains high voltage of over
600 Vp-p. Care must be paid to prevent an electric shock in
inspection or repairing.
– 95 –
KP-41PX1/41PX1K/41PX1R
K
7-5. SEMICONDUCTORS
AN77L12-TA
NJM78L12A-T3
NJM79L12A
NJM79L12A-T3
CXA2089Q-T6
CXD2064Q-T6
MSP3410D-C5-PS-B4
MSP3411G-PS-B8
SDA5273-3CP-C55-22GEG
PST593C-MMP-4P
TDA8395T/N3
2SA1091-O
2SA1091O-TPE2
2SA1208
2SA1208T-TP
2SK2251-01-F19
D10SC6M-4012
1
1
1
TOP VIEW
48pin QFP
1
2
64
65
41
40
PST9143NL
E C
B
BSS83
29
25
24
1
TOP VIEW
D
G1
1 2 3 4 5
1 32 30
5
80
G2
M27C2001-12C1-PZ01
M27C2001-12C1-RR403
4
1
S
D
3
BAS216
D2S4M
14
20
TOP VIEW
CXP86213-003S
1
TOP VIEW
NJM4560D
RC4560D
TDA2822M
TDA7264
TOP209P
2SA1837(LBS2SONY)
2SC4634LS-CB11
2SC4793(LBS2SONY)
2SC5022-02
3
2
DTA144EKA-T146
DTC143TKA-T146
DTC144EKA
DTC144EKA-T146
2SA1037AK-T146-QR
2SA1037AK-T146-R
2SC1623-L5L6
2SC2412K-T-146-QR
ANODE
DAN202K
DAN202K-T-146
B
3
2SB734-34
2SB734-T-2
14pin SOP
CXA1315M
CXA1315M-T4
TDA4665T/V5-118
2
1
3
SDA30C263-GEG
B
1
DTC144ESA-TP
2SD2144S-TP-UVW
2SD2144S-UVW
TOP VIEW
8pin DIP
1
+
2
E
1
2SC2611-15
TOP VIEW
DTZ33B
MA8330-TX
UDZSTE-175.6B
UDZSTE-176.8B
UDZSTE-179.1B
1SS355TE-17
80pin QFP
TOP VIEW
16pin SOP
CXA2040AQ-T4
2
~
–
C
EC
B
3
ERC04-06SE
ERC06-15S
TOP VIEW
LETTER SIDE
LETTER SIDE
PM0011AS
STK392-150
42pin DIP
E C
B
12
12
C B
TOP VIEW
32pin QFP
CXA2076Q-TL
2SD2539(LBSONY-1)
SPA07N60C2
PQ05RF11
D1NL20U-TR2
EL1Z
EL1Z-V1
GP08D
GP08DPKG23
MTZJ-T-77-5.6B
MTZJ-T-77-9.1A
MTZJ-T-77-9.1C
RGP02-20EL-6394
RGP10GPKG23
S2L40F
ST02D-200TA
UF4005PKG23
33
52
32
64
CATHODE
n
TOP VIEW
ERD29-08J
CATHODE
ANODE
C
D
12
TOP VIEW
SEL1210S-D
MA3030-H(TX)
MA3240-TX
B
STV9379
1
3
CATHODE
MCZ3001D
PA0053B
19
4
MARKING SIDE VIEW
3
20
1
2
ANODE
n=18pin
51
1
RD9.1EW
RD9.1EW-T1
CATHODE
B
2SC2688-LK
E
1
4
2
1
2 3
1
ON3171-R
~
ANODE
DTC144ESA
2SA1175-HFE
2SA1309A-QRSTA
2SC3311A-QRSTA
8pin SOP
13
ANODE
–
1
E
L7812CV
LM2940CT-5.0
NJM78M05FA
PQ09RF2
~
CATHODE
SE135N
SE135N-LF12
TOP VIEW
~
+
NJM79M05FA
1
CATHODE
C
E C
B
LM358D
LM358DR
M24C08-MN6T(A)
M24C32-MN6T
NJM2240M
NJM2240M (TE2)
D4SB60L-F
D4SBS4
D4SBS4-F
RBA-406B
RBV-406B
C E
1
52pin DIP
TOP VIEW
CATHODE
ANODE
CATHODE
SBX3081-51(20)
SBX3081-51(30)
21
13
CA0007AM
MC14066BF
MC14066BFEL
1
3
2
S
TOP VIEW
14pin DIP
1
G
CXD2044Q-TL
CA0007AD
NJM2058D
µPC339C
1
12
TOP VIEW
20pin SOP
TOP VIEW
68pin QFJ
3
1
4pin CHIP
MTZJ-13
MTZJ-13B
MTZJ-7.5B
MTZJ-T-77-13
MTZJ-T-77-13B
MTZJ-T-77-22
MTZJ-T-77-3.6
MTZJ-T-77-5.1
MTZJ-T-77-5.1B
MTZJ-T-77-5.6
MTZJ-T-77-6.8B
MTZJ-T-77-7.5B
MTZJ-T-77-9.1
RD3.0ES-T1B2
RD3.0ESB2
RD3.6ESB1
RD4.7ES-T1B
RD4.7ESB2
RD5.1ESB1
RD5.1ESB2
RD5.6ESB2
RD6.8ES-B2
RD9.1ES-B3
1SS133T-77
G
34
S
18pin DIP
1
7
– 96 –
E
NC
ANODE
ANODE
ANODE
CATHODE
RM-892
RM-892
RM-862
KP-41PX1/41PX1K/41PX1R
K
RM-892
RM-892
RM-862
SECTION 8
EXPLODED VIEWS
NOTE:
• Items with no part number and no
description are not stocked because they
are seldom required for routine service.
• The construction parts of an assembled
part are indicated with a collation number
in the remark column.
• Items marked " * " are not stocked since
they are seldom required for routine
service. Some delay should be anticipated
when ordering these items.
The components identified by shading
and mark ¡ are critical for safety.
Replace only with part number specified.
17
8-1. SCREEN AND CONTROL PANEL BLOCK
:
:
:
:
7-685-648-71
7-685-663-71
7-685-663-79
7-685-661-79
SCREW +BVTP 3X12
SCREW +BVTP 4X16
SCREW +BVTP 4X16
SCREW +BVTP 4X12
12
11
10
8
12
10
9
7
15
11
16
14
13
6
14
12
13
11
11
18
12
11
10
20
5
24
4
22
5
19
21
CABINET
BLOCK
25
3
REF.NO. PART NO.
1
2
3
4
5
4-206-033-01
4-202-964-01
4-206-036-01
X-4200-708-1
4-378-522-31
6
7
8
9
10
X-4200-706-1
4-063-365-11
4-070-236-11
4-070-358-11
* 4-205-155-01
11
12
13
1
DESCRIPTION
23
2
REMARK
REF.NO. PART NO.
DESCRIPTION
BUTTON POWER
SPRING
DOOR, CONTROL
GRILLE ASSY, SPEAKER
SCREW, TAPPING, HEXAGON
14
15
16
17
18
* 4-063-160-01
* 4-066-129-01
4-206-414-01
* 4-062-540-11
* 4-063-177-01
BEZNET ASSY
SCREEN, CONTRAST
PLATE (L), DIFFUSION
PLATE (F), DIFFUSION
COVER, SENSOR
19
20
21
22
23
* A-1646-237-A H1 BOARD, COMPLETE
* A-1646-238-A H2 BOARD, COMPLETE
4-206-034-01 BUTTON, MULTI
4-206-035-01 COVER, MULTI BUTTON
4-054-709-01 STRIKE
1-528-864-12 BATTERY, SOLAR
* 4-066-132-01 HOLDER, SENSOR
* 4-066-126-01 HOLDER (V), SCREEN
24
25
– 97 –
HOLDER (H), SCREEN
HOLDER, MIRROR
MIRROR (41)
COVER, MIRROR
BOARD (41), REAR
4-076-673-03 DAMPER, DOOR
4-206-030-01 LABEL CONTROL
REMARK
KP-41PX1/41PX1K/41PX1R
K
8-2. CABINET BLOCK
: 7-685-663-71
: 7-685-663-79
RM-892
RM-892
The components identified by shading
and mark ¡ are critical for safety.
Replace only with part number specified.
SCREW +BVTP 4X16
SCREW +BVTP 4X16
55
54
MECHASEAL
BLOCK
56
CHASSIS
BLOCK
53
56
57
52
51
REF.NO. PART NO.
DESCRIPTION
51
52
53
REMARK
* 4-063-176-01 HOLDER, HVR
0 1-223-925-71 RESISTOR ASSY (HIGH-VOLTAGE)
(FOCUS PACK)
1-505-426-11 SPEAKER (10.6 CM)
REF.NO. PART NO.
54
55
56
57
– 98 –
0 8-598-955-13
4-373-137-02
4-378-522-31
4-062-539-11
DESCRIPTION
REMARK
BLOCK ASSY, HIGH-VOLTAGE
CAP (Z), RUBBER
SCREW, TAPPING, HEXAGON HEAD
CABINET (REAR)
RM-862
KP-41PX1/41PX1K/41PX1R
K
8-3. MAIN BRACKET BLOCK
: 7-685-648-71
: 7-685-663-71
: 7-685-663-79
RM-892
RM-862
The components identified by shading
and mark ¡ are critical for safety.
Replace only with part number specified.
SCREW +BVTP 3X12
SCREW +BVTP 4X16
SCREW +BVTP 4X16
106
RM-892
107
105
109
104
109
103
109
102
110
111
108
113
101
112
REF.NO. PART NO.
DESCRIPTION
REMARK
101
102
103
103
104
* 4-062-537-03 BRACKET, MAIN
* A-1642-288-A E BOARD, COMPLETE
108
* A-1346-678-A D BOARD, COMPLETE (41PX1R)
* A-1642-284-A D BOARD, COMPLETE (41PX1/41PX1K)
* A-1632-921-A A BOARD, COMPLETE (41PX1/41PX1K)
104
105
106
106
* A-1632-959-A AE BOARD, COMPLETE (41PX1R)
* 4-062-536-02 BRACKET (A)
* A-1648-033-A U BOARD, COMPLETE (41PX1/41PX1K)
* A-1648-034-A UE BOARD, COMPLETE (41PX1R)
REF.NO. PART NO.
107
108
DESCRIPTION
REMARK
109
110
111
4-063-178-01 BOARD (EURO), TERMINAL
0 1-453-331-21 TRANSFORMER ASSY, FLYBACK
(NX-4010//M3P4)
* 4-316-015-02 HOLDER, WIRE
* A-1637-023-A G BOARD, COMPLETE
0 1-765-286-11 CORD, POWER
112
113
1-543-653-21 CORE ASSY, BEAD (DIVISION TYPE)
4-022-115-00 HOLDER, AC CORD
– 99 –
KP-41PX1/41PX1K/41PX1R
K
8-4. MECHASEAL BLOCK
: 7-685-648-71
: 7-685-663-71
RM-892
RM-892
RM-862
The components identified by shading
and mark ¡ are critical for safety.
Replace only with part number specified.
SCREW +BVTP 3X12
SCREW +BVTP 4X16
155
155
154
155
157
163
156
153
159
153
152
160
152
161
151
158
162
REF.NO. PART NO.
DESCRIPTION
REMARK
151
152
153
154
155
* A-1638-152-A CR BOARD, COMPLETE
0 1-452-790-41 NECK ASSY
0 1-451-517-31 DEFLECTION YOKE
0 A-1501-213-A MECHASEAL ASSY (R), SLANT
4-056-258-11 LENS (DELTA 78)
156
157
* A-1652-079-A ZR BOARD, COMPLETE
0 A-1501-214-A MECHASEAL ASSY (G), SLANT
153
REF.NO. PART NO.
DESCRIPTION
REMARK
158
159
160
161
162
* A-1638-151-A CG BOARD, COMPLETE
* A-1652-078-A ZG BOARD, COMPLETE
0 1-451-517-21 DEFLECTION YOKE
0 1-452-790-31 NECK ASSY
* A-1638-150-A CB BOARD, COMPLETE
163
0 A-1501-215-A MECHASEAL ASSY (B), SLANT
– 100 –
153
The components identified by shading
and mark ¡ are critical for safety.
Replace only with part number specified.
REF.NO. PART NO.
NOTE:
KP-41PX1/41PX1K/41PX1R
SECTION 9
RM-892
RM-892
DESCRIPTION
When indicating parts by reference
number, please include the board name.
RM-862
A
ELECTRICAL PARTS LIST
The components identified by shading
and mark ¡ are critical for safety.
Replace only with part number specified.
REF.NO. PART NO.
K
REMARK identified
REF.NO.by PART
DESCRIPTION
REMARK
The components
[ in NO.
this • Items
marked " * " are not stocked
since
manual have been carefully factory- they are seldom required for routine
selected for each set in order to satisfy service. Some delay should be anticipated
regulations regarding X-ray radiation. when ordering these items.
Should replacement be required, replace
only with the value originally used.
• CAPACITORS
PF : µµF
• All variable and adjustable resistors have
characteristic curve B, unless otherwise • There are some cases the reference
noted.
number on one board overlaps on the
other board. Therefore, when ordering
RESISTORS
parts by the reference number, please
• All resistors are in ohms
include the board name.
• F : nonflammable
DESCRIPTION
REMARK
* A-1632-921-AA BOARD, COMPLETE (41PX1/41PX1K)
****************************
<CAPACITOR>
C1
C2
C3
C4
C8
1-164-156-11
1-104-660-91
1-162-921-11
1-162-921-11
1-164-156-11
CERAMIC CHIP
ELECT
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
0.1µF
47µF
33pF
33pF
0.1µF
C15
C18
C19
C20
C21
1-164-315-11
1-164-156-11
1-162-968-11
1-162-970-11
1-162-970-11
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
470pF
0.1µF
0.0047µF
0.01µF
0.01µF
C22
C24
C25
C26
C28
1-162-927-11
1-115-416-11
1-104-660-91
1-104-660-91
1-164-156-11
CERAMIC CHIP
CERAMIC CHIP
ELECT
ELECT
CERAMIC CHIP
100pF
0.001µF
47µF
47µF
0.1µF
5%
5%
20%
20%
50V
25V
16V
16V
25V
C29
C45
C90
C101
C102
1-162-964-11
1-164-156-11
1-164-156-11
1-164-156-11
1-126-934-11
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
ELECT
0.001µF
0.1µF
0.1µF
0.1µF
220µF
10%
50V
25V
25V
25V
16V
C103
C104
C105
C106
C107
1-126-965-91
1-162-927-11
1-164-156-11
1-126-933-11
1-164-156-11
ELECT
CERAMIC CHIP
CERAMIC CHIP
ELECT
CERAMIC CHIP
22µF
100pF
0.1µF
100µF
0.1µF
20%
5%
C108
C109
C110
C111
C112
1-126-933-11
1-164-227-11
1-104-660-91
1-164-156-11
1-115-416-11
ELECT
CERAMIC CHIP
ELECT
CERAMIC CHIP
CERAMIC CHIP
100µF
0.022µF
47µF
0.1µF
0.001µF
20%
10%
20%
C113
C114
C115
C116
C117
1-104-660-91
1-164-156-11
1-162-970-11
1-127-715-91
1-162-970-11
ELECT
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
47µF
0.1µF
0.01µF
0.22µF
0.01µF
20%
C118
C119
C120
1-164-156-11 CERAMIC CHIP 0.1µF
1-164-156-11 CERAMIC CHIP 0.1µF
1-162-927-11 CERAMIC CHIP 100pF
20%
5%
5%
5%
10%
10%
10%
20%
20%
5%
25V
16V
50V
50V
25V
50V
25V
50V
25V
25V
50V
50V
25V
16V
25V
16V
25V
16V
25V
25V
10%
10%
10%
16V
25V
25V
16V
25V
5%
25V
25V
50V
REF.NO. PART NO.
DESCRIPTION
REMARK
C121
C122
1-162-925-11 CERAMIC CHIP 68pF
1-115-412-11 CERAMIC CHIP 680pF
5%
5%
50V
25V
C123
C124
C125
C126
C127
1-162-925-11
1-164-156-11
1-164-156-11
1-164-156-11
1-164-156-11
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
68pF
0.1µF
0.1µF
0.1µF
0.1µF
5%
50V
25V
25V
25V
25V
C128
C129
C130
C131
C132
1-164-156-11
1-164-156-11
1-164-156-11
1-164-156-11
1-164-156-11
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
0.1µF
0.1µF
0.1µF
0.1µF
0.1µF
C133
C134
C136
C137
C138
1-164-156-11
1-162-927-11
1-126-964-11
1-104-660-91
1-126-964-11
CERAMIC CHIP
CERAMIC CHIP
ELECT
ELECT
ELECT
0.1µF
100pF
10µF
47µF
10µF
5%
20%
20%
20%
25V
50V
50V
16V
50V
C139
C140
C141
C142
C143
1-162-970-11
1-126-964-11
1-126-934-11
1-162-926-11
1-162-927-11
CERAMIC CHIP
ELECT
ELECT
CERAMIC CHIP
CERAMIC CHIP
0.01µF
10µF
220µF
82pF
100pF
10%
20%
20%
5%
5%
25V
50V
16V
50V
50V
C144
C145
C146
C147
C148
1-164-217-11
1-162-923-11
1-164-360-11
1-162-968-11
1-162-970-11
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
150pF
47pF
0.1µF
0.0047µF
0.01µF
5%
5%
10%
10%
10%
50V
50V
16V
50V
25V
C201
C202
C203
C204
C205
1-164-156-11
1-164-156-11
1-104-661-91
1-164-156-11
1-126-965-91
CERAMIC CHIP
CERAMIC CHIP
ELECT
CERAMIC CHIP
ELECT
0.1µF
0.1µF
330µF
0.1µF
22µF
20%
25V
25V
16V
25V
50V
C207
C208
C209
C210
C211
1-126-964-11
1-164-156-11
1-216-864-11
1-162-927-11
1-126-965-91
ELECT
CERAMIC CHIP
SHORT
CERAMIC CHIP
ELECT
10µF
0.1µF
0
100pF
22µF
20%
50V
25V
5%
20%
50V
50V
C212
C213
C214
C215
C216
1-164-360-11
1-162-970-11
1-164-360-11
1-162-970-11
1-104-660-91
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
ELECT
0.1µF
0.01µF
0.1µF
0.01µF
47µF
10%
10%
10%
10%
20%
16V
25V
16V
25V
16V
– 101 –
25V
25V
25V
25V
25V
20%
KP-41PX1/41PX1K/41PX1R
The components identified by shading
and mark ¡ are critical for safety.
Replace only with part number specified.
REF.NO. PART NO.
K
RM-892
RM-892
A
DESCRIPTION
REMARK
C217
C218
C219
C220
C221
1-162-970-11
1-104-660-91
1-162-970-11
1-126-933-11
1-135-834-91
CERAMIC CHIP
ELECT
CERAMIC CHIP
ELECT
CERAMIC CHIP
0.01µF
47µF
0.01µF
100µF
2.2µF
10%
20%
10%
20%
25V
16V
25V
16V
6.3V
C222
C223
C224
C225
C226
1-164-360-11
1-162-970-11
1-164-360-11
1-162-970-11
1-104-660-91
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
ELECT
0.1µF
0.01µF
0.1µF
0.01µF
47µF
10%
10%
10%
10%
20%
16V
25V
16V
25V
16V
C227
C228
C229
C230
C232
1-162-970-11
1-104-660-91
1-162-970-11
1-162-927-11
1-216-864-11
CERAMIC CHIP
ELECT
CERAMIC CHIP
CERAMIC CHIP
SHORT
0.01µF
47µF
0.01µF
100pF
0
10%
20%
10%
5%
25V
16V
25V
50V
C236
C237
C240
C241
C242
1-162-927-11
1-135-834-91
1-126-933-11
1-104-660-91
1-162-970-11
CERAMIC CHIP
CERAMIC CHIP
ELECT
ELECT
CERAMIC CHIP
100pF
2.2µF
100µF
47µF
0.01µF
5%
20%
20%
10%
50V
6.3V
16V
16V
25V
C243
C244
C245
C246
C247
1-126-967-11
1-162-970-11
1-126-963-11
1-104-660-91
1-104-660-91
ELECT
CERAMIC CHIP
ELECT
ELECT
ELECT
47µF
0.01µF
4.7µF
47µF
47µF
20%
10%
20%
20%
20%
50V
25V
50V
16V
16V
C248
C249
C250
C251
C252
1-162-927-11
1-115-156-11
1-115-156-11
1-162-909-11
1-162-909-11
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
100pF
1µF
1µF
4pF
4pF
5%
50V
10V
10V
0.25pF 50V
0.25pF 50V
C253
C254
C255
C256
C257
1-162-927-11
1-162-923-11
1-162-927-11
1-164-156-11
1-126-965-91
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
ELECT
100pF
47pF
100pF
0.1µF
22µF
5%
5%
5%
C258
C259
C260
C261
C262
1-126-964-11
1-113-619-11
1-164-156-11
1-164-315-11
1-164-315-11
ELECT
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
10µF
0.47µF
0.1µF
470pF
470pF
20%
C263
C264
C265
C266
C267
1-164-156-11
1-126-962-11
1-126-964-11
1-126-964-11
1-126-965-91
CERAMIC CHIP
ELECT
ELECT
ELECT
ELECT
0.1µF
3.3µF
10µF
10µF
22µF
C268
C269
C270
C271
C272
1-164-156-11
1-164-392-11
1-164-392-11
1-115-416-11
1-115-416-11
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
0.1µF
390pF
390pF
0.001µF
0.001µF
C273
C274
C275
C276
C277
1-115-416-11
1-115-416-11
1-115-156-11
1-115-156-11
1-135-834-91
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
0.001µF
0.001µF
1µF
1µF
2.2µF
C278
1-135-834-91 CERAMIC CHIP 2.2µF
20%
50V
50V
50V
25V
50V
5%
5%
50V
10V
25V
50V
50V
20%
20%
20%
20%
25V
50V
50V
50V
50V
5%
5%
5%
5%
25V
50V
50V
25V
25V
5%
5%
25V
25V
10V
10V
6.3V
6.3V
REF.NO. PART NO.
DESCRIPTION
REMARK
C279
C280
C281
C282
1-126-965-91
1-164-156-11
1-126-965-91
1-164-156-11
ELECT
CERAMIC CHIP
ELECT
CERAMIC CHIP
22µF
0.1µF
22µF
0.1µF
C283
C284
C300
C301
C302
1-162-970-11
1-126-935-11
1-162-927-11
1-164-156-11
1-115-416-11
CERAMIC CHIP
ELECT
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
0.01µF
470µF
100pF
0.1µF
0.001µF
10%
20%
5%
C303
C304
C305
C306
C307
1-115-416-11
1-164-156-11
1-164-156-11
1-162-970-11
1-162-970-11
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
0.001µF
0.1µF
0.1µF
0.01µF
0.01µF
5%
C308
C309
C310
C311
C312
1-162-970-11
1-115-156-11
1-115-156-11
1-115-156-11
1-135-834-91
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
0.01µF
1µF
1µF
1µF
2.2µF
10%
25V
10V
10V
10V
6.3V
C313
C315
C316
C317
C318
1-115-416-11
1-216-864-11
1-162-921-11
1-164-156-11
1-162-921-11
CERAMIC CHIP
SHORT
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
0.001µF
0
33pF
0.1µF
33pF
5%
25V
5%
50V
25V
50V
C320
C321
C322
C323
C324
1-126-965-91
1-162-970-11
1-164-156-11
1-164-156-11
1-164-156-11
ELECT
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
22µF
0.01µF
0.1µF
0.1µF
0.1µF
C325
C326
C327
C328
C330
1-115-156-11
1-115-416-11
1-137-374-11
1-126-965-91
1-130-777-00
CERAMIC CHIP
CERAMIC CHIP
MYLAR
ELECT
MYLAR
1µF
0.001µF
0.047µF
22µF
0.1µF
C331
C332
C333
C334
C335
1-137-581-11
1-162-970-11
1-126-933-11
1-162-970-11
1-113-619-11
FILM
CERAMIC CHIP
ELECT
CERAMIC CHIP
CERAMIC CHIP
0.1µF
0.01µF
100µF
0.01µF
0.47µF
5%
10%
20%
10%
100V
25V
16V
25V
10V
C336
C337
C338
C339
C340
1-162-964-11
1-162-964-11
1-126-962-11
1-162-970-11
1-126-933-11
CERAMIC CHIP
CERAMIC CHIP
ELECT
CERAMIC CHIP
ELECT
0.001µF
0.001µF
3.3µF
0.01µF
100µF
10%
10%
20%
10%
20%
50V
50V
50V
25V
16V
C341
C342
C343
C344
C347
1-113-619-11
1-115-156-11
1-162-968-11
1-162-927-11
1-126-963-11
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
ELECT
0.47µF
1µF
0.0047µF 10%
100pF
5%
4.7µF
20%
10V
10V
50V
50V
50V
C348
C349
C350
C351
C352
1-164-315-11
1-162-921-11
1-126-963-11
1-135-834-91
1-113-619-11
CERAMIC CHIP
CERAMIC CHIP
ELECT
CERAMIC CHIP
CERAMIC CHIP
470pF
33pF
4.7µF
2.2µF
0.47µF
50V
50V
50V
6.3V
10V
C353
C354
1-135-834-91 CERAMIC CHIP 2.2µF
1-113-619-11 CERAMIC CHIP 0.47µF
– 102 –
20%
20%
5%
10%
10%
5%
20%
10%
5%
5%
20%
5%
5%
5%
20%
50V
25V
50V
25V
25V
10V
50V
25V
25V
25V
25V
25V
25V
25V
50V
25V
25V
25V
25V
10V
25V
50V
50V
63V
6.3V
10V
RM-862
KP-41PX1/41PX1K/41PX1R
The components identified by shading
and mark ¡ are critical for safety.
Replace only with part number specified.
REF.NO. PART NO.
K
RM-892
RM-892
RM-862
A
DESCRIPTION
REMARK
C355
C356
C357
1-126-965-91 ELECT
22µF
1-162-970-11 CERAMIC CHIP 0.01µF
1-164-315-11 CERAMIC CHIP 470pF
20%
10%
5%
50V
25V
50V
C358
C359
C360
C361
C362
1-113-619-11
1-162-917-11
1-162-917-11
1-162-921-11
1-162-921-11
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
0.47µF
15pF
15pF
33pF
33pF
5%
5%
5%
5%
10V
50V
50V
50V
50V
C370
C371
C372
C373
C380
1-135-834-91
1-115-416-11
1-164-156-11
1-127-715-91
1-164-156-11
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
2.2µF
0.001µF
0.1µF
0.22µF
0.1µF
C1001
C1002
C1010
C1013
C1014
1-162-919-11
1-162-919-11
1-164-156-11
1-126-965-91
1-164-156-11
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
ELECT
CERAMIC CHIP
22pF
22pF
0.1µF
22µF
0.1µF
5%
5%
C1015
C1020
C4017
C4031
C4032
1-127-715-91
1-164-230-11
1-162-922-11
1-162-970-11
1-126-964-11
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
ELECT
0.22µF
220pF
39pF
0.01µF
10µF
10%
5%
5%
10%
20%
16V
50V
50V
25V
50V
C4033
C4035
C4036
C4038
C4039
1-126-933-11
1-126-964-11
1-126-964-11
1-126-964-11
1-126-964-11
ELECT
ELECT
ELECT
ELECT
ELECT
100µF
10µF
10µF
10µF
10µF
20%
20%
20%
20%
20%
16V
50V
50V
50V
50V
C4040
C4041
C4042
C4043
C4044
1-164-156-11
1-164-156-11
1-164-156-11
1-164-156-11
1-164-156-11
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
0.1µF
0.1µF
0.1µF
0.1µF
0.1µF
25V
25V
25V
25V
25V
C4045
C4046
C4047
C4048
C4055
1-164-156-11
1-164-156-11
1-164-156-11
1-164-156-11
1-164-156-11
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
0.1µF
0.1µF
0.1µF
0.1µF
0.1µF
25V
25V
25V
25V
25V
C4056
C4057
C4058
C4059
C4060
1-164-156-11
1-164-156-11
1-164-156-11
1-164-156-11
1-164-156-11
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
0.1µF
0.1µF
0.1µF
0.1µF
0.1µF
25V
25V
25V
25V
25V
C4061
C4062
C4064
C4066
C4067
1-164-156-11
1-164-156-11
1-126-964-11
1-126-959-11
1-115-156-11
CERAMIC CHIP
CERAMIC CHIP
ELECT
ELECT
CERAMIC CHIP
0.1µF
0.1µF
10µF
0.47µF
1µF
25V
25V
50V
50V
10V
C4068
C4071
C4072
C4082
C4088
1-115-156-11
1-115-156-11
1-115-156-11
1-126-964-11
1-164-315-11
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
ELECT
CERAMIC CHIP
1µF
1µF
1µF
10µF
470pF
20%
5%
10V
10V
10V
50V
50V
C4089
C4090
C4091
1-164-315-11 CERAMIC CHIP 470pF
1-162-970-11 CERAMIC CHIP 0.01µF
1-162-970-11 CERAMIC CHIP 0.01µF
5%
10%
10%
50V
25V
25V
REF.NO. PART NO.
C4101
DESCRIPTION
1-164-217-11 CERAMIC CHIP 150pF
REMARK
5%
50V
<FILTER>
5%
10%
20%
20%
20%
CF120
1-409-327-00 TRAP, CERAMIC (6.5MHZ)
<CONNECTOR>
6.3V
25V
25V
16V
25V
CN1
1-695-302-11 CONNECTOR, BOARD TO BOARD 50P
CN6
* 1-564-516-11 PLUG, CONNECTOR 13P
CN101 1-695-915-11 TAB (CONTACT)
CN102 1-695-915-11 TAB (CONTACT)
CN104 * 1-508-784-00 PIN, CONNECTOR (5MM PITCH) 1P
50V
50V
25V
50V
25V
CN201
1-766-296-11 CONNECTOR, DUAL SCART
(AV1, AV2 IN/OUT)
CN301 * 1-564-510-11 PLUG, CONNECTOR 7P
CN4501 * 1-564-511-11 PLUG, CONNECTOR 8P
CN4502 * 1-564-510-11 PLUG, CONNECTOR 7P
<DIODE>
D2
D11
D12
D16
D101
8-719-988-61
8-719-069-55
8-719-069-55
8-719-988-61
8-719-977-81
DIODE 1SS355TE-17
DIODE UDZSTE-175.6B
DIODE UDZSTE-175.6B
DIODE 1SS355TE-17
DIODE DTZ33B
D102
D201
D202
D203
D204
8-719-988-61
8-719-069-60
8-719-069-60
8-719-069-60
8-719-069-60
DIODE 1SS355TE-17
DIODE UDZSTE-179.1B
DIODE UDZSTE-179.1B
DIODE UDZSTE-179.1B
DIODE UDZSTE-179.1B
D205
D206
D207
D208
D209
8-719-069-60
8-719-069-60
8-719-069-60
8-719-069-60
8-719-069-60
DIODE UDZSTE-179.1B
DIODE UDZSTE-179.1B
DIODE UDZSTE-179.1B
DIODE UDZSTE-179.1B
DIODE UDZSTE-179.1B
D210
D211
D212
D213
D214
8-719-069-60
8-719-069-60
8-719-069-60
8-719-069-60
8-719-069-60
DIODE UDZSTE-179.1B
DIODE UDZSTE-179.1B
DIODE UDZSTE-179.1B
DIODE UDZSTE-179.1B
DIODE UDZSTE-179.1B
D215
D216
D217
D218
D220
8-719-069-60
8-719-069-55
8-719-069-55
8-719-069-55
8-719-988-61
DIODE UDZSTE-179.1B
DIODE UDZSTE-175.6B
DIODE UDZSTE-175.6B
DIODE UDZSTE-175.6B
DIODE 1SS355TE-17
D221
D222
D223
D224
D225
8-719-988-61
8-719-069-55
8-719-069-60
8-719-069-60
8-719-069-60
DIODE 1SS355TE-17
DIODE UDZSTE-175.6B
DIODE UDZSTE-179.1B
DIODE UDZSTE-179.1B
DIODE UDZSTE-179.1B
D226
D251
D303
D304
D320
8-719-069-60
8-719-047-16
8-719-988-61
8-719-988-61
8-719-069-60
DIODE UDZSTE-179.1B
DIODE BAS216
DIODE 1SS355TE-17
DIODE 1SS355TE-17
DIODE UDZSTE-179.1B
– 103 –
KP-41PX1/41PX1K/41PX1R
The components identified by shading
and mark ¡ are critical for safety.
Replace only with part number specified.
REF.NO. PART NO.
DESCRIPTION
K
8-719-047-16
8-719-069-60
8-719-988-61
8-719-036-58
8-719-069-60
DIODE BAS216
DIODE UDZSTE-179.1B
DIODE 1SS355TE-17
DIODE MA3030-H (TX)
DIODE UDZSTE-179.1B
D4006
D4007
D4008
D4009
D4010
8-719-069-60
8-719-069-60
8-719-069-60
8-719-069-60
8-719-069-60
DIODE UDZSTE-179.1B
DIODE UDZSTE-179.1B
DIODE UDZSTE-179.1B
DIODE UDZSTE-179.1B
DIODE UDZSTE-179.1B
D4011
D4015
8-719-069-55 DIODE UDZSTE-175.6B
8-719-069-55 DIODE UDZSTE-175.6B
<FERRITE BEAD>
FB101
1-414-235-22 FERRITE
RM-892
A
REMARK
D370
D401
D402
D1010
D4004
RM-892
REF.NO. PART NO.
DESCRIPTION
REMARK
JR205
JR206
JR207
JR208
JR209
1-216-295-91
1-216-295-91
1-216-295-91
1-216-296-11
1-216-295-91
SHORT
SHORT
SHORT
SHORT
SHORT
0
0
0
0
0
JR211
JR212
JR301
JR303
JR304
1-216-295-91
1-216-295-91
1-216-295-91
1-216-296-11
1-216-296-11
SHORT
SHORT
SHORT
SHORT
SHORT
0
0
0
0
0
JR305
JR360
JR362
JR1010
1-216-296-11
1-216-295-91
1-216-295-91
1-216-864-11
SHORT
SHORT
SHORT
SHORT
0
0
0
0
0µH
<COIL>
<FILTER>
FL101
FL102
FL103
FL104
FL105
1-236-071-11
1-233-765-21
1-233-765-21
1-233-765-21
1-236-071-11
ENCAPSULATED COMPONENT
FILTER
FILTER
FILTER
ENCAPSULATED COMPONENT
FL106
FL107
FL108
FL201
FL202
1-236-071-11
1-236-071-11
1-236-071-11
1-236-071-11
1-236-071-11
ENCAPSULATED COMPONENT
ENCAPSULATED COMPONENT
ENCAPSULATED COMPONENT
ENCAPSULATED COMPONENT
ENCAPSULATED COMPONENT
FL203
FL1001
1-236-071-11 ENCAPSULATED COMPONENT
1-236-071-11 ENCAPSULATED COMPONENT
<IC>
L101
L102
L103
L120
L121
1-410-993-42
1-410-506-11
1-412-009-31
1-408-602-31
1-414-177-11
INDUCTOR CHIP
INDUCTOR
INDUCTOR CHIP
INDUCTOR
INDUCTOR
1µH
5.6µH
18µH
8.2µH
1µH
L122
L201
L202
L203
L204
1-408-602-31
1-414-187-11
1-412-002-31
1-412-002-31
1-412-002-31
INDUCTOR
INDUCTOR
INDUCTOR CHIP
INDUCTOR CHIP
INDUCTOR CHIP
8.2µH
47µH
4.7µH
4.7µH
4.7µH
L205
L206
L207
L208
L300
1-412-002-31
1-412-002-31
1-216-864-11
1-412-002-31
1-412-006-31
INDUCTOR CHIP
INDUCTOR CHIP
SHORT
INDUCTOR CHIP
INDUCTOR CHIP
4.7µH
4.7µH
0
4.7µH
10µH
L302
L303
L304
L305
1-412-979-21
1-412-979-21
1-412-979-21
1-412-979-21
INDUCTOR
INDUCTOR
INDUCTOR
INDUCTOR
1µF
1µF
1µF
1µF
IC1
IC2
IC3
IC4
IC103
8-759-376-77
8-759-564-06
1-750-797-12
8-759-394-57
8-752-390-37
IC SDA30C263-GEG
IC M24C32-MN6T
SOCKET, PLCC
IC PST593C-MMP-4P
IC CXD2064Q-T6
IC201
IC202
IC204
IC205
IC206
8-752-081-26
6-700-412-01
8-759-008-67
8-759-394-57
8-752-058-68
IC CXA2040AQ-T4
IC MSP3411G-PS-B8
IC MC14066BF
IC PST593C-MMP-4P
IC CXA1315M
Q1
Q2
Q4
Q17
Q18
8-729-120-28
8-729-026-49
8-729-120-28
8-729-120-28
8-729-027-38
TRANSISTOR 2SC1623-L5L6
TRANSISTOR 2SA1037AK-T146-R
TRANSISTOR 2SC1623-L5L6
TRANSISTOR 2SC1623-L5L6
TRANSISTOR DTA144EKA-T146
IC301
IC302
IC303
IC1001
IC4003
8-752-081-43
8-759-565-20
8-759-430-79
8-759-584-20
8-752-087-76
IC CXA2076Q-TL
IC TDA4665T/V5-118
IC TDA8395T/N3
IC SDA5273-3CP-C55-22-GEG
IC CXA2089Q-T6
Q20
Q21
Q22
Q23
Q24
8-729-120-28
8-729-120-28
8-729-120-28
8-729-026-49
8-729-026-49
TRANSISTOR 2SC1623-L5L6
TRANSISTOR 2SC1623-L5L6
TRANSISTOR 2SC1623-L5L6
TRANSISTOR 2SA1037AK-T146-R
TRANSISTOR 2SA1037AK-T146-R
Q25
Q81
Q101
Q102
Q103
8-729-026-49
8-729-120-28
8-729-120-28
8-729-026-49
8-729-026-49
TRANSISTOR 2SA1037AK-T146-R
TRANSISTOR 2SC1623-L5L6
TRANSISTOR 2SC1623-L5L6
TRANSISTOR 2SA1037AK-T146-R
TRANSISTOR 2SA1037AK-T146-R
Q104
Q105
8-729-120-28 TRANSISTOR 2SC1623-L5L6
8-729-120-28 TRANSISTOR 2SC1623-L5L6
<CHIP CONDUCTOR>
JR1
JR2
JR3
JR6
JR201
1-216-864-11
1-216-296-11
1-216-296-11
1-216-864-11
1-216-864-11
SHORT
SHORT
SHORT
SHORT
SHORT
0
0
0
0
0
<TRANSISTOR>
– 104 –
RM-862
KP-41PX1/41PX1K/41PX1R
The components identified by shading
and mark ¡ are critical for safety.
Replace only with part number specified.
REF.NO. PART NO.
DESCRIPTION
K
RM-892
RM-892
RM-862
A
REMARK
REF.NO. PART NO.
DESCRIPTION
REMARK
Q106
Q107
Q108
8-729-120-28 TRANSISTOR 2SC1623-L5L6
8-729-026-49 TRANSISTOR 2SA1037AK-T146-R
8-729-026-49 TRANSISTOR 2SA1037AK-T146-R
Q109
Q110
Q111
Q112
Q113
8-729-026-49
8-729-120-28
8-729-026-49
8-729-120-28
8-729-120-28
TRANSISTOR 2SA1037AK-T146-R
TRANSISTOR 2SC1623-L5L6
TRANSISTOR 2SA1037AK-T146-R
TRANSISTOR 2SC1623-L5L6
TRANSISTOR 2SC1623-L5L6
R1
R2
R3
R4
R5
1-216-821-11
1-216-809-11
1-216-809-11
1-216-803-11
1-216-833-11
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
1K
100
100
33
10K
5%
5%
5%
5%
5%
1/16W
1/16W
1/16W
1/16W
1/16W
Q114
Q115
Q116
Q117
Q118
8-729-120-28
8-729-120-28
8-729-026-49
8-729-026-49
8-729-039-67
TRANSISTOR 2SC1623-L5L6
TRANSISTOR 2SC1623-L5L6
TRANSISTOR 2SA1037AK-T146-R
TRANSISTOR 2SA1037AK-T146-R
TRANSISTOR BSS83
R6
R7
R9
R20
R21
1-208-798-11
1-216-817-11
1-216-817-11
1-216-809-11
1-216-809-11
METAL CHIP
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
4.7K
470
470
100
100
0.5%
5%
5%
5%
5%
1/10W
1/16W
1/16W
1/16W
1/16W
Q120
Q121
Q122
Q124
Q125
8-729-120-28
8-729-120-28
8-729-120-28
8-729-120-28
8-729-026-49
TRANSISTOR 2SC1623-L5L6
TRANSISTOR 2SC1623-L5L6
TRANSISTOR 2SC1623-L5L6
TRANSISTOR 2SC1623-L5L6
TRANSISTOR 2SA1037AK-T146-R
R24
R25
R28
R29
R30
1-216-829-11
1-216-829-11
1-216-833-11
1-216-829-11
1-216-829-11
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
4.7K
4.7K
10K
4.7K
4.7K
5%
5%
5%
5%
5%
1/16W
1/16W
1/16W
1/16W
1/16W
Q130
Q201
Q203
Q204
Q205
8-729-026-49
8-729-120-28
8-729-120-28
8-729-120-28
8-729-120-28
TRANSISTOR 2SA1037AK-T146-R
TRANSISTOR 2SC1623-L5L6
TRANSISTOR 2SC1623-L5L6
TRANSISTOR 2SC1623-L5L6
TRANSISTOR 2SC1623-L5L6
R31
R32
R33
R34
R35
1-216-829-11
1-216-809-11
1-216-809-11
1-216-809-11
1-216-809-11
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
4.7K
100
100
100
100
5%
5%
5%
5%
5%
1/16W
1/16W
1/16W
1/16W
1/16W
Q206
Q207
Q208
Q209
Q211
8-729-120-28
8-729-120-28
8-729-120-28
8-729-120-28
1-801-806-11
TRANSISTOR 2SC1623-L5L6
TRANSISTOR 2SC1623-L5L6
TRANSISTOR 2SC1623-L5L6
TRANSISTOR 2SC1623-L5L6
TRANSISTOR DTC144EKA-T146
R39
R46
R49
R52
R53
1-216-833-11
1-216-844-11
1-216-809-11
1-216-837-11
1-216-821-11
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
10K
82K
100
22K
1K
5%
5%
5%
5%
5%
1/16W
1/16W
1/16W
1/16W
1/16W
Q212
Q213
Q214
Q215
Q216
8-729-026-49
8-729-026-49
1-801-806-11
8-729-120-28
8-729-120-28
TRANSISTOR 2SA1037AK-T146-R
TRANSISTOR 2SA1037AK-T146-R
TRANSISTOR DTC144EKA-T146
TRANSISTOR 2SC1623-L5L6
TRANSISTOR 2SC1623-L5L6
R54
R58
R59
R60
R61
1-216-809-11
1-216-828-11
1-216-809-11
1-216-809-11
1-216-809-11
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
100
3.9K
100
100
100
5%
5%
5%
5%
5%
1/16W
1/16W
1/16W
1/16W
1/16W
Q300
Q304
Q305
Q306
Q307
1-801-806-11
8-729-120-28
8-729-120-28
1-801-806-11
1-801-806-11
TRANSISTOR DTC144EKA-T146
TRANSISTOR 2SC1623-L5L6
TRANSISTOR 2SC1623-L5L6
TRANSISTOR DTC144EKA-T146
TRANSISTOR DTC144EKA-T146
R62
R63
R64
R65
R66
1-216-809-11
1-216-809-11
1-216-809-11
1-216-809-11
1-216-825-11
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
100
100
100
100
2.2K
5%
5%
5%
5%
5%
1/16W
1/16W
1/16W
1/16W
1/16W
Q308
Q309
Q330
Q331
Q333
1-801-806-11
1-801-806-11
8-729-026-49
8-729-120-28
8-729-026-49
TRANSISTOR DTC144EKA-T146
TRANSISTOR DTC144EKA-T146
TRANSISTOR 2SA1037AK-T146-R
TRANSISTOR 2SC1623-L5L6
TRANSISTOR 2SA1037AK-T146-R
R67
R68
R69
R70
R71
1-216-825-11
1-216-809-11
1-216-821-11
1-216-809-11
1-216-809-11
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
2.2K
100
1K
100
100
5%
5%
5%
5%
5%
1/16W
1/16W
1/16W
1/16W
1/16W
Q334
Q335
Q401
Q402
Q403
8-729-026-49
8-729-026-49
8-729-120-28
8-729-120-28
8-729-120-28
TRANSISTOR 2SA1037AK-T146-R
TRANSISTOR 2SA1037AK-T146-R
TRANSISTOR 2SC1623-L5L6
TRANSISTOR 2SC1623-L5L6
TRANSISTOR 2SC1623-L5L6
R72
R73
R74
R76
R78
1-216-809-11
1-216-809-11
1-216-809-11
1-216-809-11
1-216-809-11
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
100
100
100
100
100
5%
5%
5%
5%
5%
1/16W
1/16W
1/16W
1/16W
1/16W
Q404
Q405
Q1001
Q1002
Q2412
8-729-026-49
8-729-026-49
1-801-806-11
8-729-026-49
8-729-027-56
TRANSISTOR 2SA1037AK-T146-R
TRANSISTOR 2SA1037AK-T146-R
TRANSISTOR DTC144EKA-T146
TRANSISTOR 2SA1037AK-T146-R
TRANSISTOR DTC143TKA-T146
R79
R80
R83
R84
R85
1-216-813-11
1-216-821-11
1-216-809-11
1-216-845-11
1-216-843-11
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
220
1K
100
100K
68K
5%
5%
5%
5%
5%
1/16W
1/16W
1/16W
1/16W
1/16W
Q2414
Q4003
Q4007
8-729-026-49 TRANSISTOR 2SA1037AK-T146-R
8-729-120-28 TRANSISTOR 2SC1623-L5L6
8-729-120-28 TRANSISTOR 2SC1623-L5L6
R86
R87
R88
1-216-821-11 RES-CHIP
1-216-835-11 RES-CHIP
1-216-809-11 RES-CHIP
1K
15K
100
5%
5%
5%
1/16W
1/16W
1/16W
<RESISTOR>
– 105 –
KP-41PX1/41PX1K/41PX1R
The components identified by shading
and mark ¡ are critical for safety.
Replace only with part number specified.
REF.NO. PART NO.
K
RM-892
RM-892
RM-862
A
DESCRIPTION
REMARK
R91
R92
1-216-809-11 RES-CHIP
1-216-809-11 RES-CHIP
100
100
5%
5%
1/16W
1/16W
R93
R94
R95
R97
R100
1-216-813-11
1-216-813-11
1-216-813-11
1-216-809-11
1-216-813-11
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
220
220
220
100
220
5%
5%
5%
5%
5%
1/16W
1/16W
1/16W
1/16W
1/16W
R101
R102
R103
R104
R105
1-216-864-11
1-216-809-11
1-216-809-11
1-216-833-11
1-216-853-11
SHORT
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
0
100
100
10K
470K
5%
5%
5%
5%
1/16W
1/16W
1/16W
1/16W
R106
R107
R108
R109
R110
1-216-833-11
1-216-818-11
1-216-842-11
1-216-821-11
1-216-832-11
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
10K
560
56K
1K
8.2K
5%
5%
5%
5%
5%
1/16W
1/16W
1/16W
1/16W
1/16W
R111
R112
R113
R114
R115
1-216-811-11
1-216-811-11
1-216-797-11
1-216-811-11
1-216-815-11
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
150
150
10
150
330
5%
5%
5%
5%
5%
1/16W
1/16W
1/16W
1/16W
1/16W
R116
R117
R118
R119
R120
1-216-817-11
1-216-831-11
1-216-805-11
1-216-834-11
1-216-831-11
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
470
6.8K
47
12K
6.8K
5%
5%
5%
5%
5%
1/16W
1/16W
1/16W
1/16W
1/16W
R121
R122
R123
R124
R125
1-216-833-11
1-216-817-11
1-216-812-11
1-216-821-11
1-216-837-11
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
10K
470
180
1K
22K
5%
5%
5%
5%
5%
1/16W
1/16W
1/16W
1/16W
1/16W
R126
R127
R128
R129
R130
1-216-809-11
1-216-837-11
1-216-814-11
1-216-815-11
1-216-827-11
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
100
22K
270
330
3.3K
5%
5%
5%
5%
5%
1/16W
1/16W
1/16W
1/16W
1/16W
R131
R132
R133
R134
R135
1-216-833-11
1-216-809-11
1-216-817-11
1-216-797-11
1-216-819-11
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
10K
100
470
10
680
5%
5%
5%
5%
5%
1/16W
1/16W
1/16W
1/16W
1/16W
R136
R137
R138
R139
R140
1-216-813-11
1-216-821-11
1-216-817-11
1-216-821-11
1-216-817-11
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
220
1K
470
1K
470
5%
5%
5%
5%
5%
1/16W
1/16W
1/16W
1/16W
1/16W
R141
R142
R144
R145
R146
1-216-820-11
1-216-864-11
1-216-822-11
1-216-809-11
1-216-809-11
RES-CHIP
SHORT
RES-CHIP
RES-CHIP
RES-CHIP
820
0
1.2K
100
100
5%
1/16W
5%
5%
5%
1/16W
1/16W
1/16W
R147
R148
R149
R150
1-216-809-11
1-216-809-11
1-216-809-11
1-216-809-11
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
100
100
100
100
5%
5%
5%
5%
1/16W
1/16W
1/16W
1/16W
REF.NO. PART NO.
DESCRIPTION
REMARK
R151
1-216-809-11 RES-CHIP
100
5%
1/16W
R152
R153
R154
R157
R160
1-216-827-11
1-216-809-11
1-216-864-11
1-216-864-11
1-216-864-11
RES-CHIP
RES-CHIP
SHORT
SHORT
SHORT
3.3K
100
0
0
0
5%
5%
1/16W
1/16W
R161
R162
R163
R164
R165
1-208-794-11
1-208-790-11
1-216-813-11
1-216-841-11
1-216-841-11
METAL CHIP
METAL CHIP
RES-CHIP
RES-CHIP
RES-CHIP
3.3K
2.2K
220
47K
47K
0.5%
0.5%
5%
5%
5%
1/10W
1/10W
1/16W
1/16W
1/16W
R166
R167
R168
R169
R170
1-216-813-11
1-216-818-11
1-216-830-11
1-216-813-11
1-208-798-11
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
METAL CHIP
220
560
5.6K
220
4.7K
5%
5%
5%
5%
0.5%
1/16W
1/16W
1/16W
1/16W
1/10W
R171
R172
R174
R175
R176
1-216-809-11
1-216-813-11
1-216-821-11
1-216-821-11
1-216-821-11
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
100
220
1K
1K
1K
5%
5%
5%
5%
5%
1/16W
1/16W
1/16W
1/16W
1/16W
R177
R178
R179
R180
R181
1-208-811-11
1-216-837-11
1-216-817-11
1-216-841-11
1-216-841-11
METAL CHIP
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
16K
22K
470
47K
47K
0.5%
5%
5%
5%
5%
1/10W
1/16W
1/16W
1/16W
1/16W
R182
R183
R184
R185
R186
1-216-635-11
1-208-770-11
1-216-817-11
1-216-818-11
1-216-830-11
METAL CHIP
METAL CHIP
RES-CHIP
RES-CHIP
RES-CHIP
220
330
470
560
5.6K
0.5%
0.5%
5%
5%
5%
1/10W
1/10W
1/16W
1/16W
1/16W
R187
R188
R189
R190
R191
1-216-821-11
1-216-825-11
1-216-818-11
1-216-830-11
1-216-825-11
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
1K
2.2K
560
5.6K
2.2K
5%
5%
5%
5%
5%
1/16W
1/16W
1/16W
1/16W
1/16W
R192
R193
R194
R195
R196
1-216-821-11
1-216-821-11
1-216-821-11
1-216-821-11
1-216-821-11
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
1K
1K
1K
1K
1K
5%
5%
5%
5%
5%
1/16W
1/16W
1/16W
1/16W
1/16W
R197
R198
R199
R200
R201
1-216-821-11
1-216-813-11
1-208-764-11
1-216-821-11
1-216-864-11
RES-CHIP
RES-CHIP
METAL CHIP
RES-CHIP
SHORT
1K
220
180
1K
0
5%
5%
0.5%
5%
1/16W
1/16W
1/10W
1/16W
R202
R203
R204
R205
R206
1-216-821-11
1-216-809-11
1-216-809-11
1-216-837-11
1-216-813-11
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
1K
100
100
22K
220
5%
5%
5%
5%
5%
1/16W
1/16W
1/16W
1/16W
1/16W
R207
R208
R209
R211
R212
1-216-841-11
1-216-819-11
1-216-821-11
1-216-821-11
1-218-285-11
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
47K
680
1K
1K
75
5%
5%
5%
5%
5%
1/16W
1/16W
1/16W
1/16W
1/16W
– 106 –
KP-41PX1/41PX1K/41PX1R
The components identified by shading
and mark ¡ are critical for safety.
Replace only with part number specified.
REF.NO. PART NO.
K
RM-892
RM-892
RM-862
A
DESCRIPTION
REMARK
R213
R214
R216
R217
R218
1-218-285-11
1-216-821-11
1-216-809-11
1-216-837-11
1-216-809-11
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
75
1K
100
22K
100
5%
5%
5%
5%
5%
1/16W
1/16W
1/16W
1/16W
1/16W
R219
R220
R221
R222
R223
1-216-837-11
1-216-864-11
1-216-816-11
1-216-841-11
1-216-864-11
RES-CHIP
SHORT
RES-CHIP
RES-CHIP
SHORT
22K
0
390
47K
0
5%
1/16W
5%
5%
1/16W
1/16W
R224
R225
R226
R227
R228
1-216-816-11
1-216-841-11
1-216-821-11
1-216-808-11
1-218-285-11
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
390
47K
1K
82
75
5%
5%
5%
5%
5%
1/16W
1/16W
1/16W
1/16W
1/16W
R229
R230
R232
R233
R234
1-216-821-11
1-216-808-11
1-216-821-11
1-216-809-11
1-216-837-11
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
1K
82
1K
100
22K
5%
5%
5%
5%
5%
1/16W
1/16W
1/16W
1/16W
1/16W
R235
R236
R237
R238
R239
1-216-809-11
1-216-837-11
1-216-864-11
1-216-841-11
1-216-816-11
RES-CHIP
RES-CHIP
SHORT
RES-CHIP
RES-CHIP
100
22K
0
47K
390
5%
5%
1/16W
1/16W
5%
5%
1/16W
1/16W
R240
R241
R242
R243
R244
1-216-864-11
1-216-841-11
1-216-816-11
1-216-864-11
1-216-817-11
SHORT
RES-CHIP
RES-CHIP
SHORT
RES-CHIP
0
47K
390
0
470
R245
R247
R248
R250
R251
1-216-821-11
1-216-817-11
1-216-809-11
1-216-864-11
1-216-821-11
RES-CHIP
RES-CHIP
RES-CHIP
SHORT
RES-CHIP
R252
R253
R254
R255
R256
1-216-833-11
1-216-821-11
1-216-817-11
1-216-809-11
1-216-809-11
R257
R258
R259
R260
R261
5%
5%
1/16W
1/16W
5%
1/16W
1K
470
100
0
1K
5%
5%
5%
1/16W
1/16W
1/16W
5%
1/16W
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
10K
1K
470
100
100
5%
5%
5%
5%
5%
1/16W
1/16W
1/16W
1/16W
1/16W
1-216-833-11
1-216-817-11
1-216-827-11
1-216-813-11
1-216-817-11
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
10K
470
3.3K
220
470
5%
5%
5%
5%
5%
1/16W
1/16W
1/16W
1/16W
1/16W
R262
R263
R264
R265
R266
1-216-809-11
1-216-821-11
1-216-841-11
1-216-829-11
1-216-841-11
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
100
1K
47K
4.7K
47K
5%
5%
5%
5%
5%
1/16W
1/16W
1/16W
1/16W
1/16W
R267
R268
R269
R270
R271
1-216-838-11
1-216-841-11
1-216-841-11
1-218-285-11
1-218-285-11
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
27K
47K
47K
75
75
5%
5%
5%
5%
5%
1/16W
1/16W
1/16W
1/16W
1/16W
REF.NO. PART NO.
DESCRIPTION
REMARK
R272
R273
R274
R280
R281
1-218-285-11
1-218-285-11
1-216-841-11
1-216-821-11
1-216-841-11
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
75
75
47K
1K
47K
5%
5%
5%
5%
5%
1/16W
1/16W
1/16W
1/16W
1/16W
R282
R283
R284
R285
R286
1-216-843-11
1-216-829-11
1-216-841-11
1-216-843-11
1-216-829-11
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
68K
4.7K
47K
68K
4.7K
5%
5%
5%
5%
5%
1/16W
1/16W
1/16W
1/16W
1/16W
R287
R288
R289
R290
R291
1-216-817-11
1-216-821-11
1-216-813-11
1-216-813-11
1-216-825-11
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
470
1K
220
220
2.2K
5%
5%
5%
5%
5%
1/16W
1/16W
1/16W
1/16W
1/16W
R292
R295
R296
R297
R298
1-216-825-11
1-216-821-11
1-216-821-11
1-216-813-11
1-216-813-11
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
2.2K
1K
1K
220
220
5%
5%
5%
5%
5%
1/16W
1/16W
1/16W
1/16W
1/16W
R300
R301
R302
R303
R304
1-216-809-11
1-216-813-11
1-216-864-11
1-216-864-11
1-216-861-11
RES-CHIP
RES-CHIP
SHORT
SHORT
RES-CHIP
100
220
0
0
2.2M
5%
5%
1/16W
1/16W
5%
1/16W
R305
R308
R309
R310
R312
1-216-813-11
1-216-809-11
1-216-813-11
1-216-813-11
1-216-864-11
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
SHORT
220
100
220
220
0
5%
5%
5%
5%
1/16W
1/16W
1/16W
1/16W
R314
R315
R316
R317
R320
1-216-864-11
1-216-864-11
1-216-813-11
1-216-813-11
1-216-809-11
SHORT
SHORT
RES-CHIP
RES-CHIP
RES-CHIP
0
0
220
220
100
5%
5%
5%
1/16W
1/16W
1/16W
R321
R322
R323
R325
R326
1-216-809-11
1-216-809-11
1-216-813-11
1-216-841-11
1-216-809-11
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
100
100
220
47K
100
5%
5%
5%
5%
5%
1/16W
1/16W
1/16W
1/16W
1/16W
R327
R329
R330
R331
R332
1-216-809-11
1-216-841-11
1-216-809-11
1-216-826-11
1-216-821-11
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
100
47K
100
2.7K
1K
5%
5%
5%
5%
5%
1/16W
1/16W
1/16W
1/16W
1/16W
R333
R334
R335
R336
R337
1-216-830-11
1-216-817-11
1-208-806-11
1-216-851-11
1-216-809-11
RES-CHIP
RES-CHIP
METAL CHIP
RES-CHIP
RES-CHIP
5.6K
470
10K
330K
100
5%
5%
0.5%
5%
5%
1/16W
1/16W
1/10W
1/16W
1/16W
R338
R339
R340
R341
R342
1-216-821-11
1-216-821-11
1-216-809-11
1-216-809-11
1-216-821-11
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
1K
1K
100
100
1K
5%
5%
5%
5%
5%
1/16W
1/16W
1/16W
1/16W
1/16W
R343
1-216-827-11 RES-CHIP
3.3K
5%
1/16W
– 107 –
KP-41PX1/41PX1K/41PX1R
The components identified by shading
and mark ¡ are critical for safety.
Replace only with part number specified.
REF.NO. PART NO.
K
REMARK
1-216-864-11
1-216-809-11
1-216-809-11
1-216-809-11
SHORT
RES-CHIP
RES-CHIP
RES-CHIP
0
100
100
100
R350
R351
R352
R353
R354
1-216-817-11
1-216-823-11
1-216-835-11
1-216-821-11
1-216-864-11
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
SHORT
R355
R356
R359
R360
R361
1-216-843-11
1-216-863-11
1-216-864-11
1-216-861-11
1-216-861-11
R362
R364
R366
R367
R368
RM-892
RM-862
A AE
DESCRIPTION
R345
R347
R348
R349
RM-892
5%
5%
5%
1/16W
1/16W
1/16W
470
1.5K
15K
1K
0
5%
5%
5%
5%
1/16W
1/16W
1/16W
1/16W
RES-CHIP
RES-CHIP
SHORT
RES-CHIP
RES-CHIP
68K
3.3M
0
2.2M
2.2M
5%
5%
1/16W
1/16W
5%
5%
1/16W
1/16W
1-216-821-11
1-216-821-11
1-216-833-11
1-216-822-11
1-216-809-11
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
1K
1K
10K
1.2K
100
5%
5%
5%
5%
5%
1/16W
1/16W
1/16W
1/16W
1/16W
R370
R392
R393
R394
R395
1-216-864-11
1-216-821-11
1-208-782-11
1-208-782-11
1-216-864-11
SHORT
RES-CHIP
METAL CHIP
METAL CHIP
SHORT
0
1K
1K
1K
0
5%
0.5%
0.5%
1/16W
1/10W
1/10W
R401
R402
R403
R404
R405
1-216-813-11
1-216-833-11
1-216-837-11
1-216-838-11
1-216-833-11
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
220
10K
22K
27K
10K
5%
5%
5%
5%
5%
1/16W
1/16W
1/16W
1/16W
1/16W
R406
R407
R408
R409
R410
1-216-833-11
1-216-833-11
1-216-821-11
1-216-821-11
1-216-837-11
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
10K
10K
1K
1K
22K
5%
5%
5%
5%
5%
1/16W
1/16W
1/16W
1/16W
1/16W
R411
R1001
R1002
R1010
R1012
1-216-837-11
1-216-809-11
1-216-809-11
1-216-864-11
1-216-817-11
RES-CHIP
RES-CHIP
RES-CHIP
SHORT
RES-CHIP
22K
100
100
0
470
5%
5%
5%
1/16W
1/16W
1/16W
5%
1/16W
R1014
R1017
R1020
R1021
R1022
1-216-829-11
1-216-864-11
1-216-845-11
1-216-811-11
1-216-811-11
RES-CHIP
SHORT
RES-CHIP
RES-CHIP
RES-CHIP
4.7K
0
100K
150
150
5%
1/16W
5%
5%
5%
1/16W
1/16W
1/16W
R1023
R1024
R1026
R1027
R1028
1-216-811-11
1-216-819-11
1-216-809-11
1-216-809-11
1-216-809-11
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
150
680
100
100
100
5%
5%
5%
5%
5%
1/16W
1/16W
1/16W
1/16W
1/16W
R2436
R2437
R2438
R2914
R2915
1-216-821-11
1-216-833-11
1-216-833-11
1-216-809-11
1-216-809-11
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
1K
10K
10K
100
100
5%
5%
5%
5%
5%
1/16W
1/16W
1/16W
1/16W
1/16W
R4003
R4011
1-218-285-11 RES-CHIP
1-216-809-11 RES-CHIP
75
100
5%
5%
1/16W
1/16W
REF.NO. PART NO.
DESCRIPTION
REMARK
R4029
R4030
R4032
1-216-833-11 RES-CHIP
1-216-833-11 RES-CHIP
1-216-833-11 RES-CHIP
10K
10K
10K
5%
5%
5%
1/16W
1/16W
1/16W
R4047
R4052
R4053
R4054
R4055
1-216-833-11
1-216-864-11
1-216-864-11
1-216-822-11
1-216-822-11
RES-CHIP
SHORT
SHORT
RES-CHIP
RES-CHIP
10K
0
0
1.2K
1.2K
5%
1/16W
5%
5%
1/16W
1/16W
R4058
R4059
R4065
R4066
R4067
1-216-822-11
1-216-822-11
1-216-864-11
1-216-864-11
1-216-864-11
RES-CHIP
RES-CHIP
SHORT
SHORT
SHORT
1.2K
1.2K
0
0
0
5%
5%
1/16W
1/16W
R4073
R4075
R4078
R4084
R4087
1-216-837-11
1-216-817-11
1-216-837-11
1-216-833-11
1-216-807-11
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
22K
470
22K
10K
68
5%
5%
5%
5%
5%
1/16W
1/16W
1/16W
1/16W
1/16W
R4088
R4089
R4105
R4106
R4107
1-216-827-11
1-216-831-11
1-216-813-11
1-216-809-11
1-216-809-11
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
3.3K
6.8K
220
100
100
5%
5%
5%
5%
5%
1/16W
1/16W
1/16W
1/16W
1/16W
R4108
R4111
1-216-813-11 RES-CHIP
1-216-821-11 RES-CHIP
220
1K
5%
5%
1/16W
1/16W
<TUNER>
TU101 0 8-598-535-10 FRONTEND BTF-EF411
<CRYSTAL>
X1
X201
X301
X302
X303
1-767-154-21
1-781-148-21
1-567-504-11
1-567-505-11
1-767-127-11
VIBRATOR, CERAMIC (11.5MHz)
VIBRATOR, CRYSTAL (18.432MHz)
OSCILLATOR, CRYSTAL (4.43MHz)
OSCILLATOR, CRYSTAL (3.58MHz)
VIBRATOR, CERAMIC (503.5kHz)
X1001
1-760-551-21 VIBRATOR, CERAMIC (20.48MHz)
*******************************************************************************
* A-1632-959-A AE BOARD, COMPLETE (41PX1R)
*****************************
1-750-797-12 SOCKET, PLCC
<CAPACITOR>
C1
C2
C3
C4
C8
1-163-038-00
1-126-947-11
1-163-239-11
1-163-239-11
1-163-038-00
CERAMIC CHIP
ELECT
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
0.1µF
47µF
33pF
33pF
0.1µF
C10
C11
C14
C15
C18
1-163-243-11
1-163-243-11
1-163-038-00
1-163-133-00
1-163-038-00
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
47pF
47pF
0.1µF
470pF
0.1µF
– 108 –
20%
5%
5%
5%
5%
5%
25V
16V
50V
50V
25V
50V
50V
25V
50V
25V
KP-41PX1/41PX1K/41PX1R
The components identified by shading
and mark ¡ are critical for safety.
Replace only with part number specified.
REF.NO. PART NO.
K
RM-892
RM-892
AE
DESCRIPTION
REMARK
C19
C20
C21
C22
C24
1-163-017-00
1-164-232-11
1-164-232-11
1-163-251-11
1-163-275-11
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
0.0047µF
0.01µF
0.01µF
100pF
1000pF
10%
10%
10%
5%
5%
50V
50V
50V
50V
50V
C25
C26
C43
C45
C90
1-126-947-11
1-126-947-11
1-163-255-11
1-163-038-00
1-163-038-00
ELECT
ELECT
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
47µF
47µF
150pF
0.1µF
0.1µF
20%
20%
5%
16V
16V
50V
25V
25V
C101
C102
C103
C104
C110
1-163-038-00
1-126-934-11
1-126-965-91
1-163-251-11
1-126-947-11
CERAMIC CHIP
ELECT
ELECT
CERAMIC CHIP
ELECT
0.1µF
220µF
22µF
100pF
47µF
20%
20%
5%
20%
25V
16V
50V
50V
16V
C112
C113
C115
C120
C121
1-163-275-11
1-126-947-11
1-163-263-11
1-163-251-11
1-163-247-11
CERAMIC CHIP
ELECT
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
1000pF
47µF
330pF
100pF
68pF
5%
20%
5%
5%
5%
50V
16V
50V
50V
50V
C122
C123
C124
C125
C126
1-163-137-00
1-163-247-11
1-163-038-00
1-164-232-11
1-126-933-11
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
ELECT
680pF
68pF
0.1µF
0.01µF
100µF
5%
5%
10%
20%
50V
50V
25V
50V
16V
C127
C128
C129
C130
C131
1-164-232-11
1-164-232-11
1-163-089-00
1-164-232-11
1-126-947-11
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
ELECT
0.01µF
0.01µF
6pF
0.01µF
47µF
10%
10%
0.5pF
10%
20%
50V
50V
50V
50V
16V
C132
C133
C134
C135
C136
1-164-232-11
1-126-963-11
1-164-232-11
1-164-232-11
1-164-232-11
CERAMIC CHIP
ELECT
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
0.01µF
4.7µF
0.01µF
0.01µF
0.01µF
10%
20%
10%
10%
10%
50V
50V
50V
50V
50V
C137
C138
C139
C143
C144
1-126-947-11
1-126-964-11
1-164-232-11
1-126-947-11
1-164-232-11
ELECT
ELECT
CERAMIC CHIP
ELECT
CERAMIC CHIP
47µF
10µF
0.01µF
47µF
0.01µF
20%
20%
10%
20%
10%
16V
50V
50V
16V
50V
C145
C146
C147
C148
C149
1-164-232-11
1-164-232-11
1-164-232-11
1-126-933-11
1-164-232-11
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
ELECT
CERAMIC CHIP
0.01µF
0.01µF
0.01µF
100µF
0.01µF
10%
10%
10%
20%
10%
50V
50V
50V
16V
50V
C150
C151
C152
C153
C154
1-164-232-11
1-164-232-11
1-164-004-11
1-164-004-11
1-164-232-11
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
0.01µF
0.01µF
0.1µF
0.1µF
0.01µF
10%
10%
10%
10%
10%
50V
50V
25V
25V
50V
C155
C201
C202
C203
C204
1-164-232-11
1-164-004-11
1-164-004-11
1-104-661-91
1-163-038-00
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
ELECT
CERAMIC CHIP
0.01µF
0.1µF
0.1µF
330µF
0.1µF
10%
10%
10%
20%
50V
25V
25V
16V
25V
REF.NO. PART NO.
DESCRIPTION
REMARK
C205
C206
C207
C208
C209
1-126-965-91
1-163-275-11
1-126-964-11
1-126-965-91
1-126-964-11
ELECT
CERAMIC CHIP
ELECT
ELECT
ELECT
22µF
1000pF
10µF
22µF
10µF
C210
C211
C212
C213
C214
1-216-295-00
1-126-965-91
1-164-346-11
1-163-133-00
1-164-346-11
SHORT
ELECT
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
0
22µF
1µF
470pF
1µF
C215
C216
C217
C218
C219
1-163-133-00
1-126-947-11
1-164-232-11
1-126-947-11
1-164-232-11
CERAMIC CHIP
ELECT
CERAMIC CHIP
ELECT
CERAMIC CHIP
470pF
47µF
0.01µF
47µF
0.01µF
5%
20%
10%
20%
10%
50V
16V
50V
16V
50V
C220
C221
C222
C223
C224
1-126-965-91
1-164-505-11
1-164-346-11
1-163-133-00
1-164-346-11
ELECT
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
22µF
2.2µF
1µF
470pF
1µF
20%
50V
16V
16V
50V
16V
C225
C226
C227
C228
C229
1-163-133-00
1-126-947-11
1-164-232-11
1-126-947-11
1-164-232-11
CERAMIC CHIP
ELECT
CERAMIC CHIP
ELECT
CERAMIC CHIP
470pF
47µF
0.01µF
47µF
0.01µF
5%
20%
10%
20%
10%
50V
16V
50V
16V
50V
C230
C242
C243
C244
C245
1-216-295-00
1-164-232-11
1-126-967-11
1-164-232-11
1-164-232-11
SHORT
CERAMIC CHIP
ELECT
CERAMIC CHIP
CERAMIC CHIP
0
0.01µF
47µF
0.01µF
0.01µF
10%
20%
10%
10%
50V
50V
50V
50V
C251
C252
C253
C254
C255
1-163-087-00
1-163-087-00
1-163-251-11
1-163-243-11
1-163-251-11
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
4pF
4pF
100pF
47pF
100pF
0.25pF 50V
0.25pF 50V
5%
50V
5%
50V
5%
50V
C256
C257
C258
C259
C260
1-163-038-00
1-126-965-11
1-126-964-11
1-164-005-11
1-163-038-00
CERAMIC CHIP
ELECT
ELECT
CERAMIC CHIP
CERAMIC CHIP
0.1µF
22µF
10µF
0.47µF
0.1µF
C261
C262
C263
C264
C265
1-163-133-00
1-163-133-00
1-163-038-00
1-126-962-11
1-126-964-11
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
ELECT
ELECT
470pF
470pF
0.1µF
3.3µF
10µF
C266
C267
C268
C269
C270
1-126-964-11
1-126-965-91
1-163-038-00
1-163-131-00
1-163-131-00
ELECT
ELECT
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
10µF
22µF
0.1µF
390pF
390pF
C271
C272
C273
C274
C275
1-163-275-11
1-163-275-11
1-163-275-11
1-163-275-11
1-164-346-11
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
1000pF
1000pF
1000pF
1000pF
1µF
C276
1-164-346-11 CERAMIC CHIP 1µF
– 109 –
20%
5%
20%
20%
20%
50V
50V
50V
50V
50V
20%
50V
16V
50V
16V
5%
5%
20%
20%
5%
5%
20%
20%
20%
20%
5%
5%
5%
5%
5%
5%
25V
50V
50V
25V
25V
50V
50V
25V
50V
50V
50V
50V
25V
50V
50V
50V
50V
50V
50V
16V
16V
RM-862
KP-41PX1/41PX1K/41PX1R
The components identified by shading
and mark ¡ are critical for safety.
Replace only with part number specified.
REF.NO. PART NO.
K
RM-892
RM-892
AE
DESCRIPTION
REMARK
C277
C278
C279
C280
1-164-505-11
1-164-505-11
1-126-965-91
1-163-038-00
CERAMIC CHIP
CERAMIC CHIP
ELECT
CERAMIC CHIP
2.2µF
2.2µF
22µF
0.1µF
C281
C282
C283
C300
C301
1-126-965-91
1-163-038-00
1-164-232-11
1-163-251-11
1-163-038-00
ELECT
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
22µF
0.1µF
0.01µF
100pF
0.1µF
20%
C302
C303
C304
C305
C306
1-163-275-11
1-163-275-11
1-163-038-00
1-163-038-00
1-164-232-11
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
1000pF
1000pF
0.1µF
0.1µF
0.01µF
5%
5%
C307
C308
C309
C310
C311
1-164-232-11
1-164-232-11
1-164-346-11
1-164-346-11
1-164-346-11
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
0.01µF
0.01µF
1µF
1µF
1µF
C312
C313
C315
C316
C317
1-164-505-11
1-163-275-11
1-216-295-00
1-163-239-11
1-163-038-00
CERAMIC CHIP
CERAMIC CHIP
SHORT
CERAMIC CHIP
CERAMIC CHIP
2.2µF
1000pF
0
33pF
0.1µF
C320
C321
C322
C323
C324
1-126-965-91
1-164-232-11
1-163-038-00
1-163-038-00
1-163-038-00
ELECT
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
22µF
0.01µF
0.1µF
0.1µF
0.1µF
C325
C326
C327
C328
C330
1-164-346-11
1-163-275-11
1-137-374-11
1-126-964-11
1-130-777-00
CERAMIC CHIP
CERAMIC CHIP
FILM
ELECT
FILM
1µF
1000pF
0.047µF
10µF
0.1µF
C331
C332
C333
C334
C335
1-137-581-11
1-164-232-11
1-126-933-11
1-164-232-11
1-164-005-11
FILM
CERAMIC CHIP
ELECT
CERAMIC CHIP
CERAMIC CHIP
0.1µF
0.01µF
100µF
0.01µF
0.47µF
5%
10%
20%
10%
100V
50V
16V
50V
25V
C336
C337
C338
C339
C340
1-163-009-11
1-163-009-11
1-126-962-11
1-164-232-11
1-126-933-11
CERAMIC CHIP
CERAMIC CHIP
ELECT
CERAMIC CHIP
ELECT
0.001µF
0.001µF
3.3µF
0.01µF
100µF
10%
10%
20%
10%
20%
50V
50V
50V
50V
16V
C341
C342
C343
C344
C347
1-164-005-11
1-164-346-11
1-163-017-00
1-163-251-11
1-126-963-11
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
ELECT
0.47µF
1µF
0.0047µF 10%
100pF
5%
4.7µF
20%
25V
16V
50V
50V
50V
C348
C350
C351
C352
C353
1-163-133-00
1-126-964-11
1-164-505-11
1-164-005-11
1-164-505-11
CERAMIC CHIP
ELECT
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
470pF
10µF
2.2µF
0.47µF
2.2µF
50V
50V
16V
25V
16V
C354
C355
1-164-005-11 CERAMIC CHIP 0.47µF
1-126-965-91 ELECT
22µF
20%
10%
5%
10%
10%
10%
5%
16V
16V
50V
25V
50V
25V
50V
50V
25V
50V
50V
25V
25V
50V
50V
50V
16V
16V
16V
REF.NO. PART NO.
DESCRIPTION
REMARK
C356
C357
C358
1-164-232-11 CERAMIC CHIP 0.01µF
1-163-133-00 CERAMIC CHIP 470pF
1-164-005-11 CERAMIC CHIP 0.47µF
10%
5%
50V
50V
25V
C359
C360
C370
C371
C372
1-163-231-11
1-163-231-11
1-164-505-11
1-163-275-11
1-164-004-11
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
15pF
15pF
2.2µF
1000pF
0.1µF
5%
5%
50V
50V
16V
50V
25V
C373
C376
C377
C380
C1001
1-164-489-11
1-163-251-11
1-126-964-11
1-163-038-00
1-163-235-11
CERAMIC CHIP
CERAMIC CHIP
ELECT
CERAMIC CHIP
CERAMIC CHIP
0.22µF
100pF
10µF
0.1µF
22pF
10%
5%
20%
C1002
C1010
C1013
C1014
C1015
1-163-235-11
1-163-038-00
1-126-965-91
1-163-038-00
1-164-489-11
CERAMIC CHIP
CERAMIC CHIP
ELECT
CERAMIC CHIP
CERAMIC CHIP
22pF
0.1µF
22µF
0.1µF
0.22µF
5%
C1020
1-163-235-11 CERAMIC CHIP 22pF
5%
10%
5%
16V
50V
50V
25V
50V
10%
50V
25V
50V
25V
16V
5%
50V
20%
16V
50V
<FILTER>
5%
20%
10%
5%
5%
20%
5%
5%
20%
20%
50V
25V
50V
50V
25V
25V
25V
16V
50V
50V
50V
63V
25V
50V
CF120
1-781-328-21 TRAP, CERAMIC (6.5MHZ)
<CONNECTOR>
CN1
1-695-302-11 CONNECTOR, BOARD TO BOARD 50P
CN2
* 1-564-508-11 PLUG, CONNECTOR 5P
CN6
* 1-564-516-11 PLUG, CONNECTOR 13P
CN101 1-695-915-11 TAB (CONTACT)
CN201 1-766-296-31 CONNECTOR, DUAL SCART
CN301 *1-564-510-11 PLUG, CONNECTOR 7P
<DIODE>
D2
D10
D11
D12
D16
8-719-988-61
8-719-069-55
8-719-069-55
8-719-069-55
8-719-988-61
DIODE 1SS355TE-17
DIODE UDZSTE-175.6B
DIODE UDZSTE-175.6B
DIODE UDZSTE-175.6B
DIODE 1SS355TE-17
D101
D102
D201
D202
D203
8-719-977-81
8-719-988-61
8-719-069-60
8-719-069-60
8-719-069-60
DIODE DTZ33B
DIODE 1SS355TE-17
DIODE UDZSTE-179.1B
DIODE UDZSTE-179.1B
DIODE UDZSTE-179.1B
D204
D205
D206
D207
D208
8-719-069-60
8-719-069-60
8-719-069-60
8-719-069-60
8-719-069-60
DIODE UDZSTE-179.1B
DIODE UDZSTE-179.1B
DIODE UDZSTE-179.1B
DIODE UDZSTE-179.1B
DIODE UDZSTE-179.1B
D209
D210
D211
D212
D213
8-719-069-60
8-719-069-60
8-719-069-60
8-719-069-60
8-719-069-60
DIODE UDZSTE-179.1B
DIODE UDZSTE-179.1B
DIODE UDZSTE-179.1B
DIODE UDZSTE-179.1B
DIODE UDZSTE-179.1B
– 110 –
RM-862
KP-41PX1/41PX1K/41PX1R
The components identified by shading
and mark ¡ are critical for safety.
Replace only with part number specified.
REF.NO. PART NO.
DESCRIPTION
D214
D215
D216
D217
D218
8-719-069-60
8-719-069-60
8-719-069-55
8-719-069-55
8-719-069-55
DIODE UDZSTE-179.1B
DIODE UDZSTE-179.1B
DIODE UDZSTE-175.6B
DIODE UDZSTE-175.6B
DIODE UDZSTE-175.6B
D220
D221
D222
D223
D224
8-719-988-61
8-719-988-61
8-719-069-60
8-719-069-60
8-719-069-60
DIODE 1SS355TE-17
DIODE 1SS355TE-17
DIODE UDZSTE-179.1B
DIODE UDZSTE-179.1B
DIODE UDZSTE-179.1B
D225
D226
D227
D228
D231
8-719-069-60
8-719-069-60
8-719-978-33
8-719-978-33
8-719-069-55
DIODE UDZSTE-179.1B
DIODE UDZSTE-179.1B
DIODE DTZ-TT11-6.8B
DIODE DTZ-TT11-6.8B
DIODE UDZSTE-175.6B
D251
D303
D304
D320
D370
8-719-047-16
8-719-988-61
8-719-988-61
8-719-069-60
8-719-047-16
DIODE BAS216
DIODE 1SS355TE-17
DIODE 1SS355TE-17
DIODE UDZSTE-179.1B
DIODE BAS216
D1010
8-719-036-58 DIODE MA3030-H(TX)
K
RM-892
RM-892
AE
REMARK
REF.NO. PART NO.
DESCRIPTION
REMARK
<CHIP, CONDUCTOR>
JR1
JR2
JR3
JR4
JR201
1-216-295-00
1-216-296-00
1-216-296-00
1-216-295-00
1-216-295-00
SHORT
SHORT
SHORT
SHORT
SHORT
0
0
0
0
0
JR203
JR208
JR209
JR211
JR212
1-216-295-00
1-216-295-00
1-216-295-00
1-216-295-00
1-216-295-00
SHORT
SHORT
SHORT
SHORT
SHORT
0
0
0
0
0
JR303
JR304
JR305
JR360
JR362
1-216-296-00
1-216-296-00
1-216-296-00
1-216-295-00
1-216-295-00
SHORT
SHORT
SHORT
SHORT
SHORT
0
0
0
0
0
JR1010 1-216-295-00 SHORT
0
<COIL>
<FERRITE BEAD>
FB101
FB102
FB103
FB104
1-414-235-11
1-414-235-11
1-414-235-11
1-414-235-11
INDUCTOR CHIP 0µH
INDUCTOR CHIP 0µH
INDUCTOR CHIP 0µH
INDUCTOR CHIP 0µH
<FILTER>
FL101
FL102
FL103
FL104
FL201
1-236-071-11
1-233-765-21
1-233-765-21
1-233-765-21
1-236-071-11
ENCAPSULATED COMPONENT
FILTER
FILTER
FILTER
ENCAPSULATED COMPONENT
FL202
1-236-071-11 ENCAPSULATED COMPONENT
FL203
1-236-071-11 ENCAPSULATED COMPONENT
FL1001 1-236-071-11 ENCAPSULATED COMPONENT
<IC>
IC1
IC2
IC3
IC4
IC102
8-759-376-77
8-759-524-94
8-759-690-63
8-759-394-57
8-759-711-62
IC SDA30C263-GEG
IC M24C32-MW6T
IC M27C2001-12C1-RR403
IC PST593C-MMP-4P
IC NJM2240M
IC103
IC201
IC202
IC204
IC205
8-752-379-35
8-752-081-26
8-759-654-15
8-759-008-67
8-759-394-57
IC CXD2044Q-TL
IC CXA2040AQ-T4
IC MSP3410D-C5-PS-B4
IC MC14066BF
IC PST593C-MMP-4P
IC206
IC301
IC302
IC303
IC1001
8-752-058-68
8-752-081-43
8-759-565-20
8-759-430-79
8-759-584-20
IC CXA1315M
IC CXA2076Q-TL
IC TDA4665T/V5-118
IC TDA8395T/N3
IC SDA5273-3CP
L10
L102
L111
L120
L121
1-410-379-31
1-408-600-31
1-216-295-00
1-408-602-31
1-408-591-11
INDUCTOR CHIP
INDUCTOR
SHORT
INDUCTOR
INDUCTOR
6.8µH
5.6µH
0
8.2µH
1µH
L122
L300
L301
1-408-602-31 INDUCTOR
1-412-006-31 INDUCTOR CHIP
1-410-993-11 INDUCTOR CHIP
8.2µH
10µH
1µH
<TRANSISTOR>
Q1
Q4
Q15
Q17
Q18
8-729-120-28
8-729-120-28
8-729-026-49
8-729-026-49
8-729-027-38
TRANSISTOR 2SC1623-L5L6
TRANSISTOR 2SC1623-L5L6
TRANSISTOR 2SA1037AK-T146-R
TRANSISTOR 2SA1037AK-T146-R
TRANSISTOR DTA144EKA-T146
Q20
Q21
Q22
Q23
Q24
8-729-120-28
8-729-120-28
8-729-120-28
8-729-026-49
8-729-026-49
TRANSISTOR 2SC1623-L5L6
TRANSISTOR 2SC1623-L5L6
TRANSISTOR 2SC1623-L5L6
TRANSISTOR 2SA1037AK-T146-R
TRANSISTOR 2SA1037AK-T146-R
Q25
Q101
Q102
Q103
Q104
8-729-026-49
8-729-120-28
8-729-026-49
8-729-026-49
8-729-120-28
TRANSISTOR 2SA1037AK-T146-R
TRANSISTOR 2SC1623-L5L6
TRANSISTOR 2SA1037AK-T146-R
TRANSISTOR 2SA1037AK-T146-R
TRANSISTOR 2SC1623-L5L6
Q105
Q106
Q107
Q108
Q109
8-729-120-28
8-729-026-49
8-729-026-49
8-729-026-49
8-729-026-49
TRANSISTOR 2SC1623-L5L6
TRANSISTOR 2SA1037AK-T146-R
TRANSISTOR 2SA1037AK-T146-R
TRANSISTOR 2SA1037AK-T146-R
TRANSISTOR 2SA1037AK-T146-R
Q110
Q111
Q112
8-729-120-28 TRANSISTOR 2SC1623-L5L6
8-729-026-49 TRANSISTOR 2SA1037AK-T146-R
8-729-120-28 TRANSISTOR 2SC1623-L5L6
– 111 –
RM-862
KP-41PX1/41PX1K/41PX1R
The components identified by shading
and mark ¡ are critical for safety.
Replace only with part number specified.
REF.NO. PART NO.
K
RM-892
RM-892
RM-862
AE
DESCRIPTION
REMARK
REF.NO. PART NO.
DESCRIPTION
REMARK
Q113
Q114
8-729-026-49 TRANSISTOR 2SA1037AK-T146-R
8-729-026-49 TRANSISTOR 2SA1037AK-T146-R
R32
R33
1-216-025-00 RES,CHIP
1-216-025-00 RES,CHIP
100
100
5%
5%
1/10W
1/10W
Q115
Q116
Q120
Q121
Q122
8-729-120-28
8-729-026-49
8-729-120-28
8-729-120-28
8-729-120-28
TRANSISTOR 2SC1623-L5L6
TRANSISTOR 2SA1037AK-T146-R
TRANSISTOR 2SC1623-L5L6
TRANSISTOR 2SC1623-L5L6
TRANSISTOR 2SC1623-L5L6
R34
R35
R40
R42
R44
1-216-025-00
1-216-025-00
1-216-067-00
1-216-069-00
1-216-069-00
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
100
100
5.6K
6.8K
6.8K
5%
5%
5%
5%
5%
1/10W
1/10W
1/10W
1/10W
1/10W
Q124
Q125
Q130
Q201
Q202
8-729-120-28
8-729-026-49
8-729-026-49
8-729-120-28
8-729-120-28
TRANSISTOR 2SC1623-L5L6
TRANSISTOR 2SA1037AK-T146-R
TRANSISTOR 2SA1037AK-T146-R
TRANSISTOR 2SC1623-L5L6
TRANSISTOR 2SC1623-L5L6
R46
R47
R48
R49
R50
1-216-095-00
1-216-057-00
1-217-671-11
1-216-025-00
1-216-065-00
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
82K
2.2K
1
100
4.7K
5%
5%
5%
5%
5%
1/10W
1/10W
1/10W
1/10W
1/10W
Q203
Q204
Q211
Q212
Q213
8-729-120-28
8-729-120-28
1-801-806-11
8-729-026-49
8-729-026-49
TRANSISTOR 2SC1623-L5L6
TRANSISTOR 2SC1623-L5L6
TRANSISTOR DTC144EKA-T146
TRANSISTOR 2SA1037AK-T146-R
TRANSISTOR 2SA1037AK-T146-R
R51
R52
R53
R54
R58
1-216-059-00
1-216-065-00
1-216-059-00
1-216-025-00
1-216-063-91
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
2.7K
4.7K
2.7K
100
3.9K
5%
5%
5%
5%
5%
1/10W
1/10W
1/10W
1/10W
1/10W
Q214
Q215
Q216
Q217
Q300
1-801-806-11
8-729-120-28
8-729-120-28
8-729-120-28
1-801-806-11
TRANSISTOR DTC144EKA-T146
TRANSISTOR 2SC1623-L5L6
TRANSISTOR 2SC1623-L5L6
TRANSISTOR 2SC1623-L5L6
TRANSISTOR DTC144EKA-T146
R59
R60
R61
R62
R64
1-216-025-00
1-216-025-00
1-216-025-00
1-216-025-00
1-216-025-00
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
100
100
100
100
100
5%
5%
5%
5%
5%
1/10W
1/10W
1/10W
1/10W
1/10W
Q301
Q302
Q303
Q304
Q305
8-729-120-28
8-729-120-28
8-729-120-28
8-729-120-28
8-729-120-28
TRANSISTOR 2SC1623-L5L6
TRANSISTOR 2SC1623-L5L6
TRANSISTOR 2SC1623-L5L6
TRANSISTOR 2SC1623-L5L6
TRANSISTOR 2SC1623-L5L6
R65
R66
R67
R68
R70
1-216-025-00
1-216-057-00
1-216-057-00
1-216-025-00
1-216-025-00
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
100
2.2K
2.2K
100
100
5%
5%
5%
5%
5%
1/10W
1/10W
1/10W
1/10W
1/10W
Q306
Q307
Q308
Q309
Q330
1-801-806-11
1-801-806-11
1-801-806-11
1-801-806-11
8-729-026-49
TRANSISTOR DTC144EKA-T146
TRANSISTOR DTC144EKA-T146
TRANSISTOR DTC144EKA-T146
TRANSISTOR DTC144EKA-T146
TRANSISTOR 2SA1037AK-T146-R
R71
R72
R73
R74
R76
1-216-025-00
1-216-025-00
1-216-025-00
1-216-025-00
1-216-025-00
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
100
100
100
100
100
5%
5%
5%
5%
5%
1/10W
1/10W
1/10W
1/10W
1/10W
Q331
Q1001
Q1002
8-729-120-28 TRANSISTOR 2SC1623-L5L6
1-801-806-11 TRANSISTOR DTC144EKA-T146
8-729-026-49 TRANSISTOR 2SA1037AK-T146-R
R77
R78
R79
R88
R91
1-216-025-00
1-216-025-00
1-216-033-00
1-216-025-00
1-216-025-00
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
100
100
220
100
100
5%
5%
5%
5%
5%
1/10W
1/10W
1/10W
1/10W
1/10W
R92
R93
R94
R95
R97
1-216-025-00
1-216-033-00
1-216-033-00
1-216-033-00
1-216-025-00
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
100
220
220
220
100
5%
5%
5%
5%
5%
1/10W
1/10W
1/10W
1/10W
1/10W
R101
R102
R103
R104
R105
1-216-061-91
1-216-025-00
1-216-025-00
1-216-073-00
1-216-113-00
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
3.3K
100
100
10K
470K
5%
5%
5%
5%
5%
1/10W
1/10W
1/10W
1/10W
1/10W
R106
R107
R110
R111
R112
1-216-073-00
1-216-295-00
1-216-073-00
1-216-029-00
1-216-029-00
RES,CHIP
SHORT
RES,CHIP
RES,CHIP
RES,CHIP
10K
0
10K
150
150
5%
1/10W
5%
5%
5%
1/10W
1/10W
1/10W
R113
R114
R115
R116
1-216-001-00
1-216-029-00
1-216-037-00
1-216-065-00
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
10
150
330
4.7K
5%
5%
5%
5%
1/10W
1/10W
1/10W
1/10W
<RESISTOR>
R1
R2
R3
R4
R5
1-216-049-00
1-216-025-00
1-216-025-00
1-216-013-00
1-216-073-00
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
1K
100
100
33
10K
5%
5%
5%
5%
5%
1/10W
1/10W
1/10W
1/10W
1/10W
R6
R7
R9
R18
R19
1-208-798-11
1-216-041-00
1-216-041-00
1-216-025-00
1-216-025-00
METAL CHIP
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
4.7K
470
470
100
100
0.5%
5%
5%
5%
5%
1/10W
1/10W
1/10W
1/10W
1/10W
R20
R21
R24
R25
R28
1-216-025-00
1-216-025-00
1-216-065-00
1-216-065-00
1-216-073-00
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
100
100
4.7K
4.7K
10K
5%
5%
5%
5%
5%
1/10W
1/10W
1/10W
1/10W
1/10W
R29
R30
R31
1-216-065-00 RES,CHIP
1-216-065-00 RES,CHIP
1-216-065-00 RES,CHIP
4.7K
4.7K
4.7K
5%
5%
5%
1/10W
1/10W
1/10W
– 112 –
KP-41PX1/41PX1K/41PX1R
The components identified by shading
and mark ¡ are critical for safety.
Replace only with part number specified.
REF.NO. PART NO.
K
RM-892
RM-892
RM-862
AE
DESCRIPTION
REMARK
R117
1-216-057-00 RES,CHIP
2.2K
5%
1/10W
R118
R119
R120
R121
R122
1-216-071-00
1-216-033-00
1-216-069-00
1-216-073-00
1-216-041-00
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
8.2K
220
6.8K
10K
470
5%
5%
5%
5%
5%
1/10W
1/10W
1/10W
1/10W
1/10W
R123
R124
R125
R126
R127
1-216-031-00
1-216-049-00
1-216-081-00
1-216-025-00
1-216-081-00
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
180
1K
22K
100
22K
5%
5%
5%
5%
5%
1/10W
1/10W
1/10W
1/10W
1/10W
R128
R129
R130
R131
R132
1-216-035-00
1-216-037-00
1-216-061-91
1-216-073-00
1-216-025-00
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
270
330
3.3K
10K
100
5%
5%
5%
5%
5%
1/10W
1/10W
1/10W
1/10W
1/10W
R133
R134
R135
R136
R137
1-216-041-00
1-216-001-00
1-216-045-00
1-216-033-00
1-216-049-00
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
470
10
680
220
1K
5%
5%
5%
5%
5%
1/10W
1/10W
1/10W
1/10W
1/10W
R138
R142
R143
R145
R146
1-216-041-00
1-216-295-00
1-216-295-00
1-216-025-00
1-216-025-00
RES,CHIP
SHORT
SHORT
RES,CHIP
RES,CHIP
470
0
0
100
100
5%
1/10W
5%
5%
1/10W
1/10W
R147
R148
R149
R150
R151
1-216-025-00
1-216-025-00
1-216-025-00
1-216-025-00
1-216-025-00
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
100
100
100
100
100
5%
5%
5%
5%
5%
1/10W
1/10W
1/10W
1/10W
1/10W
R153
R154
R156
R157
R158
1-216-025-00
1-216-295-00
1-216-089-00
1-216-089-00
1-216-073-00
RES,CHIP
SHORT
RES,CHIP
RES,CHIP
RES,CHIP
100
0
47K
47K
10K
5%
1/10W
5%
5%
5%
1/10W
1/10W
1/10W
R159
R160
R161
R162
R163
1-216-049-00
1-216-061-91
1-216-033-00
1-216-109-00
1-216-033-00
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
1K
3.3K
220
330K
220
5%
5%
5%
5%
5%
1/10W
1/10W
1/10W
1/10W
1/10W
R164
R165
R166
R167
R168
1-216-089-91
1-216-089-91
1-216-033-00
1-216-043-91
1-216-067-00
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
47K
47K
220
560
5.6K
5%
5%
5%
5%
5%
1/10W
1/10W
1/10W
1/10W
1/10W
R169
R170
R171
R172
R173
1-216-049-00
1-216-025-00
1-216-097-00
1-216-065-00
1-216-025-00
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
1K
100
100K
4.7K
100
5%
5%
5%
5%
5%
1/10W
1/10W
1/10W
1/10W
1/10W
R174
R175
R176
R177
R178
1-208-797-11
1-208-784-11
1-216-295-00
1-216-049-00
1-216-295-00
METAL CHIP
METAL CHIP
SHORT
RES,CHIP
SHORT
4.3K
1.2K
0
1K
0
0.5%
0.5%
1/10W
1/10W
5%
1/10W
REF.NO. PART NO.
DESCRIPTION
REMARK
R179
R180
R181
R182
R183
1-208-788-11
1-208-790-11
1-208-798-11
1-216-635-11
1-216-635-11
METAL CHIP
METAL CHIP
METAL CHIP
METAL CHIP
METAL CHIP
1.8K
2.2K
4.7K
220
220
0.5%
0.5%
0.5%
0.5%
0.5%
1/10W
1/10W
1/10W
1/10W
1/10W
R184
R185
R186
R187
R188
1-216-057-00
1-216-043-91
1-216-067-00
1-216-049-00
1-216-057-00
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
2.2K
560
5.6K
1K
2.2K
5%
5%
5%
5%
5%
1/10W
1/10W
1/10W
1/10W
1/10W
R189
R190
R191
R192
R193
1-216-043-91
1-216-067-00
1-216-057-00
1-216-049-00
1-216-049-00
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
560
5.6K
2.2K
1K
1K
5%
5%
5%
5%
5%
1/10W
1/10W
1/10W
1/10W
1/10W
R194
R195
R196
R197
R198
1-216-049-00
1-216-049-00
1-216-049-00
1-216-049-00
1-216-033-00
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
1K
1K
1K
1K
220
5%
5%
5%
5%
5%
1/10W
1/10W
1/10W
1/10W
1/10W
R199
R200
R201
R202
R203
1-216-033-00
1-216-049-00
1-216-033-00
1-216-033-00
1-216-025-00
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
220
1K
220
220
100
5%
5%
5%
5%
5%
1/10W
1/10W
1/10W
1/10W
1/10W
R204
R205
R206
R207
R208
1-216-025-00
1-216-689-11
1-216-033-00
1-216-089-00
1-216-041-00
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
100
39K
220
47K
470
5%
5%
5%
5%
5%
1/10W
1/10W
1/10W
1/10W
1/10W
R209
R210
R211
R212
R213
1-216-049-00
1-216-017-00
1-216-033-00
1-216-022-00
1-216-022-00
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
1K
47
220
75
75
5%
5%
5%
5%
5%
1/10W
1/10W
1/10W
1/10W
1/10W
R214
R216
R217
R218
R219
1-216-025-00
1-216-025-00
1-216-113-00
1-216-025-00
1-216-113-00
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
100
100
470K
100
470K
5%
5%
5%
5%
5%
1/10W
1/10W
1/10W
1/10W
1/10W
R220
R221
R222
R223
R224
1-216-295-00
1-216-039-00
1-216-089-00
1-216-295-00
1-216-039-00
SHORT
RES,CHIP
RES,CHIP
SHORT
RES,CHIP
0
390
47K
0
390
5%
5%
1/10W
1/10W
5%
1/10W
R225
R226
R227
R228
R229
1-216-089-00
1-216-033-00
1-216-022-00
1-216-022-00
1-216-033-00
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
47K
220
75
75
220
5%
5%
5%
5%
5%
1/10W
1/10W
1/10W
1/10W
1/10W
R230
R232
R233
R234
R235
1-216-022-00
1-216-025-00
1-216-025-00
1-216-113-00
1-216-025-00
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
75
100
100
470K
100
5%
5%
5%
5%
5%
1/10W
1/10W
1/10W
1/10W
1/10W
– 113 –
KP-41PX1/41PX1K/41PX1R
The components identified by shading
and mark ¡ are critical for safety.
Replace only with part number specified.
REF.NO. PART NO.
K
REMARK
1-216-113-00
1-216-295-00
1-216-089-00
1-216-039-00
1-216-295-00
RES,CHIP
SHORT
RES,CHIP
RES,CHIP
SHORT
470K
0
47K
390
0
R241
R242
R243
R244
R248
1-216-089-00
1-216-039-00
1-216-033-00
1-216-033-00
1-216-025-00
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
R249
R250
R251
R252
R253
1-216-001-00
1-216-033-00
1-216-025-00
1-216-025-00
1-216-025-00
R254
R255
R256
R257
R258
RM-892
RM-862
AE
DESCRIPTION
R236
R237
R238
R239
R240
RM-892
5%
1/10W
5%
5%
1/10W
1/10W
47K
390
220
220
100
5%
5%
5%
5%
5%
1/10W
1/10W
1/10W
1/10W
1/10W
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
10
220
100
100
100
5%
5%
5%
5%
5%
1/10W
1/10W
1/10W
1/10W
1/10W
1-216-025-00
1-216-025-00
1-216-025-00
1-216-073-00
1-216-017-00
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
100
100
100
10K
47
5%
5%
5%
5%
5%
1/10W
1/10W
1/10W
1/10W
1/10W
R259
R264
R265
R266
R267
1-216-041-00
1-216-089-91
1-216-065-00
1-216-081-00
1-216-065-00
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
470
47K
4.7K
22K
4.7K
5%
5%
5%
5%
5%
1/10W
1/10W
1/10W
1/10W
1/10W
R268
R269
R270
R271
R272
1-216-089-91
1-216-089-91
1-216-022-00
1-216-022-00
1-216-022-00
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
47K
47K
75
75
75
5%
5%
5%
5%
5%
1/10W
1/10W
1/10W
1/10W
1/10W
R273
R274
R280
R281
R282
1-216-022-00
1-216-089-91
1-216-049-00
1-216-089-00
1-216-093-91
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
75
47K
1K
47K
68K
5%
5%
5%
5%
5%
1/10W
1/10W
1/10W
1/10W
1/10W
R283
R284
R285
R286
R291
1-216-065-00
1-216-089-00
1-216-093-91
1-216-065-00
1-216-057-00
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
4.7K
47K
68K
4.7K
2.2K
5%
5%
5%
5%
5%
1/10W
1/10W
1/10W
1/10W
1/10W
R292
R293
R294
R295
R296
1-216-057-00
1-216-089-00
1-216-097-00
1-216-049-00
1-216-049-00
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
2.2K
47K
100K
1K
1K
5%
5%
5%
5%
5%
1/10W
1/10W
1/10W
1/10W
1/10W
R297
R298
R299
R300
R301
1-216-033-00
1-216-033-00
1-216-073-00
1-216-025-00
1-216-033-00
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
220
220
10K
100
220
5%
5%
5%
5%
5%
1/10W
1/10W
1/10W
1/10W
1/10W
R302
R303
R304
R305
R308
1-216-295-00
1-216-295-00
1-216-129-00
1-216-033-00
1-216-025-00
SHORT
SHORT
RES,CHIP
RES,CHIP
RES,CHIP
0
0
2.2M
220
100
5%
5%
5%
1/10W
1/10W
1/10W
R309
1-216-033-00 RES,CHIP
220
5%
1/10W
REF.NO. PART NO.
DESCRIPTION
REMARK
R310
R315
R316
R320
1-216-033-00
1-216-295-00
1-216-033-00
1-216-025-00
RES,CHIP
SHORT
RES,CHIP
RES,CHIP
220
0
220
100
5%
1/10W
5%
5%
1/10W
1/10W
R321
R322
R323
R325
R326
1-216-025-00
1-216-025-00
1-216-033-00
1-216-089-91
1-216-025-00
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
100
100
220
47K
100
5%
5%
5%
5%
5%
1/10W
1/10W
1/10W
1/10W
1/10W
R327
R329
R330
R331
R332
1-216-025-00
1-216-089-00
1-216-025-00
1-216-059-00
1-216-049-00
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
100
47K
100
2.7K
1K
5%
5%
5%
5%
5%
1/10W
1/10W
1/10W
1/10W
1/10W
R333
R334
R335
R336
R337
1-216-067-00
1-216-041-00
1-208-806-11
1-216-109-00
1-216-025-00
RES,CHIP
RES,CHIP
METAL CHIP
RES,CHIP
RES,CHIP
5.6K
470
10K
330K
100
5%
5%
0.5%
5%
5%
1/10W
1/10W
1/10W
1/10W
1/10W
R338
R339
R340
R341
R342
1-216-049-00
1-216-049-00
1-216-025-00
1-216-025-00
1-216-049-00
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
1K
1K
100
100
1K
5%
5%
5%
5%
5%
1/10W
1/10W
1/10W
1/10W
1/10W
R343
R344
R345
R347
R348
1-216-061-91
1-216-067-00
1-216-025-00
1-216-025-00
1-216-025-00
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
3.3K
5.6K
100
100
100
5%
5%
5%
5%
5%
1/10W
1/10W
1/10W
1/10W
1/10W
R349
R350
R351
R352
R353
1-216-025-00
1-216-041-00
1-216-053-00
1-216-077-91
1-216-033-00
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
100
470
1.5K
15K
220
5%
5%
5%
5%
5%
1/10W
1/10W
1/10W
1/10W
1/10W
R354
R355
R356
R357
R358
1-216-295-00
1-216-093-91
1-216-133-91
1-216-049-00
1-216-105-00
SHORT
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
0
68K
3.3M
1K
220K
5%
5%
5%
5%
1/10W
1/10W
1/10W
1/10W
R359
R360
R361
R370
R371
1-216-295-00
1-216-129-00
1-216-129-00
1-216-295-00
1-216-033-00
SHORT
RES,CHIP
RES,CHIP
SHORT
RES,CHIP
0
2.2M
2.2M
0
220
5%
5%
1/10W
1/10W
5%
1/10W
R373
R374
R375
R376
R377
1-216-049-00
1-216-041-00
1-216-049-00
1-216-081-00
1-216-049-00
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
1K
470
1K
22K
1K
5%
5%
5%
5%
5%
1/10W
1/10W
1/10W
1/10W
1/10W
R378
R379
R1001
R1002
R1010
1-208-811-11
1-216-041-00
1-216-025-00
1-216-025-00
1-216-295-00
METAL CHIP
RES,CHIP
RES,CHIP
RES,CHIP
SHORT
16K
470
100
100
0
0.5%
5%
5%
5%
1/10W
1/10W
1/10W
1/10W
R1012
R1014
1-216-041-00 RES,CHIP
1-216-065-00 RES,CHIP
470
4.7K
5%
5%
1/10W
1/10W
– 114 –
KP-41PX1/41PX1K/41PX1R
The components identified by shading
and mark ¡ are critical for safety.
Replace only with part number specified.
REF.NO. PART NO.
K
RM-892
RM-892
AE G
DESCRIPTION
REMARK
R1017
R1020
R1021
1-216-295-00 SHORT
1-216-097-00 RES,CHIP
1-216-029-00 RES,CHIP
0
100K
150
5%
5%
1/10W
1/10W
R1022
R1023
R1024
R1026
R1027
1-216-029-00
1-216-029-00
1-216-045-00
1-216-025-00
1-216-025-00
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
150
150
680
100
100
5%
5%
5%
5%
5%
1/10W
1/10W
1/10W
1/10W
1/10W
R1028
1-216-025-00 RES,CHIP
100
5%
1/10W
<TUNER>
TU101 0 1-693-340-14 TUNER/VIF
<CRYSTAL>
X1
X201
X301
X302
X303
1-767-154-21
1-760-628-11
1-567-504-11
1-567-505-11
1-767-127-11
VIBRATOR, CERAMIC (11.5MHz)
VIBRATOR, CRYSTAL (18.432MHz)
OSCILLATOR, CRYSTAL (4.43MHz)
OSCILLATOR, CRYSTAL (3.58MHz)
VIBRATOR, CERAMIC (500kHz)
X1001
1-579-965-21 VIBRATOR, CRYSTAL (20.48MHz)
*******************************************************************************
* A-1637-023-AG BOARD, COMPLETE
****************************
REF.NO. PART NO.
DESCRIPTION
REMARK
C6029
C6030
1-164-625-11 CERAMIC
1-104-665-11 ELECT
680pF
100µF
10%
20%
500V
25V
C6031
C6033
C6034
C6035
C6036
1-115-405-11
1-101-810-00
1-101-810-00
1-102-114-00
1-102-114-00
FILM
CERAMIC
CERAMIC
CERAMIC
CERAMIC
0.039µF
100pF
100pF
470pF
470pF
3%
5%
5%
10%
10%
1KV
500V
500V
50V
50V
C6037
C6038
C6039
C6040
C6041
1-126-960-11
1-126-768-11
1-102-114-00
1-102-114-00
1-126-972-11
ELECT
ELECT
CERAMIC
CERAMIC
ELECT
1µF
2200µF
470pF
470pF
1000µF
20%
20%
10%
10%
20%
50V
16V
50V
50V
50V
C6042
C6043
C6044
C6045
C6046
1-126-972-11
1-104-665-11
1-107-641-11
1-109-954-11
1-102-114-00
ELECT
ELECT
ELECT
ELECT
CERAMIC
1000µF
100µF
220µF
0.47µF
470pF
20%
20%
20%
20%
10%
50V
25V
160V
160V
50V
C6047
C6048
C6049
C6050
C6051
1-102-114-00
1-126-943-11
1-128-548-11
1-126-935-11
1-126-943-11
CERAMIC
ELECT
ELECT
ELECT
ELECT
470pF
2200µF
4700µF
470µF
2200µF
10%
20%
20%
20%
20%
50V
25V
25V
6.3V
25V
C6052
C6053
C6054
C6055
C6056
1-104-665-11
1-104-665-11
1-104-665-11
1-107-641-11
1-115-339-11
ELECT
ELECT
ELECT
ELECT
CERAMIC CHIP
100µF
100µF
100µF
220µF
0.1µF
20%
20%
20%
20%
10%
25V
25V
25V
160V
50V
<CONNECTOR>
* 4-374-846-01 COVER, CAPACITOR, CAP TYPE
4-382-854-11 SCREW (M3X10), P, SW (+)
<CAPACITOR>
C6001
C6002
C6003
C6004
C6005
0 1-104-706-51
1-117-703-11
0 1-161-830-91
0 1-104-706-11
0 1-161-830-00
MYLAR
CERAMIC
CERAMIC
MYLAR
CERAMIC
0.22µF
20%
0.0047µF 99%
0.0047µF
0.22µF
20%
0.0047µF
250V
250V
500V
250V
500V
C6006
C6007
C6008
C6009
C6010
0 1-119-893-51
1-107-678-11
0 1-161-830-91
0 1-161-830-91
0 1-119-893-51
CERAMIC
ELECT
CERAMIC
CERAMIC
CERAMIC
1000pF 20%
4.7µF
20%
0.0047µF
0.0047µF
1000pF 20%
250V
450V
500V
500V
250V
C6014
C6015
C6016
C6017
C6018
1-117-753-11
1-104-664-11
1-163-009-91
1-163-009-91
1-136-479-11
ELECT(BLOCK)
ELECT
CERAMIC CHIP
CERAMIC CHIP
FILM
470µF
47µF
0.001µF
0.001µF
0.001µF
20%
20%
10%
10%
2%
450V
25V
50V
50V
50V
C6019
C6020
C6021
C6023
C6024
1-164-004-11
1-126-963-11
1-126-964-11
1-104-665-11
1-126-967-11
CERAMIC CHIP
ELECT
ELECT
ELECT
ELECT
0.1µF
4.7µF
10µF
100µF
47µF
10%
20%
20%
20%
20%
25V
50V
50V
25V
50V
C6025
C6026
C6027
1-136-165-00 FILM
1-126-964-11 ELECT
1-164-625-11 CERAMIC
0.1µF
10µF
680pF
5%
20%
10%
50V
50V
500V
CN6001 1-695-915-11 TAB (CONTACT)
CN6002 1-695-915-11 TAB (CONTACT)
CN6003 1-695-915-11 TAB (CONTACT)
CN6005 1-580-843-11 PIN, CONNECTOR (POWER)
CN6006 * 1-580-689-11 PIN, CONNECTOR (PC BOARD) 4P
CN6007*
CN6008*
CN6009*
CN6010*
CN6011*
1-691-291-11 PIN, CONNECTOR (PC BOARD) 5P
1-564-509-11 PLUG, CONNECTOR 6P
1-573-986-11 PIN, CONNECTOR (PC BOARD) 5P
1-508-766-00 PIN, CONNECTOR (5MM PITCH) 4P
1-508-765-00 PIN, CONNECTOR (5MM PITCH) 3P
<DIODE>
D6001 0 8-719-068-00 DIODE ERC04-06SE
D6002 0 8-719-068-00 DIODE ERC04-06SE
D6003 0 8-719-068-00 DIODE ERC04-06SE
D6004
8-719-988-61 DIODE 1SS355TE-17
D6005
8-719-073-23 DIODE ST02D-200TA
D6007 0 8-719-510-63 DIODE D4SB60L-F
D6008
8-719-110-14 DIODE RD9.1ES-B3
D6009
8-719-991-33 DIODE 1SS133T-77
D6010
8-719-063-74 DIODE D1NL20U-TR2
D6011
8-719-979-64 DIODE UF4005PKG23
D6012
D6013
D6014
D6015
– 115 –
8-719-063-74
8-719-018-83
8-719-018-83
8-719-991-33
DIODE D1NL20U-TR2
DIODE D2S4M
DIODE D2S4M
DIODE 1SS133T-77
RM-862
KP-41PX1/41PX1K/41PX1R
The components identified by shading
and mark ¡ are critical for safety.
Replace only with part number specified.
REF.NO. PART NO.
DESCRIPTION
K
8-719-052-91 DIODE D4SBS4-F
D6017
D6018
D6019
D6020
D6021
8-719-312-47
8-719-031-78
8-719-031-78
8-719-991-33
8-719-057-96
D6022
8-719-921-88 DIODE MTZJ-13B
DIODE RBA-406B
DIODE S2L40F
DIODE S2L40F
DIODE 1SS133T-77
DIODE D10SC6M-4012
REF.NO. PART NO.
<FERRITE BEAD>
FB600101-410-397-31 FERRITE
FB6002 1-410-397-21 FERRITE
FB600301-410-397-31 FERRITE
1.1µH
1.1µH
1.1µH
<FUSE>
FH6001 * 1-533-725-11 HOLDER, FUSE
<IC>
IC TOP209P
IC MCZ3001D
PHOTO COUPLER ON3171-R
PHOTO COUPLER ON3171-R
IC SE135N
<CHIP CONDUCTOR>
1-216-864-11 SHORT
1-216-864-11 SHORT
0
0
<COIL>
L6003
L6004
L6005
L6006
L6007
1-412-525-31
1-412-525-31
1-412-525-31
1-412-523-41
1-412-523-41
INDUCTOR
INDUCTOR
INDUCTOR
INDUCTOR
INDUCTOR
10µH
10µH
10µH
6.8µH
6.8µH
L6008
L6009
L6010
L6011
1-412-525-31
1-412-525-31
1-412-525-31
1-412-533-21
INDUCTOR
INDUCTOR
INDUCTOR
INDUCTOR
10µH
10µH
10µH
47µH
<IC LINK>
PS600101-533-595-31 LINK, IC (3.15A/90V AC, 60V DC)
PS600201-533-595-31 LINK, IC (3.15A/90V AC, 60V DC)
PS600301-533-597-31 LINK, IC (5A/90V AC, 60V DC)
<TRANSISTOR>
Q6001
RM-862
REMARK
8-729-056-60
8-729-140-97
8-729-922-37
8-729-120-28
TRANSISTOR SPA07N60C2
TRANSISTOR 2SB734-34
TRANSISTOR 2SD2144S-UVW
TRANSISTOR 2SC1623-L5L6
Q6006
Q6007
Q6008
Q6009
8-729-026-49
8-729-820-82
8-729-120-28
8-729-120-28
TRANSISTOR 2SA1037AK-T146-R
TRANSISTOR 2SA1208
TRANSISTOR 2SC1623-L5L6
TRANSISTOR 2SC1623-L5L6
<RESISTOR>
F6001 0 1-576-232-21 FUSE (H.B.C.) (5A/250V)
JR6001
JR6002
DESCRIPTION
Q6002
Q6003
Q6004
Q6005
<FUSE>
IC6001 0 8-759-468-89
IC6002 8-759-670-30
IC6003 0 8-749-924-35
IC6004 0 8-749-924-35
IC6005 8-749-920-61
RM-892
G
REMARK
D6016
RM-892
R6001 0 1-202-885-91 SOLID
R6002 0 1-212-849-61 FUSIBLE
R6003
1-215-858-00 METAL OXIDE
R6005
1-216-089-91 RES-CHIP
R6006 0 1-219-720-91 METAL
1M
4.7
15
47K
10M
20%
5%
5%
5%
5%
1/2W
1/4W
1W
1/10W
1W
R6007
1-216-089-91 RES-CHIP
R6009
1-247-791-91 CARBON
R6010 0 1-220-778-11 FUSIBLE
R6011
1-215-444-00 METAL
R6012
1-208-758-11 METAL CHIP
47K
22
0.1
9.1K
100
5%
5%
10%
1%
0.5%
1/10W
1/4W
1/2W
1/4W
1/10W
R6013
R6014
R6015
R6016
R6017
1-208-808-11
1-249-413-11
1-249-377-11
1-215-395-00
1-215-481-00
METAL CHIP
CARBON
CARBON
METAL
METAL
12K
470
0.47
82
330K
0.5%
5%
5%
1%
1%
1/10W
1/4W
1/4W
1/4W
1/4W
R6018
R6019
R6020
R6021
R6022
1-215-481-00
1-216-001-00
1-216-001-00
1-215-481-00
1-249-417-11
METAL
RES-CHIP
RES-CHIP
METAL
CARBON
330K
10
10
330K
1K
1%
5%
5%
1%
5%
1/4W
1/10W
1/10W
1/4W
1/4W
R6023
R6024
R6025
R6026
R6027
1-216-073-91
1-216-073-91
1-217-625-00
1-216-065-91
1-216-073-91
RES-CHIP
RES-CHIP
METAL
RES-CHIP
RES-CHIP
10K
10K
0.05
4.7K
10K
5%
5%
10%
5%
5%
1/10W
1/10W
2W
1/10W
1/10W
R6028
R6029
R6030
R6031
R6032
1-249-417-11
1-249-377-11
1-249-377-11
1-249-377-11
1-249-377-11
CARBON
CARBON
CARBON
CARBON
CARBON
1K
0.47
0.47
0.47
0.47
5%
5%
5%
5%
5%
1/4W
1/4W
1/4W
1/4W
1/4W
R6033
R6034
R6035
R6036
R6037
1-216-065-91
1-249-377-11
1-249-377-11
1-249-417-11
1-216-065-91
RES-CHIP
CARBON
CARBON
CARBON
RES-CHIP
4.7K
0.47
0.47
1K
4.7K
5%
5%
5%
5%
5%
1/10W
1/4W
1/4W
1/4W
1/10W
R6038
R6039
R6040
R6041
R6042
1-216-073-91
1-216-073-91
1-216-041-00
1-216-073-91
1-216-049-11
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
10K
10K
470
10K
1K
5%
5%
5%
5%
5%
1/10W
1/10W
1/10W
1/10W
1/10W
R6046
R6047
R6048
R6049
R6050
1-216-065-91
1-249-413-11
1-215-477-00
1-249-417-11
1-249-441-11
RES-CHIP
CARBON
METAL
CARBON
CARBON
4.7K
470
220K
1K
100K
5%
5%
1%
5%
5%
1/10W
1/4W
1/4W
1/4W
1/4W
8-729-056-60 TRANSISTOR SPA07N60C2
– 116 –
KP-41PX1/41PX1K/41PX1R
The components identified by shading
and mark ¡ are critical for safety.
Replace only with part number specified.
REF.NO. PART NO.
K
1-216-366-00
1-215-477-00
1-249-417-11
1-215-453-00
1-215-476-00
METAL OXIDE
METAL
CARBON
METAL
METAL
R6056
1-216-353-00 METAL OXIDE
RM-892
G CB CG
DESCRIPTION
R6051
R6052
R6053
R6054
R6055
RM-892
REMARK
0.56
220K
1K
22K
200K
5%
1%
5%
1%
1%
2W
1/4W
1/4W
1/4W
1/4W
2.2
5%
1W
REF.NO. PART NO.
D762
D763
D765
D766
REMARK
DIODE 1SS133T-77
DIODE 1SS133T-77
DIODE 1SS133T-77
DIODE 1SS133T-77
<COIL>
L761
L762
<RELAY>
8-719-991-33
8-719-991-33
8-719-991-33
8-719-991-33
DESCRIPTION
1-408-623-31 INDUCTOR
1-408-617-31 INDUCTOR
470µH
150µH
RY600101-755-352-11 RELAY, AC POWER
<TRANSISTOR>
<TRANSFORMER>
T6001
T6002
T6003
T6004
0 1-433-488-11
0 1-431-732-21
0 1-429-807-12
0 1-424-861-11
Q761
Q762
Q763
Q764
Q765
TRANSFORMER, LINE FILTER
TRANSFORMER, CONVERTER (SRT)
TRANSFORMER, CONVERTER (PIT)
COIL, CHOKE
42µH
8-729-200-17
8-729-045-56
8-729-423-33
8-729-119-76
8-729-119-76
TRANSISTOR 2SA1091-O
TRANSISTOR 2SC2611-15
TRANSISTOR 2SC3311A-QRSTA
TRANSISTOR 2SA1175-HFE
TRANSISTOR 2SA1175-HFE
<RESISTOR>
<THERMISTOR>
TH6001 1-803-586-41 THERMISTOR
<VARISTOR>
VD600101-803-830-31 VARISTOR (ERZV14D621)
*******************************************************************************
* A-1638-150-ACB BOARD, COMPLETE
*****************************
4-051-602-11 SHEET, RADIATION
4-382-854-11 SCREW (M3X10), P, SW (+)
<CAPACITOR>
C762
C763
C764
C765
C766
1-126-964-11
1-161-754-00
1-102-117-00
1-161-830-00
1-162-115-00
ELECT
CERAMIC
CERAMIC
CERAMIC
CERAMIC
10µF
0.001µF
820pF
0.0047µF
330pF
20%
10%
10%
10%
50V
2KV
50V
500V
2KV
C767
C768
C769
C772
1-107-662-11
1-101-880-00
1-104-664-11
1-104-660-91
ELECT
CERAMIC
ELECT
ELECT
22µF
47pF
47µF
47µF
20%
5%
20%
20%
250V
50V
25V
16V
R761
R762
R763
R764
R765
1-219-743-11
1-260-132-11
1-216-487-11
1-216-487-11
1-247-807-31
CARBON
CARBON
METAL OXIDE
METAL OXIDE
CARBON
100
560K
12K
12K
100
5%
5%
5%
5%
5%
1/2W
1/2W
3W
3W
1/4W
R766
R767
R768
R769
R770
1-260-328-11
1-249-425-11
1-260-133-11
1-202-818-00
1-249-406-11
CARBON
CARBON
CARBON
SOLID
CARBON
1K
4.7K
680K
1K
120
5%
5%
5%
20%
5%
1/2W
1/4W
1/2W
1/2W
1/4W
R771
R772
R773
R776
R777
1-219-743-11
1-247-791-91
1-247-807-31
1-249-437-11
1-215-436-00
CARBON
CARBON
CARBON
CARBON
METAL
100
22
100
47K
4.3K
5%
5%
5%
5%
1%
1/2W
1/4W
1/4W
1/4W
1/4W
R778
R779
R781
R782
1-202-814-11
1-249-409-11
1-249-438-11
1-249-433-11
SOLID
CARBON
CARBON
CARBON
33K
220
56K
22K
20%
5%
5%
5%
1/2W
1/4W
1/4W
1/4W
<SPARK GAP>
SG761 1-519-422-11 GAP, SPARK
SG762 1-519-422-11 GAP, SPARK
SG763 1-519-422-11 GAP, SPARK
****************************************************************************
<CONNECTOR>
CN761 1-695-915-11
CN762 * 1-564-508-11
CN763 * 1-508-784-00
CN764 0 1-251-182-41
CN765 * 1-564-512-11
* A-1638-151-ACG BOARD, COMPLETE
******************************
TAB (CONTACT)
PLUG, CONNECTOR 5P
PIN, CONNECTOR (5MM PITCH) 1P
SOCKET, PICTURE TUBE
PLUG, CONNECTOR 9P
4-051-602-11 SHEET, RADIATION
4-382-854-11 SCREW (M3X10), P, SW (+)
CN766 * 1-764-333-11 PLUG, CONNECTOR 10P
<DIODE>
D761
8-719-991-33 DIODE 1SS133T-77
<CAPACITOR>
C733
C734
C735
C736
– 117 –
1-161-754-00
1-102-114-00
1-161-830-00
1-162-115-00
CERAMIC
CERAMIC
CERAMIC
CERAMIC
0.001µF 10%
470pF
10%
0.0047µF
330pF
10%
2KV
50V
500V
2KV
RM-862
KP-41PX1/41PX1K/41PX1R
The components identified by shading
and mark ¡ are critical for safety.
Replace only with part number specified.
REF.NO. PART NO.
K
RM-892
RM-892
CG CR
DESCRIPTION
REMARK
C737
1-107-662-11 ELECT
22µF
20%
250V
C738
C739
1-101-880-00 CERAMIC
1-104-664-11 ELECT
47pF
47µF
5%
20%
50V
25V
REF.NO. PART NO.
DESCRIPTION
REMARK
* A-1638-152-ACR BOARD, COMPLETE
******************************
4-051-602-11 SHEET, RADIATION
4-382-854-11 SCREW (M3X10), P, SW (+)
<CONNECTOR>
<CAPACITOR>
CN731 1-695-915-11
CN732 * 1-564-508-11
CN733 * 1-564-511-11
CN734 * 1-508-784-00
CN735 0 1-251-182-41
TAB (CONTACT)
PLUG, CONNECTOR 5P
PLUG, CONNECTOR 8P
PIN, CONNECTOR (5MM PITCH) 1P
SOCKET, PICTURE TUBE
CN736 * 1-564-512-11 PLUG, CONNECTOR 9P
CN737 * 1-564-512-11 PLUG, CONNECTOR 9P
C702
C703
C705
C708
C709
1-102-112-00
1-104-664-11
1-161-754-00
1-101-880-00
1-162-115-00
CERAMIC
ELECT
CERAMIC
CERAMIC
CERAMIC
C712
C713
1-107-662-11 ELECT
1-104-660-91 ELECT
330pF
47µF
0.001µF
47pF
330pF
10%
20%
10%
5%
10%
50V
25V
2KV
50V
2KV
22µF
47µF
20%
20%
250V
16V
<DIODE>
<CONNECTOR>
D731
D732
D733
D735
D736
8-719-991-33
8-719-991-33
8-719-991-33
8-719-991-33
8-719-991-33
DIODE 1SS133T-77
DIODE 1SS133T-77
DIODE 1SS133T-77
DIODE 1SS133T-77
DIODE 1SS133T-77
CN701 1-695-915-11
CN702 * 1-564-511-11
CN703 * 1-564-510-11
CN704 * 1-508-784-00
CN705 0 1-251-182-41
<COIL>
L731
L732
CN706 * 1-564-512-11 PLUG, CONNECTOR 9P
1-408-623-31 INDUCTOR
1-408-617-31 INDUCTOR
470µH
150µH
<DIODE>
<TRANSISTOR>
Q731
Q732
Q733
Q734
8-729-200-17
8-729-045-56
8-729-423-33
8-729-119-76
TAB (CONTACT)
PLUG, CONNECTOR 8P
PLUG, CONNECTOR 7P
PIN, CONNECTOR (5MM PITCH) 1P
SOCKET, PICTURE TUBE
TRANSISTOR 2SA1091-O
TRANSISTOR 2SC2611-15
TRANSISTOR 2SC3311A-QRSTA
TRANSISTOR 2SA1175-HFE
D701
D704
D705
D706
D708
8-719-991-33
8-719-991-33
8-719-991-33
8-719-991-33
8-719-991-33
D709
8-719-109-84 DIODE RD5.1ESB1
<RESISTOR>
DIODE 1SS133T-77
DIODE 1SS133T-77
DIODE 1SS133T-77
DIODE 1SS133T-77
DIODE 1SS133T-77
<COIL>
R731
R732
R733
R734
R735
1-219-743-11
1-260-132-11
1-216-487-11
1-216-487-11
1-247-807-31
CARBON
CARBON
METAL OXIDE
METAL OXIDE
CARBON
100
560K
12K
12K
100
5%
5%
5%
5%
5%
1/2W
1/2W
3W
3W
1/4W
L701
L702
R736
R737
R738
R739
R740
1-249-425-11
1-260-328-11
1-249-406-11
1-260-133-11
1-202-818-00
CARBON
CARBON
CARBON
CARBON
SOLID
4.7K
1K
120
680K
1K
5%
5%
5%
5%
20%
1/4W
1/2W
1/4W
1/2W
1/2W
Q701
Q703
Q704
Q705
8-729-200-17
8-729-045-56
8-729-423-33
8-729-119-76
Q706
8-729-119-76 TRANSISTOR 2SA1175-HFE
R741
R742
R744
R746
1-247-791-91
1-249-409-11
1-247-891-00
1-202-814-11
CARBON
CARBON
CARBON
SOLID
22
220
330K
33K
5%
5%
5%
20%
1/4W
1/4W
1/4W
1/2W
<SPARK GAP>
SG731 1-519-422-11 GAP, SPARK
SG732 1-519-422-11 GAP, SPARK
SG733 1-519-422-11 GAP, SPARK
*******************************************************************************
1-410-682-31 INDUCTOR
1-408-617-31 INDUCTOR
470µH
150µH
<TRANSISTOR>
TRANSISTOR 2SA1091-O
TRANSISTOR 2SC2611-15
TRANSISTOR 2SC3311A-QRSTA
TRANSISTOR 2SA1175-HFE
<RESISTOR>
R701
R704
R706
R707
R708
1-219-743-11
1-260-132-11
1-249-425-11
1-247-807-31
1-249-408-11
R709
R710
1-260-328-11 CARBON
1-247-791-91 CARBON
– 118 –
CARBON
CARBON
CARBON
CARBON
CARBON
100
560K
4.7K
100
180
5%
5%
5%
5%
5%
1/2W
1/2W
1/4W
1/4W
1/4W
1K
22
5%
5%
1/2W
1/4W
RM-862
KP-41PX1/41PX1K/41PX1R
The components identified by shading
and mark ¡ are critical for safety.
Replace only with part number specified.
REF.NO. PART NO.
K
RM-892
RM-862
CR D
DESCRIPTION
REMARK
R711
R712
R714
1-216-487-11 METAL OXIDE
1-216-487-11 METAL OXIDE
1-202-818-00 SOLID
12K
12K
1K
5%
5%
20%
3W
3W
1/2W
R715
R716
R717
R718
R719
1-260-133-11
1-249-409-11
1-249-435-11
1-249-437-11
1-219-743-11
680K
220
33K
47K
100
5%
5%
5%
5%
5%
1/2W
1/4W
1/4W
1/4W
1/2W
R721
R722
R723
1-202-814-11 SOLID
1-249-433-11 CARBON
1-249-437-11 CARBON
33K
22K
47K
20%
5%
5%
1/2W
1/4W
1/4W
CARBON
CARBON
CARBON
CARBON
CARBON
RM-892
REF.NO. PART NO.
DESCRIPTION
REMARK
C1602
1-163-009-11 CERAMIC CHIP 0.001µF
10%
50V
C1603
C1604
C1605
C1606
C1607
1-130-495-00
1-130-495-00
1-107-715-11
1-164-232-11
1-137-150-11
5%
5%
20%
10%
5%
50V
50V
50V
50V
50V
C1608
C1610
C1611
C1612
1-163-017-00 CERAMIC CHIP 0.0047µF 10% 50V
(41PX1/41PX1K)
1-163-017-00 CERAMIC CHIP 0.0047µF 10% 50V
(41PX1/41PX1K)
1-126-960-11 ELECT
1µF
20% 50V
1-126-960-11 ELECT
1µF
20% 50V
1-126-960-11 ELECT
1µF
20% 50V
C1613
C1614
C1617
C1618
C1619
1-126-967-11
1-126-967-11
1-130-495-00
1-130-495-00
1-164-004-11
ELECT
ELECT
MYLAR
MYLAR
CERAMIC CHIP
47µF
47µF
0.1µF
0.1µF
0.1µF
20%
20%
5%
5%
10%
50V
50V
50V
50V
25V
C1621
C1622
C1624
C1626
C1627
1-104-665-11
1-164-690-91
1-130-495-00
1-130-495-00
1-164-690-91
ELECT
CERAMIC CHIP
MYLAR
MYLAR
CERAMIC CHIP
100µF
0.0022µF
0.1µF
0.1µF
0.0022µF
20%
5%
5%
5%
5%
25V
50V
50V
50V
50V
C1628
C1630
C1631
C1632
C1633
1-126-964-11
1-128-550-21
1-128-550-21
1-104-664-11
1-104-664-11
ELECT
ELECT
ELECT
ELECT
ELECT
10µF
2200µF
2200µF
47µF
47µF
20%
20%
20%
20%
20%
50V
50V
50V
25V
25V
C1634
C1635
C1650
C1651
C1661
1-126-961-11
1-104-666-11
1-163-251-11
1-163-251-11
1-136-165-00
ELECT
ELECT
CERAMIC CHIP
CERAMIC CHIP
FILM
2.2µF
220µF
100pF
100pF
0.1µF
C1701
C1702
C1703
C1704
C1705
1-126-960-11
1-126-960-11
1-126-964-11
1-126-964-11
1-163-251-11
ELECT
ELECT
ELECT
ELECT
CERAMIC CHIP
1µF
1µF
10µF
10µF
100pF
20%
20%
20%
20%
5%
50V
50V
50V
50V
50V
C1706
C1707
C1708
C1709
C1710
1-163-251-11
1-164-232-11
1-126-935-11
1-164-232-11
1-163-243-11
CERAMIC CHIP
CERAMIC CHIP
ELECT
CERAMIC CHIP
CERAMIC CHIP
100pF
0.01µF
470µF
0.01µF
47pF
5%
10%
20%
10%
5%
50V
50V
16V
50V
50V
C1711
C1715
C1716
C1717
C1718
1-163-243-11
1-164-232-11
1-164-232-11
1-164-232-11
1-126-968-11
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
ELECT
47pF
0.01µF
0.01µF
0.01µF
100µF
5%
10%
10%
10%
20%
50V
50V
50V
50V
50V
C1719
C1720
C1721
C1723
C1724
1-126-968-11
1-164-232-11
1-164-232-11
1-163-235-11
1-164-004-11
ELECT
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
100µF
0.01µF
0.01µF
22pF
0.1µF
20%
10%
10%
5%
10%
50V
50V
50V
50V
25V
C1725
C1726
1-164-004-11 CERAMIC CHIP 0.1µF
1-164-004-11 CERAMIC CHIP 0.1µF
10%
10%
25V
25V
C1609
MYLAR
MYLAR
ELECT
CERAMIC CHIP
MYLAR
0.1µF
0.1µF
22µF
0.01µF
0.01µF
<SPARK GAP>
SG701 1-519-422-11 GAP, SPARK
SG702 1-519-422-11 GAP, SPARK
SG703 1-519-422-11 GAP, SPARK
*******************************************************************************
* A-1346-678-AD BOARD, COMPLETE (41PX1R)
* A-1642-284-AD BOARD, COMPLETE (41PX1/41PX1K)
****************************
4-201-023-01 SPACER, INSULATING
4-202-373-01 SPRING, IC
4-382-854-11 SCREW (M3X10), P, SW (+)
<CAPACITOR>
C1501
C1503
C1504
C1506
C1507
1-163-005-91
1-137-399-11
1-164-690-91
1-126-969-11
1-163-243-11
CERAMIC CHIP
MYLAR
CERAMIC CHIP
ELECT
CERAMIC CHIP
470pF
0.1µF
0.0022µF
220µF
47pF
10%
5%
5%
20%
5%
50V
100V
50V
50V
50V
C1508
C1509
C1510
C1511
C1512
1-137-401-11
1-163-251-11
1-126-972-11
1-126-972-11
1-126-960-11
MYLAR
CERAMIC CHIP
ELECT
ELECT
ELECT
0.22µF
100pF
1000µF
1000µF
1µF
10%
5%
20%
20%
20%
100V
50V
50V
50V
50V
C1513
C1514
C1516
C1517
C1518
1-164-232-11
1-164-232-11
1-164-004-11
1-126-964-11
1-126-933-11
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
ELECT
ELECT
0.01µF
0.01µF
0.1µF
10µF
100µF
10%
10%
10%
20%
20%
50V
50V
25V
50V
16V
C1519
C1520
C1521
C1523
C1524
1-126-933-11
1-126-964-11
1-164-232-11
1-163-243-11
1-136-177-00
ELECT
ELECT
CERAMIC CHIP
CERAMIC CHIP
FILM
100µF
10µF
0.01µF
47pF
1µF
20%
20%
10%
5%
5%
16V
50V
50V
50V
50V
C1525
C1526
C1527
C1528
C1529
1-104-665-11
1-104-664-11
1-163-145-00
1-163-145-00
1-164-690-91
ELECT
ELECT
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
100µF
47µF
0.0015µF
0.0015µF
0.0022µF
20%
20%
5%
5%
5%
25V
25V
50V
50V
50V
C1530
C1531
C1532
C1601
1-104-660-91
1-164-232-11
1-126-960-11
1-163-009-11
ELECT
CERAMIC CHIP
ELECT
CERAMIC CHIP
47µF
0.01µF
1µF
0.001µF
20%
10%
20%
10%
16V
50V
50V
50V
– 119 –
20% 50V
20% 25V
5%
50V
5%
50V
5%
50V
(41PX1/41PX1K)
KP-41PX1/41PX1K/41PX1R
The components identified by shading
and mark ¡ are critical for safety.
Replace only with part number specified.
REF.NO. PART NO.
K
REMARK
C1727
C1802
C1803
1-164-004-11 CERAMIC CHIP 0.1µF
1-164-232-11 CERAMIC CHIP 0.01µF
1-126-935-11 ELECT
470µF
10%
10%
20%
25V
50V
16V
C1804
C1805
C1806
C1807
C1808
1-126-964-11
1-164-232-11
1-104-665-11
1-126-964-11
1-164-232-11
ELECT
CERAMIC CHIP
ELECT
ELECT
CERAMIC CHIP
10µF
0.01µF
100µF
10µF
0.01µF
20%
10%
20%
20%
10%
50V
50V
25V
50V
50V
C1809
C1810
C1811
C1812
C1813
1-104-665-11
1-164-232-11
1-104-665-11
1-126-964-11
1-104-666-11
ELECT
CERAMIC CHIP
ELECT
ELECT
ELECT
100µF
0.01µF
100µF
10µF
220µF
20%
10%
20%
20%
20%
25V
50V
25V
50V
25V
C1814
C1815
C1816
1-164-004-11 CERAMIC CHIP 0.1µF
1-104-666-11 ELECT
220µF
1-126-964-11 ELECT
10µF
10%
20%
20%
C1817
1-126-964-11 ELECT
C1818
1-164-232-11 CERAMIC CHIP 0.01µF
25V
25V
50V
(41PX1R)
20% 50V
(41PX1R)
10% 50V
C1819
1-163-133-00 CERAMIC CHIP 470pF
5%
C1820
1-163-133-00
C1821
C1822
1-126-964-11
1-164-005-11
C1822
1-216-295-91
C1823
1-163-251-11 CERAMIC CHIP 100pF
C1824
1-164-005-11
C1824
C1825
1-216-295-91
1-163-251-11
C1826
1-104-665-11
50V
(41PX1R)
CERAMIC CHIP 0.47µF
25V
(41PX1R)
SHORT
0
(41PX1/41PX1K)
CERAMIC CHIP 100pF
5%
50V
(41PX1R)
ELECT
100µF
20% 25V
C1827
C1828
C1829
C1830
C1831
1-104-664-11
1-104-664-11
1-104-664-11
1-126-964-11
1-163-021-91
ELECT
ELECT
ELECT
ELECT
CERAMIC CHIP
50V
(41PX1R)
CERAMIC CHIP 470pF
5%
50V
(41PX1R)
ELECT
10µF
20% 50V
CERAMIC CHIP 0.47µF
25V
(41PX1R)
SHORT
0
(41PX1/41PX1K)
47µF
47µF
47µF
10µF
0.01µF
RM-892
D
DESCRIPTION
10µF
RM-892
REF.NO. PART NO.
DESCRIPTION
CN1804 * 1-564-508-11 PLUG, CONNECTOR 5P
CN1805 * 1-779-890-11
CN1806 * 1-779-890-11
CN1807 * 1-564-511-11
CN1805 * 1-564-510-11
CONNECTOR, BOARD TO BOARD 10P
CONNECTOR, BOARD TO BOARD 10P
PLUG, CONNECTOR 8P (41PX1R)
PLUG, CONNECTOR 7P (41PX1R)
<DIODE>
D1501
D1502
D1503
D1504
D1505
8-719-109-89
8-719-908-03
8-719-908-03
8-719-991-33
8-719-988-61
DIODE RD5.6ESB2
DIODE GP08D
DIODE GP08D
DIODE 1SS133T-77
DIODE 1SS355TE-17
D1601
D1602
D1603
D1604
D1605
8-719-991-33
8-719-914-43
8-719-991-33
8-719-991-33
8-719-914-43
DIODE 1SS133T-77
DIODE DAN202K
DIODE 1SS133T-77
DIODE 1SS133T-77
DIODE DAN202K
D1606
D1607
D1611
D1612
D1613
8-719-991-33
8-719-914-43
8-719-921-86
8-719-991-33
8-719-921-86
DIODE 1SS133T-77
DIODE DAN202K
DIODE MTZJ-13
DIODE 1SS133T-77
DIODE MTZJ-13
D1614
D1615
D1616
D1617
D1618
8-719-991-33
8-719-991-33
8-719-991-33
8-719-403-00
8-719-991-33
DIODE 1SS133T-77
DIODE 1SS133T-77
DIODE 1SS133T-77
DIODE MA3240-TX
DIODE 1SS133T-77
D1619
D1620
D1621
D1622
D1703
8-719-991-33
8-719-403-00
8-719-403-00
8-719-403-00
8-719-109-89
DIODE 1SS133T-77
DIODE MA3240-TX
DIODE MA3240-TX
DIODE MA3240-TX
DIODE RD5.6ESB2
D1704
D1705
D1706
D1707
D1708
8-719-109-89
8-719-109-84
8-719-109-84
8-719-109-84
8-719-109-84
DIODE RD5.6ESB2
DIODE RD5.1ESB1
DIODE RD5.1ESB1
DIODE RD5.1ESB1
DIODE RD5.1ESB1
D1709
D1710
D1711
D1712
D1801
8-719-109-81
8-719-109-81
8-719-109-81
8-719-109-81
8-719-923-60
DIODE RD4.7ESB2
DIODE RD4.7ESB2
DIODE RD4.7ESB2
DIODE RD4.7ESB2
DIODE MTZJ-T-77-9.1A
D1802
D1803
D1804
D1805
8-719-923-60
8-719-108-12
8-719-923-60
8-719-108-12
DIODE MTZJ-T-77-9.1A
DIODE RD9.1EW (41PX1R)
DIODE MTZJ-T-77-9.1A
DIODE RD9.1EW (41PX1R)
D1806
8-719-923-60 DIODE MTZJ-T-77-9.1A
5%
20%
20%
20%
20%
10%
25V
25V
25V
50V
50V
<CONNECTOR>
CN1501 * 1-564-506-11
CN1502 1-695-915-11
CN1601 * 1-564-508-11
CN1604 * 1-564-507-11
CN1605 * 1-508-766-00
PLUG, CONNECTOR 3P
TAB (CONTACT)
PLUG, CONNECTOR 5P
PLUG, CONNECTOR 4P
PIN, CONNECTOR (5MM PITCH) 4P
CN1606 * 1-779-890-11
CN1701 * 1-564-511-11
CN1702 * 1-564-516-11
CN1703 * 1-779-890-11
CN1705 * 1-564-505-31
CONNECTOR, BOARD TO BOARD 10P
PLUG, CONNECTOR 8P
PLUG, CONNECTOR 13P
CONNECTOR, BOARD TO BOARD 10P
PLUG, CONNECTOR 2P
CN1708 * 1-564-510-11
CN1801 1-695-299-11
CN1802 * 1-764-334-11
CN1803 * 1-764-333-11
PLUG, CONNECTOR 7P
CONNECTOR, BOARD TO BOARD 50P
PLUG, CONNECTOR 11P
PLUG, CONNECTOR 10P
REMARK
<IC>
IC1501
IC1502
IC1503
IC1602
IC1603
– 120 –
8-759-192-71
8-759-251-31
8-759-998-98
8-759-250-68
8-759-502-21
IC STV9379
IC CA0007AM
IC LM358D
IC TDA7264
IC TDA2822M
RM-862
KP-41PX1/41PX1K/41PX1R
The components identified by shading
and mark ¡ are critical for safety.
Replace only with part number specified.
REF.NO. PART NO.
DESCRIPTION
K
8-752-908-27
8-759-675-64
8-759-467-94
8-759-467-94
8-759-352-91
IC CXP86213-003S
IC M24C08-MN6T (A)
IC LM358D
IC LM358D
IC PST9143NL
IC1801
IC1802
IC1803
IC1804
IC1805
8-759-390-57
8-759-095-63
8-759-231-58
8-759-069-28
8-759-467-94
IC LM2940CT-5.0
IC PQ09RF2
IC TA7812S
IC PQ05RF11
IC LM358D (41PX1R)
<JACK>
J1601
RM-892
RM-862
D
REMARK
IC1701
IC1702
IC1703
IC1704
IC1706
RM-892
1-784-653-11 JACK, PHONO 2P (AUDIO OUT)
REF.NO. PART NO.
DESCRIPTION
REMARK
Q1612
8-729-027-56 TRANSISTOR DTC143TKA-T146
Q1613
Q1614
Q1615
Q1616
Q1617
8-729-027-56
8-729-026-49
8-729-120-28
8-729-120-28
8-729-026-49
TRANSISTOR DTC143TKA-T146
TRANSISTOR 2SA1037AK-T146-R
TRANSISTOR 2SC1623-L5L6
TRANSISTOR 2SC1623-L5L6
TRANSISTOR 2SA1037AK-T146-R
Q1701
Q1702
Q1703
Q1704
Q1705
8-729-120-28
8-729-120-28
8-729-120-28
8-729-120-28
8-729-120-28
TRANSISTOR 2SC1623-L5L6
TRANSISTOR 2SC1623-L5L6
TRANSISTOR 2SC1623-L5L6
TRANSISTOR 2SC1623-L5L6
TRANSISTOR 2SC1623-L5L6
Q1706
Q1707
Q1708
Q1709
Q1710
8-729-120-28
1-801-806-11
8-729-027-38
8-729-120-28
8-729-120-28
TRANSISTOR 2SC1623-L5L6
TRANSISTOR DTC144EKA-T146
TRANSISTOR DTA144EKA-T146
TRANSISTOR 2SC1623-L5L6
TRANSISTOR 2SC1623-L5L6
Q1711
Q1801
Q1802
Q1803
Q1804
8-729-120-28
8-729-120-28
8-729-120-28
8-729-120-28
8-729-120-28
TRANSISTOR 2SC1623-L5L6
TRANSISTOR 2SC1623-L5L6
TRANSISTOR 2SC1623-L5L6
TRANSISTOR 2SC1623-L5L6
TRANSISTOR 2SC1623-L5L6
Q1805
Q1806
Q1807
Q1808
Q1809
8-729-120-28
8-729-120-28
8-729-120-28
8-729-026-49
8-729-120-28
TRANSISTOR 2SC1623-L5L6
TRANSISTOR 2SC1623-L5L6
TRANSISTOR 2SC1623-L5L6
TRANSISTOR 2SA1037AK-T146-R
TRANSISTOR 2SC1623-L5L6
<CHIP CONDUCTOR>
JR1502
JR1503
JR1504
JR1505
JR1506
1-216-295-91
1-216-295-91
1-216-295-91
1-216-295-91
1-216-295-91
SHORT
SHORT
SHORT
SHORT
SHORT
0
0
0
0
0
JR1508
JR1510
JR1511
JR1512
JR1513
1-216-295-91
1-216-295-91
1-216-295-91
1-216-295-91
1-216-295-91
SHORT
SHORT
SHORT
SHORT
SHORT
0
0
0
0
0
JR1514
JR1701
1-216-295-91 SHORT
1-216-295-91 SHORT
0
0
<RESISTOR>
<COIL>
L1501
L1601
L1602
L1701
L1702
1-412-524-11
1-402-711-11
1-402-711-11
1-408-603-31
1-408-598-31
INDUCTOR
INDUCTOR
INDUCTOR
INDUCTOR
INDUCTOR
L1801
L1802
1-408-603-31 INDUCTOR
1-408-603-31 INDUCTOR
8.2µH
0µH
0µH
10µH
3.9µH
10µH (41PX1R)
10µH (41PX1/41PX1K)
<TRANSISTOR>
Q1501
Q1502
Q1503
Q1505
Q1601
8-729-120-28
8-729-026-49
8-729-120-28
8-729-120-28
8-729-027-56
TRANSISTOR 2SC1623-L5L6
TRANSISTOR 2SA1037AK-T146-R
TRANSISTOR 2SC1623-L5L6
TRANSISTOR 2SC1623-L5L6
TRANSISTOR DTC143TKA-T146
Q1602
Q1603
Q1604
Q1605
Q1607
8-729-120-28
8-729-027-56
8-729-027-56
8-729-027-56
8-729-120-28
TRANSISTOR 2SC1623-L5L6
TRANSISTOR DTC143TKA-T146
TRANSISTOR DTC143TKA-T146
TRANSISTOR DTC143TKA-T146
TRANSISTOR 2SC1623-L5L6
Q1608
Q1609
Q1610
Q1611
8-729-120-28
1-801-806-11
8-729-026-49
8-729-027-56
TRANSISTOR 2SC1623-L5L6
TRANSISTOR DTC144EKA-T146
TRANSISTOR 2SA1037AK-T146-R
TRANSISTOR DTC143TKA-T146
R1501
R1502
R1504
R1505
R1506
1-216-353-00
1-208-802-11
1-208-806-11
1-249-377-11
1-215-888-00
R1507
R1508
R1509
1-216-081-00 RES-CHIP
1-249-383-11 CARBON
1-208-800-11 METAL CHIP
22K
1.5
5.6K
R1509
1-208-802-11 METAL CHIP
6.8K
R1510
1-208-806-11 METAL CHIP
10K
R1511
R1512
R1513
R1514
R1515
1-216-057-00
1-216-085-91
1-216-049-00
1-216-073-00
1-216-073-00
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
2.2K
33K
1K
10K
10K
5%
5%
5%
5%
5%
1/10W
1/10W
1/10W
1/10W
1/10W
R1516
R1517
R1518
R1519
R1520
1-216-073-00
1-216-081-00
1-216-353-00
1-216-073-00
1-216-089-00
RES-CHIP
RES-CHIP
METAL OXIDE
RES-CHIP
RES-CHIP
10K
22K
2.2
10K
47K
5%
5%
5%
5%
5%
1/10W
1/10W
1W
1/10W
1/10W
R1521
R1522
R1525
R1526
R1527
1-216-097-00
1-216-089-91
1-216-083-00
1-216-083-00
1-216-121-11
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
100K
47K
27K
27K
1M
5%
5%
5%
5%
5%
1/10W
1/10W
1/10W
1/10W
1/10W
(41PX1R)
– 121 –
METAL OXIDE
METAL CHIP
METAL CHIP
CARBON
METAL OXIDE
2.2
6.8K
10K
0.47
220
5%
0.5%
0.5%
5%
5%
1W
1/10W
1/10W
1/4W
2W
5%
1/10W
5%
1/4W
0.5% 1/10W
(41PX1/41PX1K)
0.5% 1/10W
(41PX1R)
0.5% 1/10W
KP-41PX1/41PX1K/41PX1R
The components identified by shading
and mark ¡ are critical for safety.
Replace only with part number specified.
REF.NO. PART NO.
K
RM-892
RM-892
RM-862
D
DESCRIPTION
REMARK
R1527
1-216-129-00 RES-CHIP
2.2M
5%
1/10W
(41PX1/41PX1K)
5%
1/10W
(41PX1R)
5%
1/10W
(41PX1/41PX1K)
5%
1/10W
5%
1/10W
R1528
1-216-121-11 RES-CHIP
1M
R1528
1-216-129-00 RES-CHIP
2.2M
R1529
R1530
1-216-025-00 RES-CHIP
1-216-097-00 RES-CHIP
100
100K
R1531
R1532
R1533
R1534
R1537
1-216-089-00
1-216-025-00
1-249-377-11
1-216-089-91
1-216-073-00
RES-CHIP
RES-CHIP
CARBON
RES-CHIP
RES-CHIP
47K
100
0.47
47K
10K
5%
5%
5%
5%
5%
1/10W
1/10W
1/4W
1/10W
1/10W
R1538
R1539
R1540
R1541
R1542
1-216-083-00
1-216-073-00
1-216-091-00
1-216-091-00
1-216-093-91
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
27K
10K
56K
56K
68K
5%
5%
5%
5%
5%
1/10W
1/10W
1/10W
1/10W
1/10W
R1543
R1544
1-216-093-91 RES-CHIP
1-215-421-00 METAL
68K
1K
R1601
1-216-025-00 RES-CHIP
100
R1602
R1603
1-216-041-00 RES-CHIP
1-216-041-00 RES-CHIP
470
470
R1604
R1605
R1606
R1607
R1608
1-216-113-00
1-216-113-00
1-249-397-11
1-249-397-11
1-249-425-11
RES-CHIP
RES-CHIP
CARBON
CARBON
CARBON
470K
470K
22
22
4.7K
5%
5%
5%
5%
5%
1/10W
1/10W
1/4W
1/4W
1/4W
R1609
R1610
R1611
R1614
R1615
1-216-081-00
1-216-081-00
1-249-425-11
1-216-357-00
1-216-357-00
RES-CHIP
RES-CHIP
CARBON
METAL OXIDE
METAL OXIDE
22K
22K
4.7K
4.7
4.7
5%
5%
5%
5%
5%
1/10W
1/10W
1/4W
1W
1W
R1617
R1618
R1620
R1625
R1626
1-216-069-00
1-216-081-00
1-216-065-00
1-216-061-91
1-216-061-91
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
6.8K
22K
4.7K
3.3K
3.3K
5%
5%
5%
5%
5%
1/10W
1/10W
1/10W
1/10W
1/10W
R1629
R1630
R1631
R1632
R1633
1-216-049-00
1-216-081-00
1-249-389-11
1-216-089-91
1-216-089-91
RES-CHIP
RES-CHIP
CARBON
RES-CHIP
RES-CHIP
1K
22K
4.7
47K
47K
5%
5%
5%
5%
5%
1/10W
1/10W
1/4W
1/10W
1/10W
R1634
R1635
R1636
R1637
R1638
1-216-081-00
1-216-049-11
1-216-075-00
1-216-049-00
1-216-073-00
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
22K
1K
12K
1K
10K
5%
5%
5%
5%
5%
1/10W
1/10W
1/10W
1/10W
1/10W
R1639
R1640
R1641
R1642
R1643
1-216-049-11
1-216-025-00
1-216-065-00
1-216-049-00
1-216-073-00
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
1K
100
4.7K
1K
10K
5%
5%
5%
5%
5%
1/10W
1/10W
1/10W
1/10W
1/10W
R1644
1-216-075-00 RES-CHIP
12K
5%
1/10W
5%
1/10W
1%
1/4W
(41PX1/41PX1K)
5%
1/10W
(41PX1R)
5%
1/10W
5%
1/10W
REF.NO. PART NO.
DESCRIPTION
REMARK
R1645
R1648
R1649
R1650
1-216-041-00
1-249-381-11
1-216-089-00
1-216-033-00
RES-CHIP
CARBON
RES-CHIP
RES-CHIP
470
1
47K
220
5%
5%
5%
5%
1/10W
1/4W
1/10W
1/10W
R1651
R1652
R1653
R1654
R1655
1-216-073-00
1-216-099-00
1-216-049-11
1-216-049-11
1-216-073-00
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
10K
120K
1K
1K
10K
5%
5%
5%
5%
5%
1/10W
1/10W
1/10W
1/10W
1/10W
R1656
R1701
R1702
R1703
R1704
1-216-295-00
1-216-065-00
1-216-065-00
1-216-065-00
1-216-065-00
SHORT
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
0
4.7K
4.7K
4.7K
4.7K
(41PX1R)
5%
1/10W
5%
1/10W
5%
1/10W
5%
1/10W
R1705
R1706
R1707
R1708
R1709
1-216-065-00
1-216-065-00
1-216-025-00
1-216-025-00
1-216-025-00
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
4.7K
4.7K
100
100
100
5%
5%
5%
5%
5%
1/10W
1/10W
1/10W
1/10W
1/10W
R1710
R1711
R1712
R1713
R1714
1-216-049-00
1-216-089-00
1-216-073-00
1-216-089-00
1-216-073-00
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
1K
47K
10K
47K
10K
5%
5%
5%
5%
5%
1/10W
1/10W
1/10W
1/10W
1/10W
R1715
R1716
R1717
R1718
R1719
1-216-089-00
1-216-033-00
1-216-089-00
1-216-057-00
1-216-033-00
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
47K
220
47K
2.2K
220
5%
5%
5%
5%
5%
1/10W
1/10W
1/10W
1/10W
1/10W
R1720
R1721
R1722
R1725
R1726
1-216-033-00
1-216-033-00
1-216-033-00
1-216-065-00
1-216-295-91
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
SHORT
220
220
220
4.7K
0
5%
5%
5%
5%
1/10W
1/10W
1/10W
1/10W
R1727
R1728
R1729
R1730
R1731
1-216-033-00
1-216-025-00
1-216-025-00
1-216-057-00
1-216-033-00
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
220
100
100
2.2K
220
5%
5%
5%
5%
5%
1/10W
1/10W
1/10W
1/10W
1/10W
R1732
R1733
R1734
R1735
R1736
1-216-049-00
1-216-049-00
1-216-049-00
1-216-089-00
1-216-033-00
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
1K
1K
1K
47K
220
5%
5%
5%
5%
5%
1/10W
1/10W
1/10W
1/10W
1/10W
R1737
R1738
R1739
R1740
R1741
1-216-033-00
1-216-025-00
1-216-073-00
1-216-073-00
1-216-033-00
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
220
100
10K
10K
220
5%
5%
5%
5%
5%
1/10W
1/10W
1/10W
1/10W
1/10W
R1742
R1743
R1744
R1745
R1746
1-216-033-00
1-216-025-00
1-216-033-00
1-216-073-00
1-216-025-00
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
220
100
220
10K
100
5%
5%
5%
5%
5%
1/10W
1/10W
1/10W
1/10W
1/10W
R1747
R1748
1-216-025-00 RES-CHIP
1-216-025-00 RES-CHIP
100
100
5%
5%
1/10W
1/10W
– 122 –
KP-41PX1/41PX1K/41PX1R
The components identified by shading
and mark ¡ are critical for safety.
Replace only with part number specified.
REF.NO. PART NO.
K
RM-892
RM-892
RM-862
D
DESCRIPTION
REMARK
REF.NO. PART NO.
DESCRIPTION
REMARK
R1749
R1750
R1751
1-216-033-00 RES-CHIP
1-216-073-00 RES-CHIP
1-216-033-00 RES-CHIP
220
10K
220
5%
5%
5%
1/10W
1/10W
1/10W
R1807
1-216-295-91 SHORT
0
R1808
1-216-059-00 RES-CHIP
2.7K
R1752
R1753
R1754
R1755
R1756
1-216-025-00
1-216-073-00
1-216-073-00
1-216-025-00
1-216-073-00
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
100
10K
10K
100
10K
5%
5%
5%
5%
5%
1/10W
1/10W
1/10W
1/10W
1/10W
R1808
R1809
R1810
1-216-295-91 SHORT
1-216-097-00 RES-CHIP
1-216-021-00 RES-CHIP
0
100K
68
R1810
1-216-023-00 RES-CHIP
82
R1757
R1758
R1759
R1760
R1762
1-216-073-00
1-216-025-00
1-216-073-00
1-216-073-00
1-216-063-91
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
10K
100
10K
10K
3.9K
R1811
R1812
R1813
R1814
R1815
1-216-025-00
1-216-025-00
1-216-049-00
1-216-023-00
1-216-025-00
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
100
100
1K
82
100
5%
5%
5%
5%
5%
R1762
1-216-065-00 RES-CHIP
4.7K
R1763
1-208-797-11 METAL CHIP
4.3K
R1816
R1817
R1818
R1819
1-216-025-00
1-216-025-00
1-216-059-00
1-216-059-00
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
100
100
2.7K
2.7K
5%
5%
5%
5%
R1763
1-216-061-91 RES-CHIP
3.3K
R1819
1-216-295-91 SHORT
0
R1764
1-216-063-91 RES-CHIP
3.9K
R1820
1-216-059-00 RES-CHIP
2.7K
R1764
1-216-065-00 RES-CHIP
4.7K
R1820
R1821
R1822
1-216-295-91 SHORT
1-216-025-00 RES-CHIP
1-216-089-00 RES-CHIP
0
100
47K
R1823
1-216-089-00 RES-CHIP
47K
R1824
1-216-089-00 RES-CHIP
47K
R1824
R1825
1-216-295-91 SHORT
1-216-089-00 RES-CHIP
0
47K
R1825
R1826
1-216-295-91 SHORT
1-216-089-00 RES-CHIP
0
47K
R1826
R1827
1-216-295-91 SHORT
1-216-089-00 RES-CHIP
0
47K
R1828
1-216-089-00 RES-CHIP
47K
R1829
1-216-089-00 RES-CHIP
47K
R1829
1-216-295-91 SHORT
0
R1830
R1831
R1832
1-216-073-00 RES-CHIP
1-216-063-91 RES-CHIP
1-216-049-00 RES-CHIP
10K
3.9K
1K
R1832
1-216-051-00 RES-CHIP
1.2K
R1833
1-216-041-00 RES-CHIP
470
R1834
R1835
R1836
R1837
R1838
1-216-049-00
1-216-049-00
1-216-049-00
1-216-049-00
1-216-041-00
1K
1K
1K
1K
470
5%
5%
5%
5%
5%
1/10W
1/10W
1/10W
1/10W
1/10W
R1839
R1840
1-216-049-00 RES-CHIP
1-216-049-00 RES-CHIP
1K
1K
5%
5%
1/10W
1/10W
5%
1/10W
5%
1/10W
5%
1/10W
5%
1/10W
5%
1/10W
(41PX1/41PX1K)
5%
1/10W
(41PX1R)
0.5% 1/10W
(41PX1R)
5%
1/10W
(41PX1/41PX1K)
5%
1/10W
(41PX1/41PX1K)
5%
1/10W
(41PX1R)
R1765
R1766
R1767
R1768
R1769
1-216-073-00
1-216-049-11
1-216-113-00
1-216-049-11
1-216-115-00
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
10K
1K
470K
1K
560K
5%
5%
5%
5%
5%
1/10W
1/10W
1/10W
1/10W
1/10W
R1770
R1771
R1772
R1773
R1774
1-216-049-11
1-216-113-00
1-216-049-11
1-216-073-00
1-216-025-00
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
1K
470K
1K
10K
100
5%
5%
5%
5%
5%
1/10W
1/10W
1/10W
1/10W
1/10W
R1775
R1778
R1786
R1787
R1788
1-216-115-00
1-216-049-11
1-216-025-00
1-216-025-00
1-216-025-00
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
560K
1K
100
100
100
5%
5%
5%
5%
5%
1/10W
1/10W
1/10W
1/10W
1/10W
R1789
R1790
R1791
R1792
R1793
1-216-049-00
1-216-025-00
1-216-025-00
1-216-089-00
1-216-089-00
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
1K
100
100
47K
47K
5%
5%
5%
5%
5%
1/10W
1/10W
1/10W
1/10W
1/10W
R1794
R1795
R1802
R1803
R1804
1-216-089-00
1-216-089-00
1-215-925-11
1-216-073-00
1-216-113-00
RES-CHIP
RES-CHIP
METAL OXIDE
RES-CHIP
RES-CHIP
47K
47K
22K
10K
470K
5%
5%
5%
5%
5%
1/10W
1/10W
3W
1/10W
1/10W
(41PX1R)
R1805
1-216-113-00 RES-CHIP
470K
R1806
1-216-021-00 RES-CHIP
68
R1806
1-216-023-00 RES-CHIP
82
R1807
1-216-059-00 RES-CHIP
2.7K
5%
1/10W
(41PX1R)
5%
1/10W
(41PX1/41PX1K)
5%
1/10W
(41PX1R)
5%
1/10W
(41PX1R)
– 123 –
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
(41PX1/41PX1K)
5%
1/10W
(41PX1R)
(41PX1/41PX1K)
5%
1/10W
5%
1/10W
(41PX1/41PX1K)
5%
1/10W
(41PX1R)
1/10W
1/10W
1/10W
1/10W
1/10W
1/10W
1/10W
1/10W
1/10W
(41PX1R)
(41PX1/41PX1K)
5%
1/10W
(41PX1R)
(41PX1/41PX1K)
5%
1/10W
5%
1/10W
(41PX1R)
5%
1/10W
(41PX1R)
5%
1/10W
(41PX1R)
(41PX1/41PX1K)
5%
1/10W
(41PX1R)
(41PX1/41PX1K)
5%
1/10W
(41PX1R)
(41PX1/41PX1K)
5%
1/10W
(41PX1R)
5%
1/10W
(41PX1R)
5%
1/10W
(41PX1R)
(41PX1/41PX1K)
5%
5%
5%
1/10W
1/10W
1/10W
(41PX1R)
5%
1/10W
(41PX1/41PX1K)
5%
1/10W
KP-41PX1/41PX1K/41PX1R
The components identified by shading
and mark ¡ are critical for safety.
Replace only with part number specified.
REF.NO. PART NO.
REMARK
1-216-049-00 RES-CHIP
1-216-049-00 RES-CHIP
1K
1K
R1842
1-216-051-00 RES-CHIP
1.2K
R1848
R1849
1-216-041-00
1-216-049-00
1-216-049-00
1-216-049-00
1-216-049-00
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
1-216-049-00 RES-CHIP
1-216-041-00 RES-CHIP
RM-892
RM-892
D E
DESCRIPTION
R1841
R1842
R1843
R1844
R1845
R1846
R1847
K
1/10W
1/10W
(41PX1/R)
5%
1/10W
(41PX1/41PX1K)
470
1K
1K
1K
1K
1K
470
5%
5%
5%
5%
5%
5%
5%
5%
5%
1/10W
1/10W
1/10W
1/10W
1/10W
1/10W
1/10W
<RELAY>
RY1601 1-755-028-11 RELAY
RY1602 1-755-028-11 RELAY
<TERMINAL BOARD>
TB1601 1-694-303-11 TERMINAL, PUSH (CENTER SP IN)
REF.NO. PART NO.
DESCRIPTION
REMARK
C529
C530
C531
C532
1-109-844-11
1-107-648-91
1-126-971-11
1-126-971-11
FILM
ELECT
ELECT
ELECT
0.68µF
100µF
470µF
470µF
5%
20%
20%
20%
250V
160V
50V
50V
C533
C535
C536
C537
C538
1-107-655-11
1-106-387-00
1-137-374-11
1-126-968-11
1-126-968-11
ELECT
MYLAR
MYLAR
ELECT
ELECT
47µF
0.068µF
0.047µF
100µF
100µF
20%
10%
5%
20%
20%
250V
200V
50V
50V
50V
C539
C540
C541
C542
C548
1-162-114-00
1-137-372-11
1-137-374-11
1-126-934-11
1-102-244-00
CERAMIC
MYLAR
MYLAR
ELECT
CERAMIC
0.0047µF
0.022µF
0.047µF
220µF
220pF
5%
5%
20%
10%
2KV
50V
50V
16V
500V
C550
C551
C554
C555
C556
1-126-935-11
1-126-935-11
1-130-062-91
1-126-960-11
1-130-495-00
ELECT
ELECT
FILM
ELECT
MYLAR
470µF
470µF
0.0056µF
1µF
0.1µF
20%
20%
5%
20%
5%
16V
16V
630V
50V
50V
C701
C801
C802
C803
C804
1-126-933-11
1-104-665-11
1-104-665-11
1-126-934-11
1-126-934-11
ELECT
ELECT
ELECT
ELECT
ELECT
100µF
100µF
100µF
220µF
220µF
20%
20%
20%
20%
20%
16V
25V
25V
16V
16V
C805
C806
C807
C808
C809
1-126-934-11
1-126-934-11
1-137-374-11
1-137-374-11
1-137-374-11
ELECT
ELECT
MYLAR
MYLAR
MYLAR
220µF
220µF
0.047µF
0.047µF
0.047µF
20%
20%
5%
5%
5%
16V
16V
50V
50V
50V
C810
C811
C812
C813
C815
1-137-374-11
1-102-074-00
1-136-169-00
1-137-374-11
1-104-665-11
MYLAR
CERAMIC
MYLAR
MYLAR
ELECT
0.047µF
0.001µF
0.22µF
0.047µF
100µF
5%
10%
5%
5%
20%
50V
50V
50V
50V
25V
C816
C817
C818
C819
C820
1-130-014-00
1-104-664-11
1-126-933-11
1-104-664-11
1-102-129-00
FILM
ELECT
ELECT
ELECT
CERAMIC
470pF
47µF
100µF
47µF
0.01µF
5%
20%
20%
20%
10%
50V
25V
16V
25V
50V
C821
C822
C823
C824
C825
1-130-495-00
1-107-648-91
1-104-664-11
1-126-964-11
1-104-665-11
MYLAR
ELECT
ELECT
ELECT
ELECT
0.1µF
100µF
47µF
10µF
100µF
5%
20%
20%
20%
20%
50V
160V
25V
50V
25V
C826
C827
C828
C829
C830
1-136-165-00
1-126-964-11
1-102-824-00
1-126-959-11
1-102-824-00
MYLAR
ELECT
CERAMIC
ELECT
CERAMIC
0.1µF
10µF
470pF
0.47µF
470pF
5%
20%
5%
20%
5%
50V
50V
50V
50V
50V
C831
C832
C833
C834
C835
1-126-960-11
1-126-960-11
1-126-960-11
1-126-968-11
1-126-967-11
ELECT
ELECT
ELECT
ELECT
ELECT
1µF
1µF
1µF
100µF
47µF
20%
20%
20%
20%
20%
50V
50V
50V
50V
50V
C836
C837
1-136-169-00 MYLAR
1-126-963-11 ELECT
0.22µF
4.7µF
5%
20%
50V
50V
<CRYSTAL>
X1701
1-579-125-11 VIBRATOR, CERAMIC (8.0MHz)
*******************************************************************************
* A-1642-288-AE BOARD, COMPLETE
****************************
4-382-854-11 SCREW (M3X10), P, SW (+)
7-682-952-09 SCREW +PSW 3X16
<CAPACITOR>
C502
C505
C506
C507
C508
1-126-959-11
1-130-471-00
1-126-933-11
1-126-965-91
1-102-228-00
ELECT
MYLAR
ELECT
ELECT
CERAMIC
0.47µF
0.001µF
100µF
22µF
470pF
20%
5%
20%
20%
10%
50V
50V
16V
50V
500V
C509
1-106-383-00
C511
1-130-475-00
C512
1-136-479-11
C513
1-126-965-91
C514 0 1-162-116-91
MYLAR
MYLAR
FILM
ELECT
CERAMIC
0.047µF
0.0022µF
0.001µF
22µF
680pF
10%
5%
5%
20%
10%
200V
50V
50V
50V
2KV
C515 0 1-125-831-91 FILM
C516 0 1-117-648-11 FILM
C518
1-130-495-00 MYLAR
C519
1-106-359-00 MYLAR
C520
1-162-116-00 CERAMIC
0.033µF
15000pF
0.1µF
0.0047µF
680pF
3%
3%
5%
10%
10%
630V
1.2KV
50V
100V
2KV
C521
C523
C524
C526
C527
1-162-116-00
1-115-521-11
1-106-359-00
1-102-228-00
1-126-970-11
680pF
0.82µF
0.0047µF
470pF
330µF
10%
5%
10%
10%
20%
2KV
250V
100V
500V
50V
C528
1-107-957-11 ELECT
1µF
20%
250V
CERAMIC
FILM
MYLAR
CERAMIC
ELECT
– 124 –
RM-862
KP-41PX1/41PX1K/41PX1R
The components identified by shading
and mark ¡ are critical for safety.
Replace only with part number specified.
REF.NO. PART NO.
K
RM-892
RM-892
E
DESCRIPTION
REMARK
REF.NO. PART NO.
DESCRIPTION
REMARK
C838
C839
C840
1-104-665-11 ELECT
1-137-374-11 MYLAR
1-104-665-11 ELECT
100µF
0.047µF
100µF
20%
5%
20%
25V
50V
25V
C841
C842
C843
C844
C845
1-137-374-11
1-137-374-11
1-104-664-11
1-126-933-11
1-126-933-11
MYLAR
MYLAR
ELECT
ELECT
ELECT
0.047µF
0.047µF
47µF
100µF
100µF
5%
5%
20%
20%
20%
50V
50V
25V
16V
16V
C846
C847
C848
C849
C850
1-126-933-11
1-126-933-11
1-126-933-11
1-102-973-00
1-102-973-00
ELECT
ELECT
ELECT
CERAMIC
CERAMIC
100µF
100µF
100µF
100pF
100pF
20%
20%
20%
5%
5%
16V
16V
16V
50V
50V
C851
C852
C853
C854
C855
1-137-374-11
1-137-374-11
1-137-374-11
1-126-933-11
1-102-973-00
MYLAR
MYLAR
MYLAR
ELECT
CERAMIC
0.047µF
0.047µF
0.047µF
100µF
100pF
5%
5%
5%
20%
5%
50V
50V
50V
16V
50V
C856
C857
C858
C859
C860
1-102-973-00
1-126-933-11
1-104-665-11
1-104-665-11
1-126-933-11
CERAMIC
ELECT
ELECT
ELECT
ELECT
100pF
100µF
100µF
100µF
100µF
5%
20%
20%
20%
20%
50V
16V
25V
25V
16V
C861
C862
C863
C864
C865
1-137-374-11
1-137-374-11
1-137-374-11
1-126-933-11
1-137-366-11
MYLAR
MYLAR
MYLAR
ELECT
MYLAR
0.047µF
0.047µF
0.047µF
100µF
0.0022µF
5%
5%
5%
20%
5%
50V
50V
50V
16V
50V
D501
D502
D503
D504
D507
8-719-991-33
8-719-991-33
8-719-991-33
8-719-921-63
8-719-302-43
DIODE 1SS133T-77
DIODE 1SS133T-77
DIODE 1SS133T-77
DIODE MTZJ-7.5B
DIODE EL1Z
C866
C867
C868
C869
C870
1-136-177-00
1-104-664-11
1-164-096-11
1-130-487-00
1-164-096-11
MYLAR
ELECT
CERAMIC
MYLAR
CERAMIC
1µF
47µF
0.01µF
0.022µF
0.01µF
5%
20%
50V
25V
50V
50V
50V
D508
D509
D510
D511
D512
8-719-900-26
8-719-945-80
8-719-991-33
8-719-302-43
8-719-991-33
DIODE ERD29-08J
DIODE ERC06-15S
DIODE 1SS133T-77
DIODE EL1Z
DIODE 1SS133T-77
C872
C873
C874
C875
C876
1-126-960-11
1-126-964-11
1-104-664-11
1-164-096-11
1-102-973-00
ELECT
ELECT
ELECT
CERAMIC
CERAMIC
1µF
10µF
47µF
0.01µF
100pF
20%
20%
20%
5%
50V
50V
25V
50V
50V
D513
D514
D515
D517
D519
8-719-302-43
8-719-908-03
8-719-908-03
8-719-018-82
8-719-991-33
DIODE EL1Z
DIODE GP08D
DIODE GP08D
DIODE RGP02-20EL-6394
DIODE 1SS133T-77
C877
C878
C879
C880
C881
1-102-973-00
1-104-664-11
1-104-664-11
1-104-664-11
1-102-973-00
CERAMIC
ELECT
ELECT
ELECT
CERAMIC
100pF
47µF
47µF
47µF
100pF
5%
20%
20%
20%
5%
50V
25V
25V
25V
50V
D522
D523
D524
D527
D560
8-719-991-33
8-719-991-33
8-719-991-33
8-719-109-85
8-719-991-33
DIODE 1SS133T-77
DIODE 1SS133T-77
DIODE 1SS133T-77
DIODE RD5.1ESB2
DIODE 1SS133T-77
C882
C883
C884
C885
C886
1-102-973-00
1-102-973-00
1-104-665-11
1-104-664-11
1-102-973-00
CERAMIC
CERAMIC
ELECT
ELECT
CERAMIC
100pF
100pF
100µF
47µF
100pF
5%
5%
20%
20%
5%
50V
50V
25V
25V
50V
D701
D702
D820
D829
D835
8-719-109-63
8-719-991-33
8-719-109-68
8-719-109-84
8-719-109-89
DIODE RD3.0ESB2
DIODE 1SS133T-77
DIODE RD3.6ESB1
DIODE RD5.1ESB1
DIODE RD5.6ESB2
C887
C888
C889
C897
C898
1-102-973-00
1-102-973-00
1-104-665-11
1-104-665-11
1-164-096-11
CERAMIC
CERAMIC
ELECT
ELECT
CERAMIC
100pF
100pF
100µF
100µF
0.01µF
5%
5%
20%
20%
50V
50V
25V
25V
50V
D840
D842
D845
D846
8-719-991-33
8-719-991-33
8-719-991-33
8-719-991-33
DIODE 1SS133T-77
DIODE 1SS133T-77
DIODE 1SS133T-77
DIODE 1SS133T-77
5%
<CONNECTOR>
CN501
CN502
CN503
CN504
CN505
* 1-564-513-11
* 1-580-689-11
* 1-580-689-11
* 1-580-689-11
* 1-506-371-00
PLUG, CONNECTOR 10P
PIN, CONNECTOR (PC BOARD) 4P
PIN, CONNECTOR (PC BOARD) 4P
PIN, CONNECTOR (PC BOARD) 4P
PIN, CONNECTOR 2P
CN506
CN507
CN508
CN651
CN652
* 1-779-892-11
* 1-564-507-11
1-695-915-11
* 1-779-892-11
* 1-779-892-11
CONNECTOR, BOARD TO BOARD 10P
PLUG, CONNECTOR 4P
TAB (CONTACT)
CONNECTOR, BOARD TO BOARD 10P
CONNECTOR, BOARD TO BOARD 10P
CN801
CN802
CN803
CN804
CN805
* 1-564-507-11
* 1-564-507-11
* 1-564-507-11
* 1-779-892-11
* 1-508-766-00
PLUG, CONNECTOR 4P
PLUG, CONNECTOR 4P
PLUG, CONNECTOR 4P
CONNECTOR, BOARD TO BOARD 10P
PIN, CONNECTOR (5MM PITCH) 4P
CN806
CN807
CN808
CN810
* 1-508-765-00
* 1-564-509-11
* 1-573-986-11
* 1-573-963-11
PIN, CONNECTOR (5MM PITCH) 3P
PLUG, CONNECTOR 6P
PIN, CONNECTOR (PC BOARD) 5P
PIN, CONNECTOR (PC BOARD) 3P
<DIODE>
<FERRITE BEAD>
FB501
– 125 –
1-410-397-21 FERRITE
1.1µH
RM-862
The components identified by shading
and mark ¡ are critical for safety.
Replace only with part number specified.
REF.NO. PART NO.
• The components identified by [ in this manual
have been carefully factory-selected for each set
in order to satisfy regulations regarding X-ray
radiation. Should replacement be required,
replace only with the value originally used.
DESCRIPTION
REMARK
<IC>
IC501
IC801
IC802
IC803
IC804
8-759-133-90
8-759-327-51
8-759-327-51
8-759-183-37
8-759-464-79
IC µPC339C
IC PA0053B
IC PA0053B
IC CA0007AD
IC PM0011AS
IC805
IC806
IC807
IC808
IC809
8-759-711-28
8-759-464-79
8-759-700-69
8-759-464-79
8-749-014-37
IC NJM2058D
IC PM0011AS
IC NJM79L12A
IC PM0011AS
IC STK392-150
IC810
IC811
IC812
IC813
IC814
8-749-014-37
8-759-981-96
8-759-701-56
8-759-701-65
8-759-595-88
IC STK392-150
IC RC4560D
IC NJM78M05FA
IC NJM79M05FA
IC AN77L12-TA
REF.NO. PART NO.
KP-41PX1/41PX1K/41PX1R
K
RM-892
RM-892
E
DESCRIPTION
REMARK
Q802
Q803
Q804
Q805
Q806
8-729-119-76
8-729-423-33
8-729-119-76
8-729-423-33
8-729-119-76
TRANSISTOR 2SA1175-HFE
TRANSISTOR 2SC3311A-QRSTA
TRANSISTOR 2SA1175-HFE
TRANSISTOR 2SC3311A-QRSTA
TRANSISTOR 2SA1175-HFE
Q807
Q808
Q809
Q810
Q811
8-729-423-33
8-729-030-02
8-729-423-33
8-729-423-33
8-729-423-33
TRANSISTOR 2SC3311A-QRSTA
TRANSISTOR DTC144ESA
TRANSISTOR 2SC3311A-QRSTA
TRANSISTOR 2SC3311A-QRSTA
TRANSISTOR 2SC3311A-QRSTA
Q812
8-729-119-76 TRANSISTOR 2SA1175-HFE
<RESISTOR>
[R1 0
METAL
R501
1-249-421-11 CARBON
R502
1-216-465-21 METAL OXIDE
R503
1-247-843-11 CARBON
R504
1-249-419-11 CARBON
R505
1-247-885-00 CARBON
2.2K
27K
3.3K
1.5K
180K
1%
5%
5%
5%
5%
5%
1/4W
1/4W
2W
1/4W
1/4W
1/4W
R506
R507
R508
R509
R510
1-247-883-00
1-249-422-11
1-260-338-51
1-249-437-11
1-215-918-00
CARBON
CARBON
CARBON
CARBON
METAL OXIDE
150K
2.7K
6.8K
47K
1.5K
5%
5%
5%
5%
5%
1/4W
1/4W
1/2W
1/4W
3W
R511
R512
R513
R514
R516
1-215-918-00
1-215-918-00
1-247-843-11
1-215-443-00
1-215-467-00
METAL OXIDE
METAL OXIDE
CARBON
METAL
METAL
1.5K
1.5K
3.3K
8.2K
82K
5%
5%
5%
1%
1%
3W
3W
1/4W
1/4W
1/4W
R517
R518
R519
R522
R523
1-215-449-00
1-249-436-11
1-249-429-11
1-249-428-11
1-249-437-11
METAL
CARBON
CARBON
CARBON
CARBON
15K
39K
10K
8.2K
47K
1%
5%
5%
5%
5%
1/4W
1/4W
1/4W
1/4W
1/4W
LINK, IC (5A/90V AC, 60V DC)
LINK, IC (5A/90V AC, 60V DC)
LINK, IC (2A/90V AC, 60V DC)
LINK, IC (2A/90V AC, 60V DC)
LINK, IC (2A/90V AC, 60V DC)
R524
R525
R527
R528
R529
1-249-425-11
1-249-405-11
1-249-425-11
1-215-910-00
1-215-449-00
CARBON
CARBON
CARBON
METAL OXIDE
METAL
4.7K
100
4.7K
68
15K
5%
5%
5%
5%
1%
1/4W
1/4W
1/4W
3W
1/4W
PS606 0 1-533-593-31 LINK, IC (2A/90V AC, 60V DC)
PS607 0 1-533-593-31 LINK, IC (2A/90V AC, 60V DC)
PS608 0 1-533-593-31 LINK, IC (2A/90V AC, 60V DC)
R530
R531
R532
R533
R534
1-249-429-11
1-260-326-11
1-260-315-71
1-214-912-00
1-215-479-00
CARBON
CARBON
CARBON
METAL
METAL
10K
680
82
91K
270K
5%
5%
5%
1%
1%
1/4W
1/2W
1/2W
1/2W
1/4W
R535
R536
R537
R538
R539
1-247-887-00
1-249-377-11
1-260-336-11
1-249-425-11
1-249-377-11
CARBON
CARBON
CARBON
CARBON
CARBON
220K
0.47
4.7K
4.7K
0.47
5%
5%
5%
5%
5%
1/4W
1/4W
1/2W
1/4W
1/4W
R540
R541
R542
R543
R544
1-249-377-11
1-247-807-31
1-215-864-00
1-216-349-00
1-216-864-00
CARBON
CARBON
METAL OXIDE
METAL OXIDE
METAL OXIDE
0.47
100
150
1
150
5%
5%
5%
5%
5%
1/4W
1/4W
1W
1W
1W
R545
1-249-377-11 CARBON
0.47
5%
1/4W
<COIL>
L502
L503
L505
L506
L801
L802
L803
1-410-478-11
1-459-111-00
0 1-416-637-11
1-412-552-11
1-406-979-11
INDUCTOR
47µH
INDUCTOR
10mH
COIL, HORIZONTAL LINEARITY
INDUCTOR
2.2mH
INDUCTOR
220µH
1-406-979-11 INDUCTOR
1-406-665-11 INDUCTOR
220µH
100µH
<NEON LAMP>
NL501
1-519-108-99 LAMP, NEON
<IC LINK>
PS601
PS602
PS603
PS604
PS605
0 1-533-597-31
0 1-533-597-31
0 1-533-593-31
0 1-533-593-31
0 1-533-593-31
<TRANSISTOR>
Q501
Q502
Q503
Q504
Q505
8-729-119-80
8-729-044-29
8-729-119-76
8-729-046-80
8-729-038-83
TRANSISTOR 2SC2688-LK
TRANSISTOR 2SD2539 (LBSONY-1)
TRANSISTOR 2SA1175-HFE
TRANSISTOR 2SC4634LS-CB11
TRANSISTOR 2SK2251-01-F19
Q506
Q507
Q701
Q702
Q801
8-729-423-33
8-729-032-61
8-729-423-33
8-729-423-33
8-729-423-33
TRANSISTOR 2SC3311A-QRSTA
TRANSISTOR 2SC5022-02
TRANSISTOR 2SC3311A-QRSTA
TRANSISTOR 2SC3311A-QRSTA
TRANSISTOR 2SC3311A-QRSTA
– 126 –
RM-862
KP-41PX1/41PX1K/41PX1R
The components identified by shading
and mark ¡ are critical for safety.
Replace only with part number specified.
REF.NO. PART NO.
K
RM-892
RM-892
E
DESCRIPTION
REMARK
R546
R547
R548
R549
1-249-377-11
1-247-807-31
1-249-413-11
1-249-431-11
CARBON
CARBON
CARBON
CARBON
0.47
100
470
15K
5%
5%
5%
5%
1/4W
1/4W
1/4W
1/4W
R550
R551
R552
R553
R554
1-247-807-31
1-249-437-11
1-247-807-31
1-247-881-00
1-249-405-11
CARBON
CARBON
CARBON
CARBON
CARBON
100
47K
100
120K
100
5%
5%
5%
5%
5%
1/4W
1/4W
1/4W
1/4W
1/4W
R555
R556
R557
R558
R559
1-247-807-31
1-260-328-11
1-216-490-11
1-216-490-11
1-216-490-11
CARBON
CARBON
METAL OXIDE
METAL OXIDE
METAL OXIDE
100
1K
39K
39K
39K
5%
5%
5%
5%
5%
1/4W
1/2W
3W
3W
3W
R562
R563
R565
R567
R568
1-202-838-00
1-215-447-00
1-247-807-31
1-216-390-11
1-247-903-00
SOLID
METAL
CARBON
METAL OXIDE
CARBON
100K
12K
100
1.2
1M
10%
1%
5%
5%
5%
1/2W
1/4W
1/4W
3W
1/4W
R569
R570
R571
R572
R573
1-216-390-11
1-215-910-00
1-249-422-11
1-247-895-91
1-249-438-11
METAL OXIDE
METAL OXIDE
CARBON
CARBON
CARBON
1.2
68
2.7K
470K
56K
5%
5%
5%
5%
5%
3W
3W
1/4W
1/4W
1/4W
R574
R576
R577
R578
R579
1-249-435-11
1-247-807-31
1-249-422-11
1-215-473-00
1-247-889-00
CARBON
CARBON
CARBON
METAL
CARBON
33K
100
2.7K
150K
270K
5%
5%
5%
1%
5%
1/4W
1/4W
1/4W
1/4W
1/4W
R580
R581
R583
R584
R585
1-249-437-11
1-249-437-11
1-249-428-11
1-249-429-11
1-216-490-11
CARBON
CARBON
CARBON
CARBON
METAL OXIDE
47K
47K
8.2K
10K
39K
5%
5%
5%
5%
5%
1/4W
1/4W
1/4W
1/4W
3W
R586
R588
R589
R591
R595
1-215-892-11
1-249-433-11
1-247-887-00
1-249-425-11
1-215-464-00
METAL OXIDE
CARBON
CARBON
CARBON
METAL
1K
22K
220K
4.7K
62K
5%
5%
5%
5%
1%
2W
1/4W
1/4W
1/4W
1/4W
R596
R597
R701
R702
R703
1-215-473-00
1-215-464-00
1-215-449-00
1-249-421-11
1-249-421-11
METAL
METAL
METAL
CARBON
CARBON
150K
62K
15K
2.2K
2.2K
1%
1%
1%
5%
5%
1/4W
1/4W
1/4W
1/4W
1/4W
R704
R705
R706
R801
R802
1-215-457-00
1-215-457-00
1-215-457-00
1-247-807-31
1-247-807-31
METAL
METAL
METAL
CARBON
CARBON
33K
33K
33K
100
100
1%
1%
1%
5%
5%
1/4W
1/4W
1/4W
1/4W
1/4W
R803
R804
R805
R806
R807
1-249-430-11
1-249-425-11
1-247-807-31
1-249-429-11
1-247-807-31
CARBON
CARBON
CARBON
CARBON
CARBON
12K
4.7K
100
10K
100
5%
5%
5%
5%
5%
1/4W
1/4W
1/4W
1/4W
1/4W
R808
R809
1-249-429-11 CARBON
1-249-425-11 CARBON
10K
4.7K
5%
5%
1/4W
1/4W
REF.NO. PART NO.
DESCRIPTION
REMARK
R810
R811
R813
1-247-807-31 CARBON
1-247-807-31 CARBON
1-249-433-11 CARBON
100
100
22K
5%
5%
5%
1/4W
1/4W
1/4W
R814
R815
R816
R817
R818
1-247-807-31
1-247-807-31
1-247-807-31
1-247-807-31
1-249-429-11
CARBON
CARBON
CARBON
CARBON
CARBON
100
100
100
100
10K
5%
5%
5%
5%
5%
1/4W
1/4W
1/4W
1/4W
1/4W
R819
R820
R821
R822
R823
1-247-807-31
1-249-437-11
1-249-431-11
1-249-417-11
1-249-417-11
CARBON
CARBON
CARBON
CARBON
CARBON
100
47K
15K
1K
1K
5%
5%
5%
5%
5%
1/4W
1/4W
1/4W
1/4W
1/4W
R824
R825
R826
R827
R828
1-215-462-00
1-249-441-11
1-215-462-00
1-216-474-11
1-249-426-11
METAL
CARBON
METAL
METAL OXIDE
CARBON
51K
100K
51K
82
5.6K
1%
5%
1%
5%
5%
1/4W
1/4W
1/4W
3W
1/4W
R829
R830
R831
R832
R833
1-249-426-11
1-249-414-11
1-249-414-11
1-249-441-11
1-216-474-11
CARBON
CARBON
CARBON
CARBON
METAL OXIDE
5.6K
560
560
100K
82
5%
5%
5%
5%
5%
1/4W
1/4W
1/4W
1/4W
3W
R834
R835
R836
R837
R838
1-249-441-11
1-249-441-11
1-247-807-31
1-249-441-11
1-249-421-11
CARBON
CARBON
CARBON
CARBON
CARBON
100K
100K
100
100K
2.2K
5%
5%
5%
5%
5%
1/4W
1/4W
1/4W
1/4W
1/4W
R839
R841
R842
R843
R844
1-247-807-31
1-249-409-11
1-247-807-31
1-247-807-31
1-247-807-31
CARBON
CARBON
CARBON
CARBON
CARBON
100
220
100
100
100
5%
5%
5%
5%
5%
1/4W
1/4W
1/4W
1/4W
1/4W
R845
R846
R847
R848
R850
1-249-441-11
1-247-807-31
1-215-481-00
1-215-449-00
1-215-481-00
CARBON
CARBON
METAL
METAL
METAL
100K
100
330K
15K
330K
5%
5%
1%
1%
1%
1/4W
1/4W
1/4W
1/4W
1/4W
R851
R852
R853
R854
R856
1-247-807-31
1-247-807-31
1-247-887-00
1-249-429-11
1-247-807-31
CARBON
CARBON
CARBON
CARBON
CARBON
100
100
220K
10K
100
5%
5%
5%
5%
5%
1/4W
1/4W
1/4W
1/4W
1/4W
R857
R858
R859
R860
R861
1-247-807-31
1-215-455-00
1-215-455-00
1-215-455-00
1-215-455-00
CARBON
METAL
METAL
METAL
METAL
100
27K
27K
27K
27K
5%
1%
1%
1%
1%
1/4W
1/4W
1/4W
1/4W
1/4W
R862
R863
R865
R866
R867
1-215-455-00
1-215-455-00
1-249-424-11
1-249-437-11
1-215-455-00
METAL
METAL
CARBON
CARBON
METAL
27K
27K
3.9K
47K
27K
1%
1%
5%
5%
1%
1/4W
1/4W
1/4W
1/4W
1/4W
R868
R869
R870
1-215-443-00 METAL
1-249-425-11 CARBON
1-249-437-11 CARBON
8.2K
4.7K
47K
1%
5%
5%
1/4W
1/4W
1/4W
– 127 –
RM-862
KP-41PX1/41PX1K/41PX1R
The components identified by shading
and mark ¡ are critical for safety.
Replace only with part number specified.
REF.NO. PART NO.
K
RM-892
RM-892
E
DESCRIPTION
REMARK
R871
R872
1-249-417-11 CARBON
1-249-425-11 CARBON
1K
4.7K
5%
5%
1/4W
1/4W
R873
R874
R875
R877
R878
1-247-807-31
1-249-435-11
1-249-441-11
1-249-422-11
1-215-469-00
CARBON
CARBON
CARBON
CARBON
METAL
100
33K
100K
2.7K
100K
5%
5%
5%
5%
1%
1/4W
1/4W
1/4W
1/4W
1/4W
R879
R881
R882
R883
R884
1-215-445-00
1-249-408-11
1-249-429-11
1-249-429-11
1-215-445-00
METAL
CARBON
CARBON
CARBON
METAL
10K
180
10K
10K
10K
1%
5%
5%
5%
1%
1/4W
1/4W
1/4W
1/4W
1/4W
R885
R886
R887
R888
R889
1-249-441-11
1-249-428-11
1-247-807-31
1-247-807-31
1-249-439-11
CARBON
CARBON
CARBON
CARBON
CARBON
100K
8.2K
100
100
68K
5%
5%
5%
5%
5%
1/4W
1/4W
1/4W
1/4W
1/4W
R890
R891
R892
R893
R894
1-249-441-11
1-247-843-11
1-249-425-11
1-249-421-11
1-215-455-00
CARBON
CARBON
CARBON
CARBON
METAL
100K
3.3K
4.7K
2.2K
27K
5%
5%
5%
5%
1%
1/4W
1/4W
1/4W
1/4W
1/4W
R895
R896
R897
R898
R900
1-249-421-11
1-249-441-11
1-247-807-31
1-249-409-11
1-216-474-11
CARBON
CARBON
CARBON
CARBON
METAL OXIDE
2.2K
100K
100
220
82
5%
5%
5%
5%
5%
1/4W
1/4W
1/4W
1/4W
3W
R901
R902
R903
R904
R905
1-215-449-00
1-215-449-00
1-215-421-00
1-214-800-11
1-214-800-11
METAL
METAL
METAL
METAL
METAL
15K
15K
1K
2.2
2.2
1%
1%
1%
1%
1%
1/4W
1/4W
1/4W
1/2W
1/2W
R906
R908
R909
R910
R911
1-214-800-11
1-215-445-00
1-215-421-00
1-215-421-00
1-215-461-00
METAL
METAL
METAL
METAL
METAL
2.2
10K
1K
1K
47K
1%
1%
1%
1%
1%
1/2W
1/4W
1/4W
1/4W
1/4W
R912
R913
R914
R915
R916
1-215-445-00
1-215-455-00
1-215-455-00
1-215-455-00
1-215-455-00
METAL
METAL
METAL
METAL
METAL
10K
27K
27K
27K
27K
1%
1%
1%
1%
1%
1/4W
1/4W
1/4W
1/4W
1/4W
R917
R918
R919
R920
R921
1-215-455-00
1-215-455-00
1-249-435-11
1-214-800-11
1-249-429-11
METAL
METAL
CARBON
METAL
CARBON
27K
27K
33K
2.2
10K
1%
1%
5%
1%
5%
1/4W
1/4W
1/4W
1/2W
1/4W
R922
R923
R924
R925
R926
1-215-445-00
1-249-425-11
1-215-445-00
1-249-425-11
1-249-408-11
METAL
CARBON
METAL
CARBON
CARBON
10K
4.7K
10K
4.7K
180
1%
5%
1%
5%
5%
1/4W
1/4W
1/4W
1/4W
1/4W
R927
R928
R929
R930
1-249-429-11
1-249-429-11
1-214-800-11
1-214-800-11
CARBON
CARBON
METAL
METAL
10K
10K
2.2
2.2
5%
5%
1%
1%
1/4W
1/4W
1/2W
1/2W
REF.NO. PART NO.
DESCRIPTION
REMARK
R931
1-215-445-00 METAL
10K
1%
1/4W
R933
R934
R935
R936
R937
1-215-445-00
1-249-422-11
1-249-429-11
1-249-429-11
1-249-436-11
METAL
CARBON
CARBON
CARBON
CARBON
10K
2.7K
10K
10K
39K
1%
5%
5%
5%
5%
1/4W
1/4W
1/4W
1/4W
1/4W
R938
R939
R940
R941
R942
1-215-421-00
1-259-878-11
1-249-441-11
1-249-441-11
1-249-421-11
METAL
CARBON
CARBON
CARBON
CARBON
1K
1.5M
100K
100K
2.2K
1%
5%
5%
5%
5%
1/4W
1/4W
1/4W
1/4W
1/4W
R943
R944
R945
R946
R947
1-249-441-11
1-215-421-00
1-249-439-11
1-215-421-00
1-249-441-11
CARBON
METAL
CARBON
METAL
CARBON
100K
1K
68K
1K
100K
5%
1%
5%
1%
5%
1/4W
1/4W
1/4W
1/4W
1/4W
R948
R949
R950
R951
R952
1-249-409-11
1-247-807-31
1-247-807-31
1-247-807-31
1-247-807-31
CARBON
CARBON
CARBON
CARBON
CARBON
220
100
100
100
100
5%
5%
5%
5%
5%
1/4W
1/4W
1/4W
1/4W
1/4W
R953
R954
R955
R956
R957
1-249-435-11
1-215-433-00
1-215-433-00
1-249-429-11
1-214-800-11
CARBON
METAL
METAL
CARBON
METAL
33K
3.3K
3.3K
10K
2.2
5%
1%
1%
5%
1%
1/4W
1/4W
1/4W
1/4W
1/2W
R958
R959
R961
R962
R963
1-214-800-11
1-215-433-00
1-249-425-11
1-214-800-11
1-214-800-11
METAL
METAL
CARBON
METAL
METAL
2.2
3.3K
4.7K
2.2
2.2
1%
1%
5%
1%
1%
1/2W
1/4W
1/4W
1/2W
1/2W
R964
R965
R966
R967
R968
1-215-433-00
1-215-433-00
1-249-409-11
1-215-455-00
1-215-455-00
METAL
METAL
CARBON
METAL
METAL
3.3K
3.3K
220
27K
27K
1%
1%
5%
1%
1%
1/4W
1/4W
1/4W
1/4W
1/4W
R969
R970
R971
R972
R973
1-215-455-00
1-215-455-00
1-215-455-00
1-215-455-00
1-214-800-11
METAL
METAL
METAL
METAL
METAL
27K
27K
27K
27K
2.2
1%
1%
1%
1%
1%
1/4W
1/4W
1/4W
1/4W
1/2W
R974
R975
R976
R978
R979
1-215-455-00
1-214-800-11
1-215-433-00
1-215-443-00
1-249-425-11
METAL
METAL
METAL
METAL
CARBON
27K
2.2
3.3K
8.2K
4.7K
1%
1%
1%
1%
5%
1/4W
1/2W
1/4W
1/4W
1/4W
R980
R981
R982
R983
R984
1-249-409-11
1-249-409-11
1-215-469-00
1-249-409-11
1-215-445-00
CARBON
CARBON
METAL
CARBON
METAL
220
220
100K
220
10K
5%
5%
1%
5%
1%
1/4W
1/4W
1/4W
1/4W
1/4W
R985
R986
R987
R988
R989
1-249-429-11
1-215-449-00
1-249-408-11
1-249-429-11
1-249-425-11
CARBON
METAL
CARBON
CARBON
CARBON
10K
15K
180
10K
4.7K
5%
1%
5%
5%
5%
1/4W
1/4W
1/4W
1/4W
1/4W
– 128 –
RM-862
KP-41PX1/41PX1K/41PX1R
The components identified by shading
and mark ¡ are critical for safety.
Replace only with part number specified.
REF.NO. PART NO.
K
RM-892
DESCRIPTION
REMARK
1-249-431-11
1-249-429-11
1-249-425-11
1-216-474-11
1-215-445-00
CARBON
CARBON
CARBON
METAL OXIDE
METAL
15K
10K
4.7K
82
10K
5%
5%
5%
5%
1%
1/4W
1/4W
1/4W
3W
1/4W
R998
R999
R1901
R1904
1-249-425-11
1-249-425-11
1-249-439-11
1-249-425-11
CARBON
CARBON
CARBON
CARBON
4.7K
4.7K
68K
4.7K
5%
5%
5%
5%
1/4W
1/4W
1/4W
1/4W
REF.NO. PART NO.
DESCRIPTION
REMARK
R3002
R3003
R3004
R3006
1-216-073-91
1-216-041-00
1-216-033-00
1-216-065-91
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
10K
470
220
4.7K
5%
5%
5%
5%
1/10W
1/10W
1/10W
1/10W
R3007
R3010
1-216-059-00 RES-CHIP
1-216-045-00 RES-CHIP
2.7K
680
5%
5%
1/10W
1/10W
<SWITCH>
1-519-422-11 GAP, SPARK
S3001
S3002
S3003
S3004
S3005
<TRANSFORMER>
S3006 0 1-571-433-21 SWITCH, PUSH (POWER)
*******************************************************************************
<SPARK GAP>
T501
T502
T504
1-437-195-11 TRANSFORMER, HORIZONTAL DRIVE
0 1-431-211-11 TRANSFORMER, FERRITE (PMT)
0 1-453-331-21 TRANSFORMER ASSY, FLYBACK
( NX-4010//M3P4)
*******************************************************************************
1-692-431-21
1-692-431-21
1-692-431-21
1-692-431-21
1-692-431-21
SWITCH, TACTIL (PROG –)
SWITCH, TACTIL (PROG +)
SWITCH, TACTIL (VOL +)
SWITCH, TACTIL (VOL –)
SWITCH, TACTIL (TV/VIDEO)
* A-1646-238-AH2 BOARD, COMPLETE
*****************************
<CAPACITOR>
* A-1646-237-AH1 BOARD, COMPLETE
*****************************
C3204
C3205
C3214
C3217
1-163-037-11
1-163-037-11
1-163-017-00
1-163-017-00
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
0.022µF
0.022µF
0.0047µF
0.0047µF
10%
10%
10%
10%
<CAPACITOR>
C3001
C3002
C3004
C3005
1-163-021-91
1-102-074-00
1-126-933-11
1-163-275-11
CERAMIC CHIP
CERAMIC
ELECT
CERAMIC CHIP
0.01µF
0.001µF
100µF
0.001µF
10%
10%
20%
5%
50V
50V
16V
50V
<CONNECTOR>
CN3201 * 1-564-518-11
CN3202 * 1-564-526-31
CN3204 * 1-564-520-11
CN3213 1-694-564-11
PLUG, CONNECTOR 3P
PLUG, CONNECTOR 11P
PLUG, CONNECTOR 5P
TERMINAL BLOCK, S (AV4 IN)
<CONNECTOR>
CN3001 * 1-564-525-11
CN3002 * 1-564-518-11
CN3003 * 1-580-690-11
CN3004 * 1-691-292-11
<DIODE>
PLUG, CONNECTOR 10P
PLUG, CONNECTOR 3P
PIN, CONNECTOR (PC BOARD) 4P
PIN, CONNECTOR (PC BOARD) 3P
D3215
D3216
<DIODE>
D3001
D3003
D3008
8-719-109-97 DIODE RD6.8ES-B2
8-719-109-97 DIODE RD6.8ES-B2
<JACK>
J3202
8-719-109-89 DIODE RD5.6ESB2
8-719-109-89 DIODE RD5.6ESB2
8-719-302-45 DIODE SEL1210S-D (STANDBY)
1-507-806-00 JACK 1P (HEAD PHONE)
<CHIP CONDUCTOR>
JR3201
JR3202
JR3203
JR3204
<IC>
IC3002
8-742-180-30 HYB IC SBX3081-51(30)
1-216-864-11
1-216-864-11
1-216-864-11
1-216-864-11
SHORT
SHORT
SHORT
SHORT
0
0
0
0
<TRANSISTOR>
<COIL>
Q3002
8-729-120-28 TRANSISTOR 2SC1623-L5L6
L3201
L3202
L3203
<RESISTOR>
R3001
RM-862
E H1 H2
R990
R991
R993
R994
R997
SG501
RM-892
1-216-081-00 RES-CHIP
22K
5%
1/10W
– 129 –
1-408-615-31 INDUCTOR
1-408-615-31 INDUCTOR
1-408-399-00 INDUCTOR
100µH
100µH
1.5µH
50V
50V
50V
50V
KP-41PX1/41PX1K/41PX1R
The components identified by shading
and mark ¡ are critical for safety.
Replace only with part number specified.
REF.NO. PART NO.
K
DESCRIPTION
RM-862
REMARK
REF.NO. PART NO.
DESCRIPTION
REMARK
R4915
1-216-043-91 RES-CHIP
560
5%
1/10W
*******************************************************************************
R3207
R3209
R3210
R3211
R3212
1-208-785-11
1-216-033-00
1-216-033-00
1-216-033-00
1-216-033-00
R3214
R3212
1-216-025-11 RES-CHIP
1-216-025-11 RES-CHIP
METAL CHIP
RES-CHIP
RES-CHIP
RES-CHIP
RES-CHIP
1.3K
220
220
220
220
0.5%
5%
5%
5%
5%
1/10W
1/10W
1/10W
1/10W
1/10W
100
100
5%
5%
1/10W
1/10W
<SWITCH>
S3205
1-692-431-21 SWITCH, TACTIL (AUTO CONVER)
S3206
1-692-431-21 SWITCH, TACTIL (AUTO TUNE)
*******************************************************************************
* A-1648-033-AU BOARD, COMPLETE (41PX1/41PX1K)
****************************
* A-1648-034-A UE BOARD, COMPLETE (41PXIR)
*****************************
<CAPACITOR>
C2701
C2702
C2703
C2704
C2705
1-163-133-00
1-164-232-11
1-163-133-00
1-164-232-11
1-126-934-11
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
ELECT
470pF
0.01µF
470pF
0.01µF
220µF
5%
10%
5%
10%
20%
50V
50V
50V
50V
16V
C2706
C2707
C2708
C2709
C2710
1-126-964-11
1-126-964-11
1-126-947-11
1-126-964-11
1-126-947-11
ELECT
ELECT
ELECT
ELECT
ELECT
10µF
10µF
47µF
10µF
47µF
20%
20%
20%
20%
20%
50V
50V
16V
50V
16V
<CAPACITOR>
1-163-021-91
1-163-133-00
1-163-021-91
1-163-133-00
RM-892
H2 U UE
<RESISTOR>
C4901
C4902
C4903
C4904
RM-892
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
CERAMIC CHIP
<CONNECTOR>
0.01µF
470pF
0.01µF
470pF
10%
5%
10%
5%
50V
50V
50V
50V
CN2701 * 1-564-522-11 PLUG, CONNECTOR 7P
CN2702 * 1-564-523-11 PLUG, CONNECTOR 8P
CN2703 1-695-549-11 SOCKET, PIN 21P
<DIODE>
<CONNECTOR>
CN4901 * 1-564-522-11 PLUG, CONNECTOR 7P
CN4902 * 1-564-523-11 PLUG, CONNECTOR 8P
D2701
D2702
D2703
D2704
D2705
8-719-069-60
8-719-069-60
8-719-069-60
8-719-069-60
8-719-069-60
DIODE UDZSTE-179.1B
DIODE UDZSTE-179.1B
DIODE UDZSTE-179.1B
DIODE UDZSTE-179.1B
DIODE UDZSTE-179.1B
D2706
D2707
D2708
8-719-069-60 DIODE UDZSTE-179.1B
8-719-069-60 DIODE UDZSTE-179.1B
8-719-069-60 DIODE UDZSTE-179.1B
<DIODE>
D4906
D4907
D4908
8-719-069-60 DIODE UDZSTE-179.1B
8-719-069-60 DIODE UDZSTE-179.1B
8-719-069-60 DIODE UDZSTE-179.1B
<RESISTOR>
<JACK>
J4901
1-695-549-11 SOCKET, PIN 21P (AV3 IN/OUT)
<COIL>
L4900
L4901
L4902
L4903
1-412-002-31
1-412-002-31
1-412-002-31
1-412-002-31
INDUCTOR
INDUCTOR
INDUCTOR
INDUCTOR
4.7µH
4.7µH
4.7µH
4.7µH
<RESISTOR>
R4901
R4903
R4907
R4910
R4912
1-216-043-91
1-216-043-91
1-216-043-91
1-216-295-91
1-216-295-91
RES-CHIP
RES-CHIP
RES-CHIP
SHORT
SHORT
R4913
1-216-295-91 SHORT
560
560
560
0
0
5%
5%
5%
1/10W
1/10W
1/10W
R2702
R2703
R2704
R2705
R2706
1-216-022-00
1-216-033-00
1-216-039-00
1-216-039-00
1-216-024-00
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
75
220
390
390
91
5%
5%
5%
5%
5%
1/10W
1/10W
1/10W
1/10W
1/10W
R2707
R2709
R2710
R2711
R2712
1-216-023-00
1-216-113-00
1-216-089-00
1-216-113-00
1-216-089-00
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
RES,CHIP
82
470K
47K
470K
47K
5%
5%
5%
5%
5%
1/10W
1/10W
1/10W
1/10W
1/10W
R2715 1-216-025-11 RES,CHIP
100
5%
1/10W
R2716 1-216-295-91 SHORT
0
R2717 1-216-025-11 RES,CHIP
100
5%
1/10W
R2718 1-216-295-91 SHORT
0
*******************************************************************************
0
– 130 –
KP-41PX1/41PX1K/41PX1R
The components identified by shading
and mark ¡ are critical for safety.
Replace only with part number specified.
REF.NO. PART NO.
DESCRIPTION
K
RM-892
RM-892
RM-862
ZG ZR
REMARK
* A-1652-078-AZG BOARD, COMPLETE
*****************************
4-382-854-11 SCREW (M3X10), P, SW (+)
REF.NO. PART NO.
DESCRIPTION
REMARK
Q1434
Q1435
8-729-423-33 TRANSISTOR 2SC3311A-QRSTA
8-729-423-33 TRANSISTOR 2SC3311A-QRSTA
Q1436
Q1437
Q1438
8-729-423-33 TRANSISTOR 2SC3311A-QRSTA
8-729-423-33 TRANSISTOR 2SC3311A-QRSTA
8-729-119-76 TRANSISTOR 2SA1175-HFE
<CAPACITOR>
C1431
C1432
C1433
C1434
C1435
1-102-508-91
1-126-935-11
1-107-364-11
1-107-364-11
1-107-667-11
CERAMIC
ELECT
MYLAR
MYLAR
ELECT
10pF
470µF
0.01µF
0.01µF
2.2µF
0.5pF
20%
10%
10%
20%
50V
16V
200V
200V
160V
C1436
C1437
C1438
C1439
C1440
1-130-471-00
1-130-471-00
1-107-364-11
1-161-830-00
1-104-664-11
MYLAR
MYLAR
MYLAR
CERAMIC
ELECT
0.001µF
0.001µF
0.01µF
0.0047µF
47µF
5%
5%
10%
20%
50V
50V
200V
500V
25V
C1441
C1443
C1444
C1445
C1446
1-137-380-11
1-126-935-11
1-107-648-91
1-126-935-11
1-126-935-11
MYLAR
ELECT
ELECT
ELECT
ELECT
0.47µF
470µF
100µF
470µF
470µF
5%
20%
20%
20%
20%
50V
16V
160V
16V
16V
<RESISTOR>
R1431
R1432
R1433
R1434
R1435
1-249-414-11
1-249-414-11
1-249-377-11
1-215-916-00
1-216-475-11
CARBON
CARBON
CARBON
METAL OXIDE
METAL OXIDE
560
560
0.47
680
120
5%
5%
5%
5%
5%
1/4W
1/4W
1/4W
3W
3W
R1436
R1437
R1438
R1439
R1440
1-216-475-11
1-249-415-11
1-215-451-00
1-215-451-00
1-249-415-11
METAL OXIDE
CARBON
METAL
METAL
CARBON
120
680
18K
18K
680
5%
5%
1%
1%
5%
3W
1/4W
1/4W
1/4W
1/4W
R1442
R1443
R1444
R1445
R1446
1-247-807-31
1-249-377-11
1-247-807-31
1-125-417-00
1-249-401-11
CARBON
CARBON
CARBON
CARBON
CARBON
100
0.47
100
680
47
5%
5%
5%
5%
5%
1/4W
1/4W
1/4W
1/4W
1/4W
R1447
R1448
R1449
R1450
R1451
1-249-401-11
1-249-417-11
1-215-389-00
1-249-425-11
1-249-409-11
CARBON
CARBON
METAL
CARBON
CARBON
47
1K
47
4.7K
220
5%
5%
1%
5%
5%
1/4W
1/4W
1/4W
1/4W
1/4W
R1452
R1454
R1455
R1457
R1458
1-249-413-11
1-260-310-51
1-249-383-11
1-249-417-11
1-249-383-11
CARBON
CARBON
CARBON
CARBON
CARBON
470
33
1.5
1K
1.5
5%
5%
5%
5%
5%
1/4W
1/2W
1/4W
1/4W
1/4W
R1459
R1460
R1461
R1462
R1463
1-249-399-11
1-215-916-00
1-249-414-11
1-249-414-11
1-249-429-11
CARBON
METAL OXIDE
CARBON
CARBON
CARBON
33
680
560
560
10K
5%
5%
5%
5%
5%
1/4W
3W
1/4W
1/4W
1/4W
<CONNECTOR>
CN1431 * 1-564-508-11
CN1432 * 1-564-510-11
CN1433 * 1-564-507-11
CN1434 * 1-580-689-11
CN1461 * 1-564-506-11
PLUG, CONNECTOR 5P
PLUG, CONNECTOR 7P
PLUG, CONNECTOR 4P
PIN, CONNECTOR (PC BOARD) 4P
PLUG, CONNECTOR 3P
CN1462 * 1-564-507-11 PLUG, CONNECTOR 4P
CN1463 1-564-505-31 PLUG, CONNECTOR 2P
CN1464 * 1-564-507-11 PLUG, CONNECTOR 4P
<DIODE>
D1431
D1432
D1433
D1434
D1435
8-719-924-11
8-719-924-11
8-719-991-33
8-719-991-33
8-719-991-33
DIODE MTZJ-T-77-22
DIODE MTZJ-T-77-22
DIODE 1SS133T-77
DIODE 1SS133T-77
DIODE 1SS133T-77
D1436
D1437
8-719-991-33 DIODE 1SS133T-77
8-719-991-33 DIODE 1SS133T-77
R1465
1-216-475-11 METAL OXIDE 120
5%
3W
R1468
1-216-475-11 METAL OXIDE 120
5%
3W
*******************************************************************************
* A-1652-079-AZR BOARD, COMPLETE
*****************************
<CONNECTOR>
DY143101-451-517-31 DEFLECTION YOKE (G)
<CONNECTOR>
<COIL>
L1431
1-410-478-11 INDUCTOR
47µH
CN1401 * 1-564-510-11
CN1403 * 1-564-506-11
CN1404 * 1-564-507-11
CN1405 * 1-580-689-11
PLUG, CONNECTOR 7P
PLUG, CONNECTOR 3P
PLUG, CONNECTOR 4P
PIN, CONNECTOR (PC BOARD) 4P
<TRANSISTOR>
<CONNECTOR>
Q1431
Q1432
Q1433
8-729-044-61 TRANSISTOR 2SC4793 (LBS2SONY)
8-729-044-59 TRANSISTOR 2SA1837 (LBS2SONY)
8-729-119-76 TRANSISTOR 2SA1175-HFE
DY140101-451-517-31 DEFLECTION YOKE (R)
– 131 –
KP-41PX1/41PX1K/41PX1R
The components identified by shading
and mark ¡ are critical for safety.
Replace only with part number specified.
REF.NO. PART NO.
DESCRIPTION
K
REMARK
REF.NO. PART NO.
R1401
1-249-414-11 CARBON
560
5%
1/4W
R1402
1-249-414-11 CARBON
560
5%
1/4W
R1403
1-215-916-00 METAL OXIDE 680
5%
3W
R1415
1-216-475-11 METAL OXIDE 120
5%
3W
R1418
1-216-475-11 METAL OXIDE 120
5%
3W
*******************************************************************************
MISCELLANEOUS
**********************
0 1-223-925-71 RESISTOR ASSY (HIGH-VOLTAGE)
(FOCUS PACK)
0 1-451-517-21 DEFLECTION YOKE
0 1-451-517-31 DEFLECTION YOKE
0 1-452-790-31 NECK ASSY
0 1-452-790-41 NECK ASSY
SPEAKER (10.6 CM)
BATTERY, SOLAR
CORE ASSY, BEAD (DIVISION TYPE)
CORD, POWER
BLOCK ASSY, HIGH-VOLTAGE
0 A-1501-213-AMECHASEAL ASSY (R), SLANT
0 A-1501-214-AMECHASEAL ASSY (G), SLANT
0 A-1501-215-AMECHASEAL ASSY (B), SLANT
*******************************************************************************
ACCESSORIES & PACKING MATERIALS
*************************************************
* 4-029-168-01
* 4-030-895-01
* 4-041-423-11
* 4-065-646-01
* 4-065-730-01
RM-892
ZR
<RESISTOR>
1-505-426-11
1-528-864-12
1-543-653-21
0 1-765-286-11
0 8-598-955-13
RM-892
BAG, PROTECTION
JOINT
SHEET, PROTECTION
CUSHION (UPPER) (ASSY)
TRAY
* 4-072-998-01 INDIVIDUAL CARTON
* 4-206-026-01 CUSHION, LOWER
4-026-027-11 MANUAL, INSTRUCTION (41PX1)
4-026-027-21 MANUAL, INSTRUCTION (41PX1R)
4-026-027-31 MANUAL, INSTRUCTION (41PX1K)
*******************************************************************************
REMOTE COMMANDER
*****************************
1-418-572-11 REMOTE COMMANDER (RM-892)
1-473-692-11 REMOTE COMMANDER (RM-862)
– 132 –
DESCRIPTION
REMARK
RM-862
KP-41PX1/41PX1K/41PX1R
K
Sony Corporation
9-965-429-01
HNC. HVC. Projection Display Business Div
– 133 –
RM-892
RM-892
RM-862
English
2001FA71-1
© 2001. 6
Was this manual useful for you? yes no
Thank you for your participation!

* Your assessment is very important for improving the work of artificial intelligence, which forms the content of this project

Download PDF

advertising