SERVICE MANUAL
0073
HHAW
RAK-18PSPA/RAC-18WSPA
RAK-25PSPA/RAC-25WSPA
RAK-35PSPA/RAC-35WSPA
SERVICE MANUAL
TECHNICAL INFORMATION
REFER TO THE FOUNDATION MANUAL
FOR SERVICE PERSONNEL ONLY
CONTENTS
INDOOR UNIT
SPECIFICATIONS ------------------------------------------------------------------- 6
HOW TO USE ---------------------------------------------------------------------- 8
CONSTRUCTION AND DIMENSIONAL DIAGRAM --------------------- 27
MAIN PARTS COMPONENT --------------------------------------------------- 29
WIRING DIAGRAM ---------------------------------------------------------------- 31
OUTDOOR UNIT
RAK-18PSPA
RAK-25PSPA
RAK-35PSPA
CIRCUIT DIAGRAM --------------------------------------------------------------- 33
BLOCK DIAGRAM ----------------------------------------------------------------- 35
BASIC MODE ----------------------------------------------------------------------- 36
REFRIGERATING CYCLE DIAGRAM --------------------------------------- 46
Procedure for Disassembly and Reassembly -------------------------------------- 47
DESCRIPTION OF MAIN CIRCUIT OPERATION ----------------------- 49
SERVICE CALL Q & A ---------------------------------------------------------- 66
TROUBLE SHOOTING ----------------------------------------------------------- 69
RAC-18WSPA
RAC-25WSPA
RAC-35WSPA
PARTS LIST AND DIAGRAM --------------------------------------------------97
SPECIFICATIONS
DC INVERTER
TYPE
MODEL
INDOOR UNIT
OUTDOOR UNIT
INDOOR UNIT
OUTDOOR UNIT
INDOOR UNIT
OUTDOOR UNIT
RAK-18PSPA
RAC-18WSPA
RAK-25PSPA
RAC-25WSPA
RAK-35PSPA
RAC-35WSPA
POWER SOURCE
1 PHASE,50HZ,220-230V
TOTAL INPUT (W
COOLING
300 ( 70
TOTAL AMPERES (A)
CAPACITY
DIMENSIONS
(mm)
NET WEIGHT
845 (70 1350)
2.70-2.60
4.30-4.20
(KW)
1.80 (0.50 2.80)
2.50 (0.50 3.40)
3.50 (0.50 4.10)
(B.T.U./h)
6,120 (1,700 9,520)
8,500 (1,700 11,560)
11,900 (1,700 13,940)
375 (65 1,620)
585 (65 2,250)
830 (65 2,4500)
2.10-2.00
3.10-3.00
4.30-4.10
TOTAL AMPERES (A)
CAPACITY
1 PHASE,50HZ,220-230V
490(70 960)
1.70-1.70
TOTAL INPUT (W
HEATING
1 PHASE,50HZ,220-230V
880)
(KW)
2.30 (0.60 4.80)
3.20 (0.60 5.80)
4.00 (0.60 6.60)
(B.T.U./h)
7,820 (2,040 16,320)
10,880 (2,040 19,720)
13,600 (2,040 22,440)
W
780
792
780
792
780
792
H
280
600
280
600
280
600
D
218
299
218
299
218
299
(Kg)
8.0
44
8.0
44
8.0
44
After installation
SPECIFICATIONS AND PARTS ARE SUBJECT TO CHANGE FOR IMPROVEMENT
ROOM AIR CONDITIONER
INDOOR UNIT + OUTDOOR UNIT
JULY 2013
Hitachi Household Appliances(Wuhu) Co., Ltd.
RAS_AW_000covere
! "
%
%
#
!
# $
& '
( )
* '
'
%++,-.
/ '
+ "
)
.
DANGER
WORKING STANDARDS FOR PREVENTING BREAKAGE OF SEMICONDUCTORS
1. Scope
The standards provide for items to be generally observed in carrying and handling semiconductors in
relative manufactures during maintenance and handling thereof. (They apply the same to handling of
abnormal goods such as rejected goods being returned.)
2. Object parts
(1) Microcomputer
(2) Integrated circuits (I.C.)
(3) Field effective transistor (F.E.T.)
(4) P.C. boards or the like to which the parts mentioned in (1) and (2) of this paragraph are equipped.
3. Items to be observed in handling
(1) Use a conductive container for carrying and storing of parts. (Even rejected goods should be handled in
the same way.)
IC
A conductive polyvinyl bag
IC
CH I
IC40
1TH1
,188
Conductive sponge
UV
HITA
Fig. 1 Conductive container
(2) When any part is handled uncovered (in counting, packing and the like), the handling person must
always use himself as a body earth. (Make yourself a body earth by passing one M ohm earth
resistance through a ring or bracelet.)
(3) Be careful not to touch the parts with your clothing when you hold a part even if a body earth is
being taken.
(4) Be sure to place a part on a metal plate with grounding.
(5) Be careful not to fail to turn off power when you repair the printed circuit board.
At the same time,
try to repair the printed circuit board on a grounded metal plate.
Body earth (Elimik conductive band)
Clip for connection with
a grounding wire
1MΩ
Fig. 2 Body earth
(6) Use a three wire type soldering iron including a grounding wire.
Metal plate (of Al. stainless steel, etc.)
Bare copper wire (for body earth)
Working table
Resistor 1MΩ(1/2W)
Staple
Earth wire
Fig.3 Grounding of the working table
soldering iron
Grounding wire
Screw stop at the screwed
part using a rag plate
Fig.4 Grounding a solder iron
Use a high insulation mode (100V, 10MΩ or higher) when ordinary iron is to be used.
(7) In checking circuits for maintenance, inspection, or some others, be careful not to have the test probes
of the measuring instrument short circuit a load circuit or the like.
! CAUTION
1.
In quiet operation or stopping the running, slight flowing noise of refrigerant in the refrigerating cycle is
heard occasionally, but this noise is not abnormal for the operation.
2.
When it thunders near by, it is recommend to stop the operation and to disconnect the power cord plug from
the power outlet for safety.
3.
The room air conditioner does not start automatically after recovery of the electric power failure for preventing fuse blowing. Re-press START/STOP button after 3 minutes from when unit stopped.
4.
If the room air conditioner is stopped by adjusting thermostat, or missoperation, and re-start in a moment,
there is occasion that the cooling and heating operation does not start for 3 minutes, it is not abnormal and
this is the result of the operation of IC delay circuit. This IC delay circuit ensures that there is no danger of
blowing fuse or damaging parts even if operation is restarted accidentally.
5.
This room air conditioner should not be used at the cooling operation when the outside temperature is
below -10°C (14°F).
6.
This room air conditioner (the reverse cycle) should not be used when the outside temperature is below
–20°C (-4°F).
If the reverse cycle is used under this condition, the outside heat exchanger is frosted and efficiency falls.
7.
When the outside heat exchanger is frosted, the frost is melted by operating the hot gas system, it is not
trouble that at this time fan stops and the vapour may rise from the outside heat exchanger.
SPECIFICATIONS
RAK-18PSPA
RAK-25PSPA
RAK-35PSPA
MODEL
25W (DC35V)
FAN MOTOR
RAC-25WSPA
RAC-35WSPA
RAC-18WSPA
47W (DC120~380V)
FAN MOTOR CAPACITOR
NO
NO
FAN MOTOR PROTECTOR
NO
NO
–
COMPRESSOR
EU125XB2
COMPRESSOR MOTOR CAPACITOR
NO
NO
OVERLOAD PROTECTOR
NO
YES
OVERHEAT PROTECTOR
NO
YES
FUSE (for MICROPROCESSOR)
NO
3.15A
POWER RELAY
NO
G4A-1A
POWER SWITCH
NO
NO
TEMPORARY SWITCH
YES
NO
SERVICE SWITCH
NO
YES
TRANSFORMER
NO
NO
VARISTOR
NO
450NR
NOISE SUPPRESSOR
NO
NO
YES(IC)
NO
YES
NO
THERMOSTAT
REMOTE CONTROL SWITCH (LIQUID
CRYSTAL)
REFRIGERANT CHARGING
VOLUME
(Refrigerant 410A)
UNIT
----------
PIPES
(MAX. 20m)
WITHOUT REFRIGERANT BECAUSE
COUPLING IS FLARE TYPE.
(MIN. 5m)
RAS_AW_001-014en
1330g
1350g
Figure showing the installation of lndoor and Outdoor unit
MODEL RAK-18PSPA/RAC-18WSPA
RAK-25PSPA/RAC-25WSPA
RAK-35PSPA/RAC-35WSPA
above
50mm
above 50mm
about 0.45m
must not bend
2,300 mm or more
Plug
plug(Procure locally)
Maximum pipe length 20m
Minimum pipe length 5m
about 300mm
Be sure to
completely
seal any gap
with putty.
above 50mm
The indoor piping should be
insulated with the enclosed
insulation pipe. (If the insulator is
insufficient, please use commercial
products.)
above 200mm
above 50 mm when
installed on the
ceiling of balcony
above 50mm
give clearance
as wide as
possible
above
200mm
above 100mm
s The refrigerating machine oil is
easily affected by moisture. Use
caution to prevent water from
entering the cycle.
s The difference in height between
the indoor and outdoor unit
should be kept below 10m.
s The connecting pipe, no matter
big or small, should all be
insulated with insulation pipe and
then wrapped with vinyl tape.
(The insulator will deteriorate if
it is not wrapped with tape).
The connection of insulated drain
hose.
Inner diameter 16mm
above 200mm
Please use insulated drain hose for
the indoor piping (commercial
product)
WARNING
CAUTION
WARNING
PROHIBITION
“OFF”
PROHIBITION
PROHIBITION
PROHIBITION
PROHIBITION
– 2 –
Do not put objects like thin rods into the panel of blower and suction side
because the high-speed fan inside may cause danger.
Do not bundle the power cable, pull it, put something on it, heat it, process it, or
put it between things. Breakage of the power cable may result.
Use of a damaged cable may cause an electrical shock or a fire.
Do not connect the power calbe with an extension cable or do not plug too many
leads of the other electric appliance into the socket where this cable is plugged.
In addition, wire the cable with some allowances to prevent the cable from stretching.
Not doing so will cause an electrical shock, heat generation or fire.
Avoid an extended period of direct air flow for your health.
Please contact your agent if you need to remove and reinstall the unit.
Electric shock or fire may occur if you remove and reinstall the unit yourself improperly.
Please contact your agent for maintenance.
Improper self maintenance may cause electric shock and fire.
Should abnormal situation arise (like burning smell), please stop operating the
unit and remove plug from the socket or turn off the circuit breaker. Contact your
agent. Fault, short circuit or fire may occur if you continue to operate the unit
under abnormal situation.
PRECAUTIONS DURING SHIFTING OR MAINTENANCE
Please use earth line.
Do not place the earth line near water or gas pipes, lightning-conductor, or the
earth line of telephone. Improper installation of earth line may cause electric CONNECT EARTH LINE
shock.
Be sure to use the specified piping set for R410A. Otherwise, this may result in
broken copper pipes or faults.
A circuit breaker should be installed depending on the mounting site of the unit.
Without a circuit breaker, the danger of electric shock exists.
Do not install the unit near a location where there is flammable gas.
The outdoor unit may catch fire if flammable gas leaks around it. Piping shall be
PROHIBITION
suitable supported with a maximum spacing of 1m between the supports.
Please ensure smooth flow of water when installing the drain hose. If any failure
is found in the drain path, water drops from the indoor and outdoor units, causing
wet household effects.
Make sure that a single phase 230V power source is used.
The use of other power sources may cause electrical components to overheat
PROHIBITION
and lead to fire.
Please ask your sales agent or qualified technician for the installation of your unit.
Water leakage, short circuit or fire may occur if you install the unit by yourself.
Do not reconstruct the unit.
Water leakage, fault, short circuit or fire may occur if you reconstruct the unit by
yourself.
PRECAUTIONS DURING INSTALLATION
Please keep this manual after reading.
Indicates the instructions that must be followed.
Please read the “Safety Precaution” carefully before operating the unit to ensure correct usage of the unit.
Warning” and “ Caution”. The “Warning” section contains
Pay special attention to signs of “
matters which, if not observed strictly, may cause death or serious injury. The “Caution” section
contains matters which may result in serious consequences if not observed properly. Please observe
all instructions strictly to ensure safety.
The signs indicate the following meanings. (The following are examples of signs.)
This sign in the figure indicates prohibition
Make sure to connect earth line.
SAFETY PRECAUTION
CAUTION
WARNING
PROHIBITION
• Do not climb on the outdoor unit or put objects on it.
PROHIBITION
– 3 –
• This appliance is not intended for use by young children or infirm persons unless they have been
adequately supervised by a responsible person to ensure that they can use this appliance safely.
• Young children should be supervised to ensure that they do not play with the appliance.
DON’T TOUCH
• Do not touch the air outlet, bottom surface and aluminum fin of the outdoor
unit.
You may get hurt.
• Do not touch the refrigerant pipe and connecting valve.
Burns may result.
DON’T TOUCH
PROHIBITION
PROHIBITION
• If the amount of heat in the room is above the cooling or heating capability of the
unit (for example: more people entering the room, using heating equipments and
etc.), the preset room temperature cannot be achieved.
• This appliance especially indoor unit cleaning must be performed by authorized
personnel only. Consult your sales agent.
Using a commercially available detergent or similar can damage the plastic parts
or clog the drain pipe, causing water to drip with potential electric shock hazard.
PROHIBITION
• When operating the unit with the door and windows opened, (the room humidity
is always above 80%) and with the air deflector facing down or moving automatically for a long period of time, water will condense on the air deflector and drips
down occasionally. This will wet your furniture. Therefore, do not operate under
such condition for a long time.
PROHIBITION
• Do not place plants or animals directly under the air flow as it is bad for the plants or
animals.
• Do not wash the unit with water or place a water container such as a
vase on the indoor unit.
Electrical leakage could be present and cause electric shock.
• Please ensure that outdoor mounting frame is always stable, firm and
without defect. If not, the outdoor unit may collapse and cause danger.
PROHIBITION
STRICTLY OBSERVE
PRECAUTIONS
• Do not direct the cool air coming out from the air-conditioner panel to
face household heating apparatus as this may affect the working of
apparatus such as the electric kettle, oven etc.
• When operating the unit with burning equipments, regularly ventilate
the room to avoid oxygen insufficiency.
PROHIBITION
PROHIBITION
PROHIBITION
• Do not attempt to operate the unit with wet hands, this could cause fatal accident.
• The product shall be operated under the manufacturer specification and not for
any other intended use.
DON’T WET
PROHIBITION
• During thunder storm, disconnect the plug top or turn off the circuit breaker.
• Spray cans and other combustibles should not be located within a meter of the air
outlets of both indoor and outdoor units.
As a spray can’s internal pressure can be increased by hot air, a rupture may result.
“OFF”
• Do not use any conductor as fuse wire, this could cause fatal accident.
PRECAUTIONS DURING OPERATION
ENGLISH
Drain port
(Bottom)
Earth terminal
(Lower section of the side)
280
600
780
792
RAC-18WSPA,RAC-25WSPA,RAC-35WSPA
– 4 –
HEIGHT (mm)
WIDTH (mm)
MODEL
RAK-18PSPA, RAK-25PSPA,RAK-35PSPA
299
218
DEPTH (mm)
About the outdoor unit:
s When “Stop” is selected during operation
of the indoor unit, the fan of the outdoor
unit continues turning for 10 to 60
seconds to cool the electric parts down.
s In heating operation, condensate or
water due to defrosting will flow.
Do not cover the drain port of the outdoor
unit because such water may freeze in
the chilly area.
Drain hose
Drains the dehumidified water from the indoor unit to the
outdoor during “cooling” or “dehumidifying” operation.
Piping and Wiring
Air inlets (Rear and left sides)
Remote controller
Send out operation signal to the indoor unit. So as
to operate the whole unit.
Horizontal deflector Vertical deflector
(Air Outlet)
Indoor unit indicators
Light indicator showing the operating condition.
(Refer page 5)
Front panel
(Refer page 7)
Air filter
To prevent dust from coming into the indoor unit.
(Refer page 6)
Air outlet
When “heating” operation is
performed, cool air blows and
when “cooling” or “dehumidifying”
operation is performed, warm air
blows.
7(0325$5<
6:,7&+
MODEL NAME AND DIMENSIONS
RAC-18WSPA
RAC-25WSPA
RAC-35WSPA
OUTDOOR UNIT
INDOOR UNIT
NAMES AND FUNCTIONS OF EACH PART
OPERATION LAMP (Yellow)
This lamp lights during operation.
The OPERATION LAMP flashes
in the following cases during
heating.
(1) During preheating
For about 2-3 minutes after
starting up.
(2) During defrosting
Defrosting will be performed
about once an hour when frost
forms on the heat exchanger
of the outdoor unit, for 5-10
minutes each time.
TEMPORARY SWITCH
Use this switch to start and stop when the remote
controller does not work.
This temporary operation will be at the most recent
setting made. (The unit will immediately go into
automatic operation once power is switched on.)
7(0325$5<
6:,7&+
– 5 –
If the power stays on and the unit is not operated, power is slightly consumed in the control circuit.
The power is saved by turning off the power switch (or the circuit breaker when the power is supplied
from the outdoor unit).
Turn off the circuit breaker or pull out
the power plug if the unit is not be
operated for a long period.
CAUTION
TIMER LAMP (Orange)
This lamp lights when the
timer is working.
INDOOR UNIT INDICATIONS
NAMES AND FUNCTIONS OF EACH PART
ENGLISH
CAUTION
Set the filter with “FRONT” mark facing front, and
slot them into the original state.
After attaching the filters, push the front panel at
three arrow portions as shown in figure and close
it.
Vacuum dust from the air filter using vacuum cleaner.
If there is too much dust, wash the filter with a detergent
and rinse it thoroughly. After that, dry it in the shade.
Open the front panel carefully and remove the filter.
– 6 –
Do not wash with hot water at more than 40°C. The filter may shrink.
When washing it, shake off moisture completely and dry it in the shade; do not expose it directly
to the sun. The filter may shrink.
Don't operate the unit without filter. Fault may occur if you continue.
3
2
1
PROCEDURE
Please clean the filter once about every two weeks. By doing so, the power rates are saved. In
case the air filter is full of dust, the air flow will decrease and the cooling capacity will be reduced.
Further, noise may occur. Be sure to clean the filter following the procedure below.
1. AIR FILTER
Cleaning and maintenance must be carried out only by qualified service personal. Before cleaning,
stop operation and switch off the power supply.
CAUTION
MAINTENANCE
Shaft
Hole
1
Shaft
Hole
s Switch off the power plug or turn off the circuit breaker.
s Run the unit by setting the operation mode to
(FAN) and the fan speed to HI for about half a day
on a fine day, and dry the whole of the unit.
Air
Blow
3. MAINTENANCE AT BEGINNING OF LONG OFF PERIOD
– 7 –
1
B E N ZIN E
A
C
I
D
T H IN NER
s Move the shafts of the left and right arms into
the steps in the unit and securely insert them
into the holes.
2
Attaching the Front Panel
s Do not splash or direct water to the body of the unit when cleaning it as
this may cause short circuit.
s Never use hot water (above 40°C), benzine, gasoline, acid, thinner or a
brush, because they will damage the plastic surface and the coating.
CAUTION
s When the front panel is fully opened with both
hands, push the right arm to the inside to
release it, and while closing the front panel
slightly, put it out forward.
2
Removing the Front Panel
Method of removing the front panel.
Be sure to hold the front panel with both hands to
detach and attach it.
s Wipe the water thoroughly.
If water remains at indicators or signal receiver of
indoor unit, it causes trouble.
s When front panel is not removed, wipe it with a soft
dry cloth. Wipe the remote controller thoroughly with
a soft dry cloth.
s Remove the front panel and wash with clean water.
Wash it with a soft sponge.
After using neutral detergent, wash thoroughly with
clean water.
2. CLEANING OF FRONT PANEL
ENGLISH
! Warning
To protect the whole unit during lightning
please stop operating the unit and turn off
the circuit breaker.
– 8 –
When lightning occurs
þPGGÿ
If the heat present in a room exceeds the unit’s cooling capacity (for example, if there are many people in
the room or other heating appliances are used), the preset room temperature may not be reached.
Cooling and Dehumidifying Capabilities
This room air conditioner utilizes a heat pump system that absorbs
CAUTION
exterior heat and brings it into a room to be heated. As the ambient
Do not use a stove
temperature gets lower, heating capability will also lower. In such a or
any
other
situation, the inverter work to increase compressor rpm to keep the h i g h t e m p e ra t u r e
unit’s heating capability from decreasing. If the unit’s heating perfor- devices in proximity
PROHIBITION
mance is still unsatisfactory, other heating appliances should be used to the indoor unit.
to augment this unit’s performance.
The air conditioner is designed to heat an entire room so that it may take some time before you feel warm.
Timer operation is recommended for effective preheating ahead of the desired time.
Heating Capability
CAPABILITIES
INFORMATION
WARNING
WARNING
WARNING
Check to see if the power plug is securely inserted
into the wall socket.
If the power plug is not inserted into the wall socket
securely or becomes hot, an electric shock or fire may result.
If dust or dirt is found on the power plug, clean the plug
and insert it into the wall socket.
Check to see if the mounting frame has rusted excessively or if the outdoor unit has tilted or become
unstable.
It could collapse or fall, causing injury.
Check to see if the unit’s earth line has been connected correctly.
If the earth line is disconnected or faulty, unit failure or
electric shock hazard may result.
When it does not cool well.
When it does not heat well.
Clicking noise
Rustling noise
Squeaking noise
Hissing or fizzy sounds
During heating, the operation
indicator blinks and air blow stops
– 9 –
<Operation start>
The unit is preparing to blow warm air. Please wait.
<In operation>
The outdoor unit is defrosting. Please wait.
Refrigerant flow noise in the pipe or valve sound generated when flow rate is
adjusted.
Noise generated when the unit expands or contracts due to temperature changes.
Noise generated with the indoor unit fan’s rpm changing such as operation start
times.
Noise of the motorized valve when the unit is switched on.
The following phenomena do not indicate unit failure.
s Is the air filter blocked with dust?
s Is the set temperature suitable?
s Have horizontal air deflectors been adjusted to their correct
positions according to the operation mode selected?
s Are the air inlets or air outlets of indoor and outdoor units
blocked?
s Is the fan speed “LOW”or “SILENT”?
Is the fuse all right?
Is the voltage extremely high or low?
Is the circuit breaker “ON”?
Is the power plug inserted?
Do you have any power cut?
s
s
s
s
s
s Do the batteries need replacement?
s Is the polarity of the inserted batteries correct?
CHECK THE FOLLOWING POINTS
When it does not operate.
(Remote controller display is
dim or blank.)
If the remote controller is not
transmitting a signal.
CONDITION
WHEN ASKING FOR SERVICE, CHECK THE FOLLOWING POINTS.
AFTER SALES SERVICE AND WARRANTY
3
2
1
PLEASE CHECK THE FOLLOWING POINTS EVERY EITHER HALF YEARLY OR YEARLY. CONTACT
YOUR SALES AGENT SHOULD YOU NEED ANY HELP.
REGULAR INSPECTION
ENGLISH
(
)
Contact your sales agent immediately if the
following phenomena should occur:
s The circuit breaker switches off or the fuse blows
frequently.
s The switch operation is not stable.
s Foreign matter or water accidentally enters the unit interior.
s The power cord gets excessively hot or its insulation is torn or stripped.
s TIMER lamp on the indoor unit display blinks.
As the nature of the failure can be identified by the blinking cycle,
check the blinking cycle before turning off the circuit breaker.
Noise of the ventilation fan sucking in air present in the drain hose and blowing out
dehumidifying water that had accumulated in the condensed water collector. For
details, consult your sales agent.
Operation noise changes due to power variations according to room temperature
changes.
Mist is generated as the air within the room is suddenly cooled by conditioned air.
Water generated during defrosting operation evaporates and steam is emitted.
Caused as the smells and particles of smoke, food, cosmetics, etc. present in room
air become attached the unit and blown off into the room again.
Defrosting is underway (as the heating operation is stopped, the microcomputer
checks frost accumulated in the outdoor unit and instructs the unit to perform
automatic defrosting if necessary).
Shows preheating or defrosting operation is underway.
As the protective circuit or preheat sensor operates when unit operation is stopped
during preheating and then restarted, or when operation mode is switched from cooling
to heating, the lamp continues to blink.
Actual room temperature may deviate slightly from the remote controller's
temperature setting depending on the number of people in the room, indoor or
outdoor conditions.
– 10 –
Please note:
On switching on the equipment, particularly when the room light is dimmed, a slight brightness
fluctuation may occur. This is of no consequence.
The conditions of the local Power Supply Companies are to be observed.
s Please contact your sales agent immediately if the air conditioner still fails to operate normally after
the above inspections. Inform your agent of the model of your unit, production number, date of
installation. Please also inform him regarding the fault.
Notes
s In quiet operation or stopping the running, the following phenomena may
occasionally occur, but they are not abnormal for the operation.
(1) Slight flowing noise of refrigerant in the refrigerating cycle.
(2) Slight rubbing noise from the fan casing which is cooled and then
gradually warmed as operation stops.
s The odor will possibly be emitted from the room air conditioner because
the various odor, emitted by smoke, foodstuffs, cosmetics and so on,
sticks to it. So please clean the air filter and the evaporator regularly to
reduce the odor.
s If the unit still fails to operate
normally after performing the
above inspections, turn the
circuit breaker off, or pull the
power plug out, and contact
your sales agent immediately.
Does not reach the temperature
setting
The OPERATION lamp is blinking.
The outdoor unit continues to operate
even if operation is stopped.
Odors
Mist emission
Steam emitted from the outdoor unit
Changing operation noise
Perking noise
To obtain the best performance and ensure years of trouble free use, please read this instruction manual completely.
Remote Controller manual
RAR-5E2
MODEL
Remote Controller Manual
Page 1~27
ENGLISH
Remote controller
– 2 –
is in the room. Consult the shop if that is the case.
ƽ If the remote controller signals happen to operate another
appliance, move that appliance to somewhere else, or
consult the service shop.
ƽ When the remote controller is not in use, please close the
slide cover to prevent failure.
ƽNever
Notes on the remote controller
expose the remote controller to direct sunlight.
ƽDust on the signal transmitter or receiver will reduce the
sensitivity. Wipe off dust with soft cloth.
ƽSignal communication may be disabled if an electronic-
Screws
Notes on batteries
ƽ When replacing the batteries, use batteries of the same
type, and replace both old batteries together.
ƽ When the system is not used for a long time, take the
batteries out.
ƽThe batteries will last for approximately 1 year. However, if
the remote controller display begins to fade and degradation
of reception performance occurs within a year, replace both
batteries with new size AAA.LR03 (alkaline).
ƽThe attached batteries are provided for the initial use of
the system.
The usable period of the batteries may be short depending
Remote controller holder
on the manufactured date of the air conditioner.
NOTE
1. Choose a place from where the signals can reach the unit.
2. Fix the remote controller holder to a wall, a pillar or similar
location with the provided screws.
3. Place the remote controller in the remote controller holder.
Ƶ To fix the remote controller holder to the wall
1. Slide the cover to take it off.
2. Install two dry batteries AAA.LR03 (alkaline).
The direction of the batteries should match the
marks in the case.
3. Replace the cover at its original position.
Ƶ To install the batteries
PREPARATION BEFORE OPERATION
(CLOCK)
Ƶ Calendar and clock will not be transmitted from indoor
unit when the following occurs:
ƽ When there is a power failure.
ƽ When breaker is OFF by user (unit is not in STANDBY
MODE).
3. The calendar and clock from indoor unit will be transmitted.
2. Direct remote control towards indoor unit and press
(INFO) button.
After changing the batteries,
(RESET) button.
1. Press
Calendar and clock shall be set again after changing
batteries.
To modify the calendar and clock, press
button.
Then follow steps 1 to 7.
– 3 –
Note on setting the calendar and clock.
ƽ If the calendar and clock are not set, the ON-timer, OFF-timer and Weekly Timer cannot be set.
ƽ If the calendar and clock are not set correctly, the ON-timer, OFF-timer and Weekly Timer will not
operate correctly.
ƽ When the ON-timer, OFF-timer and Weekly Timer are set, the calendar and clock cannot be changed. If
need to change the calendar and clock, ON-timer, OFF-timer and Weekly Timer need to be cancelled.
NOTE
(CLOCK) button.
Calendar and clock are set.
7. Press
(CLOCK) button. Next, "CLOCK" blinks.
(TIME) button to set the clock to the current
6. Press
time.
(TIME) button to set the current day and
Next, "Day" and
5. Press
4. Press
month.
(CLOCK) button.
(TIME) button to set the current year.
3. Press
"Month" blink.
2. Press
(RESET) button when first time setting.
Ƶ To set calendar and clock
1. Press
"Year" blinks.
PREPARATION BEFORE OPERATION
ENGLISH
Keep pressing and the value will change
more quickly.
Press the [
] button to lower the room
temperature.
Press the [
] button to raise the room
temperature.
ROOM TEMPERATURE setting Buttons
Press these buttons to set the room
temperature.
Display
This indicates the room temperature
selected, current time, timer status,
function and airflow rate selected.
Sensor
A temperature sensor inside the
remote controller senses ambient
temperature around the remotecontroller.
Signal Transmitting/Receiving
Window
Point this window towards the
indoor unit when controlling it.
– 4 –
(HIGH) 䇆
(LOW) 䇆
ECO Button
Use this button to set the ECO
mode.( p.14)
fan speed for each operation mode).
selection of optimal or preferred
(SILENT) (This button allows
(MED) 䇆
(AUTO) 䇆
the airflow rate will change from
Every time you press this button
This determines the fan speed.
FAN SPEED selector Button
START/STOP button
Press this button to start
operation. Press it again to stop
operation.
The transmission sign lights up
when a signal is sent.
Transmission sign
REMOTE CONTROLLER
ƽ This controls the operation of the indoor unit. The range of control is about 7 meters. If indoor lighting is
controlled electronically, the range of controller may be shorter.
This unit can be fixed on a wall using the fixture provided. Before fixing it, make sure the indoor unit can
be controlled from the remote controller.
ƽ Handle the remote controller with care. Dropping it or getting it wet may compromise its signal transmission
capability.
ƽ After new batteries are inserted into the remote controller, the unit will initially require approximately 10
seconds to respond to commands and operate.
ƽ When remote controller is not in use for about 3 minutes during OFF condition, indicated by
on the
display, the LCD will turn off.
ƽ During clock setting, the LCD will turn off about 10 minutes later if the remote controller is not in use.
ƽ When pressing any button, the LCD will turn on.
ƽ The LCD will not turn off during TIMER setting.
NAMES AND FUNCTIONS OF REMOTE CONTROLLER
CLOCK
PROGRAM NO.
– 5 –
Precautions for Use
Do not put the remote controller in the following places.
ƽ Under direct sunlight.
ƽ In the vicinity of a heater.
ƽ Handle the remote controller carefully. Do not drop it on the floor, and protect it from water.
ƽ Once the outdoor unit stops, it will not restart for about 3 minutes (unless you turn the power switch
off and on or unplug the power cord and plug it in again).
This is to protect the device and does not indicate a failure.
ƽ If you press the MODE selector button during operation, the device may stop for about 3 minutes for
protection.
ƽ
SEND
DAY
CANCEL
COPY / PASTE
DELETE
OK
TIME
ON / OFF TIMER
ECO
CLEAN
LEAVE HOME
AUTO SWING (VERTICAL)
SLEEP TIMER
INFO
SILENT
POWERFUL
FAN
WEEKLY TIMER setting Buttons
( p.20)
AUTO SWING (Vertical) Button
Controls the angle of the
horizontal air deflector. ( p.11)
SILENT Button
Use this button to set the SILENT
mode.( p.13)
MODE selector Button
Use this button to select the
operating mode. Every time you
press this button, the mode will
change from
(AUTO)
(HEAT)
(DEHUMIDIFY)
(COOL) and
(FAN)
cyclically.
START / STOP
FAN SPEED
AUTO
SILENT
LOW
MED
HI
MODE SELECTOR
AUTO
HEAT
DEHUMIDIFY
COOL
FAN
ON / OFF TIMER setting Buttons
( p.17)
SLEEP TIMER Button
Use this button to set the sleep
timer. ( p.18)
LEAVE HOME Button
( p.15)
ONE TOUCH CLEAN Button
( p.16)
INFORMATION Button
( p.26)
POWERFUL Button
Use this button to set the
POWERFUL mode.( p.12)
NAMES AND FUNCTIONS OF REMOTE CONTROLLER
ENGLISH
If there is a power failure, operation will be automatically restarted when the power is resumed with previous operation
mode and airflow direction.
(As the operation is not stopped by remote controller.)
If you intend not to continue the operation when the power is resumed, switch off the power supply.
When you switch on the circuit breaker, the operation will be automatically restarted with previous operation mode
and air flow direction.
Note: 1. If you do not require Auto Restart Control, please consult your sales agent.
2. Auto Restart Control is not available when Timer or Sleep Timer mode is set.
(HIGH)
(LOW)
(MED)
(FAN SPEED) button (the
(START/STOP) button.
Press the
Operation starts with a beep.
Press the button again to stop operation.
Set the desired room temperature with the TEMPERATURE buttons
(the display indicates the setting).
The temperature setting and the actual room temperature may vary
depending on conditions.
(SILENT)
(AUTO)
Set the desired FAN SPEED with the
display indicates the setting).
ƽ When AUTO has been selected, the device will automatically
determine the mode of operation, HEAT or COOL depending on
the current room temperature. However the mode of operation will
not change when indoor unit is connected to multi type outdoor
unit.
ƽ If the mode automatically selected by the unit is not satisfactory,
manually change the mode setting (HEAT, DEHUMIDIFY, COOL
or FAN).
– 6 –
Press the
SILENT.
(START/STOP) button next time.
(FAN SPEED) button to select AUTO, HI, MED, LOW or
only have to press the
Ƶ As the settings are stored in the memory of the remote controller, you
START
STOP
3
2
1
Press the MODE selector button so that the display indicates the
(AUTO) mode of operation.
The device will automatically determine the mode of operation, HEAT or COOL depending on the current
room temperature. The selected mode of operation will change when the room temperature varies.
However, the mode of operation will not change when indoor unit is connected to multi type outdoor unit.
AUTOMATIC OPERATION
ƽ
ƽ
Ƶ Auto Restart Control
VARIOUS FUNCTIONS
(HIGH)
(LOW)
(MED)
(FAN SPEED) button
The temperature setting and the actual room temperature may
vary depending on conditions.
Set the desired room temperature with the TEMPERATURE buttons
(the display indicates the setting).
(SILENT)
(AUTO)
Set the desired FAN SPEED with the
(the display indicates the setting).
Press the MODE selector button so that the display indicates
(HEAT).
Ƶ During AUTO fan, the fan speed automatically changes as below:
ƽ When the difference between room temperature and setting temperature
is large, fan starts to run at HI speed.
ƽ After room temperature reaches the preset temperature, fan speed
will be changed to lower speed to obtain optimum room temperature
condition for natural healthy heating.
Ƶ As the settings are stored in the memory of the remote controller, you only
have to press the
(START/STOP) button next time.
START Press the
(START/STOP) button. Heating operation starts with
STOP a beep. Press the button again to stop operation.
3
2
1
– 7 –
Defrosting will be performed about once an hour when frost forms on the heat exchange of the outdoor unit,
for 5~10 minutes each time.
During defrosting operation, the operation lamp blinks in a cycle of 3 seconds on and 0.5 second off.
The maximum time for defrosting is 20 minutes.
However, if the indoor unit is connected to multi type outdoor unit, the maximum time for defrosting is 15 minutes.
(If the piping length used is longer than usual, frost is likely to form.)
Ƶ Defrosting
ƽ
Use the device for heating when the outdoor temperature is under 21°C.
When it is too warm (over 21°C), the heating function may not work in order to protect the device.
ƽ In order to maintain reliability of the device, please use this device when outdoor temperature is above -2 0 °C.
HEATING OPERATION
ENGLISH
ƽ
ƵAs the settings are stored in the memory of the remote controller, you
only have to press the
(START/STOP) button next time.
– 8 –
The preset room temperature may not be reached depending on the number of people present in the
room or other room conditions.
When the room temperature is higher than the temperature setting: The device will dehumidify the
room, reducing the room temperature to the preset level.
When the room temperature is lower than the temperature setting: Dehumidifying will be performed at
the temperature setting slightly lower than the current room temperature, regardless of the temperature
setting.
Ƶ Dehumidifying Function
ƽ
The range of 20-26°C is recommended as the room
temperature for dehumidifying.
Set the desired room temperature with the ROOM
TEMPERATURE setting buttons (the display indicates the
setting).
Press the MODE selector button so that the display
indicates
(DEHUMIDIFY).
The fan speed is set at LOW.
Press
(FAN SPEED) button to select SILENT or LOW fan
speed.
START Press the
(START/STOP) button. Dehumidifying operation
STOP starts with a beep. Press the button again to stop operation.
2
1
Use the device for dehumidifying when the room temperature is over 16°C.
When it is under 15°C, the dehumidifying function will not work.
DEHUMIDIFYING OPERATION
(HIGH)
(LOW)
(MED)
(FAN SPEED) button (the
The temperature setting and the actual room temperature may vary
depending on conditions.
Set the desired room temperature with the TEMPERATURE buttons
(the display indicates the setting).
(SILENT)
(AUTO)
Set the desired FAN SPEED with the
display indicates the setting).
Press the MODE selector button so that the display indicates
(COOL).
– 9 –
Ƶ During AUTO fan, the fan speed automatically changes as below:
ƽ When the difference between room temperature and setting temperature is large, fan starts to run at HI speed.
ƽ After room temperature reaches the preset temperature, fan speed
will be changed to lower speed to obtain optimum room temperature
condition for natural healthy cooling.
Ƶ As the settings are stored in the memory of the remote controller, you only
have to press the (START/STOP) button next time.
Press the (START/STOP) button. Cooling operation starts with a
beep. Press the button again to stop operation. The cooling function
does not start if the temperature setting is higher than the current
START room temperature (even though the (OPERATION) lamp lights).
The
cooling function will start as soon as user set the temperature
STOP
below the current room temperature.
3
2
1
Use the device for cooling when the outdoor temperature is -10~ 43°C.
If indoors humidity is very high (80%), some dew may form on the air outlet grille of the indoor unit.
COOLING OPERATION
ENGLISH
START
STOP
2
1
(HIGH)
(LOW)
(MED)
(FAN SPEED) button
– 10 –
(START/STOP) button. Fan operation starts with
Press the
a beep. Press the button again to stop operation.
(SILENT)
(AUTO)
Set the desired FAN SPEED with the
(the display indicates the setting).
Press the MODE selector so that the display indicates
(FAN).
User can use the device simply as an air circulator.
FAN OPERATION
s
(AUTO SWING (VERTICAL)) button. The
is displayed on the LCD.
deflector(s) will start to swing up and down.
Press
(AUTO SWING (VERTICAL)) button again. The
CAUTION
– 11 –
When operating the unit in cooling operation with the air deflector facing down and moving automatically
for a long period of time, water will be condensed on the air deflector and drips down occasionally. This
will wet your furniture.
about 45°
about 10°
about 10°
about 40°
Horizontal
Horizontal
When cooling,
dehumidifying
When heating
During cooling and dehumidifying operation, do not keep
the deflectors swinging or in the lower position (in the case
of vertical auto swing) for a long time. It may cause dew
condensation on the deflectors.
NOTE
disappeared from the LCD.
deflector(s) will stop in the current position.
Press
ƽ
ƽ
Ƶ To cancel Vertical Auto Swing
ƽ
Ƶ To start Vertical Auto Swing
AUTO SWING OPERATION
ENGLISH
NOTE
(POWERFUL) button during operation.
ƽ
(POWERFUL) button again.
(START/ STOP) button.Or
“
” disappears from the LCD.
POWERFUL operation stops.
Press
Press
ƽ
Ƶ To cancel POWERFUL operation
POWERFUL operation ends in 20 minutes. Then the system
automatically operates with the previous settings used before
POWERFUL operation.
” is displayed on the LCD.
– 12 –
When SLEEP mode, ECO mode, SILENT mode or LEAVE HOME mode is selected, POWERFUL
operation is cancelled.
ƽ During POWERFUL operation, capacity of the air conditioner will not increase
– if the air conditioner is already running at maximum capacity.
– just before defrost operation (when the air conditioner is running in HEATING operation).
ƽ After auto restart, POWERFUL operation is cancelled and previous operation shall start.
ƽ For multi model connections, POWERFUL operation may not function depending on operation conditions.
ƽ
1
“
ƽ Press
Ƶ To start POWERFUL operation
pressing
(POWERFUL) button during AUTO, HEATING, DEHUMIDIFYING, COOLING or FAN
operation, the air conditioner performs an the maximuum power.
ƽ During POWERFUL operation, cooler or warmer air will be blown out from indoor unit for COOLING of
HEATING operation respectively.
ƽ By
POWERFUL OPERATION
NOTE
1
“
slow.
Press
(SILENT) button during operation.
Press
button.
ƽ
(SILENT) button again or
(START/STOP) button. Or
“
” disappears from the LCD.
SILENT operation stops.
Fan speed will return to previous fan speed before SILENT
operation starts.
Press
ƽ
(FAN SPEED)
” is displayed on the LCD. Fan speed will be ultra
Ƶ To cancel SILENT operation
ƽ
Ƶ To start SILENT operation
By pressing
(SILENT) button during AUTO, HEATING, DEHUMIDIFYING, COOLING or FAN
operation, the fan speed will change to ultra slow.
ƽ
ƽ
During any operation with fan speed
not change.
– 13 –
(SILENT), if press
(SILENT) button, fan speed will
When POWERFUL operation is selected, SILENT operation is cancelled. Fan speed will return to
previous fan speed before SILENT operation.
ƽ After auto restart, SILENT operation is cancelled. Fan speed will return to previous
fan speed before SILENT operation.
ƽ
SILENT OPERATION
ENGLISH
(ECO) button during AUTO, HEATING,
performs the "ECO" operation.
DEHUMIDIFYING or COOLING operation, the air conditioner
By pressing the
” is displayed on the LCD.
(ECO) button during operation.
” disappears from the LCD.
(ECO) button again.
Press
ƽ
“
(START/STOP) button.Or
Press
ƽ
ƵTo cancel ECO operation
Energy saving operation will start by changing the set
temperature higher or lower automatically and reducing operation
power consumption. This function may vary based on the
connected outdoor unit.
“
ƽ Press
Ƶ To start ECO operation
ƽ
ƽ
ƽ
– 14 –
ECO function will not be effective when power consumption is low.
By pressing (POWERFUL) button, ECO operation is cancelled.
ƽ After auto restart, ECO operation is cancelled and previous operation mode shall start.
ƽ For multi model connections, energy saving operation shall only start by changing set temperature higher
or lower automatically. However, effectiveness of ECO depends on operation conditions.
NOTE
1
ECO operation is an energy saving function by changing set temperature automatically and by limiting the
max imum power consumption value.
ECO OPERATION
“
”, “
”, “
”, “
“
”, “
”, “
”, “
” is displayed on the LCD.
(TIME) button to select number of days.
(LEAVE HOME) button again.
(START/STOP) button.Or
ƽ Change to other operation mode by pressing
Return to previous operation mode.2U
ƽ Press
ƽ Press
(MODE) button.
(CANCEL) button to reset number of operation
days or to have continuous operation.
ƽPress
(SEND) button to confirm number of operation
days. Display for number of operation days will stop blinking.
ƽ Press
* Press “
(UP)” to set number of days from 1 day, 2 days, 3
days ..... 98 days, 99 days, 1 day and so on.
* Press “
(DOWN)” to set number of days from 99 days, 98
days, 97 days .... 3 days, 2 days, 1 day, 99 days and so on.
* Number of day is counted when clock indicates 0:00.
Number of days blink.
Press
ƽ Set number of operation days (1 to 99 days), if needed.
(LEAVE HOME) button during stop or operation.
” is displayed on the LCD.
Room temperature is set at 10°C and heating operation starts.
ƽ Press
Option 2. Day timer operation.
Ƶ To cancel LEAVE HOME operation
1
(LEAVE HOME) button during stop or operation.
Room temperature is set at 10°C and heating operation starts.
ƽ Press
Option 1. Continuous operation.
Ƶ To start LEAVE HOME operation
– 15 –
ƽ POWERFUL,SILENT and ECO operations are not applicable during Leave Home.
or AUTO mode, Leave Home operation cannot operate even though it is possible to set Leave Home operation.
In order to start Leave Home operation, all rooms must stop its operation. Then, press (LEAVE HOME) button to
operate Leave Home operation.
ƽ For multi connections, when all rooms are running HEATING operation, it is possible to operate Leave Home operation
by pressing the (LEAVE HOME) button.
ƽ For multi connections, if two or more rooms are set to operate Leave Home operation, the capability to reach the
set temperature at 10°C may not possible. In addition, this also depends on outdoor temperature.
ƽ For multi connections, when each room is running in different operation mode such as FAN only, COOLING, DEHUMIDIFYING
shall be in continuous operation.
ƽ By pressing (Leave Home) button, implementation of Weekly Timer or One Timer only Timer is cancelled.
ƽ In case of power supply shut down, after autorestart, all setting for number of days operation will be reset and unit
ƽ During Leave Home operation, fan speed and horizontal air deflector position cannot be changed.
Rthe unit will operate in previous mode.
ƽ After reaching the set number of operation days for Leave Home or by pressing the (Leave Home) button again,
NOTE
Day timer operation
Continuous operation
Prevent the room temperature from falling too much by setting temperature 10°C automatically when no one is at home.
This operation is able to operate by" Continuous operation" or " Day timer operation" . Please use " Day timer operation"
to set the number of days up to 99 days.
LEAVE HOME(LH) OPERATION
°
ENGLISH
” is displayed on the LCD.
ƽ
Press
Press
(CLEAN) button again.
(START/STOP) button.Or
– 16 –
multi connections, when pressing
(CLEAN) button, operation is limited to FAN operation.
multi connections, when one room operates CLEAN operation first, other rooms can operate
COOLING, DEHUMIDIFYING or FAN operation. However, when other rooms need to operate HEATING
operation, air conditioner will be in STANDBY mode. After CLEAN operation finish, HEATING operation
will start.
ƽ For
ƽ For
ƽ
”, “
CLEAN operation finish, unit will switch OFF automatically.
If Weekly Timer or Once Timer is set, there is a need to cancel those timer before operating CLEAN function.
NOTE
ƽ When
“
Press
(CLEAN) button when unit is OFF.
Total time taken for One Touch Clean operation is 60 minutes.
During this operation, HEATING or FAN operation shall
operate.
During one touch clean, operation lamp is blinking.
Ƶ To cancel CLEAN operation
ƽ
1
ƽ
Ƶ To start CLEAN operation
Drying indoor heat exchanger after cooling operation to prevent mildew.
CLEAN (ONE TOUCH CLEAN) OPERATION
ƽ
ƽ
ƽ
blink on the display.
1. Press
and
blink on the display.
and
blink on the
blink.
and set "turn-off" time light up.
A beep sound emitted from indoor unit and the (TIMER) lamp on the indoor
unit lights up.
and set "turn-on" time light up instead of blinking.
5. After setting, direct the remote controller towards the indoor and press
(SEND) button
(TIME) button.
(ON-TIMER) button so that
and
4. Set the "turn-on" time with
The
3. Press
(TIME) button. After setting, direct the remote
2. Set the "turn-off" time with
(SEND) button.
controller towards the indoor and press
(OFF-TIMER) button so that
The device will turn on (off) and off (on) at the designated time.
The switching occurs first at the preset time that comes earlier.
The arrow mark appears on the display to indicate the sequence of switching
operations.
1. Press
display.
ƽ
ƽ
ƽ
ON/OFF TIMER
A beep sound emitted from indoor unit and the (TIMER) lamp on the indoor
unit lights up.
and "set time" light up instead of blinking.
3. After setting, direct the remote controller towards the indoor and press
(SEND) button.
(TIME) button.
(ON-TIMER) button.
2. Set the "turn-on time" with
(CANCEL) button.
timer. Set the current time first because it serves as a reference.
and "ON or OFF set time" goes out with a beep and the (TIMER) lamp on the indoor unit turns off.
– 17 –
User can set only one of the OFF-timer, ON-timer or ON/OFF-timer.
If WEEKLY TIMER already set, by setting the ONCE TIMER, ONCE TIMER operation is prioritized. When
ONCE TIMER operation is complete, WEEKLY TIMER operation will be activated.
NOTE
1
”, “
” and number
3H
SLEEP TIMER off
2H
7H
(START/STOP) button.
”, “
”,
ƽ
(CANCEL) button.
– 18 –
A beep sound emitted from indoor unit and the (TIMER) lamp
on the indoor unit turns off.
ƽ SLEEP TIMER operation is cancelled.
Press
controller display.
” and number of hour disappear from the remote
”, “
(SLEEP) button again until “
Press
Room air conditioner will switch off.
off time, “
ƽ
Press
Ƶ To cancel ECO SLEEP TIMER operation
Example: If ECO SLEEP TIMER is
set for 1 hour at 18:00, the switch
off time will be at 19:00.
During ECO SLEEP TIMER operation, air conditioner will
continue to operate for the designated number of hours and
then turn off.
ƽ When the ECO SLEEP TIMER has been set, the display on
the remote controller indicates the turn off time.
ƽ
1H
”, “OFF”, off time, “
(SLEEP) button repeatedly, the number of hours
will change as below:
Pressing
”, “
of hour are displayed on the remote controller display.
ƽ During ECO SLEEP TIMER operation, fan speed will be ultra
slow.
ƽ A beep sound emitted from indoor unit and the (TIMER) lamp
on the indoor unit lights up.
“
ƽ
(SLEEP) button during operation.
ON TIMER
Press
Ƶ To start EC O SLEEP TIMER operation
Set the current time first before operating the ECO SLEEP TIMER operation.
the unit shifts the room temperature and reduces the fan speed. lt results in energy sav ing.
The timer can be set up to a duration of 7 hours.
By pressing
(SLEEP) button during AUTO, HEATING, DEHUMIDIFYING, COOLING or FAN operation,
EC O SLEEP TIMER OPERATION
When (ON TIMER) is set, the operation starts so that the preset temperature is
reached at the preset time.
The air conditioner starts operation a maximum 60 minutes before the preset time,
depending on conditions including room temperature and preset temperature.
A beep sound emitted from indoor unit and the (TIMER) lamp on the
indoor unit lights up.
and "set time" lights up instead of blinking.
Point the signal window of the remote controller towards the indoor unit and press
Ƶ To cancel Reservation
(TIME) button.
and
3. After setting, direct the remote controller towards the indoor and press
(SEND) button.
2. Set the "turn-off time" with
(OFF-TIMER) button.
ƵThe timer may be used in three ways: OFF-timer, ON-timer and ON/OFF (OFF/ON)-
1
1. Press
The device can be set to turn off at a preset time.
OFF TIMER
ONCE TIMER (ON/OFF TIMER) OPERATION
ENGLISH
Example:
In this case, air conditioner will turn off in 2 hours (at 1:38) and it will be
turned on at 6:00 the next morning.
(SLEEP) button and set ECO SLEEP TIMER.
“
”, “
”, “
”, “OFF”, off time, “
”, number of hour, "ON" and ON TIMER set time disappear
from the remote controller display.
A beep sound emitted from indoor unit and the (TIMER) lamp on the indoor unit turns off.
ECO SLEEP TIMER and ON TIMER reservations are cancelled.
(CANCEL) button.
ƽ
30 minutes
Outdoor fan
speed reduce
1 hour
Shift
temperature
Temperature
30 minutes
Outdoor fan
speed reduce
1 hour
Shift
temperature
Heating operation [diagram representation for
illustrative purpose only]
– 19 –
If ECO SLEEP TIMER is set when OFF TIMER or ON/OFF TIMER has been set earlier, the ECO
SLEEP TIMER becomes effective instead of the OFF TIMER or ON/OFF TIMER.
NOTE
Temperature
Cooling operation [diagram representation
for illustrative purpose only]
30 minutes after setting ECO SLEEP TIMER, outdoor fan speed will be reduced to lower the noise level and to
have comfort operation.
1 hour after setting ECO SLEEP TIMER, set temperature will be slightly shifted. Amount of temperature
shifted depends on type of air conditioner.
These automatic operation changes contribute to energy saving without losing comfort.
The level of energy consumption depends on outside temperature, room temperature, set temperature or air
conditioner type.
ƽ
ƽ
ƽ
Direct the remote controller towards the indoor unit and press
Ƶ To cancel ECO SLEEP TIMER and ON TIMER operation
2. Press
1. Set the ON TIMER.
The air conditioner will be turned off by ECO SLEEP TIMER and turned on by ON TIMER.
Ƶ To set SLEEP TIMER and ON TIMER
ECO SLEEP TIMER OPERATION
ENGLISH
If calendar and clock are not set, the reservation setting for WEEKLY TIMER cannot be set.
If calendar and clock are not set correctly, WEEKLY TIMER will not operate correctly.
Reservation for calendar and clock shall be set first before operating WEEKLY TIMER.
ƽ
4
3
2
1
(WEEKLY) button.
(WEEKLY) button again,
and
lights up.
blink on the
,
appear.
will not
(WEEKLY) button for about 3 seconds. The selection mode
,
blink on the display.
and
(DAY) button.
button to select a program number.
– 20 –
2
3
4
5
6
1
2 .....
The number changes from 1
ƽ If program number has been set, follow above in order to make
changes.
4. Press
Select [Full days] for daily reservation.
Select [weekday] for Monday to Friday reservation.
Select [weekend] for Saturday and Sunday reservation.
ƽ
After reservation has been set, it is easy to check and edit at the same
time.
The day changes from Mon
Tue
Wed
Thu
Fri
Sat
Sun
Mon, Tue, Wed, Thu, Fri, Sat, Sun [Full days]
Mon, Tue, Wed, Thu,
Fri [weekday]
Sat, Sun [weekend]
Mon
Tue ......
Press
3. Select the desired day of the wekk.
can be changed.
, day: Mon, program no. : 1, ON/OFF, setting time and setting
temperature blink on the display.
Press
(Mode B is selected).
ƽ If no reservation has been made, ON/OFF,
ƽ If reservation has been made, ON/OFF,
appear.
2. Set a program.
Press
display. (Mode A is selected).
Press
Ƶ How to set a WEEKLY TIMER.
1. Select Mode A or Mode B.
Step 1 : Set reservation schedule to the remote controller. Send the registered reservation
to indoor unit and then operate.
Step 1 : Set the reservation schedule to the remote controller. Send the registered reservation to indoor
unit and then operate.
Step 2 : Select Mode A or Mode B and activate or deactivate WEEKLY TIMER .
Step 3 : Copy and cancel the reservation schedule.
ƽ
ƽ
lt is possible to select Mode A or Mode B.For each mode ,up to 6 programs can be set per day. ln total, a
maximum of 42 programs can be set for a week for each mode.
ƽ
WEEKLY TIMER OPERATION
ƽ
) button to set temperature reservation.
buttons.
If TIMER lamp on the indoor unit does not light up, press
(SEND) button while directing the remote controller towards the indoor
unit for about 3 seconds.
CAUTION ! Do not press
(CANCEL) button during reservation
setting because this will result in all reservation contents to be lost.
The reservation contents will not stored in the indoor unit until
(SEND) button has been pressed.
ƽ
ƽ
ƽ
9. After all the reservations have been set, press
(SEND) button while
directing the remote controller towards the indoor unit for about 3 seconds
Timer lamp on the indoor unit will blink rapidly.
After beep sound emitted from indoor unit, TIMER lamp will light up.
Please ensure that the TIMER lamp lights up.
This indicates that the reservation has been stored in the indoor unit and
Timer function has been completed.
The reservation contents will appear on the remote controller display.
To continue with the reservation, press
Follow step 3 to 8 for reservation.
8. Press
(OK) button. The reservations are set. Day, program
number, ON reservation, setting temperature will light up.
will be
continuously blinks. If reservation is not complete, settings will not be
stored in memory.
or
(TIME) button to set time reservation.
7. Press (TEMP
6. Press
reservation.
(ON-OFF TIMER) button to select ON TIMER or OFF TIMER
– 21 –
Up to 6 programs can be set per day. Setting ON TIMER or OFF TIMER for each program number can
be at random. When pressing
(SEND) button, the set ON TIMER or OFF TIMER for each program
number will automatically arranged so that program number 1 shall have the earliest time and program
number 6 shall have the latest time.
If the setting time is the same, Priority will be given to the latest reservation contents.
CAUTION ! If the remote controller is left idle and
(SEND) button is not pressed within 3 minutes
after reservations have been made , all current reservations will be lost.
NOTE
ƽ
9
8
7
6
5
5. Press
WEEKLY TIMER OPERATION
ENGLISH
NOTE
(WEEKLY) button.
(WEEKLY) button again.
and
and
blink on the display.
blink on the display.
ƽ
To activate back the setting of WEEKLY TIMER , repeat the steps for
"How to select Mode A or Mode B of WEEKLY TIMER setting".
1. Direct the remote controller towards the indoor unit and press
(CANCEL) button.
Beep sound will be emitted from indoor unit and TIMER lamp will be OFF.
Reservation indication on remote display will also disappear.
This indicates that non-active WEEKLY TIMER has been confirmed.
Ƶ Setting non-active WEEKLY TIMER .
This indicates that Mode A or Mode B selection and active WEEKLY TIMER
have been confirmed.
After beep sound emitted from indoor unit, TIMER lamp will light up.
Please ensure that the TIMER lamp lights up.
3. Select Mode A or Mode B. Press
(SEND) button while directing the
remote controller towards the indoor unit for about 3 seconds. Timer lamp
on the indoor unit will blink rapidly.
2. Press
(Normally Mode A will blink first).
1. Press
Ƶ How to select Mode A or Mode B of WEEKLY TIMER setting.
– 22 –
When setting ONCE TIMER, operation of WEEKLY TIMER is interrupted. After ONCE TIMER operation
is complete, WEEKLY TIMER operation will be activated.
ƽ When ONCE TIMER is cancelled, operation of WEEKLY TIMER is also cancelled. Need to set WEEKLY
TIMER operation for activation.
ƽ After auto restart, WEEKLY TIMER operation is cancelled. Need to set WEEKLY TIMER operation for
activation.
ƽ
1
3
2
1
Step 2: Select Mode A or Mode B and activate or deactivate WEEKLY TIMER.
WEEKLY TIMER OPERATION
(WEEKLY) button to select Mode A or Mode B.
(DAY) button to select a day of the week to copy.
(DAY) button to select a day of the week to paste.
or
or
or
only
ƽ
Reservation data will not change if
(SEND) button is not pressed.
8. After copy and paste completed, press
(SEND) button while
directing the remote controller towards the indoor unit for about 3 seconds.
Timer lamp on the indoor unit will blink rapidly.
After beep sound emitted from indoor unit, TIMER lamp will light up.
Please ensure that the TIMER lamp lights up.
If TIMER lamp does not light up, Press
(SEND) button again.
Then start from step 3.
.
7. To continue copying to other days, press
6. Press
(COPY/PASTE) button one more time to paste.
blinks on the display.
5. Press
(COPY/PASTE) button. Then "PASTE" blinks on the display.
4. Press
* Press
(CANCEL) button to cancel the COPY mode. Normal
setting mode is activated.
3. Press
(WEEKLY) button for about 3 seconds to start editing the
2. Press
reservation schedule.
1. Press
Editing the reservation schedule is easy by copying data from one day to
another day.
Ƶ How to copy and paste.
– 23 –
If there is no reservation data, copying data from one day to another day cannot be done.
NOTE
ƽ
8
6
5
4
3
2
1
Step 3: Copy and cancel the reservation schedule.
WEEKLY TIMER OPERATION
ENGLISH
6
5
4
3
2
1
(DELETE) button. Reservation of selected program number
to select program number. Selected program number will
ƽ
– 24 –
Reservation will not change if
(SEND) button is not pressed.
(SEND) button while directing the remote
6. After deleting, press
controller towards the indoor unit for about 3 seconds. Timer lamp on the
indoor unit will blink rapidly.
After beep sound emitted from indoor unit, TIMER lamp will light up.
Please ensure that the TIMER lamp lights up.
is deleted.
5. Press
4. Press
blink.
3. Press
(DAY) button to select a day of the week to edit.
(WEEKLY) button for 3 seconds to start editing the reserva-
(WEEKLY) button to select Mode A or Mode B.
tion schedule.
2. Press
1. Press
[Delete one program number reservation]
Ƶ How to delete WEEKLY TIMER data.
Step 3: Copy and cancel the reservation schedule.
WEEKLY TIMER OPERATION
ƽ
(WEEKLY) button for 3 seconds to start editing the
(DAY) button to select a day of the week to edit.
Reservation will not change if
(WEEKLY) button to select Mode A or Mode B.
(SEND) button is not pressed.
2. Direct the remote controller towards the indoor unit and press
(DELETE) button for about 10 seconds while Mode A or Mode B display
blinks.
After beep sound emitted from indoor unit, reservations for Mode A or
Mode B will disappear.
1. Press
[Delete Mode A or Mode B]
ƽ
5. After deleting, press
(SEND) button while directing the remote
controller towards the indoor unit for about 3 seconds. Timer lamp on the
indoor unit will blink rapidly.
After beep sound emitted from indoor unit, TIMER lamp will light up.
Please ensure that the TIMER lamp lights up.
(DELETE) button for about 10 seconds. Reservations for all
4. Press
program numbers will be deleted.
ƽ If press for a short time, reservation for one program number will be
deleted.
3. Press
– 25 –
(SEND) button, no signal will be
If all reservations in the remote controller were deleted and pressed
transmitted to indoor unit. TIMER lamp will remain off and no changes will be done to the reservations
stored in the indoor unit.
NOTE
2
1
5
4
3
2. Press
2
(WEEKLY) button to select Mode A or Mode B.
reservation schedule.
1. Press
1
[Delete one day reservation]
Step 3: Copy and cancel the reservation schedule.
WEEKLY TIMER OPERATION
ENGLISH
By pressing
(INFO) button, temperature around remote controller and monthly power consumption
will be displayed on the remote controller.
1
(INFO) button.
(INFO) button. Wait
lndicated value shall be regarded as a guide only.
ƽ
ƽ
If there is no power supply to indoor unit or calendar and clock
have not been set, INFO function cannot be used for sending or
receiving information.
Once received the current calendar and clock, check whether they
are correct or not by pressing
(CLOCK) button.
Direct the remote controller towards the receiver of indoor unit (within 2
(INFO) button. Wait
meters in front of indoor unit) and press
for 2 seconds for signal transmission.
Ƶ Current calendar and clock can be retrieved
from indoor unit
If indication is not given, bring remote controller closer to the
receiver of the indoor unit.
ƽ
this month power consumption amount for heating
last month
power consumption for heating
this month power consumption
amount for cooling
last month power consumption amount for
temperature around remote control
this month power
cooling
consumption amount for heating ...... cyclically.
While temperature around remote controller is displayed, press
(INFO) button repeatedly. The display will show as below:
meters in front of indoor unit) and press
for 2 seconds for signal transmission.
Direct the remote controller towards the receiver of indoor unit (within 2
Ƶ To check monthly power consumption
Temperature will be displayed for 10 seconds.
Press
Ƶ To check temperature around remote controller
(INFO) button. Wait for 2 seconds for signal transmission.
– 26 –
An error code will be displayed. Call service center and inform the error code.
Info Function to check monthly power consumption.
During installation, in case of power failure or breaker ON / OFF, ensure to set the clock and calendar for
each indoor unit (unit in standby mode or auto restart), for single or multi connection, by pressing
(START / STOP) button.
Failure to do the above,monthly power consumption amount will not be displayed on the remote controller.
of indoor unit) and press
case failure occurs to the air conditioner, by pressing
(INFO) button, an error code will
be displayed. Direct the remote controller towards the receiver of indoor unit (within 2 meters in front
ƽ In
NOTE
ƽ After
(INFO)
changing the batteries, direct the remote controller towards the indoor unit and press
button.
Current calendar and clock will be transmitted from indoor unit.
ƽ In order to receive information from indoor unit, the distance between remote controller and receiver of indoor
units is within 2 meters.
ƽ
INFO FUNCTION
” will be displayed for about 10 seconds. Later, “
(MODE) button, “
” or “
” will be displayed.
(ECO) and
” will be displayed for about 10 seconds. Later, “
(MODE) button, “
”, “
” or “
” will be displayed.
(ECO) and
(SILENT) buttons simultaneously for about 5 seconds
when the remote controller is OFF.
All operation mode symbols will appear on the display for about 10 seconds. After
that, operation mode symbol before cancellation will be displayed.
This indicates that COOLING and DEHUMIDIFYING modes operation is unlocked.
Press
Ƶ Method to unlock COOLING and DEHUMIDIFYING modes (including FAN)
operations.
When pressing
This indicates that COOLING and DEHUMIDIFYING mode operation is locked.
”, “ ”, “
” and “
“
and “
” will remain.
ƽ
”
(SILENT) buttons simultaneously for about 5 seconds
when the remote controller is OFF.
Press
Ƶ Method to lock COOLING and DEHUMIDIFYING modes (including FAN)
operations.
(ECO) and
(POWERFUL) buttons simultaneously for about 5
Press
seconds when the remote controller is OFF.
All operation mode symbols will appear on the display for about 10 seconds. After
that, operation mode symbol before cancellation will be displayed.
This indicates that HEATING mode operation is unlocked.
ƵMethod to unlock HEATING mode (including FAN) operation.
When preessing
” and
– 27 –
Operation Mode Lock function will not activate if TIMER reservations activate.
TIMER reservations shall be deactivated first. Then, Operation Mode Lock function can be activated.
ƽ HEATING, COOLING and DEHUMIDIFYING mode (including FAN) operations can be unlocked by pressing
(RESET) button. However, by pressing the
(RESET) button, all the information stored
the
in the remote controller will disappear. You may need to set the necessary information again.
ƽ For multi connections, unit and mode which is set to lock HEATING and switched on first shall have
higher priority. Other units which are chosen to operate at different modes shall be in STANDBY until
either the first unit operation is switched off or the mode is selected to be same as the first unit.
NOTE
”, “
” and “
” will remain.
This indicates that HEATING mode operation is locked.
“
“
(ECO) and
(POWERFUL) buttons simultaneously for about 5
Press
seconds when remote controller is OFF.
Ƶ Method to lock HEATING mode (including FAN) operation.
DEHUMIDIFYING mode (including FAN) operations.
The remote controller can be set to fix the HEATING mode (including FAN), COOLING mode (including FAN) and
OPERATION MODE LOCK
ENGLISH
– 28 –
< 10010C :
>
CONSTRUCTION AND DIMENSIONAL DIAGRAM
MODEL RAK-18PSPA ,RAK-25PSPA,RAK-35PSPA
INDOOR UNIT
218
More
than
50mm
( 12.7)
More than
50mm
More
than
2300mm
More than
50mm
Service space
27
(RAK-18/25/35PSPA)
CONSTRUCTION AND DIMENSIONAL DIAGRAM
MODEL RAC-18/25/35WSPA
OUTDOOR UNIT
Unit : mm
600
More
than
200
(19.5)
580.5
345
299
NOTE:
1.For outdoor unit installation , allow at least (2) sides of space around the unit ensure ventilation flue.
2.The connecting pipe , should all the insulated with insulation pipe.
3.Piping length is within (20m).
4.Height different of the piping between the indoor unit and outdoor unit should be within (10m).
28
MAIN PARTS COMPONENT
THERMOSTAT
(Room temperature Thermistor)
Thermostat Specifications
MODEL
RAK-18PSPA,RAK-25PSPA,RAK-35PSPA
THERMOSTAT MODEL
IC
OPERATION MODE
TEMPERATURE
e
C (e
F)
COOL
HEAT
INDICATION
16
ON
15.3 (62.1)
16.7 (62.1)
OFF
15.0 (60.8)
17.3 (63.1)
INDICATION
24
ON
23.3 (76.5)
24.7 (76.5)
OFF
23.0 (75.2)
25.3 (77.5)
INDICATION
32
ON
31.3 (90.9)
32.7 (90.9)
OFF
31.0 (89.6)
33.3 (91.9)
FAN MOTOR
Fan Motor Specifications
MODEL
RAK-18/25/35PSPA
POWER SOURCE
RAC-18/25/35WSPA
DC 35V
OUTPUT
DC 120 - 380V
25W
35V
0V
CONNECTION
5V
0 - 5V
FG
47W
120~380V
RED
RED
BLK
WHT
M
YEL
0V
BLK
15V
WHT
BLU
(Control circuit built in)
BLU : BLUE
GRY : GRAY
BLK : BLACK
YEL : YELLOW
ORN : ORANGE
PNK : PINK
BRN : BROWN
GRN : GREEN
VIO : VIOLET
WHT : WHITE
RED : RED
MAIN ELECTRIC COMPONENTS FOR OUTDOOR UNIT
NAME
RATING
APPLICABLE MODELS
REVERSING VALVE COIL
81.8 1 (20 ˚C)
RAC-18/25/35WSPA
5.3 (mH), 67m 1
RAC-18/25/35WSPA
400 (嘕 F)
RAC-18/25/35WSPA
REACTOR
FILM CAPACITOR
RAS_AW_015-018e
2008.1.28, 16:03
M
COMPRESSOR
Compressor Motor Specifications
RAC-18WSPA,RAC-25WSPA,RAC-35WSPA
MODEL
EU125XB2
COMPRESSOR MODEL
PUMP TYPE
SCROLL
OUT PUT
1000W
REFRIGERANT
R-410A
APPROVED MOTOR VOLTAGE
400V MAX
(DC VOLTAGE)
WHITE
(U)
M
CONNECTION
(V)
M
M
YELLOW
RED
U-V
V-X
U-X
20˚C
(68˚F)
RESISTANCE VALUE (Ω)
(X)
2.23
2.23
2.23
75˚C
(167˚F)
(RED)X
(WHITE)U
(YELLOW)V
!
CAUTION
When the refrigerating cycle has been operated for a long time with the capillary tubes clogged or crushed
or with too little refrigerant, check the color of the refrigerating machine oil inside the compressor. If the
color has been changed conspicuously, replace the compressor.
WIRING DIAGRAM
RAK-18/ 25 /3 5 PSPA
RAC-18/25/35WSPA
! CAUTION
The marked parts ! are
very important ones for safety.
!
!
NOTE
1.Connecting cable 1.5mm dia.x2 (C D line) is used for the connection.
!
WIRING DIAGRAM OF THE PRINTED WIRING BOARD
[Remote controller] RAR-5E2
CIRCUIT DIAGRAM
MODEL RAK-18/25/35PSPA
MODEL RAC-18/25/35WSPA
OUTDOOR UNIT
INDOOR UNIT
MODEL RAK-18/25/35PSPA
RAC-18/25/35WSPA
Outdoor DC fan motor
POWER RELAY
RECTIFIER
HARMONICS
IMPROVEMENT
CIRCUIT
IPM
Inrush current
Protection circuit
DC compressor
motor
Rotor magnetic
pole position
detection circuit
lp
Wireless receive
circuit
Buzzer circuit
ls
Operation.
Timer.
Heat exchanger
thermistor
Room temperature
thermistor
Temporary switch
Indoor microcomputer (AX-12C720)
Indicating lamp
Overheat thermistor
M
Auto sweep motor 1
Defrost thermistor
Outdoor microcomputer (AX-12C820)
ld
Wireless remote
control
Outdoor temperature thermistor
Indoor / Outdoor
interface circuit
C
C
D
D
Electric expansion valve
Indoor/Outdoor
interface circuit
Reversing valve
control circuit
Reversing valve coil
DC fan motor drive
circuit
Initial setting circuit
Reset circuit
Microcomputer clock
circuit
FM
Relay drive circuit
Indoor DC fan motor
Power circuit
Reset
circuit
BASIC MODE
MODEL RAK-18/25/35PSPA
Operation mode
Fan
Cooling
Dehumidifying
Timer functions
Basic operation of
start / stop switch
Start / stop switch
Operation lamp
Heating
Start
Stop
Start
Auto
Stop
Start / stop switch
Reserve switch
Cancel switch
Operation lamp
Timer lamp
Off-timer
Timer memory
(Off-timer during stop)
(Change in reserved time)
Start / stop switch
Reserve switch
Cancel switch
Operation lamp
Timer lamp
On-timer
Timer memory
(Change in reserved time)
Set to "Silent", "Lo", "Med", "Hi", "ultra-Hi" or "stop" depending on the room temperature,
time and heat exchange temperature. Set to "stop" if the room temperature is 18˚C in the
"Silent" mode other than during preheating (cooling is recovered at 18.33˚C).
Changes from "Hi" to "Med"
or "Lo" depending on room
temperature.
Room temperature
Auto
When the compressor is running at maximum speed
during hot dash or when recovered from defrosting.
Temperature
set for
cooling
Thermo judgment
In modes other than
left.
Heat exchanger temperature
On
Off
On
36
32
29
Compressor
Hi
Med
Lo
Silent
26.0
23.0
High or ultra-High
(Fan speed set to
“AUTO”)
Med
Low
Silent
(Compressor stopped
forcibly for 3 minutes)
1. Runs at "Hi" until first
thermo off after operation
is started.
2. Runs at "Lo" when
thermo is off.
Operates at "Hi" regardless of
the room temperature.
Set to "Ultra-Hi" when the
compressor runs at maximum
speed, and to "Hi" in other
modes.
Set to "Silent", "Lo", "Med", "Hi", "Ultra-Hi" or "Stop" depending on the room
temperature and time.
Set to "Stop" if the room temperature is 18℃ in the "Silent" mode other
than during preheating (cooling is recovered at 18.33℃).
Set to "Ultra-Hi" when the compressor is running at maximum speed during
hot dash or when recovered from defrosting.
Med
Operates at "Med" regardless
of the room temperature.
Same as at left.
Set to "Silent", "Lo", "Med" or "Stop" depending on the room temperature and time.
Set to "Stop" if the room temperature is 18℃ in the "Silent" mode other than during
preheating (cooling is recovered at 18.33℃).
Silent
Operates at "Lo" regardless of Same as at left.
the room temperature.
Operates at "Silent" regardless Same as at left.
of the room temperature.
Basic operation of
Performs only fan operation at See page 38.
temperature controller the set speed regardless of
the room temperature.
Set to "Lo" in modes other than
when the compressor stops.
Set to "Silent" in modes other than
when the compressor stops.
See page 40.
(1) Judging by room temperature
Operating mode at start up is judged (initial judgment).
(a) Conditions for judgment (any of the followings).
・When auto operation is started after the previous auto mode operation.
・When auto operation is started after the previous manual mode operation.
・When the operating mode is switched to auto while operating at manual mode.
[ Room temperature setting of
remote controller ]
Hi
Lo
Operating mode is judged by room tempertature.
(b) Judging method
・[ Cooling ] : Room temperature ≧ Remote controller setting
・[ Heating ] : Room temperature < Remote controller setting
35.0
30.0
3’
Fan speed mode (indoor fan)
(On-timer during operation)
Set to "Silent", "Lo", or "Stop" depending on the
room temperature and time.
Set to "Stop" if the room temperature is 18℃
in the "Silent" mode other than during
preheating (cooling is recovered at 18.33℃).
The fan speed is controlled by the heat
exchanger temperature; the overload control is
executed as in the following diagram:
See page 42.
Cooling
Heating
(2) Judging operating mode change during operation (Continuous judgment).
(a) Conditions for judgment
・The mode is reviewed at interval time.
*Interval time as below
・The first interval time : 10 minutes
・The second interval time : 15 minutes
・On and after the third interval time : 55 minutes
(b) Judging method
・Judge by setting the hysteresis on the final preset temperature.
The final preset temperature is the actually targeted preset temperature which is sum of basic preset
temperature and each type of shift value.
(e.g. preset temperature correction value, powerful shift value, eco shift value, eco sleep shift value, etc.)
Heat exchanger temperature
KAFON
KAFOF
On
"Med" with overload
"Lo"
Off
On
[ Currently cooling ]
・Room temperature ≦
・Room temperature >
[ Currently heating ]
・Room temperature ≧
・Room temperature <
Cooling
Heating
final preset temperature
Sleep operation
Enters sleep operation after
(with sleep button ON) set as on the left.
Action during sleep operation
silent (sleep) operation.
Leave home
Same as at left.
See page 40.
Same as at left.
See page 40.
Same as at left.
See page 42.
+
Same as at left.
Performs the sleep operation of each operation mode.
See page 44.
Notes:
1. The speed set of rotaion for the fan motor in each operation mode are as shown in Table 1.
2. The set room temperatures in the diagram include the shift values in Table 2.
36
Table 1 Mode data file
MODEL
RAK-18PSPA
RAK-25PSPA
VALUE
LABEL NAME
WMAX
4400 min-1
5400 min-1
5700 min-1
WMAX2
4400 min-1
5400 min-1
5700 min-1
WSTD
2150 min-1
2900 min-1
3500 min-1
WJKMAX
2000 min-1
2600 min-1
3000 min-1
WBEMAX
1800 min-1
2400 min-1
2800 min-1
WSZMAX
1800 min-1
2200 min-1
2300 min-1
CMAX
2600 min-1
3100 min-1
4200 min-1
CMAX2
2600 min-1
3100 min-1
4200 min-1
CSTD
1700 min-1
2100 min-1
3050 min-1
CKYMAX
2700 min-1
2700 min-1
2700 min-1
CJKMAX
2500 min-1
2500 min-1
2500 min-1
CBEMAX
2200 min-1
2200 min-1
2200 min-1
CSZMAX
1700 min-1
1700 min-1
1700 min-1
WMIN
1100 min-1
1100 min-1
1100 min-1
CMIN
1100 min-1
1100 min-1
1100 min-1
STARTMC
90 Seconds
90 Seconds
90 Seconds
DWNRATEW
80%
80%
80%
DWNRATEC
70%
70%
70%
SHIFTW
1.00
1.00
1.00
SHIFTC
1.33
1.33
1.33
CLMXTP
30.00
30.00
30.00
TEION
4.00
4.00
4.00
TEIOF
9.00
9.00
9.00
SFTDSW
1.00
1.00
1.00
DFTIM-OTP0
50 Minutes
50 Minutes
60 Minutes
DFTIM-OTP5
60 Minutes
60 Minutes
90 Minutes
DFTIM-OTP10
60 Minutes
60 Minutes
90 Minutes
RAS_AW_024e
RAK-35PSPA
3min.
Notes:
(1) Condition for entering into Cool Dashed mode. When fan set to “Hi” or “Auto and when the compressor speed (P section) due to temperature difference between setting
temperature (including the correction shift only) and room temperature is CMAX or higher.
(2) Cool Dashed will release when i) a maximum 25 minutes is lapsed and ii) room temperature is lower than set temperature –3°C (thermo off) and iii) when room temperature
has achieved setting temperature –1°C then maximum Cool Dashed time will be revised to 20 minutes. And iv) indoor fan is set to Lo and Med fan mode and v) change
operation mode.
(3) During Cool Dashed operation, thermo off temperature is set temperature (with shift value) –3°C. After thermo off, operation continue in Fuzzy control mode.
(4) Compressor minimum “ON” time and “OFF” time is 3 minutes.
(5) During normal cooling mode, compressor maximum rpm CMAX will maintain for 60 minutes if indoor temperature is lower than CLMXTP. No time constrain if indoor temperature is higher than CLMXTP.
(6) When fan is set to “Hi”, compressor rpm will be limited to CSTD.
(7) When fan is set to “Med”, compressor rpm will be limited to CJKMAX.
(8) When fan is set to “Lo”, compressor rpm will be limited to CBEMAX.
(9) During Cool Dashed, when room temperature reaches set temperature –1°C compressor rpm is actual rpm x DWNRATEC.
Notes:
(1) If the room temperature is (cooling preset temperature) - (1.33°C) or less after 30 seconds from starting the operation, the operation is done assuming as the preset temperature =
(room temperature at the time) - (2°C).
(2) The indoor fan is operated in the “Lo” mode. During thermo OFF indoor fan will be OFF for 5 minutes and ON for 1 minute.
(3) When the operation is started by the themostat turning ON, the start of the indoor fan is delayed 32 seconds after the start of compressor operation.
(4) The compressor is operated forcedly for 3 minutes after operation is started.
(5) The minimum ON time and OFF time of the compressor are 3 minutes.
8
8
8
Notes:
(1) Condition for entering into Hot Dashed mode. When fan set to “Hi” or “Auto mode” and i) Indoor temperature is lower than 18°C, and ii) outdoor temperature is lower than
10°C, and iii) compressor speed (P section) due to temperature difference between setting temperature (including the correction shift only) and room temperature is WMAX or
higher.
(2) Hot Dashed will release when i) Room temperature has achieved the set temperature + SFTDSW. ii) Thermo off.
(3) During Hot Dashed operation, thermo off temperature is set temperature (with shift value) +3°C. After thermo off, operation continue in Fuzzy control mode.
(4) Compressor minimum “ON” time and “OFF” time is 3 minutes.
(5) During normal heating mode, compressor maximum rpm WMAX will maintain for 120 minutes if indoor temperature is higher than 18°C. No time limit constrain if indoor
temperature is lower than 18°C and outdoor temperature is lower than 2°C.
(6) During Hotkeep or Defrost mode, indoor operation lamp will blink at interval of 3 seconds “ON” and 0.5 second “OFF”.
(7) When heating mode starts, it will enter into Hotkeep mode if indoor heat exchanger temperature is lower than YNEOF + 0.33°C.
(8) When fan is set to “Med” or “Lo”, compressor rpm will be limited to WBEMAX.
(9) In “Silent” fan mode, if indoor temperature is lower than 18°C, indoor fan will stop. If indoor temperature is higher than 18°C + 0.33°C, fan will continue in “Ultra-Lo” mode.
During Hotkeep or Defrost mode, fan will continue in “silent” mode.
(10) During Hot Dashed or outdoor temperature is lower than –5°C, compressor rpm is WMAX2.
(11) During Hot Dashed, when room temperature reaches set temperature + SFTDSW compressor rpm is actual rpm x DWNRATEW.
Setting Defrosting Inhibit Period
Time
DFTIM_OT P5
DFTIM_OTP 10
DFTIM_OT P0
–10
– 5˚C
0
˚C
Outdoor temperature
Notes:
(1) The first inhibit time after operation start is set to DFTIM_FST.
(2) From the second time onwards, the inhibit time is set according to the time required for
defrosting.
Reverse cycle operation time 㻢 [DEFCOL] : DEFTIM_COL is set.
Reverse cycle operation time < [DEFCOL] : The time corresponding to outdoor temperature is set.
ECO
ECO button
Cooling:0.66ć
Dehumidifying:0.66ć
Set temperature
Heating:0.66ć
Current restrict
Compressor speed
Notes:
Can’t set POWERFUL and ECO at the same time.
During FAN operation,can’t set ECO.
SILENT
Silent button
Indoor
fan
8,WUD+L
+L
0HG
/RZ
6LOHQW
8OWUD/R
Compresson
speed
WSZMAX/CSZMAX
Outdoor
fan
Notes:
Can’t set POWERFUL and SILENT at the same time.
MODEL RAK-18/25/35PSPA
RAC-18/25/35WSPA
COOLING CYCLE
OUTDOOR UNIT
INDOOR UNIT
+27*$63,3(
HEATING
CYCLE
INDOOR UNIT
OUTDOOR UNIT
+27*$63,3(
Procedure for Disassembly and Reassembly
INDOOR UNIT RAK-18/25/35PSPA
1. Front Panel
(1)Pull up the washable panel by holding it at both
lower sides with both hands.
3. Control P.W.B. and Indicating
P.W.B.
(1)Remove each connector from the lead wire.
(2)Remove the four P.W.B. supports from the
control P.W.B.
(3)Pull the support hook at the upper side of the
indication lamp of the indicating P.W.B. and pull
out the P.W.B. forward.
7(0325$5<
6:,7&+
Control P.W.B.
Fig. 1
(2)When the panel opens full, push the inner part
of the right arm into the inside and pull the panel
forward while closing it gradually.
Support hook
Indicating P.W.B.
7(0325$5<
6:,7&+
Fig. 4
Fig. 2
2. Front cover
(1)After removing two screws, pull the center of
the front cover forward and release the claws.
(2)Hold the front cover at both lower sides and
pull them forward to remove.
7(0325$5<
6:,7&+
Fig. 3
4. Tangential
T
air flow fan and fan motor
(1) Remove two screws locking the drain pan.
(2) Press to lower the hook at the center of theunit a little and pull the
claw forward to removethe drain pan.
OUTDOOR UNIT MODEL RAC-18/25/35WSPA
1. Electrical parts
(1)Remove the service value cover lock screws
and lower the cover to remove it.
(2)Remove the top cover lock screw and raise the
cover to remove it.
Fig. 5
(3) Remove the lowerbearing covers.
(4) Remove the locking hook of the lower bearingcover from the
Cabinet.
Upper bearing cover
Fig. 9
Lower bearing cover
Cabinet
Fig. 6
(5) Remove the screws that fix the bearing cover to the left
of the evaporator.
(6) Lift the left side of the evaporator, pull it towards you,
and detach the lug of the bottom of the bearing cover.
(7) Remove the screws that fix the fan motor retainer.
(8) Push the bottom of the evaporator upwards and remove
the lugs of the fan motor retainer.
(9) Loosen the fan-fixing screws and remove the fan.
(3)Remove the front cover lock screw.
(4)Lower the right side of the front cover and pull
it forward. Then, remove the cover from the
hook.
(5)Pull the right side of the front cover a little and
pull up the left side to remove it from the hook.
Fig. 10
Fig. 7
(10) Remove the rubber dampers from the left and right sides
of the fan motor.
(11) Turn the fan motor towards you, thereby removing it.
Fig. 8
(6)Remove each connector and earth cable from
the lead wire. Then,remove the electrical box .
DESCRIPTION OF MAIN CIRCUIT OPERATION
RAK-18/25/35PSPA
1. Power circuit
CN10
XA-6P-Top
6
C131
12V
35V
CJ2
5
4
OUT
5V
5V
L752
R126
0V
0V
IC712
7
R631
Q751
R752
C121
+
-
C122
GND
C123
C114
IN
ZD121
R120
R116
C621
C751
R751
ZD131
D121
IC121
C132
R125
R118
C115
4
Q114
R119
C112
3
1
D111
2
IC111
C116 R117 C113
R112
ZD111
C111
7
+
-
R115
R124
R123
C102
C103
5
6
Q116
1
Q112
8
M
2
L751
R111
R122
L111
R114
Q113
Q115
3
R132
Q111
R121
R131
35V
ICP1
+
-
C133
Q131
ICP2
Indoor Fan
Motor
10
0V
47
12 V power supply
97
57
Power supply voltage
Indoor fan power supply
45
Indoor fan PWM output
68
Indoor fan speed feedback
Fig. 1-1
Power to operate indoor unit (DC35V) is generated at the power supply in outdoor unit and it is sent to indoor unit
through the connecting cord C and D.
Then, DC 12V (12V line) is generated using DC/DC converter from the voltage sent from outdoor unit, as the
control voltage of 12V is required to drive the auto sweep motor and others.
Furthermore, 5V (5V line), which is necessary to drive the microcomputer and to control the fan motor, is generated
using three-terminal regulator IC121.
2. Reset Circuit
5V
2
R523
R522
1
C522
5
Microcomputer
C524
C521
R521
11 Reset
3
IC521
0V
Fig.2-1
Timing chart
Voltage
5.0V
㽳 pin of IC521 supply voltage
RES detecting voltage
RES canceling voltage
4.2V
4.4V
Voltage
㽲 pin of IC521 output voltage
or 㽼 pin of microcomputer
5.0V
Fig.2-2
Reset circuit is to initialize the indoor unit microcomputer when switching ON the power or after recovering from power
failure.
Microcomputer operates when 㽼 pin of the indoor unit microcomputer (reset input) is "Lo" for resetting and "Hi" for heating.
Waveform of each part when switching ON the power and when shutting down is shown in the Fig. 2-2.
After switching ON the power, 㽲 pin of IC521 supply voltage and 㽼 pin of microcomputer becomes Hi when DC5V line
rises and reaches approximately 4.4V or higher.
Then, resetting will be cancelled and microcomputer starts operating.
After shutting down the power, 㽲 pin of IC521 supply voltage and 㽼 pin of microcomputer becomes Lo when DC5V line
falls and reaches approximately 4.2V or lower.
Then, the microcomputer will be in reset condition.
3. Fan Motor Drive Circuit
CN10
6
35V line
5V
Microcomputer
0V
4
5V line
3
A
B
No. of
45
rotation output
L751
Q751
R751
2
C751
R752
C631
Fan Motor
1
0V
0V
No. of
68
rotation detect
M
R631
C
0V
Fig. 3-1
The waveform of
voltage at the
point
T1
T2
T1 = Low No. of rotation
T2 = High No. of rotation
At T2
At T1
The waveform of
voltage at the
point
T1
The waveform of
voltage at the
point
T2
Fig. 3-2
Rotation
The 610Hz PWM pulse shown in Fig. 3-2 from the microcomputer
pin 45 is output to point . The width of this pulse changes with
instruction number of rotations.
This pulse changes to analog voltage by R751 and C751 and it is
applied to the fan motor as instruction voltage number of rotations.
The relationship between the voltage of point
and number of
rotations becomes as shown in Fig. 3-3. (The gap may arise
depending on the condition of unit.)
(about 1200)
The feedback pulse of number of rotation is outputted from the
fan motor and input to micro computer pin 68 . The frequency of
this pulse is 12/60 of the number of rotations. (Ex: 1000min-1
12/60=200Hz) The microcomputer observes this frequency and to
make it as the instruction number of rotation all the time, adjusts
min-1 )
the output pulse width of pin 45 .
If the feedback pulse becomes lower than 100min-1 caused by
0
lock or failure of a fan motor, the fan output stops temporary as
the fan lock is faulty. The pulse will output again after 10 seconds.
If the abnormal in fan lock is detected twice in 10 minutes, the unit
is completely stopped and change to the fault mode which the
timer lamp blinks 10 times.
(
1
2
3
B (V)
Voltage of point 䃢
Fig. 3-3
4
5
6
• When the buzzer sounds, an approx.
3.9kHz square signal is output from
buzzer output pin 83 of the micro
computer. After the amplitude of this
signal has been set to 12Vp-p by a
transistor, it is applied to the buzzer.
The piezoelectric element in the buzzer
oscillates to generate the buzzer's sound.
R6
+
GND
66
INPUT
6. Initial Setting Circuit (IC401)
When power is supplied, the microcomputer reads the data in IC401 (E2PROM) and sets the preheating
activation value and the rating and maximum speed of the compressor, etc. to their initial values.
Data of self-diagnosis mode is stored in IC401; data will not be erased even when power is turned off.
5V
3
4
6
5
C401
0V
0V
5V
R403
8
7
R404
5V
1
2
Microcomputer
82 SCL
81 SDA
} External ROM
IC401 (E2PROM)
Fig. 6-1
0V
7. Temporary Switch Circuit
Temporary
switch
R734
5V
TEMPORARY SW
R629
54
C642
SW211
0V
MICROCOMPUTER
0V
Fig. 7-1
The temporary switch is used to operate the air conditioner temporarily when the wireless remote control
is lost or faulty.
The air conditioner operates in the previous mode at the previously set temperature. However, when the
power switch is set to OFF, it starts automatic operation.
8. Room Temperature Thermistor Circuit
A room temperature thermistor circuit is shown in Fig. 8-1.
According to room temperature, the voltage of point
becomes as it is shown in Fig.8-2.
(V)
5V
Room Temperature
Thermistor
Voltage of point
90
A
䃢
4
Microcomputer
R305
Room
temperature input
C302
R301
5
3
2
1
0
0
10
20
30
Room temperature (㷄 )
Fig. 8-2
Fig. 8-1
9. Heat Exchanger Thermistor Circuit
Heat exchanger temperature is noticed inside the room
(1) Preheating
(2) Low-temperature defrosts at cooling and dehumidification operation time.
(3) Not working of reversing valve or detection of opening of heat exchange thermistor is controlled.
According to heat exchange temperature, the voltage of point
becomes as it is shown in Fig. 9-2.
(V)
5V
A
䃢
4
Microcomputer
R306
Voltage of point
Heat exchanger
thermistor
91 Heat exchanger
input
R302
5
C303
3
2
1
0
-10 0
0V
0V
10 20 30 40
Heat temperature ( 㷄)
Fig. 9-2
Fig. 9-1
40
R921
10
DSW1
R923
R924
R541
R642
R544
R542
R610
R922
R543
DSW1
10
10
10
93
RAC-18/25/35WSPA
TERMINAL
BOARD
! ()*
''
$%
䌓䌅䌌䌆䇭 䌃䌈䌅䌃䌋
䌌䋨 䌁䋩䌎䋨 䌂䋩䇭 䇭 䌃䇭 䇭 䌄
䌓䌗
䌔䌅䌓䌔䇭䌓䌗䌉䌔䌃䌈
%
&'
%
"
"
"#
"
"
"
3. Latch-type reversing valve control circuit
㶎Timing for voltage measurement
Forcible cooling
switch (test switch)
1s
1s
1s
ON
Reversing valve
OFF
Start
Compressor
Stop
Fig. 3-1
Reversing valve
4
3
2
䌃䌎䋲
Red
䌖䌈䋭䋲䌐
R䋴䋴䋱
Cooling/heating
switchover relay
䋨 2P lacking䋩
Reversing valve relay
䋨 䌒䌌䋱 䋩
䋨 䌒䌌䋲 䋩
䋱䋲䌖
Reversing valve
relay coil
䋱䋲䌖
䌁䌃 220䌖-230V
䌄䌂䋱
1
Cooling/heating
relay coil
䊶 This model comes equipped with a latch-type
reversing valve.
䊶 The latch-type reversing valve is so designed
that its valve is "slid" in a specified direction
according to a specific operation mode, thereby
switching freezing channels and retaining the
built-in permanent magnet.
䊶 The latch-type reversing valve control circuit is
so designed that, in response to an operation
command from the indoor microcomputer, the
reversing valve coil receives a current in a
specified direction according to a specific
operation mode, thereby sliding the valve.
䊶 The product is energized twice at increments
of 1 second as illustrated in Fig. 3-1, starting
immediately before compressor startup.
䊶 During forcible cooling, the product is energized
twice at increments of 1 second as illustrated in
Fig. 3-1, starting immediately after the forcible
freezing switch is turned on.
䊶 When stopped, the product holds the valve in
the position where it was before stoppage.
䌈I䌃
IC2
Microcomputer
29
11
6
36 Reversing valve ON
28
10
7
35 Reversing valve cooling/
heating switchover
Cooling Lo
Heating Hi
Fig. 3-2
䊶 Before conducting an energization check of the reversing valve, detach the connector CN2, measure the resistance at both
ends of the connector, and ensure that it is within the range [400 㱅 㫧100 㱅]. Check for energization only when the above
test proves the product to be normal. If it is abnormal, it should be a lead wire break or a reversing valve failure.
䊶 Voltage when measured with a tester while the reversing valve is energized (at the timing for voltage measurement)
㶎Hold down the "test switch" of the outdoor electrical parts for at least 1 second.
䇭 Energization begins 1 second after the "test switch" is pressed.
Tester type
Connect pin 㽵 of the CN2 to the positive terminal
of the tester.
Connect pin 㽲 of the CN2 to the negative terminal
of the tester.
Connect pin 㽲 of the CN2 to the positive terminal of the tester.
Connect pin 㽵 of the CN2 of the negative terminal of the tester.
Analog tester
The pointer will keep swinging up to about 150 V DC,
goes back to 0 V, and then swing back to about 150 V
DC.
The pointer will swing in reverse direction.
Digital tester
The pointer will momentarily display a high value, go
back to 0 V, and then display a large value again.
The tester will display a large negative value, go back to 0 V,
and then display a negative large value.
䊶 When the voltage is measured with a tester with the timing for voltage measurement, and if the pointer swings as illustrated
in the above table, then the product should be normal. (There are dispersions with testers. Moreover, a digital tester often
results in its reading being illegible. An analog tester is therefore recommended.)
㶎The product is energized only twice a second. Missing the timings will therefore result in failure to measure normal operations.
㶎If the reversing valve proper is normal, it will synchronize with the timing for voltage measurement and the reversing valve
itself will click twice. If this click is heard, the reversing valve should be functioning normally.
㶎If the energization check shows an abnormality, the electrical parts should be out of order.
5. Electric expansion valve circuit
RED
22
12
5
34
23
13
4
32
24
14
3
30
25
15
2
29
3.15A Fuse
Switching
power source
3.15A
3.15A
(DC260-360V)
TERMINAL
BOARD
Fig. 7-1 System power module circuit (U+ is ON, V- is ON)
In the diagram, U+,V+ and W+ are called the
"upper arm", U-, V- and W-, the "lower arm".
module (IPM).
Fig. 7-1 shows peripheral circuits of intelligent power
7. Intelligent power module circuit (IPM circuit)
R660
C024
C023
C022
C021
R008
C032
Intelligent power module switches power supply current according to position of the compressor motor
rotor.
The switching order is as shown in Fig. 7-2.
At point ( : U+ is ON, V- is ON (circuit in Fig. 7-1)
At point ) : U+ is chopped (OFF), V- is ON (circuit in Fig. 7-4)
E
V
+
W
F
+
U+
V+
Upper arm
transistor
Time
Lower arm
transistor
U-
T
V-
W-
Fig. 7-2 Switching order of power module
Upper arm transistor is controlled to ON/OFF by 2.5kHz-5kHz chopper signal. Rotation speed of the
compressor is proportional to duty ratio (ON time/ ON time + OFF time) of this chopper signal.
Time T in Fig. 7-2 shows the switching period, and relation with rotation speed (N) of the compressor is
shown by formula below;
N = 60/2 X 1/T
Fig. 7-3 shows voltage waveform at each point shown in Figs. 7-1 and 7-4. First half of upper arm is
chopper, second half is ON, and first half of lower arm is chopper, second half is ON.
U
+
U - transistor ON
transistor chopped
Voltage at A
V
280V-300V
Chopping period
T
Chopping period (208嘕 sec.)
ON
Upper arm transistor
Current at B
Fig. 7-3 Voltage waveform at each point
When power is supplied U+ V- , because of that U+ is chopped, current flows as shown below;
(1) When U+ transistor is ON: U+ transistor U coil V coil V- transistor DC current detection
resistor Point % (Fig. 7-3)
(2) When U+ transistor is OFF: (by inductance of motor coil) U coil
U- diode Point $ (Fig. 7-4)
V coil
V-transistor
C024
C023
C022
C021
C032
R008
Fig. 7-4 Power module circuit (U+ is OFF, V– is ON)
Since current flows at point B only when U+ transistor and V– transistor are ON, the current waveform
at point B becomes intermittent waveform as shown in Fig. 7 -3. Since current at point B is approximately
proportional to the input current of the air conditioner, input current is controlled by using DC current
(Id) detection resistor.
<Reference>
If power module is defected, self diagnosis lamps on the MAIN P.W.B. may indicate as shown below:
Table 7 -1
Fig. 7-5
6(59,&(&$//4$
02'(/ RAK-18/25/35PSPA
&22/,1*02'(
4
7KHFRPSUHVVRUKDVVWRSSHG
VXGGHQO\GXULQJFRROLQJ
RSHUDWLRQ
$
&KHFNLILQGRRUKHDW
H[FKDQJHULVIURVWHG
:DLWIRUPLQXWHVXQWLOLWLV
GHIURVWHG
,IWKHDLUFRQGLWLRQHURSHUDWHVLQ
FRROLQJPRGHZKHQLWLVFROG
WKHHYDSRUDWRUPD\JHWIURVWHG
'(+80,',)<,1*02'(
4
6RXQGRIUXQQLQJZDWHULVKHDUGIURP
LQGRRUXQLWGXULQJGHKXPLGLI\LQJ
$
1RUPDOVRXQGZKHQUHIULJHUDQWIORZVLQSLSH
4
&RPSUHVVRURFFDVLRQDOO\GRHVQRW
RSHUDWHGXULQJGHKXPLGLI\LQJ
$
&RPSUHVVRUPD\QRWRSHUDWHZKHQURRPWHPSHUDWXUH
LV㷄RUOHVV
4
&ROGDLUFRPHVRXWGXULQJD
GHKXPLGLI\LQJRSHUDWLRQ
$
7RLPSURYHWKHGHKXPLGLILFDWLRQHIILFLHQF\SHUIRUPV
TXLHWIDQRSHUDWLRQ7KHUHIRUHWKHDLULVFROGDQGLWLV
QRWDPDOIXQFWLRQ
4
7KHRSHUDWLRQGRHVQRWVWRSHYHQE\
VHWWLQJWKHWHPSHUDWXUHKLJKHUWKDQ
URRPWHPSHUDWXUHRQWKHUHPRWH
FRQWUROOHU
$
,WVHWVWRSHUIRUPGHKXPLGLI\LQJRSHUDWLRQE\VHWWLQJ
WKHWHPSHUDWXUHVOLJKWO\ORZHUWKDQUHPRWHFRQWUROOHU
VHWWLQJ
+($7,1*02'(
4
7KHFLUFXODWLRQVWRSVRFFDVLRQ
DOO\GXULQJ+HDWLQJPRGH
$
,WRFFXUVGXULQJGHIURVWLQJ
:DLWIRUPLQXWHVXQWLO
WKHFRQGHQVHULVGHIURVWHG
4
:KHQWKHIDQVSHHGLVVHWDW
+,*+RU0('WKHIORZLV
DFWXDOO\:HDN
$
$WWKHEHJLQQLQJRIKHDWLQJ
WKHIDQVSHHGUHPDLQV
/2:IRUVHFRQGV
,I+,*+LVVHOHFWHGLW
VZLWFKHVWR/2:DQGDJDLQ
WR0('DIWHUDGGLWLRQDO
VHFRQGV
4
+HDWLQJRSHUDWLRQVWRSVZKLOH
WKHWHPSHUDWXUHLVSUHVHWDW
$
,IWHPSHUDWXUHLVKLJKLQWKH
RXWGRRUKHDWLQJRSHUDWLRQ
PD\VWRSWRSURWHFWLQWHUQDO
GHYLFHV
$872)5(6+'()5267,1*
4
$IWHUWKH212))EXWWRQLVSUHVVHGWR
VWRSKHDWLQJWKHRXWGRRUXQLWLVVWLOO
ZRUNLQJZLWKWKH23(5$7,21ODPS
OLJKWLQJ
$
$XWR)UHVK'HIURVWLQJLVFDUULHGRXWWKHV\VWHP
FKHFNVWKHRXWGRRUKHDWH[FKDQJHUDQGGHIURVWVLW
DVQHFHVVDU\EHIRUHVWRSSLQJRSHUDWLRQ
$87223(5$7,21
4
)DQVSHHGGRHVQRWFKDQJHZKHQIDQ
VSHHGVHOHFWRULVFKDQJHGGXQLQJDXWR
RSHUDWLRQ
$
$WWKLVSRLQWIDQVSHHGLVDXWRPDWLF
4
+RZLVWKHDXWRPDWLFRSHUDWLRQPRGH
GHWHUPLQHG"
$
$FFRUGLQJWRWKHURRPWHPSHUDWXUHDQGRXWVLGH
WHPSHUDWXUHKHDWLQJRUFRROLQJRSHUDWLRQLV
DXWRPDWLFDOO\VHOHFWHG5HIHUWRWKHEDVLFRSHUD
WLRQVHFWLRQ
4
7KHURRPWHPSHUDWXUHFDQQRWEH
FRQWUROOHGDWDQDXWRPDWLFRSHUDWLRQ
$
,WLVDXWRPDWLFDOO\VHWDVIROORZV
$WFRROLQJDQGKHDWLQJ6HWDWʝ
7KHURRPWHPSHUDWXUHVHWWLQJFDQEHUDLVHGʝ
E\´µRUORZHUHGʝE\´µ
1,&(7(03(5$785(5(6(59$7,21
4
:KHQRQWLPHUKDVEHHQSURJUDPPHG
RSHUDWLRQVWDUWVEHIRUHWKHSUHVHWWLPH
KDVEHHQUHDFKHG
$
7KLVLVEHFDXVH1LFHWHPSHUDWXUHUHVHUYDWLRQ
IXQFWLRQLVRSHUDWLQJ7KLVIXQFWLRQVWDUWVRSHUDWLRQ
HDUOLHUVRWKHSUHVHWWHPSHUDWXUHLVUHDFKHGDW
WKHSUHVHWWLPH2SHUDWLRQPD\VWDUWPD[LPXP
PLQXWHVEHIRUHWKHSUHVHWWLPH
4
'RHV1LFHWHPSHUDWXUHUHVHUYDWLRQ
IXQFWLRQRSHUDWHGXULQJGHKXPLGLI\LQJ"
$
,WGRHVQRWZRUN,WZRUNVRQO\GXULQJFRROLQJDQG
KHDWLQJ
4
(YHQLIWKHVDPHWLPHLVSUHVHWWKH
RSHUDWLRQVWDUWWLPHYDULHV
$
7KLVLVEHFDXVH1LFHWHPSHUDWXUHUHVHUYDWLRQ
IXQFWLRQLVRSHUDWLQJ7KHVWDUWWLPHYDULHV
DFFRUGLQJWRWKHORDGRIURRP6LQFHORDGYDULHV
JUHDWO\GXULQJKHDWLQJWKHRSHUDWLRQVWDUWWLPHLV
FRUUHFWHGVRLWZLOOYDU\HDFKGD\
Q4
When the heating operation is started,
the indoor fan does not start
immediately and the damper at the
bottom air outlet occasionally does not
open.
A4
This is because the preheating device is working.
It will not start to drive the fan until the refrigerating
cycle warms up and warm air blows. Wait for a while.
The damper does not open either during preheating
or for one minute after preheating is finished.
27+(56
$
7KLVLVEHFDXVHWKHFRRO
ZLQGSUHYHQWLRQIXQFWLRQ
LVRSHUDWLQJDQGGRHVQRW
LQGLFDWHDIDXOW
7KHKHDWH[FKDQJHUWHPSHUDWXUHLV
VHQVHGLQWKHDXWRIDQVSHHGPRGH
:KHQWKHWHPSHUDWXUHLVORZWKHIDQ
VSHHGYDULHVDPRQJKLJKDLUIORZORZDLU
IORZDQGEUHH]H
4
7KHLQGRRUIDQYDULHV
DPRQJKLJKDLUIORZORZ
DLUIORZDQGEUHH]HLQWKH
DXWRIDQVSHHGPRGH
+HDWLQJRSHUDWLRQ
4
/RXGQRLVHIURPWKHRXWGRRUXQLWLV
KHDUGZKHQRSHUDWLRQLVVWDUWHG
$
:KHQRSHUDWLRQLVVWDUWHGWKHFRPSUHVVRUURWDWLRQ
VSHHGJRHVWRPD[LPXPWRLQFUHDVHWKHKHDWLQJRU
FRROLQJFDSDELOLW\VRQRLVHEHFRPHVVOLJKWO\ORXGHU
7KLVGRHVQRWLQGLFDWHDIDXOW
4
1RLVHIURPWKHRXWGRRUXQLW
RFFDVLRQDOO\FKDQJHV
$
7KHFRPSUHVVRUURWDWLRQVSHHGFKDQJHVDFFRUGLQJWR
WKHGLIIHUHQFHEHWZHHQWKHWKHUPRVWDWVHWWHPSHUDWXUH
DQGURRPWHPSHUDWXUH
7KLVGRHVQRWLQGLFDWHDIDXOW
4
7KHUHLVDGLIIHUHQFHEHWZHHQWKHVHW
WHPSHUDWXUHDQGURRPWHPSHUDWXUH
$
7KHUHPD\EHDGLIIHUHQFHEHWZHHQWKHVHWWHPSHUDWXUH
DQGURRPWHPSHUDWXUHEHFDXVHRIFRQVWUXFWLRQRI
URRPDLUFXUUHQWHWF6HWWKHWHPSHUDWXUHDWD
FRPIRUWDEOHOHYHOIRUWKHVSDFH
4
$LUGRHVQRWIORZLPPHGLDWHO\DIWHU
RSHUDWLRQLVVWDUWHG
$
3UHOLPLQDU\RSHUDWLRQLVSHUIRUPHGIRURQHPLQXWH
ZKHQWKHSRZHUVZLWFKLVWXUQHGRQDQGKHDWLQJRU
GHKXPLGLI\LQJLVVHW7KHRSHUDWLRQODPSEOLQNVGXULQJ
WKLVWLPHIRUKHDWLQJ7KLVGRHVQRWLQGLFDWHDIDXOW
4
7KHXQLWLVRSHUDWHGDIWHUEXLOWLQ
LQVWDOODWLRQEHKLQGWKHODWWLFHGRRU,W
WXUQVRIIIRUDORQJWLPHDQGWKHURRPLV
QRWZDUPHGFRROHG
$
&KHFNWRVHHLIZDUPFRRODLULVEHLQJVKRUWFLUFXLWHG
EHKLQGWKHODWWLFHGRRU$VKRUWFLUFXLWLVOLNHO\WRRFFXU
ZKHQWKHGHIOHFWRUSRVLWLRQLVQRWDSSURSULDWHWKH
ODWWLFHGRHVQRWKDYHDELJHQRXJKRSHQLQJDQGRU
WKHXQLWLVLQVWDOOHGLQWKHLQQHUSDUW,QVWDOOWKHXQLWDV
QHDUWKHODWWLFHGRRUDVSRVVLEOH
7528%/(6+227,1*
02'(/ RAC-18/25/35WSPA
PRECAUTIONS FOR CHECKING
Outdoor Controller
Point
400 F
4
WARNING
I.P.M.
Power
Compressor
motor
Indoor Controller
Control
P.W.B.
Remember that
voltage of 175 V is
applied to the 0V line
on the P.W.B. or the
like as shown in the
right diagram.
line
Point
Main
P.W.B.
Voltage at point A
Ground voltage
350V
Point B (0V line)
Always keep your hands
and metallic things away
from the cabinet.
WARNING
DANGER!
Don't install
the ground
line.
When using an
oscilloscope, never
ground it.
Don't forget that high
voltage as noted in
the figure above may
apply to the
oscilloscope.
STRUCTURE OF AN INDOOR UNIT ELECTRIC PARTS
RAK-18/25/35PSPA
ELEC. COVER
FIXTURE SCREW
FIXTURE SCREW
Removing electrical parts
1. Remove the electrical parts cover.
2. Remove the connectors from the CN1 (heat exchange
thermistor), CN15 (stepping motor) and CN10 (fan motor).
3. Remove two lock screws.
4. Remove the electrical parts in the direction of arrow.
When installing the parts, use
caution not to pinch any code
between the part and cabinet.
CN3
CN10
CN12
CN15
CN1
Removing the indicating P.W.B.
1. Remove the connector from the CN12 on
the control P.W.B.
2. Remove the upper hook from the indicating
P.W.B. lock resin, pull the P.W.B. forward a
little and remove it.
Removing control P.W.B.
1. Remove the connectors from the CN12.
2. Remove the P.W.B. from the P.W.B. support.
RAS_AW_063-082e
THE SUPPORT FUNCTION OF FAILURE DIAGNOSIS
No.
Function Name
Description
1
Self-diagnosis indication function
<Indicating a failure on the indoor
unit side>
• The “timer lamp” indicates a mode of failure detected
on the indoor or outdoor unit side by blinking
frequency.
• A failure detected on the outdoor unit side will be
indicated by the “timer lamp” blinking 4 times after a
retry operation has been performed several times.
Note: In some failure modes, only the retry operation is
repeated without lamp indication.
<Failure modes that will repeat a retry operation without
the indoor unit lamp indication are as follows:>
OH thermistor temperature rise
Outdoor unit communication error
Power voltage abnormal
Less frequent defects
<Indicating a failure on the outdoor
unit side>
• The “LD301” indicates a mode of failure detected on
the outdoor unit side by blinking frequency.
Upon failure detection, the outdoor unit will shut down
and the LD301 continues to blink until the unit is reset.
(In the event of communication errors, the LD301
continues to blink until communication is restored.)
TROUBLESHOOTING WHEN TIMER LAMP BLINKS.
Model: RAK-18/25/35PSPA
Perform troubleshooting according to the number of times the indoor timer lamp and outdoor LD301
blink.
SELF-DIAGNOSIS LIGHTING MODE
Model: RAK- 18/25/35PSPA
1
2
(
Interface voltage error
Lights for 0.35 sec. at interval of 0.35 sec.)
<Cautions>
(1)
(2)
(3)
RAS_AW_063-082e
If the interface circuit is faulty when power is supplied, the self-diagnosis display will not be displayed.
If the indoor unit does not operate at all, check if the connecting cable is connected to the outdoor unit.
To check operation again when the timer lamp is blinking, you can use the remote control for operation
(except for mode mark 1).
SELF-DIAGNOSIS LIGHTING MODE
MODEL RAC-18/25/35WSPA
77
OUTDOOR UNIT
Remove the compressor connector.
LD301(SELF DIAGNOSIS LAMP)
If your first attempt
fails, wait 3 minutes
(for the unit to restart) and check the
self-diagnosis lamp
status again.
With the unit set in the operating
state, press the cooling/heativg/
dehvmidity button.
Does the unit operate for
approximately 2 seconds (the
LD301 coming on) and then
stop due to a failure of switching
(the lamp blinking 4 times)?
Yes
• Check the drive
circuit (IPM) using
the PRD checker.
• Check the position
sensor circuit.
Normal
No
Check the refrigerating
cycle.
Check outdoor electrical parts.
MODEL RAK-18/25/35PSPA;RAC-18/25/35WSPA
&+(&.,1*7+(,1'22581,7(/(&75,&$/3$576
3RZHUGRHVQRWFRPHRQQRRSHUDWLRQ
1R
,V9'&EHLQJJHQHUDWHG
EHWZHHQWHUPLQDOV&DQG'RQ
WKHWHUPLQDOERDUG"
,V9$&EHLQJJHQHUDWHG 1R
EHWZHHQWHUPLQDOV/DQG1RQ
WKHRXWGRRUXQLWWHUPLQDOERDUG"
<HV
,V9'&EHLQJJHQHUDWHG
EHWZHHQWHUPLQDOV&DQG'RQ
WKHRXWGRRUXQLWWHUPLQDOERDUG"
&KHFNWKHLQGRRURXWGRRUXQLW
FRQQHFWLQJFRUGDQGFRUUHFWDQ\
GHIHFWLYHVHFWLRQZURQJFRQQHF
WLRQLQFRPSOHWHLQVHUWLRQ
<HV
1R
<HV
<HV
$UHFRQQHFWLRQZLUHV&DQG'
UHYHUVHG"
1R
$YHFRQWUROYROWDJHV99
EHLQJJHQHUDWHGQRUPDOO\"
1R
&RUUHFWWKHFDEOHFRQQHFWLRQ
&KHFNWKHRXWGRRUXQLWSRZHU
FLUFXLWDQGUHSDLUWKHGHIHFWLYH
VHFWLRQ
&KHFNDFFRUGLQJWRWKHSURSHU
PHWKRGIRUFKHFNLQJWKHSRZHU
FLUFXLW
<HV
<HV
'RWKHDLUGHIOHFWRUVSHUIRUP
LQLWLDORSHUDWLRQZKHQWKHSRZHU
EUHDNHULVWXUQHGRQDQGRII"
&KHFNWKHLQGLFDWLQJ3:%
FRQQHFWLRQFRUGDQGOLJKW
UHFHLYLQJXQLW
1R
,VWKHPLFURFRPSXWHUUHVHWLQSXW 1R
SLQ 㽸 +L"
&KHFNWKHUHVHWFLUFXLWDQG
UHSDLUDQ\GHIHFWLYHVHFWLRQ
<HV
,VWKHPLFURFRPSXWHUFORFNVLJQDO
1R
0+]DWSLQ 㽻, 㽼 EHLQJ
JHQHUDWHGQRUPDOO\"
5HSODFHWKHPLFURFRPSXWHUDQG
RVFLOODWRU
<HV
5HSODFHWKHFRQWURO3:%
3HUIRUPILQDORSHUDWLRQFKHFN
2XWGRRUXQLWGRHVQRWRSHUDWHEXWUHFHLYHVUHPRWHLQIUDUHGVLJQDO
6HWURRPWHPSHUDWXUH㷄LQWKHFRROLQJ
PRGHRUWR㷄LQWKHKHDWLQJPRGHDQG
SUHVVWKHVWDUWVWRSEXWWRQ
5HPRYHWKHRXWGRRUXQLWFRYHUDQG
HOHFWULFDOSDUWVFRYHUDQGFKHFN
VHOIGLDJQRVLVODPS/'
&KHFNWKHURRPWHPSHUDWXUH
WKHUPLVWRULILWLVGHIHFWLYH
UHSODFHLW
QRUPDOYDOXHV!
䇭 䇭 䇭 㷄→DSSUR[Nї
䇭 䇭 䇭 㷄→DSSUR[Nї
䇭 䇭 䇭 㷄→DSSUR[Nї
+,&
7(676:,7&+
/'
/'
/'
&KHFNWKHKHDWH[FKDQJHU
WKHUPLVWRULILWLVGHIHFWLYH
UHSODFHLW
QRUPDOYDOXHV!
䇭 䇭 䇭 㷄→DSSUR[Nї
䇭 䇭 䇭 㷄→DSSUR[Nї
䇭 䇭 䇭 㷄→DSSUR[Nї
<HV
,30
3:%&RQWURO
'RHV/'EOLQNRQHWLPH"
㶎5HSHDWVVHFRQGRQDQG
VHFRQG RII
1R
7LPHUODPSEOLQNVQLQHWLPHV
<HV
'RHVRXWGRRUHOHFWULFDOSDUW
/'EOLQNQLQHWLPHV"
&RPPXQLFDWLRQFLUFXLW
VHOIGLDJQRVLVLVGRHVE\WKH
RSHUDWLRQRIWKHUHPRWHFRQWURO
OHU
&KHFNRXWGRRUHOHFWULFDOSDUWV
DQGUHSDLUDQ\GHIHFWLYHSDUWV
DURXQGWKHRXWGRRULQWHUIDFH
WUDQVPLWWLQJFLUFXLW
$VIRUWKHGLDJQRVLVUHVXOW"
7LPHU/DPSEOLQNV
WKUHHWLPHV
&KHFNLQGRRUHOHFWULFDOSDUWV
DQGUHSDLUDQ\GHIHFWLYHSDUWV
DURXQGWKHLQGRRULQWHUIDFH
WUDQVPLWWLQJFLUFXLW
<HV
&KHFNRXWGRRUHOHFWULFDOSDUWV
DQGUHSDLUDQ\GHIHFWLYHSDUWV
'RHV/'VZLWFKRIIVHYHUDO
VHFRQGVDIWHULWOLJKWV"
3HUIRUPILQDORSHUDWLRQFKHFN
. ……
&KHFNLQJWKHPDLQ3:%SRZHUFLUFXLW
,V9EHLQJRXWSXWDWSLQ
㽲UHODWLYHWR9DWSLQ㽴
RI&1"
1R
&KHFNZKHWKHUWKHFRQQHFWLRQFDEOHLV
GLVFRQQHFWHGRUFRQQHFWHGUHYHUVHO\
&KHFNWKHRXWGRRUXQLWPDLQ3:%LILWLV
RN
<HV
,V9EHLQJRXWSXWDW
UHODWLYHWR9DWRI
&"
1R
<HV
,V,&3QRUPDO"/HVVWKDQ
їLVQRUPDO$ERYHїLV
EORZQRSHQ
1R
5HSODFH,&3&KHFNZKHWKHU
GHIOHFWRUPRWRUVKRUWHGDQG
DOVRFKHFN,&3,I,&
4&DQG='DUH
GHIHFWLYH,&3ZLOOEH
RSHQHGDJDLQ
<HV
,VWKHWKHUPDOIXVHRQWKH
WHUPLQDOERDUGEORZQ
RSHQ"
<HV
5HSODFHWKHWHUPLQDOERDUG
0DNHVXUHWRLQVHUWWKH
FRQQHFWLRQFDEOHXQWLOWKH
HQG
1R
5HSODFH4,&
,V'&9EHLQJRXWSXW"
5HSODFH,&&KHFNZKHWKHU
9OLQHLVVKRUWHGLIVR,&3LV
RSHQHGDJDLQ
1R
<HV
3HUIRUPILQDORSHUDWLRQFKHFN
6HOI'LDJQRVLV0HPRU\)XQFWLRQ
'HIHFWLYHPRGHVVWRUHGLQWKHQRQYRODWLOHPHPRU\RIWKHLQGRRUXQLWDUHUHLQGLFDWHGE\WKHUHPRWHFRQWUROOHURSHUDWLRQ7KLV
LVXVHIXOWRFKHFNWKHGHIHFWLYHPRGHZKHQVZLWFKLQJ2))WKHSRZHURUUHVWDUWLQJWKHXQLWRSHUDWLRQZLWKRXWFKHFNLQJWKH
QXPEHURIEOLQNLQJRIWKHGHIHFWLYHLQGLFDWLRQODPS7KHGHIHFWLYHPRGHZKLFKRFFXUUHGWKHODVWLVPHPRUL]HG
'HIHFWLYHPRGHVRIZKLFKRFFXUUHQFHIUHTXHQF\LVWRRORZWRLQGLFDWHRQWKHLQGRRUXQLWDUHDOVRVWRUHGLQWKHPHPRU\WKXV
GHIHFWLYHSKHQRPHQRQZKLFKZDVQRWFKHFNHGDWWKHYLVLWFDQEHIRXQGE\FOHDULQJWKHPHPRU\DQGUHFKHFNLQJWKHPHPRU\
FRQWHQWVODWHURQ
5HLQGLFDWLRQPHWKRGIRUGHIHFWLYHPRGH
7XUQWKHFLUFXLWEUHDNHU2))DQGVHWWKHUHPRWHFRQWUROOHU6723SRVLWLRQ
1RLQGLFDWLRQVWDWXV
7XUQWKHFLUFXLWEUHDNHU21
6HWWKHUHPRWHFRQWUROOHU&22/DQGWREHVHW㷄DQGSUHVVWKH䌛 䇭 䌝EXWWRQ
ZKLOHSUHVVLQJWKH䌛 㺢䌝 RIWHPSHUDWXUHEXWWRQV7UDQVPLVVLRQ
7KHPDLQXQLWPDNHVWKHUHFHLYLQJVRXQG䌛 3L䌝 DQGEHFRPHVWKHGHIHFWLYHLQGLFDWLRQ
PRGH7LPHUODPSJRHVRQDQGRIIEXWLIWKHXQLWKDVQRPHPRU\WKHLQGLFDWLRQLV
QRWVKRZQ
)LQLVKDIWHUWXUQLQJWKHFLUFXLWEUHDNHU2))3OHDVHWXUQ2))RQFHZLWKRXWIDLO
&OHDUPHWKRGIRUGDWDRIGHIHFWLYHPRGH
3URFHHGWKHUHLQGLFDWLRQRIGHIHFWLYHPRGHSURFHHGZLWKRXWIDLODIWHUKDYLQJWKH
UHLQGLFDWLRQGRQRWRSHUDWHWKHUHPRWHFRQWUROOHUH[FHSWIRULQGLFDWHGRQHV
7XUQWKHFLUFXLWEUHDNHU2))&RQWLQXH2))PRUHWKDQVHFRQGV
7XUQWKHFLUFXLWEUHDNHU21
6HWWKHUHPRWHFRQWUROOHU+($7DQGWREHVHW㷄DQGSUHVVWKH䌛 䇭 䌝 EXWWRQ
ZKLOHSUHVVLQJWKH䌛 㺣䌝 RIWHPSHUDWXUHEXWWRQV7UDQVPLVVLRQ
)LQLVKWKHFOHDUDIWHUKDYLQJWKHUHFHLYLQJVRXQG䌛 3LL䌝RIRQHVHFRQG
7XUQWKHFLUFXLWEUHDNHU2))DQGILQLVK3OHDVHWXUQ2))RQFHZLWKRXWIDLO
1RWHV
7KLVIXQFWLRQLVYDOLGRQO\RQFHULJKWDIWHUVZLWFKLQJ21WKHSRZHUDQGGRHVQRWZRUNLIRWKHUUHPRWHFRQWUROOHURSHUDWLRQ
ZDVPDGHSULRUWRLW
7DNHQRWHWKDWWKLVIXQFWLRQPD\QRWZRUNZKHQQRWIROORZLQJWKHDERYHSURFHGXUHV
,ILWGRHVQRWZRUNVZLWFK2))WKHSRZHUDQGWU\DJDLQ
,IQRWKLQJLVVWRUHGLQWKHPHPRU\WKHODPSGRHVQRWEOLQNHYHQLIUHLQGLFDWLRQRSHUDWLRQLVFDUULHGRXW
$IWHUFDUU\LQJRXWUHLQGLFDWLRQRSHUDWLRQWKHUHPRWHFRQWUROOHURSHUDWLRQZLOOQRWEHDFFHSWHGRQFHWKHGDWDKDVEHHQ
FOHDUHG7RFDUU\RXWQRUPDORSHUDWLRQVZLWFK2))WKHSRZHUEHIRUHKDQG
MODEL RAC-18/25/35WSPA
WHVW
5HSODFHRXWGRRU3:% 0DLQ
5HSODFHRXWGRRU3:% 0DLQ
5HSODFHRXWGRRU3:%0DLQ
9
$& 9
3:% V
5HSODFHRXWGRRU3:% 0DLQ
3:% V
3:% V
5HSODFHRXWGRRU3:% 0DLQ
5HSODFHIDQPRWRU
5HSODFHRXWGRRU3:% 0DLQ
6ZLWFK 2)) PDLQ SRZHU VXSSO\
6KRUW FLUFXLW EHWZHHQ -: DQG -:
6ZLWFK 21 PDLQ SRZHU VXSSO\ ² /' ZLOO EOLQN WLPH
:LWKLQ PLQXWHV 3UHVV 7HVW 6ZLWFK IRU VHFRQG RU PRUH
6HOIGLDJQRVLVUHVXOWZLOOEHVKRZQ²/'ZLOO21/,7DQG/'ZLOOEHEOLQNLQJ7KHQUHIHUWRGLDJQRVLV
WDEOH 6ZLWFK 2)) PDLQ SRZHU VXSSO\ 7KHQ UHOHDVH EDFN -: DQG -: WR RULJLQDO FRQGLWLRQ QR VKRUW
FLUFXLW FRQGLWLRQ
,I VWHS 1R LV QRW FDUULHG RXW WKH V\VWHP ZLOO QRW RSHUDWH SURSHUO\ XQWLO PLQXWHV KDV ODSVHG DIWHU
UHVWRUH WKH SRZHU VXSSO\
䇭 䃂
,Q FDVH RI VHUYLFH SHUVRQ IRUJRW WR UHOHDVH -: DQG -: WR RULJLQDO FRQGLWLRQ
&DVH ,I PDLQ SRZHU VXSSO\ FRQWLQXRXVO\ 21 RXWGRRU PLFURFRPSXWHU ZLOO NHHS VKRZLQJ GLDJQRVLV UHVXOW /' ZLOO
21 DQG /' ZLOO EOLQNV
&DVH ,I PDLQ SRZHU VXSSO\ 2)) DW RQFH WKHQ VZLWFK 21 DJDLQ
D 2XWGRRU PLFURFRPSXWHU ZLOO ZDLW WKH VHOI FKHFN FRPPDQG E\ SUHVVLQJ WHVWVHUYLFH VZLWFK ZLWKLQ PLQXWHV
/' EOLQNV WLPH
,I WHVWVHUYLFH VLJQDO LQSXW LV QRW UHFHLYHG XQLW ZLOO UHWXUQ WR QRUPDO RSHUDWLRQ PRGH DIWHU WKLV PLQXWHV KDV
ODSVHG /' 2)) DQG /' EOLQNV WLPH
&DVH ,I PDLQ SRZHU VXSSO\ 2)) DW RQFH WKHQ VZLWFK 21 DJDLQ DQG RQ LQGRRU XQLW E\ UHPRWH FRQWURO
D ,QGRRUXQLWZLOOUHFHLYHUHPRWHFRQWUROVLJQDODQGVHQGVLJQDOWRRXWGRRUXQLW)RUWKHILUVWPLQXWHVRXWGRRU
PLFURFRPSXWHU ZLOO LJQRUH WKLV LQGRRU VLJQDO /' EOLQNV WLPH
E $IWHUPLQXWHVKDVODSVHG/'2))DQG/'EOLQNVWLPHXQLWZLOOUHWXUQWRQRUPDORSHUDWLRQPRGH
&+(&.,1*7+( 5(027( &21752//(5
37
Please set the DIP switch No.6 to ON accordingly (Refer to page
54
).
54
(JUDGING BETWEEN GAS LEAKAGE AND
COMPRESSOR DEFECTIVE)
CHECKING THE REFRIGERATING CYCLE
1. Troubleshooting procedure (No operation, No heating, No cooling)
Lighting mode
Connect U,V,W phase leads to the
power module again and operate the
air conditioner.
Blinks Blinks Blinks Blinks Blinks Blinks
2 times 3 times 4 times 5 times 6 times 8times
Selfdiagnosis lamp
LD301
Time until the
lamp lights
Possible
malfunctioning
part
Is the self-diagnosis lamp mode as
shown on the right?
Approx. Within
Approx.
Approx. 10
10
seconds 30
seconds
seconds
Approx. 10 seconds
Compressor
Blinking
Gas
leakage
Compressor
off
YES
(R410 A)
The values above are the theoretical ones.
Normal
Stop to operate and check the gas
pressure in balancing mode.
Checking the IPM (main P.W.B.)
Error (Gas leaking)
When the
self-diagnosis lamp
lights in the same
condition as above.
Gas leaks.
Repair and seal refrigerant.
The compressor is defective. Replace it
and seal refrigerant.
If the compressor checker for an
inverter type air conditioner is
available, re-check using it.
(
Perform a final check of operation.
)
Model: RAC- 18/25/35WSPA
㶎
Do not operate for 5 minutes
or more.
㶎
PARTS LIST AND DIAGRAM
INDOOR UNIT
MODEL: RAK-18PSPA,RAK-25PSPA,RAK-35PSPA
INDOOR UNIT
MODEL
RAK-18PSPA,RAK-25PSPA,RAK-35PSPA
NO.
HHAW PARTS NO.
RAK-18PSPA
RAK-25PSPA
RAK-35PSPA
Q"TY/
UNIT
PARTS NAME
1
HWRAK-18PSPA
901
1
CABINET ASS'Y
2
HWRAK-25PEA
902
2
VERTICAL AIR DEFLECTOR
3
HWRAS-E10H3
903
1
FAN MORTOR
4
HWRAK-18PSPA
902
1
TANGENTIAL AIR FLOW FAN
5
HWRAK-18PSPA
903
1
FAN SUPPORT ASS'Y
6
HWRAS-E10H3
905
1
FAN COVER
7
HWRAK-18PSPA
904
1
FAN MOTOR SUPPORT
8
HWRAK-18PSPA
905
1
EVAPORATOR ASS'Y
9
HWRAK-18PSPA
906
1
PIPING ASS'Y
10
HWRAS-E10H3
909
1
UPPER COVER
11
HWRAK-18PSPA
907
1
SPRING
12
HWRAS-E10H3
910
1
TERMINAL BOARD (2P)
13
HWRAS-E10H3
911
1
THERMISTOR ASS'Y
14
HWRAK-25PEA
903
1
COVER(ELECTRIC)
1
P.W.B.(MAIN)
15
HWRAK-18PSPA 908 HWRAK-25PSPA 901 HWRAK-35PSPA 901
16
HWRAS-E10H3
914
1
ELEC-COVER-L
17
HWRAS-E10H3
915
1
ELEC-COVER-R
18
HWRAK-25PEA
905
1
P.W.B.(INDICATION)
19
HWRAS-E10H3
917
1
LED-COVER
20
HWRAS-E10H3
918
1
FC-GUIDE
21
HWRAS-E10H3
*919
1
PIPE-COVER
22
HWRAK-18PSPA
909
1
DRAIN PAN ASS'Y
23
HWRAK-18PSPA
919
1
DRAIN CAP
24
HWRAS-E10H3
921
1
DRAINAGE PIPE
25
HWRAK-18PSPA
910
1
STEPPING MOTOR
26
HWRAK-18PSPA
911
2
DEFLECTOR SUPPORT
27
HWRAK-18PSPA
912
1
HORIZONTAL AIR DEFLECTOR
28
HWRAS-E10H3
924
1
AIR FILTER
29
HWRAK-25PEA
906
1
FRONT PANEL AS
30
HWRAK-25PEA
907
1
K-PANLE
31
HWRAK-18PSPA
913
1
REMOTE CONTROL ASS'Y
32
HWRAK-18PSPA
914
1
FRONT COVER
33
HWRAS-E10H3
927
1
T-COVER ASS'Y
34
HWRAS-E10H3
928
2
CAP
35
HWRAS-E10H3
929
1
H-LABEL
36
HWRAS-E10H3
930
1
S-COVER-R
37
HWRAS-E10H3
931
1
S-COVER-L
38
HWRAS-E10H3
932
1
MOUNTING PLATE
MODEL
RAC-18/25/35WSPA
46
48
45
50
52
51
53
MODEL
NO.
RAC-18WSPA,RAC-25WSPA,RAC-35WSPA
HHAW PARTS NO.
RAC-18WSPA
RAC-25WSPA
RAC-35WSPA
Q"TY/
UNIT
PARTS NAME
1
HWRAC-18WSA
A01
1
BASE
2
HWRAC-18WSA
A02
1
COMPRESSOR
3
HWRAC-18WSA
A03
3
COMPRESSOR RUBBER
4
HWRAC-SX10HAK
A04
3
PUSH NUT
5
HWRAC-18WSA
A04
1
CONDENSER ASSEMBLY
6
HWRAC-18WSPA
A01
1
REVERSING VALVE(INCLUDING 2S/3S-VALVE&EXPANSION VALVE)
7
HWRAC-50WEA
A06
1
3S-VALVE
8
HWRAC-50WEA
A05
1
2S-VALVE
9
HWRAC-18WSPA
A02
1
ELECTRIC EXPANSION VALVE
10
HWRAC-18WSPA
A03
1
SOUND PROOF
11
HWRAC-18WSPA
A04
1
SOUND PROOF
12
HWRAC-18WSPA
A31
1
SOUND PROOF
13
HWRAC-18WSA
A10
1
OVERLOAD RELAY COVER(COMPRESSOR)
14
HWRAC-18WSA
A11
1
CONNECTING CORD(COMPRESSOR)
15
HWRAC-50NX2
A16
1
DEFROST THERMISTOR
16
HWRAC-50NX2
A17
1
BULB SUPPORT(DEFROST THERMISTOR)
17
HWRAC-50NX2
A18
1
COIL(REVERSING VALVE)
18
HWRAC-50NX2
A19
1
COIL(EXPANSION VALVE)
19
HWRAC-18WSPA
A05
1
PARTITION ASSEMBLY
20
HWRAC-18WSPA
A06
1
REACTOR
21
HWRAC-SX18HAK
A19
1
FAN MOTOR SUPPORT
22
HWRAC-50NX2
A23
1
FAN MOTOR
23
HWRAC-50NX2
A24
1
PROPELLER FAN
24
HWRAC-50NX2
A25
1
NUT (PROPELLER FAN)
25
HWRAC-50NX2
A26
1
SIDE COVER (LEFT)
26
HWRAC-50NX2
A27
1
HANDLE
27
HWRAC-50NX2
A28
1
FRONT COVER
28
HWRAC-18WSA
A11
1
LOGO LABEL
29
HWRAC-SX18HAK
A24
1
DISCHARGE GRILL
30
HWRAC-18WSPA
A08
1
THERMISTOR(OUTDOOR TEMPERATURE)
31
HWRAC-18WSPA
A09
1
COVER(FOR OUTDOOR TEMPERATURE THERMISTOR
32
HWRAC-SX18HAK
A26
1
SIDE COVER (RIGHT)
33
HWRAC-SX18HAK
A27
1
VALVE COVER
34
HWRAC-18WSPA
A10
1
TOP COVER
35
HWRAC-18WSPA
A11
1
TERMINAL COVER
36
HWRAC-18WSPA
A12
2
TERMINAL BOARD(2P)
37
HWRAC-18WSPA
A13
1
ELECTRIC PARTS PLATE
38
HWRAC-18WSPA
A14
1
HEAT SINK
HWRAC-18WSPA A15
HWRAC-25WSPA A01
HWRAC-35WSPA A01
1
P.W.B(CONTROL)
40
HWRAC-18WSPA
A16
1
ELECTRIC PARTS COVER
41
HWRAC-18WSPA
A17
1
HEAT SINK2
42
HWRAC-18WSPA
A18
1
FUSE(25A)
43
HWRAC-18WSPA
A19
1
SUPPORT(P.W.B CONTROL)
39
HWRAC-18WSPA A20
HWRAC-25WSPA A02
HWRAC-35WSPA A02
1
P.W.B(CONTROL) ELECTRIC ASSEMBLY
45
HWRAC-18WSPA
A21
1
SOUND PROOF COVER
46
HWRAC-18WSPA
A22
1
FUSE(3.15A)
47
HWRAC-18WSPA
A23
1
HOT GAS PIPE
48
HWRAC-18WSPA
A24
1
C-CAP
49
HWRAC-18WSPA
A25
1
SPRING
50
HWRAC-18WSPA
A26
1
S-TANK-ZU
51
HWRAC-18WSPA
A27
1
BAND
52
HWRAC-18WSPA
A28
1
RUB-BUSH
53
HWRAC-18WSPA
A29
1
G-SHEET
44
+,7$&+,
RAK-18PSPA/RAC-18WSPA
RAK-25PSPA/RAC-25WSPA
RAK-35PSPA/RAC-35WSPA
HHAW NO. 0073E
Was this manual useful for you? yes no
Thank you for your participation!

* Your assessment is very important for improving the work of artificial intelligence, which forms the content of this project

Download PDF

advertisement