I GB F D - Olimpia Splendid

I GB F D - Olimpia Splendid
ISTRUZIONI PER INSTALLAZIONE, USO E MANUTENZIONE
INSTRUCTIONS FOR INSTALLATION, USE AND MAINTENANCE
I
GB
INSTRUCTIONS POUR L'INSTALLATION, L’EMPLOI ET L'ENTRETIEN
F
HANDBUCH FÜR INSTALLATION, GEBRAUCH UND WARTUNG
D
1
2
3
P
H
D
G
F
C
Q
I
B
O
E
N
K
A
M
L
R
2
4
5
C
A
B
6
B
A
3
7
A
A
8
I
G
G
H
L
F
E
B
D
D
C
D
D
D
D
A
D
9
> 30 cm
> 60 c m
> 60cm
> 30cm
> 15 cm
> 30 cm
4
10
65
20
18
55
16
14
LWT °C
LWT °C
45
35
12
10
8
6
25
4
2
15
-20
-10
0
0
10
ODT °C
20
30
40
-10
0
10
20
ODT °C
30
40
50
11
A
B
C
12
A
D
13
B
5
15
14
A
C
B
C
A
B
D
E
F
H
D
E
G
16
17
A
C
B
D
E
F
E
G
18
6
H
19
U.I. SMALL
U.I. BIG
80
80
70
70
60
60
50
kPa
kPa
50
40
Vmax
40
Vmax
30
Vmed
30
Vmed
20
Vmin
20
Vmin
10
10
0
0
0
500
1000
1500
2000
2500
3000
0
3500
500
1000
l/h
1500
2000
l/h
2500
3000
3500
20
A
B
21
10
9
8
A
7 6
11
5
F
4
12
2
3
B
16
13
14
1
10
E
17
15
18
D
10
C
7
22
23
24
8
25
26
A
V/ph/Hz
OS-CEBSH24EI
OS-CEBCH36EI
OS-CEBCH48EI
OS-CEBTH48EI
OS-CEBCH60EI
OS-CEBTH60EI
220-240/1/50
220-240/1/50
220-240/1/50
380-415/3+N/50
220-240/1/50
380-415/3+N/50
B
kW
3,0
4,8
6,0
5,5
6,0
7,5
C
A
13,5
22
28
8,15
28
11,5
D
MFA
25A
40A
40A
25A
40A
25A
E
V/ph/Hz
F
G
U.I.SHERPA SMALL
U.I.SHERPA BIG
220-240/1/50
220-240/1/50
kW
3,22
6,22
A
14,1
27,2
27
A
B
D
C
9
28
Led A Led 4 Led 1 Led 5 Led 2 Led 6 Led 3
Led B
Led 7 Led 8 Led 9
Key 1
Key 3
Key 5
Key 7
Key 2
Key 4
Key 6
Key 7
29
20
60
Ccc
Hcc
55
Hc2
50
15
Cc2
40
SP ° C
SP ° C
45
35
10
30
25
Cc4
Hc4
20
5
15
- 15
Hc1
-5
5
ODT ° C
10
15
Hc3
25
15
Cc1
25
35
ODT ° C
Cc3
45
11
ITALIANO
1
GENERALITÁ
13
1.1
INFORMAZIONI GENERALI
13
1.2
SIMBOLOGIA
14
1.2.1
Pittogrammi redazionali
14
1.2.2
Pittogrammi relativi alla sicurezza
14
1.3
AVVERTENZE
14
1.4
REGOLE FONDAMENTALI DI SICUREZZA
15
1.5
RICEVIMENTO E DISIMBALLO
15
1.6
UNITÀ ESTERNA
16
1.7
UNITÀ INTERNA
16
1.8
ELENCO DEI COMPONENTI PRINCIPALI UNITÀ INTERNA
16
1.9
ELENCO COMPONENTI A CORREDO UNITÀ INTERNA E DESCRIZIONI DELLE PARTI
16
2
INSTALLAZIONE
17
2.1
INSTALLAZIONE DELL’UNITÀ INTERNA
17
2.1.1
Apertura dei pannelli
17
2.1.2
Accesso ai componenti interni
17
2.2
INSTALLAZIONE DELL’UNITÀ ESTERNA
17
2.3
LIMITI DI FUNZIONAMENTO
18
2.4
COLLEGAMENTI FRIGORIFERI
18
2.4.1
3URYHHYHUL¿FKH
19
2.4.2
Caricamento del refrigerante addizionale
19
2.5
COLLEGAMENTI IDRAULICI
19
2.5.1
Circuito idraulico
20
2.6
VALORI DI RIFERIMENTO ACQUA IMPIANTO
21
2.7
RIEMPIMENTO IMPIANTO IDRAULICO
21
2.8
SBLOCCO POMPA CIRCOLAZIONE
21
2.9
COLLEGAMENTI ELETTRICI
21
2.9.1
Accesso al quadro elettrico
22
2.9.2
Cavi di collegamento
22
2.9.3
Connessioni elettriche
22
2.10
CONTROLLI DI INSTALLAZIONE
23
2.10.1
Preparazione alla prima messa in servizio
23
2.10.2
Controlli durante e dopo la prima messa in servizio
23
3
USO E MANUTENZIONE
24
3.1
Pannello di comando dell’unità interna
24
3.1.1
Descrizione pannello di controllo
24
3.2
ATTIVAZIONE E FUNZIONI UTENTE
24
3.2.1
Attivazione
24
3.2.2
Menù temperature/set
24
3.2.3
Menù utente
25
3.3
IMPOSTAZIONE DEI PARAMETRI MENÙ UTENTE
25
3.4
ATTIVAZIONE E FUNZIONI SERVICE
27
3.5
IMPOSTAZIONE DEI PARAMETRI MENÙ SERVICE
29
3.6
DISATTIVAZIONE E SPEGNIMENTO PER LUNGHI PERIODI
33
3.7
PULIZIA
33
3.8
MANUTENZIONE PERIODICA
33
3.9
ALLARMI
33
3.9.1
Allarmi display unità interna
33
3.9.2
Allarmi display unità esterna
34
12
1
1
INFORMAZIONI GENERALI
Desideriamo innanzitutto ringraziarVi di avere deciso di accordare la vostra preferenza ad una pompa di calore aria acqua di
nostra produzione.
Come potrete renderVi conto avete effettuato una scelta vincente in quanto avete acquistato un prodotto che rappresenta lo stato
dell’Arte nella tecnologia della climatizzazione domestica.
Questo manuale è stato concepito con l’obiettivo di fornirVi tutte le spiegazioni per essere in grado di gestire al meglio il Vostro
sistema di climatizzazione.
Vi invitiamo quindi a leggerlo attentamente prima di mettere in funzione l’apparecchio.
Mettendo in atto i suggerimenti che sono contenuti in questo manuale, grazie alla pompa di calore aria-acqua che avete acquistato,
potrete fruire senza problemi di condizioni ambientali ottimali con il minor investimento in termini energetici.
ATTENZIONE
Il manuale è suddiviso in 3 sezioni o capitoli:
CAP. 1 GENERALITÀ
6LULYROJHDOO¶LQVWDOODWRUHVSHFLDOL]]DWRHDOO¶XWHQWH¿QDOH
Contiene informazioni, dati tecnici e avvertenze importanti che devono essere conosciute prima di installare e utilizzare la pompa
di calore aria-acqua.
CAP. 2 INSTALLAZIONE
Si rivolge solo ed esclusivamente ad un installatore specializzato.
Contiene tutte le informazioni necessarie al posizionamento e montaggio della pompa di calore aria-acqua nel luogo in cui va
installato.
L’installazione della pompa di calore aria acqua da parte di personale non specializzato fa decadere le condizioni di garanzia.
CAP. 3 USO E MANUTENZIONE
Contiene le informazioni utili per comprendere l’uso e la programmazione della pompa di calore aria-acqua e gli interventi di
manutenzione più comuni.
Documento riservato ai termini di legge con divieto di riproduzione o di trasmissione a terzi senza esplicita autorizzazione di
OLIMPIA SPLENDID.
/HPDFFKLQHSRVVRQRVXELUHDJJLRUQDPHQWLHTXLQGLSUHVHQWDUHSDUWLFRODULGLYHUVLGDTXHOOLUDI¿JXUDWLVHQ]DSHUTXHVWRFRVWLWXLUH
pregiudizio per i testi contenuti in questo manuale.
Leggere attentamente il presente manuale prima di procedere con qualsiasi operazione (installazione, manutenzione,
uso) ed attenersi scrupolosamente a quanto descritto nei singoli capitoli.
LA DITTA COSTRUTTRICE NON SI ASSUME RESPONSABILITÀ PER DANNI A PERSONE O COSE DERIVANTI DALLA
MANCATA OSSERVANZA DELLE NORME CONTENUTE NEL PRESENTE LIBRETTO.
/DGLWWDFRVWUXWWULFHVLULVHUYDLOGLULWWRGLDSSRUWDUHPRGL¿FKHLQTXDOVLDVLPRPHQWRDLSURSULPRGHOOLIHUPRUHVWDQGROHFDUDWWHULVWLFKH
essenziali descritte nel presente manuale.
L’installazione e la manutenzione di apparecchiature per la climatizzazione come la presente potrebbero risultare pericolose in
quanto all’interno di questi apparecchi è presente un gas refrigerante sotto pressione e componenti elettrici sotto tensione.
Pertanto l’installazione, il primo avviamento e le successive fasi di manutenzione devono essere eseguite esclusivamente
GDSHUVRQDOHDXWRUL]]DWRHTXDOL¿FDWRYHGLPRGXORULFKLHVWDƒDYYLDPHQWRDOOHJDWRDOO¶DSSDUHFFKLR
Questa unità è conforme alle direttive Europee:
‡ %DVVDWHQVLRQH&(
‡ &RPSDWLELOLWjHOHWWURPDJQHWLFD&(
‡ 5HVWUL]LRQHGHOO¶XVRGLVRVWDQ]HSHULFRORVHQHOOHDSSDUHFFKLDWXUHHOHWWULFKHHGHOHWWURQLFKH&(5+26
‡ 5L¿XWLGLDSSDUHFFKLDWXUHHOHWWULFKHHGHOHWWURQLFKH&(5$((HVXFFHVVLYHPRGL¿FKH
Installazioni eseguite al di fuori delle avvertenze fornite dal presente manuale e l’utilizzo al di fuori dei limiti di temperatura prescritti
fanno decadere la garanzia.
L’ordinaria manutenzione e la pulizia generale esterna possono essere eseguite anche dall’utente, in quanto non comportano
RSHUD]LRQLGLI¿FROWRVHRSHULFRORVH
Durante il montaggio, e ad ogni operazione di manutenzione, è necessario osservare le precauzioni citate nel presente
PDQXDOHHVXOOHHWLFKHWWHDSSRVWHDOO¶LQWHUQRGHJOLDSSDUHFFKLQRQFKpDGRWWDUHRJQLSUHFDX]LRQHVXJJHULWDGDOFRPXQH
buonsenso e dalle Normative di Sicurezza vigenti nel luogo d’installazione.
ÊQHFHVVDULRLQGRVVDUHVHPSUHJXDQWLHGRFFKLDOLSURWHWWLYLSHUHVHJXLUHLQWHUYHQWLVXOODWRUHIULJHUDQWHGHJOLDSSDUHFFKL
/HSRPSHGLFDORUHDULDDFTXD121'(9212HVVHUHLQVWDOODWHLQDPELHQWLFRQSUHVHQ]DGLJDVLQ¿DPPDELOLJDVHVSORVLYL
LQDPELHQWLPROWRXPLGLODYDQGHULHVHUUHHFFRLQORFDOLGRYHVRQRSUHVHQWLDOWULPDFFKLQDULFKHJHQHUDQRXQDIRUWH
fonte di calore.
In caso di sostituzione di componenti utilizzare esclusivamente ricambi originali OLIMPIA SPLENDID.
13
ITALIANO
1.1
GENERALITÀ
1
ITALIANO
1.2
IMPORTANTE!
3HUSUHYHQLUHRJQLULVFKLRGLIROJRUD]LRQHqLQGLVSHQVDELOHVWDFFDUHJOLLQWHUUXWWRULJHQHUDOLSULPDGLHIIHWWXDUHFROOHJDPHQWL
HOHWWULFLHGRJQLRSHUD]LRQHGLPDQXWHQ]LRQHVXJOLDSSDUHFFKL
5HQGHUHQRWHDWXWWRLOSHUVRQDOHLQWHUHVVDWRDOWUDVSRUWRHGDOO¶LQVWDOOD]LRQHGHOODPDFFKLQDOHSUHVHQWLLVWUX]LRQL
SMALTIMENTO
,OVLPERORVXOSURGRWWRRVXOODFRQIH]LRQHLQGLFDFKHLOSURGRWWRQRQGHYHHVVHUHFRQVLGHUDWRFRPHXQQRUPDOHUL¿XWRGRPHVWLFR
ma deve essere portato nel punto di raccolta appropriato per il riciclaggio di apparecchiature elettriche ed elettroniche.
Provvedendo a smaltire questo prodotto in modo appropriato, si contribuisce a evitare potenziali conseguenze negative per
l’ambiente e per la salute, che potrebbero derivare da uno smaltimento inadeguato del prodotto.
3HULQIRUPD]LRQLSLGHWWDJOLDWHVXOULFLFODJJLRGLTXHVWRSURGRWWRFRQWDWWDUHO¶XI¿FLRFRPXQDOHLOVHUYL]LRORFDOHGLVPDOWLPHQWR
UL¿XWLRLOQHJR]LRLQFXLqVWDWRDFTXLVWDWRLOSURGRWWR
Questa disposizione è valida solamente negli Stati membri dell’UE.
SIMBOLOGIA
I pittogrammi riportati nel seguente capitolo consentono di fornire rapidamente ed in modo univoco informazioni necessarie alla
corretta utilizzazione della macchina in condizioni di sicurezza.
1.2.1
Pittogrammi redazionali
Service
‡ &RQWUDVVHJQDVLWXD]LRQLQHOOHTXDOLVLGHYHLQIRUPDUHLO6(59,&(D]LHQGDOHLQWHUQR
SERVIZIO ASSISTENZA TECNICA CLIENTI.
Indice
‡ ,SDUDJUD¿SUHFHGXWLGDTXHVWRVLPERORFRQWHQJRQRLQIRUPD]LRQLHSUHVFUL]LRQLPROWRLPSRUWDQWLSDUWLFRODUPHQWHSHUTXDQWR
riguarda la sicurezza.
Il mancato rispetto può comportare:
‡ SHULFRORSHUO¶LQFROXPLWjGHJOLRSHUDWRUL
‡ SHUGLWDGHOODJDUDQ]LDFRQWUDWWXDOH
‡ GHFOLQD]LRQHGLUHVSRQVDELOLWjGDSDUWHGHOODGLWWDFRVWUXWWULFH
Mano alzata
‡ &RQWUDVVHJQDD]LRQLFKHQRQVLGHYRQRDVVROXWDPHQWHIDUH
1.2.2
Pittogrammi relativi alla sicurezza
Tensione elettrica pericolosa
‡ 6HJQDODDOSHUVRQDOHLQWHUHVVDWRFKHO¶RSHUD]LRQHGHVFULWWDSUHVHQWDVHQRQHIIHWWXDWDQHOULVSHWWRGHOOHQRUPDWLYHGLVLFXUH]]D
il rischio di subire uno shock elettrico.
Pericolo generico
‡ 6HJQDODFKHO¶RSHUD]LRQHGHVFULWWDSUHVHQWDVHQRQHIIHWWXDWDQHOULVSHWWRGHOOHQRUPDWLYHGLVLFXUH]]DLOULVFKLRGLVXELUH
GDQQL¿VLFL
Pericolo di forte calore
‡ 6HJQDODFKHO¶RSHUD]LRQHGHVFULWWDSUHVHQWDVHQRQHIIHWWXDWDQHOULVSHWWRGHOOHQRUPDWLYHGLVLFXUH]]DLOULVFKLRGLVXELUH
bruciature per contatto con componenti con elevata temperatura.
1.3
AVVERTENZE
‡ /¶LQVWDOOD]LRQHGHYHHVVHUHHVHJXLWDGDOFRQFHVVLRQDULRRGDDOWURSHUVRQDOHTXDOL¿FDWRVHO¶LQVWDOOD]LRQHQRQqHVHJXLWD
correttamente, può esserci il rischio di perdita di acqua, scossa elettrica o incendio.
‡ ,QVWDOODUHODSRPSDGLFDORUHDULDDFTXDDWWHQHQGRVLDOOHLVWUX]LRQLFRQWHQXWHQHOSUHVHQWHPDQXDOHVHO¶LQVWDOOD]LRQHQRQq
eseguita correttamente può esserci il rischio di perdita di acqua, scossa elettrica o incendio.
‡ 6LUDFFRPDQGDGLXWLOL]]DUHHVFOXVLYDPHQWHLFRPSRQHQWLVSHFL¿FDWDPHQWHGHVWLQDWLDOO¶LQVWDOOD]LRQHLQGRWD]LRQHO¶XWLOL]]RGL
componenti da questi diversi potrebbe essere causa di perdita di acqua, scosse elettriche o incendio.
‡ 8QDYROWDXOWLPDWDO¶LQVWDOOD]LRQHFRQWUROODUHFKHQRQYLVLDSHUGLWDGLUHIULJHUDQWHLOOLTXLGRUHIULJHUDQWHVHHVSRVWRDOOD
¿DPPDSURGXFHJDVWRVVLFR
‡ $OO¶DWWRGHOO¶LQVWDOOD]LRQHRGHOODULFROORFD]LRQHGHOO¶LPSLDQWRDVVLFXUDUVLFKHQHOFLUFXLWRGHOUHIULJHUDQWHQRQSHQHWULDOFXQD
VRVWDQ]DFRPHDGHVHPSLRDULDGLYHUVDGDOOLTXLGRUHIULJHUDQWHVSHFL¿FDWR5$ODSUHVHQ]DGLDULDRGLDOWUHVRVWDQ]H
estranee nel circuito del refrigerante potrebbe provocare un aumento abnorme della pressione o la rottura dell’impianto, con
FRQVHJXHQWLGDQQLDOOHSHUVRQH
14
1
‡ ,QFDVR GLIXRULXVFLWH GL DFTXD VSHJQHUH O¶XQLWj HGLQWHUURPSHUH OH DOLPHQWD]LRQL GHOO¶XQLWj LQWHUQH HG HVWHUQD WUDPLWHJOL
interruttori generali.
Chiamare, con sollecitudine, il Servizio Tecnico di Assistenza OLIMPIA SPLENDID, oppure personale professionalmente
TXDOL¿FDWRHQRQLQWHUYHQLUHSHUVRQDOPHQWHVXOO¶DSSDUHFFKLR
‡ 1HOFDVRLQFXLQHOO¶LPSLDQWRVLDSUHVHQWHXQDFDOGDLDYHUL¿FDUHGXUDQWHLOIXQ]LRQDPHQWRGHOODVWHVVDFKHODWHPSHUDWXUD
dell’acqua circolante all’interno della pompa di calore aria-acqua non superi i 65°C.
‡ 4XHVWROLEUHWWRG¶LVWUX]LRQHqSDUWHLQWHJUDQWHGHOO¶DSSDUHFFKLRHGLFRQVHJXHQ]DGHYHHVVHUHFRQVHUYDWRFRQFXUDHGRYUj
SEMPRE accompagnare l’apparecchio anche in caso di sua cessione ad altro proprietario o utente oppure di un trasferimento
su un altro impianto. In caso di suo danneggiamento o smarrimento richiederne un altro esemplare al Servizio Tecnico di
Assistenza OLIMPIA SPLENDID di zona.
‡ $VVLFXUDUVLFKHYHQJDUHDOL]]DWRLOFROOHJDPHQWRGLWHUUDQRQPHWWHUHDPDVVDO¶DSSDUHFFKLRVXWXED]LRQLGLGLVWULEX]LRQH
VFDULFDWRULSHUVRYUDWHQVLRQLRVXOODWHUUDGHOO¶LPSLDQWRWHOHIRQLFRVHQRQHVHJXLWRFRUUHWWDPHQWHLOFROOHJDPHQWRGLWHUUDSXz
HVVHUHFDXVDGLVFRVVDHOHWWULFDVRYUDFRUUHQWLPRPHQWDQHHGLDOWDLQWHQVLWjSURYRFDWHGDIXOPLQLRGDDOWUHFDXVHSRWUHEEHUR
danneggiare la pompa di calore aria acqua.
‡ 6LUDFFRPDQGDGLLQVWDOODUHXQLQWHUUXWWRUHGLGLVSHUVLRQHDPDVVDODPDQFDWDLQVWDOOD]LRQHGLTXHVWRGLVSRVLWLYRSRWUHEEH
essere causa di scossa elettrica.
1.4
1.5
REGOLE FONDAMENTALI DI SICUREZZA
Ricordiamo che l’utilizzo di prodotti che impiegano energia elettrica ed acqua, comporta l’osservanza di alcune regole
fondamentali di sicurezza quali:
ÊYLHWDWRO¶XVRGHOO¶DSSDUHFFKLRDLEDPELQLHDOOHSHUVRQHLQDELOLQRQDVVLVWLWH
ÊYLHWDWRWRFFDUHO¶DSSDUHFFKLRVHVLqDSLHGLQXGLHFRQSDUWLGHOFRUSREDJQDWHRXPLGH
Ê YLHWDWD TXDOVLDVL RSHUD]LRQH GL SXOL]LD SULPD GL DYHU VFROOHJDWR O¶DSSDUHFFKLR GDOOD UHWH GL DOLPHQWD]LRQH HOHWWULFD
posizionando gli interruttori generali dell’impianto su “spento”.
ÊYLHWDWRPRGL¿FDUHLGLVSRVLWLYLGLVLFXUH]]DRGLUHJROD]LRQHVHQ]DO¶DXWRUL]]D]LRQHHOHLQGLFD]LRQLGHOFRVWUXWWRUH
GHOO¶DSSDUHFFKLR
ÊYLHWDWRWLUDUHVWDFFDUHWRUFHUHLFDYLHOHWWULFLIXRULXVFHQWLGDOO¶DSSDUHFFKLRDQFKHVHTXHVWRqVFROOHJDWRGDOODUHWHGL
alimentazione elettrica.
È vietato introdurre oggetti e sostanze attraverso le griglie di aspirazione e mandata d’aria.
ÊYLHWDWRDSULUHJOLVSRUWHOOLGLDFFHVVRDOOHSDUWLLQWHUQHGHOO¶DSSDUHFFKLRVHQ]DDYHUSULPDSRVL]LRQDWRO¶LQWHUUXWWRUH
generale dell’impianto su “spento”.
È vietato disperdere e lasciare alla portata di bambini il materiale dell’imballo in quanto può essere potenziale fonte di
pericolo.
1RQLPPHWWHUH5$QHOO¶DWPRVIHUDO¶5$qXQJDVVHUUDÀXRUXUDWRULFKLDPDWRQHO3URWRFROORGL.\RWRFRQXQ
Potenziale di Riscaldamento Globale (GWP)= 1975.
RICEVIMENTO E DISIMBALLO
L’imballo è costituito da materiale adeguato ed eseguito da personale esperto. Le unità vengono consegnate complete ed in
perfette condizioni, tuttavia per il controllo della qualità dei servizi di trasporto attenersi alle seguenti avvertenze:
‡ DO ULFHYLPHQWR GHJOL LPEDOOL YHUL¿FDUH VH OD FRQIH]LRQH ULVXOWD GDQQHJJLDWD LQ FDVR SRVLWLYR ULWLUDUH OD PHUFH FRQ ULVHUYD
SURGXFHQGRSURYHIRWRJUD¿FKHHGHYHQWXDOLGDQQLDSSDUHQWL
‡ GLVLPEDOODUHYHUL¿FDQGRODSUHVHQ]DGHLVLQJROLFRPSRQHQWLFRQJOLHOHQFKLG¶LPEDOOR
‡ FRQWUROODUHFKHWXWWLLFRPSRQHQWLQRQDEELDQRVXELWRGDQQLGXUDQWHLOWUDVSRUWRQHOFDVRQRWL¿FDUHHQWURJLRUQLGDOULFHYLPHQWR
JOLHYHQWXDOLGDQQLDOORVSHGL]LRQLHUHDPH]]RUDFFRPDQGDWDUUSUHVHQWDQGRGRFXPHQWD]LRQHIRWRJUD¿FD
Analoga informazione inviarla tramite fax anche a OLIMPIA SPLENDID.
Nessuna informazione concernente danni subiti potrà essere presa in esame dopo 3 giorni dalla consegna. Per qualunque
controversia sarà competente il foro di REGGIO nell’EMILIA.
15
ITALIANO
‡ /¶LQVWDOOD]LRQHGHJOLDSSDUHFFKLOLIMPIA SPLENDIDGHYHHVVHUHHIIHWWXDWDGDLPSUHVDDELOLWDWDFKHD¿QHODYRURULODVFLDO
responsabile dell’impianto una dichiarazione di conformità in ottemperanza alle Norme vigenti ed alle indicazioni fornite dalla
OLIMPIA SPLENDID nel presente libretto.
1
UNITÀ ESTERNA¿J
/¶XQLWjHVWHUQD¿JqGLVSRQLELOHLQVHLPRGHOOL
ITALIANO
1.6
OS-CEBSH24EI
OS-CEBCH36EI
OS-CEBCH48EI
OS-CEBTH48EI
OS-CEBCH60EI
OS-CEBTH60EI
Larghezza mm
842
990
940
940
940
940
Profondità mm
324
324
360
360
360
360
Altezza mm
695
695
1245
1245
1245
1245
Peso kg
61
82
106
99
106
104
1.7
UNITÀ INTERNA¿J
/¶XQLWjLQWHUQD¿JqGLVSRQLELOHLQTXDWWURPRGHOOL
Larghezza mm
Profondità
SDQQHOORFRPDQGLPP
1.8
SMALL 3W
BIG
BIG 3W
500
500
500
500
280 + 16
280 + 16
280 + 16
280 + 16
Altezza mm
810
810
810
810
Peso kg
36
36,3
38
38,3
ELENCO DEI COMPONENTI PRINCIPALI UNITÀ INTERNA¿J
A
B
C
D
E
F
G
H
I
K
L
M
N
O
P
Q
R
1.9
SMALL
Ingresso acqua
Valvola di sicurezza 3bar
Scambiatore a piastre
Flussostato
Manometro
Vaso d’espansione
Collettore resistenze elettriche
6¿DWRDULDDXWRPDWLFR
Pompa acqua
9DOYRODDWUHYLHLQWHJUDWDDERUGRPDFFKLQDQHOODYHUVLRQH:
Uscita acqua impianto
8VFLWDDFTXDFDOGDVDQLWDULDSUHVHQWHVRORQHOODYHUVLRQH:
Assieme quadro elettrico
Pannello comandi
Termostato di sicurezza resistenze elettriche a riarmo manuale
Termostato di sicurezza resistenze elettriche a riarmo automatico
Interruttore generale
ELENCO COMPONENTI A CORREDO E DESCRIZIONI DELLE PARTI
Gli apparecchi vengono spediti con imballo standard costituiti da un involucro in cartone e una serie di protezioni in polistirolo
espanso.
Al di sotto dell’imballo dell’unità esterna è presente un piccolo bancale che facilita le operazioni di trasporto e spostamento,
mentre l’imballo dell’unità interna è dotato di maniglie in modo da facilitarne la movimentazione.
Si trovano a corredo dell’unità interna, all’interno dell’imballo, i seguenti particolari:
‡ VWDIIDDPXURSHUO¶DQFRUDJJLRGHOO¶DSSDUHFFKLR
‡ GLPDSHUO¶LVWDOOD]LRQHDSDUHWH
‡ ¿OWURDVHWDFFLRDG<FRQDWWDFFKL))GD´OXFHPDJOLDGDPP
‡ WUHYDOYROHDVIHUD´VRORSHUPRGHOOL:
‡ GLPDSHULOSRVL]LRQDPHQWRGHOO¶XQLWjDPXUR
16
2
INSTALLAZIONE
Per ottenere una buona riuscita dell’installazione e prestazioni di funzionamento ottimali, seguire attentamente quanto indicato
nel presente manuale. La mancata applicazione delle norme indicate, che può causare mal funzionamento delle apparecchiature,
sollevano la ditta OLIMPIA SPLENDID da ogni forma di garanzia e da eventuali danni causati a persone, animali o cose.
È importante che l’impianto elettrico sia eseguito secondo le norme vigenti, rispetti i dati riportati nel capitolo Caratteristiche
tecniche e sia costituito da una corretta messa a terra.
L’apparecchio deve essere installato in posizione tale da consentire facilmente la manutenzione.
2.1
INSTALLAZIONE DELL’UNITÀ INTERNA¿JJ
Prevedere:
‡ TXDWWURWDVVHOOL0SHULO¿VVDJJLRDSDUHWHLGRQHLDOWLSRGLVXSSRUWR
‡ XQRVSD]LROLEHURODWHUDOHHVXSHULRUHGLPLQLPRFPVXI¿FLHQWHDFRQVHQWLUHODULPR]LRQHGHOOHFRSHUWXUHSHUOHRSHUD]LRQL
di manutenzione ordinaria e straordinaria
‡ XQRVFDULFRGLDFTXDQHOOHYLFLQDQ]H
‡ XQ¶DOLPHQWD]LRQHHOHWWULFDFRQIRUPHQHOOHYLFLQDQ]HGHOO¶XQLWjLQWHUQD
‡ XQ¶DOLPHQWD]LRQHGLDFTXDSHULOULHPSLPHQWRGHOFLUFXLWRLGUDXOLFR
‡ FDYRGLFRPXQLFD]LRQHWUDXQLWjLQWHUQDHGXQLWjHVWHUQDYHGLSDU
/¶XQLWjLQWHUQDGHYHHVVHUHVHPSUH¿VVDWDDSDUHWHDGDOWH]]DXRPRDOO¶LQWHUQRGHOO¶DELWD]LRQH
3HUJOLVSD]LGLLQVWDOOD]LRQHHODSRVL]LRQHGHLWXELIDUULIHULPHQWRDOOD¿JHGXWLOL]]DUHODGLPDGLSRVL]LRQDPHQWRIRUQLWDFRQ
l’unità.
2.1.1
Apertura dei pannelli¿J
$SULUHORVSRUWHOOLQR¿JULI$WLUDQGRODSDUWHVXSHULRUHYHUVRO¶HVWHUQRORVSRUWHOOLQRVLDSUHYHUVRLOEDVVR
6YLWDUHODYLWHGL¿VVDJJLRGHOSDQQHOORIURQWDOH¿JULI%
6ROOHYDUHLOSDQQHOORIURQWDOHHWLUDUORYHUVRGLVp¿JULI&
2.1.2
Accesso ai componenti interni¿JJ
3HUDFFHGHUHDGLFRPSRQHQWLLQWHUQLGHOTXDGURHOHWWULFRULPXRYHUHOHGXHYLWL¿JULI$FKH¿VVDQRLOFRSHUFKLRGHOORVWHVVR
sul lato sinistro.
3HUDFFHGHUHDGLFRPSRQHQWLGLHWURLOTXDGURHOHWWULFRULPXRYHUHOHTXDWWURYLWL¿JULI$HUXRWDUHLOTXDGURVXOOHFHUQLHUH
poste sul lato destro del quadro. È possibile sganciare il quadro elettrico ed agganciarlo con le apposite scanalature delle stesse
VXO¿DQFRGHVWUR¿JLQWDOPRGRqSRVVLELOHDFFHGHUHDWXWWLLFRPSRQHQWLDOO¶LQWHUQRGHOO¶DSSDUHFFKLRHSURFHGHUHIDFLOPHQWH
all’installazione od alla manutenzione dell’apparecchio.
$OO¶LQWHUQRGHOTXDGURHOHWWULFRVLWURYDQRDOORJJLDWLLVHJXHQWLFRPSRQHQWL¿J
A Ingresso cavi
B Morsettiera di alimentazione unità interna
C Morsettiera connessioni utenze
D Fermacavi
E Interruttore magnetotermico resistenze elettriche
F Contattore di sicurezza per resistenze elettriche
G Relè resistenze
H Filtro EMC
I Scheda elettronica di controllo
L Fusibile 250V 5A T
2.2
INSTALLAZIONE DELL’UNITÀ ESTERNA¿J
,QVWDOODUHO¶XQLWjHVWHUQDVXXQDEDVHVROLGDLQJUDGRGLVRSSRUWDUQHLOSHVRO¶XQLWjHVWHUQDVHLQVWDOODWDLQPRGRLQFRPSOHWRRVX
una base non adeguata, potrebbe provocare, qualora dovesse distaccarsi dalla sua base, danni alle persone o alle cose.
ÊPROWRLPSRUWDQWHFKHLOOXRJRLQFXLHVHJXLUHO¶LQVWDOOD]LRQHYHQJDVFHOWRFRQODPDVVLPDFXUDDO¿QHGLJDUDQWLUHDGHJXDWD
protezione dell’apparecchio da eventuali urti e possibili conseguenti danni.
Scegliere un luogo adeguatamente ventilato, in cui durante la stagione estiva la temperatura esterna non superi i 46°C.
/DVFLDUHDWWRUQRDOO¶DSSDUHFFKLRXQRVSD]LROLEHURVXI¿FLHQWHWDOHGDHYLWDUHLOULFLUFRORHGDIDFLOLWDUHOHRSHUD]LRQLGLPDQXWHQ]LRQH
Prevedere, sotto all’apparecchio, uno strato di ghiaia per il drenaggio dell’acqua di sbrinamento.
/DVFLDUHVSD]LRDOGLVRWWRGHOO¶XQLWjSHULPSHGLUHLOFRQJHODPHQWRGHOO¶DFTXDGLVEULQDPHQWRLQVLWXD]LRQLQRUPDOLDVVLFXUDUH
un’altezza della base di almeno 5 cm, per l’uso in regioni con inverni freddi, assicurare un’altezza di almeno 15 cm dai piedi in
entrambi i lati dell’unità.
In caso di installazione in località a forte innevamento, montare il supporto dell’apparecchio ad un’altezza superiore al livello
massimo della neve.
Installare l’unità in modo che non venga attraversata dal vento.
Prevedere:
‡ GHLEORFFKHWWLDQWLYLEUDQWL
‡ XQ¶DOLPHQWD]LRQHHOHWWULFDFRQIRUPHQHOOHYLFLQDQ]HGHOO¶XQLWjHVWHUQD
17
ITALIANO
2
2
ITALIANO
A corredo dell’unità esterna viene fornita una rete di copertura della batteria di scambio termico; questa è prevista
per installazioni accessibili al pubblico. Il montaggio della rete potrebbe causare, in caso di elevata umidità a bassa
WHPSHUDWXUDQHEELDRQHYHO¶DFFXPXORGLJKLDFFLRVXOODEDWWHULDFRQULGX]LRQHGHOOHSUHVWD]LRQLGHOVLVWHPD
2.3
LIMITI DI FUNZIONAMENTO¿J
,GLDJUDPPLGL¿JGH¿QLVFRQRLOLPLWLGLWHPSHUDWXUDGHOO¶DFTXD/:7HGHOO¶DULDHVWHUQD2'7LQFXLODSRPSDGLFDORUHSXz
funzionare nelle due modalità raffreddamento e riscaldamento/produzione acqua sanitaria e raffreddamento.
2.4
COLLEGAMENTI FRIGORIFERI¿JJ
3HUGH¿QLUHOHOLQHHGLFROOHJDPHQWRIULJRULIHUHWUDOHXQLWjLQWHUQDHGHVWHUQDULIHULUVLDOODVRWWRVWDQWHWDEHOOD
OSCEBSH24EI
OSCEBCH36EI
OSCEBCH48EI
OSCEBTH48EI
OSCEBCH60EI
OSCEBTH60EI
Massima lunghezza
GHLWXELGLFROOHJDPHQWRP
25
30
50
50
50
50
Limite di differenza di
elevazione tra le due
unità se l’unità esterna è
SRVL]LRQDWDSLLQDOWRP
12
20
25
30
25
30
Limite di differenza di
elevazione tra le due
unità se l’unità esterna è
SRVL]LRQDWDSLLQEDVVRP
9
12
20
20
20
20
Carica aggiuntiva di
refrigerante per metro
oltre i 5 metri di tubazioni
JP
60
60
60
60
60
60
8WLOL]]DUHHVFOXVLYDPHQWHWXELFRQGLDPHWULFKHULVSHFFKLDQROHGLPHQVLRQLULFKLHVWHWXEROLQHDJDV´WXEROLQHDOLTXLGR´
La lunghezza massima delle linee di collegamento all’unità interna deve essere in accordo alla tabella 1 rabboccando la carica
GL5$FRPHSUHYLVWRYHGLSDU1RQLQVWDOODUHOHXQLWjROWUHLOPDVVLPRGLVOLYHOORFRQVHQWLWRWUDO¶XQLWjLQWHUQDHTXHOOD
esterna.
Completare il circuito frigorifero collegando l’unità interna con l’unità esterna tramite delle tubazioni in rame isolate.
8VDUHHVFOXVLYDPHQWHWXED]LRQLLQUDPHLVRODWHVSHFL¿FKHSHUUHIULJHUD]LRQHFKHYHQJRQRIRUQLWHSXOLWHHVLJLOODWHDOOHHVWUHPLWj
Le connessioni frigorifere dell'unità interna sono dietro il quadro elettrico, quelle dell’unità esterna sono sul lato destro e per
accedervi bisogna rimuovere la protezione:
A OLQHDJDV´XQLWjLQWHUQD
B OLQHDOLTXLGR´XQLWjLQWHUQD
C 9DOYRODOLQHDJDV´XQLWjHVWHUQD
D 9DOYRODOLQHDOLTXLGR´XQLWjHVWHUQD
Individuare il percorso delle tubazioni in modo da ridurre il più possibile la lunghezza e le curve dei tubi per ottenere il massimo
rendimento dell’impianto.
,QVHULUHOHOLQHHIULJRULIHUHLQXQDFDQDOLQDSDVVDFDYLSRVVLELOPHQWHFRQVHSDUDWRUHLQWHUQRGLRSSRUWXQHGLPHQVLRQL¿VVDWDDO
muro in cui far passare successivamente le tubazioni e i cavi elettrici.
Tagliare i tratti di tubazione abbondando di circa 3-4 cm sulla lunghezza.
IMPORTANTE: effettuare il taglio esclusivamente con un tagliatubi a rotella stringendo a piccoli intervalli per non
VFKLDFFLDUHLOWXER
18
‡
‡
‡
‡
‡
‡
‡
5LPXRYHUHHYHQWXDOLEDYHFRQO¶DSSRVLWRXWHQVLOH
,Q¿ODUHQHOWXERSULPDGLHVHJXLUHODFDUWHOODWXUDLOGDGRGL¿VVDJJLR¿J$
(VHJXLUHODFDUWHOODWXUDVXOOHHVWUHPLWjGHLWXELXWLOL]]DQGRO¶DSSRVLWRXWHQVLOHLQPRGRLPSHFFDELOHVHQ]DURWWXUHLQFULQDWXUH
RVIDOGDWXUH¿J%
$YYLWDUHPDQXDOPHQWHLOGDGRGHOWXERVXOOD¿OHWWDWXUDGHOO¶DWWDFFR
$YYLWDUHGH¿QLWLYDPHQWHXWLOL]]DQGRXQDFKLDYH¿VVDSHUWHQHUHIHUPDODSDUWH¿OHWWDWDGHOO¶DWWDFFRSHUHYLWDUQHGHIRUPD]LRQL
HXQDFKLDYHGLQDPRPHWULFDVXOGDGR¿JWDUDWDFRQLVHJXHQWLYDORULLQEDVHDOOHGLPHQVLRQLGHLWXEL:
'LDPHWUR¶¶1PFRSSLDGLVHUUDJJLR1P
'LDPHWUR¶¶1PFRSSLDGLVHUUDJJLR1P
3URYHHYHUL¿FKH¿JJ
8OWLPDWLLFROOHJDPHQWLGHLWXELRFFRUUHHVHJXLUHXQDYHUL¿FDVXOODSHUIHWWDWHQXWDGHOO¶LPSLDQWRIULJRULIHUR
3HUHVHJXLUHOHRSHUD]LRQLGLVHJXLWRGHVFULWWHqQHFHVVDULRXWLOL]]DUHXQJUXSSRPDQRPHWULFRVSHFL¿FRSHU5$HGXQDSRPSD
del vuoto con portata minima di 40 l/min:
1 6YLWDUHLOWDSSRGLFKLXVXUDGHOUDFFRUGRGLVHUYL]LRGHOODOLQHDGHOJDV¿JULI&
2 &ROOHJDUHODSRPSDGHOYXRWRHGLOJUXSSRPDQRPHWULFRPHGLDQWHGHLWXELÀHVVLELOLFRQDWWDFFRGD´DOUDFFRUGRGLVHUYL]LR
GHOODOLQHDGHOJDV¿J
3 Accendere la pompa ed aprire i rubinetti del gruppo manometrico.
4 $EEDVVDUHODSUHVVLRQH¿QRDN3DPP+JEDU
5 Continuare a mantenere la depressione per almeno 1 ora.
6 Chiudere i rubinetti del gruppo manometrico e spegnere la pompa.
7 'RSRPLQXWLVRORVHODSUHVVLRQHqULPDVWDDN3DPP+JEDUSDVVDUHDOO¶RSHUD]LRQHGLFXLDOSXQWR6HOD
SUHVVLRQHDOO¶LQWHUQRGHOFLUFXLWRqULVDOLWDDGXQYDORUHVXSHULRUHDN3DPP+JEDUqQHFHVVDULRSURFHGHUH
DOODULFHUFDGHOODSHUGLWDPHGLDQWHVROX]LRQHVDSRQDWDFRQFLUFXLWRIULJRULIHURLQSUHVVLRQHGLD]RWRaEDULQGLYLGXDWDH
riparata la quale è necessario poi ripartire dal punto 3.
8 &RQXQDFKLDYHHVDJRQDOHGDPPDSULUHORVWHORGHOODYDOYRODGHOOLTXLGR¿QRDGDSULUODFRPSOHWDPHQWH
9 Aprire completamente, servendosi di una chiave esagonale da5 mm, lo stelo della valvola del gas.
107RJOLHUHLOWXERÀHVVLELOHGLFDULFDFROOHJDWRDOUDFFRUGRGLVHUYL]LRGHOWXERGHOJDV
115LPHWWHUHDOVXRSRVWRLOWDSSRGHOUDFFRUGRGLVHUYL]LRGHOWXERGHOJDVH¿VVDUORFRQXQDFKLDYHLQJOHVHR¿VVD
125LPHWWHUHLWDSSLGHJOLVWHOLGHOOHYDOYROHGLVHUYL]LRVLDGHOJDVFKHGHOOLTXLGRH¿VVDUOL
Figura 14:
A Stelo valvola
B Coperchio stelo valvola
C Foro di carico
D Valvola principale
Figura 15:
A Gruppo manometrico
B Eventuale vacuometro
C Pompa del vuoto
D 5XELQHWWRGHOWXERÀHVVLELOHDSHUWR
E 5DFFRUGRGLVHUYL]LRFKLXVR
F Tubo del gas
G Tubo del liquido
H Unità esterna
2.4.2
Caricamento del refrigerante addizionale¿JJ
Se la lunghezza delle tubazioni è superiore ai 5 m rabboccare refrigerante come riportato della tabella al par. 2.4
5LSRUWDUHVXOO¶HWLFKHWWDDFRUUHGR¿JFRQO¶XQLWjHVWHUQDODFDULFDGHOO¶XQLWjHVWHUQD$ODTXDQWLWjGLUHIULJHUDQWHDGGL]LRQDWD
%HODFDULFDWRWDOHGHOVLVWHPD$%
Figura 17:
A Gruppo manometrico
B Eventuale vacuometro
C Rubinetto del liquido della bombola
D Bombola di gas R410A
E 5DFFRUGRGLVHUYL]LRFKLXVR
F Tubo del gas
G Tubo del liquido
H Unità esterna
2.5
COLLEGAMENTI IDRAULICI¿JJ
La scelta e l’installazione dei componenti è demandata, per competenza, all’installatore che dovrà operare secondo le regole
della buona tecnica e della Legislazione vigente.
Prima di collegare le tubazioni assicurarsi che queste non contengano sassi, sabbia, ruggine, scorie o comunque corpi estranei
che potrebbero danneggiare l’impianto.
È opportuno realizzare un by-pass nell’impianto per poter eseguire il lavaggio dello scambiatore a piastre senza dover scollegare
l’apparecchio. Le tubazioni di collegamento devono essere sostenute in modo da non gravare, con il loro peso, sull’apparecchio.
*OLDWWDFFKLLGUDXOLFLVRQRSRVL]LRQDWLQHOODSDUWHLQIHULRUHGHOO¶XQLWj¿J
I collegamenti idraulici vanno completati installando:
‡ YDOYROHGLV¿DWRDULDQHLSXQWLSLDOWLGHOOHWXED]LRQL
‡ JLXQWLHODVWLFLÀHVVLELOL
‡ YDOYROHGLLQWHUFHWWD]LRQH
‡ ¿OWURDFTXDDVHWDFFLRFRQPDJOLHGLPP
‡ LVRODUHWHUPLFDPHQWHWXWWLLFRPSRQHQWLHOHWXED]LRQLLGUDXOLFKH
19
ITALIANO
2
2
,OGLDPHWURQRPLQDOHPLQLPRGHOOHWXED]LRQLLGUDXOLFKHGLFROOHJDPHQWRGHYHHVVHUHGL´
3HUFRQVHQWLUHOHRSHUD]LRQLGLPDQXWHQ]LRQHRULSDUD]LRQHqLQGLVSHQVDELOHFKHRJQLDOODFFLDPHQWRLGUDXOLFRVLDGRWDWR
GHOOHUHODWLYHYDOYROHGLFKLXVXUDPDQXDOL
ITALIANO
La tabella sottostante mostra le caratteristiche che deve avere l’impianto idraulico.
Unità
OS-CEBSH24EI
OS-CEBCH36EI
OS-CEBCH48EI
U.I. SHERPA SMALL
Portata acqua
nominale*
Contenuto
acqua impianto
Pressione di
esercizio
Dislivello
impianto
OS-CEBTH48EI
OS-CEBCH60EI
OS-CEBTH60EI
U.I. SHERPA BIG
l/s
0,31
0,52
0,62
0,62
0,69
0,79
l
l
23
400
38
400
45
400
45
400
51
400
58
400
Max
kPa
300
300
300
300
300
300
Max
m
20
20
20
20
20
20
Min
Max**
* per impianti a pavimento
** con temperatura massima acqua impianto 35°C
,JUD¿FLLQ¿JPRVWUDQRODSUHYDOHQ]DGLVSRQLELOHSHURJQLYHORFLWjGHOFLUFRODWRUHLGUDXOLFRDOOHFRQQHVVLRQLLGUDXOLFKHGHOO¶XQLWj
interna.
9HUL¿FDUHFKHOHSHUGLWHGLFDULFRGHOO¶LPSLDQWRJDUDQWLVFDQRODSRUWDWDG¶DFTXDULFKLHVWDYHGLSDU
Se dovessero essere necessarie prevalenze superiori a causa di perdite di carico dell’impianto elevate si dovrà aggiungere un
vaso inerziale oppure un separatore idraulico ed una pompa esterna di rinvio.
&RQWUROODUHVHO¶LPSLDQWRKDXQFRQWHQXWRGLDFTXDPLQLPRULFKLHVWRSHUJDUDQWLUHLOEXRQIXQ]LRQDPHQWRGHOVLVWHPDVHLQVXI¿FLHQWH
aggiungere un vaso di accumulo tale da raggiungere il contenuto richiesto.
Le tubazioni di distribuzione dell’acqua dovranno essere adeguatamente isolate con polietilene espanso o materiali similari.
Anche le valvole di intercettazione, le curve ed i raccordi vari dovranno essere adeguatamente isolati.
3HUHYLWDUHVDFFKHGLDULDDOO¶LQWHUQRGHOFLUFXLWRLQVHULUHLGLVSRVLWLYLGLV¿DWRDXWRPDWLFLRPDQXDOLLQWXWWLLSXQWLWXED]LRQLSL
DOWHVLIRQLHFFGRYHO¶DULDVLSXzDFFXPXODUH
8QDYROWDULHPSLWRFRPSOHWDWRLOFLUFXLWRLGUDXOLFRHYHUL¿FDWRFKHQRQFLVLDQRSHUGLWHULPXRYHUHODVWDIIDGLEORFFDJJLR
SRPSDGLFLUFROD]LRQH¿JULI$ULPXRYHQGRLOGDGRGL¿VVDJJLR¿JULI%ULPRQWDUHLOGDGR
2.5.1
Circuito idraulico¿J
/RVFKHPDLGUDXOLFRGHOOD¿JUDSSUHVHQWDOHSDUWLSULQFLSDOLGHOO¶XQLWjLQWHUQDHGXQFLUFXLWRLGUDXOLFRWLSLFR
1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
A
B
C
D
E
20
Ingresso acqua
9DOYRODGLVLFXUH]]DEDU
Manometro
Sonda temperatura ritorno acqua impianto T1
Scambiatore a piastre
Sonda temperatura mandata acqua impianto T2
Flussostato
Vaso di espansione
Collettore resistenze elettriche
6¿DWRDULDDXWRPDWLFR
Pompa di circolazione
9DOYRODYLHGHYLDWULFHLQWHJUDWDDERUGRPDFFKLQDVXYHUVLRQH:
Uscita acqua impianto
Uscita acqua per accumulo acqua sanitaria
Filtro acqua a rete
Connessioni tubi refrigerante
Sonda temperatura bollitore sanitario T3
Unità interna
Unità esterna
,PSLDQWRYHQWLOFRQYHWWRULUDGLDWRULRSDQQHOOLSDYLPHQWLUDGLDQWL
Accumulo acqua sanitaria
6RUJHQWHGLFDORUHDJJLXQWLYDHVFDOGDLDDJDV
,QVWDOODUHVXOODWXED]LRQHG¶LQJUHVVRDFTXDGHOO¶DSSDUHFFKLRULWRUQRGDOO¶LPSLDQWRXQ¿OWURDVHWDFFLRFRQPDJOLHGLPP
2
VALORI DI RIFERIMENTO ACQUA IMPIANTO
‡
‡
‡
‡
‡
‡
‡
‡
2.7
S+·
&RQGXFLELOLWjHOHWWULFDFRPSUHVDWUDHPS/cm
'XUH]]DWRWDOHFRPSUHVDWUDHƒ)
)HUURWRWDOHPLQRUHGLSSP
0DQJDQHVHPLQRUHGLSSP
&ORUXULPLQRUHGLSSP
,RQL]ROIRDVVHQWL
,RQLDPPRQLDFDDVVHQWL
Se la durezza totale è superiore ai 20°F o alcuni valori di riferimento dell’acqua di reintegro non rientrano nei limiti indicati contattare
il nostro servizio prevendita per determinare i trattamenti da implementare.
Acque di pozzo o falda non provenienti da acquedotto vanno sempre analizzate attentamente e in caso condizionate con opportuni
sistemi di trattamento. In caso di installazione di un addolcitore oltre a seguire le prescrizioni del costruttore, regolare la durezza
GHOO¶DFTXDG¶XVFLWDQRQDOGLVRWWRGHLƒ)HIIHWWXDQGRDOWUHVuLWHVWGLS+HGLVDOLQLWjHYHUL¿FDUHODFRQFHQWUD]LRQHGLFORUXULLQ
uscita dopo la rigenerazione delle resine.
In caso di pericolo di gelo svuotare l’impianto o introdurvi del liquido antigelo in una percentuale congrua alle temperature minime
raggiungibili.
6ROX]LRQLGLDFTXDHJOLFROHHWLOHQLFRXVDWHFRPHÀXLGRWHUPRYHWWRUHLQOXRJRGLDFTXDSURYRFDQRXQDGLPLQX]LRQHGHOOHSUHVWD]LRQL
GHOOHXQLWj$GGL]LRQDUHO¶DFTXDFRQXQDSHUFHQWXDOHPDVVLPDGHOGLJOLFROHHWLOHQLFRSDULDGXQDSURWH]LRQH¿QRDƒ&
RIEMPIMENTO IMPIANTO IDRAULICO
Una volta terminati i collegamenti idraulici, occorre procedere al riempimento dell’impianto. Contemporaneamente a questo è
QHFHVVDULRV¿DWDUHO¶DULDDOO¶LQWHUQRGHOOHWXED]LRQLHGHOO¶DSSDUHFFKLRWUDPLWHJOLV¿DWLDULDVXOFLUFXLWRHVXOO¶DSSDUHFFKLR
Inizialmente, con circuito acqua vuoto, la macchina non deve essere collegata alla rete di alimentazione elettrica. Solo nelle
IDVL¿QDOLGLULHPSLPHQWRGHOFLUFXLWRLGUDXOLFRVLSXzDOLPHQWDUHODPDFFKLQDHIDUSDUWLUHODSRPSDGLFLUFROD]LRQH6LFRQVLJOLD
di attivare la funzione di forzatura temporanea della pompa di circolazione per 15 minuti tramite l’attivazione del parametro FPA
YHGLSDU&RQWUROOLGHOODSRPSDGLFLUFROD]LRQH
6HXWLOL]]DWDXQDSRPSDDXVLOLDULDHVWHUQDDQFKHTXHVWDGHYHHVVHUHDYYLDWDVRORQHOOHIDVL¿QDOLGLULHPSLPHQWRGHOFLUFXLWR
La pressione di esercizio dell’impianto non deve superare gli 1,5 BAR a pompa spenta.
,QRJQLFDVRSHUYHUL¿FDUHHYHQWXDOLSHUGLWHGHOO¶LPSLDQWRDOO¶DWWRGHOFROODXGRVLFRQVLJOLDGLDO]DUHODSUHVVLRQHGLWHVWSUHVVLRQH
PDVVLPDEDUSHUSRLVFDULFDUORVXFFHVVLYDPHQWHSHUUDJJLXQJHUHODSUHVVLRQHGLHVHUFL]LR
2.8
SBLOCCO POMPA CIRCOLAZIONE¿J
Se durante le prima accensione, dopo l’avvio del circolatore compare sul display del pannello di controllo AL6, controllare che
OHYDOYROHGHOO¶LPSLDQWRVLDQRDSHUWHFKHFLVLDDOPHQRXQ¶XWHQ]DFRQLOFLUFXLWRDSHUWRFKHLO¿OWURDVHWDFFLRHVWHUQRQRQVLD
ostruito, che non vi siano bolle d’aria all’interno del circuito, che la pressione idrica dell’impianto sia corretta e che il circolatore
non sia bloccato.
Dopo aver rimosso la causa togliere l’allarme premendo sul pannello comandi per dieci secondi il pulsante di accensione
¿J.H\
3HUVEORFFDUHODSRPSDGLFLUFROD]LRQHUXRWDUHO¶DOEHURGHOODVWHVVDFRPHULSRUWDWRLQ¿JGRSRDYHUULPRVVRLOWDSSR
2.9
COLLEGAMENTI ELETTRICI¿JJ
‡ ,FROOHJDPHQWLHOHWWULFLGHYRQRHVVHUHHVHJXLWLQHOULVSHWWRGHOOHLVWUX]LRQLFRQWHQXWHQHOPDQXDOHGLLQVWDOOD]LRQHHGHOOHQRUPH
RSUDWLFKHFKHUHJRODQRJOLDOODFFLDPHQWLGLDSSDUHFFKLHOHWWULFLDOLYHOORQD]LRQDOHLQVXI¿FLHQWHFDSDFLWjRFROOHJDPHQWLHOHWWULFL
incompleti potrebbero essere causa di scosse elettriche o incendio.
‡ Attenzione i circuiti di alimentazione elettrica delle unità interna ed esterna devono essere separati; la linea dell'unità
esterna deve essere protetta con interruttore magnetotermico o fusibili opportunamente dimensionati.
‡ 1RQXWLOL]]DUHPDLXQ¶DOLPHQWD]LRQHDOODTXDOHVLDFROOHJDWRDQFKHXQDOWURDSSDUHFFKLR
‡ 3HULOFROOHJDPHQWRXWLOL]]DUHXQFDYRGLOXQJKH]]DVXI¿FLHQWHDFRSULUHO¶LQWHUDGLVWDQ]DVHQ]DDOFXQDFRQQHVVLRQHQRQ
XWLOL]]DUHSUROXQJKHQRQDSSOLFDUHDOWULFDULFKLVXOO¶DOLPHQWD]LRQHPDXWLOL]]DUHXQFLUFXLWRGLDOLPHQWD]LRQHGHGLFDWRLQFDVR
FRQWUDULRSRWUHEEHHVVHUFLULVFKLRGLVXUULVFDOGDPHQWRVFRVVDHOHWWULFDRLQFHQGLR
‡ 3HU L FROOHJDPHQWL HOHWWULFL IUD XQLWj LQWHUQD HG HVWHUQD XWLOL]]DUH L WLSL GL FDYL VSHFL¿FDWL ¿VVDUH VDOGDPHQWH L FDYL GL
interconnessione in modo che i rispettivi morsetti non siano sottoposti a sollecitazioni esterne utilizzando i fermacavi all’interno
GHOOHXQLWjFROOHJDPHQWLR¿VVDJJLLQFRPSOHWLSRVVRQRHVVHUHFDXVDGLVXUULVFDOGDPHQWRRLQFHQGLR
‡ 'RSR DYHU FROOHJDWR L FDYL GL LQWHUFRQQHVVLRQH H GL DOLPHQWD]LRQH DFFHUWDUVL FKH L FDYL VLDQR VLVWHPDWL LQ PRGR GD QRQ
HVHUFLWDUHIRU]HHFFHVVLYHVXOOHFRSHUWXUHRVXLSDQQHOOLHOHWWULFLPRQWDUHOHFRSHUWXUHVXLFDYL
‡ 1HOFDVRLQFXLGXUDQWHO¶RSHUD]LRQHGLLQVWDOOD]LRQHYLVLDVWDWDIXRULXVFLWDGLUHIULJHUDQWHDHUDUHO¶DPELHQWHLOUHIULJHUDQWH
VHHVSRVWRDOOD¿DPPDSURGXFHJDVWRVVLFR
Prima di effettuare qualsiasi intervento assicurarsi che le alimentazioni elettriche delle unità esterna ed interna siano disinserite.
3HULFROOHJDPHQWLHOHWWULFLIDUHULIHULPHQWRDOOH¿JJ
La tensione di alimentazione deve essere quella riportata nella tabella delle caratteristiche tecniche.
I terminali dei cavi devono essere provvisti di terminali a puntale di sezione proporzionata ai cavi di collegamento prima del loro
inserimento all’interno della morsettiera.
21
ITALIANO
2.6
ITALIANO
2
Le linee di alimentazione devono essere adeguatamente dimensionate per evitare cadute di tensione o il surriscaldamento di
cavi o altri dispositivi posti sulle linee stesse.
La linea di alimentazione dell’unità esterna deve essere sezionabile dalla rete elettrica mediante un interruttore magnetotermico
adeguato all’assorbimento della macchina con relè differenziale con taratura massima pari a quanto prescritto dalle normative
HOHWWULFKHQD]LRQDOLULIHULUVLDOODWDEHOODGL¿J
/DOLQHDGHOO¶XQLWjLQWHUQDqJLjSURWHWWDGDXQPDJQHWRWHUPLFRVXOO¶DOLPHQWD]LRQHGHOOHUHVLVWHQ]HHOHWWULFKHHGDXQIXVLELOHYHGL
SDUVLFRQVLJOLDGLLQVWDOODUHVXOODOLQHDGLDOLPHQWD]LRQHXQUHOqGLIIHUHQ]LDOH
9HUL¿FDUHFKHGXUDQWHLOIXQ]LRQDPHQWRGHOFRPSUHVVRUHODWHQVLRQHGLDOLPHQWD]LRQHHOHWWULFDFRUULVSRQGDDOYDORUH
nominale +/-10%.
ÊYLHWDWRO¶XVRGHLWXELGHOUHIULJHUDQWHHGHOO¶DFTXDSHUODPHVVDDWHUUDGHOO¶DSSDUHFFKLR
Il costruttore non è responsabile di eventuali danni causati dalla mancanza di messa a terra o dall’inosservanza di quanto riportato
negli schemi elettrici.
/DWDEHOODGL¿JPRVWUDJOLDVVRUELPHQWLPDVVLPLGHOOHXQLWj
A
B
C
D
E
F
G
Alimentazione unità esterna
Potenza massima assorbita unità esterna
Corrente massima assorbita unità esterna
)XVLELOHRPDJQHWRWHUPLFR0)$
Alimentazione unità interna
3RWHQ]DPDVVLPDDVVRUELWDXQLWjLQWHUQDFRQUHVLVWHQ]HHOHWWULFKHDWWLYDWH
&RUUHQWHPDVVLPDDVVRUELWDXQLWjLQWHUQDFRQUHVLVWHQ]HHOHWWULFKHDWWLYDWH
$FFHVVRDOOHFRQQHVVLRQLHOHWWULFKH
Le morsettiere per le connessioni elettriche dell’unità esterna sono situate nella parte laterale destra dell’unità, per accedervi
ULPXRYHUHLOFRSHUFKLRGHOTXDGURHOHWWULFRGRSRDYHUWROWROHYLWLGL¿VVDJJLR
Per accedere alle morsettiere per le connessioni elettriche dell’unità interna, far riferimento ai par. 2.1.1 e 2.1.2.
Tali operazioni sono consentite solo a personale specializzato.
2.9.2
Cavi di collegamento
La tabella seguente riassume i cavi da utilizzare.
Cavo comunicazione ODU/IDU
A
2 x 0,5 mm2 schermato
Cavo sonda ACS e aria esterna
B
H03RN-F 2 G 0,5 / H03VV-F 2 G 0,5
UNITÀ INTERNA
Cavo alimentazione
C
UNITÀ ESTERNA
Cavo alimentazione
D
SHERPA SMALL
SHERPA BIG
H05VV 3 x 2,5 mm2
H05VV-F 3 x 4 mm2
OSCEBSH24EI
OSCEBCH36EI
OSCEBCH48EI
OS-CEBTH48EI
OSCEBCH60EI
OS-CEBTH60EI
H07RN-F 3 G2,5
H07RN-F 3 G4
H07RN-F 3 G4
H07RN-F 5 G2,5
H07RN-F 3 G4
H07RN-F 5 G2,5
&RQQHVVLRQLHOHWWULFKH¿JJ
Effettuare le connessioni dei cavi elencati nel paragrafo precedente alle morsettiere delle unità interna ed esterna facendo
ULIHULPHQWRDOOH¿JJHFRPHVRWWRGHVFULWWR
Unità interna:
‡ morsetti L-N- alimentazione dell’unità interna
‡ morsetti 24-25LQJUHVVRVRQGDGLULOHYD]LRQHGHOODWHPSHUDWXUDHVWHUQDQHFHVVDULRSHUDWWLYD]LRQHGHOOHFXUYHFOLPDWLFKH
per l’abilitazione delle resistenze elettriche di riscaldamento poste all’interno dell’unità o per l’attivazione di una sorgente di
FDORUHHVWHUQD
‡ morsetti 26-27LQJUHVVRVRQGDGLULOHYD]LRQHGHOODWHPSHUDWXUDVHUEDWRLRDFTXDVDQLWDULDQHFHVVDULRSHULOFRQWUROORGHOOD
WHPSHUDWXUDGHOVHUEDWRLRDFTXDVDQLWDULDHODJHVWLRQHGHLFLFOLDQWLOHJLRQHOOD
‡ morsetti Q-P: cavo di comunicazione tra unità interna ed unità esterna
‡ morsetti N-L-12: valvola a tre vie per deviazione acqua sanitaria installata di serie sulla versione 3W a bordo macchina,
LQVWDOODELOHHVWHUQDPHQWHQHOODYHUVLRQHEDVHGLVSRQLELOHXQNLW
‡ morsetti N-13: attivazione contattore per alimentazione resistenza elettrica nel serbatoio di acqua sanitaria durante i cicli
DQWLOHJLRQHOOD9+]:PD[
‡ morsetti 14-15DWWLYD]LRQHVRUJHQWHGLFDORUHHVWHUQDHVERLOHUDJDVFRQWDWWR$$9DF
‡ morsetti 16-17FRQWDWWRDOODUPHFRQWDWWR$$9DF
‡ morsetti 5-LULFKLHVWDDFTXDFDOGDVDQLWDULDTXDQGRODWHPSHUDWXUDGHOVHUEDWRLRDFTXDFDOGDVDQLWDULDYLHQHGH¿QLWDGDXQ
FRQWUROORHVWHUQRGHGLFDWRXQFRQWDWWRLQFKLXVXUDSRVWRWUDTXHVWLPRUVHWWLDWWLYDODULFKLHVWDGLDFTXDFDOGDVDQLWDULD
‡ PRUVHWWRVFKHGDHOHWWURQLFD contatto pulito remoto accensione / spegnimento
22
‡ PRUVHWWRVFKHGDHOHWWURQLFD contatto pulito remoto modo riscaldamento/modo raffreddamento
‡ PRUVHWWRVFKHGDHOHWWURQLFD contatto pulito remoto modo Eco
‡ PRUVHWWRVFKHGDHOHWWURQLFD contatto pulito remoto modalità notturna
‡ PRUVHWWRVFKHGDHOHWWURQLFDFRQWDWWRSXOLWRUHPRWRDWWLYD]LRQHDFTXDVDQLWDULDJLjFROOHJDWRDPRUVHWWLHUD/
‡ PRUVHWWRVFKHGDHOHWWURQLFDFRQWDWWRSXOLWRUHPRWR7$YHGLSDUFRQWUROORUHPRWR
‡ PRUVHWWRVFKHGDHOHWWURQLFD collegamento comune contatti puliti remoti
,PRUVHWWLGDDVLWURYDQRVXOODVFKHGDHOHWWURQLFDLPRUVHWWLSRVVRQRHVVHUHV¿ODWLGDOODVFKHGDFRVuGDSRWHUOLFROOHJDUHSL
IDFLOPHQWHSHUSRLUHLQVHULWLQHOODSRVL]LRQHRULJLQDOHYHGL¿J
7XWWLLFDYLDJJLXQWLGHYRQRHVVHUHGLXQDOXQJKH]]DVXI¿FLHQWHGDFRQVHQWLUHO¶DSHUWXUDGHOTXDGURHOHWWULFR
Unità esterna monofase:
alimentazione dell’unità esterna
‡ morsetti L-Ncavo di comunicazione tra unità interna ed unità esterna
‡ morsetti Q-PUnità esterna trifase:
‡ morsetti R-S-T-Nalimentazione dell’unità esterna
cavo di comunicazione tra unità interna ed unità esterna
‡ morsetti Q-P)LVVDUHWXWWLLFDYLFRQJOLDSSRVLWLIHUPDFDYL
2.10
CONTROLLI DI INSTALLAZIONE¿JJ
2.10.1
Preparazione alla prima messa in servizio¿J
/DSULPDPHVVDLQVHUYL]LRGHOODSRPSDGLFDORUHDULDDFTXDGHYHHVVHUHHIIHWWXDWDGDOSHUVRQDOHWHFQLFRTXDOL¿FDWR
Prima di mettere in servizio le pompe di calore aria-acqua accertarsi che:
‡ 7XWWHOHFRQGL]LRQLGLVLFXUH]]DVLDQRVWDWHULVSHWWDWH
‡ /DSRPSDGLFDORUHDULDDFTXDVLDVWDWDRSSRUWXQDPHQWH¿VVDWDDOSLDQRGLDSSRJJLR
‡ 6LDVWDWDRVVHUYDWDO¶DUHDGLULVSHWWR
‡ ,FROOHJDPHQWLLGUDXOLFLVLDQRVWDWLHVHJXLWLVHFRQGRLOOLEUHWWRG¶LVWUX]LRQH
‡ /¶LPSLDQWRLGUDXOLFRVLDVWDWRFDULFDWRHV¿DWDWR
‡ /HYDOYROHGLLQWHUFHWWD]LRQHGHOFLUFXLWRLGUDXOLFRVLDQRDSHUWH
‡ 6HSUHVHQWHXQDFDOGDLDQHOO¶LPSLDQWRYHUL¿FDUHFKHVLDQRVWDWHLQVWDOODWHOHYDOYROHGLQRQULWRUQRVXJOLLQJUHVVLDFTXDDOOD
pompa di calore ed alla caldaia in modo tale da evitare riduzioni di portata d’acqua nell’impianto ed ingresso di acqua troppo
calda nella pompa di calore
‡ ,FROOHJDPHQWLHOHWWULFLVLDQRVWDWLHVHJXLWLFRUUHWWDPHQWH
‡ /DWHQVLRQHVLDFRPSUHVDWUDH9OHXQLWjPRQRIDVHHH9SHUOHXQLWjWULIDVH
‡ /¶DOLPHQWD]LRQHWULIDVHSHULPRGHOOLWULIDVHDEELDXQRVELODQFLDPHQWRPDVVLPRWUDOHIDVLGHO
‡ /DPHVVDDWHUUDVLDHVHJXLWDFRUUHWWDPHQWH
‡ ,OVHUUDJJLRGLWXWWHOHFRQQHVVLRQLHOHWWULFKHVLDVWDWREHQHVHJXLWR
‡ /DVH]LRQHGHLFDYLGLDOLPHQWD]LRQHVLDDGHJXDWDDOO¶DVVRUELPHQWRGHOO¶DSSDUHFFKLRHGDOODOXQJKH]]DGHOFROOHJDPHQWR
eseguito
‡ /D SURFHGXUD GL UHJROD]LRQH GHOOD GXUH]]D GHOO¶DFTXD VLD VWDWD HVHJXLWD HG LO SRWHQ]LRPHWUR VXOOD VFKHGD ODYDJJL VLD
correttamente posizionato
‡ 5LPXRYHUHRJQLRJJHWWRLQSDUWLFRODUHWUXFLROLVSH]]RQLGL¿ORHYLWHULH
‡ &RQWUROODUHFKHWXWWLLFDYLVLDQRFROOHJDWLHFKHWXWWLLFROOHJDPHQWLHOHWWULFLVLDQREHQVROLGL
‡ 3ULPDGLSRWHUDYYLDUHLOFRPSUHVVRUHLOVLVWHPDGHYHHVVHUHVWDWRDFFHVRFRQWLQXDPHQWHSHUDOPHQRRUH
‡ 6LDODYDOYRODGLVHUYL]LRGHOWXERGHOJDVFKHTXHOODGHOWXERGHOOLTXLGR¿JULI(GHYRQRHVVHUHDSHUWH
‡ &KLHGHUHDOFOLHQWHGLHVVHUHSUHVHQWHDOODSURYDGHOIXQ]LRQDPHQWR
‡ ,OOXVWUDUHLFRQWHQXWLGHOPDQXDOHG¶LVWUX]LRQLDOFOLHQWH
‡ &RQVHJQDUHDOFOLHQWHLOPDQXDOHG¶LVWUX]LRQLHLOFHUWL¿FDWRGLJDUDQ]LD
2.10.2
Controlli durante e dopo la prima messa in servizio¿J
$GDYYLDPHQWRHIIHWWXDWRELVRJQDYHUL¿FDUHFKH
‡ /DFRUUHQWHDVVRUELWDGDOFRPSUHVVRUHVLDLQIHULRUHDTXHOODPDVVLPDLQGLFDWDQHLGDWLGLWDUJD
‡ 9HUL¿FDUHFKHGXUDQWHLOIXQ]LRQDPHQWRGHOFRPSUHVVRUHODWHQVLRQHHOHWWULFDFRUULVSRQGDDOYDORUHGLWDUJD
‡ 9HUL¿FDUHFKHO¶DOLPHQWD]LRQHWULIDVHDEELDXQRVELODQFLDPHQWRPDVVLPRWUDOHIDVLGHO
‡ 9HUL¿FDUHFKHLOOLYHOORGLUXPRURVLWjGHOFRPSUHVVRUHWULIDVHQRQVLDDQRUPDOH
‡ /¶DSSDUHFFKLRRSHULDOO¶LQWHUQRGHOOHFRQGL]LRQLGLIXQ]LRQDPHQWRFRQVLJOLDWHYHGL¿J
‡ ,OFLUFXLWRLGUDXOLFRVLDFRPSOHWDPHQWHGLVDHUDWR
‡ /DSRPSDGLFDORUHDULDDFTXDHVHJXDXQDUUHVWRHODVXFFHVVLYDULDFFHQVLRQH
‡ ,OVDOWRWHUPLFRWUDPDQGDWDHULWRUQRLPSLDQWRGHYHHVVHUHFRPSUHVRWUD·ƒ&LQWHUURJDQGRLSDUDPHWULWHW
‡ 6HLOVDOWRWHUPLFRGRYHVVHHVVHUHLQIHULRUHDLƒ&LPSRVWDUHXQDYHORFLWjGHOFLUFRODWRUHSLEDVVD6HDOFRQWUDULRLOVDOWRULVXOWD
SLDOWRGLƒ&YHUL¿FDUHO¶DSHUWXUDGLWXWWHOHYDOYROHSUHVHQWLVXOO¶LPSLDQWRHGHYHQWXDOPHQWHDJJLXQJHUHXQDSRPSDHVWHUQD
per aumentare la portata d’acqua.
23
ITALIANO
2
3
3
ITALIANO
3.1
3.1.1
USO E MANUTENZIONE
PANNELLO DI COMANDO DELL’UNITÀ INTERNA¿J
Aprendo lo sportello sul pannello frontale si accede al manometro, al pannello di controllo ed all’interruttore generale.
6XOSDQQHOOR¿JVRQRSUHVHQWLLVHJXHQWLGLVSRVLWLYL
A 0DQRPHWUR9LVXDOL]]DODSUHVVLRQHGHOO¶LPSLDQWRLGUDXOLFRFRQVHQWHGLYHUL¿FDUHODSUHVVLRQHGHOO¶DFTXDDOO¶LQWHUQRGHOFLUFXLWR
I valori devono essere compresi da 1 a 2 bar.
B Pannello di controllo
C Interruttore generale unità interna
D 9LWH¿VVDJJLRSDQQHOORDQWHULRUH
Descrizione pannello di controllo¿J
Il pannello di controllo ha un display, una tastiera ad otto tasti e nove led.
Led A: viene usato quando vengono mostrate delle temperature
Led B: punto decimali
Led1 DFFHQVLRQHJLDOOR
Led2 UDIIUHGGDPHQWRYHUGH
Led3 ULVFDOGDPHQWRURVVR
Led4 SRPSDDFFHVDYHUGH
Led5 DOODUPHDWWXDOHVWRULFRURVVR
Led6 ULVFDOGDWRUHDGGL]LRQDOHJLDOOR
Led7 WHPSRUL]]DWRUHDWWLYDWRJLDOOR
Led8 SURGX]LRQHDFTXDVDQLWDULDDWWLYDURVVR
Led9 PRGR(&2DWWLYRYHUGH
Key1:
IUHFFLDVXSHUPXRYHUVLVXOPHQRPRGL¿FDUHLOYDORUHYLVXDOL]]DWR
Key2:
IUHFFLDJLFRPHLO.H\ PDQHOODGLUH]LRQHRSSRVWD4XDQGRSUHPXWRLQVLHPHDO.H\
permette l’uscita al menù
precedente.
selezione raffreddamento/riscaldamento/solo produzione acqua sanitaria.
Key3:
Key4:
PHQGLFRQ¿JXUD]LRQH3HUPHWWHGLDFFHGHUHDLPHQXWHQWHRVHUYLFH
menù temperatura/impostazione. Premendo questo pulsante, si ha l’accesso diretto ai valori di temperatura mnemonici.
Key5:
3UHPHQGROHIUHFFHVLSXzVHOH]LRQDUHTXHOORGHVLGHUDWRHFRQ.H\
vederne il valore. Per l’impostazione delle
WHPSHUDWXUHSUHPHUH.H\
SHUWUHVHFRQGLHOHIUHFFHSHUPRGL¿FDUQHLOYDORUHSUHPHUH.H\
per
confermare. L’uscita dal menù avviene automaticamente dopo 60 secondi senza schiacciare alcun pulsante o premendo
contemporaneamente le frecce.
3HUPHWWHGLPRVWUDUHLOYDORUHGHOSDUDPHWURPRGL¿FDUQHO¶LPSRVWD]LRQHSUHPHQGRORSHUWUHVHFRQGLHFRQIHUPDUH
Key6:
il nuovo valore
Key7:
Abilita o disabilita il secondo set point CS2 in raffreddamento o HS2 in riscaldamento per consentire un risparmio
energetico.
Key8:
Premendo questo pulsante l’unità viene accesa o messa in attesa.
3.2
ATTIVAZIONE E FUNZIONI UTENTE
3.2.1
Attivazione¿JJ
5LIHULUVLDOOD¿JXUDSHULOHGHGLSXOVDQWLGHOSDQQHOORFRPDQGL
Per attivare l’unità procedere nel seguente modo:
‡ 'DUHWHQVLRQHDOO¶XQLWjLQWHUQDHGDOO¶XQLWjHVWHUQDWUDPLWHJOLLQWHUUXWWRULJHQHUDOL
‡ $WWLYDUHLOTXDGURGHOO¶XQLWjLQWHUQDWUDPLWHO¶LQWHUUXWWRUH¿JULI&VXOSDQQHOORFRPDQGL
giallo ed il led verde
che mostra l’attivazione della pompa
‡ 3UHPHUHLOWDVWR.H\ sull’interfaccia utente, si accenderà il led1
GLFLUFROD]LRQHLQ¿QHVXOGLVSOD\YLHQHYLVXDOL]]DWRLOPRGRGLIXQ]LRQDPHQWR&/*SHULOPRGRUDIIUHGGDPHQWR+7*SHU
riscaldamento e San per produzione acqua sanitaria.
‡ 3UHPHUHLOWDVWR.H\
SHUVHOH]LRQDUHLOPRGRGLIXQ]LRQDPHQWRSUHPHQGR.H\
in sequenza si attiva modo
raffreddamento e si accende il led 2 verde
, poi il modo riscaldamento e si accende il led 3 rosso
LQ¿QHVLDWWLYD
il modo produzione acqua sanitaria ed i led 2 e 3 saranno spenti.
3UHPHQGRLOSXOVDQWH.H\
VLDWWLYDLOPRGRGLULVSDUPLRHQHUJHWLFR(FRO¶DFFHQVLRQHGHOOHG
verde mostra l’attivazione
del modo Eco.
3.2.2
Menù temperature/set
'DOSDQQHOORFRPDQGLqSRVVLELOHYHUL¿FDUHOHWHPSHUDWXUHPLVXUDWHGDOOHVRQGHGHOO¶XQLWjLQWHUQDHYLVXDOL]]DUHHGLPSRVWDUHL
VHWSRLQWDFTXDPHQWHPSHUDWXUHVHW
Le temperature ed i set point visualizzabili sul display sono:
‡ WWHPSHUDWXUDDFTXDHQWUDQWH
‡ WWHPSHUDWXUDDFTXDXVFHQWH
‡ WWHPSHUDWXUDVHQVRUHVHUEDWRLRDFTXDVDQLWDULD
24
3
WWHPSHUDWXUDVHQVRUHDULDHVWHUQD
F6VHWSRLQWLQPRGRUDIIUHGGDPHQWR
F6VHWSRLQW(FRLQPRGRUDIIUHGGDPHQWR
&+&RUHGLIXQ]LRQDPHQWRFRPSUHVVRUH
+6VHWSRLQWLQPRGRULVFDOGDPHQWR
+6VHWSRLQW(FRLQPRGRULVFDOGDPHQWR
ITALIANO
‡
‡
‡
‡
‡
‡
Per visualizzare le suddette temperature/set procedere nel seguente modo:
, si visualizza t1 sul display
‡ 3UHPHUH.H\
R.H\
, per visualizzare gli altri mnemonici sul display
‡ 3UHPHUH.H\
, si visualizza il valore di temperatura/set misurato
‡ 3UHPHUH.H\
‡ 3UHPHUH.H\
per uscire dal modo temperature/set
3.2.3
Menù utente
7UDPLWHLOSDQQHOORGLFRQWUROORGHOO¶XQLWjLQWHUQDLQROWUHqSRVVLELOHDWWLYDUHOHVHJXHQWLIXQ]LRQLPRGL¿FDELOLGDOPHQXWHQWH
‡
OROLOGIO
3HULPSRVWDUHO¶RURORJLRPRGL¿FDUHLOSDUDPHWURKU6SHUOHRUHHGLOSDUDPHWURɉLQSHULPLQXWL
‡
TIMER
Con questa funzione è possibile far avviare e spegnere una volta al giorno il sistema.
&RQLOSDUDPHWURWLɉ VLDWWLYDODIXQ]LRQHFRQLOSDUDPHWUR6W$VLLPSRVWDO¶RUDGLDYYLDPHQWRHFRQLOSDUDPHWUR6WRVL
imposta l'ora di spegnimento del sistema.
‡
FUNZIONAMENTO NOTTURNO
Con la modalità funzionamento notturno viene limitata la resa ed il rumore del sistema.
/DIXQ]LRQHYLHQHDELOLWDWDFRQLOSDUDPHWURQF/ O¶RUDGLLQL]LRPRGRFRQLOSDUDPHWURQ6WHO¶RUDGL¿QHFRQLOSDUDPHWUR
nSP.
‡
SET POINT RAFFREDDAMENTO
È possibile impostare il termostato per due diverse temperature di raffreddamento dell’acqua tramite i parametri CS1 e CS2.
La temperatura CS2 verrà utilizzata attivando il modo Eco in raffreddamento.
‡
SET POINT RISCALDAMENTO
È possibile impostare il termostato per due diverse temperature di riscaldamento dell’acqua tramite i parametri HS1 e HS2.
La temperatura HS2 verrà utilizzata attivando il modo Eco in riscaldamento.
‡
SET POINT SANITARIO
È possibile impostare il termostato per una temperatura di riscaldamento dell’acqua tramite il parametro HS3.
‡
CURVE CLIMATICHE
Per ottimizzare il risparmio energetico, sono disponibili due curve climatiche, una per il riscaldamento ed una per il
raffreddamento. Questa funzione permette di adeguare la temperatura dell’acqua alla temperatura dell’aria esterna e quindi
al carico termico ottimizzando il risparmio energetico del sistema.
/H FXUYH FOLPDWLFKH GHYRQR HVVHUH LPSRVWDWH DGHJXDWDPHQWH DOO¶LPSLDQWR GDO SHUVRQDOH DXWRUL]]DWR PRGL¿FDQGR DOFXQL
parametri nel menù service.
/¶XWHQWHSXzDELOLWDUHODFXUYDLQULVFDOGDPHQWRLPSRVWDQGRLOSDUDPHWUR+FF +FF ODFXUYDYLHQHHVFOXVDHGLOVLVWHPD
funziona con i set point Hs1 e Hs2.
/¶XWHQWHSXzDELOLWDUHODFXUYDLQUDIIUHGGDPHQWRLPSRVWDQGRLOSDUDPHWUR&FF &FF ODFXUYDYLHQHHVFOXVDHGLOVLVWHPD
funziona con i set point Cs1 e Cs2.
3.3
IMPOSTAZIONE DEI PARAMETRI MENÙ UTENTE
è possibile accedere al menù utente, premendolo verrà visualizzato sul display Usr per User
7UDPLWHLOSXOVDQWH.(<
XWHQWH
8QDYROWDVHOH]LRQDWRLOPHQXWHQWHSUHPHQGR.(<
, si entra nel menù e viene visualizzato il primo parametro, poi
con le frecce sù e giù è possibile visualizzare tutti i parametri del menù utente. Premendo nuovamente il pulsante info/set si
visualizza il valore del parametro, premendo nuovamente info/set per tre secondi il valore sul display lampeggia e può essere
PRGL¿FDWRLOYDORUHYROXWRFRQOHIUHFFH.H\
H.H\
, premere
per confermare.
Premere menù per uscire e le frecce per selezionare un altro parametro.
Procedere nello stesso modo per gli altri parametri.
L’uscita dal menù avviene automaticamente dopo 60 secondi senza schiacciare alcun pulsante o premendo contemporaneamente
H.H\
.
OHGXHIUHFFH.H\
25
3
ITALIANO
Per l’impostazione dei parametri fare riferimento anche alla tabella sottostante riassuntiva dei parametri.
Esempio:
3UHPHUH.H\
3UHPHUH.H\
3UHPHUH.H\
3UHPHUH.H\
3UHPHUH.H\
3UHPHUH.H\
3UHPHUH.H\
3UHPHUH.H\
3UHPHUH.H\
, si visualizza USr sul display
VLYLVXDOL]]DLOSULPRSDUDPHWURKU6LPSRVWD]LRQHRUHGHOO¶RURORJLR
VLYLVXDOL]]DLOYDORUHGHOSDUDPHWURHV
per tre secondi, il valore del parametro lampeggia sul display
.H\
per aumentare o diminuire il valore del parametro visualizzato sul display
, per confermare il valore impostato, il display smette di lampeggiare
, per uscire e visualizzare il parametro
R.H\
SHUFDPELDUHSDUDPHWURHSURFHGHUHFRPHVRSUDSHUPRGL¿FDUHDOWULSDUDPHWUL
H.H\
contemporaneamente per uscire dal menu utente
Parametro
MNEMONICO
DISPLAY
MENU
Campo di
regolazione
Impostazione
di fabbrica
OROLOGIO SISTEMA:
IMPOSTAZIONE ORA
Kɝ6
Utente
0-23
0
OROLOGIO SISTEMA:
IMPOSTAZIONE
MINUTI
ɉLQ
Utente
0-59
0
ATTIVAZIONE/
DISATTIVAZIONE
TIMER
WLPHUGLVDWWLYDWR
WLPHUDWWLYDWR
WLɉ
Utente
0-1
0
ORA DI AVVIAMENTO
SISTEMA
StA
Utente
00.0 – 23.5
0.00
ORA DI
SPEGNIMENTO
SISTEMA
Sto
Utente
00.0 – 23.5
0.00
'HFLPDOL GHFLQHGLPLQXWLHV
PLQXWL PLQXWL
'HFLPDOL GHFLQHGLPLQXWLHV
PLQXWL PLQXWL
La resa ed il rumore massimo
sono ridotti
ATTIVAZIONE/
DISATTIVAZIONE
MODO NOTTURNO
PRGRQRWWXUQR
disattivato
PRGRQRWWXUQR
attivato
ncL
Utente
0,1
0
ORA DI ACCENSIONE
MODO NOTTURNO
nSt
Utente
00.0 – 23.5
0.00
ORA DI
SPEGNIMENTO
MODO NOTTURNO
nSP
Utente
00.0 – 23.5
0.00
Temperatura acqua
ingresso
t1
Temperature/
Set
Temperatura acqua
uscita
t2
Temperature/
Set
Temperatura sensore
serbatoio acqua
sanitaria
t3
Temperature/
Set
Temperatura sensore
aria esterna
t4
Temperature/
Set
CHC
Temperature/
Set
/XF ƒ&
- 25°C
/XF ƒ&
- 20°C
/XF ƒ&
/XF ƒ&
Impostazioni di fabbrica per
pavimenti radianti
/XF ƒ&
- 25°C
/XF ƒ&
- 20°C
/XF ƒ&
/XF ƒ&
Impostazioni di fabbrica per
pavimenti radianti
/XF ƒ&
- 55°C
/XF ƒ&
- 60°C
/XF ƒ&
/XF ƒ&
Impostazioni di fabbrica per
pavimenti radianti
Ore di funzionamento
compressore
SET POINT
RAFFREDDAMENTO
1
cS1
Temperature/
Set
Utente
SET POINT
RAFFREDDAMENTO
(FR0RGH
cS2
Temperature/
Set
Utente
SET POINT
RISCALDAMENTO 1
HS1
Temperature/
Set
Utente
26
COMMENTI
'HFLPDOL GHFLQHGLPLQXWLHV
PLQXWL PLQXWL
'HFLPDOL GHFLQHGLPLQXWLHV
PLQXWL PLQXWL
3
SET POINT
RISCALDAMENTO 2
(FR0RGH
MNEMONICO
DISPLAY
HS2
MENU
Campo di
regolazione
Impostazione
di fabbrica
Temperature/
Set
/XF ƒ&
- 55°C
/XF ƒ&
- 60°C
/XF ƒ&
/XF ƒ&
Impostazioni di fabbrica per
pavimenti radianti
20-55°C
50°C
HS3 è usato solo quando
GK8 FRQWUROORDFTXDLQ
XVFLWD ƒ&YDORUH¿VVR
Utente
SET POINT
SERBATOIO ACQUA
SANITARIA
HS3
Temperature/
Set
COMMENTI
Utente
ATTIVAZIONE/
DISATTIVAZIONE
CURVA CLIMATICA
RAFFREDDAMENTO
FXUYDFOLPDWLFD
disattivata
FXUYDFOLPDWLFD
attivata
ATTIVAZIONE/
DISATTIVAZIONE
CURVA CLIMATICA
RISCALDAMENTO
FXUYDFOLPDWLFD
disattivata
FXUYDFOLPDWLFD
attivata
3.4
Ccc
Hcc
Utente
Utente
0, 1
0, 1
0
0
6H&FF LOFRQWUROORGL
temperatura viene effettuato
con i set point cS1 o cS2
VH&FF LOFRQWUROORGL
temperatura viene effettuato in
accordo con la curva climatica
6H+FF LOFRQWUROORGL
temperatura viene effettuato
con i set point HS1 o HS2
VH+FF LOFRQWUROORGL
temperatura viene effettuato in
accordo con la curva climatica
ATTIVAZIONE E FUNZIONI SERVICE
Per attivare l’unità procedere nel seguente modo:
‡ 'DUHWHQVLRQHDOO¶XQLWjLQWHUQDHGDOO¶XQLWjHVWHUQDWUDPLWHJOLLQWHUUXWWRULJHQHUDOL
‡ $WWLYDUHLOTXDGURGHOO¶XQLWjLQWHUQDWUDPLWHO¶LQWHUUXWWRUH&VXOSDQQHOORFRPDQGL
‡ 3UHPHUHLOWDVWR.H\ sull’interfaccia utente, si accenderà il led 1 giallo
ed il led verde
che mostra l’attivazione
GHOODSRPSDGLFLUFROD]LRQHLQ¿QHVXOGLVSOD\YLHQHYLVXDOL]]DWRLOPRGRGLIXQ]LRQDPHQWR&/*SHULOPRGRUDIIUHGGDPHQWR
HTG per riscaldamento e San per produzione acqua sanitaria.
‡ 3UHPHUHLOWDVWR.H\
SHUVHOH]LRQDUHLOPRGRGLIXQ]LRQDPHQWRSUHPHQGR.H\
in sequenza si
, poi il modo riscaldamento e si accende il led 3 rosso
LQ¿QH
attiva modo raffreddamento e si accende il led 2 verde
si attiva il modo produzione acqua sanitaria ed i led 2 e 3 saranno spenti.
VLDWWLYDLOPRGRGLULVSDUPLRHQHUJHWLFR(FRO¶DFFHQVLRQHGHOOHGYHUGH
mostra
‡ 3UHPHQGRLOSXOVDQWH.H\
l’attivazione del modo Eco.
7UDPLWHLOSDQQHOORGLFRQWUROORGHOO¶XQLWjLQWHUQDLQROWUHqSRVVLELOHDWWLYDUHOHVHJXHQWLIXQ]LRQLPRGL¿FDELOLGDOPHQVHUYLFH
‡
‡
*(67,21(5(6,67(1=((/(775,&+(81,7¬,17(51$
Le unità sono dotate di resistenza di supporto a due stadi: 1.5kW + 1.5kW sulle unità interne SMALL e 3 kW + 3 kW sulle unità
LARGE.
Per abilitare questa funzione è necessario installare il kit sonda temperatura aria esterna. Possono essere abilitate per
LQWHJUDUHODSRWHQ]DLQULVFDOGDPHQWRLQSURGX]LRQHGLDFTXDVDQLWDULDHGXUDQWHO¶HVHFX]LRQHGHLFLFOLDQWLOHJLRQHOODYHGL
SDUGHGLFDWR
$VHFRQGDGHOOHQHFHVVLWjHGHOODSRWHQ]DHOHWWULFDDGLVSRVL]LRQHqSRVVLELOHDELOLWDUOHFRQLOSDUDPHWUREF VLQJRODUPHQWH
FRQLOSDUDPHWUR$(+ RLQFRSSLDVLQJRODUPHQWHFRQLOSDUDPHWUR$(+ HGH¿QHQGRDFKHWHPSHUDWXUDHVWHUQDDELOLWDUOH
WUDPLWHLOSDUDPHWURRW(HVRW( ƒ&
La prima resistenza verrà attivata quando la temperatura dell’aria esterna è inferiore a otE, se la temperatura dell’acqua
qLQIHULRUHGLƒ.ULVSHWWRDOODWHPSHUDWXUDLPSRVWDWDHGRSRLPLQXWLGH¿QLWLGDOSDUDPHWUR(K3FKHVLYHUL¿FDQRTXHVWH
condizioni. La seconda resistenza verrà attivata dopo alcuni minuti dall’attivazione della prima se i parametri non sono
VRGGLVIDWWLLOWHPSRGLDWWLYD]LRQHSXzHVVHUHYDULDWRGDDPLQXWLWUDPLWHLOSDUDPHWUR(K3
/
HUHVLVWHQ]HHOHWWULFKHQRQSRVVRQRHVVHUHDWWLYDWHVHqDELOLWDWRLOIXQ]LRQDPHQWRGLXQDVRUJHQWHGLFDORUHHVWHUQDEF Le resistenze elettriche verranno attivate anche nell'eventualità di un guasto dell'unità esterna.
CONTROLLO TEMPERATURA ACQUA
Il termostato di regolazione della temperatura dell’acqua può essere impostato per regolare la temperatura di mandata
GHOO¶DFTXD LPSRVWD]LRQH SUHGH¿QLWD GL IDEEULFD /8F R SHU UHJRODUH OD WHPSHUDWXUD GHOO¶DFTXD GL ULWRUQR GDOO¶LPSLDQWR
/8F 27
ITALIANO
Parametro
3
‡
ITALIANO
‡
CONTROLLI DELLA POMPA DI CIRCOLAZIONE
Durante l’installazione può essere forzato il funzionamento della pompa di circolazione per 15 minuti portando il parametro
)3$ LQWDOPRGRVLIDFLOLWDORVSXUJRGHOO¶DULDQHOODIDVH¿QDOHGLULHPSLPHQWRGLDFTXDGHOO¶LPSLDQWR
La pompa di circolazione può funzionare con diverse modalità a seconda delle esigenze dell’impianto a cui è collegata l’unità:
)XQ]LRQDPHQWRFRQWLQXRGHOODSRPSDLPSRVWD]LRQHGLIDEEULFDSDUDPHWURF33 /DSRPSDVLVSHJQHTXDQGRLOVHWSRLQWGHOO¶DFTXDYLHQHVRGGLVIDWWRYHUUjDWWLYDWDODSRPSDSHULRGLFDPHQWHSHUYHUL¿FDUH
ODWHPSHUDWXUDGHOO¶DFTXDQHOFLUFXLWR,OFLFORGLFDPSLRQDPHQWRqGH¿QLWRGDOYDORUHGLLPSRVWD]LRQHGHOSDUDPHWURF33
HVF33 ODSRPSDVLDWWLYHUjSHUXQPLQXWRRJQLGLHFLPLQXWLFRQVHWSRLQWVRGGLVIDWWR
ÊSUHVHQWHODIXQ]LRQHDQWLEORFFDJJLRGHOODSRPSDPHQWUHLOVLVWHPDqLQ2))SRQHQGRLOSDUDPHWUR336 TXHVWD
IXQ]LRQHYLHQHDELOLWDWDFRQLOSDUDPHWUR3TGVLGH¿QLVFHRJQLTXDQWHRUHYLHQHIDWWRO¶DYYLDPHQWRHGLOSDUDPHWUR3TW
GH¿QLVFHSHUTXDQWRIDUIXQ]LRQDUHODSRPSDGXUDQWHLOFLFORDQWLEORFFDJJLR
‡
GESTIONE SORGENTE DI CALORE ESTERNA AUSILIARIA
In funzione riscaldamento o produzione acqua sanitaria, il controllo provvede ad eseguire, tramite il parametro
EF XQDVRVWLWX]LRQHGHOO¶XQLWjSRPSDGLFDORUH TXDORUD OD WHPSHUDWXUD GHOO¶DULD HVWHUQD VLD LQIHULRUH DG XQ YDORUH
SUHLPSRVWDWRSDUDPHWURRW(
‡
PRODUZIONE ACQUA SANITARIA
Si può collegare l’apparecchio ad un serbatoio con uno scambiatore intermedio per produrre acqua sanitaria. Le unità interne
YHUVLRQH:FRQODYDOYRODDWUHYLHSRVVRQRGHYLDUHLOÀXVVRGHOO¶DFTXDFDOGDDGXQVHUEDWRLRSHUO¶DFFXPXORGLDFTXD
sanitaria.
La richiesta di acqua sanitaria può avvenire in due modi:
‡ WUDPLWHXQFRQWDWWRSXOLWR/LPSRVWDQGRLOSDUDPHWURGK8 LQTXHVWRFDVRLPSRVWDUHLOWHUPRVWDWRHVWHUQRFRQWDWWR
pulito ad una temperatura inferiore ai 60°C.
‡ WUDPLWHXQVHQVRUHGLWHPSHUDWXUDLQVHULWRQHOVHUEDWRLRGLDFTXDVDQLWDULDLPSRVWDQGRLOSDUDPHWURGK8 LQTXHVWR
caso il set point viene impostato con il parametro HS3.
Tramite il parametro hyS è possibile anche controllare il ciclo di isteresi del controllo di temperatura del serbatoio.
'LIDEEULFD+6 ƒ&HK\6 ƒ.TXLQGLODWHPSHUDWXUDQHOVHUEDWRLRYDULHUjGDDƒ&
6HYLHQHDWWLYDWDXQDULFKLHVWDGLSURGX]LRQHDFTXDVDQLWDULDLOFRQWUROORPRGL¿FDLOVXRVWDWRQHLVHJXHQWLPRGL
‡ VHO¶XQLWjVWjIXQ]LRQDQGRLQULVFDOGDPHQWRYLHQHFRPPXWDWDODYDOYRODDWUHYLHHGLOÀXVVRGLDFTXDFDOGDYLHQHGHYLDWR
YHUVRLOVHUEDWRLR$&6LQ´4XDQGRYLHQHUDJJLXQWDODWHPSHUDWXUDULFKLHVWDODYDOYRODDWUHYLHGHYLDLOÀXVVRGL
DFTXDLQ´YHUVRO¶LPSLDQWRGLULVFDOGDPHQWRHGLOVLVWHPDFRQWLQXHUjDIXQ]LRQDUHFRPHSULPDGHOODULFKLHVWDGLDFTXD
sanitaria.
‡ VHO¶XQLWjVWjIXQ]LRQDQGRLQUDIIUHGGDPHQWRYLHQHIHUPDWRLOFRPSUHVVRUHFRPPXWDWDODYDOYRODDWUHYLHHGLOÀXVVR
di acqua calda viene deviato verso il serbatoio ACS. Quando viene raggiunta la temperatura richiesta viene fermato il
FRPSUHVVRUHFRPPXWDWDODYDOYRODGLLQYHUVLRQHGLFLFORUHIULJHUDQWHHODYDOYRODDWUHYLHHGLQ¿QHDYYLDWRLOFRPSUHVVRUH
dopo tre minuti dal precedente spegnimento.
Durante la produzione di acqua sanitaria il sistema eroga la massima potenza possibile per soddisfare velocemente la
richiesta di acqua sanitaria.
‡
CICLO ANTILEGIONELLA
Tramite l’attivazione della funzione Antilegionella il regolatore è in grado di svolgere autonomamente le procedure di
disinfezione termica su impianti di acqua calda sanitaria, diminuendo sensibilmente il rischio di presenza e proliferazione
dei batteri responsabili della legionella.
La funzione di disinfezione può essere attivata tramite il parametro Ldi. Si può scegliere di scaldare l’acqua sanitaria con la
SRPSDGLFDORUHHOHUHVLVWHQ]HHOHWWULFKHDGXHVWDGLDERUGRGHOO¶XQLWjLQWHUQDLPSRVWDQGRLOSDUDPHWUR/G$ RSSXUHWUDPLWH
XQDUHVLVWHQ]DQHOVHUEDWRLRGLDFTXDVDQLWDULDWUDPLWHLOSDUDPHWUR/G$ 1HOVHFRQGRFDVRFRQ/G$ ODUHVLVWHQ]DHOHWWULFD
GHYHHVVHUHDOLPHQWDWDVHSDUDWDPHQWHHGDWWLYDWDWUDPLWHXQUHOqFROOHJDWRDGLPRUVHWWL1NDFWLYDWLRQ
/DGH¿QL]LRQHGHOO¶LQWHUYDOORGLWHPSRGLHVHFX]LRQHGHOFLFORLQJLRUQLSHUTXDQWRWHPSRHGDFKHWHPSHUDWXUDHVHJXLUHLFLFOL
GLGLVLQIH]LRQHYHQJRQRGH¿QLWLULVSHWWLYDPHQWHGDLSDUDPHWUL/G6/GGH/GW
28
CONTROLLO REMOTO
È possibile controllare alcune funzioni dell’apparecchio in modo remoto tramite dei contatti puliti.
/HFRQQHVVLRQLGHLFRQWDWWLYDQQRHIIHWWXDWLVXOODPRUVHWWLHUDGHOODVFKHGDHOHWWURQLFDGHOO¶XQLWjLQWHUQD¿JFRPHVRWWR
descritto:
morsetto 1: accensione/spegnimento: con contatto pulito aperto il sistema è in stand by, con contatto chiuso il sistema è
acceso
morsetto 2: cambio modo di funzionamento riscaldamento/raffreddamento: con contatto pulito aperto il sistema è in modo
riscaldamento, con contatto chiuso il sistema è in modo raffreddamento
morsetto 3: secondo set point ECO mode: con contatto pulito aperto il Set point selezionato è cS1 in modalità raffreddamento
R+6LQPRGDOLWjULVFDOGDPHQWRFRQFRQWDWWRFKLXVRLO6HWSRLQWVHOH]LRQDWRqF6LQPRGDOLWjUDIIUHGGDPHQWR
o HS2 in modalità riscaldamento
morsetto 4: attivazione selezione modalità funzionamento notturno: con contatto pulito aperto funzione disabilitata, con
contatto chiuso funzione attivata
morsetto 5 JLjFROOHJDWRDOODPRUVHWWLHUDGHOO¶XQLWjLQWHUQD/DWWLYD]LRQHULVFDOGDPHQWRDFTXDVDQLWDULDFRQFRQWDWWR
SXOLWRDSHUWRPRGDOLWjDFTXDVDQLWDULDGLVDELOLWDWDFRQFRQWDWWRFKLXVRPRGDOLWjDFTXDVDQLWDULDDELOLWDWD
morsetto 6: attivazione/inibizione della modalità raffreddamento o riscaldamento. Quando il contatto è aperto, rimane attivo
il funzionamento acqua sanitaria. Può essere anche essere collegato ad un cronotermostato
od ai contatti in parallelo chiller/boiler dei comandi elettronici dei venticonvettori Bi2 e Bi2+.
I contatti devono essere chiusi sul morsetto L
/¶DELOLWD]LRQHGHLFRQWDWWLUHPRWLGHLPRUVHWWLHYLHQHDELOLWDWDFRQLOSDUDPHWURUɉ7 ‡
PROTEZIONI ANTIGELO
/RVFDPELDWRUHDSLDVWUHVDOGREUDVDWHGHOO¶XQLWjLQWHUQDqSURWHWWRFRQWURURWWXUHGDJHORGDXQÀXVVRVWDWRFKHLQWHUURPSHLO
IXQ]LRQDPHQWRGHOVLVWHPDTXDQGRODSRUWDWDG¶DFTXDqLQVXI¿FLHQWHHGDLVHQVRULGLWHPSHUDWXUDVXOORVFDPELDWRUH
‡
CURVE CLIMATICHE¿J
Per ottimizzare il risparmio energetico, sono disponibili due curve climatiche, una per il riscaldamento ed una per il
raffreddamento. Questa funzione permette di adeguare la temperatura dell’acqua alla temperatura dell’aria esterna e quindi
al carico termico ottimizzando il risparmio energetico del sistema.
/¶DELOLWD]LRQHGHOODFXUYDLQULVFDOGDPHQWRDYYLHQHLPSRVWDQGRLOSDUDPHWUR+FF L’impostazione della curva climatica viene fatta tramite quattro parametri:
Hc1 temperatura dell’aria esterna per avere la massima temperatura dell’acqua
Hc2 temperatura dell’acqua massima
Hc3 temperatura dell’aria esterna per avere la minima temperatura dell’acqua
Hc4 temperatura dell’acqua minima
/¶DELOLWD]LRQHGHOODFXUYDLQUDIIUHGGDPHQWRDYYLHQHLPSRVWDQGRLOSDUDPHWUR&FF L’impostazione della curva climatica viene fatta tramite quatto parametri:
Cc1 temperatura dell’aria esterna per avere la massima temperatura dell’acqua
Cc2 temperatura dell’acqua massima
Cc3 temperatura dell’aria esterna per avere la minima temperatura dell’acqua
Cc4 temperatura dell’acqua minima
La durata dell’azione è dettata dalle caratteristiche dell’impianto. Il batterio della Legionella reagisce in maniera diversa in
funzione della temperatura massima raggiunta nel circuito e all’aumentare della temperatura diminuisce il tempo di durata.
Il controllo segnala l’esecuzione della funzione Antilegionella mostrando sul display la scritta LEG ed esce dalla funzione dopo
un tempo massimo di 5 ore se per qualche motivo la temperatura non è raggiunta all’interno del serbatoio.
Anche nel caso in cui vengano effettuati prelievi di ACS eccessivi durante il ciclo antilegionella e la temperatura non venisse
mantenuta, dopo due tentativi, il controllo esce dalla funzione. Quando non viene completato il ciclo antilegionella per due
volte di seguito, comparirà sul display l’allarme A8.
Durante la ejecución de la función antilegionela, la función de refrigeración o calefacción de la instalación se interrumpe
FXDQGRHOFLFORGHGHVLQIHFFLyQHVHQFRPHQGDGRDODERPEDGHFDORU\DVXVUHVLVWHQFLDVHOpFWULFDVSDUiPHWUR/G$ 3RUHOFRQWUDULRODIXQFLyQGHUHIULJHUDFLyQRFDOHIDFFLyQQRVHLQWHUUXPSHVLHOFLFORDQWLOHJLRQHODHVUHDOL]DGRSRUXQD
UHVLVWHQFLDHOpFWULFDLQWURGXFLGDHQHOGHSyVLWRGHDJXDVDQLWDULDSDUiPHWUR/G$ $O¿QHGLHYLWDUHXVWLRQLTXDORUDVLSUHOHYLDFTXDFDOGDGXUDQWHODIDVHGLGLVLQIH]LRQHWHUPLFDqFRQVLJOLDWRO¶LQVHULPHQWRGL
dispositivi di sicurezza antiscottatura su ogni utenza o all’uscita del serbatoio di acqua sanitaria.
9HGL¿J&859$&/,0$7,&$5,6&$/'$0(172+FFH5$))5(''$0(172&FF
Non cambiare i parametri CHS, rtF, Adr e FPt sono parametri per usi di fabbrica.
3.5
IMPOSTAZIONE DEI PARAMETRI MENÙ SERVICE
è possibile accedere al menù Service, premendolo due volte verrà visualizzato sul display SEr
7UDPLWHLOSXOVDQWH.(<
SHU6HUYLFHDVVLVWHQ]D
8QDYROWDVHOH]LRQDWRLOPHQVHUYLFHSUHPHQGR.(<
VLYLVXDOL]]DVXOGLVSOD\ODULFKLHVWDGLSDVVZRUG3$6SUHPHUH
info/set e sul display si visualizza 00, premendo nuovamente per tre secondi info/set viene visualizzato 00 ad intermittenza, a
questo punto inserire il valore PAS e premere info/set per confermare. Premere Menù si visualizza PAS sul display e con le
frecce sù e giù è possibile visualizzare tutti i parametri del menù utente. Premendo nuovamente il pulsante info/set si visualizza
LOYDORUHGHOSDUDPHWURSUHPHQGRQXRYDPHQWHLQIRVHWSHUWUHVHFRQGLLOYDORUHVXOGLVSOD\ODPSHJJLDHSXzHVVHUHPRGL¿FDWRLO
H.H\
, premere info/set per confermare.
YDORUHYROXWRFRQOHIUHFFH.H\
Premere menù per uscire e le frecce per selezionare un altro parametro.
Procedere nello stesso modo per gli altri parametri.
L’uscita dal menù avviene automaticamente dopo 60 secondi senza schiacciare alcun pulsante o premendo contemporaneamente
OHGXHIUHFFH.H\
H.H\
.
Esempio:
3UHPHUH.H\
due volte, si visualizza SER sul display
3UHPHUH.H\
, si visualizza PAS sul display
3UHPHUH.H\
, si visualizza 00 sul display
3UHPHUH.H\
, per tre secondi, il valore 00 lampeggia sul display
3UHPHUH.H\ R.H\
, per aumentare o diminuire il valore visualizzato sul display
3UHPHUH.H\
, per confermare il valore impostato, il display smette di lampeggiare
3UHPHUH.H\
, per uscire, si visualizza PAS sul display
, per visualizzare un parametro. In sequenza appaiono gli mnemonici dei parametri sul
3UHPHUH.H\ R.H\
GLVSOD\IHUPDUVLVXOSDUDPHWURGDPRGL¿FDUH
, per tre secondi, il valore del parametro lampeggia sul display
3UHPHUH.H\
3UHPHUH.H\ R.H\
, per cambiare il parametro
, per confermare il valore impostato, il display smette di lampeggiare
3UHPHUH.H\
3UHPHUH.H\
SHUXVFLUHVLYLVXDOL]]DORPQHPRQLFRGHOO¶XOWLPRSDUDPHWURVXOGLVSOD\ULSUHQGHUHGDOSXQWR
SHUPRGL¿FDUHXQDOWURSDUDPHWUR
3UHPHUH.H\
H.H\
contemporaneamente per uscire dal menu utente.
29
ITALIANO
3
3
ITALIANO
Per l’impostazione dei parametri fare riferimento anche alla tabella riassuntiva dei parametri.
30
Parametro
MNEMONICO
DISPLAY
MENU
Campo di
regolazione
Impostazione
di fabbrica
RESISTENZE
ELETTRICHE INTERNE
ADDIZIONALI
UHVLVWHQ]HHOHWWULFKH
disattivate
SULPRVWDGLRUHVLVWHQ]H
elettriche attivato
SULPRHVHFRQGRVWDGLR
resistenze elettriche attivato
AEH
Service
0,1,2
0
SENSORE DI
CONTROLLO
TEMPERATURA ACQUA
FRQWUROOREDVDWRVXOOD
temperatura dell'acqua
entrante
FRQWUROOREDVDWRVXOOD
temperatura dell'acqua
uscente
LUc
Service
0,1
1
BPHE HEATER SETPOINT
cHS
Service
-5 a 5 °C
2°C
CONTROLLO REMOTO
VRORLQWHUIDFFLDXWHQWH
SRUWDGLFRPXQLFD]LRQH
attivata
FRQWDWWLSXOLWL
remotizzabili
attivati
Uɉ7
Service
0,1,2
0
FUNZIONE
ANTIBLOCCAGGIO
POMPA CON POMPA
SPENTA
IXQ]LRQHDQWLEORFFDJJLR
pompa disattivata
IXQ]LRQHDQWLEORFFDJJLR
pompa attivata
PPS
Service
0,1
1
PERIODICITÀ FUNZIONE
ANTI BLOCCAGGIO
POMPA
Pqd
Service
0 -100 ore
72
TEMPO DI
FUNZIONAMENTO
POMPA IN FUNZIONE
ANTIBLOCCAGGIO
Pqt
Service
0 - 10 minuti
0,5
AVVISO DI
MANUTENZIONE POMPA
3ɉG
Service
0-999 giorni
0
AVVISO DI
MANUTENZIONE FILTRO
ACQUA
8)ɉ
Service
0-999 giorni
0
RICHIESTA ATTIVAZIONE
SORGENTE DI CALORE
ESTERNA
ULFKLHVWDDWWLYD]LRQH
disabilitata
ULFKLHVWDDWWLYD]LRQH
abilitata
bc
Service
0,1
0
COMMENTI
Non utilizzato
6HUɉ7 2Q2II
C/H possono essere
controllati solo dai
contatti puliti remoti,
questi comandi
sono disabilitati
sull'interfaccia utente
Modi Eco e notturno,
produzione acqua
sanitaria e contatto TA
sono sempre abilitati
con qualsiasi valore
GLUɉ7
6WHS VHFRQGL
6HEF OHUHVLVWHQ]H
elettriche nell'unità
interna non possono
essere attivate
Parametro
MNEMONICO
DISPLAY
MENU
Campo di
regolazione
Impostazione
di fabbrica
COMMENTI
SOGLIA TEMPERATURA
ARIA ESTERNA
PER ATTIVAZIONE
RESISTENZE
ELETTRICHE
ADDIZIONALI O
SORGENTE DI CALORE
ESTERNA
otE
Service
-15 a 20°C
2°C
6HEF HWHPSHUDWXUD
DULDHVWHUQDWRW(
il contatto connesso
ai morsetti 14 e 15
YLHQHFKLXVR6HEF $(+!HWRW(OD
resistenza elettrica
interna può essere
attivata.
PRODUZIONE ACQUA
SANITARIA
SURGX]LRQHGLVDELOLWDWD
SURGX]LRQHDWWLYDWD
tramite contatto pulito
SURGX]LRQHDWWLYDWD
tramite sensore serbatoio
acqua sanitaria
dhU
Service
0,1,2
1
6HGK8 LPSRVWDUH
il termostato esterno
FRQWDWWRSXOLWRDGXQD
temperatura inferiore
ai 60°C
MODALITÀ FUNZIONE
CICLO ANTILEGIONELLA
3RPSDGLFDORUH
resistenze elettriche unità
interna
UHVLVWHQ]HHOHWWULFKHQHO
serbatoio acqua sanitaria
LdA
Service
0,1
0
PERIODICITÀ FUNZIONE
ANTILEGIONELLA
/GL IXQ]LRQHGLVDELOLWDWD
6HOGD H/GL!OD
funzione è abilitata con
resistenza elettrica
nel serbatoio di acqua
sanitaria
Ldi
Service
0 - 30 giorni
0
ORA DI ATTIVAZIONE
CICLO ANTILEGIONELLA
Lds
Service
00,0 - 23,5
2,00
TEMPERATURA CICLO
ANTILEGIONELLA
Ldt
Service
50°C - 80°C
65°C
DURATA CICLO
ANTILEGIONELLA
Ldd
Service
0 - 240
minuti
30
ATTIVAZIONE FORZATA
POMPA
IRU]DWXUDSRPSDQRQ
attivata
IRU]DWXUDSRPSDDWWLYDWD
FPA
Service
0,1
0
Funzione attiva
solamente con sistema
in stand-by
RITARDO ATTIVAZIONE
RESISTENZE
ELETTRICHE UNITÀ
INTERNA
EhP
Service
0 - 60 minuti
15
Ritardo tra l'avviamento
della pompa di calore
ed il controllo delle
condizioni per attivare
lo stadio 1 della
resistenza elettrica.
Se abilitato il secondo
stadio viene attivato
con 15 minuti di ritardo
ULVSHWWRDOSULPRWHPSR
¿VVR
PERIODICITÀ
ATTIVAZIONE POMPA
QUANDO IL SET POINT É
SODDISFATTO
cPP
Service
0-20 minuti
0
Quando il set
point è soddisfatto
FRPSUHVVRUHVSHQWR
F33 ODSRPSD
rimane accesa
cPP>0 la pompa è
spenta per cPP minuti,
poi viene accesa per
XQPLQXWRTXHVWR
campionamento
viene fatto in modo
FLFOLFRSHUYHUL¿FDUHOD
temperatura dell'acqua
nel circuito
'HFLPDOL GHFLQHGL
PLQXWLHV PLQXWL¿QRD minuti
31
ITALIANO
3
ITALIANO
3
Parametro
MNEMONICO
DISPLAY
MENU
Campo di
regolazione
Impostazione
di fabbrica
ISTERESI TEMPERATURA
SERBATOIO ACQUA
SANITARIA T3
hyS
Service
5°C - 25°C
10°C
Da usare solo quando
GK8 VHQVRUHW
nel serbatoio acqua
VDQLWDULD
CURVA CLIMATICA
RAFFREDDAMENTO ARIA
ESTERNA PER MASSIMA
TEMPERATURA ACQUA
Cc1
Service
-15 – +50°C
20°C
CURVA CLIMATICA
RAFFREDDAMENTO
MASSIMA TEMPERATURA
ACQUA
Cc2
Service
/XF 4°C -20°C,
/XF 7°C -27°C
18°C
Impostazioni di fabbrica
per ventilconvettori
e controllo impianti a
temperatura acqua in
XVFLWD/8F CURVA CLIMATICA
RAFFREDDAMENTO ARIA
ESTERNA PER MINIMA
TEMPERATURA ACQUA
Cc3
Service
-15 – +50°C
40°C
CURVA CLIMATICA
RAFFREDDAMENTO
MINIMA TEMPERATURA
ACQUA
Cc4
Service
/XF 4°C -20°C,
/XF 7°C -27°C
15°C
CURVA CLIMATICA
RISCALDAMENTO ARIA
ESTERNA PER MASSIMA
TEMPERATURA ACQUA
Hc1
Service
-15 – +50°C
-5°C
CURVA CLIMATICA
RISCALDAMENTO
MASSIMA TEMPERATURA
ACQUA
Hc2
Service
/XF 20-60°C,
/XF 20-55°C
35°C
CURVA CLIMATICA
RISCALDAMENTO ARIA
ESTERNA PER MINIMA
TEMPERATURA ACQUA
Hc3
Service
-15 – +50°C
20°C
CURVA CLIMATICA
RISCALDAMENTO MINIMA
TEMPERATURA ACQUA
Hc4
Service
/XF 20-60°C,
/XF 20-55°C
28°C
PASSWORD MENU'
SERVICE
PAS
Service
rtF
Service
0 – 200
VWHS
0
USO DI FABBRICA,
NON MODIFICARE
Adr
Service
1 – 255
1
Indirizzo porta di
comunicazione RS485
da usare con qualsiasi
periferica di controllo
UHPRWR3&RDOWUR
INDIRIZZO PERIFERICA
32
COMMENTI
&F•&F&F•&F
Impostazioni di fabbrica
per ventilconvettori
e controllo impianti a
temperatura acqua in
XVFLWD/8F +F•+F+F•+F
Valore in possesso
al Service Olimpia
Splendid
3
DISATTIVAZIONE E SPEGNIMENTO PER LUNGHI PERIODI¿JJ
Per disattivare la pompa di calore procedere come segue:
‡ 3UHPHUHLOWDVWR.H\,VXOSDQQHOORGLFRQWUROOR¿QFKpVXOGLVSOD\YLHQHYLVXDOL]]DWR6W\6WDQGE\
‡ 7RJOLHUHO¶DOLPHQWD]LRQHGHOO¶XQLWjHVWHUQD
In questo modo rimane attiva la funzione di antibloccaggio della pompa di circolazione.
Il non utilizzo della pompa di calore per un lungo periodo comporta l’effettuazione delle seguenti operazioni:
‡ 3UHPHUHLOWDVWR.H\,VXOO¶LQWHUIDFFLDXWHQWH¿QFKpVXOGLVSOD\YLHQHYLVXDOL]]DWR6W\6WDQGE\
‡ 7RJOLHUHO¶DOLPHQWD]LRQHGHOO¶XQLWjLQWHUQDWUDPLWHO¶LQWHUUXWWRUH¿JULI&VXOSDQQHOORFRPDQGL
‡ 7RJOLHUHO¶DOLPHQWD]LRQHGHOO¶XQLWjLQWHUQDHGHOO¶XQLWjHVWHUQDWUDPLWHJOLLQWHUUXWWRULJHQHUDOL
Togliendo l’alimentazione anche all’unità interna non rimane attiva la funzione di antibloccaggio della pompa di circolazione e
SRWUHEEHUHQGHUVLQHFHVVDULRORVEORFFRGHOODVWHVVD¿J
Per rimettere in funzione la pompa di calore aria-acqua, dopo un lungo periodo di inattività della pompa di calore, si consiglia di
fare intervenire il Servizio di Assistenza Tecnico.
3.7
PULIZIA
L’unica operazione di pulizia necessaria, da parte del responsabile dell’impianto, è quella della pannellatura esterna della pompa
di calore aria-acqua, da effettuarsi solo con panni inumiditi con acqua e sapone.
1HOFDVRGLPDFFKLHWHQDFLLQXPLGLUHLOSDQQRFRQXQDPLVFHODDOGLDFTXDHGDOFRROGHQDWXUDWRRFRQSURGRWWLVSHFL¿FL
7HUPLQDWDODSXOL]LDDVFLXJDUHFRQFXUDOHVXSHU¿FL
Non usare spugne intrise di prodotti abrasivi o detersivi in polvere. È vietata qualsiasi operazione di pulizia prima di aver
VFROOHJDWRO¶DSSDUHFFKLRGDOO¶DOLPHQWD]LRQHHOHWWULFDSRVL]LRQDQGRJOLLQWHUUXWWRULJHQHUDOLGHOO¶XQLWjLQWHUQDHGHOO
XQLWj
esterna su “spento”.
3.8
MANUTENZIONE PERIODICA
/DPDQXWHQ]LRQHSHULRGLFDqLQGLVSHQVDELOHSHUPDQWHQHUHODSRPSDGLFDORUHVHPSUHHI¿FLHQWHVLFXUDHGDI¿GDELOHQHOWHPSR
Essa può essere effettuata con periodicità semestrale, per alcuni interventi e annuale per altri, dal Servizio Tecnico di Assistenza,
che è tecnicamente abilitato e preparato e può inoltre disporre, se necessario, di ricambi originali.
Il piano di manutenzione che il Servizio Tecnico di Assistenza OLIMPIA SPLENDID o il manutentore deve osservare, con periodicità
annuale, prevede le seguenti operazioni e controlli:
‡ 9HUL¿FDSUHVVLRQHGHOYDVRGLHVSDQVLRQH
‡ 5LHPSLPHQWRFLUFXLWRDFTXD
‡ 3UHVHQ]DDULDQHOFLUFXLWRDFTXD
‡ (I¿FLHQ]DVLFXUH]]H
‡ 7HQVLRQHHOHWWULFDGLDOLPHQWD]LRQH
‡ $VVRUELPHQWRHOHWWULFR
‡ 6HUUDJJLRFRQQHVVLRQLHOHWWULFKH
‡ 3XOL]LDJULJOLHYHQWLODWRULHGDOHWWHEDWWHULDXQLWjHVWHUQD
‡ 9HUL¿FDSUHVHQ]DVSRUFRVXO¿OWURDUHWHPHWDOOLFD
3.9
ALLARMI
3.9.1
Allarmi display unità interna
La tabella 6 mostra gli allarmi o gli override visualizzabili sul display del pannello di controllo.
Gli override NON rappresentano un avviso di malfunzionamento del sistema ma segnalano una particolare condizione
GLIXQ]LRQDPHQWRWHPSRUDQHR*OLRYHUULGH121ULFKLHGRQRO¶LQWHUYHQWRGHOO¶DVVLVWHQ]DWHFQLFD
Quando appare un allarme, compare lo mnemonico sul display e si accende contemporaneamente il led 5
contatto di allarme tra i morsetti 16 e 17.
e viene chiuso il
Codice Override/Allarme
Mnemonico sul display
Override #1
Or1
Temperatura dell’acqua entrante inferiore a 10°C
Descrizione override/allarme
Override #2
Or2
Protezione antigelo scambiatore
Override #3
Or3
Richiesta di attivazione della sorgente di calore attiva
Override #4
Or4
&RQWDWWR7$DSHUWRPRUVHWWRGHOODVFKHGDHOHWWURQLFD
Override #5
Or5
Limitazione capacità dell’unità esterna
Override #6
Or6
Ciclo di sbrinamento in corso
Allarme #1
A1
Guasto sensore acqua in uscita
Allarme #2
A2
Guasto sensore acqua in entrata
Allarme #3
A3
Guasto sensore serbatoio acqua sanitaria
33
ITALIANO
3.6
ITALIANO
3
Allarme #4
A4
Guasto sensore aria esterna
Allarme #5
A5
Protezione antigelo scambiatore a piastre
Allarme #6
A6
$OODUPHÀXVVRVWDWR
Allarme #7
A7
Errore di comunicazione con l’unità esterna
Allarme #8
A8
Ciclo antilegionella non effettuato
Allarme #9
A9
Errore comunicazione porta seriale RS485
Allarme #10
A10
3URWH]LRQHGLVRYUDFRUUHQWHDOODUPHXQLWjHVWHUQD
Allarme #11
A11
3URWH]LRQHWHQVLRQHGLDOLPHQWD]LRQHDOODUPHXQLWjHVWHUQD
Allarme #12
A12
6HTXHQ]DIDVLXQLWjHVWHUQDHUUDWDDOODUPHXQLWjHVWHUQD
Allarme #13
A13
*XDVWRVHQVRULXQLWjHVWHUQDDOODUPHXQLWjHVWHUQD
9HUL¿FDUHWLSRGLDOODUPHVXVFKHGDXQLWjHVWHUQDSDU
4XDQGRDSSDUHXQDOODUPHYHUL¿FDUHQHOODWDEHOODODFDXVDHULPXRYHUHLOJXDVWRRSSXUHFKLDPDUHO¶DVVLVWHQ]DWHFQLFD
3HUULPXRYHUHJOLDOODUPLGD$DG$SUHPHUHLOSXOVDQWH.H\ per dieci secondi oppure chiamare l’assistenza tecnica.
,OFRQWUROORKDLQROWUHODSRVVLELOLWjGLDWWLYDUHGXHDOODUPLGLPDQXWHQ]LRQHSRPSDHGHO¿OWURDFTXD7UDPLWHLOSDUDPHWUR3ɉG
YLHQHGH¿QLWRLOQXPHURGLJLRUQLGLIXQ]LRQDPHQWRSULPDGHOO¶DWWLYD]LRQHGHOO¶DOODUPHSRPSDHWUDPLWHLOSDUDPHWUR8)ɉLJLRUQL
GLIXQ]LRQDPHQWRSULPDGHOO¶DWWLYD]LRQHGHOO¶DOODUPH¿OWUR
*OLDOODUPLSRVVRQRHVVHUHDWWLYDWLLPSRVWDQGRLOSDUDPHWURUHODWLYRGDDJLRUQLVH LOFRQWDWRUHQRQYLHQHDWWLYDWR
Quando l’allarme è attivato e la macchina ha funzionato per il numero di giorni impostato, sul display viene mostrato FiL per il
.
¿OWURH3ɉ3SHUODSRPSDLOSDUDPHWURqLPSRVWDWRHVLDFFHQGHLOOHG
SHUGLHFLVHFRQGL¿QRDOODVSDUL]LRQH
3HUGLVDWWLYDUHO¶DOODUPH)L/SHULO¿OWURH3ɉ3SHUODSRPSDSUHPHUHLOSXOVDQWH.(<
dell’allarme.
3.9.2
Allarmi display unità esterna
Sulla scheda di controllo dell’unità esterna è presente un display a due digit che mostra gli allarmi quando presenti.
La tabella sottostante mostra gli allarmi dell’unità esterna.
Codice errore
34
Descrizione allarme
E0
Malfunzionamento EEPROM
E2
Errore di comunicazione tra unità esterna ed unità interna
E3
Errore di comunicazione scheda esterna
E4
Guasto sensore di temperatura unità esterna
E5
Protezione tensione di alimentazione compressore
E6
3URWH]LRQHGHOPRGXOR3)&VRORSHU..ZLWKSKDVH
P0
Protezione temperatura testa compressore
P1
Protezione alta pressione
P2
Protezione bassa pressione
P3
Protezione di sovracorrente compressore
P4
Protezione temperatura di mandata compressore
P5
Protezione alta temperatura di condensazione
P6
Protezione modulo
ENGLISH
1
GENERAL
37
1.1
GENERAL INFORMATION
37
1.2
6<0%2/6
38
1.2.1
Editorial pictograms
38
1.2.2
Safety pictograms
38
1.3
WARNINGS
38
1.4
(66(17,$/6$)(7<5(*8/$7,216
39
1.5
5(&(37,21$1'813$&.,1*
39
1.6
EXTERNAL UNIT
40
1.7
INTERNAL UNIT
40
1.8
LIST OF INTERNAL UNIT MAIN COMPONENTS
40
1.9
LIST OF COMPONENTS PROVIDED AND DESCRIPTION OF PARTS
40
2
INSTALLATION
41
2.1
INTERNAL UNIT INSTALLATION
41
2.1.1
Opening the panels
41
2.1.2
Access to internal components
41
2.2
EXTERNAL UNIT INSTALLATION
41
2.3
OPERATING LIMITS
42
2.4
REFRIGERANT CONNECTIONS
42
2.4.1
Tests and checks
43
2.4.2
Charging additional refrigerant
43
2.5
+<'5$8/,&&211(&7,216
43
2.5.1
Hydraulic circuit
44
2.6
6<67(0:$7(55()(5(1&(9$/8(6
45
2.7
+<'5$8/,&6<67(0),//,1*
45
2.8
CIRCULATION PUMP RELEASE
45
2.9
ELECTRICAL CONNECTIONS
45
2.9.1
Access to electrical connections
46
2.9.2
Connecting cables
46
2.9.3
Electrical connections
46
2.10
,167$//$7,21&+(&.6
47
2.10.1
Preparing for initial start-up
47
2.10.2
Checks during and after initial start-up
47
3
USE AND MAINTENANCE
48
3.1
INTERNAL UNIT CONTROL PANEL
48
3.1.1
Description of control panel
48
3.2
ACTIVATION AND USER FUNCTIONS
48
3.2.1
Activation
48
3.2.2
Temperature/set menu
48
3.2.3
User menu
49
3.3
SETTING THE USER MENU PARAMETERS
49
3.4
ACTIVATION AND SERVICE FUNCTIONS
51
3.5
SETTING THE SERVICE MENU PARAMETERS
53
3.6
DEACTIVATION AND SHUTDOWN FOR PROLONGED PERIODS
57
3.7
CLEANING
57
3.8
SCHEDULED MAINTENANCE
57
3.9
ALARMS
57
3.9.1
Alarms on internal unit display
57
3.9.2
Alarms on external unit display
58
36
1
1
1.1
GENERAL
GENERAL INFORMATION
ATTENTION
The manual is divided into 3 sections or chapters:
CHAP. 1 GENERAL INFORMATION
Aimed at the specialised installer and the end user.
It contains information, technical data and important warnings to heed before installing and using the air-water heat pump.
CHAP. 2 INSTALLATION
Aimed exclusively at a specialised installer.
It contains all the information necessary for the positioning and mounting of the air-water heat pump in the place where it will
be installed.
Installation of the air-water heat pump by non-specialised personnel will invalidate the warranty conditions.
CHAP. 3 USE AND MAINTENANCE
It contains useful information for understanding the use and programming of the air-water heat pump and the most common
maintenance interventions.
This is a legally reserved document and reproduction or transmission to third parties without the explicit authorisation of OLIMPIA
SPLENDID is strictly forbidden.
The appliances could be subject to updating and therefore appear different from the designs contained herein, although this does
not in any way invalidate the texts contained in the manual.
5HDGWKLVPDQXDOFDUHIXOO\EHIRUHSHUIRUPLQJDQ\RSHUDWLRQLQVWDOODWLRQPDLQWHQDQFHXVHDQGIROORZWKHLQVWUXFWLRQV
FRQWDLQHGLQHDFKFKDSWHU
THE MANUFACTURER IS NOT RESPONSIBLE FOR DAMAGES TO PERSONS OR PROPERTY CAUSED BY FAILURE TO
FOLLOW THE INSTRUCTIONS IN THIS MANUAL.
The manufacturer reserves the right to modify at any time its models without changing the fundamental characteristics described
in this manual.
The installation and maintenance of air-conditioners like this one may be hazardous as they contain a cooling gas under pressure
as well as powered parts.
7KHUHIRUHLQVWDOODWLRQLQLWLDOVWDUWXSDQGVXEVHTXHQWPDLQWHQDQFHPXVWEHFDUULHGRXWVROHO\E\DXWKRULVHGDQGTXDOL¿HG
SHUVRQQHOVHHVWVWDUWXSUHTXHVWIRUPDWWDFKHGWRDSSOLDQFH
This unit complies with the following European Directives:
‡ /RZYROWDJH(&
‡ (OHFWURPDJQHWLFFRPSDWLELOLW\(&
‡ 8VHUHVWULFWLRQVRIKD]DUGRXVVXEVWDQFHVLQHOHFWULFDODQGHOHFWURQLFGHYLFHV(&5R+6
‡ :DVWHHOHFWULFDODQGHOHFWURQLFHTXLSPHQW(&:(((DQGVXEVHTXHQWDPHQGPHQWV
Failing to comply with the instructions contained in this manual, and using the unit with temperatures exceeding the permissible
temperature range will invalidate the warranty.
5RXWLQHPDLQWHQDQFHDQGJHQHUDOH[WHUQDOFOHDQLQJFDQDOVREHGRQHE\WKHXVHUDVWKHVHRSHUDWLRQVDUHQRWGLI¿FXOWRUGDQJHURXV
'XULQJWKHDVVHPEO\DQGHDFKPDLQWHQDQFHRSHUDWLRQDOZD\VSD\DWWHQWLRQWRWKHZDUQLQJVGHVFULEHGLQWKLVPDQXDO
DQGRQWKHODEHOVDI¿[HGLQVLGHWKHDSSOLDQFHVDQGUHVSHFWDQ\WKLQJVXJJHVWHGE\FRPPRQVHQVHDQGWKRVHRIWKH
6DIHW\1RUPVLQIRUFHLQWKHSODFHRILQVWDOODWLRQ
$OZD\VZHDUJORYHVDQGSURWHFWLYHJRJJOHVZKHQFDUU\LQJRXWLQWHUYHQWLRQVRQWKHFRROLQJSDUWRIWKHDSSOLDQFH
$LUZDWHUKHDWSXPSV08671(9(5EHLQVWDOOHGLQURRPVZKHUHWKHUHLVLQÀDPPDEOHJDVH[SORVLYHJDVDKLJKOHYHO
RIKXPLGLW\ODXQGU\URRPVJUHHQKRXVHVHWFRULQURRPVZKHUHWKHUHDUHRWKHUPDFKLQHVJHQHUDWLQJDORWRIKHDW
6KRXOGFRPSRQHQWVQHHGUHSODFLQJDOZD\VXVH2/,03,$63/(1','RULJLQDOVSDUHSDUWV
37
ENGLISH
:HZRXOG¿UVWRIDOOOLNHWRWKDQN\RXIRUKDYLQJFKRVHQRQHRIRXUSURGXFWVDQGFRQJUDWXODWH\RXRQ\RXUFKRLFHRIDLUZDWHU
heat pump.
We are sure you will be happy with it because it represents the state of the art in home air conditioning technology.
This manual was written with a view to providing you with all the information required to best manage your air conditioning system.
Therefore, please read the manual carefully before using the equipment.
By following the suggestions contained in this manual, the air-water heat pump that you have purchased will operate without
problems giving you optimum room temperatures with minimum energy costs.
1
IMPORTANT!
7RSUHYHQWDQ\ULVNRIHOHFWULFVKRFNWKHPDVWHUVZLWFKHVPXVWEHGLVFRQQHFWHGEHIRUHPDNLQJHOHFWULFDOFRQQHFWLRQV
DQGFDUU\LQJRXWPDLQWHQDQFHRQWKHDSSOLDQFHV
0DNHVXUHWKDWDOOSHUVRQQHOUHVSRQVLEOHIRUWUDQVSRUWDQGLQVWDOODWLRQRIWKHDSSOLDQFHDUHDZDUHRIWKHVHLQVWUXFWLRQV
DISPOSAL
The symbol on the product or on the packaging indicates that the product must not be considered as normal domestic refuse but
it must be taken to an appropriate disposal point for recycling electrical and electronic appliances.
Disposing of this product in the appropriate way avoids causing potentially negative consequences both for the environment and
for the health that could occur if the product is not disposed of correctly.
Further information about the recycling of this product can be obtained from your local town hall, your refuse collection service,
or in the store at which you bought the product.
This regulation is valid only in EU member states.
1.2
SYMBOLS
The pictograms shown in the next chapter provide the information necessary for correct use of the appliance in a rapid and
unmistakable way.
1.2.1
Editorial pictograms
ENGLISH
Service
‡ 5HIHUVWRVLWXDWLRQVLQZKLFK\RXVKRXOGLQIRUPWKH6(59,&(GHSDUWPHQWLQWKHFRPSDQ\
TECHNICAL SUPPORT
,QGH[
‡ 3DUDJUDSKVPDUNHGZLWKWKLVV\PEROFRQWDLQYHU\LPSRUWDQWLQIRUPDWLRQDQGUHFRPPHQGDWLRQVSDUWLFXODUO\DVUHJDUGVVDIHW\
Failure to comply with them could result in:
‡ GDQJHUIRUWKHRSHUDWRUV¶VDIHW\
‡ ORVVRIWKHZDUUDQW\
‡ UHIXVDORIOLDELOLW\E\WKHPDQXIDFWXUHU
5DLVHGKDQG
‡ 5HIHUVWRDFWLRQVWKDWDEVROXWHO\PXVWQRWEHSHUIRUPHG
1.2.2
Safety pictograms
'DQJHURIKLJKYROWDJH
‡ 6LJQDOVWRSHUVRQQHOWKDWWKHRSHUDWLRQGHVFULEHGFRXOGFDXVHHOHFWULFVKRFNLIQRWSHUIRUPHGDFFRUGLQJWRVDIHW\UHJXODWLRQV
Generic danger
‡ 6LJQDOVWKDWWKHRSHUDWLRQGHVFULEHGFRXOGFDXVHSK\VLFDOLQMXU\LIQRWSHUIRUPHGDFFRUGLQJWRVDIHW\UHJXODWLRQV
'DQJHUIURPKHDW
‡ 6LJQDOVWKDWLIWKHRSHUDWLRQGHVFULEHGLVQRWSHUIRUPHGVWULFWO\DFFRUGLQJWRVDIHW\UHJXODWLRQVWKHUHLVDULVNRIEXUQVIURP
contact with very hot components.
1.3
WARNINGS
‡
7KHLQVWDOODWLRQPXVWEHFDUULHGRXWE\WKHGHDOHURUE\RWKHUTXDOL¿HGSHUVRQQHOLIWKHLQVWDOODWLRQLVQRWFDUULHGRXWFRUUHFWO\
WKHUHPD\EHDULVNRIZDWHUOHDNDJHHOHFWULFVKRFNRU¿UH
‡
,QVWDOOWKHDLUZDWHUKHDWSXPSIROORZLQJWKHLQVWUXFWLRQVLQGLFDWHGLQWKLVPDQXDOLIWKHLQVWDOODWLRQLVQRWFDUULHGRXWFRUUHFWO\
WKHUHPD\EHDULVNRIZDWHUOHDNDJHHOHFWULFVKRFNRU¿UH
,WLVDGYLVDEOHWRXVHVROHO\WKHFRPSRQHQWVVSHFL¿FDOO\GHVLJQHGIRUWKHDSSOLDQFHSURYLGHGXVHRIRWKHUFRPSRQHQWVPD\
OHDGWRZDWHUOHDNDJHHOHFWULFVKRFNRU¿UH
‡
38
‡
2QFHLQVWDOODWLRQLVFRPSOHWHFKHFNWKHUHDUHQRUHIULJHUDQWOHDNVLIH[SRVHGWRWKHÀDPHWKHUHIULJHUDQWSURGXFHVWR[LF
JDV
‡
8SRQLQVWDOODWLRQRUUHLQVWDOODWLRQRIWKHV\VWHPHQVXUHWKDWQRVXEVWDQFHVVXFKDVDLUKDYHSHQHWUDWHGWKHUHIULJHUDQWFLUFXLW
RWKHUWKDQWKHVSHFL¿HGUHIULJHUDQW5$WKHSUHVHQFHRIDLURURWKHUIRUHLJQVXEVWDQFHVLQVLGHWKHUHIULJHUDQWFLUFXLWPD\
FDXVHDQDEQRUPDOSUHVVXUHLQFUHDVHRUV\VWHPEUHDNGRZQZLWKFRQVHTXHQWKDUPWRSHUVRQV
1.4
‡
OLIMPIA SPLENDID appliances must be installed by an authorised installer who, on completion of the work, will release
a declaration of conformity to the client in compliance with current regulations and with the indications given by OLIMPIA
SPLENDID in this booklet.
‡
,QWKHHYHQWRIZDWHUOHDNVVZLWFKRIIWKHXQLWDQGLQWHUUXSWWKHSRZHUVXSSOLHVRIWKHLQWHUQDODQGH[WHUQDOXQLWVXVLQJWKH
master switches.
As soon as possible, call the OLIMPIA SPLENDIDWHFKQLFDOVHUYLFHGHSDUWPHQWRUHOVHSURIHVVLRQDOO\TXDOL¿HGSHUVRQQHO
and do not intervene personally on the appliance.
‡
:KHQWKHUHLVDERLOHULQWKHV\VWHPFKHFNWKDWWKHWHPSHUDWXUHRIWKHZDWHUFLUFXODWLQJLQWKHDLUZDWHUKHDWSXPSGRHVQRW
exceed 65°C while in operation.
‡
7KLVLQVWUXFWLRQERRNOHWLVDQLQWHJUDOSDUWRIWKHDSSOLDQFHDQGPXVWFRQVHTXHQWO\EHVWRUHGFDUHIXOO\DQGALWAYS stay
with the appliance, even if it is sold to another owner or user, or moved to another system. If it is damaged or lost, request
another from your local OLIMPIA SPLENDID Service Technician.
‡
0DNHVXUHWKDWDQHDUWKFRQQHFWLRQLVFUHDWHGGRQRWHDUWKWKHDSSOLDQFHRQWRGLVWULEXWLRQSLSHVRYHUYROWDJHGLVFKDUJHUV
RURQWKHHDUWKRIDWHOHSKRQHV\VWHPLILWLVQRWSHUIRUPHGFRUUHFWO\WKHHDUWKFRQQHFWLRQFDQOHDGWRHOHFWULFVKRFNKLJK
intensity momentary overcurrent due to lightning or other causes could damage the air-water heat pump.
‡
$OHDNDJHLQGLFDWRUVKRXOGEHLQVWDOOHGIDLOXUHWRLQVWDOOWKLVGHYLFHPD\OHDGWRHOHFWULFVKRFN
ESSENTIAL SAFETY REGULATIONS
Remember that some fundamental safety rules should be followed when using a product that uses electricity and water, such as:
,WLVIRUELGGHQIRUWKHDSSOLDQFHWREHXVHGE\FKLOGUHQRUXQDVVLVWHGGLVDEOHGSHUVRQV
,WLVIRUELGGHQWRWRXFKWKHDSSOLDQFHZLWKZHWKDQGVRUERG\ZKHQEDUHIRRW
$Q\FOHDQLQJLVSURKLELWHGXQWLOWKHDSSOLDQFHKDVEHHQFXWRIIIURPWKHSRZHUPDLQVE\VHWWLQJWKHV\VWHP¶VPDVWHU
VZLWFKHVWR2))
,WLVIRUELGGHQWRPRGLI\WKHVDIHW\RUDGMXVWPHQWGHYLFHVRUDGMXVWZLWKRXWDXWKRULVDWLRQDQGLQGLFDWLRQVRIWKHPDQXfacturer.
,WLVIRUELGGHQWRSXOOFXWRUNQRWWKHHOHFWULFDOFDEOHVFRPLQJRXWRIWKHDSSOLDQFHHYHQLILWLVGLVFRQQHFWHGIURPWKH
mains supply.
,WLVIRUELGGHQWRSRNHREMHFWVRUDQ\WKLQJHOVHWKURXJKWKHLQOHWRURXWOHWJULOOV
,WLVIRUELGGHQWRRSHQWKHGRRUVZKLFKDFFHVVWKHLQWHUQDOSDUWVRIWKHDSSOLDQFHZLWKRXW¿UVWWXUQLQJWKHV\VWHPPDVWHU
VZLWFKWR³2))´
'LVSRVHRIWKHSDFNLQJUHVSRQVLEO\DQGQHYHUOHDYHLWZLWKLQUHDFKRIFKLOGUHQDVLWLVDSRWHQWLDOKD]DUG
'RQRWDOORZ5$WRHVFDSHLQWRWKHDWPRVSKHUH5$LVDÀXRULQDWHGJUHHQKRXVHJDVDVFLWHGLQWKH.\RWR3URWRFROZLWKD*OREDO:DUPLQJ3RWHQWLDO*:3RI
1.5
RECEPTION AND UNPACKING
7KHSURGXFWLVSDFNHGE\H[SHUWSHUVRQQHOXVLQJVXLWDEOHPDWHULDOV7KHXQLWVDUHGHOLYHUHGFRPSOHWHDQGLQSHUIHFWFRQGLWLRQ
however for the purposes of checking the quality of transport services, take the following into account:
‡ RQUHFHLYLQJWKHJRRGVFKHFNLIWKHSDFNDJHLVGDPDJHG,IVRDFFHSWWKHJRRGVZLWKUHVHUYHWDNLQJSKRWRJUDSKVRIDQ\
apparent damage.
‡ XQSDFNDQGFKHFNWKHFRQWHQWVDJDLQVWWKHSDFNLQJOLVW
‡ FKHFNWKDWQRQHRIWKHFRPSRQHQWVKDYHEHHQGDPDJHGGXULQJWUDQVSRUWLIWKH\KDYHLQIRUPWKHIRUZDUGHUE\UHJLVWHUHG
letter with receipt within 3 days of receiving the goods and enclosing photographic evidence.
Send a copy by fax to OLIMPIA SPLENDID.
No information concerning damage suffered can be taken into account 3 days after delivery. The competent court for any disputes
is the court of REGGIO nell’EMILIA.
39
ENGLISH
1
1
1.6
EXTERNAL UNIT ¿J
7KHH[WHUQDOXQLW¿JLVDYDLODEOHLQVL[PRGHOV
OS-CEBSH24EI
OS-CEBCH36EI
OS-CEBCH48EI
OS-CEBTH48EI
OS-CEBCH60EI
OS-CEBTH60EI
Width mm
842
990
940
940
940
940
Depth mm
324
324
360
360
360
360
Height mm
695
695
1245
1245
1245
1245
Weight kg
61
82
106
99
106
104
1.7
INTERNAL UNIT ¿J
7KHLQWHUQDOXQLW¿JLVDYDLODEOHLQIRXUPRGHOV
Width mm
ENGLISH
Depth
FRQWUROSDQHOPP
1.8
SMALL 3W
BIG
BIG 3W
500
500
500
500
280 + 16
280 + 16
280 + 16
280 + 16
Height mm
810
810
810
810
Weight kg
36
36,3
38
38,3
LIST OF INTERNAL UNIT MAIN COMPONENTS ¿J
A
B
C
D
E
F
G
H
I
K
L
M
N
O
P
Q
R
1.9
SMALL
Water inlet
Safety valve 3 bar
Plate heat exchanger
Flow switch
Pressure gauge
Expansion vessel
Electrical heater elements collector
Automatic air breather
Water pump
7KUHHZD\YDOYHLQWHJUDWHGRQERDUGWKHPDFKLQHLQYHUVLRQ:
System water outlet
'RPHVWLFKRWZDWHURXWOHWYHUVLRQ:RQO\
Electric panel assembly
Control panel
Electrical heater elements safety thermostat with manual rearm
Electrical heater elements safety thermostat with automatic rearm
Master switch
LIST OF COMPONENTS PROVIDED AND DESCRIPTION OF PARTS
Appliances are shipped with standard packing comprising cardboard wrapping and a series of expanded polystyrene protections.
There is a small pallet beneath the packaging of the external unit that facilitates the transfer and handling operations while the
SDFNDJLQJRIWKHLQWHUQDOXQLWLV¿WWHGZLWKKDQGOHVWKDWIDFLOLWDWHVKDQGOLQJ
The following parts are supplied with the internal unit inside the packing:
‡ ZDOOEUDFNHWIRUDQFKRULQJWKHDSSOLDQFH
‡ WHPSODWHIRUZDOOPRXQWHGLQVWDOODWLRQ
‡ <VKDSHGVLHYH¿OWHUZLWK´))¿WWLQJVPPPHVK
‡ WKUHH´EDOOYDOYHV:PRGHOVRQO\
‡ WHPSODWHIRUSRVLWLRQLQJWKHXQLWRQWKHZDOO
40
2
2
INSTALLATION
Follow the instructions given in this manual closely in order to achieve a successful installation and optimum performance.
Failure to apply the indicated regulations, which may cause the appliance to malfunction, relieves OLIMPIA SPLENDID of any
form of warranty and of any damage caused to persons, animals or property.
The electrical system must comply with current regulations, as stated in the Technical Features chapter, and be correctly earthed.
The appliance must be installed in an accessible position to enable maintenance to be carried out.
2.1
INTERNAL UNIT INSTALLATION ¿J
The internal unit must always be wall-mounted at head height, inside the residence.
)RUWKHLQVWDOODWLRQDQGSRVLWLRQRISLSLQJVHH¿JDQGXVHWKHWHPSODWHSURYLGHGZLWKWKHXQLW
2SHQLQJWKHSDQHOV¿J
ENGLISH
Prepare:
‡ IRXU0SOXJVIRUIDVWHQLQJWRWKHZDOOVXLWDEOHIRUWKHW\SHRIZDOO
‡ OHDYHHQRXJKVSDFHDWOHDVWFPDWWKHVLGHVDQGDERYHWRUHPRYHWKHFRYHUVVRWKDWURXWLQHDQGVSHFLDOPDLQWHQDQFH
can be carried out
‡ DQHDUE\ZDWHUGUDLQDJHSRLQW
‡ FRPSOLDQWSRZHUVXSSO\QHDUWKHLQWHUQDOXQLW
‡ DZDWHUVXSSO\WR¿OOWKHK\GUDXOLFFLUFXLW
‡ FRPPXQLFDWLRQFDEOHEHWZHHQLQWHUQDOXQLWDQGH[WHUQDOXQLWVHHVHFW
2SHQWKHGRRU¿JUHI$E\SXOOLQJWKHXSSHUSDUWRXWZDUGVWKHGRRURSHQVGRZQZDUGV
8QVFUHZWKHVFUHZIDVWHQLQJWKHIURQWSDQHO¿JUHI%
/LIWWKHIURQWSDQHODQGSXOOLWWRZDUGV\RX¿JUHI&
2.1.2
Access to internal components¿J
7RDFFHVVWKHFRPSRQHQWVLQVLGHWKHHOHFWULFSDQHOUHPRYHWKHWZRVFUHZV¿JUHI$IDVWHQLQJWKHFRYHURQWKHOHIWKDQGVLGH
7RDFFHVVWKHFRPSRQHQWVEHKLQGWKHHOHFWULFSDQHOUHPRYHWKHIRXUVFUHZV¿JUHI$DQGWXUQWKHSDQHORQWKHKLQJHV
located on the right-hand side of the panel. The electric panel can be detached and attached using the grooves on the rightKDQGVLGHRIWKHSDQHO¿JWKLVHQDEOHVDFFHVVWRDOOWKHFRPSRQHQWVLQVLGHWKHDSSOLDQFHDQGWKHDSSOLDQFHWREHLQVWDOOHG
or maintained more easily.
7KHIROORZLQJFRPSRQHQWVDUHKRXVHGLQVLGHWKHHOHFWULFSDQHO¿J
A Cables inlet
B Internal unit power terminal board
C Utility connections terminal board
D Cable grips
E Electrical heater elements thermomagnetic circuit breaker
F Safety contactor for electrical heater elements
G Elements relay
H(0&¿OWHU
I Control electronic board
L Fuse 250V 5A T
2.2
EXTERNAL UNIT INSTALLATION ¿J
,QVWDOOWKHH[WHUQDOXQLWRQDVROLGEDVHWKDWLVDEOHWRVXSSRUWLWVZHLJKWLILQVWDOOHGLQFRPSOHWHO\RURQWRDQLQDSSURSULDWHEDVH
the external unit could cause damage to persons or property, if it should detach from the base.
It is very important that the installation place be chosen with extreme care in order to ensure adequate protection of the device
against impact or possible consequential damage.
Choose a place that is adequately ventilated and in which the outdoor temperature in summer does not exceed 46°C.
/HDYHVXI¿FLHQWIUHHVSDFHDURXQGWKHDSSOLDQFHLQRUGHUWRDYRLGUHFLUFXODWLRQDQGWRIDFLOLWDWHPDLQWHQDQFH
Prepare a layer of gravel underneath the appliance for drainage of the defrost water.
Leave space underneath the unit to prevent the defrost water from freezing. In normal situations, ensure the base is at least 5
FPRIIWKHJURXQGIRUXVHLQUHJLRQVZLWKYHU\FROGZLQWHUVHQVXUHDVSDFHRIDWOHDVWFPRQERWKVLGHVRIWKHXQLW
When installed in a location with high snow fall, mount the support of the appliance at a height that is above the maximum level
of snow.
Install the unit so that wind is not blowing across it.
Prepare:
‡ DQWLYLEUDWLRQGDPSHUV
‡ FRPSOLDQWSRZHUVXSSO\QHDUWKHH[WHUQDOXQLW
41
2
7KHH[WHUQDOXQLWLVVXSSOLHGZLWKDPHVKIRUFRYHULQJWKHKHDWH[FKDQJHEDWWHU\WKLVLVHQYLVDJHGIRULQVWDOODWLRQV
DFFHVVLEOHWRWKHSXEOLF)LWWLQJWKHPHVKPD\FDXVHLQWKHHYHQWRIKLJKKXPLGLW\DWORZWHPSHUDWXUHIRJRUVQRZD
EXLOGXSRILFHRQWKHEDWWHU\ZLWKUHGXFHGV\VWHPSHUIRUPDQFH
2.3
OPERATING LIMITS ¿J
7KHGLDJUDPVLQ¿JGH¿QHWKHZDWHU/:7DQGRXWGRRUDLU2'7WHPSHUDWXUHOLPLWVZLWKLQZKLFKWKHKHDWSXPSFDQUXQLQ
its two modes, domestic water cooling and heating/production, and cooling only.
2.4
REFRIGERANT CONNECTIONS ¿J
7RGH¿QHWKHUHIULJHUDQWFRQQHFWLRQOLQHVEHWZHHQWKHLQWHUQDOXQLWDQGWKHH[WHUQDOXQLWVHHWKHWDEOHEHORZ
ENGLISH
OSCEBSH24EI
OSCEBCH36EI
OSCEBCH48EI
OSCEBTH48EI
OSCEBCH60EI
OSCEBTH60EI
Maximum length of
FRQQHFWLQJSLSHVP
25
30
50
50
50
50
Limit of elevation difference
between the two units if the
external unit is positioned
KLJKHUP
12
20
25
30
25
30
Limit of elevation difference
between the two units if the
external unit is positioned
ORZHUP
9
12
20
20
20
20
Additional charge of
refrigerant per metre over 5
PHWUHVSLSLQJJP
60
60
60
60
60
60
8VHVROHO\SLSHVZLWKGLDPHWHUVWKDWFRPSO\ZLWKWKHUHTXLUHGGLPHQVLRQV´JDVSLSH´OLTXLGSLSH
The maximum length of the connecting lines to the internal unit must comply with table 1, topping up the charge of R410A as
HQYLVDJHGVHHVHFW'RQRWLQVWDOOWKHXQLWVEH\RQGWKHPD[LPXPKHLJKWGLIIHUHQFHSHUPLWWHGEHWZHHQWKHLQWHUQDOXQLW
and the external unit.
Complete the refrigerant circuit by connecting the internal unit to the external unit using insulated copper pipes.
8VHVROHO\LQVXODWHGFRSSHUSLSHVVSHFL¿FIRUFRROLQJSXUSRVHVVXSSOLHGFOHDQDQGVHDOHGDWWKHHQGV
7KHUHIULJHUDQWFRQQHFWLRQVRIWKHLQWHUQDOXQLWDUHEHKLQGWKHHOHFWULFSDQHOWKRVHRIWKHH[WHUQDOXQLWDUHRQWKHULJKWKDQGVLGH
and the safety panel must be removed in order to gain access.
A ´JDVOLQHLQWHUQDOXQLW
B ´OLTXLGOLQHLQWHUQDOXQLW
C ´JDVOLQHYDOYHH[WHUQDOXQLW
D ´OLTXLGOLQHYDOYHH[WHUQDOXQLW
Identify a route for the pipes that reduces the length and the bends in the pipes as much as possible to obtain maximum performance from the system.
,QVHUWWKHUHIULJHUDQWOLQHVLQWRDVXLWDEO\VL]HGFDEOHURXWLQJGXFWLISRVVLEOHZLWKLQWHUQDOVHSDUDWRUIDVWHQHGWRWKHZDOOIRU
routing the pipes and electrical wires.
Cut the lengths of pipe about 3-4 cm longer than the required length.
,03257$17FXWXVLQJDZKHHOSLSHFXWWHURQO\WLJKWHQLQJDWVPDOOLQWHUYDOVVRDVQRWWRFUXVKWKHSLSH
‡
‡
‡
‡
‡
‡
‡
42
5HPRYHDQ\EXUUVXVLQJDQDSSURSULDWHWRRO
%HIRUHÀDULQJLQVHUWWKHIDVWHQLQJQXWLQWRWKHSLSH¿J$
)ODUHWKHHQGVRIWKHSLSHVLPSHFFDEO\ZLWKRXWFUDFNVZULQNOHVRUIROGVXVLQJDVSHFLDOWRRO¿J%
0DQXDOO\WLJKWHQWKHSLSHQXWRQWRWKHWKUHDGRIWKH¿WWLQJ
'H¿QLWLYHO\WLJKWHQXVLQJD¿[HGZUHQFKWRNHHSWKHWKUHDGHGSDUWRIWKH¿WWLQJVWDWLRQDU\WRSUHYHQWGHIRUPDWLRQ
DQGDG\QDPRPHWULFZUHQFKRQWKHQXW¿JFDOLEUDWHGZLWKWKHIROORZLQJYDOXHVGHSHQGLQJRQWKHVL]HRIWKH
pipes:
'LDPHWHU¶¶1PWLJKWHQLQJWRUTXH1P
'LDPHWHU¶¶1PWLJKWHQLQJWRUTXH1P
2
7HVWVDQGFKHFNV¿J
Once the pipes are connected, check the refrigerant circuit is perfectly sealed.
7RSHUIRUPWKHRSHUDWLRQVGHVFULEHGEHORZXVHDPDQRPHWULFXQLWVSHFL¿FIRU5$DQGDYDFXXPSXPSZLWKPLQLPXPÀRZ
rate of 40 l/min:
1 8QVFUHZWKHFDSRQWKHJDVOLQHXQLRQ¿JUHI&
2 &RQQHFWWKHYDFXXPSXPSDQGWKHPDQRPHWULFXQLWWRWKHJDVOLQHXQLRQXVLQJWKHKRVHVZLWK´¿WWLQJ¿J
3 Switch on the pump and open the manometric unit taps.
4 /RZHUWKHSUHVVXUHWRN3DPP+JEDU
5 Maintain the vacuum for at least 1 hour.
6 Shut the manometric unit taps and switch off the pump.
7 $IWHUPLQXWHVJRWRSRLQWVROHO\SURYLGHGWKHSUHVVXUHUHPDLQVDWN3DPP+JEDU,IWKHSUHVVXUHZLWKLQWKH
FLUFXLWKDVULVHQWRDYDOXHJUHDWHUWKDQN3DPP+JEDULWZLOOEHQHFHVVDU\WRVHDUFKIRUWKHOHDNXVLQJDVRDS\
VROXWLRQZLWKUHIULJHUDQWFLUFXLWXQGHUQLWURJHQSUHVVXUHaEDURQFHLGHQWL¿HGDQGUHSDLUHGUHVWDUWIURPSRLQW
8 Use a 4 mm hex key to open the liquid valve stem until it opens fully.
9 Use a 5 mm hex key to fully open the gas valve stem.
10 Remove the hose connected to the gas pipe union.
11 5HSRVLWLRQWKHFDSRQWKHJDVOLQHXQLRQDQGIDVWHQLWXVLQJDVSDQQHURU¿[HGZUHQFK
12 Reposition the caps on the gas and liquid valve stems and fasten them.
ENGLISH
Figure 14:
A Valve stem
B Valve stem cover
C Charge hole
D Main valve
Figure 15:
A Manometric unit
B 9DFXXPPHWHUZKHUHDSSOLFDEOH
C Vacuum pump
D +RVHWDSRSHQ
E 8QLRQFORVHG
F Gas pipe
G Liquid pipe
H External unit
&KDUJLQJDGGLWLRQDOUHIULJHUDQW¿J
If the pipe length is over 5 m, top up the refrigerant as indicated in the table in sect. 2.4
1RWHGRZQRQWKHODEHO¿JSURYLGHGZLWKWKHH[WHUQDOXQLWWKHFKDUJHRIWKHH[WHUQDOXQLW$WKHTXDQWLW\RIDGGHGUHIULJHUDQW
%DQGWKHWRWDOFKDUJHRIWKHV\VWHP$%
Figure 17:
A Manometric unit
B 9DFXXPPHWHUZKHUHDSSOLFDEOH
C Cylinder liquid tap
D R410A gas cylinder
E 8QLRQFORVHG
F Gas pipe
G Liquid pipe
H External unit
2.5
HYDRAULIC CONNECTIONS ¿JJ
The choice and installation of components is decided by the installer, who must operate in compliance with good workmanship
and current legislation.
Before connecting the pipes, ensure they are free from stones, grit, rust, debris or any foreign bodies that may damage the system.
It is good practice to create a by-pass in the system so that the appliance does not have to be disconnected in order to wash the
plate heat exchanger. The connecting pipes must be supported, so that their weight does not rest on the appliance.
7KHK\GUDXOLFFRQQHFWLRQVDUHORFDWHGDWWKHERWWRPRIWKHXQLW¿J
The hydraulic connections should be completed by installing:
‡ DLUUHOLHIYDOYHVDWWKHKLJKHVWSRLQWVRIWKHSLSHV
‡ ÀH[LEOHHODVWLFMRLQWV
‡ RQRIIYDOYHV
‡ VLHYHZDWHU¿OWHUZLWKPPPHVK
‡ WKHUPDOO\LQVXODWHDOOK\GUDXOLFFRPSRQHQWVDQGSLSLQJ
43
2
7KHPLQLPXPQRPLQDOGLDPHWHURIWKHK\GUDXOLFFRQQHFWLQJSLSHVPXVWEH´
7RDOORZWKHPDLQWHQDQFHDQGUHSDLURSHUDWLRQVLWLVLQGLVSHQVDEOHWKDWHDFKK\GUDXOLFFRQQHFWLRQLV¿WWHGZLWKUHVSHFtive manual closing valves.
The table below shows the characteristics the hydraulic system must have.
Unit
OS-CEBSH24EI
OS-CEBCH36EI
OS-CEBCH48EI
I.U. SHERPA SMALL
Nominal water
ÀRZ
System water
content
Operating
pressure
System height
difference
*
**
OS-CEBTH48EI
OS-CEBCH60EI
OS-CEBTH60EI
I.U. SHERPA BIG
l/s
0,31
0,52
0,62
0,62
0,69
0,79
l
l
23
400
38
400
45
400
45
400
51
400
58
400
Max
kPa
300
300
300
300
300
300
Max
m
20
20
20
20
20
20
Min
Max**
for systems at ground level
with maximum system water temperature 35°C
ENGLISH
7KHJUDSKVLQ¿JVKRZWKHKHDGIRUHDFKK\GUDXOLFFLUFXODWRUVSHHGDYDLODEOHWRWKHK\GUDXOLFFRQQHFWLRQVRIWKHLQWHUQDOXQLW
&KHFNWKDWWKHV\VWHP¶VSUHVVXUHORVVHVJXDUDQWHHWKHUHTXLUHGZDWHUÀRZVHHVHFW
If greater heads are required due to high pressure losses in the system, an inertial vessel or a hydraulic separator and an external
idle pump must be added.
&KHFNLIWKHV\VWHPKDVWKHPLQLPXPZDWHUFRQWHQWUHTXLUHGWRHQVXUHJRRGV\VWHPRSHUDWLRQ,ILWLVLQVXI¿FLHQWDGGDVWRUDJH
vessel in order to reach the required content.
The water distribution pipes must be suitably insulated with expanded polyethylene or similar materials. The on/off valves, bends
and unions must also be suitably insulated.
7RSUHYHQWDLUORFNVLQVLGHWKHFLUFXLWLQVHUWDXWRPDWLFRUPDQXDOEUHDWKHUGHYLFHVDWDOOWKHSRLQWVKLJKSLSHVWUDSVHWFZKHUH
air may accumulate.
2QFHWKHK\GUDXOLFFLUFXLWLVFRPSOHWHDQGWKHDEVHQFHRIOHDNVKDVEHHQDVFHUWDLQHGUHPRYHWKHFLUFXODWLRQSXPS
EUDFNHW¿JUHI$E\UHPRYLQJWKHIDVWHQLQJQXW¿JUHI%UH¿WWKHQXW
2.5.1
Hydraulic circuit ¿J
7KHK\GUDXOLFGLDJUDPLQ¿JVKRZVWKHPDLQSDUWVRIWKHLQWHUQDOXQLWDQGDW\SLFDOK\GUDXOLFFLUFXLW
1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
A
B
C
D
E
44
Water inlet
6DIHW\YDOYHEDU
Pressure gauge
System water return temperature probe T1
Plate heat exchanger
6\VWHPZDWHUÀRZWHPSHUDWXUHSUREH7
Flow switch
Expansion vessel
Electrical heater elements collector
Automatic air breather
Circulation pump
ZD\GLYHUWHUYDOYHLQWHJUDWHGRQERDUGWKHPDFKLQHLQYHUVLRQ:
System water outlet
Water outlet for domestic water storage
0HVKZDWHU¿OWHU
Refrigerant pipe connections
Domestic heater temperature probe T3
Internal unit
External unit
6\VWHPIDQFRLOVUDGLDWRUVRUUDGLDQWSDQHOVÀRRUV
Domestic water storage
$GGLWLRQDOKHDWVRXUFHHJJDVERLOHU
,QVWDOODVLHYH¿OWHUZLWKPPPHVKRQWKHDSSOLDQFH¶VZDWHULQOHWSLSHUHWXUQIURPV\VWHP
2
2.6
SYSTEM WATER REFERENCE VALUES
‡
‡
‡
‡
‡
‡
‡
‡
S+WR
(OHFWULFFRQGXFWLYLW\EHWZHHQDQG—6FP
7RWDOKDUGQHVVEHWZHHQDQGƒ)
7RWDOLURQEHORZSSP
0DQJDQHVHEHORZSSP
&KORULGHVEHORZSSP
6XOSKXULRQVDEVHQW
$PPRQLXPLRQVDEVHQW
If the total hardness is above 20°F or some of the make-up water reference values are not within the indicated limits, contact our
pre-sales service to determine the treatments to be used.
Bore or groundwater not from the water supply system should always be carefully analysed and if necessary treated with appropriate
systems. If installing a softener, in addition to following the manufacturer’s guidelines adjust the hardness of the outlet water to
QRORZHUWKDQƒ)DOVRUXQS+DQGVDOLQLW\WHVWVDQGFKHFNWKHFRQFHQWUDWLRQRIFKORULGHVDWRXWOHWDIWHUUHJHQHUDWLRQRIUHVLQV
In the case of possible freezing, empty the system and introduce an antifreeze liquid in a proportion that is appropriate for the
minimum temperatures that can be reached.
Solutions of water and ethylene glycol used as heat-transfer liquids in place of water cause a reduction in the performance of the
XQLW$GGDPD[LPXPRIRIHWK\OHQHJO\FROSURWHFWLRQHTXLYDOHQWWRDVORZDVƒ&WRWKHZDWHU
HYDRAULIC SYSTEM FILLING
2QFHWKHK\GUDXOLFFRQQHFWLRQVDUHFRPSOHWHWKHV\VWHPPXVWEH¿OOHG$WWKHVDPHWLPHWKHDLULQVLGHWKHSLSHVDQGDSSOLDQFH
must be bled through the air breathers on the circuit and appliance.
Initially, with the water circuit empty, the machine must not be connected to the power supply.
2QO\LQWKH¿QDOSKDVHVRI¿OOLQJWKHK\GUDXOLFFLUFXLWFDQWKHPDFKLQHEHSRZHUHGDQGWKHFLUFXODWLRQSXPSVWDUWHG
,WLVDGYLVDEOHWRWHPSRUDULO\IRUFHWKHFLUFXODWLRQSXPSIRUPLQXWHVE\DFWLYDWLQJSDUDPHWHU)3$VHHVHFW&LUFXODWLRQ
SXPSFKHFNV
,IDQH[WHUQDODX[LOLDU\SXPSLVXVHGWKLVPXVWDOVREHVWDUWHGVROHO\LQWKH¿QDOFLUFXLW¿OOLQJSKDVHV
The system operating pressure must not exceed 1.5 BAR with the pump off.
,QDQ\FDVHWRWHVWIRUV\VWHPOHDNVUDLVHWKHWHVWSUHVVXUHPD[LPXPSUHVVXUHEDUWKHQGLVFKDUJHLWWRUHDFKWKHRSHUDWLQJ
pressure.
2.8
CIRCULATION PUMP RELEASE ¿J
If during initial start-up, AL6 appears on the control panel display after starting the circulator, check that the system valves are
RSHQWKDWWKHUHLVDWOHDVWRQHXWLOLW\ZLWKWKHFLUFXLWRSHQWKDWWKHH[WHUQDOVLHYH¿OWHULVQRWFORJJHGWKDWWKHUHDUHQRDLUEXEEOHV
in the circuit, that the system water pressure is correct and that the circulator is not blocked.
RQWKHFRQWUROSDQHOIRUVHFRQGV¿J.H\
After removing the cause, clear the alarm by pressing the ON button
7RUHOHDVHWKHFLUFXODWLRQSXPSWXUQLWVVKDIWDVVKRZQLQ¿JDIWHUKDYLQJUHPRYHGWKHFDS
2.9
ELECTRICAL CONNECTIONS ¿J
‡
7KHHOHFWULFDOFRQQHFWLRQVPXVWEHPDGHLQFRPSOLDQFHZLWKWKHLQVWUXFWLRQVJLYHQLQWKHLQVWDOODWLRQPDQXDODQGZLWKQDWLRQDO
VWDQGDUGVRUSURFHGXUHVJRYHUQLQJHOHFWULFDOFRQQHFWLRQVLQVXI¿FLHQWFDSDFLW\RULQFRPSOHWHHOHFWULFDOFRQQHFWLRQVPD\OHDG
WRHOHFWULFVKRFNRU¿UH
‡ :DUQLQJ WKH SRZHU FLUFXLWV RI WKH LQWHUQDO DQG H[WHUQDO XQLWV PXVW EH VHSDUDWH WKH H[WHUQDO XQLW OLQH PXVW EH
SURWHFWHGZLWKDWKHUPRPDJQHWLFFLUFXLWEUHDNHURUVXLWDEO\VL]HGIXVHV
‡ 1HYHUXVHDSRZHUVRXUFHWRZKLFKDQRWKHUDSSOLDQFHLVFRQQHFWHG
‡ )RUWKHFRQQHFWLRQXVHDFDEOHORQJHQRXJKWRFRYHUWKHHQWLUHGLVWDQFHZLWKRXWWKHQHHGIRULQWHUPHGLDWHFRQQHFWLRQVGR
QRWXVHH[WHQVLRQFDEOHVGRQRWDSSO\RWKHUORDGVWRWKHSRZHUVXSSO\XVHDGHGLFDWHGSRZHUVXSSO\IDLOXUHWRGRVRPD\
OHDGWRDULVNRIRYHUKHDWLQJHOHFWULFVKRFNRU¿UH
‡ )RUWKHHOHFWULFDOFRQQHFWLRQVEHWZHHQWKHLQWHUQDODQGH[WHUQDOXQLWXVHWKHVSHFL¿HGW\SHVRIFDEOHVIDVWHQLQWHUFRQQHFWLRQ
FDEOHVVHFXUHO\VRWKDWWKHUHVSHFWLYHWHUPLQDOVDUHQRWVXEMHFWHGWRH[WHUQDOVWUHVVXVLQJWKHFDEOHJULSVLQVLGHWKHXQLW
LQFRPSOHWHFRQQHFWLRQVRUIDVWHQLQJVPD\OHDGWRRYHUKHDWLQJRU¿UH
‡ $IWHUKDYLQJFRQQHFWHGWKHLQWHUFRQQHFWLRQDQGSRZHUFDEOHVHQVXUHWKDWWKHFDEOHVDUHQRWH[HUWLQJDQ\VWUDLQRQWKHFRYHUV
RUHOHFWULFSDQHOV¿WWKHFRYHUVRQWKHFDEOHV
‡ 6KRXOGDQ\UHIULJHUDQWOHDNRXWGXULQJLQVWDOODWLRQDHUDWHWKHDUHDLIH[SRVHGWRWKHÀDPHWKHUHIULJHUDQWSURGXFHVWR[LF
JDV
Ensure the power supply to the external and internal units is off before carrying out any operation.
)RUWKHHOHFWULFDOFRQQHFWLRQVVHH¿J
The power voltage must be that stated in the technical features table.
The cable terminals must be equipped with leads with section proportionate to the connecting cables before being inserted into
the terminal board.
45
ENGLISH
2.7
2
The power lines must be suitably sized to prevent voltage drops or overheating of cables or other devices on the lines.
The power line of the external unit must be capable of being sectioned from the mains using a thermomagnetic circuit breaker
suitable for the machine input with differential relay, with maximum calibration equal to that stated in national electrical regulations
VHHWDEOHLQ¿J
The internal unit line is already protected by a thermomagnetic circuit breaker on the electrical heater elements power supply
DQGE\DIXVHVHHVHFWLQVWDOODWLRQRIDGLIIHUHQWLDOUHOD\RQWKHSRZHUOLQHLVUHFRPPHQGHG
&KHFNWKDWGXULQJWKHFRPSUHVVRURSHUDWLRQWKHHOHFWULFDOSRZHUYROWDJHFRUUHVSRQGVWRWKHQRPLQDOYDOXH
8VLQJWKHUHIULJHUDQWRUZDWHUSLSHVWRHDUWKWKHDSSOLDQFHLVIRUELGGHQ
The manufacturer is not liable for any damage arising from failure to earth or failure to comply with that indicated in the wiring
diagrams.
7KHWDEOHLQ¿JVKRZVWKHPD[LPXPLQSXWVRIWKHXQLWV
ENGLISH
A
B
C
D
E
F
G
2.9.1
External unit power supply
External unit maximum absorbed power
External unit maximum absorbed current
)XVHRUWKHUPRPDJQHWLFFLUFXLWEUHDNHU0)$
Internal unit power supply
,QWHUQDOXQLWPD[LPXPDEVRUEHGSRZHUZLWKHOHFWULFDOKHDWHUHOHPHQWVDFWLYDWHG
,QWHUQDOXQLWPD[LPXPDEVRUEHGFXUUHQWZLWKHOHFWULFDOKHDWHUHOHPHQWVDFWLYDWHG
Access to electrical connections
The terminal boards for the external unit’s electrical connections are located on the right-hand side of the unit. To gain access,
remove the electric panel cover after having removed the fastening screws.
To access the terminal boards for the internal unit’s electrical connections, see sect. 2.1.1 and 2.1.2.
These operations are permitted solely to specialist personnel.
2.9.2
Connecting cables
The following table summarises the cables to be used.
ODU/IDU communication cable
A
2 x 0,5 mm2 shielded
DHW and outside air probe cable
B
H03RN-F 2 G 0,5 / H03VV-F 2 G 0,5
INTERNAL UNIT
Power cable
SHERPA SMALL
C
EXTERNAL UNIT
Power cable
D
H05VV 3 x 2,5 mm
SHERPA BIG
2
H05VV-F 3 x 4 mm2
OSCEBSH24EI
OSCEBCH36EI
OSCEBCH48EI
OS-CEBTH48EI
OSCEBCH60EI
OS-CEBTH60EI
H07RN-F 3 G2,5
H07RN-F 3 G4
H07RN-F 3 G4
H07RN-F 5 G2,5
H07RN-F 3 G4
H07RN-F 5 G2,5
2.9.3
Electrical connections ¿J
&RQQHFWWKHFDEOHVOLVWHGLQWKHVHFWLRQEHORZWRWKHWHUPLQDOERDUGVRIWKHLQWHUQDODQGH[WHUQDOXQLWVUHIHUULQJWR¿J
and the descriptions below.
Internal unit:
‡ terminals L-N- internal unit power supply
‡ terminals 24-25RXWGRRUWHPSHUDWXUHGHWHFWLRQSUREHLQOHWUHTXLUHGIRUDFWLYDWLQJWKHFOLPDWHFXUYHVHQDEOLQJWKHHOHFWULFDO
KHDWHUHOHPHQWVLQVLGHWKHXQLWRUDFWLYDWLQJDQH[WHUQDOKHDWVRXUFH
‡ terminals 26-27GRPHVWLFZDWHUWDQNWHPSHUDWXUHGHWHFWLRQSUREHLQOHWUHTXLUHGIRUFKHFNLQJWHPSHUDWXUHRIWKHGRPHVWLF
ZDWHUWDQNDQGPDQDJLQJDQWLOHJLRQHOODF\FOHV
‡ terminals Q-P: communication cable between internal unit and external unit
‡ terminals N-L-12: 3-way valve for domestic water diversion installed as standard on 3W on-board machine version, can be
LQVWDOOHGH[WHUQDOO\RQWKHEDVLFYHUVLRQNLWDYDLODEOH
‡ terminals N-13: contactor activation for electrical heater element power supply in domestic water tank during anti-legionella
F\FOHV9+]:PD[
‡ terminals 14-15DFWLYDWLRQRIH[WHUQDOKHDWVRXUFHHJJDVERLOHUFRQWDFW$$9DF
‡ terminals 16-17DODUPFRQWDFWFRQWDFW$$9DF
‡ terminals 5-LGRPHVWLFKRWZDWHUUHTXHVWZKHQWKHGRPHVWLFKRWZDWHUWDQNWHPSHUDWXUHLVVHWE\DGHGLFDWHGH[WHUQDO
FRQWURODFORVHGFRQWDFWEHWZHHQWKHVHWHUPLQDOVDFWLYDWHVWKHGRPHVWLFKRWZDWHUUHTXHVW
‡ terminal 1 electronic board on / off remote free contact
46
2
‡ terminal 2 electronic board heating/cooling mode remote free contact
‡ terminal 3 electronic board Eco mode remote free contact
‡ terminal 4 electronic board night-time mode remote free contact
‡ terminal 5 electronic boardGRPHVWLFZDWHUDFWLYDWLRQUHPRWHIUHHFRQWDFWDOUHDG\FRQQHFWHGWRWHUPLQDOERDUG/
‡ terminal 6 electronic board7$UHPRWHIUHHFRQWDFWVHHVHFWUHPRWHFRQWURO
‡ terminal 7 electronic board remote free contacts common connection
7HUPLQDOVWRDUHORFDWHGRQWKHHOHFWURQLFERDUGWKHWHUPLQDOVFDQEHUHPRYHGIURPWKHERDUGWRFRQQHFWWKHPPRUHHDVLO\
DQGWKHQUHWXUQHGWRWKHRULJLQDOSRVLWLRQVHH¿J
$OODGGLWLRQDOFDEOHVPXVWEHORQJHQRXJKWRHQDEOHWKHHOHFWULFSDQHOWRRSHQ
Single-phase external unit:
‡ terminals L-N- external unit power supply
communication cable between internal unit and external unit
‡ terminals Q-PThree-phase external unit:
‡ terminals R-S-T-Nexternal unit power supply
communication cable between internal unit and external unit
‡ terminals Q-P-
2.10
INSTALLATION CHECKS ¿J
2.10.1
Preparing for initial start-up ¿J
7KHLQLWLDOVWDUWXSRIWKHDLUZDWHUKHDWSXPSPXVWEHFDUULHGRXWE\TXDOL¿HGWHFKQLFDOSHUVRQQHO
Before starting up the air-water heat pumps ensure that:
‡ $OOVDIHW\FRQGLWLRQVDUHPHW
‡ 7KHDLUZDWHUKHDWSXPSKDVEHHQSURSHUO\IDVWHQHGWRWKHVXSSRUWVXUIDFH
‡ 7KHPLQLPXPGLVWDQFHKDVEHHQREVHUYHG
‡ 7KHK\GUDXOLFFRQQHFWLRQVKDYHEHHQFDUULHGRXWLQDFFRUGDQFHZLWKWKHLQVWUXFWLRQERRNOHW
‡ 7KHK\GUDXOLFV\VWHPKDVEHHQFKDUJHGDQGEOHG
‡ 7KHK\GUDXOLFFLUFXLWRQRIIYDOYHVDUHRSHQ
‡ ,IDERLOHULV¿WWHGLQWKHV\VWHPFKHFNWKDWFKHFNYDOYHVKDYHEHHQLQVWDOOHGRQWKHZDWHULQOHWVRQWKHKHDWSXPSDQGRQ
WKHERLOHUWRSUHYHQWORVVRIZDWHUÀRZLQWKHV\VWHPDQGH[FHVVLYHO\KRWZDWHUHQWHULQJWKHKHDWSXPS
‡ 7KHHOHFWULFDOFRQQHFWLRQVKDYHEHHQPDGHFRUUHFWO\
‡ 9ROWDJHLVEHWZHHQDQG9IRUVLQJOHSKDVHXQLWVDQGDQG9IRUWKUHHSKDVHXQLWV
‡ 7KHWKUHHSKDVHSRZHUVXSSO\IRUWKUHHSKDVHPRGHOVKDVDPD[LPXPXQEDODQFHEHWZHHQSKDVHVRI
‡ 7KHV\VWHPLVFRUUHFWO\HDUWKHG
‡ $OOWKHHOHFWULFDOFRQQHFWLRQVKDYHEHHQFRUUHFWO\WLJKWHQHG
‡ 7KHSRZHUFDEOHVKDYHDVHFWLRQWKDWLVDGHTXDWHIRUWKHFRQVXPSWLRQRIWKHDSSOLDQFHDQGWKHOHQJWKRIWKHFRQQHFWLRQ
made.
‡ 7KHZDWHUKDUGQHVVDGMXVWPHQWKDVEHHQFDUULHGRXWDQGWKHSRWHQWLRPHWHULVFRUUHFWO\SRVLWLRQHGRQWKHZDVKFRQWUROFDUG
‡ 5HPRYHDQ\REMHFWVSDUWLFXODUO\FKLSVELWVRIZLUHDQGEROWVDQGVFUHZV
‡ &KHFNWKDWDOOWKHFDEOHVDUHFRQQHFWHGDQGWKDWDOOHOHFWULFDOFRQQHFWLRQVDUHVHFXUH
‡ %HIRUHWKHFRPSUHVVRUFDQEHVWDUWHGWKHV\VWHPPXVWKDYHEHHQRQFRQWLQXRXVO\IRUDWOHDVWKRXUV
‡ %RWKWKHJDVSLSHYDOYHDQGWKHOLTXLGSLSHYDOYH¿JUHI(PXVWEHRSHQ
‡ $VNWKHFOLHQWWRDWWHQGWKHUXQQLQJWHVW
‡ ,OOXVWUDWHWKHFRQWHQWVRIWKHLQVWUXFWLRQPDQXDOWRWKHFXVWRPHU‡+DQGRYHUWKHLQVWUXFWLRQPDQXDODQGWKHZDUUDQW\FHUWL¿FDWH
to the client.
&KHFNVGXULQJDQGDIWHULQLWLDOVWDUWXS¿J
When the start-up has been completed check that:
‡ 7KHFXUUHQWDEVRUEHGE\WKHFRPSUHVVRULVEHORZWKHPD[LPXPLQGLFDWHGRQWKHSODWHGDWD
‡ &KHFNWKDWGXULQJFRPSUHVVRURSHUDWLRQWKHHOHFWULFDOSRZHUYROWDJHFRUUHVSRQGVWRWKHQRPLQDOYDOXH
‡ &KHFNWKDWWKHWKUHHSKDVHSRZHUVXSSO\KDVDPD[LPXPXQEDODQFHEHWZHHQSKDVHVRI
‡ &KHFNWKDWWKHQRLVHOHYHORIWKHWKUHHSKDVHFRPSUHVVRULVZLWKLQWKHQRUP
‡ 7KHDSSOLDQFHRSHUDWHVZLWKLQWKHUHFRPPHQGHGRSHUDWLQJFRQGLWLRQVVHH¿J
‡ $OODLUKDVEHHQFRPSOHWHO\EOHGIURPWKHK\GUDXOLFFLUFXLW
‡ 7KHDLUZDWHUKHDWSXPSSHUIRUPVDVWRSDQGWKHQUHVWDUWV
‡ 7KHWKHUPDOJUDGLHQWEHWZHHQV\VWHPÀRZDQGUHWXUQPXVWEHEHWZHHQDQGƒ&FKHFNLQJSDUDPHWHUVWDQGW
‡ ,IWKHWKHUPDOJUDGLHQWLVEHORZƒ&VHWDORZHUFLUFXODWRUVSHHG2QWKHRWKHUKDQGLIWKHWKHUPDOJUDGLHQWLVJUHDWHUWKDQ
ƒ&FKHFNDOOWKHYDOYHVRQWKHV\VWHPDUHRSHQDQGDGGDQH[WHUQDOSXPSWRLQFUHDVHWKHZDWHUÀRZLIQHFHVVDU\
47
ENGLISH
)DVWHQDOOWKHFDEOHVXVLQJFDEOHJULSV
3
3
3.1
3.1.1
USE AND MAINTENANCE
INTERNAL UNIT CONTROL PANEL ¿J
The pressure gauge, control panel and master switch are accessed by opening the front panel door.
7KHSDQHO¿JLQFOXGHVWKHIROORZLQJGHYLFHV
A Pressure gauge. Displays the hydraulic system pressure, enables the water pressure inside the circuit to be checked. Values
must be between 1 and 2 bar.
B Control panel
C Internal unit master switch
D Front panel fastening screw
Description of control panel¿J
used when temperatures are displayed
decimal point
21\HOORZ
FRROLQJJUHHQ
KHDWLQJUHG
SXPSRQJUHHQ
FXUUHQWSDVWDODUPUHG
DGGLWLRQDOKHDWHU\HOORZ
WLPHUDFWLYDWHG\HOORZ
GRPHVWLFZDWHUSURGXFWLRQDFWLYHUHG
(&2PRGHDFWLYHJUHHQ
XSDUURZWRVFUROOPHQXRUPRGLI\GLVSOD\HGYDOXH
GRZQDUURZOLNH.H\
EXWLQRSSRVLWHGLUHFWLRQ3UHVVWRJHWKHUZLWK.H\
to quit the current menu
select cooling/heating/domestic water production only
FRQ¿JXUDWLRQPHQX)RUDFFHVVLQJXVHURUVHUYLFHPHQXV
temperature/set menu. Press this button to access the temperature values. Press the arrows to select the required
WRYLHZWKHYDOXH7RVHWWKHWHPSHUDWXUHVSUHVV.H\
for three seconds and the
YDOXHDQG.H\
DUURZVWRFKDQJHWKHYDOXHSUHVV.H\
WRFRQ¿UP4XLWWKHPHQXDXWRPDWLFDOO\E\QRWSUHVVLQJDQ\EXWWRQV
for 60 seconds or by pressing both arrows simultaneously
Key6:
)RUYLHZLQJWKHSDUDPHWHUYDOXHPRGLI\LQJLWVVHWWLQJE\SUHVVLQJIRUWKUHHVHFRQGVDQGFRQ¿UPLQJWKHQHZ
value
Key7:
Enables or disables the second set-point CS2 in cooling or HS2 in heating to save energy.
Key8:
Press this button to switch the unit on or put it in standby
ENGLISH
Led A:
Led B:
Led1
Led2
Led3
Led4
Led5
Led6
Led7
Led8
Led9
Key1:
Key2:
Key3:
Key4:
Key5:
3.2
ACTIVATION AND USER FUNCTIONS
3.2.1
Activation ¿J
6HH¿JXUHIRUWKH/('VDQGEXWWRQVRQWKHFRQWUROSDQHO
To activate the unit, proceed as follows:
‡ 3RZHUWKHLQWHUQDOXQLWDQGWKHH[WHUQDOXQLWXVLQJWKHPDVWHUVZLWFKHV
‡ $FWLYDWHWKHLQWHUQDOXQLW¶VSDQHOXVLQJWKHVZLWFK¿JUHI&RQWKHFRQWUROSDQHO
and green LED
which shows the circulation pump
‡ 3UHVV.H\ on the user interface to switch on yellow LED1
is activated. The operating mode is then displayed: CLG for cooling mode, HTG for heating and San for domestic water
production.
WRVHOHFWWKHRSHUDWLQJPRGHRQ¿UVWSUHVVLQJ.H\
cooling mode is activated and the green
‡ 3UHVV.H\
LED 2 lights up
, then heating and red LED 3 DQG¿QDOO\GRPHVWLFZDWHUSURGXFWLRQDQG/('VDQGVZLWFKRII
3UHVV.H\
WRDFWLYDWH(FRHQHUJ\VDYLQJPRGHZKHQWKHJUHHQ/('
is on, Eco mode is active
3.2.2
Temperature/set menu
The temperatures measured by the internal unit probes can be checked and viewed and the water set-points set on the control
SDQHOLQWKHWHPSHUDWXUHVHWPHQX
The temperatures and set-points that can be viewed on the display are:
‡ WHQWHULQJZDWHUWHPSHUDWXUH
‡ WOHDYLQJZDWHUWHPSHUDWXUH
‡ WGRPHVWLFZDWHUWDQNVHQVRUWHPSHUDWXUH
48
3
‡
‡
‡
‡
‡
‡
WRXWVLGHDLUVHQVRUWHPSHUDWXUH
F6VHWSRLQWLQFRROLQJPRGH
F6VHWSRLQW(FRLQFRROLQJPRGH
&+&FRPSUHVVRURSHUDWLQJKRXUV
+6VHWSRLQWLQKHDWLQJPRGH
+6VHWSRLQW(FRLQKHDWLQJPRGH
3.2.3
User menu
7KHIROORZLQJIXQFWLRQVPRGL¿DEOHIURPWKHXVHUPHQXFDQDOVREHDFWLYDWHGRQWKHLQWHUQDOXQLW¶VFRQWUROSDQHO
‡
&/2&.
7RVHWWKHFORFNPRGLI\SDUDPHWHUKU6IRUWKHKRXUVDQGSDUDPHWHUɉLQIRUWKHPLQXWHV
‡
TIMER
With this function the system can be set to switch on and off once a day.
3DUDPHWHUWLɉ DFWLYDWHVWKHIXQFWLRQSDUDPHWHU6W$VHWVWKHVWDUWWLPHDQGSDUDPHWHU6WRVHWVWKHV\VWHPVKXWGRZQWLPH
‡
NIGHT-TIME MODE
System yield and noise are limited in night-time mode.
7KHIXQFWLRQLVHQDEOHGZLWKSDUDPHWHUQF/ WKHPRGHVWDUWWLPHZLWKSDUDPHWHUQ6WDQGWKHHQGWLPHZLWKSDUDPHWHUQ63
‡
COOLING SET-POINT
The thermostat can be set for two different water cooling temperatures, using parameters CS1 and CS2.
Temperature CS2 is used by activating Eco mode in cooling.
‡
+($7,1*6(732,17
The thermostat can be set for two different water heating temperatures, using parameters HS1 and HS2.
Temperature HS2 is used by activating Eco mode in heating.
‡
'20(67,&:$7(56(732,17
The thermostat can be set for one water heating temperature, using parameter HS3.
‡
&/,0$7(&859(6
To optimise energy saving, two climate curves are available: one for heating and one for cooling. This function enables the
water temperature to be adjusted to the outside air temperature and therefore to the heating load, optimising system energy
saving.
The climate curves must be set on the system by authorised personnel, modifying certain parameters in the service menu.
7KHXVHUFDQHQDEOHWKHFXUYHLQKHDWLQJE\VHWWLQJSDUDPHWHU+FF ZLWK+FF WKHFXUYHLVGLVDEOHGDQGWKHV\VWHPUXQV
with set-points Hs1 and Hs2.
7KHXVHUFDQHQDEOHWKHFXUYHLQFRROLQJE\VHWWLQJSDUDPHWHU&FF ZLWK&FF WKHFXUYHLVGLVDEOHGDQGWKHV\VWHPUXQV
with set-points Cs1 and Cs2.
3.3
SETTING THE USER MENU PARAMETERS
to access the user menu, pressing it displays Usr for User.
8VHEXWWRQ.(<
WRHQWHUWKHPHQXDQGGLVSOD\WKH¿UVWSDUDPHWHUWKHQXVHWKHXSDQG
2QFHWKHXVHUPHQXLVVHOHFWHGSUHVV.(<
GRZQDUURZVWRYLHZDOOWKHSDUDPHWHUVLQWKHXVHUPHQX3UHVVWKHLQIRVHWEXWWRQDJDLQWRYLHZWKHYDOXHRIWKHSDUDPHWHURQ
SUHVVLQJLQIRVHWDJDLQIRUWKUHHVHFRQGVWKHYDOXHRQWKHGLVSOD\ÀDVKHVDQGFDQEHPRGL¿HGXVLQJWKHDUURZV.H\
and
.H\
, press
WRFRQ¿UP
Press menu to exit and the arrows to select another parameter.
Proceed in the same way for the other parameters.
4XLWWKHPHQXDXWRPDWLFDOO\E\QRWSUHVVLQJDQ\EXWWRQVIRUVHFRQGVRUE\SUHVVLQJERWKDUURZV.H\
DQG.H\
simultaneously.
49
ENGLISH
To view the above temperatures/set-points, proceed as follows:
, to view t1 on the display
‡ 3UHVV.H\
RU.H\
, to view the other mnemonic symbols on the display
‡ 3UHVV.H\
, to view the measured temperature/set-point value
‡ 3UHVV.H\
‡ 3UHVV.H\
to quit temperature/set mode
3
To set the parameters see the table below that summarises the parameters.
Example:
3UHVV.H\
3UHVV.H\
3UHVV.H\
3UHVV.H\
3UHVV.H\
3UHVV.H\
3UHVV.H\
3UHVV.H\
3UHVV.H\
, to view USr on the display
WRYLHZWKH¿UVWSDUDPHWHUKU6FORFNKRXUVHWWLQJ
WRYLHZWKHSDUDPHWHUYDOXHHJ
IRUWKUHHVHFRQGVWKHSDUDPHWHUYDOXHÀDVKHVRQWKHGLVSOD\
.H\
to increase or reduce the parameter value displayed
WRFRQ¿UPWKHVHWYDOXHWKHGLVSOD\VWRSVÀDVKLQJ
, to exit and view the parameter
RU.H\
to change parameter and proceed as above to change other parameters
DQG.H\
simultaneously to quit the user menu
ENGLISH
Parameter
DISPLAY
MNEMONIC
MENU
Range of
DGMXVWPHQW
Factory
setting
6<67(0&/2&.
HOUR SETTING
Kɝ6
User
0-23
0
6<67(0&/2&.
MINUTE SETTING
ɉLQ
User
0-59
0
TIMER ACTIVATION/
DEACTIVATION
WLPHUGHDFWLYDWHG
WLPHUDFWLYDWHG
WLɉ
User
0-1
0
StA
User
00.0 – 23.5
0.00
'HFLPDOV WHQVRIPLQXWHV
HJ PLQXWHV minutes
Sto
User
00.0 – 23.5
0.00
'HFLPDOV WHQVRIPLQXWHV
HJ PLQXWHV minutes
6<67(067$577,0(
6<67(06+87'2:1
TIME
NIGHT-TIME MODE
ACTIVATION/
DEACTIVATION
QLJKWWLPHPRGH
deactivated
QLJKWWLPHPRGH
activated
The yield and the maximum
noise level are reduced
ncL
User
0,1
0
NIGHT-TIME MODE
SWITCH-ON TIME
nSt
User
00.0 – 23.5
0.00
'HFLPDOV WHQVRIPLQXWHV
HJ PLQXWHV minutes
NIGHT-TIME MODE
SHUTDOWN TIME
nSP
User
00.0 – 23.5
0.00
'HFLPDOV WHQVRIPLQXWHV
HJ PLQXWHV minutes
t1
Temperature/
Set
Outlet water
temperature
t2
Temperature/
Set
Domestic water tank
sensor temperature
t3
Temperature/
Set
Outside air sensor
temperature
t4
Temperature/
Set
CHC
Temperature/
Set
/XF ƒ&
- 25°C
/XF ƒ&
- 20°C
/XF ƒ&
/XF ƒ&
Factory settings for radiant
ÀRRUV
/XF ƒ&
- 25°C
/XF ƒ&
- 20°C
/XF ƒ&
/XF ƒ&
Factory settings for radiant
ÀRRUV
/XF ƒ&
- 55°C
/XF ƒ&
- 60°C
/XF ƒ&
/XF ƒ&
Factory settings for radiant
ÀRRUV
Inlet water temperature
Compressor operating
hours
COOLING SET-POINT
1
cS1
Temperature/
Set
User
COOLING SET-POINT
(FR0RGH
cS2
Temperature/
Set
User
HEATING SET-POINT
1
HS1
Temperature/
Set
User
50
COMMENTS
3
Parameter
HEATING SET-POINT
(FR0RGH
DISPLAY
MNEMONIC
HS2
MENU
Range of
DGMXVWPHQW
Factory
setting
Temperature/
Set
/XF ƒ&
- 55°C
/XF ƒ&
- 60°C
/XF ƒ&
/XF ƒ&
20-55°C
50°C
User
DOMESTIC WATER
7$1.6(732,17
HS3
Temperature/
Set
COMMENTS
Factory settings for radiant
ÀRRUV
+6LVXVHGVROHO\ZKHQGK8 ZDWHUFKHFNDWRXWOHW ƒ&
¿[HGYDOXH
User
HEATING CLIMATE
CURVE ACTIVATION/
DEACTIVATION
FOLPDWHFXUYH
deactivated
FOLPDWHFXUYH
activated
3.4
Ccc
Hcc
User
User
0, 1
0, 1
0
0
,I&FF WKHWHPSHUDWXUH
control is performed with setpoint cS1 or cS2
,I&FF WKHWHPSHUDWXUH
control is performed in
accordance with climate curve
,I+FF WKHWHPSHUDWXUH
control is performed with setpoint HS1 or HS2
,I+FF WKHWHPSHUDWXUH
control is performed in
accordance with climate curve
ACTIVATION AND SERVICE FUNCTIONS
To activate the unit, proceed as follows:
‡ 3RZHUWKHLQWHUQDOXQLWDQGWKHH[WHUQDOXQLWXVLQJWKHPDVWHUVZLWFKHV
‡ $FWLYDWHWKHLQWHUQDOXQLW¶VSDQHOXVLQJVZLWFK&RQWKHFRQWUROSDQHO
‡ 3UHVV.H\
on the user interface to switch on yellow LED 1
and green LED
which shows the circulation pump
is activated. The operating mode is then displayed: CLG for cooling mode, HTG for heating and San for domestic water
production.
‡ 3UHVV.H\
WRVHOHFWWKHRSHUDWLQJPRGHRQ¿UVWSUHVVLQJ.H\
cooling mode is activated and the green
, then heating and red LED 3 DQG¿QDOO\GRPHVWLFZDWHUSURGXFWLRQDQG/('VDQGVZLWFKRII
LED 2 lights up
WRDFWLYDWH(FRHQHUJ\VDYLQJPRGHZKHQWKHJUHHQ/('
is on, Eco mode is active.
‡ 3UHVV.H\
7KHIROORZLQJIXQFWLRQVPRGL¿DEOHIURPWKHVHUYLFHPHQXFDQDOVREHDFWLYDWHGRQWKHLQWHUQDOXQLW¶VFRQWUROSDQHO
‡
‡
,17(51$/81,7(/(&75,&$/+($7(5(/(0(1760$1$*(0(17
The units are equipped with additional 2-stage heater elements: 1.5 kW + 1.5 kW on SMALL internal units and 3 kW + 3 kW
on LARGE units.
To enable this function, the outside air temperature probe kit must be installed. They can be enabled to supplement the power
LQKHDWLQJLQGRPHVWLFZDWHUSURGXFWLRQDQGGXULQJDQWLOHJLRQHOODF\FOHVVHHGHGLFDWHGVHFWLRQ
'HSHQGLQJRQQHFHVVLW\DQGHOHFWULFSRZHUVXSSO\DYDLODEOHWKH\DUHHQDEOHGZLWKSDUDPHWHUEF LQGLYLGXDOO\ZLWKSDUDPHWHU
$(+ RULQSDLUVZLWKSDUDPHWHU$(+ DQGE\VHWWLQJDWZKDWRXWGRRUWHPSHUDWXUHWKH\DUHWRDFWLYDWHLQSDUDPHWHURW(
HJRW( ƒ&
7KH¿UVWHOHPHQWZLOODFWLYDWHZKHQWKHRXWVLGHDLUWHPSHUDWXUHJRHVEHORZRW(LIWKHZDWHUWHPSHUDWXUHLVƒ.EHORZWKHVHW
temperature and the number of minutes set in parameter EhP after these conditions occur. The second element will activate
VHYHUDOPLQXWHVDIWHUWKHDFWLYDWLRQRIWKH¿UVWLIWKHSDUDPHWHUVDUHQRWPHWWKHDFWLYDWLRQWLPHFDQEHYDULHGEHWZHHQ
and 60 minutes in parameter EhP.
7KHHOHFWULFDOKHDWHUHOHPHQWVFDQQRWEHDFWLYDWHGLIDQH[WHUQDOKHDWVRXUFHLVHQDEOHGEF The electrical heater elements will activate even in the event of a fault on the external unit.
:$7(57(03(5$785(&21752/
7KHZDWHUWHPSHUDWXUHWKHUPRVWDWFDQEHVHWWRDGMXVWWKHZDWHUÀRZWHPSHUDWXUHIDFWRU\VHWWLQJ/8F RUWRDGMXVWWKH
V\VWHPUHWXUQZDWHUWHPSHUDWXUH/8F 51
ENGLISH
COOLING CLIMATE
CURVE ACTIVATION/
DEACTIVATION
FOLPDWHFXUYH
deactivated
FOLPDWHFXUYH
activated
3
‡
REMOTE CONTROL
Some appliance functions can be controlled remotely using free contacts.
7KHFRQWDFWVVKRXOGEHFRQQHFWHGWRWKHWHUPLQDOERDUGRIWKHLQWHUQDOXQLW¶VHOHFWURQLFERDUG¿JDVGHVFULEHGEHORZ
terminal 1: on/off: with the free contact open the system is in stand-by, with the contact closed the system is on
terminal 2: toggle heating/cooling operating mode: with the free contact open the system is in heating mode, with the
contact closed the system is in cooling mode
terminal 3: as per ECO mode set-point: with the free contact open the set-point selected is cS1 in cooling mode or HS1
LQKHDWLQJPRGHZLWKWKHFRQWDFWFORVHGWKHVHWSRLQWVHOHFWHGLVF6LQFRROLQJPRGHRU+6LQKHDWLQJPRGH
terminal 4: night-time mode selection activation: with the free contact open the function is disabled, with the contact closed
the function is active
terminal 5 DOUHDG\FRQQHFWHGWRWKHWHUPLQDOERDUGRIWKHLQWHUQDOXQLW/GRPHVWLFZDWHUKHDWLQJDFWLYDWLRQZLWKWKH
IUHHFRQWDFWRSHQGRPHVWLFZDWHUPRGHLVGLVDEOHGZLWKWKHFRQWDFWFORVHGGRPHVWLFZDWHUPRGHLVHQDEOHG
terminal 6: cooling or heating mode activation/inhibition. when the contact is open, the domestic water function remains
active. It may also be connected to a chrono-thermostat or in parallel to the chiller/boiler contacts of the electronic
controls of fan coils Bi2 and Bi2+.
The contacts must be closed on terminal L
7KHUHPRWHFRQWDFWVRIWHUPLQDOVDQGDUHHQDEOHGXVLQJSDUDPHWHUUɉ7 ‡
CIRCULATION PUMP CHECKS
'XULQJLQVWDOODWLRQWKHFLUFXODWLRQSXPSFDQEHIRUFHGWRUXQIRUPLQXWHVE\VHWWLQJSDUDPHWHU)3$ LQWKLVZD\DLULQWKH
¿QDOSKDVHRI¿OOLQJWKHV\VWHPZLWKZDWHULVSXUJHG
The circulation pump can run in different modes depending on the requirements of the system to which the unit is connected:
‡ &RQWLQXRXVSXPSRSHUDWLRQIDFWRU\VHWWLQJRISDUDPHWHUF33 ‡ 7KHSXPSVZLWFKHVRIIZKHQWKHZDWHUVHWSRLQWLVUHDFKHGWKHSXPSDFWLYDWHVSHULRGLFDOO\WRYHULI\WKHZDWHUWHPSHUDWXUH
LQWKHFLUFXLW7KHVDPSOLQJF\FOHLVGH¿QHGE\WKHYDOXHVHWLQSDUDPHWHUF33HJF33 WKHSXPSDFWLYDWHVIRURQH
PLQXWHLQHYHU\WHQZLWKWKHVHWSRLQWUHDFKHG
7KHSXPSDQWLORFNLQJIXQFWLRQLVDFWLYHZKLOHWKHV\VWHPLVLQ2))VHWWLQJSDUDPHWHU336 HQDEOHVWKLVIXQFWLRQ
parameter Pqd sets every how many hours the start-up is set for and parameter Pqt sets how long the pump is to run
during the anti-locking cycle.
‡
$8;,/,$5<(;7(51$/+($76285&(0$1$*(0(17
,QKHDWLQJRUGRPHVWLFZDWHUSURGXFWLRQPRGHWKHFRQWUROUHSODFHVWKHKHDWSXPSXQLWYLDSDUDPHWHUEF LIWKHRXWVLGH
DLUWHPSHUDWXUHLVEHORZDSUHVHWYDOXHSDUDPHWHURW(
‡
DOMESTIC WATER PRODUCTION
The appliance can be connected to a tank with an intermediate exchanger to produce domestic water. The 3W internal units
ZLWKWKHZD\YDOYHFDQGLYHUWWKHKRWZDWHUÀRZWRDGRPHVWLFZDWHUVWRUDJHWDQN
The domestic water request can occur in two ways:
‡ YLDDIUHHFRQWDFW/E\VHWWLQJSDUDPHWHUGK8 LQWKLVFDVHVHWWKHH[WHUQDOWKHUPRVWDWIUHHFRQWDFWWRDWHPSHUDWXUH
below 60°C.
‡ YLDDWHPSHUDWXUHVHQVRULQVWDOOHGLQWKHGRPHVWLFZDWHUWDQNE\VHWWLQJSDUDPHWHUGK8 LQWKLVFDVHWKHVHWSRLQWLV
set with parameter HS3.
Via parameter hyS it is also possible to check the hysteresis cycle of the tank temperature check.
+6 ƒ&DQGK\6 ƒ.DUHIDFWRU\VHWVRWKHWHPSHUDWXUHLQWKHWDQNZLOOYDU\EHWZHHQDQGƒ&
,IDGRPHVWLFZDWHUSURGXFWLRQUHTXHVWDFWLYDWHVWKHFRQWUROPRGL¿HVLWVVWDWXVDVIROORZV
‡ LIWKHXQLWLVUXQQLQJLQKHDWLQJPRGHWKHZD\YDOYHLVVZLWFKHGDQGWKHKRWZDWHUÀRZLVGLYHUWHGWRZDUGVWKH'+:
WDQNLQ´:KHQWKHUHTXLUHGWHPSHUDWXUHLVUHDFKHGWKHZD\YDOYHGLYHUWVWKHZDWHUÀRZLQ´WRZDUGVWKHKHDWLQJ
system and the system will continue to run in the same way as before the domestic water request.
‡ LIWKHXQLWLVUXQQLQJLQFRROLQJPRGHWKHFRPSUHVVRUVWRSVWKHZD\YDOYHLVVZLWFKHGDQGWKHKRWZDWHUÀRZLVGLYHUWHG
towards the DHW tank. When the required temperature is reached, the compressor stops, the refrigerant cycle inversion
valve and the 3-way valve are switched and the compressor starts three minutes after the previous stoppage.
During domestic water production the system dispenses the maximum power possible to rapidly meet the domestic water
request.
‡
ANTI-LEGIONELLA CYCLE
Through the activation of the anti-legionella function, the adjuster is able to conduct the thermal disinfection procedures
autonomously on domestic hot water systems, considerably reducing the risk of the presence and proliferation of the bacteria
responsible for legionella.
The disinfection function is activated in parameter Ldi. The user can opt to heat the domestic water with the heat pump and
WKHWZRVWDJHHOHFWULFDOKHDWHUHOHPHQWVRQERDUGWKHLQWHUQDOXQLWE\VHWWLQJSDUDPHWHU/G$ RUYLDDQHOHPHQWLQWKH
GRPHVWLFZDWHUWDQNLQSDUDPHWHU/G$ ,QWKHVHFRQGFDVHZLWK/G$ WKHHOHFWULFDOKHDWHUHOHPHQWPXVWEHSRZHUHG
VHSDUDWHO\DQGDFWLYDWHGYLDDUHOD\FRQQHFWHGWRWHUPLQDOV1NDFWLYDWLRQ
The time interval for running the cycle in days, for how long and at what temperature to run the disinfection cycles are set
respectively in parameters LdS, Ldd and Ldt.
ENGLISH
52
3
‡
FROST-PROTECTION
7KHLQWHUQDOXQLW¶VEUD]HGSODWHVH[FKDQJHULVSURWHFWHGDJDLQVWIUHH]LQJE\DÀRZVZLWFKZKLFKVWRSVWKHV\VWHPZKHQWKH
ZDWHUÀRZLVLQVXI¿FLHQWDQGE\WZRWHPSHUDWXUHVHQVRUVRQWKHSODWHH[FKDQJHUZKLFKVWRSWKHV\VWHPZKHQWKHZDWHU
temperatures are too low
‡
CLIMATE CURVES ¿J
To optimise energy saving, two climate curves are available: one for heating and one for cooling. This function enables the
water temperature to be adjusted to the outside air temperature and therefore to the heating load, optimising system energy
saving.
7KHFXUYHLVHQDEOHGLQKHDWLQJE\VHWWLQJSDUDPHWHU+FF The climate curve is set using four parameters:
The climate curve is set using four parameters:
Hc1 outside air temperature to have maximum water temperature
Hc2 maximum water temperature
Hc3 outside air temperature to have minimum water temperature
Hc4 minimum water temperature
7KHFXUYHLVHQDEOHGLQFRROLQJE\VHWWLQJSDUDPHWHU&FF The climate curve is set using four parameters:
Cc1 outside air temperature to have maximum water temperature
Cc2 maximum water temperature
Cc3 outside air temperature to have minimum water temperature
Cc4 minimum water temperature
6HH¿J&/,0$7(&859(+($7,1*+FFDQG&22/,1*&FF
'RQRWPRGLI\SDUDPHWHUV&+6UW)$GUDQG)3WWKH\DUHIDFWRU\VHWSDUDPHWHUV
3.5
SETTING THE SERVICE MENU PARAMETERS
to access the Service menu, pressing it twice displays SEr for Service
8VHEXWWRQ.(<
WRGLVSOD\WKHSDVVZRUGUHTXHVW3$6SUHVVLQIRVHWDQGGLVSOD\V
2QFHWKHVHUYLFHPHQXLVVHOHFWHGSUHVV.(<
SUHVVLQIRVHWDJDLQIRUWKUHHVHFRQGVDQGÀDVKHVWKHQHQWHUWKH3$6DQGSUHVVLQIRVHWWRFRQ¿UP3UHVV0HQXWRGLVSOD\
PAS and use the up and down arrows to view all parameters in the user menu. Press the info/set button again to view the value
RIWKHSDUDPHWHURQSUHVVLQJLQIRVHWDJDLQIRUWKUHHVHFRQGVWKHYDOXHRQWKHGLVSOD\ÀDVKHVDQGFDQEHPRGL¿HGXVLQJWKH
DUURZV.H\
DQG.H\
SUHVVLQIRVHWDJDLQWRFRQ¿UP
Press menu to exit and the arrows to select another parameter.
Proceed in the same way for the other parameters.
4XLWWKHPHQXDXWRPDWLFDOO\E\QRWSUHVVLQJDQ\EXWWRQVIRUVHFRQGVRUE\SUHVVLQJERWKDUURZV.H\
DQG.H\
simultaneously.
Example:
3UHVV.H\
twice to view SER on the display
3UHVV.H\
, to view PAS on the display
3UHVV.H\
, to view 00 on the display
3UHVV.H\
IRUWKUHHVHFRQGVWKHYDOXHÀDVKHVRQWKHGLVSOD\
3UHVV.H\ RU.H\
, to increase or reduce the value displayed
3UHVV.H\
WRFRQ¿UPWKHVHWYDOXHWKHGLVSOD\VWRSVÀDVKLQJ
, to exit, PAS is displayed
3UHVV.H\
3UHVV.H\ RU.H\
, to view a parameter. The mnemonic symbols of the parameters appear in sequence on
WKHGLVSOD\6WRSDWWKHSDUDPHWHUWREHPRGL¿HG
3UHVV.H\
IRUWKUHHVHFRQGVWKHSDUDPHWHUYDOXHÀDVKHVRQWKHGLVSOD\
, to change the parameter
3UHVV.H\ RU.H\
3UHVV.H\
WRFRQ¿UPWKHVHWYDOXHWKHGLVSOD\VWRSVÀDVKLQJ
WRH[LWWKHPQHPRQLFV\PERORIWKHODVWSDUDPHWHURQWKHGLVSOD\DSSHDUVUHVWDUWIURPSRLQWWR
3UHVV.H\
modify another parameter.
3UHVV.H\
DQG.H\
simultaneously to quit the user menu.
53
ENGLISH
The duration of the action is dictated by system characteristics. Legionella bacteria react differently depending on the maximum
temperature reached in the circuit. The higher the temperature, the shorter the duration.
The control signals the anti-legionella function is running by displaying LEG and exits the function after a maximum of 5 hours,
if for some reason the temperature is not reached inside the tank.
In the event excessive DHW is tapped off during the anti-legionella cycle and the temperature is not maintained, after two
attempts the control exits the function. When the anti-legionella cycle is not completed two consecutive times, alarm A8 is
displayed.
While the anti-legionella function is running, the system’s cooling or heating functions are interrupted when the disinfection
F\FOHLVFDUULHGRXWE\WKHKHDWSXPSDQGWKHHOHFWULFDOKHDWHUHOHPHQWVSDUDPHWHU/G$ 2QWKHRWKHUKDQGWKHKHDWLQJ
or cooling function is not interrupted if the anti-legionella cycle is carried out by an electrical heater element in the domestic
ZDWHUWDQNSDUDPHWHU/G$ To prevent scalding if tapping off hot water during the disinfection cycle, it is advisable to install anti-scalding safety devices
on each utility and at the domestic water tank outlet.
3
To set the parameters see the table that summarises the parameters.
ENGLISH
Parameter
54
DISPLAY
MNEMONIC
MENU
Range of
DGMXVWPHQW
Factory
setting
COMMENTS
ADDITIONAL INTERNAL
ELECTRICAL HEATER
ELEMENTS
HOHFWULFDOKHDWHU
elements deactivated
HOHFWULFDOKHDWHU
HOHPHQWV¿UVWVWDJH
activated
HOHFWULFDOKHDWHU
HOHPHQWV¿UVWDQGVHFRQG
stage activated
AEH
Service
0,1,2
0
WATER TEMPERATURE
CONTROL SENSOR
FRQWUROEDVHGRQ
entering water temperature
FRQWUROEDVHGRQOHDYLQJ
water temperature
LUc
Service
0,1
1
BPHE HEATER SETPOINT
cHS
Service
-5 to 5 °C
2°C
REMOTE CONTROL
XVHULQWHUIDFHRQO\
FRPPXQLFDWLRQSRUW
activated
UHPRWHFRQWUROIUHH
contacts activated
Uɉ7
Service
0,1,2
0
3803$17,/2&.,1*
FUNCTION WITH PUMP
OFF
SXPSDQWLORFNLQJ
function deactivated
SXPSDQWLORFNLQJ
function activated
PPS
Service
0,1
1
3803$17,/2&.,1*
)81&7,21)5(48(1&<
Pqd
Service
0 -100 hours
72
TIME PUMP RUNNING IN
$17,/2&.,1*)81&7,21
Pqt
Service
0 - 10
minutes
0,5
PUMP MAINTENANCE
MESSAGE
3ɉG
Service
0-999 days
0
WATER FILTER
MAINTENANCE MESSAGE
8)ɉ
Service
0-999 days
0
EXTERNAL HEAT
SOURCE ACTIVATION
REQUEST
DFWLYDWLRQUHTXHVW
disabled
DFWLYDWLRQUHTXHVW
enabled
bc
Service
0,1
0
,IEF WKHHOHFWULFDO
heater elements in the
internal unit cannot be
activated
OUTSIDE AIR
TEMPERATURE
THRESHOLD FOR
ACTIVATION OF
ADDITIONAL ELECTRICAL
HEATER ELEMENTS
OR EXTERNAL HEAT
SOURCE
otE
Service
-15 to 20°C
2°C
,IEF DQGRXWVLGHDLU
WHPSHUDWXUHWRW(
the contact connected
to terminals 14 and
LVFORVHG,IEF $(+!DQGWRW(
the internal electrical
heater element can be
activated.
Not used
,IUɉ7 2Q2II&+
can be controlled
only by the remote
free contacts, these
commands can be
disabled on the user
interface
Eco and night-time
modes, domestic
water production and
TA contact are always
enabled with any value
RIUɉ7
6WHS VHFRQGV
3
Parameter
DISPLAY
MNEMONIC
MENU
Range of
DGMXVWPHQW
Factory
setting
COMMENTS
DOMESTIC WATER
PRODUCTION
SURGXFWLRQGLVDEOHG
SURGXFWLRQDFWLYDWHGYLD
free contact
SURGXFWLRQDFWLYDWHGYLD
domestic water tank sensor
dhU
Service
0,1,2
1
$17,/(*,21(//$&<&/(
FUNCTION MODE
,QWHUQDOXQLWKHDWSXPS
+ electrical heater elements
HOHFWULFDOKHDWHU
elements in domestic water
tank
LdA
Service
0,1
0
ANTI-LEGIONELLA
)81&7,21)5(48(1&<
/GL IXQFWLRQGLVDEOHG
,IOGD DQG/GL!WKH
function is enabled with the
electrical heater element in
the domestic water tank
Ldi
Service
0 - 30 days
0
$17,/(*,21(//$&<&/(
ACTIVATION TIME
Lds
Service
00,0 - 23,5
2,00
$17,/(*,21(//$&<&/(
TEMPERATURE
Ldt
Service
50°C - 80°C
65°C
$17,/(*,21(//$&<&/(
DURATION
Ldd
Service
0 - 240
minutes
30
PUMP FORCED
ACTIVATION
SXPSIRUFLQJQRW
activated
SXPSIRUFLQJDFWLYDWHG
FPA
Service
0,1
0
Function active solely
with system in stand-by
INTERNAL UNIT
ELECTRICAL HEATER
ELEMENTS ACTIVATION
'(/$<
EhP
Service
0 - 60
minutes
15
Delay between starting
the heat pump and
checking the conditions
for activating stage 1
of the electrical heater
element. If enabled,
the second stage
is activated with a
15-minute delay after
WKH¿UVW¿[HGWLPH
PUMP ACTIVATION
)5(48(1&<:+(16(7
POINT IS REACHED
cPP
Service
0-20 minutes
0
When the set-point is
UHDFKHGFRPSUHVVRU
RII
F33 SXPSVWD\VRQ
cPP>0 pump switches
off for cPP minutes,
then switches on
IRURQHPLQXWHWKLV
sampling is performed
in a cycle to verify the
temperature of the
water in the circuit
DOMESTIC WATER
7$1.7(03(5$785(
+<67(5(6,67
hyS
Service
5°C - 25°C
10°C
To be used solely when
GK8 VHQVRUWLQ
GRPHVWLFZDWHUWDQN
,IGK8 VHWWKH
external thermostat
IUHHFRQWDFWWRD
temperature below
60°C
ENGLISH
'HFLPDOV WHQVRI
PLQXWHVHJ PLQXWHVXSWR minutes
55
3
ENGLISH
Parameter
DISPLAY
MNEMONIC
MENU
Range of
DGMXVWPHQW
Factory
setting
COMMENTS
COOLING CLIMATE
CURVE FOR MAXIMUM
WATER TEMPERATURE
Cc1
Service
-15 – +50°C
20°C
OUTSIDE AIR COOLING
CLIMATE CURVE FOR
MAXIMUM WATER
TEMPERATURE
Cc2
Service
/XF 4°C -20°C,
/XF 7°C -27°C
18°C
Factory settings for
fan coils and control of
systems with leaving
water temperature
/8F OUTSIDE AIR COOLING
CLIMATE CURVE FOR
MINIMUM WATER
TEMPERATURE
Cc3
Service
-15 – +50°C
40°C
COOLING CLIMATE
CURVE FOR MINIMUM
WATER TEMPERATURE
Cc4
Service
/XF 4°C -20°C,
/XF 7°C -27°C
15°C
OUTSIDE AIR HEATING
CLIMATE CURVE FOR
MAXIMUM WATER
TEMPERATURE
Hc1
Service
-15 – +50°C
-5°C
HEATING CLIMATE
CURVE FOR MAXIMUM
WATER TEMPERATURE
Hc2
Service
/XF 20-60°C,
/XF 20-55°C
35°C
OUTSIDE AIR HEATING
CLIMATE CURVE FOR
MINIMUM WATER
TEMPERATURE
Hc3
Service
-15 – +50°C
20°C
HEATING CLIMATE
CURVE FOR MINIMUM
WATER TEMPERATURE
Hc4
Service
/XF 20-60°C,
/XF 20-55°C
28°C
SERVICE MENU
PASSWORD
PAS
Service
rtF
Service
0 – 200
VWHS
0
)$&725<86('2
12702',)<
Adr
Service
1 – 255
1
RS485 communication
port address to be used
with any remote control
SHULSKHUDO3&RUWKH
OLNH
PERIPHERAL ADDRESS
56
&F•&F&F•&F
Factory settings for
fan coils and control of
systems with leaving
water temperature
/8F +F•+F+F•+F
Value held by Olimpia
Splendid Service
3
3.6
DEACTIVATION AND SHUTDOWN FOR PROLONGED PERIODS ¿J
To deactivate the heat pump proceed as follows:
‡ 3UHVV.H\,RQWKHFRQWUROSDQHOXQWLO6W\6WDQGE\DSSHDUVRQWKHGLVSOD\
‡ &XWSRZHUWRWKHH[WHUQDOXQLW
This way the circulation pump anti-locking function remains active.
If the heat pump is not used for a prolonged period of time, the following operations should be carried out:
‡ 3UHVV.H\,RQWKHXVHULQWHUIDFHXQWLO6W\6WDQGE\DSSHDUVRQWKHGLVSOD\
‡ &XWSRZHUWRWKHLQWHUQDOXQLWXVLQJWKHVZLWFK¿JUHI&RQWKHFRQWUROSDQHO
‡ &XWSRZHUWRWKHLQWHUQDODQGH[WHUQDOXQLWVXVLQJWKHPDVWHUVZLWFKHV
Cutting power also to the internal unit deactivates the circulation pump anti-locking function and the pump may need to be released
¿J
To restart the air-water heat pump after a long period of heat pump inactivity, contact a Service Technician.
CLEANING
The only cleaning required of the system supervisor is to clean the outer panels of the air-water heat pump using a cloth dampened
with soap and water.
6WXEERUQVWDLQVFDQEHFOHDQHGXVLQJDFORWKZLWKDPL[WXUHRIZDWHUDQGGHQDWXUHGDOFRKRORUZLWKVSHFL¿FSURGXFWV
Dry the surfaces carefully after cleaning.
'RQRWXVHDEUDVLYHRUSRZGHUFOHDQLQJSURGXFWV$Q\FOHDQLQJLVSURKLELWHGXQWLOWKHDSSOLDQFHKDVEHHQFXWRIIIURP
WKHSRZHUPDLQVE\VHWWLQJWKHPDVWHUVZLWFKHVRIWKHLQWHUQDODQGH[WHUQDOXQLWVWR2))
3.8
SCHEDULED MAINTENANCE
Scheduled maintenance is essential for keeping the heat pump in perfect working condition, safe and reliable over time. This can
be done, every six months for some interventions and annually for others, by the Service Technician, who is technically authorised
and trained, and will use original spare parts.
The maintenance plan that the OLIMPIA SPLENDID service technician or the maintenance engineer must adhere to, on an
annual basis, includes the following operations and checks:
‡ &KHFNRIWKHH[SDQVLRQWDQNSUHVVXUH
‡ )LOOLQJWKHZDWHUFLUFXLW
‡ $LUSUHVHQFHLQZDWHUFLUFXLW
‡ (I¿FLHQF\RIVDIHW\XQLWV
‡ 3RZHUVXSSO\YROWDJH
‡ (OHFWULFDODEVRUSWLRQ
‡ 7LJKWQHVVRIHOHFWULFDOFRQQHFWLRQV
‡ &OHDQLQJWKHIDQJULOOVDQGH[WHUQDOXQLWEDWWHU\¿QV
‡ &KHFNIRUGLUWRQWKHPHWDOOLFPHVK¿OWHU
3.9
ALARMS
3.9.1
Alarms on internal unit display
Table 6 shows the alarms or overrides that can appear on the control panel display.
2YHUULGHV'2127UHSUHVHQWV\VWHPPDOIXQFWLRQVWKH\VLJQDOSDUWLFXODUWHPSRUDU\RSHUDWLQJFRQGLWLRQV2YHUULGHV
'2127UHTXLUHWKHLQWHUYHQWLRQRIWHFKQLFDOVXSSRUW
When an alarm activates, the mnemonic symbol appears on the display, LED 5
contact between terminals 16 and 17 is closed.
switches on simultaneously and the alarm
Override/Alarm Code
Mnemonic on display
Override #1
Or1
Entering water temperature below 10°C
Override/Alarm Description
Override #2
Or2
Exchanger frost-protection
Override #3
Or3
Heat source activation request active
Override #4
Or4
7$FRQWDFWRSHQWHUPLQDORQWKHHOHFWURQLFERDUG
Override #5
Or5
External unit capacity limitation
Override #6
Or6
Defrost cycle in progress
Allarme #1
A1
Outlet water sensor faulty
Allarme #2
A2
Inlet water sensor faulty
Allarme #3
A3
Domestic water tank sensor faulty
57
ENGLISH
3.7
3
Allarme #4
A4
Outside air sensor faulty
Allarme #5
A5
Plate exchanger frost-protection
Allarme #6
A6
Flow switch alarm
Allarme #7
A7
Communication error with external unit
Allarme #8
A8
Anti-legionella cycle not performed
Allarme #9
A9
RS485 serial port communication error
Allarme #10
A10
2YHUFXUUHQWSURWHFWLRQH[WHUQDOXQLWDODUP
Allarme #11
A11
3RZHUYROWDJHSURWHFWLRQH[WHUQDOXQLWDODUP
Allarme #12
A12
:URQJH[WHUQDOXQLWSKDVHVVHTXHQFHH[WHUQDOXQLWDODUP
Allarme #13
A13
([WHUQDOXQLWVHQVRUVIDXOW\H[WHUQDOXQLWDODUP
** Check alarm type on external unit board sect. 3.9.2
When an alarm activates, check the cause in table 6 and remove the fault or call technical support.
ENGLISH
7RUHPRYHDODUPV$WR$SUHVV.H\ for ten seconds or call technical support.
7KHFRQWUROFDQDOVRDFWLYDWHWZRSXPSPDLQWHQDQFHDQGZDWHU¿OWHUDODUPV3DUDPHWHU3ɉGVHWVWKHQXPEHURIUXQQLQJGD\V
EHIRUHWKHDFWLYDWLRQRIWKHSXPSDODUPDQGSDUDPHWHU8)ɉVHWVWKHQXPEHURIUXQQLQJGD\VEHIRUHWKHDFWLYDWLRQRIWKH¿OWHU
alarm.
$ODUPVFDQEHDFWLYDWHGE\VHWWLQJWKHUHODWLYHSDUDPHWHUIURPWRGD\VLI WKHFRXQWHULVQRWDFWLYDWHG
:KHQWKHDODUPDFWLYDWHVDQGWKHPDFKLQHKDVUXQIRUWKHVHWQXPEHURIGD\VWKHGLVSOD\VKRZV)L/IRU¿OWHUDQG3ɉ3IRUSXPS
switches on.
the parameter is set and the LED
for ten seconds until the alarm clears.
7RGHDFWLYDWHWKH)L/DODUPIRUWKH¿OWHUDQG3ɉ3IRUWKHSXPSSUHVV.(<
$ODUPVRQH[WHUQDOXQLWGLVSOD\
The external unit control board has a two-digit display that shows any active alarms.
The table below shows the external unit alarms.
Error code
58
Alarm Description
E0
EEPROM malfunction
E2
Communication error between external unit and internal unit
E3
External board communication error
E4
External unit temperature sensor faulty
E5
Compressor power voltage protection
E6
3)&PRGXOHSURWHFWLRQRQO\IRU..ZLWKSKDVH
P0
Compressor head temperature protection
P1
High pressure protection
P2
Low pressure protection
P3
Compressor overcurrent protection
P4
&RPSUHVVRUÀRZWHPSHUDWXUHSURWHFWLRQ
P5
Condensation high temperature protection
P6
Module protection
FRANÇAIS
1
GENERALITES
61
1.1
INFORMATIONS GENERALES
61
1.2
6<0%2/(6
62
1.2.1
Pictogrammes rédactionnels
62
1.2.2
Pictogrammes relatifs à la sécurité
62
1.3
AVERTISSEMENTS
62
1.4
REGLES FONDAMENTALES DE SÉCURITÉ
63
1.5
RECEPTION ET DEBALLAGE
63
1.6
UNITÉ EXTERNE
64
1.7
UNITÉ INTERNE
64
1.8
LISTE DES COMPOSANTS PRINCIPAUX UNITE INTERNE
64
1.9
LISTE COMPOSANTS FOURNIS ET DESCRIPTION DES PARTIES
64
2
INSTALLATION
65
2.1
INSTALLATION DE L’UNITÉ INTERNE
65
2.1.1
Ouverture des panneaux
65
2.1.2
Accès aux composants internes
65
2.2
INSTALLATION DE L’UNITÉ EXTERNE
65
2.3
LIMITES DE FONCTIONNEMENT
66
2.4
BRANCHEMENTS FRIGORIFIQUES
66
2.4.1
Tests et contrôles
67
2.4.2
Chargement du réfrigérant supplémentaire
67
2.5
%5$1&+(0(176+<'5$8/,48(6
67
2.5.1
Circuit hydraulique
68
2.6
VALEURS DE RÉFÉRENCE EAU CIRCUIT
69
2.7
5(03/,66$*(&,5&8,7+<'5$8/,48(
69
2.8
DEBLOCAGE POMPE CIRCULATION
69
2.9
BRANCHEMENTS ÉLECTRIQUES
69
2.9.1
Accès aux connexions électriques
70
2.9.2
Câbles de branchement
70
2.9.3
Connexions électriques
70
2.10
CONTRÔLES DE INSTALLATION
71
2.10.1
Préparation de la première mise en service
71
2.10.2
Contrôles pendant et après la première mise en service
71
3
EMPLOI ET MAINTENANCE
72
3.1
PANNEAU DE COMMANDE DE L’UNITE INTERNE
72
3.1.1
Description pupitre de contrôle
72
3.2
ACTIVATION ET FONCTIONS UTILISATEUR
72
3.2.1
Activation
72
3.2.2
Menu températures/set
72
3.2.3
Menu utilisateur
73
3.3
CONFIGURATION DES PARAMÈTRES MENU UTILISATEUR
73
3.4
ACTIVATION ET FONCTIONS SERVICE
75
3.5
CONFIGURATION DES PARAMÈTRES MENU SERVICE
77
3.6
DESACTIVATION ET EXTINCTION POUR PERIODES PROLONGEES
81
3.7
1(772<$*(
81
3.8
MAINTENANCE PERIODIQUE
81
3.9
ALARMES
81
3.9.1
$ODUPHVGLVSRVLWLIG¶DI¿FKDJHXQLWpLQWHUQH
81
3.9.2
$ODUPHVGLVSRVLWLIG¶DI¿FKDJHXQLWpH[WHUQH
82
60
1
1
INFORMATIONS GENERALES
Nous souhaitons tout d'abord vous remercier d'avoir accordé votre préférence à une pompe à chaleur air-eau de notre marque.
Comme vous pourrez le constater, vous avez effectué un choix gagnant en achetant un produit qui représente ce qu’il y a de
plus avancé dans la technologie de la climatisation domestique.
&HPDQXHODpWpFRQoXD¿QGHYRXVIRXUQLUWRXWHVOHVH[SOLFDWLRQVTXLYRXVSHUPHWWURQWGHJpUHUDXPLHX[YRWUHV\VWqPHGH
climatisation.
Nous vous invitons donc à le lire attentivement avant de mettre votre appareil en marche.
(QDSSOLTXDQWOHVVXJJHVWLRQV¿JXUDQWGDQVOHSUpVHQWPDQXHOYRXVSRXUUH]JUkFHjODSRPSHjFKDOHXUDLUHDXTXHYRXV
avez achetée, obtenir sans problèmes des conditions ambiantes optimales avec un investissement réduit en termes d'énergie.
ATTENTION
Le manuel est divisé en 3 sections ou chapitres:
CHAP. 1 GENERALITES
,OV¶DGUHVVHjO¶LQVWDOODWHXUTXDOL¿pHWjO¶XWLOLVDWHXU¿QDO
Ce manuel contient des informations, des données techniques et des avertissements importants qui doivent être connus avant
d'installer et d'utiliser la pompe à chaleur air-eau.
CAP. 2 INSTALLATION
Il s'adresse uniquement et exclusivement à un installateur spécialisé.
Il contient toutes les informations nécessaires à la mise en place et au montage de la pompe à chaleur air-eau au lieu où elle
doit être installée.
L’installation de la pompe à chaleur air-eau par du personnel non spécialisé entraîne la nullité de la garantie.
CAP. 3 EMPLOI ET MAINTENANCE
Le manuel contient des informations utiles pour comprendre l'utilisation et la programmation de la pompe à chaleur air-eau et
les interventions d'entretien les plus communes.
Document réservé aux termes de la loi avec interdiction de reproduction ou de transmission à tiers sans l’autorisation expresse
de la société OLIMPIA SPLENDID.
Les machines peuvent subir des mises à jour et par conséquent présenter des éléments différents de ceux qui sont représentés,
sans que cela constitue pour autant un préjudice pour les textes contenus dans ce manuel.
/LUHDWWHQWLYHPHQWOHSUpVHQWPDQXHODYDQWGHSURFpGHUjWRXWHRSpUDWLRQLQVWDOODWLRQHQWUHWLHQXWLOLVDWLRQHWVXLYUHVFUXSXOHXVHPHQW
ce qui est décrit dans chacun des chapitres.
LE FABRICANT DECLINE TOUTE RESPONSABILITE EN CAS DE DOMMAGES AUX PERSONNES OU AUX BIENS DERIVANT
DU NON-RESPECT DES NORMES CONTENUES DANS LE PRESENT LIVRET.
/HIDEULFDQWVHUpVHUYHOHGURLWG¶DSSRUWHUjWRXWPRPHQWGHVPRGL¿FDWLRQVjFHVPRGqOHVWRXWHQFRQVHUYDQWOHVFDUDFWpULVWLTXHV
essentielles décrites dans le présent manuel.
L’installation et l’entretien d’appareils pour la climatisation comme celui qui est décrit dans ce manuel pourraient être dangereux
étant donné qu’il se trouve à l’intérieur de ces appareils un gaz frigorigène sous pression ainsi que des composants électriques
sous tension.
Par conséquent l’installation, la mise en service et la maintenance doivent être effectuées exclusivement par du personnel autorisé
HWTXDOL¿pYRLUIRUPXODLUHGHGHPDQGHGHPLVHHQVHUYLFHMRLQWjO¶DSSDUHLO
Cette unité est conforme aux directives européennes:
‡ %DVVHWHQVLRQ&(
‡ &RPSDWLELOLWppOHFWURPDJQpWLTXH&(
‡ 5HVWULFWLRQGHO
XWLOLVDWLRQGHSURGXLWVGDQJHUHX[GDQVOHVDSSDUHLOVpOHFWULTXHVHWpOHFWURQLTXHV&(5+26
‡ 'pFKHWVG¶DSSDUHLOVpOHFWULTXHVHWpOHFWURQLTXHV&(5$((WHOOHTXHPRGL¿pH
Les installations effectuées en dehors des instructions fournies par le présent manuel et l'utilisation en dehors des limites de
température prescrites annulent la garantie.
L’entretien ordinaire et le nettoyage général peuvent être effectués au besoin par l'utilisateur, car il ne prévoit pas d'opérations
GLI¿FLOHVRXGDQJHUHXVHV
/RUVGXPRQWDJHHWjFKDTXHRSpUDWLRQG¶HQWUHWLHQLOIDXWREVHUYHUOHVSUpFDXWLRQVFLWpHVGDQVOHSUpVHQWPDQXHOHW
VXUOHVpWLTXHWWHVPLVHVjO¶LQWpULHXUGHVDSSDUHLOVDLQVLTX¶DGRSWHUWRXWHOHVSUpFDXWLRQVVXJJpUpHVSDUOHERQVHQV
FRPPXQHWSDUOHV1RUPHVGH6pFXULWpHQYLJXHXUVXUOHOLHXGHO¶LQVWDOODWLRQ
,OIDXWWRXMRXUVPHWWUHGHVJDQWVHWFKDXVVHUGHVOXQHWWHVGHSURWHFWLRQSRXUHIIHFWXHUOHVLQWHUYHQWLRQVVXUOHF{Wp
UpIULJpUDQWGHVDSSDUHLOV
/HVFOLPDWLVHXUV1('2,9(173$6rWUHLQVWDOOpVGDQVGHVSLqFHVRLO\DSUpVHQFHGHJD]LQÀDPPDEOHVJD]H[SORVLIV
GDQV GHV HQGURLWV WUqV KXPLGHV EXDQGHULHV VHUUHV HWF RX GDQV GHV ORFDX[ R VH WURXYHQW G¶DXWUHV PDFKLQHV
SURGXLVDQWXQHLPSRUWDQWHVRXUFHGHFKDOHXU
(QFDVGHUHPSODFHPHQWGHFRPSRVDQWVXWLOLVHUH[FOXVLYHPHQWGHVSLqFHVGHUHFKDQJHRULJLQDOHV2/,03,$63/(1','
61
FRANÇAIS
1.1
GENERALITES
1
IMPORTANT!
3RXUSUpYHQLUWRXWULVTXHG
pOHFWURFXWLRQLOHVWLQGLVSHQVDEOHGHGpVDFWLYHUO
LQWHUUXSWHXUJpQpUDODYDQWG
HIIHFWXHUGHV
EUDQFKHPHQWVpOHFWULTXHVRXGHVRSpUDWLRQVG
HQWUHWLHQVXUOHVDSSDUHLOV
&RPPXQLTXHUFHVLQVWUXFWLRQVjWRXWOHSHUVRQQHOFRQFHUQpSDUOHWUDQVSRUWHWO¶LQVWDOODWLRQGHODPDFKLQH
ELIMINATION
Ce symbole apposé sur le produit ou son emballage indique que ce produit ne doit pas être jeté au titre des ordures ménagères
normales, mais doit être remis à un centre de collecte pour le recyclage des appareils électriques et électroniques.
En contribuant à une élimination correcte de ce produit, vous protéger l'environnement et la santé d'autrui. L'environnement et
la santé sont mis en danger par une élimination incorrecte du produit.
Pour toutes informations complémentaires concernant le recyclage de ce produit, adresser-vous à votre municipalité, votre service
des ordures ou au magasin où vous avez acheté le produit.
Cette consigne n'est valable que pour les états membres de l'UE.
1.2
SYMBOLES
Les pictogrammes reportés au chapitre suivant permettent de fournir rapidement et de manière univoque les informations
nécessaires pour une utilisation correcte de la machine dans des conditions de sécurité.
3LFWRJUDPPHVUpGDFWLRQQHOV
Service
‡ ,QGLTXHGHVVLWXDWLRQVRLOIDXWLQIRUPHUOH6(59,&(LQWHUQHGHODVRFLpWp
SERVICE ASSISTANCE TECHNIQUE CLIENTS.
Table des matières
‡ /HVSDUDJUDSKHVSUpFpGpVSDUFHV\PEROHFRQWLHQQHQWGHVLQIRUPDWLRQVHWGHVSUHVFULSWLRQVWUqVLPSRUWDQWHVQRWDPPHQW
pour ce qui concerne la sécurité.
Le non-respect peut comporter :
‡ GDQJHUSRXUODVpFXULWpGHVRSpUDWHXUV
‡ SHUWHGHODJDUDQWLHGXFRQWUDW
‡ GpJDJHPHQWGHODUHVSRQVDELOLWpGXIDEULFDQW
0DLQOHYpH
‡ ,QGLTXHOHVDFWLRQVTX¶LOQHIDXWDEVROXPHQWSDVDFFRPSOLU
3LFWRJUDPPHVUHODWLIVjODVpFXULWp
FRANÇAIS
7HQVLRQpOHFWULTXHGDQJHUHXVH
‡ 6LJQDOHDXSHUVRQQHOFRQFHUQpTXHO¶RSpUDWLRQGpFULWHSUpVHQWHVLHOOHQ¶HVWSDVHIIHFWXpHFRQIRUPpPHQWDX[QRUPHVGH
sécurité, le risque d’électrocution.
'DQJHUJpQpUDO
‡ 6LJQDOHDXSHUVRQQHOFRQFHUQpTXHO¶RSpUDWLRQGpFULWHSUpVHQWHVLHOOHQ¶HVWSDVHIIHFWXpHFRQIRUPpPHQWDX[QRUPHVGH
sécurité, le risque de provoquer des dommages physiques.
'DQJHUGHWHPSpUDWXUHpOHYpH
‡ 6LJQDOHTXHO¶RSpUDWLRQGpFULWHSUpVHQWHVLHOOHQ
HVWSDVHIIHFWXpHGDQVOHUHVSHFWGHVQRUPHVGHVpFXULWpOHULVTXHGHVXELU
des brûlures par contact avec des composants à température élevée.
1.3
62
AVERTISSEMENTS
‡
/¶LQVWDOODWLRQ GRLW rWUH HIIHFWXpH SDU OH FRQFHVVLRQQDLUH RX DXWUH SHUVRQQHO TXDOL¿p VL O
LQVWDOODWLRQ Q
HVW SDV HIIHFWXpH
correctement, il peut y avoir un risque de fuite d'eau, d'électrocution ou d'incendie.
‡
,QVWDOOHUODSRPSHjFKDOHXUDLUHDXHQVHFRQIRUPDQWDX[LQVWUXFWLRQV¿JXUDQWGDQVOHSUpVHQWPDQXHOVLO
LQVWDOODWLRQQ
HVW
pas effectuée correctement, il peut y avoir un risque de fuite d'eau, d'électrocution ou d'incendie.
‡
,O HVW FRQVHLOOp G
XWLOLVHU H[FOXVLYHPHQW OHV FRPSRVDQWV VSpFL¿TXHPHQW GHVWLQpV j O
LQVWDOODWLRQ IRXUQLH O
XWLOLVDWLRQ GH
composants autres que les composants en question pourrait être à l'origine de fuite d'eau, d'électrocution ou d'incendie.
‡
8QHIRLVO
LQVWDOODWLRQWHUPLQpHV
DVVXUHUGHO
DEVHQFHGHSHUWHGHOLTXLGHUpIULJpUDQWOHOLTXLGHUpIULJpUDQWV
LOHVWH[SRVpj
ÀDPPHSURGXLWXQJD]WR[LTXH
‡
$XPRPHQWGHO
LQVWDOODWLRQRXGXGpSODFHPHQWGHO
LQVWDOODWLRQV
DVVXUHUTX
LOQHSpQqWUHULHQG
DXWUHFRPPHGHO
DLUSDU
H[HPSOHGDQVOHFLUFXLWGXSURGXLWUpIULJpUDQWTXHOHOLTXLGHUpIULJpUDQWVSpFL¿p5$ODSUpVHQFHG
DLURXDXWUHVSURGXLWV
étrangers dans le circuit du liquide réfrigérant pourrait provoquer une augmentation anormale de la pression ou la rupture
GXFLUFXLWFHTXLSRXUUDLWHQWUDvQHUGHVGRPPDJHVSRXUOHVSHUVRQQHV
1
/¶LQVWDOODWLRQGHVDSSDUHLOVOLIMPIA SPLENDIDGRLWrWUHHIIHFWXpHSDUXQHHQWUHSULVHKDELOLWpHTXLjOD¿QGHVWUDYDX[GHYUD
délivrer au responsable du circuit une déclaration de conformité selon les Dispositions en vigueur et les indications fournies
par OLIMPIA SPLENDID dans le présent manuel. L’installation des appareils OLIMPIA SPLENDID doit être effectuée par
XQHHQWUHSULVHKDELOLWpHTXLHQ¿QGHWUDYDLOGRLWUHPHWWUHDXUHVSRQVDEOHGHO
pTXLSHPHQWXQHGpFODUDWLRQGHFRQIRUPLWp
selon les normes en vigueur et les indications fournies par OLIMPIA SPLENDID dans le présent manuel.
‡
(QFDVGHIXLWHVG¶HDXpWHLQGUHO¶XQLWpHWLQWHUURPSUHOHVDOLPHQWDWLRQVGHO¶XQLWpLQWHUQHHWH[WHUQHDXPR\HQGHVLQWHUUXSWHXUV
généraux.
Appeler dans les meilleurs délais le Service technique d'assistance OLIMPIA SPLENDID, ou bien du personnel
SURIHVVLRQQHOOHPHQWTXDOL¿pHWQHSDVLQWHUYHQLUSHUVRQQHOOHPHQWVXUO
DSSDUHLO
‡
6LXQHFKDXGLqUHHVWSUpVHQWHGDQVO
LQVWDOODWLRQV
DVVXUHUSHQGDQWVRQIRQFWLRQQHPHQWTXHODWHPSpUDWXUHGHO
HDXFLUFXODQW
à l'intérieur de la pompe à chaleur air-eau ne dépasse pas 65°C
‡
/HSUpVHQWPDQXHOG
XWLOLVDWLRQIDLWSDUWLHLQWpJUDQWHGHO
DSSDUHLOHVWGRLWSDUFRQVpTXHQWrWUHFRQVHUYpDYHFVRLQHWTOUJOURS
accompagner l’appareil même en cas de cession de ce dernier à un autre propriétaire ou utilisateur ou bien de transfert sur
une autre installation. En cas de détérioration ou de perte du manuel, il convient d'en demander un autre exemplaire au
Service technique d'assistance OLIMPIA SPLENDID de secteur.
‡
6
DVVXUHUTXHODPLVHjODWHUUHHVWELHQUpDOLVpHQHSDVPHWWUHO
DSSDUHLOjODPDVVHVXUGHVWXEHVGHGLVWULEXWLRQGHV
déchargeurs pour surtensions ou sur la terre de l'installation téléphonique. S'il n'est pas effectué correctement, le branchement
jODWHUUHSHXWrWUHjO
RULJLQHG
pOHFWURFXWLRQVOHVVXULQWHQVLWpVPRPHQWDQpHVSURYRTXpHVSDUODIRXGUHRXSDUG
DXWUHV
causes pourraient endommager la pompe de chaleur air eau.
‡
,OHVWFRQVHLOOpG
LQVWDOOHUXQLQWHUUXSWHXUGHGLVSHUVLRQjPDVVHODQRQLQVWDOODWLRQGHFHGLVSRVLWLISRXUUDLWrWUHjO
RULJLQH
d'électrocutions.
REGLES FONDAMENTALES DE SÉCURITÉ
Rappelons que l'utilisation de produits employant de l'énergie électrique et de l'eau nécessite le respect de quelques règles
fondamentales de sécurité, telles que :
/
XWLOLVDWLRQGHO
DSSDUHLOSDUGHVHQIDQWVHWGHVSHUVRQQHVKDQGLFDSpHVQRQDVVLVWpHVHVWLQWHUGLWH
,OHVWGpIHQGXGHWRXFKHUO
DSSDUHLOSLHGVQXVRXVLGHVSDUWLHVGXFRUSVVRQWPRXLOOpHVRXKXPLGHV
7RXWHRSpUDWLRQGHQHWWR\DJHHVWGpIHQGXHDYDQWG
DYRLUGpEUDQFKpO
DSSDUHLOGXUpVHDXG
DOLPHQWDWLRQpOHFWULTXHHQ
DPHQDQWO
LQWHUUXSWHXUJpQpUDOGHO
DSSDUHLOVXU³pWHLQW´
,OHVWGpIHQGXGHPRGL¿HUOHVGLVSRVLWLIVGHVpFXULWpRXGHUpJODJHVDQVO
DXWRULVDWLRQHWOHVLQGLFDWLRQVGXFRQVWUXFWHXU
de l'appareil.
,OHVWGpIHQGXGHWLUHUGpWDFKHUWRUGUHOHVFkEOHVpOHFWULTXHVVRUWDQWGHO
DSSDUHLOPrPHVLFHGHUQLHUHVWGpEUDQFKp
GXUpVHDXG
DOLPHQWDWLRQpOHFWULTXH
,OHVWGpIHQGXG
LQWURGXLUHGHVREMHWVRXGHVSURGXLWVjWUDYHUVOHVJULOOHVG
DVSLUDWLRQHWGHUHIRXOHPHQWG
DLU
,OHVWGpIHQGXG
RXYULUOHVSRUWLOORQVG
DFFqVDX[SDUWLHVLQWHUQHVGHO
DSSDUHLOVDQVDYRLUDXSUpDODEOHDPHQpO
LQWHUUXSWHXU
JpQpUDOGHO
DSSDUHLOVXU³pWHLQW´
,OHVWGpIHQGXGHMHWHUGDQVODQDWXUHRXGHODLVVHUjODSRUWpHGHVHQIDQWVOHPDWpULDXG
HPEDOODJHFDULOSHXWrWUHXQH
source potentielle de danger.
1HSDVpPHWWUHGH5$GDQVO
DWPRVSKqUHOH5$HVWXQJD]jHIIHWGHVHUUHÀXRUpFLWpGDQVOH3URWRFROHGH
.\RWRDYHFXQ3RXYRLUGH5pFKDXIIHPHQW*OREDO*:3pJDOj
1.5
RECEPTION ET DEBALLAGE
/¶HPEDOODJHHVWFRQVWLWXpGHPDWpULDX[DSSURSULpVHWLOHVWHIIHFWXpSDUGXSHUVRQQHOTXDOL¿p/HVXQLWpVVRQWOLYUpHVFRPSOqWHVHW
en parfait état, toutefois, pour le contrôle de la qualité des services de transport, il faut se conformer aux avertissements suivants :
‡ jODUpFHSWLRQGHVHPEDOODJHVYpUL¿HUVLOHFDUWRQHVWHQGRPPDJpVLF¶HVWOHFDVUHWLUHUODPDUFKDQGLVHVRXVUpVHUYHHQ
produisant des preuves photographiques des éventuels dégâts apparents.
‡ GpEDOOHUHQYpUL¿DQWODSUpVHQFHGHFKDFXQGHVFRPSRVDQWVDYHFOHVOLVWHVG¶HPEDOODJH
‡ V¶DVVXUHU TX¶DXFXQ FRPSRVDQW Q¶D VXEL GH GRPPDJHV SHQGDQW OH WUDQVSRUW GDQV OH FDV FRQWUDLUH QRWL¿HU OHV pYHQWXHOV
dommages au transporteur dans le délai de 3 jours à partir de la réception par lettre recommandée avec accusé de réception
en présentant la documentation photographique.
Envoyer aussi par fax cette même information à OLIMPIA SPLENDID.
Aucune information concernant les dommages subis ne pourra être prise en compte passé un délai de 3 jours à compter de la
livraison. Pour tout litige, le Tribunal compétent sera celui de REGGIO EMILIA.
63
FRANÇAIS
1.4
‡
1
1.6
UNITÉ EXTERNE¿J
/¶XQLWpH[WHUQH¿JHVWGLVSRQLEOHHQVL[PRGqOHV
OS-CEBSH24EI
OS-CEBCH36EI
OS-CEBCH48EI
OS-CEBTH48EI
OS-CEBCH60EI
842
990
940
940
940
940
324
360
360
360
360
Largeur mm
Profondeur mm
Hauteur mm
695
695
1245
1245
1245
1245
Poids kg
61
82
106
99
106
104
1.7
UNITÉ INTERNE ¿J
/¶XQLWpLQWHUQH¿JHVWGLVSRQLEOHHQTXDWUHPRGqOHV
Largeur mm
3URIRQGHXUSDQQHDXGH
FRPPDQGHPP
FRANÇAIS
1.8
SMALL
SMALL 3W
BIG
BIG 3W
500
500
500
500
280 + 16
280 + 16
280 + 16
280 + 16
Hauteur mm
810
810
810
810
Poids kg
36
36,3
38
38,3
LISTE DES COMPOSANTS PRINCIPAUX UNITE INTERNE¿J
A
B
C
D
E
F
G
H
L
K
L
M
N
O
P
Q
R
1.9
OS-CEBTH60EI
Entrée eau
Valve de sécurité 3 bars
Échangeur à plaques
Flux-stat
Manomètre
Vase d’expansion
Collecteur résistances électriques
Évent air automatique
Pompe eau
9DOYHjWURLVYRLHVLQWpJUpHVXUPDFKLQHGDQVODYHUVLRQ:
Sortie eau circuit
6RUWLHHDXFKDXGHVDQLWDLUHSUpVHQWVHXOHPHQWGDQVODYHUVLRQ:
Ensemble cadre électrique
Panneau de commande
Thermostat de sécurité résistances électriques à réarmement manuel
Thermostat de sécurité résistances électriques à réarmement automatique
Interrupteur général
LISTE COMPOSANTS FOURNIS ET DESCRIPTION DES PARTIES
Les appareils sont expédiés avec un emballage standard constitué d’une enveloppe en carton et d’une série de protections en
polystyrène expansé.
Au-dessous de l'emballage de l'unité externe se trouve une petite palette qui facilite les opérations de transport et de manutention,
tandis que l'emballage de l'unité interne est doté de poignées en vue d'en faciliter la manutention.
On trouve avec l’unité interne, à l’intérieur de l’emballage, les éléments suivants :
‡ pWULHUPXUDOSRXUOD¿[DWLRQGHO¶DSSDUHLO
‡ JDEDULWSRXUO¶LQVWDOODWLRQPXUDOH
‡ ¿OWUHjFULEOHHQ<DYHFSULVHV))´PDLOOHPP
‡ WURLVYDOYHVjELOOH´VHXOHPHQWSRXUPRGqOHV:
‡ JDEDULWSRXUOHSRVLWLRQQHPHQWGHO¶XQLWpPXUDOH
64
2
2
INSTALLATION
Pour obtenir une bonne installation et des performances de fonctionnement optimales, suivre attentivement les indications du
présent manuel. Le non respect des dispositions indiquées, qui peut entraîner un mauvais fonctionnement des appareils, dégage
la société OLIMPIA SPLENDID de toute forme de garantie et de toute responsabilité concernant les dommages causés à des
personnes, des animaux ou des choses.
Il est important que l’équipement électrique soit effectué selon les dispositions en vigueur, respecte les données indiquées dans
le chapitre Caractéristiques techniques et soit doté d’une bonne mise à la terre.
L’appareil doit être installé dans une position permettant d’effectuer facilement la maintenance.
2.1
INSTALLATION DE L’UNITÉ INTERNE¿JXUHV
Prévoir :
‡ TXDWUHFKHYLOOHV0SRXUOD¿[DWLRQPXUDOHDSSURSULpHVDXW\SHGHVXSSRUW
‡ XQHVSDFHOLEUHODWpUDOHWVXSpULHXUG¶DXPLQLPXPFPVXI¿VDQWSRXUSHUPHWWUHO¶HQOqYHPHQWGHVFRXYHUWXUHVSRXUOHV
opérations de maintenance ordinaire et extraordinaire
‡ XQHpYDFXDWLRQG¶HDXjSUR[LPLWp
‡ XQHDOLPHQWDWLRQpOHFWULTXHFRQIRUPHjSUR[LPLWpGHO¶XQLWpLQWHUQH
‡ XQHDOLPHQWDWLRQG¶HDXSRXUOHUHPSOLVVDJHGXFLUFXLWK\GUDXOLTXH
‡ FkEOHGHFRPPXQLFDWLRQHQWUHXQLWpLQWHUQHHWXQLWpH[WHUQHYRLUSDU
/¶XQLWpLQWHUQHGRLWrWUHWRXMRXUV¿[pHDXPXUjKDXWHXUG¶KRPPHjO¶LQWpULHXUGHO¶KDELWDWLRQ
3RXUOHVHVSDFHVG¶LQVWDOODWLRQHWODSRVLWLRQGHVWXEHVVHUHSRUWHUjOD¿JHWXWLOLVHUOHJDEDULWGHSRVLWLRQQHPHQWIRXUQLDYHF
l’unité.
2XYHUWXUHGHVSDQQHDX[¿J
2XYULUOHSRUWLOORQ¿JUpI$HQWLUDQWODSDUWLHVXSpULHXUHYHUVO¶H[WpULHXUOHSRUWLOORQV¶RXYUHYHUVOHEDV
'pYLVVHUODYLVGH¿[DWLRQGXSDQQHDXHQIDoDGH¿JUpI%
6RXOHYHUOHSDQQHDXHQIDoDGHHWOHWLUHUYHUVVRL¿JUpI&
$FFqVDX[FRPSRVDQWVLQWHUQHV¿JXUHV
3RXUDFFpGHUDX[FRPSRVDQWVLQWHUQHVGXFDGUHpOHFWULTXHHQOHYHUOHVGHX[YLV¿JUpI$TXL¿[HQWOHFRXYHUFOHGHFHGHUQLHU
sur le côté gauche.
3RXUDFFpGHUDX[FRPSRVDQWVVLWXpVGHUULqUHOHFDGUHpOHFWULTXHHQOHYHUOHVTXDWUHYLV¿JUpI$HWIDLUHWRXUQHUOHFDGUH
sur les charnières présentes sur le côté droit du cadre. Il est possible de décrocher le cadre électrique et de l’accrocher avec
OHVUDLQXUHVSUpVHQWHVVXUOHÀDQFGURLW¿JGHFHWWHIDoRQLOHVWSRVVLEOHG¶DFFpGHUjWRXVOHVFRPSRVDQWVjO¶LQWpULHXUGH
l’appareil et de procéder facilement à l’installation ou à la maintenance de l’appareil.
$O¶LQWpULHXUGXFDGUHpOHFWULTXHVRQWORJpVOHVFRPSRVDQWVVXLYDQWV¿J
A Entrée câbles
B Boîte à bornes d’alimentation unité interne
C Boîte à bornes connexions utilisations
D Serre-câbles
E Interrupteur magnétothermique résistances électriques
F Contacteur de sécurité pour résistances électriques
G Relais résistances
H Filtre EMC
I Carte électronique de contrôle
L Fusible 250V 5A T
2.2
INSTALLATION DE L’UNITÉ EXTERNE¿J
,QVWDOOHUO¶XQLWpH[WHUQHVXUXQHEDVHVROLGHHQPHVXUHG
HQVXSSRUWHUOHSRLGVO¶XQLWpH[WHUQHVLHOOHHVWLQVWDOOpHGHIDoRQ
incomplète ou sur une base non appropriée, pourrait provoquer, si elle devait se détacher de sa base, des dommages aux personnes.
,OHVWWUqVLPSRUWDQWTXHOHOLHXGHO¶LQVWDOODWLRQVRLWFKRLVLDYHFOHPD[LPXPGHVRLQD¿QG¶DVVXUHUXQHSURWHFWLRQDSSURSULpHGH
l’appareil contre les chocs éventuels et les dommages consécutifs suivants.
Choisir un lieu correctement aéré où, pendant la saison estivale, la température externe ne dépasse pas 46°C.
/DLVVHUDXWRXUGHO¶DSSDUHLOXQHVSDFHOLEUHVXI¿VDQWSURSUHjpYLWHUOHUHF\FODJHHWjIDFLOLWHUOHVRSpUDWLRQVGHPDLQWHQDQFH
Prévoir, sous l’appareil, une couche de gravier pour le drainage de l’eau de dégivrage.
/DLVVHUGHO¶HVSDFHDXGHVVRXVGHO¶XQLWpSRXUHPSrFKHUODFRQJpODWLRQGHO¶HDXGHGpJLYUDJHGDQVGHVVLWXDWLRQVQRUPDOHV
assurer une hauteur de la base d’au moins 5 cm, pour l’emploi dans les régions à hivers froids, assurer une hauteur d’au moins
15 cm par rapport aux pieds des deux côtés de l’unité. En cas d’installation dans des localités à fort enneigement, monter le
support de l’appareil à une hauteur supérieure au niveau maximum de la neige.
Installer l’unité de façon qu’elle ne soit pas traversée par le vent.
Prévoir :
‡ GHVEORFVDQWLYLEUDWLRQV
‡ XQHDOLPHQWDWLRQpOHFWULTXHFRQIRUPHjSUR[LPLWpGHO¶XQLWpH[WHUQH
65
FRANÇAIS
FRANÇAIS
2
$YHFO¶XQLWpH[WHUQHHVWIRXUQLXQWUHLOOLVGHFRXYHUWXUHGHODEDWWHULHG¶pFKDQJHWKHUPLTXHLOHVWSUpYXSRXUGHVLQVWDOODWLRQV
DFFHVVLEOHVDXSXEOLF/HPRQWDJHGXWUHLOOLVSRXUUDLWFDXVHUHQFDVG¶KXPLGLWppOHYpHjEDVVHWHPSpUDWXUHEURXLOODUG
RXGHQHLJHO¶DFFXPXODWLRQGHJODFHVXUODEDWWHULHDYHFUpGXFWLRQGHVSHUIRUPDQFHVGXV\VWqPH
/,0,7(6'()21&7,211(0(17¿J
/HVVFKpPDVGHOD¿JGp¿QLVVHQWOHVOLPLWHVGHWHPSpUDWXUHGHO¶HDX/:7HWGHO¶DLUH[WHUQH2'7RODSRPSHGHFKDOHXU
peut fonctionner dans les deux modalités de refroidissement et de chauffage/production eau sanitaire et refroidissement.
%5$1&+(0(176)5,*25,),48(6¿JXUHV
3RXUGp¿QLUOHVOLJQHVGHEUDQFKHPHQWIULJRUL¿TXHVHQWUHOHVXQLWpVLQWHUQHVHWH[WHUQHVVHUHSRUWHUDXWDEOHDXFLGHVVRXV
OSCEBSH24EI
OSCEBCH36EI
OSCEBCH48EI
OSCEBTH48EI
OSCEBCH60EI
OSCEBTH60EI
Longueur maximum des
WXEHVGHEUDQFKHPHQWP
25
30
50
50
50
50
Limite de différence
d’élévation entre les deux
unités si l’unité externe est
SODFpHSOXVKDXWP
12
20
25
30
25
30
Limite de différence
d’élévation entre les deux
unités si l’unité externe est
SODFpHSOXVEDVP
9
12
20
20
20
20
Charge supplémentaire
de réfrigérant par mètre
au-delà des 5 mètres de
WX\DXWHULHJP
60
60
60
60
60
60
8WLOLVHUH[FOXVLYHPHQWGHVWXEHVGHGLDPqWUHVUHÀpWDQWOHVGLPHQVLRQVUHTXLVHVWXEHOLJQHJD]´WXEHOLJQHOLTXLGH´
La longueur maximum des lignes de branchement à l’unité interne doit être conforme au tableau 1 en reconstituant la charge de
5$GHODIDoRQSUpYXHYRLUSDU1HSDVLQVWDOOHUOHVXQLWpVDXGHOjGXGpQLYHOOHPHQWPD[LPXPSHUPLVHQWUHO¶XQLWp
interne et celle externe.
&RPSOpWHUOHFLUFXLWIULJRUL¿TXHHQEUDQFKDQWO¶XQLWpLQWHUQHDYHFO¶XQLWpH[WHUQHDXPR\HQGHVWX\DXWHULHVHQFXLYUHLVROpHV
8WLOLVHUH[FOXVLYHPHQWGHVWX\DXWHULHVHQFXLYUHLVROpHVVSpFL¿TXHVSRXUODUpIULJpUDWLRQTXLVRQWIRXUQLHVSURSUHVHWVFHOOpHV
aux extrémités.
/HVFRQQH[LRQVIULJRUL¿TXHVGHO¶XQLWpLQWHUQHVRQWGHUULqUHOHFRIIUHWpOHFWULTXHFHOOHVGHO¶XQLWpH[WHUQHVXUOHF{WpGURLWHWSRXU
y accéder il faut enlever la protection.
A OLJQHJD]´XQLWpLQWHUQH
B OLJQHOLTXLGH´XQLWpLQWHUQH
C 9DOYHOLJQHJD]´XQLWpH[WHUQH
D 9DOYHOLJQHOLTXLGH´XQLWpH[WHUQH
,GHQWL¿HUOHSDUFRXUVGHVWX\DXWHULHVGHIDoRQjUpGXLUHOHSOXVSRVVLEOHODORQJXHXUHWOHVFRXUEHVGHVWXEHVSRXUREWHQLUOH
rendement maximum du circuit.
,QVpUHUOHVOLJQHVIULJRUL¿TXHVGDQVXQHJDLQHSDVVHFkEOHVVLSRVVLEOHDYHFVpSDUDWHXULQWHUQHGHGLPHQVLRQVDSSURSULpHV
¿[pHDXPXUSRXUIDLUHSDVVHUHQVXLWHOHVWX\DXWHULHVHWOHVFkEOHVpOHFWULTXHV
Couper les segments de tuyauterie en laissant environ 3-4 cm sur la longueur.
,03257$17HIIHFWXHUODFRXSHH[FOXVLYHPHQWDYHFOHGLVSRVLWLIGHFRXSHjURXOHWWHHQVHUUDQWjGHSHWLWVLQWHUYDOOHV
SRXUQHSDVpFUDVHUOHWXEH
‡
‡
‡
‡
‡
‡
‡
66
(QOHYHUOHVEDYXUHVpYHQWXHOOHVDYHFO¶RXWLOSUpYXjFHWHIIHW
(Q¿OHUGDQVOHWXEHDYDQWG¶HIIHFWXHUO¶DSSOLFDWLRQO¶pFURXGH¿[DWLRQ¿J$
(IIHFWXHUO¶DSSOLFDWLRQVXUOHVH[WUpPLWpVGHVWXEHVHQXWLOLVDQWO¶RXWLOSUpYXjFHWHIIHWGHIDoRQLPSHFFDEOHVDQVUXSWXUHV
RX¿VVXUHV¿J%
9LVVHUPDQXHOOHPHQWO¶pFURXGXWXEHVXUOH¿OHWDJHGHODSULVH
9LVVHUGp¿QLWLYHPHQWHQXWLOLVDQWXQHFOHI¿[HSRXUWHQLULPPRELOHODSDUWLH¿OHWpHGHODSULVHSRXUHQpYLWHUOHV
GpIRUPDWLRQVHWXQHFOHIG\QDPRPpWULTXHVXUO¶pFURX¿JFDOLEUpDYHFOHVYDOHXUVVXLYDQWHVVXUODEDVHGHV
dimensions des tubes :
'LDPqWUH¶¶1PFRXSOHGHVHUUDJH1P
'LDPqWUH¶¶1PFRXSOHGHVHUUDJH1P
2
7HVWVHWFRQWU{OHV¿JXUHV
8QHIRLVWHUPLQpVOHVEUDQFKHPHQWVGHVWXEHVLOIDXWHIIHFWXHUXQFRQWU{OHG¶pWDQFKpLWpSDUIDLWHGXFLUFXLWIULJRUL¿TXH
3RXUHIIHFWXHUOHVRSpUDWLRQVGpFULWHVFLDSUqVLOHVWQpFHVVDLUHG¶XWLOLVHUXQJURXSHPDQRPqWUHVSpFL¿TXHSRXU5$HWXQH
pompe à vide d’un débit minimum de 40 l/min :
1 'pYLVVHUOHERXFKRQGHIHUPHWXUHGXUDFFRUGGHVHUYLFHGHODOLJQHGXJD]¿JUpI&
2 %UDQFKHUODSRPSHjYLGHHWOHJURXSHPDQRPqWUHDXPR\HQGHVWXEHVÀH[LEOHVDYHFSULVH´DXUDFFRUGGHVHUYLFHGH
ODOLJQHGXJD]¿J
3 Allumer la pompe et ouvrir les robinets du groupe manomètre.
4 $EDLVVHUODSUHVVLRQMXVTX¶jN3DPP+JEDU
5 Continuer à maintenir la dépression pendant au moins 1 heure
6 Fermer les robinets du groupe manomètre et éteindre la pompe.
7 $SUqVPLQXWHVVHXOHPHQWVLODSUHVVLRQHVWUHVWpHjN3DPP+JEDUSDVVHUjO¶RSpUDWLRQGpFULWHDXSRLQW
6LODSUHVVLRQjO¶LQWpULHXUGXFLUFXLWHVWUHPRQWpHjXQHYDOHXUVXSpULHXUHjN3DPP+JEDULOHVWQpFHVVDLUH
GHSURFpGHUjODUHFKHUFKHGHODSHUWHDXPR\HQG¶XQHVROXWLRQVDYRQQHXVHDYHFFLUFXLWIULJRUL¿TXHVRXVSUHVVLRQG¶D]RWH
aEDUVDSUqVDYRLULGHQWL¿pHWUpSDUpODTXHOOHLOHVWQpFHVVDLUHHQVXLWHGHUHFRPPHQFHUGXSRLQW
8 Avec une clef hexagonale 4 mm ouvrir la tige de la valve du liquide jusqu’à l’ouvrir complètement.
9 Ouvrir complètement, au moyen d’une clef hexagonale 5 mm, la tige de la valve du gaz.
10 (QOHYHUOHWXEHÀH[LEOHGHFKDUJHEUDQFKpDXUDFFRUGGHVHUYLFHGXWXEHGXJD]
11 5HPHWWUHjVDSODFHOHERXFKRQGXUDFFRUGGHVHUYLFHGXWXEHGXJD]HWOH¿[HUDYHFXQHFOHIDQJODLVHRX¿[H
12 5HPHWWUHOHVERXFKRQVGHVWLJHVGHVYDOYHVGHVHUYLFHDXVVLELHQGXJD]TXHGXOLTXLGHHWOHV¿[HU
Figure 14 :
A Tige valve
B Couvercle tige valve
C 2UL¿FHGHFKDUJHPHQW
D Valve principale
Figure 15 :
A Groupe manomètre
B Vacuomètre éventuel
C Pompe à vide
D 5RELQHWGXWXEHÀH[LEOHRXYHUW
E 5DFFRUGGHVHUYLFHIHUPp
F Tube du gaz
G Tube du liquide
H Unité externe
&KDUJHPHQWGXUpIULJpUDQWVXSSOpPHQWDLUH¿JXUHV
Si la longueur des tuyauteries est supérieure à 5 m remettre à niveau le réfrigérant de la façon indiquée dans le tableau au par. 2.4
,QGLTXHUVXUO¶pWLTXHWWHIRXUQLH¿JDYHFO¶XQLWpH[WHUQHODFKDUJHGHO¶XQLWpH[WHUQH$ODTXDQWLWpGHUpIULJpUDQWDGGLWLRQQpH
%HWODFKDUJHWRWDOHGXV\VWqPH$%
Figure 17 :
A Groupe manomètre
B Vacuomètre éventuel
C Robinet du liquide de la bouteille
D Bouteille de gaz R410A
E 5DFFRUGGHVHUYLFHIHUPp
F Tube du gaz
G Tube du liquide
H Unité externe
2.5
BRANCHEMENTS HYDRAULIQUES ¿JXUHV
Le choix et l’installation des composants relève de la compétence de l’installateur qui devra opérer selon les règles de la bonne
technique et de la Législation en vigueur.
Avant de brancher les tuyauteries, s’assurer qu’elles ne contiennent pas de cailloux, de sable, rouille, de scories ou, en général,
de corps étrangers qui pourraient endommager le circuit.
Il convient de réaliser une dérivation dans le système pour pouvoir effectuer le lavage de l'échangeur à plaques sans devoir
débrancher l'appareil. Les tubes de raccordement doivent être supportés de façon à ne pas peser, par leur poids, sur l'appareil.
/HVSULVHVK\GUDXOLTXHVVRQWSODFpHVGDQVODSDUWLHLQIpULHXUHGHO¶XQLWp¿J
Les branchements hydrauliques doivent être complétés en installant :
‡ pYHQWVGDQVOHVSRLQWVOHVSOXVKDXWVGHVWXEHV
‡ MRLQWVpODVWLTXHVÀH[LEOHV
‡ YDOYHVG¶LQWHUFHSWLRQ
‡ ¿OWUHHDXjFULEOHDYHFPDLOOHVGHPP
‡ LVROHUWKHUPLTXHPHQWWRXVOHVFRPSRVDQWVHWOHVWX\DXWHULHVK\GUDXOLTXHV
67
FRANÇAIS
2
/HGLDPqWUHQRPLQDOPLQLPXPGHVWX\DXWHULHVK\GUDXOLTXHVGHEUDQFKHPHQWGRLWrWUHGH´
3RXUSHUPHWWUHOHVRSpUDWLRQVG
HQWUHWLHQRXGHUpSDUDWLRQLOHVWLQGLVSHQVDEOHTXHFKDTXHEUDQFKHPHQWK\GUDXOLTXH
VRLWGRWpGHVYDOYHVPDQXHOOHVGHIHUPHWXUHFRUUHVSRQGDQWHV
Le tableau ci-dessous montre les caractéristiques que doit avoir le circuit hydraulique.
Unité
OS-CEBSH24EI
OS-CEBCH36EI
OS-CEBCH48EI
U.I. SHERPA SMALL
Débit eau nominal*
Contenu eau
circuit
Pression de
service
Dénivellement
circuit
OS-CEBTH48EI
OS-CEBCH60EI
OS-CEBTH60EI
U.I. SHERPA BIG
l/s
0,31
0,52
0,62
0,62
0,69
0,79
l
l
23
400
38
400
45
400
45
400
51
400
58
400
Max
kPa
300
300
300
300
300
300
Max
m
20
20
20
20
20
20
Min
Max**
* pour installations au sol
** avec température maximum eau circuit 35°C
/HVJUDSKLTXHVGHOD¿JXUHPRQWUHQWODKDXWHXUG¶pYDOXDWLRQGLVSRQLEOHSRXUFKDTXHYLWHVVHGXFLUFXODWHXUK\GUDXOLTXHDX[
connexions hydrauliques de l’unité interne.
6¶DVVXUHUTXHOHVSHUWHVGHFKDUJHPHQWGXFLUFXLWJDUDQWLVVHQWOHGpELWG¶HDXGHPDQGpYRLUSDU
S’il devait être nécessaire de disposer de hauteurs d’élévation supérieures à cause de pertes de chargement du circuit élevées,
il faudra ajouter un vase inertiel ou bien un séparateur hydraulique et une pompe externe de renvoi.
&RQWU{OHUVLOHFLUFXLWDXQFRQWHQXG¶HDXPLQLPXPQpFHVVDLUHSRXUJDUDQWLUOHERQIRQFWLRQQHPHQWGXV\VWqPHV¶LOHVWLQVXI¿VDQW
ajouter un vase d’accumulation propre à atteindre le contenu requis.
Les tuyauteries de distribution de l’eau devront être correctement isolées avec du polyéthylène expansé ou des matériaux
similaires. Les valves d’interception, les courbes et les raccords devront aussi être correctement isolés.
Pour éviter les poches d’air à l’intérieur du circuit, insérer les dispositifs d’évent automatiques ou manuels dans tous les points
WX\DXWHULHVSOXVKDXWHVVLSKRQVHWFRO¶DLUSHXWV¶DFFXPXOHU
8QHIRLVOHFLUFXLWK\GUDXOLTXHUHPSOLHWO¶DEVHQFHGHIXLWHVFRQWU{OpHHQOHYHUO¶pWULHUGHEORFDJHGHODSRPSHGHFLUFXODWLRQ
¿JUpI$HQHQOHYDQWO¶pFURXGH¿[DWLRQ¿JUpI%UHPRQWHUO¶pFURX
&LUFXLWK\GUDXOLTXH¿J
/HVFKpPDK\GUDXOLTXHGHOD¿JUHSUpVHQWHOHVSDUWLHVSULQFLSDOHVGHO¶XQLWpLQWHUQHHWXQFLUFXLWK\GUDXOLTXHW\SLTXH
FRANÇAIS
1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
A
B
C
D
E
68
Entrée eau
9DOYHGHVpFXULWpEDUV
Manomètre
Capteur de température retour eau circuit T1
Échangeur à plaques
Capteur de température retour refoulement circuit T2
Flux-stat
Vase d’expansion
Collecteur résistances électriques
Évent air automatique
Pompe de circulation
9DOYHYRLHVGpYLDWULFHLQWpJUpHVXUPDFKLQHVXUYHUVLRQ:
Sortie eau circuit
Sortie eau pour accumulation eau sanitaire
Filtre eau à treillis
Connexions tubes réfrigérant
Capteur température chaudière sanitaire T3
Unité interne
Unité externe
&LUFXLWYHQWLODWHXUVFRQYHFWHXUVUDGLDWHXUVRXSDQQHDX[VROVUD\RQQDQWV
Accumulation eau sanitaire
6RXUFHGHFKDOHXUVXSSOpPHQWDLUHH[FKDXGLqUHjJD]
,QVWDOOHUVXUODWX\DXWHULHG¶HQWUpHG¶HDXGHO¶DSSDUHLOUHWRXUGXFLUFXLWXQ¿OWUHjFULEOHjPDLOOHVGHPP
2
2.6
VALEURS DE RÉFÉRENCE EAU CIRCUIT
‡
‡
‡
‡
‡
‡
‡
-
S+·
&RQGXFWLYLWppOHFWULTXHFRPSULVHHQWUHHW—6FP
'XUHWpWRWDOHFRPSULVHHQWUHHWƒ)
)HUWRWDOLQIpULHXUjSSP
0DQJDQqVHLQIpULHXUjSSP
&KORUXUHVLQIpULHXUjSSP
,RQVVRXIUHDEVHQWV
Ions ammoniac : absents
Si la dureté totale est supérieure à 20°F ou que certaines valeurs de référence de l'eau de renouvellement ne sont pas comprises
dans les limites indiquées, contacter notre service technique pour déterminer les traitements à mettre en oeuvre.
Les eaux de puits ou de nappes phréatiques ne provenant pas du réseau public doivent toujours être soigneusement analysées
et, si besoin est, conditionnées au moyen de systèmes de traitement appropriés. En cas d'installation d'un détartreur, en plus de
VXLYUHOHVLQVWUXFWLRQVGXIDEULFDQWUpJOHUODGXUHWpGHO
HDXGHVRUWLHVXUXQPLQLPXPGHƒ)HQHIIHFWXDQWpJDOHPHQWOHVWHVWV
GHS+HWGHVDOLQLWpHWFRQWU{OHUODFRQFHQWUDWLRQGHFKORUXUHVDSUqVODUpJpQpUDWLRQGHVUpVLQHV
En cas de risque de gel, vider le circuit ou y introduire du liquide antigel dans un pourcentage approprié aux températures
minimum atteignables.
/HVVROXWLRQVG
HDXHWGHJO\FROpWK\OpQLTXHHPSOR\pHVFRPPHÀXLGHWKHUPLTXHDXOLHXGHO
HDXSURYRTXHQWXQHGLPLQXWLRQ
GHVSHUIRUPDQFHVGHVXQLWpV$MRXWHUO
HDXGDQVXQSRXUFHQWDJHPD[LPDOGHGHJO\FROpWK\OpQLTXHpJDOjXQHSURWHFWLRQ
PD[LPDOHGHƒ&
2.7
REMPLISSAGE CIRCUIT HYDRAULIQUE
2.8
DEBLOCAGE POMPE CIRCULATION¿J
6LORUVGXSUHPLHUDOOXPDJHDSUqVOHGpPDUUDJHGXFLUFXODWHXURQYRLWDSSDUDvWUHVXUOHGLVSRVLWLIG¶DI¿FKDJHGXSDQQHDXGH
contrôle AL6, s’assurer que les valves du circuit sont ouvertes, qu’il y a au moins une utilisation avec le circuit ouvert, que le
¿OWUHjFULEOHH[WHUQHQ¶HVWSDVREVWUXpTX¶LOQ¶\DSDVGHEXOOHVG¶DLUjO¶LQWpULHXUGXFLUFXLWTXHODSUHVVLRQG¶HDXGXFLUFXLWHVW
correcte et que le circulateur ne soit pas bloqué.
pendant
Après avoir éliminé la cause, couper l’alarme en appuyant sur bouton d’allumage présent sur le pupitre de commande
GL[VHFRQGHV¿J.H\
3RXUGpEORTXHUODSRPSHGHFLUFXODWLRQWRXUQHUO¶DUEUHGHFHWWHGHUQLqUHGHODIDoRQLQGLTXpHjOD¿JXUHDSUqVDYRLUHQOHYp
le bouchon.
2.9
BRANCHEMENTS ÉLECTRIQUES¿JXUHV
‡
/HVEUDQFKHPHQWVpOHFWULTXHVGRLYHQWrWUHHIIHFWXpVGDQVOHUHVSHFWGHVLQVWUXFWLRQV¿JXUDQWGDQVOHPDQXHOG
LQVWDOODWLRQHW
GHVQRUPHVRXSUDWLTXHVUpJLVVDQWOHVEUDQFKHPHQWVG
DSSDUHLOVpOHFWULTXHVDXQLYHDXQDWLRQDOXQHFDSDFLWpLQVXI¿VDQWH
ou des branchements électriques incomplets pourraient être à l'origine d'électrocutions ou d'incendies.
‡ $WWHQWLRQOHVFLUFXLWVG¶DOLPHQWDWLRQpOHFWULTXHGHVXQLWpVLQWHUQHHWH[WHUQHGRLYHQWrWUHVpSDUpVODOLJQHGHO¶XQLWp
H[WHUQHGRLWrWUHSURWpJpHDXPR\HQG¶XQLQWHUUXSWHXUPDJQpWRWKHUPLTXHRXGHIXVLEOHRSSRUWXQpPHQWGLPHQVLRQQpV
‡ 1HMDPDLVXWLOLVHUXQHDOLPHQWDWLRQjODTXHOOHXQDXWUHDSSDUHLOHVWEUDQFKp
‡ 3RXUOHEUDQFKHPHQWXWLOLVHUXQFkEOHG
XQHORQJXHXUVXI¿VDQWHSRXUFRXYULUODGLVWDQFHWRXWHQWLqUHVDQVDXFXQHFRQQH[LRQ
QHSDVXWLOLVHUGHUDOORQJHVQHSDVDSSOLTXHUG
DXWUHVFKDUJHVVXUO
DOLPHQWDWLRQPDLVXWLOLVHUXQFLUFXLWG
DOLPHQWDWLRQGpGLp
GDQVOHFDVFRQWUDLUHLOSRXUUDLW\DYRLUXQULVTXHGHVXUFKDXIIHG
pOHFWURFXWLRQRXG
LQFHQGLH
‡ 3RXUOHVEUDQFKHPHQWVpOHFWULTXHVHQWUHXQLWpLQWHUQHHWH[WHUQHXWLOLVHUOHVW\SHVGHFkEOHVVSpFL¿pV¿[HUVROLGHPHQW
OHVFkEOHVG
LQWHUFRQQH[LRQGHWHOOHVRUWHTXHOHVERUQHVUHVSHFWLYHVQHVRLHQWSDVVRXPLVHVjGHVHIIRUWVH[WHUQHVGHV
EUDQFKHPHQWVRXGHV¿[DWLRQVLQFRPSOHWVSHXYHQWrWUHODFDXVHGHVXUFKDXIIHVRXG
LQFHQGLHV
‡ $SUqVDYRLUEUDQFKpOHVFkEOHVGHFRQQH[LRQHWG
DOLPHQWDWLRQV¶DVVXUHUTXHOHVFkEOHVVRQWGLVSRVpVGHIDoRQjQHSDV
H[HUFHUGHIRUFHVH[FHVVLYHVVXUOHVFRXYHUWXUHVRXVXUOHVSDQQHDX[SXSLWUHVpOHFWULTXHVPRQWHUOHVFRXYHUWXUHVVXUOHV
câbles.
‡ 6LSHQGDQWO
RSpUDWLRQG
LQVWDOODWLRQLO\DHXXQHIXLWHGHOLTXLGHUpIULJpUDQWDpUHUODSLqFHOHOLTXLGHUpIULJpUDQWV
LOHVW
H[SRVpjODÀDPPHSURGXLWXQJD]WR[LTXH
Avant toute intervention, s’assurer que l'alimentation électrique des unités externe et interne est coupée.
3RXUOHVEUDQFKHPHQWVpOHFWULTXHVVHUHSRUWHUDX[¿JXUHV
La tension d’alimentation doit être celle indiquée dans le tableau des caractéristiques techniques.
Les bornes des câbles doivent être dotées de bornes à pointe d’une section proportionnée aux câbles de branchement avant
leur insertion à l’intérieur de la boîte à bornes.
69
FRANÇAIS
Une fois terminés les branchements hydrauliques, procéder au remplissage du circuit. Simultanément, il nécessaire d’éventer
l’air à l’intérieur des tuyauteries et de l’appareil au moyen des évents d’air présents sur le circuit et sur l’appareil.
Initialement, quand le circuit de l’eau est vide, la machine ne doit pas être branchée au réseau d’alimentation électrique.
&HQ¶HVWTXHGDQVOHVSKDVHV¿QDOHVGHUHPSOLVVDJHGXFLUFXLWK\GUDXOLTXHTXHO¶RQSHXWDOLPHQWHUODPDFKLQHHWIDLUHGpPDUUHU
la pompe de circulation. Il est conseillé d’activer la fonction de forçage temporaire de la pompe de circulation pendant 15 minutes
DXPR\HQGHO¶DFWLYDWLRQGXSDUDPqWUH)3$YRLUSDU&RQWU{OHVGHODSRPSHGHFLUFXODWLRQ
6LRQXWLOLVHXQHSRPSHDX[LOLDLUHH[WHUQHFHWWHGHUQLqUHDXVVLGRLWrWUHGpPDUUpHVHXOHPHQWGDQVOHVSKDVHV¿QDOHVGHUHPSOLVVDJH
du circuit. La pression de service du circuit ne doit pas dépasser 1,5 BARS quand la pompe est éteinte.
'DQVWRXVOHVFDVSRXUYpUL¿HUOHVSHUWHVGXFLUFXLWDXPRPHQWGXWHVWLOHVWFRQVHLOOpG¶DXJPHQWHUODSUHVVLRQGHWHVWSUHVVLRQ
PD[LPXPEDUVSXLVGHO¶pYDFXHUSRXUDWWHLQGUHODSUHVVLRQGHVHUYLFH
2
Les lignes d’alimentation doivent être correctement dimensionnées pour éviter des chutes de tension ou la surchauffe de câbles
ou d’autres dispositifs présents sur les lignes.
La ligne d’alimentation de l’unité externe doit pouvoir être sectionnée du réseau électrique au moyen d’un interrupteur relais
magnétothermique approprié à l’absorption de la machine avec un relais différentiel à calibrage maximum conforme aux normes
pOHFWULTXHVQDWLRQDOHVYRLUWDEOHDXGHOD¿J
La ligne de l’unité interne est déjà protégée par un relais magnétothermique sur l’alimentation des résistances électriques et par
XQIXVLEOHYRLUSDULOHVWFRQVHLOOpG¶LQVWDOOHUVXUODOLJQHG¶DOLPHQWDWLRQXQUHODLVGLIIpUHQWLHO
6
DVVXUHUTXHSHQGDQWOHIRQFWLRQQHPHQWGXFRPSUHVVHXUODWHQVLRQG
DOLPHQWDWLRQpOHFWULTXHFRUUHVSRQGjODYDOHXU
nominale +/-10%.
,OHVWLQWHUGLWG¶XWLOLVHUGHVWXEHVGXUpIULJpUDQWHWGHO¶HDXSRXUODPLVHjODWHUUHGHO¶DSSDUHLO
Le fabricant n’est pas responsable des dommages causés par l’absence de mise à la terre ou par le non respect des indications
des schémas électriques.
/HWDEOHDXGH¿JPRQWUHOHVDEVRUSWLRQVPD[LPXPGHVXQLWpV
A
B
C
D
E
F
G
Alimentation unité externe
Puissance maximum absorbée unité externe
Courant maximum absorbé unité externe
)XVLEOHRXUHODLVPDJQpWRWKHUPLTXH0)$
Alimentation unité interne
3XLVVDQFHPD[LPXPDEVRUEpHXQLWpLQWHUQHDYHFUpVLVWDQFHVpOHFWULTXHVDFWLYpHV
&RXUDQWPD[LPXPDEVRUEpXQLWpLQWHUQHDYHFUpVLVWDQFHVpOHFWULTXHVDFWLYpHV
$FFqVDX[FRQQH[LRQVpOHFWULTXHV
Les boîtes à bornes pour les connexions électriques de l’unité externe sont situées dans la partie latérale droite de l’unité, pour
\DFFpGHUHQOHYHUOHFRXYHUFOHGXFDGUHpOHFWULTXHDSUqVDYRLUHQOHYpOHVYLVGH¿[DWLRQ
Pour accéder aux boîtes à bornes pour les connexions électriques de l’unité interne, se reporter aux par. 2.1.1 et 2.1.2.
Ces opérations sont permises seulement à du personnel spécialisé.
&kEOHVGHEUDQFKHPHQW
Le tableau suivant résume les câbles à utiliser.
Cavo comunicazione ODU/IDU
A
2 x 0,5 mm2 blindé
Cavo sonda ACS e aria esterna
B
H03RN-F 2 G 0,5 / H03VV-F 2 G 0,5
FRANÇAIS
UNITE INTERNE
Câble alimentation
C
UNITE EXTERNE
Câble alimentation
D
SHERPA SMALL
SHERPA BIG
H05VV 3 x 2,5 mm2
H05VV-F 3 x 4 mm2
OSCEBSH24EI
OSCEBCH36EI
OSCEBCH48EI
OS-CEBTH48EI
OSCEBCH60EI
OS-CEBTH60EI
H07RN-F 3 G2,5
H07RN-F 3 G4
H07RN-F 3 G4
H07RN-F 5 G2,5
H07RN-F 3 G4
H07RN-F 5 G2,5
&RQQH[LRQVpOHFWULTXHV¿JXUHV
Effectuer les connexions des câbles énumérés dans le paragraphe précédent aux boîtes à bornes des unités interne et externe
HQIDLVDQWUpIpUHQFHDX[¿JXUHVHWGHODIDoRQLQGLTXpHFLGHVVRXV
Unité interne:
‡ bornes L-N- alimentation de l’unité interne
‡ bornes 24-25HQWUpHFDSWHXUGHPHVXUHGHODWHPSpUDWXUHH[WHUQHQpFHVVDLUHSRXUO¶DFWLYDWLRQGHVFRXUEHVFOLPDWLTXHV
pour l’activation des résistances électriques de chauffage situées à l’intérieur de l’unité ou pour l’activation d’une source de
FKDOHXUH[WHUQH
‡ bornes 26-27 HQWUpH FDSWHXU GH PHVXUH GH OD WHPSpUDWXUH UpVHUYRLU HDX VDQLWDLUH QpFHVVDLUH SRXU OH FRQWU{OH GH OD
WHPSpUDWXUHGXUpVHUYRLUHDXVDQLWDLUHHWODJHVWLRQGHVF\FOHVDQWLOpJLRQHOORVH
‡ bornes Q-P : câble de communication entre unité interne et unité externe
‡ bornes N-L-12 : valve à trois voies pour déviation eau sanitaire installée de série sur la version 3W sur machine, à installer
H[WpULHXUHPHQWVXUODYHUVLRQEDVHGLVSRQLEOHHQNLW
‡ bornes N-13 : activation contacteur pour alimentation résistance électrique dans le réservoir d’eau sanitaire pendant les
F\FOHVDQWLOpJLRQHOORVH9+]:PD[
‡ bornes 14-15DFWLYDWLRQVRXUFHGHFKDOHXUH[WHUQHH[FKDXGLqUHjJD]FRQWDFW$$9DF
‡ bornes 16-17FRQWDFWDODUPHFRQWDFW$$9DF
‡ bornes 5-LGHPDQGHHDXFKDXGHVDQLWDLUHTXDQGODWHPSpUDWXUHGXUpVHUYRLUHDXFKDXGHVDQLWDLUHHVWGp¿QLHSDUXQ
FRQWU{OHH[WHUQHGpGLpXQFRQWDFWHQIHUPHWXUHVLWXpHQWUHFHVERUQHVDFWLYHODGHPDQGHG¶HDXFKDXGHVDQLWDLUH
‡ ERUQHFDUWHpOHFWURQLTXH contact propre distant allumage /extinction
70
2
‡ ERUQHFDUWHpOHFWURQLTXH contact propre distant mode chauffage/mode refroidissement
‡ ERUQHFDUWHpOHFWURQLTXH contact propre distant mode Eco
‡ ERUQHFDUWHpOHFWURQLTXH contact propre distant modalité nocturne
‡ ERUQHFDUWHpOHFWURQLTXHFRQWDFWSURSUHGLVWDQWDFWLYDWLRQHDXVDQLWDLUHGpMjEUDQFKpjODERvWHjERUQHV/
‡ ERUQHFDUWHpOHFWURQLTXHFRQWDFWSURSUHGLVWDQW7$YRLUSDUFRQWU{OHGLVWDQW
‡ ERUQHFDUWHpOHFWURQLTXH branchement commun contacts propres distants
/HVERUQHVjVHWURXYHQWVXUODFDUWHpOHFWURQLTXHOHVERUQHVSHXYHQWrWUHHQOHYpHVGHODFDUWHGHIDoRQjSRXYRLUOHV
EUDQFKHUSOXVIDFLOHPHQWSRXUHQVXLWHOHVUHPHWWUHHQSODFHGDQVODSRVLWLRQRULJLQDOHYRLU¿J
7RXVOHVFkEOHVDMRXWpVGRLYHQWrWUHG¶XQHORQJXHXUVXI¿VDQWHSRXUSHUPHWWUHO¶RXYHUWXUHGXFDGUHpOHFWULTXH
Unité externe monophasée :
alimentation de l’unité externe
‡ bornes L-Ncâble de communication entre unité interne et unité externe
‡ bornes Q-PUnité externe triphasée :
‡ bornes R-S-T-Nalimentation de l’unité externe
câble de communication entre unité interne et unité externe
‡ bornes Q-P-
2.10
CONTRÔLES DE INSTALLATION ¿JXUHV
3UpSDUDWLRQGHODSUHPLqUHPLVHHQVHUYLFH¿J
/DSUHPLqUHPLVHHQVHUYLFHGHODSRPSHGHFKDOHXUDLUHDXGRLWrWUHHIIHFWXpHSDUOHSHUVRQQHOWHFKQLTXHTXDOL¿p
Avant de mettre les pompes à chaleur air-eau en service, s'assurer que :
‡ 7RXWHVOHVFRQGLWLRQVGHVpFXULWpRQWpWpUHVSHFWpHV
‡ /DSRPSHjFKDOHXUDLUHDXDpWpFRUUHFWHPHQW¿[pHDXSODQG
DSSXL
‡ /D]RQHOLEUHVXUOHSRXUWRXUDELHQpWpUHVSHFWpH
‡ /HVEUDQFKHPHQWVHDXRQWELHQpWpHIIHFWXpVVHORQOHPDQXHOG
XWLOLVDWLRQ
‡ /HFLUFXLWG
HDXDpWpUHPSOLHWSXUJp
‡ /HVYDOYHVG
LQWHUFHSWLRQGXFLUFXLWG
HDXVRQWRXYHUWHV
‡ 6LXQHFKDXGLqUHHVWSUpVHQWHGDQVOHFLUFXLWV¶DVVXUHUTX¶RQWpWpLQVWDOOpHVOHVYDOYHVGHQRQUHWRXUVXUOHVHQWUpHVG¶HDX
à la pompe de chaleur et à la chaudière de façon à éviter des réductions de débit d’eau dans le circuit et l’entrée d’eau trop
chaude dans la pompe de chaleur
‡ /HVEUDQFKHPHQWVpOHFWULTXHVRQWpWpHIIHFWXpVFRUUHFWHPHQW
‡ /DWHQVLRQHVWFRPSULVHHQWUHHW9OHVXQLWpVPRQRSKDVpHVHWHW9SRXUOHVXQLWpVWULSKDVpHV
‡ /¶DOLPHQWDWLRQWULSKDVpHSRXUOHVPRGqOHVWULSKDVpVDXQGpVpTXLOLEUHPD[LPXPHQWUHOHVSKDVHVGH
‡ /DPLVHjWHUUHDpWpHIIHFWXpHFRUUHFWHPHQW
‡ /HVHUUDJHGHWRXWHVOHVFRQQH[LRQVpOHFWULTXHVDpWpELHQHIIHFWXp
‡ /DVHFWLRQGHVFkEOHVG
DOLPHQWDWLRQHVWDSSURSULpHSRXUO
DEVRUSWLRQGHO
DSSDUHLOHWODORQJXHXUGXEUDQFKHPHQWHIIHFWXp
‡ /DSURFpGXUHGHUpJODJHGHODGXUHWpGHO
HDXDpWpHIIHFWXpHHWOHSRWHQWLRPqWUHVXUODFDUWHODYDJHVHVWFRUUHFWHPHQW
positionné.
‡ (QOHYHUWRXWREMHWHQSDUWLFXOLHUOHVFRSHDX[OHVERXWVGH¿OHWODYLVVHULH
‡ 6¶DVVXUHUTXHWRXVOHVFkEOHVVRQWEUDQFKpVHWTXHWRXVOHVEUDQFKHPHQWVpOHFWULTXHVVRQWELHQVROLGHV
‡ $YDQWGHSRXYRLUGpPDUUHUOHFRPSUHVVHXUGXV\VWqPHLOGRLWDYRLUpWpDOOXPpHQSHUPDQHQFHSHQGDQWDXPRLQVKHXUHV
‡ 7DQWODYDOYHGHVHUYLFHGXWXEHGXJD]TXHFHOOHGXWXEHGXOLTXLGH¿JUpI(GRLYHQWrWUHRXYHUWHV
‡ 'HPDQGHUDXFOLHQWG¶rWUHSUpVHQWDXPRPHQWGXWHVWGHIRQFWLRQQHPHQW
‡ ([SRVHUOHFRQWHQXGXPDQXHOG¶XWLOLVDWLRQDXFOLHQW
‡ 5HPHWWUHDXFOLHQWOHPDQXHOG¶XWLOLVDWLRQHWOHFHUWL¿FDWGHJDUDQWLH
&RQWU{OHVSHQGDQWHWDSUqVODSUHPLqUHPLVHHQVHUYLFH¿J
8QHIRLVOHGpPDUUDJHHIIHFWXpLOIDXWYpUL¿HUTXH
‡ /HFRXUDQWDEVRUEpSDUOHFRPSUHVVHXUHVWLQIpULHXUjODYDOHXUPD[LPXPLQGLTXpHVXUODSODTXHVLJQDOpWLTXH
‡ 6
DVVXUHUTXHSHQGDQWOHIRQFWLRQQHPHQWGXFRPSUHVVHXUODWHQVLRQpOHFWULTXHFRUUHVSRQGjODYDOHXUQRPLQDOH
‡ 6¶DVVXUHUTXHO¶DOLPHQWDWLRQWULSKDVpHDXQGpVpTXLOLEUHPD[LPXPHQWUHOHVSKDVHVGH
‡ 6¶DVVXUHUTXHOHQLYHDXGHEUXLWGXFRPSUHVVHXUWULSKDVpQ¶HVWSDVDQRUPDO
‡ /¶DSSDUHLOIRQFWLRQQHjO¶LQWpULHXUGHVFRQGLWLRQVGHIRQFWLRQQHPHQWFRQVHLOOpHVYRLU¿J
‡ /HFLUFXLWG
HDXHVWFRPSOqWHPHQWSXUJp
‡ /DSRPSHjFKDOHXUDLUHDXGRLWHIIHFWXHUXQDUUrWVXLYLG
XQUHGpPDUUDJH
‡ /¶pFDUWWKHUPLTXHHQWUHUHIRXOHPHQWHWUHWRXUFLUFXLWGRLWrWUHFRPSULVHQWUHGDQVXQHSODJHGH·ƒ&HQLQWHUURJHDQWOHV
paramètres t1 et t2.
‡ 6LOHVDXWWKHUPLTXHGHYDLWrWUHLQIpULHXUjƒ&SDUDPpWUHUXQHYLWHVVHSOXVSHWLWHSRXUOHGLVSRVLWLIGHFLUFXODWLRQ6LHQ
revanche, le saut est supérieur à 7°C, contrôler l'ouverture de toutes les valves présentes sur le circuit et, si besoin est,
ajouter une pompe externe pour augmenter le débit.
71
FRANÇAIS
Fixer tous les câbles avec les serre-câbles
3
3
3.1
FRANÇAIS
EMPLOI ET MAINTENANCE
PANNEAU DE COMMANDE DE L’UNITE INTERNE ¿J
En ouvrant le portillon sur le pupitre en façade on accède au manomètre, au pupitre de contrôle et à l’interrupteur général.
6XUOHSDQQHDX¿JVRQWSUpVHQWVOHVGLVSRVLWLIVVXLYDQWV
A 0DQRPqWUH$I¿FKHODSUHVVLRQGXFLUFXLWK\GUDXOLTXHSHUPHWGHYpUL¿HUODSUHVVLRQGHO¶HDXjO¶LQWpULHXUGXFLUFXLW/HVYDOHXUV
doivent être comprises de 1 à 2 bars.
B Panneau de contrôle
C Interrupteur général unité interne
D 9LV¿[DWLRQSDQQHDXDYDQW
'HVFULSWLRQSXSLWUHGHFRQWU{OH¿J
/HSDQQHDXGHFRQWU{OHDXQGLVSRVLWLIG¶DI¿FKDJHXQFODYLHUjKXLWWRXFKHVHWQHXIYR\DQWVjGLRGHV
Voyant à diodes AHVWXWLOLVpTXDQGGHVWHPSpUDWXUHVVRQWDI¿FKpHV
Voyant à diodes B: point décimaux
Led1 DOOXPDJHMDXQH
Led2 UHIURLGLVVHPHQWYHUW
Led3 FKDXIIDJHURXJH
Led4 SRPSHDOOXPpHYHUW
Led5 DODUPHDFWXHOOHKLVWRULTXHURXJH
Led6 GLVSRVLWLIFKDXIIDQWVXSSOpPHQWDLUHMDXQH
Led7 WHPSRULVDWHXUDFWLYpMDXQH
Led8 SURGXFWLRQHDXVDQLWDLUHDFWLYHURXJH
Led9 PRGH(&2DFWLIYHUW
Key1:
ÀqFKHKDXWSRXUVHGpSODFHUGDQVOHPHQXRXPRGL¿HUODYDOHXUDI¿FKpH
Key2:
ÀqFKHEDVFRPPHOD.H\
mais dans la direction opposée. Quand elle est enfoncée en même temps que la
.H\
elle permet la sortie du menu précédent.
sélection refroidissement/chauffage/seulement production eau sanitaire.
Key3:
Key4:
PHQXGHFRQ¿JXUDWLRQ3HUPHWG¶DFFpGHUDX[PHQXXWLOLVDWHXURXVHUYLFH
PHQX WHPSpUDWXUHFRQ¿JXUDWLRQ (Q DSSX\DQW VXU FH ERXWRQ RQ D DFFqV GLUHFW DX[ YDOHXUV GH WHPSpUDWXUH
Key5:
PQpPRQLTXHV(QDSSX\DQWVXUOHVÀqFKHVRQSHXWVpOHFWLRQQHUFHOOHVRXKDLWpHHWDYHFOD.H\
en voir la
YDOHXU3RXUODFRQ¿JXUDWLRQGHVWHPSpUDWXUHVSUHVVHU.H\
SHQGDQWWURLVVHFRQGHVHWOHVÀqFKHVSRXUHQ
SRXUFRQ¿UPHU/DVRUWLHGXPHQXDOLHXDXWRPDWLTXHPHQWDSUqVVHFRQGHV
PRGL¿HUODYDOHXUSUHVVHU.H\
VDQVHQIRQFHUDXFXQERXWRQRXHQDSSX\DQWVLPXOWDQpPHQWVXUOHVÀqFKHV
Key6:
3HUPHWG¶DI¿FKHUODYDOHXUGXSDUDPqWUHG¶HQPRGL¿HUODFRQ¿JXUDWLRQHQDSSX\DQWSHQGDQWWURLVVHFRQGHV
HWGHFRQ¿UPHUODQRXYHOOHYDOHXU
Key7:
Active ou désactive le deuxième set point CS2 en refroidissement ou HS2 en chauffage pour permettre des
économies d’énergie
Key8:
En appuyant sur ce bouton l’unité est allumée ou mise en attente.
3.2
ACTIVATION ET FONCTIONS UTILISATEUR
3.2.1
Activation ¿JXUHV
6HUHSRUWHUjOD¿JXUHSRXUOHVYR\DQWVjGLRGHVHWOHVERXWRQVGXSDQQHDXGHFRPPDQGH
Pour activer l’unité, procéder dans le suivant mode :
‡ 0HWWUHVRXVWHQVLRQO¶XQLWpLQWHUQHHWO¶XQLWpH[WHUQHDXPR\HQGHVLQWHUUXSWHXUVJpQpUDX[
‡ $FWLYHUOHFDGUHGHO¶XQLWpLQWHUQHDXPR\HQGHO¶LQWHUUXSWHXU¿JUpI&VXUOHSDQQHDXGHFRPPDQGH
jaune et le voyant à diodes vert
‡ 3UHVVHUOHWRXFKH.H\ sur l’interface utilisateur, on voit s’allumer le voyant 1
TXLLQGLTXHO¶DFWLYDWLRQGHODSRPSHGHFLUFXODWLRQHQ¿QVXUOHGLVSRVLWLIG¶DI¿FKDJHV¶DI¿FKHOHPRGHGHIRQFWLRQQHPHQW
CLG pour le mode refroidissement, HTG pour chauffage et San pour production eau sanitaire.
‡ 3UHVVHU OD WRXFKH .H\ SRXU VpOHFWLRQQHU OH PRGH GH IRQFWLRQQHPHQW HQ DSSX\DQW VXU .H\ en
séquence on active le mode refroidissement et on voit s’allumer le voyant à diodes 2 vert
, puis le mode chauffage et on
voit s’allumer le voyant à diodes 3 rouge HQ¿QOHPRGHSURGXFWLRQHDXVDQLWDLUHV¶DFWLYHHWOHVYR\DQWVjGLRGHVHW
s’éteignent.
(Q DSSX\DQW VXU OH ERXWRQ .H\ RQ YRLW V¶DFWLYHU OH PRGH G¶pFRQRPLH G¶pQHUJLH (FR O¶DOOXPDJH GX YR\DQW j
diodes 9
vert montre l’activation du mode Eco.
0HQXWHPSpUDWXUHVVHW
6XUOHSDQQHDXGHFRPPDQGHLOHVWSRVVLEOHGHYpUL¿HUOHVWHPSpUDWXUHVPHVXUpHVSDUOHVFDSWHXUVGHO¶XQLWpLQWHUQHHWG¶DI¿FKHU
HWGHFRQ¿JXUHUOHVVHWSRLQWVHDXPHQXWHPSpUDWXUHVVHW
/HVWHPSpUDWXUHVHWOHVVHWSRLQWVDI¿FKDEOHVVXUOHGLVSRVLWLIG¶DI¿FKDJHVRQW
‡ WWHPSpUDWXUHHDXHQWUDQWH
‡ WWHPSpUDWXUHHDXVRUWDQWH
‡ WWHPSpUDWXUHFDSWHXUUpVHUYRLUHDXVDQLWDLUH
72
3
‡
‡
‡
‡
‡
‡
WWHPSpUDWXUHFDSWHXUDLUH[WHUQH
F6VHWSRLQWGHPRGHUHIURLGLVVHPHQW
F6VHWSRLQW(FRGHPRGHUHIURLGLVVHPHQW
&+&KHXUHVGHIRQFWLRQQHPHQWFRPSUHVVHXU
+6VHWSRLQWGHPRGHFKDXIIDJH
+6VHWSRLQW(FRGHPRGHFKDXIIDJH
3RXUDI¿FKHUOHVGLWHVWHPSpUDWXUHVVHWSURFpGHUGHODIDoRQVXLYDQWH
‡ 3UHVVHU.H\ RQYRLWV¶DI¿FKHUWVXUOHGLVSRVLWLIG¶DI¿FKDJH
RX.H\
SRXUDI¿FKHUOHVDXWUHVGRQQpHVPQpPRQLTXHVVXUOHGLVSRVLWLIG¶DI¿FKDJH
‡ 3UHVVHU.H\
RQYRLWV¶DI¿FKHUODYDOHXUGHWHPSpUDWXUHVHWPHVXUpH
‡ 3UHVVHU.H\
‡ 3UHVVHU.H\
pour quitter le mode températures/set
3.2.3
Menu utilisateur
$XPR\HQGXSDQQHDXGHFRQWU{OHGHO¶XQLWpLQWHUQHHQRXWUHLOHVWSRVVLEOHG¶DFWLYHUOHVIRQFWLRQVVXLYDQWHVPRGL¿DEOHVGDQV
le menu utilisateur :
‡
+25/2*(
3RXUFRQ¿JXUHUO¶KRUORJHPRGL¿HUOHSDUDPqWUHKU6SRXUOHVKHXUHVHWOHSDUDPqWUHɉLQSRXUOHVPLQXWHV
‡
TIMER
Avec cette fonction, il est possible de démarrer et d’éteindre une fois par jour le système.
$YHFOHSDUDPqWUHWLɉ RQDFWLYHODIRQFWLRQDYHFOHSDUDPqWUH6W$RQSDUDPqWUHO¶KHXUHGHGpPDUUDJHHWDYHFOHSDUDPqWUH
Sto on paramètre l'heure d’extinction du système.
‡
FONCTIONNEMENT NOCTURNE
Avec la modalité fonctionnement nocturne, on limite le rendement et le bruit du système.
/DIRQFWLRQHVWDFWLYpHDYHFOHSDUDPqWUHQF/ O¶KHXUHGHGpEXWPRGHDYHFOHSDUDPqWUHQ6WHWO¶KHXUHGH¿QDYHFOH
paramètre nSP.
‡
6(732,175()52,',66(0(17
,OHVWSRVVLEOHGHFRQ¿JXUHUOHWKHUPRVWDWSRXUGHX[WHPSpUDWXUHVGLIIpUHQWHVGHUHIURLGLVVHPHQWGHO¶HDXDXPR\HQGHV
paramètres CS1 et CS2.
La température CS2 sera utilisée en activant le mode Eco in refroidissement.
‡
6(732,17&+$8))$*(
,OHVWSRVVLEOHGHFRQ¿JXUHUOHWKHUPRVWDWSRXUGHX[WHPSpUDWXUHVGLIIpUHQWHVGHFKDXIIDJHGHO¶HDXDXPR\HQGHVSDUDPqWUHV
HS1 et HS2.
La température HS2 sera utilisée en activant le mode Eco in chauffage.
‡
6(732,176$1,7$,5(
,OHVWSRVVLEOHGHFRQ¿JXUHUOHWKHUPRVWDWSRXUXQHWHPSpUDWXUHGHFKDXIIDJHGHO¶HDXDXPR\HQGXSDUDPqWUH+6
‡
&285%(6&/,0$7,48(6
Pour optimiser les économies d’énergie, sont disponibles deux courbes climatiques, une pour le chauffage et une pour le
refroidissement. Cette fonction permet d’adapter la température de l’eau à la température de l’air externe et par conséquent
au chargement thermique en optimisant les économies d’énergie du système.
/HVFRXUEHVFOLPDWLTXHVGRLYHQWrWUHFRQ¿JXUpHVGHIDoRQDSSURSULpHDXFLUFXLWSDUOHSHUVRQQHODXWRULVpHQPRGL¿DQWFHUWDLQV
paramètres dans le menu service.
/¶XWLOLVDWHXUSHXWDFWLYHUODFRXUEHHQFKDXIIDJHHQFRQ¿JXUDQWOHSDUDPqWUH+FF +FF ODFRXUEHHVWH[FOXHHWOHV\VWqPH
fonctionne avec les set points Hs1 et Hs2.
/¶XWLOLVDWHXUSHXWDFWLYHUODFRXUEHLQUHIURLGLVVHPHQWHQFRQ¿JXUDQWOHSDUDPqWUH&FF &FF ODFRXUEHHVWH[FOXHHWOH
système fonctionne avec les set points Cs1 et Cs2.
3.3
CONFIGURATION DES PARAMÈTRES MENU UTILISATEUR
LOHVWSRVVLEOHG¶DFFpGHUDXPHQXXWLOLVDWHXUHQDSSX\DQWGHVVXVRQYRLWV¶DI¿FKHUVXUOH
$XPR\HQGXERXWRQ.(<
GLVSRVLWLIG¶DI¿FKDJH8VUSRXU8VHUXWLOLVDWHXU
8QHIRLVVpOHFWLRQQpOHPHQXXWLOLVDWHXUHQDSSX\DQWVXU.(<
RQHQWUHGDQVOHPHQXHWRQYRLWV¶DI¿FKHUOHSUHPLHU
SDUDPqWUHSXLVDYHFOHVÀqFKHVKDXWHWEDVLOHVWSRVVLEOHG¶DI¿FKHUWRXVOHVSDUDPqWUHVGXPHQXXWLOLVDWHXU(QDSSX\DQW
GHQRXYHDXVXUOHERXWRQLQIRVHWRQYRLWV¶DI¿FKHUODYDOHXUGXSDUDPqWUHHQDSSX\DQWGHQRXYHDXVXULQIRVHWSHQGDQWWURLV
et
VHFRQGHVODYDOHXUVXUOHGLVSRVLWLIG¶DI¿FKDJHFOLJQRWHHWRQSHXWPRGL¿HUODYDOHXUVRXKDLWpHDYHFOHVÀqFKHV.H\
.H\
, presser
SRXUFRQ¿UPHU
3UHVVHUPHQXSRXUVRUWLUHWOHVÀqFKHVSRXUVpOHFWLRQQHUXQDXWUHSDUDPqWUH
Procéder de la même façon pour les autres paramètres.
La sortie du menu à lieu automatiquement après 60 secondes sans enfoncer aucun bouton ou en appuyant simultanément sur
HW.H\
.
OHVGHX[ÀqFKHV.H\
73
FRANÇAIS
3
3RXUODFRQ¿JXUDWLRQGHVSDUDPqWUHVVHUHSRUWHUpJDOHPHQWDXWDEOHDXFLGHVVRXVGHUpFDSLWXODWLRQGHVSDUDPqWUHV
Exemple:
3UHVVHU.H\
3UHVVHU.H\
3UHVVHU.H\
3UHVVHU.H\
3UHVVHU.H\
3UHVVHU.H\
3UHVVHU.H\
3UHVVHU.H\
paramètres
3UHVVHU.H\
RQYRLWV¶DI¿FKHU86UVXUOHGLVSRVLWLIG¶DI¿FKDJH
RQYRLWV¶DI¿FKHUOHSUHPLHUSDUDPqWUHKU6FRQ¿JXUDWLRQKHXUHVGHO¶KRUORJH
RQYRLWV¶DI¿FKHUODYDOHXUGXSDUDPqWUHH[
SHQGDQWWURLVVHFRQGHVODYDOHXUGXSDUDPqWUHFOLJQRWHVXUOHGLVSRVLWLIG¶DI¿FKDJH
.H\
SRXUDXJPHQWHURXGLPLQXHUODYDOHXUGXSDUDPqWUHDI¿FKpVXUOHGLVSRVLWLIG¶DI¿FKDJH
SRXUFRQ¿UPHUODYDOHXUFRQ¿JXUpHOHGLVSRVLWLIG¶DI¿FKDJHFHVVHGHFOLJQRWHU
SRXUVRUWLUHWDI¿FKHUOHSDUDPqWUH
RX.H\
SRXUFKDQJHUGHSDUDPqWUHHWSURFpGHUGHODIDoRQLQGLTXpHFLGHVVXVSRXUPRGL¿HUDXWUHV
HW.H\
MNEMONIQUE
DISPOSITIF
D’AFFICHAGE
MENU
&KDPSGH
UpJODJH
&RQ¿JXUDWLRQ
d’usine
+25/2*(6<67Ê0(
CONFIGURATION
HEURE
Kɝ6
Utilisateur
0-23
0
+25/2*(6<67Ê0(
CONFIGURATION
MINUTES
ɉLQ
Utilisateur
0-59
0
ACTIVATION/
DESACTIVATION
TIMER
WLPHUGpVDFWLYp
WLPHUDFWLYp
WLɉ
Utilisateur
0-1
0
HEURE DE
DEMARRAGE
6<67Ê0(
StA
Utilisateur
00.0 – 23.5
0.00
'pFLPDOHV GL]DLQHV
GHPLQXWHVH[ PLQXWHV PLQXWHV
HEURE
D’EXTINCTION
6<67Ê0(
Sto
Utilisateur
00.0 – 23.5
0.00
'pFLPDOHV GL]DLQHV
GHPLQXWHVH[ PLQXWHV PLQXWHV
Paramètre
ACTIVATION/
DESACTIVATION
MODE NOCTURNE
PRGHQRFWXUQH
désactivé
PRGHQRFWXUQH
activé
FRANÇAIS
simultanément pour quitter le menu utilisateur
Le rendement et le bruit
maximum sont réduits
ncL
Utilisateur
0,1
0
nSt
Utilisateur
00.0 – 23.5
0.00
'pFLPDOHV GL]DLQHV
GHPLQXWHVH[ PLQXWHV PLQXWHV
nSP
Utilisateur
00.0 – 23.5
0.00
'pFLPDOHV GL]DLQHV
GHPLQXWHVH[ PLQXWHV PLQXWHV
t1
Températures/
Set
t2
Températures/
Set
Température capteur
réservoir eau sanitaire
t3
Températures/
Set
Température capteur
air externe
t4
Températures/
Set
CHC
Températures/
Set
/XF ƒ&
- 25°C
/XF ƒ&
- 20°C
/XF ƒ&
/XF ƒ&
&RQ¿JXUDWLRQVG¶XVLQHSRXU
sols rayonnants
/XF ƒ&
- 25°C
/XF ƒ&
- 20°C
/XF ƒ&
/XF ƒ&
&RQ¿JXUDWLRQVG¶XVLQHSRXU
sols rayonnants
HEURE D’ALLUMAGE
MODE NOCTURNE
HEURE
D'EXTINCTION MODE
NOCTURNE
Température eau
entrée
Température eau sortie
Heures de
fonctionnement
compresseur
SET POINT
REFROIDISSEMENT 1
cS1
Températures/
Set
Utilisateur
SET POINT
REFROIDISSEMENT 2
(FR0RGH
cS2
Températures/
Set
Utilisateur
74
COMMENTAIRES
3
Paramètre
MNEMONIQUE
DISPOSITIF
D’AFFICHAGE
SET POINT
CHAUFFAGE 1
MENU
&KDPSGH
UpJODJH
&RQ¿JXUDWLRQ
d’usine
Températures/
Set
/XF ƒ&
- 55°C
/XF ƒ&
- 60°C
/XF ƒ&
/XF ƒ&
&RQ¿JXUDWLRQVG¶XVLQHSRXU
sols rayonnants
/XF ƒ&
- 55°C
/XF ƒ&
- 60°C
/XF ƒ&
/XF ƒ&
&RQ¿JXUDWLRQVG¶XVLQHSRXU
sols rayonnants
20-55°C
50°C
HS1
Utilisateur
SET POINT
&+$8))$*((FR
0RGH
HS2
Températures/
Set
Utilisateur
SET POINT
SERBATOIO ACQUA
SANITARIA
HS3
Températures/
Set
COMMENTAIRES
HS3 est utilisé seulement
TXDQGGK8 FRQWU{OHHDXj
ODVRUWLH ƒ&YDOHXU¿[H
Utilisateur
ACTIVATION/
DESACTIVATION
COURBE
CLIMATIQUE
REFROIDISSEMENT
FRXUEHFOLPDWLTXH
désactivée
FRXUEHFOLPDWLTXH
activée
ACTIVATION/
DESACTIVATION
COURBE
CLIMATIQUE
CHAUFFAGE
FRXUEHFOLPDWLTXH
désactivée
FRXUEHFOLPDWLTXH
activée
Hcc
Utilisateur
Utilisateur
0, 1
0, 1
0
0
6L+FF OHFRQWU{OHGH
température est effectué
avec les set points HS1 ou
HS2
VL+FF OHFRQWU{OHGH
température est effectué
selon la courbe climatique
ACTIVATION ET FONCTIONS SERVICE
Pour activer l’unité procéder de la façon suivante :
‡ 0HWWUHVRXVWHQVLRQO¶XQLWpLQWHUQHHWO¶XQLWpH[WHUQHDXPR\HQGHVLQWHUUXSWHXUVJpQpUDX[
‡ $FWLYHUOHFDGUHGHO¶XQLWpLQWHUQHDXPR\HQGHO¶LQWHUUXSWHXU&VXUOHSDQQHDXGHFRPPDQGH
‡ 3UHVVHUODWRXFKH.H\ sur l’interface utilisateur, on verra s’allumer le voyant à diodes 1 jaune
et le voyant à diodes
vert
TXLLQGLTXHO¶DFWLYDWLRQGHODSRPSHGHFLUFXODWLRQHQ¿QVXUOHGLVSRVLWLIG¶DI¿FKDJHRQYRLWV¶DI¿FKHUOHPRGHGH
fonctionnement: CLG pour le mode refroidissement, HTG pour chauffage et San pour production eau sanitaire.
SRXUVpOHFWLRQQHUOHPRGHGHIRQFWLRQQHPHQWHQDSSX\DQWVXU.H\
en
‡ 3UHVVHUOHWRXFKH.H\
séquence on active le mode refroidissement et on voit s’allumer le voyant à diodes 2 vert
, puis le mode chauffage et on
voit s’allumer le voyant à diodes 3 rouge
HQ¿QOHPRGHSURGXFWLRQHDXVDQLWDLUHV¶DFWLYHHWOHVYR\DQWjGLRGHVHW
s’éteignent.
‡ (QDSSX\DQWVXUOHERXWRQ.H\
RQDFWLYHOHPRGHG¶pFRQRPLHG¶pQHUJLH(FRO¶DOOXPDJHGXYR\DQWjGLRGHVYHUW
montre l’activation du mode Eco.
$XPR\HQGXSDQQHDXGHFRQWU{OHGHO¶XQLWpLQWHUQHHQRXWUHLOHVWSRVVLEOHG¶DFWLYHUOHVIRQFWLRQVVXLYDQWHVPRGL¿DEOHVGDQV
le menu de service:
‡
‡
*(67,21'(65e6,67$1&(6e/(&75,48(681,7(6,17(51(6
Les unités sont dotées d’une résistance de support à deux stades : 1.5 kW + 1.5 kW sur les unités internes SMALL et 3 kW
+ 3 kW sur les unités LARGE.
Pour activer cette fonction il faut installer le kit capteur de température air externe. On peut l’activer, pour renforcer la puissance
HQFKDXIIDJHHQSURGXFWLRQG¶HDXVDQLWDLUHHWSHQGDQWO¶H[pFXWLRQGHVF\FOHVDQWLOpJLRQHOORVHYRLUSDUDJUDSKHVSpFL¿TXH
6HORQOHVH[LJHQFHVHWODSXLVVDQFHpOHFWULTXHGLVSRQLEOHLOHVWSRVVLEOHGHOHVDFWLYHUDYHFOHSDUDPqWUHEF LQGLYLGXHOOHPHQW
DYHFOHSDUDPqWUH$(+ RXHQFRXSOHLQGLYLGXHOOHPHQWDYHFOHSDUDPqWUH$(+ HWHQGp¿QLVVDQWjTXHOOHWHPSpUDWXUH
H[WHUQHOHVDFWLYHUDXPR\HQGXSDUDPqWUHRW(H[RW( ƒ&
La première résistance est activée quand la température de l’air externe est inférieure à otE, si la température de l’eau
HVWLQIpULHXUHGHƒ.SDUUDSSRUWjODWHPSpUDWXUHFRQ¿JXUpHHWDSUqVOHVPLQXWHVGp¿QLHVSDUOHSDUDPqWUH(K3GHSUpVHQFH
de ces conditions. La seconde résistance est activée quelques minutes après l’activation de la première si les paramètres
QHVRQWSDVVDWLVIDLWVOHWHPSVG¶DFWLYDWLRQSHXWrWUHPRGL¿pGHjPLQXWHVDXPR\HQGXSDUDPqWUH(K3
/HVUpVLVWDQFHVpOHFWULTXHVQHSHXYHQWSDVrWUHDFWLYpHVVLOHIRQFWLRQQHPHQWG¶XQHVRXUFHGHFKDOHXUH[WHUQHEF HVW
activé. Les résistances électriques seront activées même en cas de panne de l’unité externe.
CONTRÔLE TEMPÉRATURE EAU
/HWKHUPRVWDWGHUpJODJHGHODWHPSpUDWXUHGHO¶HDXSHXWrWUHFRQ¿JXUpSRXUUpJOHUODWHPSpUDWXUHGHUHIRXOHPHQWGHO¶HDX
FRQ¿JXUDWLRQSUpGp¿QLHHQXVLQH/8F RXSRXUUpJOHUODWHPSpUDWXUHGHO¶HDXGHUHWRXUGXFLUFXLW/8F 75
FRANÇAIS
3.4
Ccc
6L&FF OHFRQWU{OHGH
température est effectué
avec les set points cS1 ou
cS2
VL&FF OHFRQWU{OHGH
température est effectué
selon la courbe climatique
3
‡
FRANÇAIS
‡
CONTRÔLES DE LA POMPE DE CIRCULATION
Pendant l’installation on peut forcer le fonctionnement de la pompe de circulation pendant 15 minutes en portant le paramètre
)3$ GHFHWWHIDoRQRQIDFLOLWHODSXUJHGHO¶DLUGDQVODSKDVH¿QDOHGHUHPSOLVVDJHG¶HDXGXFLUFXLW
La pompe de circulation peut fonctionner de différentes façons selon les exigences du circuit auquel est branchée l’unité:
‡ )RQFWLRQQHPHQWFRQWLQXGHODSRPSHFRQ¿JXUDWLRQG¶XVLQHSDUDPqWUHF33 ‡ /D SRPSH V¶pWHLQW TXDQG OH VHW SRLQW GH O¶HDX HVW VDWLVIDLW OD SRPSH VHUD DFWLYpH SpULRGLTXHPHQW SRXU YpUL¿HU OD
WHPSpUDWXUHGHO¶HDXGDQVOHFLUFXLW/HF\FOHG¶pFKDQWLOORQQDJHHVWGp¿QLHSDUODYDOHXUGHFRQ¿JXUDWLRQGXSDUDPqWUH
F33H[F33 ODSRPSHV¶DFWLYHUDSHQGDQWXQHPLQXWHWRXWHVOHVGL[PLQXWHVDYHFVHWSRLQWVDWLVIDLW
(VWSUpVHQWHXQHIRQFWLRQDQWLEORFDJHGHODSRPSHWDQGLVTXHOHV\VWqPHHVW2))HQUpJODQWOHSDUDPqWUH336 FHWWHIRQFWLRQHVWDFWLYpHDYHFOHSDUDPqWUH3TGRQGp¿QLWWRXWHVOHVFRPELHQG¶KHXUHHVWHIIHFWXpOHGpPDUUDJHHWOH
SDUDPqWUH3TWGp¿QLWSRXUFRPELHQGHWHPSVGRLWIRQFWLRQQHUODSRPSHSHQGDQWOHF\FOHDQWLEORFDJH
‡
*(67,216285&('(&+$/(85(;7(51($8;,/,$,5(
(QIRQFWLRQFKDXIIDJHRXSURGXFWLRQHDXVDQLWDLUHOHFRQWU{OHHIIHFWXHDXPR\HQGXSDUDPqWUHEF XQUHPSODFHPHQWGH
O¶XQLWpSRPSHGHFKDOHXUVLODWHPSpUDWXUHGHO¶DLUH[WHUQHHVWLQIpULHXUHjXQHYDOHXUSUpGp¿QLHSDUDPqWUHRW(
‡
PRODUCTION EAU SANITAIRE
On peut brancher l’appareil à un réservoir avec un échangeur intermédiaire pour produire de l’eau sanitaire. Les unités
LQWHUQHVYHUVLRQ:DYHFODYDOYHjWURLVYRLHVSHXYHQWGpYLHUOHÀX[GHO¶HDXFKDXGHjXQUpVHUYRLUSRXUO¶DFFXPXODWLRQ
d’eau sanitaire.
La demande d’eau sanitaire peut se faire de deux façons :
‡ DXPR\HQG¶XQFRQWDFWSURSUH/HQFRQ¿JXUDQWOHSDUDPqWUHGK8 GDQVFHFDVFRQ¿JXUHUOHWKHUPRVWDWH[WHUQH
FRQWDFWSURSUHVXUXQHWHPSpUDWXUHLQIpULHXUHDX[ƒ&
‡ DXPR\HQG¶XQFDSWHXUGHWHPSpUDWXUHLQVpUpGDQVOHUpVHUYRLUG¶HDXVDQLWDLUHHQFRQ¿JXUDQWOHSDUDPqWUHGK8 GDQVFHFDVOHVHWSRLQWHVWFRQ¿JXUpDYHFOHSDUDPqWUH+6
Au moyen du paramètre hyS il est possible également de contrôler le cycle d’hystérésis du contrôle de température du
réservoir.
(QXVLQH+6 ƒ&HWK\6 ƒ.SDUFRQVpTXHQWODWHPSpUDWXUHGDQVOHUpVHUYRLUYDULHUDGHjƒ&
6LO¶RQDFWLYHXQHGHPDQGHGHSURGXFWLRQHDXVDQLWDLUHOHFRQWU{OHPRGL¿HVRQpWDWGHVIDoRQVVXLYDQWHV
‡ VLO¶XQLWpIRQFWLRQQHHQFKDXIIDJHODYDOYHjWURLVYRLHVFRPPXWHHWOHÀX[G¶HDXFKDXGHHVWGpYLpYHUVOHUpVHUYRLU$&6
HQ´4XDQGHVWDWWHLQWHODWHPSpUDWXUHGHPDQGpHODYDOYHjWURLVYRLHVGpYLHOHÀX[G¶HDXHQ´YHUVOHFLUFXLWGH
chauffage et le système continue de fonctionner comme avant la demande d’eau sanitaire.
‡ VLO¶XQLWpIRQFWLRQQHHQUHIURLGLVVHPHQWOHFRPSUHVVHXUV¶DUUrWHODYDOYHjWURLVYRLHVFRPPXWHHWOHÀX[G¶HDXFKDXGHHVW
dévié vers le réservoir ACS. Quand la température demandée est atteinte, le compresseur commute la valve d’inversion
GHF\FOHUpIULJpUDQWHWODYDOYHjWURLVYRLHVHWHQ¿QOHFRPSUHVVHXUHVWGpPDUUpWURLVPLQXWHVDSUqVO¶H[WLQFWLRQSUpFpGHQWH
Pendant la production d’eau sanitaire le système fournit la puissance maximum possible pour satisfaire rapidement la
demande d’eau sanitaire.
‡
CYCLE ANTI-LÉGIONELLOSE
Par l'activation de la fonction Anti-légionellose le régulateur est en mesure d'effectuer de façon autonome les procédures de
désinfection thermique sur les installations d'eau chaude sanitaire dotées de recyclage, en diminuant sensiblement le risque
de présence et de prolifération des bactéries responsables de la légionellose.
La fonction de désinfection peut être activée au moyen du paramètre Ldi. On peut choisir de chauffer l’eau sanitaire avec
ODSRPSHGHFKDOHXUHWOHVUpVLVWDQFHVpOHFWULTXHVjGHX[VWDGHVVXUO¶XQLWpLQWHUQHHQFRQ¿JXUDQWOHSDUDPqWUH/G$ RX
ELHQDXPR\HQG¶XQHUpVLVWDQFHGDQVOHUpVHUYRLUG¶HDXVDQLWDLUHDXPR\HQGXSDUDPqWUH/G$ 'DQVOHVHFRQGFDVDYHF
/G$ ODUpVLVWDQFHpOHFWULTXHGRLWrWUHDOLPHQWpHVpSDUpPHQWHWDFWLYpHDXPR\HQG¶XQUHODLVEUDQFKpDX[ERUQHV1
NDFWLYDWLRQ
/DGp¿QLWLRQGHO¶LQWHUYDOOHGHWHPSVG¶H[pFXWLRQGXF\FOHHQMRXUVSRXUFRPELHQGHWHPSVHWjTXHOOHWHPSpUDWXUHHIIHFWXHU
OHVF\FOHVGHGpVLQIHFWLRQVRQWGp¿QLVUHVSHFWLYHPHQWSDUOHVSDUDPqWUHV/G6/GGHW/GW
76
&2175Ð/(',67$17
Il est possible de contrôler certaines fonctions de l’appareil de façon distante au moyen de contacts propres.
/HVFRQQH[LRQVGHVFRQWDFWVGRLYHQWrWUHHIIHFWXpHVVXUODERvWHjERUQHVGHODFDUWHpOHFWURQLTXHGHO¶XQLWpLQWHUQH¿J
de la façon décrite ci-dessous :
borne 1 : allumage/extinction: avec contact propre ouvert le système est en veille, avec contact fermé le système est allumé
borne 2 : changement de mode de fonctionnement chauffage/refroidissement : avec contact propre ouvert le système est
en mode chauffage, avec contact fermé le système est en mode refroidissement
borne 3 : deuxième set point ECO mode: avec contact propre ouvert le Set point sélectionné est cS1 en modalité
UHIURLGLVVHPHQWRX+6HQPRGDOLWpFKDXIIDJHDYHFFRQWDFWIHUPpOH6HWSRLQWVpOHFWLRQQpHVWF6HQPRGDOLWpUHIURLGLVVHPHQW
ou HS2 en modalité chauffage
borne 4 : activation sélection modalité fonctionnement nocturne : avec contact propre ouvert fonction désactivée, avec
contact fermé fonction activée
borne 5GpMjEUDQFKpHjODERvWHjERUQHVGHO¶XQLWpLQWHUQH/DFWLYDWLRQFKDXIIDJHHDXVDQLWDLUHDYHFFRQWDFWSURSUH
RXYHUWPRGDOLWpHDXVDQLWDLUHGpVDFWLYpHDYHFFRQWDFWIHUPpPRGDOLWpHDXVDQLWDLUHDFWLYpH
borne 6 : activation/inhibition de la modalité refroidissement ou chauffage. Quand le contact est ouvert, le fonctionnement
eau sanitaire reste actif. Peut être également branché à un chrono-thermostat ou aux contacts en parallèle chiller/boiler des
commandes électroniques des ventilateurs convecteurs Bi2 et Bi2+.
Les contacts doivent être fermés sur la borne L
/¶DFWLYDWLRQGHVFRQWDFWVGLVWDQWVGHVERUQHVHWHVWDFWLYpHDYHFOHSDUDPqWUHUɉ7 3
‡
PROTECTIONS ANTIGEL
/¶pFKDQJHXUjSODTXHVVRXGpHVEUDVpHVGHO¶XQLWpLQWHUQHHVWSURWpJpFRQWUHOHVUXSWXUHVGHJHOSDUXQÀX[VWDWTXLLQWHUURPSW
OHIRQFWLRQQHPHQWGXV\VWqPHTXDQGOHGpELWG¶HDXHVWLQVXI¿VDQWHWSDUOHVFDSWHXUVGHWHPSpUDWXUHVXUO¶pFKDQJHXU
‡
COURBES CLIMATIQUES¿J
Pour optimiser les économies d’énergie, sont disponibles deux courbes climatiques, une pour le chauffage et une pour le
refroidissement. Cette fonction permet d’adapter la température de l’eau à la température de l’air externe et par conséquent
au chargement thermique en optimisant les économies d’énergie du système.
/¶DFWLYDWLRQGHODFRXUEHHQFKDXIIDJHDOLHXHQFRQ¿JXUDQWOHSDUDPqWUH+FF /DFRQ¿JXUDWLRQGHODFRXUEHFOLPDWLTXHVHIDLWDXPR\HQGHTXDWUHSDUDPqWUHV
Hc1 température de l’air externe pour avoir la maximum température de l’eau
Hc2 température de l’eau maximum
Hc3 température de l’air externe pour avoir la température minimum de l’eau
Hc4 température de l’eau minimum
/¶DFWLYDWLRQGHODFRXUEHHQUHIURLGLVVHPHQWDOLHXHQFRQ¿JXUDQWOHSDUDPqWUH&FF /DFRQ¿JXUDWLRQGHODFRXUEHFOLPDWLTXHHVWHIIHFWXpHDXPR\HQGHTXDWUHSDUDPqWUHV
Cc1 température de l’air externe pour avoir la maximum température de l’eau
Cc2 température de l’eau maximum
Cc3 température de l’air externe pour avoir la température minimum de l’eau
Cc4 température de l’eau minimum
9RLU¿J&285%(&/,0$7,48(&+$8))$*(+FFHW5()52,',66(0(17&FF
1HSDVFKDQJHUOHVSDUDPqWUHV&+6UW)$GUHW)3WVRQWGHVSDUDPqWUHVSRXUGHVXVDJHVG¶XVLQH
3.5
CONFIGURATION DES PARAMÈTRES MENU SERVICE
LOHVWSRVVLEOHG¶DFFpGHUDXPHQX6HUYLFHHQDSSX\DQWGHX[IRLVRQYHUUDV¶DI¿FKHUVXUOH
$XPR\HQGXERXWRQ.(<
GLVSRVLWLIG¶DI¿FKDJH6(UTXLVLJQL¿H6HUYLFHDVVLVWDQFH
RQYRLWV¶DI¿FKHUVXUOHGLVSRVLWLIG¶DI¿FKDJHODGHPDQGHGH
8QHIRLVVpOHFWLRQQpOHPHQXVHUYLFHHQDSSX\DQWVXU.(<
PRWGHSDVVH3$6SUHVVHULQIRVHWHWVXUOHGLVSRVLWLIG¶DI¿FKDJHRQYRLWV¶DI¿FKHUHQDSSX\DQWGHQRXYHDXWURLVVHFRQGHV
VXULQIRVHWRQYRLWV¶DI¿FKHUGHIDoRQLQWHUPLWWHQWHjFHSRLQWVDLVLUODYDOHXU3$6HWSUHVVHULQIRVHWSRXUFRQ¿UPHU3UHVVHU
0HQXRQYRLWV¶DI¿FKHU3$6VXUOHGLVSRVLWLIG¶DI¿FKDJHHWDYHFOHVÀqFKHVKDXWHWEDVLOHVWSRVVLEOHG¶DI¿FKHUWRXVOHVSDUDPqWUHV
GXPHQXXWLOLVDWHXU(QDSSX\DQWGHQRXYHDXVXUOHERXWRQLQIRVHWRQYRLWV¶DI¿FKHUODYDOHXUGXSDUDPqWUHHQDSSX\DQWGH
QRXYHDXVXULQIRVHWSHQGDQWWURLVVHFRQGHVODYDOHXUVXUOHGLVSRVLWLIG¶DI¿FKDJHFOLJQRWHHWRQSHXWPRGL¿HUODYDOHXUVRXKDLWpH
HW.H\
SUHVVHULQIRVHWSRXUFRQ¿UPHU
DYHFOHVÀqFKHV.H\
3UHVVHUPHQXSRXUVRUWLUHWOHVÀqFKHVSRXUVpOHFWLRQQHUXQDXWUHSDUDPqWUH
Procéder de la même façon pour les autres paramètres.
La sortie du menu à lieu automatiquement après 60 secondes sans enfoncer aucun bouton ou en appuyant simultanément sur
OHVGHX[ÀqFKHV.H\
HW.H\
.
Exemple :
3UHVVHU.H\
GHX[IRLVRQYRLWV¶DI¿FKHU6(5VXUOHGLVSRVLWLIG¶DI¿FKDJH
3UHVVHU.H\
RQYRLWV¶DI¿FKHU3$6VXUOHGLVSRVLWLIG¶DI¿FKDJH
3UHVVHU.H\
RQYRLWV¶DI¿FKHUVXUOHGLVSRVLWLIG¶DI¿FKDJH
3UHVVHU.H\
SHQGDQWWURLVVHFRQGHVODYDOHXUFOLJQRWHVXUOHGLVSRVLWLIG¶DI¿FKDJH
3UHVVHU.H\ RX.H\
SRXUDXJPHQWHURXGLPLQXHUODYDOHXUDI¿FKpHVXUOHGLVSRVLWLIG¶DI¿FKDJH
SRXUFRQ¿UPHUODYDOHXUFRQ¿JXUpHOHGLVSRVLWLIG¶DI¿FKDJHFHVVHGHFOLJQRWHU
3UHVVHU.H\
3UHVVHU.H\
SRXUTXLWWHURQYRLWV¶DI¿FKHU3$6VXUOHGLVSRVLWLIG¶DI¿FKDJH
3UHVVHU.H\ RX.H\
SRXUDI¿FKHUXQSDUDPqWUH2QYRLWDSSDUDvWUHHQVpTXHQFHOHVVLJOHVPQpPRQLTXHV
GHVSDUDPqWUHVVXUOHGLVSRVLWLIG¶DI¿FKDJHV¶DUUrWHUVXUOHSDUDPqWUHjPRGL¿HU
SHQGDQWWURLVVHFRQGHVODYDOHXUGXSDUDPqWUHFOLJQRWHVXUOHGLVSRVLWLIG¶DI¿FKDJH
3UHVVHU.H\
3UHVVHU.H\ RX.H\
SRXUPRGL¿HUOHSDUDPqWUH
SRXUFRQ¿UPHUODYDOHXUFRQ¿JXUpHOHGLVSRVLWLIG¶DI¿FKDJHFHVVHGHFOLJQRWHU
3UHVVHU.H\
SRXUTXLWWHURQYRLWV¶DI¿FKHUOHVLJOHPQpPRQLTXHGXGHUQLHUSDUDPqWUHVXUOHGLVSRVLWLIG¶DI¿FKDJH
3UHVVHU.H\
UHSUHQGUHjSDUWLUGXSRLQWSRXUPRGL¿HUXQDXWUHSDUDPqWUH
3UHVVHU.H\
HW.H\
simultanément pour quitter le menu utilisateur.
77
FRANÇAIS
La durée de l’action est dictée par les caractéristiques de l’installation. La bactérie de la légionellose réagit différemment
en fonction de la température maximum atteinte dans le circuit, la durée diminue proportionnellement à l’augmentation de
ODWHPSpUDWXUH/HFRQWU{OHVLJQDOHO¶H[pFXWLRQGHODIRQFWLRQ$QWLOpJLRQHOORVHHQLQGLTXDQWVXUOHGLVSRVLWLIG¶DI¿FKDJHOD
mention LEG et quitte la fonction après un temps maximum de 5 heures si, pour quelque motif que ce soit, la température
n’est pas atteinte à l’intérieur du réservoir.
Si sont effectués des prélèvements d’ACS excessifs pendant le cycle anti-légionellose et que la température n’est pas
maintenue, après deux tentatives, le contrôle quitte la fonction. Quand le cycle anti-légionellose n’est pas terminé deux fois
GHVXLWHRQYHUUDDSSDUDvWUHVXUOHGLVSRVLWLIG¶DI¿FKDJHO¶DODUPH$
Pendant l’exécution de la fonction Anti-légionellose, les exigences de refroidissement ou de chauffage du circuit ne sont pas
VDWLVIDLWHVVLOHFKDXIIDJHGXUpVHUYRLUSHQGDQWOHF\FOHGHGpVLQIHFWLRQHVWFRQ¿pjODSRPSHGHFKDOHXUHWDX[UpVLVWDQFHV
pOHFWULTXHVGHFHWWHGHUQLqUHVLHQUHYDQFKHOHF\FOHHVWHIIHFWXpSDUXQHUpVLVWDQFHpOHFWULTXHLQWURGXLWHGDQVOHUpVHUYRLU
d’eau sanitaire.
$¿QG¶pYLWHUGHVEU€OXUHVVLO¶RQSUpOqYHGHO¶HDXFKDXGHSHQGDQWODSKDVHGHGpVLQIHFWLRQWKHUPLTXHLOHVWFRQVHLOOpG¶DFWLYHU
les dispositifs de sécurité anti-brûlures sur chaque utilisation ou à la sortie du réservoir d’eau sanitaire.
3
FRANÇAIS
78
3RXUODFRQ¿JXUDWLRQGHVSDUDPqWUHVVHUHSRUWHUpJDOHPHQWDXWDEOHDXUpFDSLWXODWLIGHVSDUDPqWUHV
Paramètre
MNEMONIQUE
DISPOSITIF
D’AFFICHAGE
MENU
&KDPSGH
UpJODJH
&RQ¿JXUDWLRQ
d’usine
RÉSISTANCES
ÉLECTRIQUES INTERNES
SUPPLÉMENTAIRES
UpVLVWDQFHVpOHFWULTXHV
désactivées
SUHPLHUVWDGH
résistances électriques
activé
SUHPLHUHWVHFRQGH
stade résistances
électriques activé
AEH
Service
0,1,2
0
CAPTEUR DE CONTRÔLE
TEMPÉRATURE EAU
FRQWU{OHEDVpVXU
la température de l’eau
entrante
FRQWU{OHEDVpVXU
la température de l’eau
sortante
LUc
Service
0,1
1
BPHE HEATER SETPOINT
cHS
Service
-5 à 5 °C
2°C
CONTRÔLE DISTANT
VHXOHPHQWLQWHUIDFH
utilisateur
SRUWGHFRPPXQLFDWLRQ
activée
FRQWDFWVSURSUHV
activables à distance
activés
Uɉ7
Service
0,1,2
0
FONCTION ANTIBLOCAGE
POMPE AVEC POMPE
ÉTEINTE
IRQFWLRQDQWLEORFDJH
pompe désactivée
IRQFWLRQDQWLEORFDJH
pompe activée
PPS
Service
0,1
1
PERIODICITE FONCTION
ANTI BLOCAGE POMPE
Pqd
Service
0 -100
heures
72
TEMPS DE
FONCTIONNEMENT
POMPE EN FONCTION
ANTIBLOCAGE
Pqt
Service
0 - 10
minutes
0,5
AVIS DE MAINTENANCE
POMPE
3ɉG
Service
0-999 jours
0
AVIS DE MAINTENANCE
FILTRE EAU
8)ɉ
Service
0-999 jours
0
DEMANDE ACTIVATION
SOURCE DE CHALEUR
EXTERNE
GHPDQGHDFWLYDWLRQ
désactivée
GHPDQGHDFWLYDWLRQ
activée
bc
Service
0,1
0
COMMENTAIRES
Non utilisé
6LUɉ7 2Q2II
C/H peuvent être
contrôlés seulement
par les contacts
propres distants, ces
commandes
sont désactivées sur
l’interface utilisateur
Modes Eco et nocturne,
production eau
sanitaire et contact TA
sont toujours activés
avec n’importe quelle
YDOHXUGHUɉ7
SDV VHFRQGHV
6LEF OHVUpVLVWDQFHV
électriques de l’unité
interne ne peuvent pas
être activées
3
MNEMONIQUE
DISPOSITIF
D’AFFICHAGE
MENU
&KDPSGH
UpJODJH
&RQ¿JXUDWLRQ
d’usine
COMMENTAIRES
SEUIL TEMPÉRATURE
AIR EXTERNE
POUR ACTIVATION
RÉSISTANCES
ÉLECTRIQUES
SUPPLÉMENTAIRES OU
SOURCE DE CHALEUR
EXTERNE
otE
Service
-15 à 20°C
2°C
6LEF OHFRQWDFWVXU
les bornes 14 et 15
de la boîte à bornes
unité interne quand la
température air externe
t4 est inférieure à otE.
6L7RW(EF HW
AEH>0 les résistances
électriques sont
activées
PRODUCTION EAU
SANITAIRE
SURGXFWLRQGpVDFWLYpH
SURGXFWLRQDFWLYpHDX
moyen de contact propre
SURGXFWLRQDFWLYpHDX
moyen de capteur réservoir
eau sanitaire
dhU
Service
0,1,2
1
6LGK8 FRQ¿JXUHU
le thermostat externe
FRQWDFWSURSUHjXQH
température inférieure
aux 60°C
MODALITE FONCTION
&<&/($17,
LÉGIONELLOSE
3RPSHGHFKDOHXU
résistances électriques
unité interne
UpVLVWDQFHVpOHFWULTXHV
dans le réservoir eau
sanitaire
LdA
Service
0,1
0
PERIODICITE FONCTION
ANTI-LÉGIONELLOSE
/GL IRQFWLRQGpVDFWLYpH
6LOGD HW/GL!ODIRQFWLRQ
est activée avec résistance
électrique dans le réservoir
d’eau sanitaire
Ldi
Service
0 - 30 jours
0
HEURE D’ACTIVATION
&<&/($17,
LÉGIONELLOSE
Lds
Service
00,0 - 23,5
2,00
7(03e5$785(&<&/(
ANTI-LÉGIONELLOSE
Ldt
Service
50°C - 80°C
65°C
'85((&<&/($17,
LÉGIONELLOSE
Ldd
Service
0 - 240
minutes
30
ACTIVATION FORCEE
POMPE
IRUoDJHSRPSHQRQ
activé
IRUoDJHSRPSHDFWLYp
FPA
Service
0,1
0
Fonction active
uniquement avec
système en veille
RETARD ACTIVATION
RÉSISTANCES
ÉLECTRIQUES UNITE
INTERNE
EhP
Service
0 - 60
minutes
15
Retard entre le
démarrage de la
pompe de chaleur et le
contrôle des conditions
pour activer le stade
1 de la résistance
électrique.
S’il est activé, le
second stade démarre
avec 15 minutes de
retard par rapport au
SUHPLHUWHPSV¿[H
'pFLPDOHV GL]DLQHV
GHPLQXWHVH[ PLQXWHVMXVTX¶j minutes
FRANÇAIS
Paramètre
79
FRANÇAIS
3
Paramètre
MNEMONIQUE
DISPOSITIF
D’AFFICHAGE
MENU
&KDPSGH
UpJODJH
&RQ¿JXUDWLRQ
d’usine
COMMENTAIRES
PERIODICITE ACTIVATION
POMPE QUAND LE SET
POINT Il EST SATISFAIT
cPP
Service
0-20 minutes
0
Quand le set point est
VDWLVIDLWFRPSUHVVHXU
pWHLQW
F33 ODSRPSHUHVWH
allumée
cPP>0 la pompe est
éteinte pendant cPP
minutes, puis elle est
DOOXPpHXQHPLQXWH
cet échantillonnage
est effectué de façon
F\FOLTXHSRXUYpUL¿HUOD
température de l’eau
dans le circuit
+<67(5(6,6
TEMPÉRATURE
RÉSERVOIR EAU
SANITAIRE T3
hyS
Service
5°C - 25°C
10°C
A utiliser seulement
TXDQGGK8 FDSWHXU
t3 dans le réservoir eau
VDQLWDLUH
COURBE CLIMATIQUE
REFROIDISSEMENT
AIR EXTERNE POUR
TEMPÉRATURE MAXIMUM
EAU
Cc1
Service
-15 – +50°C
20°C
COURBE CLIMATIQUE
REFROIDISSEMENT
TEMPÉRATURE MAXIMUM
EAU
Cc2
Service
/XF 4°C -20°C,
/XF 7°C -27°C
18°C
Paramétrages d’usine
pour ventilateurs
convecteurs et
contrôle installations à
température eau à la
VRUWLH/8F COURBE CLIMATIQUE
REFROIDISSEMENT
AIR EXTERNE POUR
TEMPÉRATURE MINIMUM
EAU
Cc3
Service
-15 – +50°C
40°C
COURBE CLIMATIQUE
REFROIDISSEMENT
TEMPÉRATURE MINIMUM
EAU
Cc4
Service
/XF 4°C -20°C,
/XF 7°C -27°C
15°C
COURBE CLIMATIQUE
CHAUFFAGE AIR
EXTERNE POUR
TEMPÉRATURE MAXIMUM
EAU
Hc1
Service
-15 – +50°C
-5°C
COURBE CLIMATIQUE
CHAUFFAGE
TEMPÉRATURE MAXIMUM
EAU
Hc2
Service
/XF 20-60°C,
/XF 20-55°C
35°C
COURBE CLIMATIQUE
CHAUFFAGE AIR
EXTERNE POUR
TEMPÉRATURE MINIMUM
EAU
Hc3
Service
-15 – +50°C
20°C
COURBE CLIMATIQUE
CHAUFFAGE
TEMPÉRATURE MINIMUM
EAU
Hc4
Service
/XF 20-60°C,
/XF 20-55°C
28°C
MOT DE PASSE MENU DE
SERVICE
PAS
Service
rtF
Service
0 – 200
SDV
0
EMPLOI D’USINE, NE
PAS MODIFIER
Adr
Service
1 – 255
1
Adresse port de
communication RS485
à utiliser avec n’importe
quel périphérique de
FRQWU{OHGLVWDQW3&RX
DXWUH
ADRESSE PERIPHERIQUE
80
&F•&F&F•&F
Paramétrages d’usine
pour ventilateurs
convecteurs et
contrôle installations à
température eau à la
VRUWLH/8F +F•+F+F•+F
Valeur en possession
du Service Olimpia
Splendid
3
3.6
DESACTIVATION ET EXTINCTION POUR PERIODES PROLONGEES¿JXUHV
Pour désactiver la pompe de chaleur procéder comme suit :
‡ 3UHVVHUODWRXFKH.H\,VXUOHSXSLWUHGHFRQWU{OHMXVTX¶jFHTXHVXUOHGLVSRVLWLIG¶DI¿FKDJHRQYRLHV¶DI¿FKHU6W\YHLOOH
‡ (QOHYHUO¶DOLPHQWDWLRQGHO¶XQLWpH[WHUQH
De cette façon la fonction d’antiblocage de la pompe de circulation reste active.
La non utilisation de la pompe de chaleur de façon prolongée nécessite les opérations suivantes :
‡ 3UHVVHUODWRXFKH.H\,VXUO¶LQWHUIDFHXWLOLVDWHXUMXVTX¶jFHTXHVXUOHGLVSRVLWLIG¶DI¿FKDJHRQYRLHV¶DI¿FKHU6W\YHLOOH
‡ (QOHYHUO¶DOLPHQWDWLRQGHO¶XQLWpLQWHUQHDXPR\HQGHO¶LQWHUUXSWHXU¿JUpI&VXUOHSXSLWUHGHFRPPDQGH
‡ (QOHYHUO¶DOLPHQWDWLRQGHO¶XQLWpLQWHUQHHWGHO¶XQLWpH[WHUQHDXPR\HQGHVLQWHUUXSWHXUVJpQpUDX[
En coupant l’alimentation également de l’unité interne, la fonction antiblocage de la pompe de circulation ne reste pas active et
LOSRXUUDLWrWUHQpFHVVDLUHGHODGpEORTXHU¿J
Pour remettre en fonction la pompe de chaleur air-eau, après une inactivité prolongée de la pompe de chaleur, il est conseillé
de faire intervenir le Service d’Assistance Technique.
3.7
NETTOYAGE
La seule opération de nettoyage nécessaire, par le responsable de l’installation, est celle des panneaux externes de la pompe
de chaleur air-eau, à faire uniquement au moyen de chiffons imbibés d’eau et de savon.
'DQVOHFDVGHWDFKHVWHQDFHVLPELEHUOHFKLIIRQG¶XQPpODQJHjG¶HDXHWG¶DOFRROGpQDWXUpHRXDYHFGHVSURGXLWVVSpFL¿TXHV
3.8
MAINTENANCE PERIODIQUE
/DPDLQWHQDQFHSpULRGLTXHHVWLQGLVSHQVDEOHSRXUPDLQWHQLUODSRPSHGHFKDOHXUWRXMRXUVHI¿FDFHV€UHHW¿DEOHGDQVODGXUpH
Elle peut être effectuée selon une périodicité semestrielle, pour certaines interventions, et annuelle pour d’autres, par le Service
Technique d’Assistance, qui est techniquement préparé et peut en outre disposer, si nécessaire, de pièces de rechange originales.
Le plan de maintenance que le Service Technique d’Assistance OLIMPIA SPLENDID ou le technicien de maintenance doit
respecter, selon une périodicité annuelle, prévoit les opérations et contrôles suivants :
‡ 9pUL¿FDWLRQGHODSUHVVLRQGXYDVHG
H[SDQVLRQ
‡ 5HPSOLVVDJHFLUFXLWG
HDX
‡ 3UpVHQFHDLUGDQVOHFLUFXLWG
HDX
‡ (I¿FLHQFHVpFXULWpV
‡ 7HQVLRQpOHFWULTXHG
DOLPHQWDWLRQ
‡ $EVRUSWLRQpOHFWULTXH
‡ 6HUUDJHGHVFRQQH[LRQVpOHFWULTXHV
‡ 1HWWR\DJHGHVJULOOHVGHVYHQWLODWHXUVHWDLOHWWHVEDWWHULHXQLWpH[WHUQH
‡ &RQWU{OHHQFUDVVHPHQWGXOH¿OWUHjWUHLOOLVPpWDOOLTXH
3.9
ALARMES
$ODUPHVGLVSRVLWLIG¶DI¿FKDJHXQLWpLQWHUQH
/HWDEOHDXPRQWUHOHVDODUPHVRXOHVRYHUULGHVSRXYDQWV¶DI¿FKHUVXUOHGLVSRVLWLIG¶DI¿FKDJHGXSDQQHDXGHFRQWU{OH
/HV RYHUULGHV 1( UHSUpVHQWHQW 3$6 XQ DYLV GH G\VIRQFWLRQQHPHQW GX V\VWqPH PDLV VLJQDOHQW XQH FRQGLWLRQ GH
IRQFWLRQQHPHQWWHPSRUDLUH/HVRYHUULGHV1(QpFHVVLWHQW3$6O¶LQWHUYHQWLRQGHO¶DVVLVWDQFHWHFKQLTXH
4XDQGDSSDUDvWXQHDODUPHRQYRLWDSSDUDvWUHOHVLJOHPQpPRQLTXHVXUOHGLVSRVLWLIG¶DI¿FKDJHHWV¶DOOXPHU
le voyant 5 et le contact d’alarme entre les bornes 16 et 17 se ferme.
simultanément
Code Override/Alarme
,QGLFDWLRQPQpPRQLTXH
sur le dispositif
G¶DI¿FKDJH
Override #1
Or1
Température de l’eau entrante inférieure à 10°C
Override #2
Or2
Protection antigel échangeur
Override #3
Or3
Demande d'activation de la source de chaleur active
Override #4
Or4
&RQWDFW7$RXYHUWERUQHGHOD¿FKHpOHFWURQLTXH
Override #5
Or5
Limitation capacité de l’unité externe
Override #6
Or6
Cycle de dégivrage en cours
Alarme #1
A1
Défaut capteur eau de sortie
Alarme #2
A2
Défaut capteur eau d’entrée
Alarme #3
A3
Défaut capteur réservoir eau sanitaire
Description override/alarme
81
FRANÇAIS
1H SDV XWLOLVHU G¶pSRQJHV LPELEpHV GH SURGXLWV DEUDVLIV RX GH SURGXLWV QHWWR\DQWV HQ SRXGUH 7RXWH RSpUDWLRQ GH
QHWWR\DJH HVW LQWHUGLWH DYDQW G¶DYRLU GpEUDQFKp O¶DSSDUHLO GH O¶DOLPHQWDWLRQ pOHFWULTXH HQ DPHQDQW OHV LQWHUUXSWHXUV
JpQpUDX[GHO¶XQLWpLQWHUQHHWGHO¶XQLWpH[WHUQHVXU³pWHLQW´
3
Alarme #4
A4
Défaut capteur air externe
Alarme #5
A5
Protection antigel échangeur à plaques
Alarme #6
A6
$ODUPHÀX[VWDW
Alarme #7
A7
Erreur de communication avec l’unité externe
Alarme #8
A8
Cycle anti-légionellose non effectué
Alarme #9
A9
Erreur communication port série RS485
Alarme #10
A10
3URWHFWLRQGHVXULQWHQVLWpDODUPHXQLWpH[WHUQH
Alarme #11
A11
3URWHFWLRQWHQVLRQG¶DOLPHQWDWLRQDODUPHXQLWpH[WHUQH
Alarme #12
A12
6pTXHQFHSKDVHVXQLWpH[WHUQHHUURQpHDODUPHXQLWpH[WHUQH
Alarme #13
A13
'pIDXWFDSWHXUVXQLWpH[WHUQHDODUPHXQLWpH[WHUQH
9pUL¿HUW\SHG¶DODUPHVXUFDUWHXQLWpH[WHUQHSDU
4XDQGDSSDUDvWXQHDODUPHYpUL¿HUGDQVOHWDEOHDXODFDXVHHWHQOHYHUOHGpIDXWRXELHQDSSHOHUO¶DVVLVWDQFHWHFKQLTXH
3RXUVXSSULPHUOHVDODUPHV$j$SUHVVHUOHERXWRQ.H\ pendant dix secondes ou bien appeler l’assistance technique.
/HFRQWU{OHDHQRXWUHODSRVVLELOLWpG¶DFWLYHUGHX[DODUPHVGHPDLQWHQDQFHSRPSHHWGX¿OWUHHDX$XPR\HQGXSDUDPqWUH3ɉG
RQGp¿QLWOHQRPEUHGHMRXUVGHIRQFWLRQQHPHQWDYDQWO¶DFWLYDWLRQGHO¶DODUPHSRPSHHWDXPR\HQGXSDUDPqWUH8)ɉOHVMRXUV
GHIRQFWLRQQHPHQWDYDQWO¶DFWLYDWLRQGHO¶DODUPH¿OWUH
/HVDODUPHVSHXYHQWrWUHDFWLYpHVHQFRQ¿JXUDQWOHSDUDPqWUHUHODWLIGHjMRXUVVL OHFRPSWHXUQ¶HVWSDVDFWLYp
4XDQGO¶DODUPHHVWDFWLYpHHWTXHODPDFKLQHDIRQFWLRQQpSHQGDQWOHQRPEUHGHMRXUVFRQ¿JXUpVXUOHGLVSRVLWLIG¶DI¿FKDJHRQ
s’allume .
YRLWV¶DI¿FKHU)L/SRXUOH¿OWUHHW3ɉ3SRXUODSRPSHOHSDUDPqWUHHVWFRQ¿JXUpHWOHYR\DQW
pendant dix secondes jusqu’à la
3RXUGpVDFWLYHUO¶DODUPH)L/SRXUOH¿OWUHHW3ɉ3SRXUODSRPSHSUHVVHUOHERXWRQ.(<
disparition de l’alarme.
$ODUPHVGLVSRVLWLIG¶DI¿FKDJHXQLWpH[WHUQH
6XUOD¿FKHGHFRQWU{OHGHO¶XQLWpH[WHUQHHVWSUpVHQWXQGLVSRVLWLIG¶DI¿FKDJHjGHX[FKLIIUHVTXLDI¿FKHOHVDODUPHVTXDQGHOOHV
sont présentes.
Le tableau ci-dessous montre les alarmes de l’unité externe.
FRANÇAIS
Code erreur
82
Description alarme
E0
Dysfonctionnement EEPROM
E2
Erreur de communication entre unité externe et unité interne
E3
Erreur de communication carte externe
E4
Défaut capteur de température unité externe
E5
Protection tension d’alimentation compresseur
E6
3URWHFWLRQGXPRGXOH3)&VHXOHPHQWSRXU..jSKDVH
P0
Protection température tête compresseur
P1
Protection haute pression
P2
Protection basse pression
P3
Protection de surintensité compresseur
P4
Protection température de refoulement compresseur
P5
Protection haute température de condensation
P6
Protection module
DEUTSCHE
1
ALLGEMEINES
85
1.1
ALLGEMEINE INFORMATIONEN
85
1.2
6<0%2/*(%81*
86
1.2.1
Redaktionelle Piktogramme
86
1.2.2
Piktogramme bezüglich der Sicherheit
86
1.3
WARNHINWEISE
86
1.4
GRUNDLEGENDE SICHERHEITSREGELN
87
1.5
(5+$/781'$863$&.(1
87
1.6
AUSSENEINHEIT
88
1.7
INNENEINHEIT
88
1.8
/,67('(5+$837.20321(17(1'(5,11(1(,1+(,7
88
1.9
9(5=(,&+1,6'(50,7*(/,()(57(1.20321(17(181'%(6&+5(,%81*'(57(,/(
88
2
INSTALLATION
89
2.1
INSTALLATION DER INNENEINHEIT
89
2.1.1
Öffnung der Blenden
89
2.1.2
Zugriff auf die Innenkomponenten
89
2.2
INSTALLATION DER AUSSENEINHEIT
89
2.3
BETRIEBSGRENZEN
90
2.4
.h+/$16&+/h66(
90
2.4.1
3UIXQJHQXQG.RQWUROOHQ
91
2.4.2
Laden des Zusatzkühlmittels
91
2.5
:$66(5$16&+/h66(
91
2.5.1
Wasserkreis
92
2.6
%(=8*6:(57()h5:$66(5$1/$*(
93
2.7
)h//(1'(5:$66(5$1/$*(
93
2.8
FREIGABE DER UMLAUFPUMPE
93
2.9
(/(.75,6&+($16&+/h66(
93
2.9.1
Zugang zu den elektrischen Anschlüssen
94
2.9.2
Anschlusskabel
94
2.9.3
Elektrische Anschlüsse
94
2.10
.21752//(1'(5,167$//$7,21
95
2.10.1
Vorbereitung zur ersten Inbetriebnahme
95
2.10.2
.RQWUROOHQZlKUHQGXQGQDFKGHU(UVWLQEHWULHEQDKPH
95
3
BEDIENUNG UND WARTUNG
96
3.1
Bedientafel der Inneneinheit
96
3.1.1
Beschreibung der Bedientafel
96
3.2
$.7,9,(581*81'%(187=(5)81.7,21(1
96
3.2.1
Aktivierung
96
3.2.2
Menü Temperaturen/Set
96
3.2.3
Benutzermenü
97
3.3
(,167(//81*'(53$5$0(7(5'(6%(187=(50(1h6
97
3.4
$.7,9,(581*81')81.7,21(16(59,&(
99
3.5
(,167(//81*'(53$5$0(7(5'(66(59,&(0(1h6
101
3.6
'($.7,9,(581*81'$%6&+$/781*)h5/$1*(=(,75b80(
105
3.7
REINIGUNG
105
3.8
PROGRAMMIERTE WARTUNG
105
3.9
ALARME
105
3.9.1
Alarme Display Inneinheit
105
3.9.2
Alarme Display Außeneinheit
106
84
1
1
ALLGEMEINE INFORMATIONEN
:LUEHGDQNHQXQVGDIUGDVV6LHHLQHU/XIW:DVVHU:lUPHSXPSHXQVHUHU3URGXNWLRQGHQ9RU]XJJHJHEHQKDEHQ
Sie werden sich davon überzeugen können, dass Sie eine gute Wahl getroffen haben, denn das von Ihnen gekaufte Produkt
UHSUlVHQWLHUWGHQDNWXHOOVWHQ6WDQGLQGHU+DXVNOLPDJHUlWHWHFKQLN
'LHVHV+DQGEXFKZXUGHPLWGHU=LHOVHW]XQJYHUIDVVW,KQHQDOOH(UNOlUXQJHQ]XUEHVWP|JOLFKHQ1XW]XQJ,KUHV.OLPDJHUlWHV
zu liefern.
%LWWHOHVHQ6LHGDV+DQGEXFKGDKHUVRUJIlOWLJEHYRU6LHGDV*HUlWLQ%HWULHEQHKPHQ
Bei Umsetzung der in diesem Handbuch enthaltenen Anweisungen erhalten Sie dank der von Ihnen gekauften Luft-Wasser:lUPHSXPSHSUREOHPORVRSWLPDOH5DXPEHGLQJXQJHQEHLPLQLPDOHP(QHUJLHDXIZDQG
ACHTUNG
'DV+DQGEXFKLVWLQ$EVFKQLWWHRGHU.DSLWHOJHJOLHGHUW
KAP. 1 ALLGEMEINES
'LHVHV.DSLWHOULFKWHWVLFKDQGHQ)DFKLQVWDOODWHXUXQGDQGHQ(QGDQZHQGHU
(QWKlOW ,QIRUPDWLRQHQ WHFKQLVFKH 'DWHQ XQG ZLFKWLJH +LQZHLVH GLH YRU GHU ,QVWDOODWLRQ XQG %HGLHQXQJ GHU /XIW:DVVHU
:lUPHSXPSHEHNDQQWVHLQPVVHQ
KAP. 2 INSTALLATION
Richtet sich nur und ausschließlich an den Fachinstallateur.
(QWKlOWDOOHQRWZHQGLJHQ,QIRUPDWLRQHQ]XU3RVLWLRQLHUXQJXQG0RQWDJHGHU/XIW:DVVHU:lUPHSXPSHDP$XIVWHOOXQJVRUW
'LH,QVWDOODWLRQGHU/XIW:DVVHU:lUPHSXPSHGXUFKQLFKWTXDOL¿]LHUWHV3HUVRQDOIKUW]XP9HUIDOOGHU*DUDQWLH
KAP. 3 BEDIENUNG UND WARTUNG
HQWKlOW GLH ]XP 9HUVWlQGQLV GHU %HGLHQXQJ XQG 3URJUDPPLHUXQJ GHU /XIW:DVVHU:lUPHSXPSH XQG GHU ZLFKWLJVWHQ
Wartungseingriffe erforderlichen Informationen.
Dokument mit Eigentumsvorbehalt im Sinne des Gesetzes mit dem Verbot der Reproduktion oder Weitergabe an Dritte ohne
ausdrückliche Genehmigung de Firma OLIMPIA SPLENDID.
Die Maschinen können Aktualisierungen unterliegen und Teile aufweisen, die von den dargestellten verschieden sind, ohne dass
GDYRQGLH*OWLJNHLWGHULQGLHVHP+DQGEXFKHQWKDOWHQHQ7H[WHEHHLQWUlFKWLJWZLUG
/HVHQ6LHGLHVHV+DQGEXFKDXIPHUNVDPEHYRU6LHLUJHQGHLQHQ(LQJULII,QVWDOODWLRQ:DUWXQJ%HGLHQXQJGXUFKIKUHQ
XQGKDOWHQ6LHVLFKVWULNWDQGLH%HVFKUHLEXQJHQLQGHQHLQ]HOQHQ.DSLWHOQ
DIE HERSTELLERFIRMA ÜBERNIMMT KEINERLEI VERANTWORTUNG FÜR SCHÄDEN AN PERSONEN ODER
GEGENSTÄNDEN AUFGRUND DER NICHTBEACHTUNG DER IN DIESER BROSCHÜRE ENTHALTENEN VORSCHRIFTEN.
'LH+HUVWHOOHU¿UPDEHKlOWVLFKGDV5HFKWDXIMHGHU]HLWLJHbQGHUXQJHQDQLKUHQ0RGHOOHQYRU'LHLQGLHVHP+DQGEXFKEHVFKULHEHQHQ
grundlegenden Eigenschaften bleiben davon unberührt.
'LH,QVWDOODWLRQXQG:DUWXQJYRQ.OLPDJHUlWHQZLHGHPKLHUEHVFKULHEHQHQNDQQJHIlKUOLFKVHLQZHLOVLFKLP,QQHUQGLHVHU*HUlWH
HLQXQWHU'UXFNVWHKHQGHV.KOJDVVRZLHHOHNWULVFKH.RPSRQHQWHQXQWHU'UXFNEH¿QGHQ
,QVWDOODWLRQHUVWH,QEHWULHEQDKPHXQGGLHDQVFKOLH‰HQGHQ:DUWXQJVSKDVHQVLQGGDKHUDXVVFKOLH‰OLFKGXUFKEHIXJWHV
)DFKSHUVRQDODXV]XIKUHQVLHKH)RUPXODU]XU$QIRUGHUXQJGHV6WDUWVLQGHU$QODJH]XP*HUlW
'LHVH(LQKHLWVWHKWLQhEHUHLQVWLPPXQJPLWIROJHQGHQ(XURSDULFKWOLQLHQ
‡ 1LHGHUVSDQQXQJ(*
‡ (OHNWURPDJQHWLVFKH9HUWUlJOLFKNHLW(*
‡ %HVFKUlQNXQJHQ]XU9HUZHQGXQJYRQEHVWLPPWHQJHIlKUOLFKHQ6WRIIHQLQHOHNWULVFKHQXQGHOHNWURQLVFKHQ*HUlWH
&(5+26
‡ (OHNWURXQG(OHNWURQLN$OWJHUlWH&(:(((XQGDQVFKOLH‰HQGHbQGHUXQJHQ
Installationen, die ohne Beachtung der in diesem Handbuch enthaltenen Anweisungen ausgeführt werden, sowie die Benutzung
außerhalb der vorgeschriebenen Temperaturgrenzen führen zum Verfall der Garantie.
'LHSURJUDPPLHUWH:DUWXQJXQGGLHlX‰HUH*HQHUDOUHLQLJXQJN|QQHQDXFKYRP%HQXW]HUDXVJHIKUWZHUGHQGDHVVLFKQLFKW
XPVFKZLHULJHRGHUJHIlKUOLFKH(LQJULIIHKDQGHOW
:lKUHQGGHU0RQWDJHXQGEHLMHGHP:DUWXQJVHLQJULIILVWHVQRWZHQGLJGLHLQGLHVHP+DQGEXFKXQGDXIGHQ(WLNHWWHQLP
,QQHUQGHU*HUlWHDQJHJHEHQHQ9RUVLFKWVPD‰QDKPHQHLQ]XKDOWHQVRZLHDOOHQDFKDOOJHPHLQHU(UNHQQWQLVQDKHOLHJHQGHQ
VRZLHDXIJUXQGDP,QVWDOODWLRQVRUWJHOWHQGHU%HVWLPPXQJHQYRUJHJHEHQHQ6FKXW]YRUNHKUXQJHQ]XWUHIIHQ
(V LVW HUIRUGHUOLFK EHL GHU 'XUFKIKUXQJ YRQ (LQJULIIHQ DQ GHQ .KOVHLWH GHU *HUlWH VWHWV 6FKXW]KDQGVFKXKH XQG
6FKXW]EULOOHQ]XWUDJHQ
'LH/XIW:DVVHU:lUPHSXPSHQ'h5)(11,&+7LQ8PJHEXQJHQPLW9RUNRPPHQHQWÀDPPEDUHURGHUH[SORVLYHU*DVH
LQVHKUIHXFKWHQ8PJHEXQJHQ:lVFKHUHLHQ7UHLEKlXVHUQXVZRGHULQ5lXPHQLQGHQHQVLFKZHLWHUHVWDUNH:lUPH
DEJHEHQGH0DVFKLQHQEH¿QGHQEHWULHEHQZHUGHQ
%HL$XVZHFKVHOXQJYRQ.RPSRQHQWHQYHUZHQGHQ6LHDXVVFKOLH‰OLFK2ULJLQDOHUVDW]WHLOHYRQ2/,03,$63/(1','
85
DEUTSCHE
1.1
ALLGEMEINES
1
WICHTIG!
=XU9RUEHXJXQJMHJOLFKHU6WURPVFKODJJHIDKULVWXQEHGLQJWGHU+DXSWVFKDOWHUDE]XVWHOOHQEHYRULUJHQGZHOFKHHOHNWULVFKHQ
$QVFKOVVHKHUJHVWHOOWRGHU:DUWXQJVDUEHLWHQDQGHQ*HUlWHQGXUFKJHIKUWZHUGHQ0DFKHQ6LHGLHVH$QZHLVXQJHQ
GHPJHVDPWHQLQGHQ7UDQVSRUWXQGGLH,QVWDOODWLRQGHU0DVFKLQHHLQEH]RJHQHQ3HUVRQDOEHNDQQW
ENTSORGUNG
Das Symbol auf dem Produkt oder auf der Packung zeigt an, dass das Produkt nicht als normaler Hausabfall zu betrachten,
VRQGHUQHLQHUIUGDV5HF\FOLQJHOHNWULVFKHUXQGHOHNWURQLVFKHU*HUlWH]XVWlQGLJHQ6WHOOH]XEHUJHEHQLVW
Indem Sie dieses Produkt auf geeignete Weise entsorgen, tragen Sie dazu bei, möglichen negativen Folgen für die Gesundheit
und die Umwelt vorzubeugen. die aus einer nicht fachgerechten Entsorgung des Produkts entstehen könnten.
%H]JOLFKGHWDLOOLHUWHU,QIRUPDWLRQHQ]XP5HF\FOLQJGLHVHV3URGXNWVQHKPHQ6LH.RQWDNWPLWGHU]XVWlQGLJHQVWlGWLVFKHQ%HK|UGH
GHU|UWOLFKHQ$EIDOOHQWVRUJXQJVVWHOOHRGHUGHP*HVFKlIWLQGHP6LHGDV3URGXNWJHNDXIWKDEHQDXI
Diese Vorschrift gilt nur in den Mitgliedsstaaten der EG.
1.2
SYMBOLGEBUNG
'LH LP IROJHQGHQ .DSLWHO ZLHGHUJHJHEHQHQ 3LNWRJUDPPH HUODXEHQ GLH VFKQHOOH XQG HLQGHXWLJH /LHIHUXQJ GHU ]XU NRUUHNWHQ
Bedienung der Maschine unter Sicherheitsbedingungen erforderlichen Informationen.
1.2.1
Redaktionelle Piktogramme
Service
‡ .HQQ]HLFKQHW6LWXDWLRQHQLQGHQHQGHUEHWULHEOLFKH6(59,&(]XLQIRUPLHUHQLVW
TECHNISCHER KUNDENDIENSTSERVICE
=HLJH¿QJHU
‡ 'LHPLWGLHVHP6\PEROJHNHQQ]HLFKQHWHQ$EVFKQLWWHHQWKDOWHQ,QIRUPDWLRQHQXQG9RUVFKULIWHQGLHLQVEHVRQGHUHKLQVLFKWOLFK
der Sicherheit sehr wichtig sind.
Die Nichtbeachtung kann folgende Auswirkungen haben:
‡ 9HUOHW]XQJVJHIDKUIUGLH%HGLHQHU
‡ 9HUOXVWGHU9HUWUDJVJDUDQWLH
‡ 9HUIDOOGHU+DIWXQJVHLWHQVGHU+HUVWHOOHU¿UPD
(UKREHQH Hand
‡ .HQQ]HLFKQHW+DQGOXQJHQGLHLQNHLQHP)DOO]XOlVVLJVLQG
3LNWRJUDPPHEH]JOLFKGHU6LFKHUKHLW
*HIlKUOLFKHHOHNWULVFKH6SDQQXQJ
‡ =HLJWGHPEHWURIIHQHQ3HUVRQDODQGDVVGHUEHVFKULHEHQH9RUJDQJIDOOVQLFKWXQWHU(LQKDOWXQJGHU6LFKHUKHLWVYRUVFKULIWHQ
durchgeführt, die Gefahr eines elektrischen Stromschlags mit sich bringt.
$OOJHPHLQH*HIDKU
‡ =HLJWGHPEHWURIIHQHQ3HUVRQDODQGDVVGHUEHVFKULHEHQH9RUJDQJIDOOVQLFKWXQWHU(LQKDOWXQJGHU6LFKHUKHLWVYRUVFKULIWHQ
durchgeführt, die Gefahr von Verletzungen mit sich bringt.
*HIDKUGXUFKJUR‰H+LW]H
‡ =HLJWGHPEHWURIIHQHQ3HUVRQDODQGDVVGHUEHVFKULHEHQH9RUJDQJIDOOVQLFKWXQWHU(LQKDOWXQJGHU6LFKHUKHLWVYRUVFKULIWHQ
GXUFKJHIKUWGLH*HIDKUYRQ9HUEUHQQXQJHQGXUFKGDV%HUKUHQVHKUKHL‰HU.RPSRQHQWHQPLWVLFKEULQJW
DEUTSCHE
1.3
86
WARNHINWEISE
‡
'LH,QVWDOODWLRQLVWYRP9HUWUDJVKlQGOHURGHUDQGHUHP)DFKSHUVRQDODXV]XIKUHQ:HQQGLH,QVWDOODWLRQQLFKWNRUUHNWDXVJHIKUW
worden ist, kann das Risiko des Wasseraustritts, eines elektrischen Stromschlags oder von Brand bestehen.
‡
,QVWDOOLHUHQ6LHGLH/XIW:DVVHU:lUPHSXPSHXQWHU%HIROJHQGHULQGLHVHP+DQGEXFKHQWKDOWHQHQ$QZHLVXQJHQ:HQQGLH
Installation nicht korrekt ausgeführt worden ist, kann das Risiko des Wasseraustritts, eines elektrischen Stromschlags oder
von Brand bestehen.
‡
%LWWH YHUZHQGHQ 6LH DXVVFKOLH‰OLFK GLH PLWJHOLHIHUWHQ VSH]L¿VFK IU GLH ,QVWDOODWLRQ YRUJHVHKHQHQ .RPSRQHQWHQ 'LH
9HUZHQGXQJYRQGLHVHQYHUVFKLHGHQHQ.RPSRQHQWHQNDQQGDV5LVLNRGHV:DVVHUDXVWULWWVHLQHVHOHNWULVFKHQ6WURPVFKODJV
oder von Brand herbeiführen.
‡
1DFK$EVFKOXVVGHU,QVWDOODWLRQVWHOOHQ6LHVLFKHUGDVVNHLQ.KOPLWWHODXVWULWWEHL$XVVHW]XQJDQ)HXHUHU]HXJWGDV.KOPLWWHO
giftige Gase.
‡
6WHOOHQ6LHEHLGHU,QVWDOODWLRQRGHUGHU$XIVWHOOXQJGHU$QODJHVLFKHUGDVVNHLQHUOHLYRPVSH]L¿]LHUWHQ.KOPLWWHO5$
YHUVFKLHGHQH6XEVWDQ]ZLH]XP%HLVSLHO/XIWLQGHQ.KOPLWWHONUHLVHLQGULQJWGDV9RUKDQGHQVHLQYRQ/XIWRGHUDQGHUHQ
)UHPGVXEVWDQ]HQLP.KONUHLVNDQQ]XHLQHPDEQRUPHQ'UXFNDQVWLHJRGHUHLQHP'HIHNWLQGHU$QODJHPLWGDUDXVIROJHQGHQ
3HUVRQHQVFKlGHQIKUHQ
1
‡
'LH,QVWDOODWLRQGHUOLIMPIA SPLENDID*HUlWHLVWGXUFKHLQH)DFK¿UPDDXV]XIKUHQGLHEHL$EVFKOXVVGHU$UEHLWHQGHP
9HUDQWZRUWOLFKHQGHU$QODJHHLQH(UNOlUXQJ]XU.RQIRUPLWlWPLWGHQJHOWHQGHQ9RUVFKULIWHQXQGGHQYRQOLIMPIA SPLENDID
in diesem Handbuch festgesetzten Anweisungen übergibt.
‡
%HLP$XVWUHWHQYRQ:DVVHUVFKDOWHQ6LHGLH$QODJHDXVXQGXQWHUEUHFKHQ6LHGLH9HUVRUJXQJHQGHU,QQHQHLQKHLWHQXQG
Außeneinheiten mit Hilfe de Hauptschalter.
5XIHQ6LHXQYHU]JOLFKGHQ7HFKQLVFKHQ.XQGHQGLHQVWYRQOLIMPIA SPLENDID oder entsprechendes Fachpersonal und
JUHLIHQ6LHQLFKWVHOEVWDP*HUlWHLQ
1.4
‡
6ROOWHHLQ+HL]NHVVHOLQGHU$QODJHYRUKDQGHQVHLQVWHOOWHQ6LHZlKUHQGGHV%HWULHEVGHVVHOEHQVLFKHUGDVVGLH7HPSHUDWXU
GHVLP,QQHUQGHU/XIW:DVVHU:lUPHSXPSHXPODXIHQGH:DVVHUƒ&QLFKWEHUVWHLJW
‡
'LHVH%HGLHQXQJVDQOHLWXQJLVW%HVWDQGWHLOGHV*HUlWVXQGHQWVSUHFKHQGVRUJIlOWLJDXI]XEHZDKUHQ6LHKDWGDV*HUlWSTETS
]XEHJOHLWHQDXFKEHLhEHUJDEHDQHLQHQDQGHUHQ%HVLW]HURGHU$QZHQGHURGHUEHLhEHUWUDJXQJDXIHLQHDQGHUH$QODJH
)RUGHUQ6LHEHL%HVFKlGLJXQJRGHU9HUOXVWHLQDQGHUHV([HPSODUEHLP7HFKQLVFKHQ.XQGHQGLHQVWYRQOLIMPIA SPLENDID
Ihres Gebietes an.
‡
6WHOOHQ6LHVLFKHUGDVVGHU(UGDQVFKOXVVKHUJHVWHOOWZLUG/HJHQ6LHGDV*HUlWQLFKWDQ0DVVHDXI9HUWHLOHURKUOHLWXQJHQ
hEHUVSDQQXQJVDEOHLWHURGHUDQGLH(UGXQJGHU7HOHIRQOHLWXQJ%HLIHKOHUKDIWHU$XVIKUXQJNDQQGHU(UGDQVFKOXVV8UVDFKH
IUHOHNWULVFKH6WURPVFKOlJHVHLQ0RPHQWDQHhEHUVWU|PHKRKHU,QWHQVLWlWGXUFK%OLW]HRGHUDQGHUH8UVDFKHQN|QQHQGLH
/XIW:DVVHU:lUPHSXPSHEHVFKlGLJHQ
‡
'LH ,QVWDOODWLRQ HLQHV (UGVFKOXVVVFKDOWHUV ZLUG HPSIRKOHQ 'LH IHKOHQGH ,QVWDOODWLRQ GLHVHU 9RUULFKWXQJ NDQQ HOHNWULVFKH
6WURPVFKOlJHYHUXUVDFKHQ
GRUNDLEGENDE SICHERHEITSREGELN
Bitte beachten Sie, dass bei der Verwendung von Produkten, die elektrische Energie und Wasser verbrauchen, die Einhaltung
einiger grundlegender Regeln erforderlich ist, darunter:
'LH%HQXW]XQJGHV*HUlWVGXUFK.LQGHUXQGXQJHHLJQHWHQLFKWXQWHUVWW]WH3HUVRQHQLVWYHUERWHQ
'LH%HUKUXQJGHV*HUlWHVZHQQ6LHEDUIX‰VLQGRGHUPLWQDVVHQRGHUIHXFKWHQ.|USHUWHLOHQLVWYHUERWHQ
-HJOLFKHU5HLQLJXQJVHLQJULIIYRUGHP$EWUHQQHQGHV*HUlWHVYRQGHUHOHNWULVFKHQ6WURPYHUVRUJXQJGXUFK6WHOOHQGHV
+DXSWVFKDOWHUVGHU$QODJHDXI³$XV´LVWYHUERWHQ
(VLVWYHUERWHQGLH6LFKHUKHLWVRGHU5HJHOYRUULFKWXQJHQRKQH*HQHKPLJXQJXQG$QZHLVXQJHQGHV+HUVWHOOHUVGHV
*HUlWHV]XlQGHUQ
(VLVWYHUERWHQGLHDXVGHP*HUlWWUHWHQGHQ(OHNWURNDEHO]X]LHKHQ]XO|VHQRGHU]XYHUGUHKHQDXFKZHQQGDV*HUlW
von der Stromversorgung getrennt ist.
(VLVWYHUERWHQ*HJHQVWlQGHRGHU6XEVWDQ]HQGXUFKGLH/XIWVDXJXQG±GUXFNOHLWXQJHQHLQ]XIKUHQ
'LHgIIQXQJGHU=XJDQJVWUHQ]XGHQ,QQHQWHLOHQGHV*HUlWHVRKQH]XYRUGHQ+DXSWVFKDOWHUGHU$QODJHDXI³$XV´
JHVWHOOW]XKDEHQLVWYHUERWHQ
(VLVWYHUERWHQGDV9HUSDFNXQJVPDWHULDOIU.LQGHUHUUHLFKEDU]XODVVHQGDGLHVHLQHSRWHQWLHOOH*HIDKUHQTXHOOHGDUVWHOOW
5$QLFKWLQGLH$WPRVSKlUHDXVODVVHQ5$LVWHLQLP.\RWR3URWRNROOYHU]HLFKQHWHV)OXRUJDVPLWHLQHPJOREDOHP
7UHLEKDXVSRWHQWLDO*:3 ERHALT UND AUSPACKEN
Die Verpackung besteht aus geeignetem Material und wird von Fachpersonal ausgeführt. Die Einheiten werden komplett und
LQHLQZDQGIUHLHP=XVWDQGJHOLHIHUW%HDFKWHQ6LH]XU.RQWUROOHGHU7UDQVSRUWVHUYLFH4XDOLWlWGHQQRFKIROJHQGH$QZHLVXQJHQ
‡ 3UIHQ6LHEHLP(UKDOWGHU3DFNXQJHQREGLHVH6FKlGHQDXIZHLVHQ1HKPHQ6LHLPSRVLWLYHQ)DOOGLH:DUHPLW9RUEHKDOW
DQXQGIHUWLJHQ6LH)RWRV]XP1DFKZHLVHYHQWXHOOHUVLFKWEDUHU6FKlGHQDQ
‡ (QWIHUQHQ6LHGLH9HUSDFNXQJXQGSUIHQ6LHGDV9RUKDQGHQVHLQGHUHLQ]HOQHQ.RPSRQHQWHQDQKDQGGHU3DFNOLVWHQ
‡ 6WHOOHQ6LHVLFKHUGDVVNHLQH.RPSRQHQWHQ7UDQVSRUWVFKlGHQDXIZHLVHQ%HQDFKULFKWLJHQ6LHEHL6FKlGHQGHQ6SHGLWHXU
innerhalb von 3 Tagen per Einschreiben mit Rückschein und Vorlage der Fotodokumentation.
Senden Sie die analoge Information auch per Fax an OLIMPIA SPLENDID.
1DFK$EODXIYRQ7DJHQDEGHU$XVOLHIHUXQJN|QQHQNHLQH,QIRUPDWLRQHQKLQVLFKWOLFKGDYRQJHWUDJHQHU6FKlGHQEHUFNVLFKWLJW
ZHUGHQ%HLDOOHQ6WUHLWIlOOHQLVWGHU]XVWlQGLJH*HULFKWVVWDQG5(**,2(0,/,$
DEUTSCHE
1.5
87
1
1.6
AUSSENEINHEIT $EE
'LH$X‰HQHLQKHLW$EELVWLQVHFKV0RGHOOHQHUKlOWOLFK
OS-CEBSH24EI
OS-CEBCH36EI
OS-CEBCH48EI
OS-CEBTH48EI
OS-CEBCH60EI
Breite mm
842
990
940
940
940
940
Tiefe mm
324
324
360
360
360
360
Höhe mm
695
695
1245
1245
1245
1245
Gewicht kg
61
82
106
99
106
104
1.7
INNENEINHEIT $EE
'LH,QQHQHLQKHLW$EELVWLQYLHU0RGHOOHQHUKlOWOLFK
Breite mm
7LHIH%HGLHQWDIHOPP
1.8
SMALL
SMALL 3W
BIG
BIG 3W
500
500
500
500
280 + 16
280 + 16
280 + 16
280 + 16
Höhe mm
810
810
810
810
Gewicht kg
36
36,3
38
38,3
LISTE DER HAUPTKOMPONENTEN DER INNENEINHEIT $EE
A
B
C
D
E
F
G
H
I
K
L
M
N
O
P
Q
R
1.9
OS-CEBTH60EI
Wassereinlass
Sicherheitsventil 3 bar
3ODWWHQZlUPHEHUWUDJHU
)OXVVZlFKWHU
Manometer
([SDQVLRQVJHIl‰
.ROOHNWRUIUHOHNWULVFKH:LGHUVWlQGH
Automatischer Luftauslass
Wasserpumpe
'UHLZHJYHQWLOLQWHJULHUWDQ%RUGGHU0DVFKLQHLQGHU9HUVLRQ:
Anlagen-Wasseraustritt
$XVJDQJIUKHL‰HV6DQLWlUZDVVHUYRUKDQGHQQXULQGHU9HUVLRQ:
Gruppe elektrische Schalttafel
Bedientafel
6LFKHUKHLWVWKHUPRVWDWIUHOHNWULVFKH:LGHUVWlQGHPLWPDQXHOOH5FNVHW]XQJ
6LFKHUKHLWVWKHUPRVWDWIUHOHNWULVFKH:LGHUVWlQGHPLWDXWRPDWLVFKHU5FNVHW]XQJ
Hauptschalter
VERZEICHNIS DER MITGELIEFERTEN KOMPONENTEN UND BESCHREIBUNG DER TEILE
DEUTSCHE
'LH*HUlWHZHUGHQPLW6WDQGDUGYHUSDFNXQJEHVWHKHQGDXV.DUWRQXPKOOXQJXQGHLQHU5HLKHYRQ6FKDXPVWRII6FKXW]HOHPHQWHQ
versandt.
8QWHUGHU9HUSDFNXQJGHU$X‰HQHLQKHLWEH¿QGHWVLFKHLQHNOHLQH3DOHWWH]XU8QWHUVWW]XQJGHU7UDQVSRUWXQG9HUVFKLHEHYRUJlQJH
ZlKUHQGGLH3DFNXQJGHU,QQHQHLQKHLWPLW*ULIIHQIUHLQHOHLFKWHUH%HZHJXQJDXVJHVWDWWHWLVW
,P,QQHUQGHU3DFNXQJGHU,QQHQHLQKHLWEH¿QGHQVLFKIROJHQGH]XP/LHIHUXPIDQJGHV*HUlWVJHK|UHQGH7HLOH
‡ :DQGEJHO]XU9HUDQNHUXQJGHV*HUlWV
‡ 6FKDEORQHIUGLH:DQGLQVWDOODWLRQ
‡ <)LOWHUVLHEPLW´))$QVFKOVVHQ/LFKWH:HLWHGHU0DVFKHPP
‡ .XJHOYHQWLO´QXUIU0RGHOOH:
‡ 6FKDEORQHIUGLH3RVLWLRQLHUXQJGHU(LQKHLWDQGHU:DQG
88
2
2
INSTALLATION
=XU*HZlKUOHLVWXQJHLQHUHLQZDQGIUHLHQ,QVWDOODWLRQXQGRSWLPDOHU%HWULHEVOHLVWXQJHQVLQGGLH$QZHLVXQJHQLQGLHVHP+DQGEXFK
VWULNW]XEHIROJHQ'LHQLFKWHUIROJWH$QZHQGXQJGHUDQJHJHEHQHQ9RUVFKULIWHQNDQQ%HWULHEVVW|UXQJHQDQGHQ*HUlWHQYHUXUVDFKHQ
und entbindet die Firma OLIMPIA SPLENDIDDXVMHGHU)RUPGHU*HZlKUOHLVWXQJVSÀLFKWVRZLHGHU+DIWXQJIUHYHQWXHOOH6FKlGHQ
DQ3HUVRQHQ7LHUHQRGHU*HJHQVWlQGHQ
(VLVWZLFKWLJGDVVGLHHOHNWULVFKH$QODJHJHPl‰GHQJHOWHQGHQ9RUVFKULIWHQXQWHU(LQKDOWXQJGHULP.DSLWHO³7HFKQLVFKH'DWHQ´
enthaltenen Werte ausgeführt wird und dass sie mit einer korrekten Erdung versehen wird.
'DV*HUlWLVWLQHLQHU3RVLWLRQ]XLQVWDOOLHUHQZHOFKHGLH:DUWXQJXQWHUVWW]W
2.1
INSTALLATION DER INNENEINHEIT $EE
Es sind vorzusehen:
‡ 9LHUIUGHQ+DOWHUXQJVW\SJHHLJQHWH0'EHO]XU%HIHVWLJXQJDQ:DQG
‡ (LQ IUHLHU VHLWOLFKHU$EVWDQG YRQ PLQGHVWHQV FP DXVUHLFKHQG ]XU (QWIHUQXQJ GHU$EGHFNXQJHQ IU GLH (LQJULIIH GHU
programmierten und außerordentlichen Wartung
‡ :DVVHUDEÀXVVLQGHU1lKH
‡ HLQHNRQIRUPHHOHNWULVFKH6WURPYHUVRUJXQJLQGHU1lKHGHU,QQHQHLQKHLW
‡ HLQH:DVVHUYHUVRUJXQJ]XP)OOHQGHV:DVVHUNUHLVHV
‡ .RPPXQLNDWLRQVNDEHO]ZLVFKHQGHU,QQHQHLQKHLWXQGGHU$X‰HQHLQKHLWVLHKH$EV
Die Inneneinheit ist stets auf Mannhöhe an der Wand im Innern der Wohnung zu befestigen.
1HKPHQ6LHEH]JOLFKGHU,QVWDOODWLRQVDEVWlQGHXQGGLH3RVLWLRQGHU5RKUH%H]XJDXIGLH$EEXQGYHUZHQGHQ6LHPLWGHU
Einheit gelieferte Schablone.
2.1.1
Öffnung der Blenden$EE
gIIQHQ6LHGLH.ODSSH$EE3RV$LQGHP6LHGHQREHUHQ7HLOQDFKDX‰HQ]LHKHQ'LH.ODSSH|IIQHWVLFKQDFKXQWHQ
/|VHQ6LH6FKUDXEHQ]XU%HIHVWLJXQJGHU9RUGHUEOHQGH$EE3RV%
6WHOOHQ6LHGLH9RUGHUEOHQGHKRFKXQG]LHKHQ6LH]XVLFK$EE3RV&
2.1.2
Zugriff auf die Innenkomponenten$EE
,P,QQHUQGHUHOHNWULVFKHQ6FKDOWWDIHOVLQGIROJHQGH.RPSRQHQWHQXQWHUJHEUDFKW$EE
A .DEHOHLQJDQJ
B Versorgungsklemmleiste Inneneinheit
C .OHPPOHLVWHIUGHQ9HUEUDXFKHUDQVFKOXVV
D .DEHOVLFKHUXQJ
E 7KHUPRPDJQHWVFKDOWHUHOHNWULVFKH:LGHUVWlQGH
F 6LFKHUKHLWVVFKW]IUHOHNWULVFKH:LGHUVWlQGH
G 5HODLVIU:LGHUVWlQGH
H EMC Filter
I (OHNWURQLVFKH.RQWUROONDUWH
L Schmelzsicherung 250V 5A T
2.2
INSTALLATION DER AUSSENEINHEIT $EE
Installieren Sie die Außeneinheit auf einem festen Untersatz mit Eignung zur Aufnahme des Gewichts. Wenn die Außeneinheit
XQYROOVWlQGLJRGHUDXIHLQHPQLFKWSDVVHQGHQ8QWHUVDW]LQVWDOOLHUWZLUGN|QQWHGLHVHVLFKYRP8QWHUVDW]O|VHQXQG6FKlGHQ
DQ3HUVRQHQRGHU*HJHQVWlQGHQYHUXUVDFKHQ(VLVWVHKUZLFKWLJGDVVGHU,QVWDOODWLRQVRUWPLWK|FKVWHU6RUJIDOWJHZlKOWZLUG
XPHLQHQDQJHPHVVHQHQ6FKXW]GHV*HUlWVYRUP|JOLFKHQ6W|‰HQXQGGDUDXVIROJHQGHQ6FKlGHQ]XJDUDQWLHUHQ:lKOHQ6LH
HLQHQDXVHLFKHQGEHOIWHWHQ2UWDQGHPZlKUHQGGHU6RPPHUVDLVRQGLH$X‰HQWHPSHUDWXUƒ&QLFKWEHUVWHLJW
/DVVHQ6LHDXVUHLFKHQGIUHLHQ$EVWDQGXPGDV*HUlWXPGLH5H]LUNXODWLRQ]XYHUPHLGHQXQGGLH:DUWXQJVHLQJULIIH]XXQWHUVWW]HQ
6HKHQ6LHHLQH.LHVVFKLFKWIUGLH'UlQDJHGHV7DXZDVVHUVXQWHUGHP*HUlWYRU/DVVHQ6LHIUHLHQ3ODW]XQWHUGHU(LQKHLWXP
GDV*HIULHUHQGHV7DXZDVVHUV]XYHUPHLGHQ6WHOOHQ6LHEHLQRUPDOHQ9HUKlOWQLVVHQHLQH8QWHUVDW]K|KHYRQPLQGHVWHQVFP
vor. Für den Einsatz in Regionen mit kalten Wintern ist eine Höhe von mindestens 15 cm von den Füßen in beide Richtungen
GHU(LQKHLWYRU]XVHKHQ%HLGHU,QVWDOODWLRQDQ2UWHQPLWVWDUNHP6FKQHHIDOOPRQWLHUHQ6LHGLH*HUlWHKDOWHUXQJDXIHLQHU+|KH
über der maximalen Schneehöhe.
Installieren Sie Einheit so, dass sie nicht vom Wind durchzogen wird.
Es sind vorzusehen:
‡ 9LEUDWLRQVVFKXW]EO|FNH
‡ HLQHNRQIRUPHHOHNWULVFKH6WURPYHUVRUJXQJLQGHU1lKHGHU$X‰HQHLQKHLW
89
DEUTSCHE
)UGHQ=XJULIIDXIGLH,QQHQNRPSRQHQWHQGHUHOHNWULVFKHQ6FKDOWWDIHOHQWIHUQHQ6LHGLHEHLGHQ6FKUDXEHQ$EE3RV$]XU
%HIHVWLJXQJGHV'HFNHOVGHUVHOEHQDXIGHUOLQNHQ6HLWH)UGHQ=XJULIIDXIGLH.RPSRQHQWHQKLQWHUGHUHOHNWULVFKHQ6FKDOWWDIHO
HQWIHUQHQ6LHGLHYLHU6FKUDXEHQ$EE3RV$XQGGUHKHQ6LHGLH7DIHODQGHQ6FKDUQLHUHQDXIGHUUHFKWHQ6HLWHGHU7DIHO
'LHHOHNWULVFKH6FKDOWWDIHONDQQDXVJHKlQJWXQGZLHGHUHLQJHKlQJWZHUGHQPLW+LOIHGHUHLJHQVYRUJHVHKHQHQ1XWHQGHUVHOEHQ
DXIGHUUHFKWHQ6HLWH$EE$XIGLHVH:HLVHLVWHVP|JOLFKDXIDOOH.RPSRQHQWHQLP,QQHUQGHV*HUlWHV]X]XJUHLIHQXQG
EHTXHPGLH,QVWDOODWLRQRGHU:DUWXQJGHV*HUlWVGXUFK]XIKUHQ
2
=XP/LHIHUXPJDQJGHU$X‰HQHLQKHLWJHK|UWHLQ$EGHFNQHW]IUGLH:lUPHEHUWUDJXQJVEDWWHULH'LHVH9RUULFKWXQJLVW
IU|IIHQWOLFK]XJlQJOLFKH,QVWDOODWLRQHQYRUJHVHKHQ'LH0RQWDJHGHV1HW]HVN|QQWHLP)DOOKRKHU/XIWIHXFKWLJNHLWEHL
QLHGULJHQ7HPSHUDWXUHQ1HEHORGHU6FKQHHGLH$QVDPPOXQJYRQ(LVXQWHUGHU%DWWHULHPLW$QQDKPHGHU6\VWHPOHLVWXQJHQ
YHUXUVDFKHQ
2.3
BETRIEBSGRENZEN $EE
'LH 'LDJUDPPH QDFK$EE GH¿QLHUHQ GLH *UHQ]ZHUWH IU GLH :DVVHUWHPSHUDWXU /:7 XQG GLH$X‰HQWHPSHUDWXU 2'7
LQQHUKDOE GHUHU GLH :lUPHSXPSH LQ GHQ EHLGHQ %HWULHEVDUWHQ .KOXQJ XQG +HL]XQJ6DQLWlUZDVVHUKHUVWHOOXQJ XQG .KOXQJ
laufen kann.
2.4
KÜHLANSCHLÜSSE $EE
=XU'H¿QLWLRQGHU.KODQVFKOXVVOHLWXQJHQ]ZLVFKHQGHU,QQHQHLQKHLWXQGGHU$X‰HQHLQKHLWQHKPHQ6LH%H]XJDXIGLHQDFKVWHKHQGH
Tabelle.
OSCEBSH24EI
OSCEBCH36EI
OSCEBCH48EI
OSCEBTH48EI
OSCEBCH60EI
OSCEBTH60EI
0D[LPDOH/lQJHGHU
$QVFKOXVVURKUHP
25
30
50
50
50
50
Maximale
Erhöhungsdifferenz
zwischen den beiden
Einheiten, wenn die
Außeneinheit oben
SRVLWLRQLHUWLVWP
12
20
25
30
25
30
Maximale
Erhöhungsdifferenz
zwischen den beiden
Einheiten, wenn die
Außeneinheit unten
SRVLWLRQLHUWLVWP
9
12
20
20
20
20
=XVDW].KOPLWWHOODGXQJ
pro Meter bei mehr als 5
0HWHU5RKUOHLWXQJHQJP
60
60
60
60
60
60
9HUZHQGHQ6LHDXVVFKOLH‰OLFK5RKUHPLW'XUFKPHVVHUQGLHGHQJHIRUGHUWHQ$EPHVVXQJHQHQWVSUHFKHQ*DVOHLWXQJVURKU´
)OVVLJNHLWVOHLWXQJVRKU´
'LHPD[LPDOH/lQJHGHU$QVFKOXVVOHLWXQJHQDQGLH,QQHQHLQKHLWPXVVLQhEHUHLQVWLPPXQJVWHKHQPLWGHU7DEHOOH'DEHLLVW
GLH$XIIOOXQJPLW5$ZLHYRUJHVHKHQYRU]XQHKPHQVLHKH$EV,QVWDOOLHUHQ6LHGLH(LQKHLWHQQLFKWEHUGHPPD[LPDO
]XOlVVLJHQ+|KHQXQWHUVFKLHG]ZLVFKHQ,QQHQHLQKHLWXQG$X‰HQHLQKHLW
9HUYROOVWlQGLJHQ6LHGHQ.KONUHLVLQGHP6LHGLH,QQHQHLQKHLWPLWWHOVGHULVROLHUHQ.XSIHUOHLWXQJHQPLWGHU$X‰HQHLQKHLWYHUELQGHQ
9HUZHQGHQ6LHDXVVFKOLH‰OLFKLVROLHUWH6SH]LDO.XSIHUURKUHIU.KOPLWWHOGLHVDXEHUXQGDQLKUHQ(QGHQGYHUVLHJHOWJHOLHIHUW
werden.
'LH.KODQVFKOVVHGHU,QQHQHLQKHLWEH¿QGHQVLFKKLQWHUGHUHOHNWULVFKHQ6FKDOWWDIHO'LH$QVFKOVVHGHU$X‰HQHLQKHLWEH¿QGHQ
sich auf der rechten Seite, für den Zugang ist der Schutz zu entfernen.
A *DVOHLWXQJ´,QQHQHLQKHLW
B )OVVLJNHLWVOHLWXQJ´,QQHQHLQKHLW
C 9HQWLO*DVOHLWXQJ´$X‰HQHLQKHLW
D 9HQWLO)OVVLJNHLWVOHLWXQJ´$X‰HQHLQKHLW
%HVWLPPHQ6LHGHQ9HUODXIGHU5RKUOHLWXQJHQGHUDUWGDVVGLH/lQJHXQGGLH.UPPXQJHQGHU6FKOlXFKHP|JOLFKVWJHULQJ
gehalten werden, um den maximalen Wirkungsgrad der Anlage zu erhalten.
%HIHVWLJHQ 6LH HLQHQ JHHLJQHW EHPHVVHQHQ .DEHOGXUFKJDQJVNDQDO P|JOLFKVW PLW ,QQHQWUHQQXQJ DQ GHU :DQG GXUFK GHQ
anschließend Schlauchleitungen und Stromkabel geführt werden.
6FKQHLGHQ6LHGLH6FKODXFKOHLWXQJHQPLWHLQHPhEHUVWDQGYRQ]LUNDFPDXIGHU/lQJH]X
DEUTSCHE
:,&+7,*)KUHQ6LHGHQ6FKQLWWDXVVFKOLH‰OLFKPLWHLQHP5DG5RKUVFKQHLGHUGXUFK'UFNHQ6LHGDEHLLQNOHLQHQ
$EVWlQGHQXPGHQ6FKODXFKQLFKW]XTXHWVFKHQ
‡
‡
‡
‡
‡
‡
‡
90
(QWIHUQHQ6LH*UDWJHJHEHQHQIDOOVPLWJHHLJQHWHP:HUN]HXJ
)KUHQ6LHYRUGHU$XVIKUXQJGHU.HOFKXQJGLH%HIHVWLJXQJVPXWWHULQGDV5RKU$EE$
)KUHQ6LHGLH.HOFKXQJPLW+LOIHGHVHQWVSUHFKHQGHQ:HUN]HXJVDQGHQ5RKUHQGHQHLQZDQGIUHLRKQH%UFKH5LVVHRGHU
6SDOWHDXV$EE%
6FKUDXEHQ6LHGLH0XWWHUGHV5RKUVPDQXHOODXIGDV$QVFKOXVVJHZLQGH
6FKUDXEHQ6LHHQGJOWLJ]XXQWHU9HUZHQGXQJHLQHV¿[HQ6FKUDXEHQVFKOVVHOV]XP)HVWKDOWHQGHV*HZLQGHWHLOV
GHV$QVFKOXVVHVXP9HUIRUPXQJHQ]XYHUPHLGHQXQGHLQHV'UHKPRPHQWVFKOVVHOVDXIGHU0XWWHU$EEGHU
PLWIROJHQGHQ:HUWHQDXIGHU*UXQGODJHGHU5RKUDEPHVVXQJHQMXVWLHUWLVW:
'XUFKPHVVHU¶¶1P$Q]XJVPRPHQW1P
'XUFKPHVVHU¶¶1P$Q]XJVPRPHQW1P
2
3UIXQJHQXQG.RQWUROOHQ$EE
1DFK)HUWLJVWHOOXQJGHU5RKUYHUELQGXQJHQLVWHLQHhEHUSUIXQJGHUHLQZDQGIUHLHQ'LFKWLJNHLWGHU.KODQODJHGXUFK]XIKUHQ
=XU'XUFKIKUXQJGHUQDFKVWHKHQGEHVFKULHEHQHQ$UEHLWVVFKULWWHLVWGLH9HUZHQGXQJHLQHUVSH]L¿VFKHQ0DQRPHWHU*UXSSHIU
R410A sowie einer Vakuumpumpe mit einer Mindestförderleistung von 40 l/min erforderlich:
1 /|VHQ6LHGLH9HUVFKOXVVNDSSHGHV6HUYLFH)LWWLQJVGHU*DVOHLWXQJ$EE3RV&
2 6FKOLH‰HQ6LHGLH9DNXXPSXPSHXQGGLH0DQRPHWHU*UXSSHPLW+LOIHYRQ6FKOlXFKHQPLW´$QVFKOXVVDP6HUYLFH)LWWLQJ
GHU*DVOHLWXQJDQ$EE
3 6FKDOWHQ6LHGLH3XPSHHLQXQG|IIQHQ6LHGLH+lKQHGHU0DQRPHWHU*UXSSH
4 6HQNHQ6LHGHQ'UXFNELVDXIN3DPP+JEDU
5 Halten Sie den Unterdruck für mindestens 1 Stunde bei.
6 6FKOLH‰HQ6LHGLH+lKQHGHU0DQRPHWHU*UXSSHXQGVFKDOWHQ6LHGLH3XPSHDE
7 *HKHQ6LHQDFK0LQXWHQQXUZHQQGHU'UXFNDXIN3DPP+JEDUJHEOLHEHQLVWDXIGHQ6FKULWWQDFK3XQNW
EHU:HQQGHU'UXFNLP,QQHUQGHV.UHLVHVDXIHLQHQ:HUWEHUN3DPP+JEDUJHVWLHJHQLVWPXVVGLH
XQGLFKWH6WHOOHJHVXFKWZHUGHQPLW+LOIHYRQ6HLIHQO|VXQJPLW.KONUHLVLQ6WLFNVWRIIGUXFNaEDU1DFK(UPLWWOXQJXQG
Reparatur der Stelle ist wieder bei Punkt 3 zu beginnen.
8 gIIQHQ6LHPLWHLQHPPP6HFKVNDQWVFKOVVHOGHQ6FKDIWGHV)OVVLJNHLWVYHQWLOVELVGLHVHVYROOVWlQGLJJH|IIQHWLVW
9 gIIQHQ6LHGHQ6FKDIWGHV*DVYHQWLOVXQWHU9HUZHQGXQJHLQHVPP6HFKVNDQWVFKOVVHOVYROOVWlQGLJ
10 Entfernen Sie den mit dem Service-Fitting des Gasrohrs verbundenen Schlauch.
11 6HW]HQ6LHGLH9HUVFKOXVVNDSSHGHV6HUYLFH)LWWLQJVGHU*DVOHLWXQJDXILKUHQ6LW]XQGEHIHVWLJHQVLHPLWHLQHP(QJOlQGHU
oder einem Maulschlüssel.
12 6HW]HQ6LHGLH9HUVFKOXVVNDSSHQGHU6HUYLFH9HQWLO6FKlIWHVRZRKOIU*DVDOVDXFKIU)OVVLJNHLWZLHGHUHLQXQGEHIHVWLJHQ
sie.
Abbildung 14:
A Ventilschaft
B Deckel für Ventilschaft
C Ladeöffnung
D Hauptventil
Abbildung 15:
A Manometer-Gruppe
B Eventueller Vakuummesser
C Vakuumpumpe
D 6FKODXFKKDKQRIIHQ
E 6HUYLFH)LWWLQJJHVFKORVVHQ
F Gasrohr
G Flüssigkeitsrohr
H Außeneinheit
/DGHQGHV=XVDW]NKOPLWWHOV$EE
:HQQGLH5RKUOHLWXQJHQOlQJHUDOVPVLQGIOOHQ6LH.KOPLWWHOQDFKZLHDQJHJHEHQLQGHU7DEHOOHLP$EV
7UDJHQ 6LH DXI GHU PLW GHU $X‰HQHLQKHLW JHOLHIHUWHQ (WLNHWWH $EE GLH /DGXQJ GHU $X‰HQHLQKHLW $ GLH 0HQJH GHV
=XVDW]NKOPLWWHOV%VRZLHGLH*HVDPWODGXQJGHV6\VWHPV$%HLQ
Abbildung 17:
A Manometer-Gruppe
B Eventueller Vakuummesser
C Hahn für Flüssigkeit der Flasche
D *DVÀDVFKH5$
E 6HUYLFH)LWWLQJJHVFKORVVHQ
F Gasrohr
G Flüssigkeitsrohr
H Außeneinheit
WASSERANSCHLÜSSE$EE
:DKOXQG,QVWDOODWLRQGH.RPSRQHQWHQIlOOWLQGLH=XVWlQGLJNHLWGHV,QVWDOODWHXUVGHUQDFKGHQ5HJHOQGHU.XQVWXQGXQWHU
Einhaltung der geltenden Gesetzgebung vorzugehen hat.
Vor dem Anschluss der Rohrleitungen ist sicherzustellen, dass diese keine Steine, Sand, Rost, Schlacken oder sonstige Fremdkörper
HQWKDOWHQZHOFKHGLH$QODJHEHVFKlGLJHQN|QQWHQ
(V HPS¿HKOW VLFK$XVIKUXQJ HLQHV %\SDVVHV LQ GHU$QODJH XP GDV :DVFKHQ GHV 3ODWWHQZlUPHEHUWUDJHUV RKQH7UHQQHQ
GHV*HUlWVDXVIKUHQ]XN|QQHQ'LH$QVFKOXVVURKUOHLWXQJHQVLQGVRDE]XVWW]HQGDVVLKU*HZLFKWQLFKWDXIGHP*HUlWODVWHW
'LH:DVVHUDQVFKOVVHVLQGLPXQWHUHQ7HLOGHU(LQKHLWSRVLWLRQLHUW$EE
'LH:DVVHUDQVFKOVVHZHUGHQGXUFKIROJHQGH,QVWDOODWLRQHQYHUYROOVWlQGLJW
‡ (QWOIWXQJVYHQWLODQGHQK|FKVWHQ6WHOOHQGHU5RKUOHLWXQJHQ
‡ HODVWLVFKHXQGELHJVDPH.XSSOXQJVHOHPHQWH
‡ 6SHUUYHQWLO
‡ :DVVHU¿OWHUVLHEPLWPP0DVFKHQ
‡ ,VROLHUHQ6LHDOOH:DVVHUDQVFKOXVVNRPSRQHQWHQXQG5RKUOHLWXQJHQWKHUPLVFK
91
DEUTSCHE
2.5
2
'HU0LQGHVW1HQQGXUFKPHVVHUGHU:DVVHUDQVFKOXVVURKUOHLWXQJHQPXVV´EHWUDJHQ
8P:DUWXQJVRGHU5HSDUDWXUDUEHLWHQP|JOLFK]XPDFKHQLVWHVXQYHU]LFKWEDUGDVVMHGHU:DVVHUDQVFKOXVVPLWGHQ
HQWVSUHFKHQGHQ+DQGVSHUUYHQWLOHQDXVJHVWDWWHWLVW
Die untenstehende Tabelle zeigt die Eigenschaften, die für die Wasseranlage vorgeschrieben sind.
OS-CEBSH24EI OS-CEBCH36EI OS-CEBCH48EI OS-CEBTH48EI OS-CEBCH60EI OS-CEBTH60EI
Einheit
NennWasserfördervolumen*
Inneneinheit SHERPA
SMALL
Inneneinheit SHERPA BIG
l/s
0,31
0,52
0,62
0,62
0,69
0,79
l
l
23
400
38
400
45
400
45
400
51
400
58
400
Wasserinhalt der
Anlage
Min
Max**
Betriebsdruck
Max
kPa
300
300
300
300
300
300
Höhenunterschied
Anlage
Max
m
20
20
20
20
20
20
* für Anlagen am Boden
** bei maximaler Anlagenwassertemperatur von 35 °C
Die Graphen in Abb. 19 zeigen für jede Geschwindigkeit des Wasserkreises die verfügbare Förderhöhe an den Wasseranschlüssen
der Inneneinheit.
6WHOOHQ6LHVLFKHUGDVVGLH(QHUJLHJHIlOOHGHU$QODJHGDVJHIRUGHUWH)|UGHUYROXPHQJDUDQWLHUHQVLHKH$EV
Sollten aufgrund starker Energiefälle der Anlage größere Förderhöhen erforderlich sein, ist die Hinzufügung eines Trägheitsgefäßes
oder eines Wasserabscheiders und einer externen Umführpumpe erforderlich.
6WHOOHQ6LHVLFKHUGDVVGLH$QODJHHLQHQJHIRUGHUWHQ0LQGHVWZDVVHULQKDOW]XU*HZlKUOHLVWXQJGHVHLQZDQGIUHLHQ%HWULHEVGHV
6\VWHPVKDW%HLXQ]XUHLFKHQGHU:DVVHUPHQJHIJHQ6LHHLQ6DPPHOJHIl‰]XU$XIQDKPHGHVJHIRUGHUWHQ,QKDOWVKLQ]X
'LH:DVVHU9HUWHLOHUURKUOHLWXQJHQVLQGDQJHPHVVHQHPLW3RO\lWK\OHQ6FKDXPVWRIIRGHUlKQOLFKHQ0DWHULDOLHQ]XLVROLHUHQ$XFK
6SHUUYHQWLOH.XUYHQXQG)LWWLQJVVLQGDQJHPHVVHQ]XLVROLHUHQ
=XU9HUPHLGXQJYRQ/XIWEODVHQLP,QQHUQGHV.UHLVODXIHVVROOWHQXQEHGLQJWDXWRPDWLVFKHRGHUPDQXHOOH(QWOIWXQJVYRUULFKWXQJHQ
LQDOOHQ3XQNWHQHLQJHVHW]WZHUGHQLQGHQHQVLFK/XIWVWDXHQNDQQK|KHUJHOHJHQH5RKUOHLWXQJHQ6LSKRQVXVZ
1DFKYROOVWlQGLJHU)OOXQJGHV:DVVHUNUHLVHVXQG6LFKHUVWHOOXQJGDVVNHLQH8QGLFKWLJNHLWHQYRUOLHJHQHQWIHUQHQ6LH
GHQ%HIHVWLJXQJVEJHOGHU8PODXISXPSH$EE3RV$LQGHP6LHGLH%HIHVWLJXQJVPXWWHU$EE3RV%O|VHQ
6HW]HQ6LHGLH0XWWHUZLHGHUHLQ
2.5.1
Wasserkreis $EE
DEUTSCHE
Der Wasserplan der Abb. 21 stellt die Hauptteile der Inneneinheit und einen typischen Wasserkreis dar.
1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
A
B
C
D
E
92
Wassereinlass
6LFKHUKHLWVYHQWLOEDU
Manometer
Temperatursonde Wasserrücklauf Anlage T1
3ODWWHQZlUPHEHUWUDJHU
Temperatursonde Wasserzuleitung Anlage T2
)OXVVZlFKWHU
([SDQVLRQVJHIl‰
.ROOHNWRUIUHOHNWULVFKH:LGHUVWlQGH
Automatischer Luftauslass
Umlaufpumpe
:HJ9HQWLOZHLFKHLQWHJULHUWDQ%RUGGHU0DVFKLQHDXI9HUVLRQ:
Anlagen-Wasseraustritt
:DVVHUDXVODVVIU6DQLWlUZDVVHUVWDX
1HW]ZDVVHU¿OWHU
.KOPLWWHOVFKODXFKDQVFKOVVH
7HPSHUDWXUVRQGH6DQLWlUERLOHU7
Inneneinheit
Außeneinheit
$QODJH9HQWLO.RQYHNWRUHQ5DGLDWRUHQRGHU6WUDKOEOHQGHQE|GHQ
6DQLWlUZDVVHUVWDX
=XVDW]ZlUPHTXHOOH]%*DVEUHQQHU
,QVWDOOLHUHQ6LHDXIGHU:DVVHUHLQODVVURKUOHLWXQJGHV*HUlWV5FNODXI]XU$QODJHHLQ)LOWHUVLHEPLWPP0DVFKHQ
2
2.6
BEZUGSWERTE FÜR WASSERANLAGE
‡
‡
‡
‡
‡
‡
‡
‡
S+·
(OHNWULVFKH/HLWIlKLJNHLW]ZLVFKHQXQG—6FP
*HVDPWKlUWH]ZLVFKHQXQGƒ)
*HVDPWHLVHQJHKDOWXQWHUSSP
0DQJDQXQWHUSSP
&KORULGHXQWHUSSP
6FKZHIHO,RQHDEZHVHQG
$PPRQLDN,RQHDEZHVHQG
:HQQGLH*HVDPWKlUWHPHKUDOVƒ)EHWUlJWRGHUHLQLJH%H]XJVZHUWHGHV1DFKIOOZDVVHUVQLFKWLQQHUKDOEGHUDQJHJHEHQHQ
:HUWHOLHJHQQHKPHQ6LH.RQWDNWPLWXQVHUHP9RUYHUNDXIVVHUYLFHDXIXPGLH]XLPSOHPHQWLHUHQGH%HKDQGOXQJIHVW]XOHJHQ
1LFKWDXVGHU:DVVHUOHLWXQJNRPPHQGHV%UXQQHQRGHU*UXQGZDVVHULVWVWHWVVRUJIlOWLJ]XDQDO\VLHUHQXQGJHJHEHQHQIDOOVPLW
JHHLJQHWHQ6\VWHPHQDXI]XEHUHLWHQ%HL,QVWDOODWLRQHLQHV(QWKlUWHUVVLQGGLH9RUVFKULIWHQGHV+HUVWHOOHUV]XEHDFKWHQ
'DUEHUKLQDXVLVWGLH+lUWHGHV$XVJDEHZDVVHUVDXFKPLW'XUFKIKUXQJGHUS+XQG6DO]JHKDOW7HVWVDXIQLFKWXQWHUƒ)
einzustellen und die Chloridkonzentration im Ausgang nach der Regeneration der Harze zu überprüfen. Bei Frostgefahr entleeren
Sie die Anlage oder füllen Sie Frostschutzmittel in einer der erreichbaren Mindesttemperatur entsprechenden Menge nach. Als
:lUPHWUlJHUDQVWHOOHYRQ:DVVHUYHUZHQGHWH/|VXQJHQDXV:DVVHUXQGbWK\OHQJO\NROIKUHQ]XHLQHU5HGX]LHUXQJGHU/HLVWXQJHQ
GHU(LQKHLWHQ*HEHQ6LH:DVVHUPLWHLQHPPD[LPDOHQ$QWHLOYRQbWK\OHQJO\NROIUHLQHQ6FKXW]ELVƒ&KLQ]X
2.7
FÜLLEN DER WASSERANLAGE
Nach Fertigstellung der Wasseranlagen ist die Füllung der Anlage vorzunehmen. Dabei ist es erforderlich, durch die Entlüftungen
DXIGHP.UHLVXQGDP*HUlWJOHLFK]HLWLJGLH/XIWDXVGHP,QQHUQGHU5RKUOHLWXQJHQXQGGHV*HUlWVKHUDXV]XODVVHQ
$QIlQJOLFKEHLOHHUHP:DVVHUNUHLVGDUIGLH0DVFKLQHQLFKWDQGDVHOHNWULVFKH6WURPQHW]DQJHVFKORVVHQZHUGHQ
Erst in den Endphasen der Füllung des Wasserkreises kann die Maschine gespeist und die Umlaufpumpe gestartet werden.
(VHPS¿HKOWVLFKGLH)XQNWLRQGHUWHPSRUlUHQ)RUFLHUXQJGHU8PODXISXPSHIU0LQXWHQGXUFK$NWLYLHUXQJGHV3DUDPHWHUV)3$
VLHKH$EV.RQWUROOHQGH8PODXISXPSH%HL9HUZHQGXQJHLQHUH[WHUQHQ+LOIVSXPSHGDUIDXFKGLHVHHUVWLQGHQ(QGSKDVHQ
der Anlagenfüllung gestartet werden. Der Betriebsdruck der Anlage darf bei ausgeschalteter Pumpe 1,5 BAR nicht überschreiten.
,QMHGHP)DOOHPS¿HKOWHVVLFK]XUhEHUSUIXQJHYHQWXHOOHU8QGLFKWLJNHLWHQGHU$QODJHEHLGHU$EQDKPHGHQ7HVWGUXFNPD[LPDO
EDU]XHUK|KHQXQGDQVFKOLH‰HQG]XHQWODGHQXPGHQ%HWULHEVGUXFN]XHUUHLFKHQ
2.8
FREIGABE DER UMLAUFPUMPE$EE
:HQQZlKUHQGGHVHUVWHQ(LQVFKDOWHQVQDFKGHP6WDUWGHU8PODXISXPSHGHU$ODUP$/HUVFKHLQWVWHOOHQ6LHVLFKHUGDVVGLH
9HQWLOHLQGHU$QODJHJH|IIQHWVLQGGDVVPLQGHVWHQVHLQ9HUEUDXFKHUPLWRIIHQHQ.UHLVYRUKDQGHQLVWGDVVGDVH[WHUQH)LOWHUVLHE
QLFKWYHUVWRSIWLVWGDVVNHLQH/XIWEODVHQLP,QQHUQGHV.UHLVHVDXIWUHWHQGDVVGHU:DVVHUGUXFNLQGHU$QODJHNRUUHNWLVWXQG
dass die Umlaufpumpe nicht blockiert ist.
Setzen Sie nach dem Beheben der Ursache den Alarm zurück durch Drücken des Einschalttasters $EE.H\DXIGHU
Bedientafel für zehn Sekunden.
Zur Entriegelung der Umlaufpumpe nehmen Sie die Verschlusskappe ab und drehen die Welle der Pumpe wie in der Abb. 22
angegeben.
2.9
ELEKTRISCHE ANSCHLÜSSE$EE
'LHHOHNWULVFKHQ$QVFKOVVHVLQGXQWHU(LQKDOWXQJGHU$QZHLVXQJHQLQGLHVHP,QVWDOODWLRQVKDQGEXFKVRZLHGHUQDWLRQDOHQ
1RUPHQXQG0HWKRGHQIUGLH$QVFKOVVHHOHNWULVFKHU*HUlWHKHU]XVWHOOHQ(LQHXQ]XUHLFKHQGH.DSD]LWlWRGHUXQYROOVWlQGLJH
HOHNWULVFKH$QVFKOVVHN|QQHQ]XHOHNWULVFKHQ6WURPVFKOlJHQRGHU%UDQGIKUHQ
‡ $FKWXQJGLH.UHLVHGHUHOHNWULVFKHQ6WURPYHUVRUJXQJGHU,QQHQHLQKHLWXQGGHU$X‰HQHLQKHLWVLQG]XWUHQQHQ'LH/HLWXQJ
der Außeneinheit ist durch einen Thermomagnetschalter oder geeignet bemessene Schmelzsicherungen zu schützen.
‡ 9HUZHQGHQ6LHQLHPDOVHLQH6WURPYHUVRUJXQJDQGLHDXFKHLQDQGHUHV*HUlWDQJHVFKORVVHQLVW
‡ 9HUZHQGHQ 6LH IU GHQ $QVFKOXVV HLQ .DEHO DXVUHLFKHQGHU /lQJH ]XP $EGHFNHQ GHU JHVDPWHQ 'LVWDQ] RKQH MHGH
9HUELQGXQJVVWHOOH 9HUZHQGHQ 6LH NHLQH 9HUOlQJHUXQJHQ /HJHQ 6LH NHLQH ZHLWHUHQ /DVWHQ DQ GLH 6WURPYHUVRUJXQJ
VRQGHUQYHUZHQGHQ6LHHLQHQJHVRQGHUWHQ9HUVRUJXQJVNUHLVDQGHUQIDOOVEHVWHKWGLH*HIDKUGHUhEHUKLW]XQJHOHNWULVFKHU
6WURPVFKOlJHRGHUYRQ%UDQG
‡ 9HUZHQGHQ 6LH IU GLH HOHNWULVFKHQ $QVFKOVVH ]ZLVFKHQ ,QQHQHLQKHLW XQG $X‰HQHLQKHLW GLH VSH]L¿]LHUWHQ .DEHOW\SHQ
%HIHVWLJHQ6LHGLH9HUPDVFKXQJVNDEHOVRGDVVGLHHQWVSUHFKHQGHQ.OHPPHQNHLQHQlX‰HUHQ%HDQVSUXFKXQJHQXQWHUOLHJHQ
9HUZHQGHQ6LHGD]XGLH.DEHOVLFKHUXQJHQLP,QQHQGHU(LQKHLW8QYROOVWlQGLJH$QVFKOVVHRGHU%HIHVWLJXQJHQN|QQHQ]X
hEHUKLW]XQJRGHU%UDQGIKUHQ
‡ 1DFK GHP$QVFKOXVV GHU 9HUPDVFKXQJV XQG 9HUVRUJXQJVNDEHO VWHOOHQ 6LH VLFKHU GDVV GLH .DEHO VR DQJHRUGQHW VLQG
GDVVNHLQH]XKRKHQ.UlIWHDXIGLH$EGHFNXQJHQRGHUGLHHOHNWULVFKHQ6FKDOWWDIHOQDXVJHEWZHUGHQ0RQWLHUHQ6LHGLH
$EGHFNXQJHQDQGHQ.DEHOQ
‡ 6ROOWH HV EHL GHU ,QVWDOODWLRQ ]XP$XVWULWW YRQ .KOPLWWHO NRPPHQ EHOIWHQ 6LH GHQ 5DXP EHL$XVVHW]XQJ DQ )ODPPHQ
SURGX]LHUWGDV.KOPLWWHOJLIWLJH*DVH
Stellen Sie vor der Durchführung jeglichen Eingriffes sicher, dass die elektrischen Stromversorgungen der Außen- und Inneneinheit
ausgeschaltet sind.
Nehmen Sie für die elektrischen Anschlüsse Bezug auf die Abb. 23, 24, 25, 26.
Die Versorgungsspannung muss mit der in der Tabelle der technischen Daten angegebenen Spannung übereinstimmen.
'LH.DEHOPVVHQPLW.DEHOVFKXKHQDXVJHVWDWWHWVHLQGHUHQ4XHUVFKQLWWYRUGHP(LQIKUHQLQGLH.OHPPOHLVWHSURSRUWLRQDO]X
den Anschlusskabeln auszulegen ist.
93
DEUTSCHE
‡
2
'LH9HUVRUJXQJVOHLWXQJHQVLQGDQJHPHVVHQ]XGLPHQVLRQLHUHQXP6SDQQXQJVDEIlOOHRGHUGLHhEHUKLW]XQJYRQ.DEHOQRGHU
DQGHUHQDXIGHU/HLWXQJVHOEVWEH¿QGOLFKHQ9RUULFKWXQJHQ]XYHUPHLGHQ
Die Versorgungsleitungen sind mit Hilfe eines für die Stromaufnahme der Maschine geeigneten Thermomagnetschalters mit
Differentialrelais und maximaler Justierung entsprechend den Vorgaben der nationalen elektrotechnischen Vorschriften vom
5HVWGHVHOHNWULVFKHQ6WURPQHW]HVJHWUHQQWZHUGHQN|QQHQVLHKH7DEHOOHQDFK$EE
'LH/HLWXQJGHU,QQHQHLQKHLWLVWEHUHLWVGXUFKHLQHQ7KHUPRPDJQHWVFKDOWHUDXIGHU6WURPYHUVRUJXQJGHUHOHNWULVFKHQ:LGHUVWlQGH
XQG HLQH 6FKPHO]VLFKHUXQJ VLHKH $EV JHVFKW]W (V HPS¿HKOW VLFK GLH ,QVWDOODWLRQ HLQHV 'LIIHUHQWLDOUHODLV DXI GHU
Versorgungsleitung.
6WHOOHQ6LHVLFKHUGDVVZlKUHQGGHV%HWULHEVGHU.RPSUHVVRUHQGLHHOHNWULVFKH9HUVRUJXQJVVSDQQXQJGHP1HQQZHUW
HQWVSULFKW
'LH9HUZHQGXQJGHU.KOPLWWHOXQG:DVVHUURKUHIUGLH(UGXQJGHV*HUlWVLVWYHUERWHQ
Der Hersteller ist nicht haftbar für eventuelle Schäden aufgrund fehlender Erdung oder bei Nichtbeachtung der Angaben in den
elektrischen Schaltplänen.
Die Tabelle nach Abb. 26 zeigt die maximalen Stromaufnahmen der Einheiten
A
B
C
D
E
F
G
Speisung Außeneinheit
Maximale Leistungsaufnahme der Außeneinheit
Maximale Stromaufnahme der Außeneinheit
6FKPHO]VLFKHUXQJRGHU7KHUPRPDJQHW0)$
Speisung Inneneinheit
0D[LPDOH/HLVWXQJVDXIQDKPHGHU,QQHQHLQKHLWPLWDNWLYLHUWHQHOHNWULVFKHQ:LGHUVWlQGHQ
0D[LPDOH6WURPDXIQDKPHGHU,QQHQHLQKHLWPLWDNWLYLHUWHQHOHNWULVFKHQ:LGHUVWlQGHQ
=XJDQJ]XGHQHOHNWULVFKHQ$QVFKOVVHQ
'LH.OHPPOHLVWHQIUGLHHOHNWULVFKHQ$QVFKOVVHGHU$X‰HQHLQKHLWOLHJHQLPVHLWOLFKHQUHFKWHQ7HLOGHU(LQKHLW)UGHQ=XJDQJ
entfernen Sie nach dem Lösen der Befestigungsschrauben den Deckel der elektrischen Schalttafel.
Für den Zugang zu den elektrischen Anschlüssen der Inneneinheit nehmen Sie Bezug auf die Abschnitte 2.1.1 und 2.1.2.
Diese Eingriffe dürfen nur durch Fachpersonal ausgeführt werden.
$QVFKOXVVNDEHO
'LHQDFKVWHKHQGH7DEHOOHOLHIHUWHLQHhEHUVLFKWGHU]XYHUZHQGHQGHQ.DEHO
.RPPXQLNDWLRQVNDEHO2'8,'8
A
2 x 0,5 mm2 abgeschirmt
Sondenkabel ACS und Außenluft
B
H03RN-F 2 G 0,5 / H03VV-F 2 G 0,5
INNENEINHEIT
Versorgungskabel
SHERPA SMALL
C
AUSSENEINHEIT
Versorgungskabel
D
H05VV 3 x 2,5 mm
SHERPA BIG
2
H05VV-F 3 x 4 mm2
OSCEBSH24EI
OSCEBCH36EI
OSCEBCH48EI
OS-CEBTH48EI
OSCEBCH60EI
OS-CEBTH60EI
H07RN-F 3 G2,5
H07RN-F 3 G4
H07RN-F 3 G4
H07RN-F 5 G2,5
H07RN-F 3 G4
H07RN-F 5 G2,5
(OHNWULVFKH$QVFKOVVH$EE
6WHOOHQ 6LH GLH$QVFKOVVH GHU LP YRUVWHKHQGHQ$EVFKQLWW DXIJHOLVWHWHQ .DEHO DQ GLH .OHPPOHLVWH GHU ,QQHQHLQKHLW XQG GHU
Außeneinheit her. Nehmen Sie dabei Bezug auf die Abbildungen 23, 24, 25 sowie auf die untenstehenden Beschreibungen.
DEUTSCHE
Inneneinheit:
‡ Klemmen L-N- Stromversorgung der Inneneinheit
‡ Klemmen 24-25(LQJDQJIUGLH6RQGH]XU(UIDVVXQJGHU$X‰HQWHPSHUDWXUQRWZHQGLJ]XU$NWLYLHUXQJGHU.OLPDNXUYHQ
]XU)UHLVFKDOWXQJGHUHOHNWULVFKHQ+HL]ZLGHUVWlQGHLP,QQHUQGHU(LQKHLWRGHU]XU$NWLYLHUXQJHLQHUH[WHUQHQ:lUPHTXHOOH
‡ Klemmen 26-27 (LQJDQJ IU GLH 6RQGH ]XU (UIDVVXQJ GHU 7HPSHUDWXU GHV 6DQLWlUZDVVHUWDQNV QRWZHQGLJ ]XU
7HPSHUDWXUNRQWUROOHGHV6DQLWlUZDVVHUWDQNVVRZLH]XU9HUZDOWXQJGHU$QWLOHJLRQHOOHQ]\NOHQ
‡ Klemmen Q-P.RPPXQLNDWLRQVNDEHO]ZLVFKHQGHU,QQHQHLQKHLWXQGGHU$X‰HQHLQKHLW
‡ Klemmen N-L-12'UHLZHJYHQWLO]XU8POHLWXQJGHV6DQLWlUZDVVHUVEHLGHU9HUVLRQ:VHULHQPl‰LJDQ%RUGGHU0DVFKLQH
LQVWDOOLHUWEHLGHU*UXQGYHUVLRQH[WHUQLQVWDOOLHUEDU.LWHUKlOWOLFK
‡ Klemmen N-1$NWLYLHUXQJGHV.RQWDNWJHEHUV]XU6SHLVXQJGHVHOHNWULVFKHQ:LGHUVWDQGVLP6DQLWlUZDVVHUWDQNZlKUHQG
GHU$QWLOHJLRQHOOHQ]\NOHQ9+]:PD[
‡ Klemmen 14-15$NWLYLHUXQJGHUH[WHUQHQ:lUPHTXHOOH*DVERLOHU.RQWDNWJHEHU$$9DF
‡ Klemmen 16-17$ODUPNRQWDNW.RQWDNW$$9$&
‡ Klemmen 5-L$QIRUGHUXQJYRQKHL‰HP6DQLWlUZDVVHUZHQQGLH7HPSHUDWXUGHV7DQNVPLWKHL‰HP6DQLWlUZDVVHUYRQ
HLQHUJHVRQGHUWHQH[WHUQHQ.RQWUROOHIHVWJHOHJWZLUG(LQ6FKOLH‰.RQWDNW]ZLVFKHQGLHVHQEHLGHQ.OHPPHQDNWLYLHUWGLH
$QIRUGHUXQJYRQKHL‰HP6DQLWlUZDVVHU
‡ Klemme 1 ElektronikkarteSRWHQWLDOIUHLHU)HUQ.RQWDNW(LQVFKDOWXQJ$EVFKDOWXQJ
94
2
‡
‡
‡
‡
Klemme 2 ElektronikkarteSRWHQWLDOIUHLHU)HUQ.RQWDNW+HL]PRGXV.KOPRGXV
Klemme 3 ElektronikkarteSRWHQWLDOIUHLHU)HUQ.RQWDNWgNR0RGXV
Klemme 4 ElektronikkarteSRWHQWLDOIUHLHU)HUQ.RQWDNW1DFKWEHWULHE
Klemme 5 ElektronikkarteSRWHQWLDOIUHLHU)HUQ.RQWDNW$NWLYLHUXQJ6DQLWlUZDVVHUEHUHLWVDQJHVFKORVVHQDQGLH.OHPPOHLVWH
/
‡ Klemme 6 ElektronikkarteSRWHQWLDOIUHLHU)HUQ.RQWDNW7$VLHKH$EV)HUQVWHXHUXQJ
‡ Klemme 7 ElektronikkarteJHPHLQVDPHU$QVFKOXVVSRWHQWLDOIUHLH)HUQ.RQWDNWH
'H.OHPPHQELVEH¿QGHQVLFKDXIGHU(OHNWURQLNNDUWH'LH.OHPPHQN|QQHQYRQGHU.DUWHDEJH]RJHQZHUGHQVRGDVVVLH
OHLFKWHUDQJHVFKORVVHQXQGGDQDFKZLHGHULQGHU2ULJLQDOSRVLWLRQHLQJHVHW]WZHUGHQN|QQHQVLHKH$EE
$OOH=XVDW]NDEHOPVVHQHLQH]XUP|JOLFKHQgIIQXQJGHUHOHNWULVFKHQ6FKDOWWDIHODXVUHLFKHQGH/lQJHKDEHQ
Einphasen-Außeneinheit:
Speisung der Außeneinheit
‡ Klemmen L-N‡ Klemmen Q-P- .RPPXQLNDWLRQVNDEHO]ZLVFKHQGHU,QQHQHLQKHLWXQGGHU$X‰HQHLQKHLW
Dreiphasen-Außeneinheit:
Speisung der Außeneinheit
‡ Klemmen R-S-T-N‡ Klemmen Q-P- .RPPXQLNDWLRQVNDEHO]ZLVFKHQGHU,QQHQHLQKHLWXQGGHU$X‰HQHLQKHLW
2.10
KONTROLLEN DER INSTALLATION$EE
9RUEHUHLWXQJ]XUHUVWHQ,QEHWULHEQDKPH$EE
'LHHUVWH,QEHWULHEQDKPHGHU/XIW:DVVHU:lUPHSXPSHLVWYRQTXDOL¿]LHUWHP7HFKQLNSHUVRQDOGXUFK]XIKUHQ
9RUGHUHUVWHQ,QEHWULHEQDKPHGHU/XIW:DVVHU:lUPHSXPSHVLQGIROJHQGH%HGLQJXQJHQVLFKHU]XVWHOOHQ
‡ $OOH6LFKHUKHLWVYRUJDEHQZXUGHQHLQJHKDOWHQ
‡ 'LH/XIW:DVVHU:lUPHSXPSHZXUGHDXIJHHLJQHWH:HLVHDQGHU6WDQGÀlFKHEHIHVWLJW
‡ 'HU$EVWDQGVEHUHLFKZXUGHHLQJHKDOWHQ
‡ 'LH:DVVHUDQVFKOVVHZXUGHQGHU%HGLHQXQJVDQOHLWXQJJHPl‰DXVJHIKUW
‡ 'LH:DVVHUDQODJHZXUGHEHIOOWXQGHQWOIWHW
‡ 6WHOOHQ6LHVLFKHUGDVVGLH6FKOLH‰YHQWLOHGHV:DVVHUNUHLVHVJH|IIQHWVLQG
‡ :HQQHLQ+HL]NHVVHOLQGHU$QODJHYRUKDQGHQLVWVWHOOHQ6LHVLFKHUGDVVGLH5FNVFKODJYHQWLOHDXIGHQ:DVVHUHLQOlXIHQ
DQGHU:lUPHSXPSHXQGDP+HL]NHVVHOVRLQVWDOOLHUWVLQGGDVVGLH$EQDKPHGHU:DVVHUI|UGHUOHLVWXQJLQGLH$QODJHVRZLH
GHU(LQODXI]XKHL‰HQ:DVVHUVLQGLH:lUPHSXPSHYHUPLHGHQZHUGHQ
‡ 'LHHOHNWULVFKHQ$QVFKOVVHZXUGHQNRUUHNWDXVJHIKUW
‡ 'LH6SDQQXQJOLHJW]ZLVFKHQXQG9IUGLH(LQSKDVHQ(LQKHLWHQEH]LHKXQJVZHLVHXQG9IUGLH'UHLSKDVHQ
Einheiten
‡ 'LH'UHLSKDVHQVSDQQXQJIUGLH0RGHOOHGDUIHLQH$EZHLFKXQJYRQPD[LPDO]ZLVFKHQGHQ3KDVHQDXIZHLVHQ
‡ 'LH(UGXQJZXUGHNRUUHNWDXVJHIKUW
‡ $OOHHOHNWULVFKHQ$QVFKOVVHZXUGHQJXWEHIHVWLJW
‡ 'HU 4XHUVFKQLWW GHU 6WURPNDEHO LVW GHU /HLVWXQJVDXIQDKPH GHV *HUlWV XQG GHU /lQJH GHV DXVJHIKUWHQ $QVFKOXVVHV
angemessen.
‡ 'LH3UR]HGXU]XU(LQVWHOOXQJGHU:DVVHUKlUWHZXUGHDXVJHIKUWXQGGDV3RWHQWLRPHWHUDXIGHU.DUWHGHU:DVFKJlQJH
wurde korrekt positioniert.
‡ (QWIHUQHQ6LHMHJOLFKHV2EMHNWLQVEHVRQGHUH6SlQH'UDKWDEVFKQLWWHXQG6FKUDXEHQ
‡ 6WHOOHQ6LHVLFKHUGDVVDOOH.DEHODQJHVFKORVVHQVLQGXQGGDVVDOOHHOHNWULVFKHQ$QVFKOVVHJXWIHVWVLW]HQ
‡ %HYRUGHU.RPSUHVVRUJHVWDUWHWZHUGHQNDQQPXVVGDV6\VWHPNRQWLQXLHUOLFKIU6WXQGHQHLQJHVFKDOWHWZHUGHQ
‡ 6RZRKOGDV6HUYLFH9HQWLOGHV*DVURKUVDOVDXFKGHV)OVVLJNHLWVURKUV$EE3RV(PVVHQJH|IIQHWVHLQ
‡ %LWWHQ6LHGHQ.XQGHQEHLGHQ)XQNWLRQVSUIXQJHQDQZHVHQG]XVHLQ
‡ %ULQJHQ6LHGHP.XQGHQGLH,QKDOWHGHU%HGLHQXQJVDQOHLWXQJQlKHU
‡ +lQGLJHQ6LHGHP.XQGHQGLH%HGLHQXQJVDQOHLWXQJXQGGDV*DUDQWLH]HUWL¿NDWDXV
.RQWUROOHQZlKUHQGXQGQDFKGHU(UVWLQEHWULHEQDKPH$EE
Nach durchgeführtem Start sind folgende Punkte sicherzustellen:
‡ 'LH6WURPDXIQDKPHGHV.RPSUHVVRUVLVWQLHGULJHUDOVGHUDXIGHP7\SHQVFKLOGDQJHJHEHQH:HUW
‡ 6WHOOHQ6LHVLFKHUGDVVZlKUHQGGHV%HWULHEVGHU.RPSUHVVRUHQGLHHOHNWULVFKH9HUVRUJXQJVVSDQQXQJGHP1HQQZHUW
% entspricht.
‡ 'LH'UHLSKDVHQVSDQQXQJGDUIHLQH$EZHLFKXQJYRQPD[LPDO]ZLVFKHQGHQ3KDVHQDXIZHLVHQ
‡ 6WHOOHQ6LHVLFKHUGDVVGHU*HUlXVFKSHJHOGHV'UHLSKDVHQ.RPSUHVVRUVLPQRUPDOHQ%HUHLFKOLHJW
‡ 'DV*HUlWDUEHLWHWLQQHUKDOEGHUHPSIRKOHQHQ%HWULHEVEHGLQJXQJHQVLHKH$EE
‡ 'HU:DVVHUNUHLVLVWYROOVWlQGLJHQWOIWHW
‡ 'LH/XIW:DVVHU:lUPHSXPSHIKUWHLQH$EVFKDOWXQJXQGGLHDQVFKOLH‰HQGH:LHGHUHLQVFKDOWXQJGXUFK
‡ 'HUWKHUPLVFKH6SUXQJ]ZLVFKHQ'UXFNOHLWXQJXQG5FNODXIGHU$QODJHPXVVVWHWV·ƒ&EHWUDJHQZHQQGLH3DUDPHWHU
t1 und t2 abgefragt werden
‡ :HQQGHUWKHUPLVFKH6SUXQJXQWHUƒ&OLHJHQVROOWHVWHOOHQ6LHHLQHQLHGULJHUH*HVFKZLQGLJNHLWGHV8POlXIHUVHLQ6ROOWH
der thermische Sprung hingegen über 7 °C liegen, überprüfen Sie die Öffnung aller Ventile an der Anlage und fügen Sie
gegebenenfalls eine externe Pumpe hinzu, um das Wasserfördervolumen zu erhöhen.
95
DEUTSCHE
%HIHVWLJHQ6LHDOOH.DEHOPLWGHQHQWVSUHFKHQGHQ.DEHOVLFKHUXQJHQ
3
3
3.1
BEDIENUNG UND WARTUNG
BEDIENTAFEL DER INNENEINHEIT$EE
Beim Öffnen der Vorderblende wird der Zugang zum Manometer, zur Bedientafel und zum Hauptschalter frei.
$XIGHU7DIHO$EEEH¿QGHQVLFKIROJHQGH9RUULFKWXQJHQ
A 0DQRPHWHU=HLJWGHQ'UXFNGHU:DVVHUDQODJHDQXQGHUODXEWGLHhEHUSUIXQJGHV:DVVHUGUXFNVLP,QQHUQGHV.UHLVHV
Die Werte müssen zwischen 1 und 2 bar liegen.
B Bedientafel
C Hauptschalter Inneneinheit
D Befestigungsschraube für die Vorderblende
%HVFKUHLEXQJGHU%HGLHQWDIHO$EE
Die Bedientafel hat ein Display, eine Tastatur mit acht Tasten und neun Leds.
Led A: wird verwendet, wenn Temperaturen angezeigt werden
Led B: Dezimalpunkt
Led1 (LQVFKDOWXQJJHOE
Led2 .KOXQJJUQ
Led3 +HL]XQJURW
Led4 3XPSHHLQJHVFKDOWHWJUQ
Led5 $ODUPDNWXHOOKLVWRULVFKURW
Led6 =XVDW]KHL]XQJJHOE
Led7 =HLWJHEHUDNWLYLHUWJHOE
Led8 6DQLWlUZDVVHUSURGXNWLRQDNWLYURW
Led9 g.20RGXVDNWLYJUQ
Key1:
3IHLOQDFKREHQIUGLH%HZHJXQJLP0HQRGHU]XUbQGHUXQJGHVDQJH]HLJWHQ:HUWHV
Key2:
3IHLOQDFKXQWHQZLH.H\
aber in der entgegengesetzten Richtung. Erlaubt beim Drücken zusammen mit
.H\
den Ausgang zum vorhergehenden Menü.
:DKOYRQ.KOXQJ+HL]XQJQXU6DQLWlUZDVVHUSURGXNWLRQ
Key3:
Key4:
.RQ¿JXUDWLRQVPHQ(UODXEWGHQ(LQVWLHJLQGDV%HQXW]HURGHU6HUYLFH0HQ
Menü Temperatur/Einstellung. Beim Drücken dieses Tasters erfolgt der direkte Zugriff auf die Temperaturwerte.
Key5:
%HLP'UFNHQGHU3IHLOHNDQQGLHJHZQVFKWH2SWLRQJHZlKOWZHUGHQPLW.H\
kann der Wert eingesehen
ZHUGHQ=XU(LQVWHOOXQJGHU7HPSHUDWXUHQGUFNHQ6LH.H\
IUGUHL6HNXQGHQXQGlQGHUQ6LHGHQ:HUWPLW
]XP%HVWlWLJHQ'DV9HUODVVHQGHV0HQVHUIROJWDXWRPDWLVFKLQQHUKDOEYRQ
GHQ3IHLOHQ'UFNHQ6LH.H\
60 Sekunden ohne Drücken irgendeines Tasters oder durch gleichzeitiges Drücken der Pfeile.
Key6:
(UODXEWGLH$Q]HLJHGHV3DUDPHWHUZHUWHVGLHbQGHUXQJVHLQHU(LQVWHOOXQJGXUFK'UFNHQIUGUHL6HNXQGHQ
XQGGLH%HVWlWLJXQJGHVQHXHQ:HUWHV
Key7:
$NWLYLHUWRGHUGHDNWLYLHUWGHQ]ZHLWHQ6HWSRLQW&6LQ.KOXQJRGHU+6LQ+HL]XQJXPHLQH(QHUJLHHUVSDUQLV
möglich zu machen
Key8:
Beim Drücken dieses Tasters wird die Einheit eingeschaltet oder in den Wartezustand versetzt.
3.2
AKTIVIERUNG UND BENUTZERFUNKTIONEN
3.2.1
Aktivierung $EE
DEUTSCHE
Nehmen Sie Bezug auf die Abbildung 28 für die Leds und die Taste der Bedientafel.
Gehen Sie zur Aktivierung der Einheit wie folgt vor:
‡ *HEHQ6LHPLW+LOIHGHU+DXSWVFKDOWHU6SDQQXQJDQGLH,QQHQHLQKHLWXQGDQGLH$X‰HQHLQKHLW
‡ $NWLYLHUHQ6LHGLH6FKDOWWDIHOGHU,QQHQHLQKHLWPLW+LOIHGHV6FKDOWHUV$EE3RV&DXIGHU%HGLHQWDIHO
leuchtet auf, und die grüne Led
zeigt
‡ GUFNHQ6LHGLH7DVWH.H\ an der Bedienerschnittstelle, die gelbe Led1
GLH$NWLYLHUXQJGHU8PODXISXPSHDQ=XP6FKOXVVHUVFKHLQWGLH%HWULHEVDUWDP'LVSOD\&/*IUGHQ.KOPRGXV+7*IU
GHQ+HL]PRGXVXQG6DQIU6DQLWlUZDVVHUSURGXNWLRQ
‡ 'UFNHQ6LHGLH7DVWH.H\
IUGLH:DKOGHU%HWULHEVDUW%HLP'UFNHQYRQ.H\
in der Sequenz
ZLUGGHU.KOPRGXVDNWLYLHUWXQGGLHJUQH/HG
, leuchtet auf, danach wird der Heizmodus aktiviert, und die rote
Led 3 OHXFKWHWDXI=XP6FKOXVVZLUGGLH6DQLWlUZDVVHUSURGXNWLRQDNWLYLHUWXQGGLH/HGVXQGVLQGDXV
%HLP'UFNHQGHV7DVWHUV.H\
ZLUGGHU(QHUJLHVSDUPRGXVgNRDNWLYLHUW'DV$XÀHXFKWHQGHUJUQHQ/HG
zeigt
die Aktivierung des Öko-Modus.
0HQ7HPSHUDWXUHQ6HW
Von der Bedienkonsole aus ist es möglich, die von den Sonden der Inneneinheit gemessenen Temperaturen zu überprüfen und
GLH:DVVHU6HWSRLQWVHLQ]XVWHOOHQ0HQ7HPSHUDWXUHQ6HW
Folgende Temperaturen und Setpoints können auf dem Display eingestellt werden:
‡ W7HPSHUDWXU(LQODXIZDVVHU
‡ W7HPSHUDWXU$XVODXIZDVVHU
‡ W7HPSHUDWXU6HQVRU6DQLWlUZDVVHUWDQN
96
3
‡
‡
‡
‡
‡
‡
W7HPSHUDWXU6HQVRU$X‰HQOXIW
F66HWSRLQWLP.KOPRGXV
F66HWSRLQWgNRLP.KOPRGXV
&+&%HWULHEVVWXQGHQ.RPSUHVVRU
+66HWSRLQWLP+HL]PRGXV
+66HWSRLQWgNRLP+HL]PRGXV
%HQXW]HUPHQ
0LW+LOIHGHU%HGLHQWDIHOGHU,QQHQHLQKHLWLVWHVGDUEHUKLQDXVP|JOLFKIROJHQGHYRP%HQXW]HUPHQDXVPRGL¿]LHUEDUH)XQNWLRQHQ
zu aktivieren.
‡
8+5
=XU(LQVWHOOXQJGHU8KUPRGL¿]LHUHQ6LHGHQ3DUDPHWHUKU6IUGLH6WXQGHQXQGGHQ3DUDPHWHUɉLQIUGLH0LQXWHQ
‡
TIMER
Mit dieser Funktion ist es möglich, das System einmal pro Tag zu starten und abzuschalten.
0LWGHP3DUDPHWHUWLɉ ZLUGGLH)XQNWLRQDNWLYLHUWPLWGHP3DUDPHWHU6W$ZLUGGLH6WDUW]HLWPLWGHP3DUDPHWHU6WRGLH
Abschaltzeit des Systems eingestellt.
‡
NACHTBETRIEB
,P1DFKWEHWULHEVPRGXVZHUGHQ/HLVWXQJXQG*HUlXVFKGHV6\VWHPVEHJUHQ]W
'LH)XQNWLRQZLUGDNWLYLHUWPLWGHP3DUDPHWHUQF/ GLH6WDUW8KU]HLWIUGHQ0RGXVPLWGHP3DUDPHWHUQ6WGLH(QG8KU]HLW
mit dem Parameter nSP.
‡
6(732,17.h+/81*
Es besteht die Möglichkeit, den Thermostat mit Hilfe der Parameter CS1 und CS2 für zwei verschiedene
Wasserkühlungstemperaturen einzustellen.
'LH7HPSHUDWXU&6ZLUGYHUZHQGHWLQGHPGHUgNR0RGXVLQGHU.KOXQJDNWLYLHUWZLUG
‡
6(732,17+(,=81*
Es besteht die Möglichkeit, den Thermostat mit Hilfe der Parameter HS1 und HS2 für zwei verschiedene
Wasserheizungstemperaturen einzustellen.
Die Temperatur HS2 wird verwendet, indem der Öko-Modus in der Heizung aktiviert wird.
‡
6(732,176$1,7b5:$66(5
Es besteht die Möglichkeit, den Thermostat mit Hilfe des Parameters HS3 für eine Wasserheizungstemperatur einzustellen.
‡
./,0$.859(1
=XU2SWLPLHUXQJGHU(QHUJLHHUVSDUQLVVWHKHQ]ZHL.OLPDNXUYHQ]XU9HUIJXQJHLQHIUGLH+HL]XQJXQGHLQHIUGLH.KOXQJ
'LHVH)XQNWLRQHUODXEWGLH$QSDVVXQJGHU:DVVHUWHPSHUDWXUDQGLH$X‰HQWHPSHUDWXUXQGGDPLWDQGLH:lUPHODVWVRGDVV
die Energieersparnis des Systems optimiert wird.
'LH .OLPDNXUYHQ PVVHQ GXUFK DXWRULVLHUWHV 3HUVRQDO DQJHPHVVHQ IU GLH$QODJH HLQJHVWHOOW ZHUGHQ 'D]X VLQG HLQLJH
3DUDPHWHUGHV6HUYLFHPHQV]XPRGL¿]LHUHQ
'HU%HQXW]HUNDQQGLH.XUYHLQGHU+HL]XQJGXUFK(LQVWHOOXQJGHV3DUDPHWHUV+FF DNWLYLHUHQ0LW+FF ZLUGGLH.XUYH
ausgeschlossen, und das System arbeitet mit den Setpoints Hs1 und Hs2.
'HU%HQXW]HUNDQQGLH.XUYHLQGHU.KOXQJGXUFK(LQVWHOOXQJGHV3DUDPHWHUV&FF DNWLYLHUHQ0LW&FF ZLUGGLH.XUYH
ausgeschlossen, und das System arbeitet mit den Setpoints Cs1 und Cs2.
3.3
EINSTELLUNG DER PARAMETER DES BENUTZERMENÜS
ist es möglich, auf das Benutzer-Menü zuzugreifen. Bei zweimaligem Drücken erscheint auf
0LW+LOIHGHV7DVWHUV.(<
GHP'LVSOD\8VUSHU8VHU%HQXW]HU
1DFK:DKOGHV%HQXW]HUPHQVGXUFK'UFNHQYRQ.(<
, erfolgt der Einstieg in das Menü, und es erscheint der erste
Parameter. Mit Hilfe der Auf- und Ab-Pfeile können anschließend alle Parameter des Benutzermenüs anzeigt werden. Beim
erneuten Drücken des Tasters info/set erscheint der Wert des Parameters, beim nochmaligen erneuten Drücken von info/set für
JHlQGHUW
GUHL6HNXQGHQEOLQNWGHU:HUWDXIGHP'LVSOD\XQGGHUJHZQVFKWH:HUWNDQQPLWGHQ3IHLOHQ.H\ XQG.H\
werden. Drücken Sie
]XP%HVWlWLJHQ
'UFNHQ6LH0HQ]XP%HVWlWLJHQXQGGLH3IHLOH]XU:DKOHLQHVDQGHUHQ3DUDPHWHUV
Gehen Sie auf dieselbe Weise für die übrigen Parameter vor.
Das Verlassen des Menüs erfolgt automatisch innerhalb von 60 Sekunden ohne Drücken irgendeines Tasters oder durch
XQG.H\
.
JOHLFK]HLWLJHV'UFNHQGHUEHLGHQ3IHLOH.H\
97
DEUTSCHE
Zur Anzeige der oben genannten Temperaturen/Setpoints ist wie folgt vorzugehen:
, es erscheint t1 auf dem Display
‡ 'UFNHQ6LH.H\
RGHU.H\
, zur Anzeige weiterer Mnemonik-Elemente auf dem Display
‡ 'UFNHQ6LH.H\
, zur Anzeige der/des gemessenen Temperatur/Sets
‡ 'UFNHQ6LH.H\
‡ 'UFNHQ6LH.H\
zum Beenden des Modus Temperatur/Set
3
Nehmen Sie zur Einstellung der Parameter auch Bezug auf die untenstehende Parameterübersichtstabelle.
Beispiel:
%HLP'UFNHQYRQ.H\
%HLP'UFNHQYRQ.H\
%HLP'UFNHQYRQ.H\
%HLP'UFNHQYRQ.H\
%HLP'UFNHQYRQ.H\
%HLP'UFNHQYRQ.H\
%HLP'UFNHQYRQ.H\
%HLP'UFNHQYRQ.H\
weiterer Parameter vor.
%HLP'UFNHQYRQ.H\
, erscheint USr auf dem Display
HUVFKHLQWGHUHUVWH3DUDPHWHUKU6(LQVWHOOXQJGHU6WXQGHQDXIGHU8KU
HUVFKHLQWGHU:HUWGHV3DUDPHWHUV%VS
für drei Sekunden blinkt der Wert des Parameters auf dem Display
RGHU.H\
wird der auf dem Display angezeigte Wert erhöht oder erniedrigt
]XP%HVWlWLJHQGHVHLQJHVWHOOWHQ:HUWHVK|UWGDV'LVSOD\DXI]XEOLQNHQ
, wird der Parameter angezeigt
RGHU.H\
]XUbQGHUXQJGHV3DUDPHWHUVXQGJHKHQ6LHZLHREHQEHVFKULHEHQ]XUbQGHUXQJ
XQG.H\
wird das Benutzermenü verlassen.
MNEMONIK
DISPLAY
MENÜ
(LQVWHOOEHUHLFK
Werkseinstellung
6<67(08+5
EINSTELLUNG DER
STUNDEN
Kɝ6
Benutzer
0-23
0
6<67(08+5
EINSTELLUNG DER
MINUTEN
ɉLQ
Benutzer
0-59
0
$.7,9,(581*
'($.7,9,(581*
TIMER
7LPHUGHDNWLYLHUW
7LPHUDNWLYLHUW
WLɉ
Benutzer
0-1
0
StA
Benutzer
00.0 – 23.5
0.00
'H]LPDOVWHOOHQ ]HKQ
0LQXWHQ%VS 0LQXWHQ Minuten
0.00
'H]LPDOVWHOOHQ ]HKQ
0LQXWHQ%VS 0LQXWHQ Minuten
SYSTEMUHR
EINSTELLUNG DER
MINUTEN
6<67(067$57=(,7
6<67(0$%6&+$/7=(,7
Sto
$.7,9,(581*
'($.7,9,(581*
NACHTBETRIEB
1DFKWEHWULHE
deaktiviert
1DFKWEHWULHEDNWLYLHUW
EINSCHALTZEIT IM
NACHTMODUS
DEUTSCHE
ABSCHALTZEIT
NACHTBETRIEB
ncL
nSt
Benutzer
Benutzer
Benutzer
nSP
Benutzer
EinlaufwasserTemperatur
t1
Temperaturen/
Set
Temperatur
Auslaufwasser
t2
Temperaturen/
Set
Temperatur Sensor
6DQLWlUZDVVHUWDQN
t3
Temperaturen/
Set
Temperatur Sensor
Außenluft
t4
Temperaturen/
Set
CHC
Temperaturen/
Set
Betriebsstunden
.RPSUHVVRU
6(732,17.h+/81*
cS1
Temperaturen/
Set
Benutzer
6(732,17.h+/81*
gNR0RGXV
cS2
Temperaturen/
Set
Benutzer
98
00.0 – 23.5
0,1
0
KOMMENTARE
Leistung und maximale
*HUlXVFKEHODVWXQJ
sind reduziert
0.00
'H]LPDOVWHOOHQ ]HKQ
0LQXWHQ%VS 0LQXWHQ Minuten
00.0 – 23.5
0.00
'H]LPDOVWHOOHQ ]HKQ
0LQXWHQ%VS 0LQXWHQ Minuten
/XF ƒ&
- 25°C
/XF ƒ&
- 20°C
/XF ƒ&
/XF ƒ&
Werkseinstellung für
Strahlböden
/XF ƒ&
- 25°C
/XF ƒ&
- 20°C
/XF ƒ&
/XF ƒ&
Werkseinstellung für
Strahlböden
00.0 – 23.5
3
SYSTEMUHR
EINSTELLUNG DER
MINUTEN
MENÜ
(LQVWHOOEHUHLFK
Werkseinstellung
Temperaturen/
Set
/XF ƒ&
- 55°C
/XF ƒ&
- 60°C
/XF ƒ&
/XF ƒ&
Werkseinstellung für
Strahlböden
/XF ƒ&
- 55°C
/XF ƒ&
- 60°C
/XF ƒ&
/XF ƒ&
Werkseinstellung für
Strahlböden
20-55°C
50°C
MNEMONIK
DISPLAY
SETPOINT HEIZUNG 1
HS1
Benutzer
SETPOINT HEIZUNG 2
gNR0RGXV
HS2
Temperaturen/
Set
Benutzer
SETPOINT
6$1,7b5:$66(57$1.
Temperaturen/
Set
HS3
$.7,9,(581*
'($.7,9,(581*
./,0$.859(
.h+/81*
.OLPDNXUYHGHDNWLYLHUW
.OLPDNXUYHDNWLYLHUW
$.7,9,(581*
'($.7,9,(581*
./,0$.859(+(,=81*
.OLPDNXUYHGHDNWLYLHUW
.OLPDNXUYHDNWLYLHUW
3.4
Ccc
Hcc
Benutzer
Benutzer
Benutzer
0, 1
0, 1
KOMMENTARE
HS3 wird nur
verwendet,
ZHQQGK8 :DVVHUNRQWUROOHLP
$XVODXI ƒ&IHVWHU
:HUW
0
%HL&FF ZLUGGLH
Temperaturkontrolle
mit dem Setpoint cS1
oder cS2 durchgeführt.
%HL&FF ZLUGGLH
Temperaturkontrolle
GHU.OLPDNXUYHJHPl‰
durchgeführt
0
%HL+FF ZLUGGLH
Temperaturkontrolle
mit dem Setpoint HS1
oder HS2 durchgeführt.
%HL+FF ZLUGGLH
Temperaturkontrolle
GHU.OLPDNXUYHJHPl‰
durchgeführt
AKTIVIERUNG UND FUNKTIONEN SERVICE
Gehen Sie zur Aktivierung der Einheit wie folgt vor:
‡ *HEHQ6LHPLW+LOIHGHU+DXSWVFKDOWHU6SDQQXQJDQGLH,QQHQHLQKHLWXQGDQGLH$X‰HQHLQKHLW
‡ $NWLYLHUHQ6LHGLH6FKDOWWDIHOGHU,QQHQHLQKHLWPLW+LOIHGHV6FKDOWHUV&DXIGHU%HGLHQWDIHO
‡ 'UFNHQ6LHGLH7DVWH.H\
an der Bedienerschnittstelle, die gelbe Led 1
leuchtet auf, und die grüne Led
]HLJWGLH$NWLYLHUXQJGHU8PODXISXPSHDQ=XP6FKOXVVHUVFKHLQWGLH%HWULHEVDUWDP'LVSOD\&/*IUGHQ.KOPRGXV+7*
IUGHQ+HL]PRGXVXQG6DQIU6DQLWlUZDVVHUSURGXNWLRQ
‡ 'UFNHQ6LHGLH7DVWH.H\
IUGLH:DKOGHU%HWULHEVDUW%HLP'UFNHQYRQ.H\
in der Sequenz
ZLUG GHU .KOPRGXV DNWLYLHUW XQG GLH JUQH /HG , leuchtet auf, danach wird der Heizmodus aktiviert, und die rote
Led 3 OHXFKWHWDXI=XP6FKOXVVZLUGGLH6DQLWlUZDVVHUSURGXNWLRQDNWLYLHUWXQGGLH/HGVXQGVLQGDXV
‡ %HLP'UFNHQGHV7DVWHUV.H\
ZLUGGHU(QHUJLHVSDUPRGXVgNRDNWLYLHUW'DV$XÀHXFKWHQGHUJUQHQ/HG
zeigt die Aktivierung des Öko-Modus.
0LW+LOIHGHU%HGLHQWDIHOGHU,QQHQHLQKHLWLVWHVGDUEHUKLQDXVP|JOLFKIROJHQGHYRP%HQXW]HUPHQDXVPRGL¿]LHUEDUH)XQNWLRQHQ
zu aktivieren.
‡
‡
9(5:$/781*'(5(/(.75,6&+(1:,'(567b1'(,11(1(,1+(,7
'LH(LQKHLWHQVLQGPLWHLQHP]ZHLVWX¿JHQ6WW]ZLGHUVWDQGDXVJHVWDWWHWN:N:DXIGHQ,QQHQHLQKHLWHQ60$//VRZLH
3 kW + 3 kW auf den Einheiten LARGE. Zur Aktivierung dieser Funktion ist die Installation des Außenluft-Temperatursonden.LWVHUIRUGHUOLFK'LH$NWLYLHUXQJLVWP|JOLFK]XU/HLVWXQJVHUJlQ]XQJEHLP+HL]HQEHLGHU3URGXNWLRQYRQ6DQLWlUZDVVHUXQG
ZlKUHQGGHU$XVIKUXQJGHU$QWLOHJLRQHOOHQ=\NOHQ6LHKHJHVRQGHUWHQ$EVFKQLWW
-HQDFK%HGDUIXQGGHUYHUIJEDUHQHOHNWULVFKHQ/HLVWXQJLVWGLH$NWLYLHUXQJP|JOLFKPLWGHP3DUDPHWHUEF HLQ]HOQPLW
GHP3DUDPHWHU$(+ RGHUSDDUZHLVHHLQ]HOQPLWGHP3DUDPHWHU$(+ 'DUEHUKLQDXVNDQQPLW+LOIHGHV3DUDPHWHUV
RW(%VSRW( ƒ&IHVWJHOHJWZHUGHQEHLZHOFKHU$X‰HQWHPSHUDWXUGLH$NWLYLHUXQJHUIROJHQVROO
Der erste Widerstand wird aktiviert, wenn die Temperatur der Außenluft unter otE liegt, wenn die Wassertemperatur mehr als
ƒ.XQWHUGHUHLQJHVWHOOWHQ7HPSHUDWXUOLHJWVRZLHQDFK$EODXIGHULP3DUDPHWHU(K3HLQJHVWHOOWHQ=HLWLQ0LQXWHQDEGHP
Eintreten dieser Bedingungen. Der zweite Widerstand wird aktiviert innerhalb einiger Minuten nach Aktivierung des ersten
Widerstands, wenn die Parameter nicht erfüllt sind. Die Aktivierungszeit kann mit Hilfe des Parameters EhP zwischen 0 und
0LQXWHQHLQJHVWHOOWZHUGHQ'LHHOHNWULVFKHQ:LGHUVWlQGHN|QQHQQLFKWDNWLYLHUWZHUGHQZHQQGHU%HWULHEHLQHUH[WHUQHQ
:lUPHTXHOOHEF DNWLYLHUWLVW
'LHHOHNWULVFKHQ:LGHUVWlQGHZHUGHQEHLHLQHP'HIHNWGHU$X‰HQHLQKHLWDNWLYLHUW
KONTROLLE DER WASSERTEMPERATUR
'HU7KHUPRVWDW]XU(LQVWHOOXQJGHU:DVVHUWHPSHUDWXUNDQQ]XU5HJHOXQJGHU=XODXIZDVVHU7HPSHUDWXU:HUNVHLQVWHOOXQJ
/8F RGHU]XU5HJHOXQJGHU7HPSHUDWXUGHV5FNODXIZDVVHUVYRQGHU$QODJH/8F YHUZHQGHWZHUGHQ
99
DEUTSCHE
3
‡
FERNSTEUERUNG
(LQLJH)XQNWLRQHQGHV*HUlWVN|QQHQPLW+LOIHSRWHQWLDOIUHLHU.RQWDNWHDXI'LVWDQ]NRQWUROOLHUWZHUGHQ
'LH$QVFKOVVHGHU.RQWDNWHZHUGHQKHUJHVWHOOWDXIGHU.OHPPOHLVWHGHU(OHNWURQLNNDUWHGHU,QQHQHLQKHLW$EEZLH
unten beschrieben:
Klemme 1: (LQVFKDOWXQJ$XVVFKDOWXQJ EHL RIIHQHP SRWHQWLDOIUHLHP .RQWDNW VWHKW GDV 6\VWHP DXI 6WDQGE\ EHL
JHVFKORVVHQHP.RQWDNWLVWGDV6\VWHPHLQJHVFKDOWHW
Klemme 2 :HFKVHO GHU %HWULHEVDUW +HL]XQJ.KOXQJ EHL RIIHQHP SRWHQWLDOIUHLHP .RQWDNW OlXIW GDV 6\VWHP LP
+HL]XQJVPRGXVEHLJHVFKORVVHQHP.RQWDNWOlXIWGDV6\VWHPLP.KOPRGXV
Klemme 3 =ZHLWHU6HWSRLQWg.20RGXVEHLRIIHQHPSRWHQWLDOIUHLHP.RQWDNWLVWGHUJHZlKOWH6HWSRLQWF6LP.KOPRGXV
RGHU+6LP+HL]XQJVPRGXV%HLJHVFKORVVHQHP.RQWDNWLVWGHUJHZlKOWH6HWSRLQWF6LP.KOPRGXVRGHU
HS2 im Heizungsmodus.
Klemme 4 $NWLYLHUXQJGHU:DKOGHV1DFKWEHWULHEVPRGXVEHLRIIHQHPSRWHQWLDOIUHLHP.RQWDNWLVWGLH)XQNWLRQGHDNWLYLHUW
%HLJHVFKORVVHQHP.RQWDNWLVWGLH)XQNWLRQDNWLYLHUW
Klemme 5 EHUHLWVDQGLH.OHPPOHLVWHGHU,QQHQHLQKHLW/DQJHVFKORVVHQ$NWLYLHUXQJGHU+HL]XQJGHV6DQLWlUZDVVHUV
EHLRIIHQHPSRWHQWLDOIUHLHP.RQWDNWLVWGHU6DQLWlUZDVVHUPRGXVGHDNWLYLHUW%HLJHVFKORVVHQHP.RQWDNWLVW
GHU6DQLWlUZDVVHUPRGXVDNWLYLHUW
Klemme 6 $NWLYLHUXQJ+HPPXQJGHU%HWULHEVDUW.KOXQJRGHU+HL]XQJ%HLRIIHQHP.RQWDNWEOHLEWGHU6DQLWlUZDVVHUEHWULHE
DNWLY.DQQDXFKDQHLQ=HLWWKHUPRVWDWRGHUDQGLH3DUDOOHONRQWDNWH&KLOOHU%RLOHUGHUHOHNWURQLVFKHQ6WHXHUXQJHQ
GHU9HQWLO.RQYHNWRUHQ%LXQG%LDQJHVFKORVVHQZHUGHQ
'LH.RQWDNWHPVVHQDXIGHU.OHPPH/JHVFKORVVHQVHLQ
'LH$NWLYLHUXQJGHU)HUQNRQWDNWHXQGZLUGIUHLJHJHEHQGXUFKGHQ3DUDPHWHUUɉ7 ‡
KONTROLLEN DER UMLAUFPUMPE
:lKUHQGGHU,QVWDOODWLRQNDQQGHU%HWULHEGHU8PODXISXPSHIU0LQXWHQIRUFLHUWZHUGHQVRGDVVGHU3DUDPHWHU)3$ gesetzt wird. Auf diese Weise wird das Ausblasen der Luft in der Endphase des Füllens der Anlage mit Wasser unterstützt.
Die Umlaufpumpe kann auf verschiedene Weisen je nach den Anforderungen der Anlage, an welche die Einheit angeschlossen
ist, arbeiten.
‡ 'DXHUEHWULHEGHU3XPSH:HUNOHLQVWHOOXQJGHV3DUDPHWHUVF33 ‡ 'LH3XPSHZLUGDEJHVFKDOWHWVREDOGGHU6HWSRLQWIUGDV:DVVHUHLQJHKDOWHQZLUG'LH3XPSHZLUGUHJHOPl‰LJDNWLYLHUW
XPGLH7HPSHUDWXUGHV:DVVHUVLP.UHLVODXI]XEHUSUIHQ'HU3UI]\NOXVZLUGGH¿QLHUWYRP(LQVWHOOZHUWGHV3DUDPHWHUV
F33]%VSPLWF33 ZLUGGLH3XPSHDOOH]HKQ0LQXWHQPLWHLQJHKDOWHQHP6HWSRLQWIUHLQH0LQXWHDNWLYLHUW
'LH$QWLEORFNLHUIXQNWLRQ GHU 3XPSH LVW YRUKDQGHQ ZlKUHQG GDV 6\VWHP DXI 2)) JHVFKDOWHW LVW 'XUFK 6HW]HQ GHV
3DUDPHWHUV336 ZLUGGLHVH)XQNWLRQDNWLYLHUW0LWGHP3DUDPHWHU3TGZLUGGH¿QLHUWQDFKZLHYLHOHQ6WXQGHQMHZHLOV
GHU6WDUWHUIROJWXQGGHU3DUDPHWHU3TWOHJWIHVWZLHODQJHGLH3XPSHZlKUHQGGHV$QWLEORFNLHU]\NOXVLQ%HWULHEEOHLEW
‡
VERWALTUNG EINER EXTERNEN HILFSWÄRMEQUELLE
,QGHU+HL]IXQNWLRQRGHUEHLGHU6DQLWlUZDVVHUSURGXNWLRQYHUDQODVVWGLH6WHXHUXQJEHUGHQ3DUDPHWHUEF HLQHQ:HFKVHO
GHU:lUPHSXPSHQHLQKHLWIDOOVGLH$X‰HQOXIWWHPSHUDWXUXQWHUHLQHQYRUHLQJHVWHOOWHQ:HUWVLQNW3DUDPHWHURW(
‡
PRODUKTION VON SANITÄRWASSER
'DV*HUlWNDQQDQHLQHP7DQNPLW=ZLVFKHQ:lUPHEHUWUDJHUIUGLH6DQLWlUZDVVHUSURGXNWLRQDQJHVFKORVVHQZHUGHQ
'LH,QQHQHLQKHLWHQLQGHU9HUVLRQ:PLW'UHLZHJYHQWLON|QQHQGHQ+HL‰ZDVVHUÀXVV]XHLQHP7DQNIUGLH$XIQDKPHYRQ
6DQLWlUZDVVHUXPOHLWHQ
'LH$QIRUGHUXQJYRQ6DQLWlUZDVVHUNDQQDXI]ZHL:HLVHQHUIROJHQ
‡ EHU HLQHQ SRWHQWLDOIUHLHQ .RQWDNW / GXUFK (LQVWHOOXQJ GHV 3DUDPHWHUV GK8 ,Q GLHVHP )DOO VWHOOHQ 6LH GHQ
$X‰HQWKHUPRVWDW3RWHQWLDOIUHLHUQ.RQWDNWDXIHLQH7HPSHUDWXUXQWHUƒ&HLQ
‡ PLW+LOIHHLQHVLQGHQ6DQLWlUZDVVHUWDQNHLQJHVHW]WHQ7HPSHUDWXUVHQVRUVPLW(LQVWHOOXQJGHV3DUDPHWHUVGK8 ,Q
diesem Fall wird der Setpoint mit dem Parameter HS3 eingestellt.
Mit Hilfe des Parameters hyS ist es auch möglich, den Hysteresezyklus der Temperaturkontrolle des Tanks zu überprüfen.
$E:HUN+6 ƒ&XQGK\6 ƒ.VRGDVVGLH7HPSHUDWXULP7DQN]ZLVFKHQXQGƒ&OLHJW
DEUTSCHE
100
%HL$QIRUGHUXQJHLQHU6DQLWlUZDVVHUSURGXNWLRQlQGHUWGLH.RQWUROOHLKUHQ6WDWXVDXIIROJHQGH:HLVHQ
‡ :HQQGLH(LQKHLWLP+HL]PRGXVOlXIWZLUGGDV'UHLZHJYHQWLOXPJHVFKDOWHWXQGGHU+HL‰ZDVVHUÀXVVZLUGXPJHOHLWHWLQ
5LFKWXQJGHV7DQNV$&6LQ´%HLP(UUHLFKHQGHUJHIRUGHUWHQ7HPSHUDWXUOHLWHWGDV'UHLZHJYHQWLOGHQ:DVVHUÀXVV
LQ´LQ5LFKWXQJGHU+HL]XQJVDQODJHXQGGDV6\VWHPOlXIWZHLWHUZLHYRUGHU6DQLWlUZDVVHUDQIRUGHUXQJ
‡ :HQQGLH(LQKHLWLP.KOPRGXVOlXIWZLUGGHU.RPSUHVVRUDEJHVFKDOWHWGDVGDV'UHLZHJYHQWLOZLUGXPJHVFKDOWHWXQG
GHU+HL‰ZDVVHUÀXVVZLUGXPJHOHLWHWLQ5LFKWXQJGHV7DQNV$&6%HLP(UUHLFKHQGHUJHIRUGHUWHQ7HPSHUDWXUZLUGGHU
.RPSUHVVRUDEJHVFKDOWHWGDV.KO]\NOXVXPNHKUYHQWLOXQGGDV'UHLZHJYHQWLOZHUGHQXPJHVFKDOWHWXQG]XP6FKOXVV
ZLUGGHU.RPSUHVVRULQQHUKDOEYRQGUHL0LQXWHQDEGHPYRUKHULJHQ$EVFKDOWHQJHVWDUWHW
:lKUHQG GHU 6DQLWlUZDVVHUSURGXNWLRQ JLEW GDV 6\VWHP GLH PD[LPDO P|JOLFKH /HLVWXQJ DE XP VFKQHOO GLH
6DQLWlUZDVVHUDQIRUGHUXQJ]XHUIOOHQ
‡
ANTILEGIONELLENZYKLYUS
'XUFK$NWLYLHUXQJGHU$QWLOHJLRQHOOHQIXQNWLRQLVWGHU5HJOHULQGHU/DJHVHOEVWWlWLJGLH:lUPHGHVLQIHNWLRQVSUR]HGXUHQDQGHQ
+HL‰VDQLWlUZDVVHUDQODJHQGXUFK]XIKUHQXQGVRGDV5LVLNRGHV$XIWUHWHQVXQGGHU9HUPHKUXQJGHU/HJLRQHOOHQ%DNWHULH
deutlich zu mindern.
Die Desinfektionsfunktion kann mit Hilfe des Parameters Ldi aktiviert werden. Es besteht die Möglichkeit der Wahl für die
(UKLW]XQJGHV6DQLWlUZDVVHUVPLWGHU:lUPHSXPSHXQGGHQ]ZHLVWX¿JHQHOHNWULVFKHQ:LGHUVWlQGHQDQ%RUGGHU,QQHQHLQKHLW
GXUFK (LQVWHOOXQJ GHV 3DUDPHWHUV /G$ RGHU PLWWHOV HLQHV :LGHUVWDQGV LP 6DQLWlUZDVVHUWDQN GXUFK (LQVWHOOXQJ GHV
3DUDPHWHUV/G$ ,P]ZHLWHQ)DOOPLW/G$ LVWGHUHOHNWULVFKH:LGHUVWDQGJHWUHQQW]XVSHLVHQXQGGXUFKHLQDQGLH
.OHPPHQ1NDFWLYDWLRQDQJHVFKRVVHQHV5HODLV]XDNWLYLHUHQ
Die Festlegung des Zeitintervalls für die Ausführung des Zyklus in Tagen, für die Zeitdauer und die Temperatur, mit der die
Desinfektionszyklen auszuführen sind, erfolgt in den Parametern LdS, Ldd und Ldt.
3
'LH'DXHUGHV9RUJDQJVKlQJWYRQGHQ$QODJHQHLJHQVFKDIWHQDE'LH/HJLRQHOOHQ%DNWHULHUHDJLHUWMHQDFKGHULP.UHLV
erreichten Höchsttemperatur auf unterschiedliche Weise und hat mit dem Anstieg der Temperatur eine kürzere Lebensdauer.
'LH.RQWUROOHVLJQDOLVLHUWGLH$XVIKUXQJGHU$QWLOHJLRQHOOHQ)XQNWLRQGXUFK$Q]HLJHYRQ/(*DXIGHP'LVSOD\1DFKHLQHU
Zeit von maximal 5 Stunden, wenn aus irgendeinem Grund die Temperatur im Innern des Tanks nicht erreicht worden ist,
ZLUGGLH)XQNWLRQYHUODVVHQ$XFKGDQQZHQQZlKUHQGGHV$QWLOHJLRQHOOHQ=\NOXV]XYLHOH$&6(QWQDKPHQGXUFKJHIKUW
ZHUGHQ XQG GLH 7HPSHUDWXU QLFKW EHLEHKDOWHQ ZLUG YHUOlVVW GLH .RQWUROOH QDFK ]ZHL 9HUVXFKHQ GLH )XQNWLRQ :HQQ GHU
Antilegionellen-Zyklus zweimal hintereinander nicht abgeschlossen wird, erscheint der Alarm A8 auf dem Display.
:lKUHQG GHU $XVIKUXQJ GHU $QWLOHJLRQHOOHQ)XQNWLRQ ZHUGHQ GLH .KO RGHU +HL]IXQNWLRQHQ GHU $QODJH XQWHUEURFKHQ
ZHQQ GHU 'HVLQIHNWLRQV]\NOXV YRQ GHU :lUPHSXPSH XQG GHQ HOHNWULVFKHQ :LGHUVWlQGHQ EHUQRPPHQ ZLUG 3DUDPHWHU
/G$ 'LH.KORGHU+HL]IXQNWLRQHQZLUGKLQJHJHQQLFKWXQWHUEURFKHQZHQQGHU$QWLOHJLRQHOOHQ=\NOXVGXUFKHLQHQLP
6DQLWlUZDVVHUWDQNHLQJHVHW]WHQ:LGHUVWDQGDXVJHIKUWZLUG3DUDPHWHU/G$ =XU9HUPHLGXQJYRQ9HUEUHQQXQJHQEHLGHU(QWQDKPHYRQ+HL‰ZDVVHUZlKUHQGGHU:lUPHGHVLQIHNWLRQHPS¿HKOWVLFKGHU
(LQVDW]YRQ9HUEUKXQJVVFKXW]YRUULFKWXQJHQDXIMHGHP9HUEUDXFKHURGHUDP$XVJDQJGHV6DQLWlUZDVVHUWDQNV
‡
)52676&+87=
'HU:lUPHEHUWUDJHUPLWVFKZHL‰JHO|WHWHQ3ODWWHQGHU,QQHQHLQKHLWLVWJHJHQ)URVWEUXFKJHVFKW]WGXUFKHLQHQ)OXVVZlFKWHU
der den Betrieb des Systems unterbricht, sobald die Wasserförderleistung unzureichend ist, sowie durch zwei Temperatursensor
DXIGHP3ODWWHQZlUPHEHUWUDJHUGLHGHQ%HWULHEGHV6\VWHPVXQWHUEUHFKHQVREDOGGLH:DVVHUWHPSHUDWXUHQ]XQLHGULJ
sind.
‡
KLIMAKURVEN $EE
=XU2SWLPLHUXQJGHU(QHUJLHHUVSDUQLVVWHKHQ]ZHL.OLPDNXUYHQ]XU9HUIJXQJHLQHIUGLH+HL]XQJXQGHLQHIUGLH.KOXQJ
'LHVH)XQNWLRQHUODXEWGLH$QSDVVXQJGHU:DVVHUWHPSHUDWXUDQGLH$X‰HQWHPSHUDWXUXQGGDPLWDQGLH:lUPHODVWVRGDVV
die Energieersparnis des Systems optimiert wird.
'LH$NWLYLHUXQJGHU.XUYHLP+HL]PRGXVHUIROJWGXUFK(LQVWHOOXQJGHV3DUDPHWHUV+FF 'LH(LQVWHOOXQJGHU.OLPDNXUYHHUIROJWGXUFKYLHU3DUDPHWHU
Hc1 Temperatur der Außenluft, um die maximale Wassertemperatur zu erhalten
Hc2 Maximale Wassertemperatur
Hc3 Temperatur der Außenluft, um die minimale Wassertemperatur zu erhalten
Hc4 Minimale Wassertemperatur
'LH$NWLYLHUXQJGHU.XUYHLP.KOPRGXVHUIROJWGXUFK(LQVWHOOXQJGHV3DUDPHWHUV&FF 'LH(LQVWHOOXQJGHU.OLPDNXUYHHUIROJWGXUFKYLHU3DUDPHWHU
Cc1 Temperatur der Außenluft, um die maximale Wassertemperatur zu erhalten
Cc2 Maximale Wassertemperatur
Cc3 Temperatur der Außenluft, um die minimale Wassertemperatur zu erhalten
Cc4 Minimale Wassertemperatur
6LHKH$EE./,0$.859(+(,=81*+FFXQG.h+/81*&FF
bQGHUQ6LHQLFKWGLH3DUDPHWHU&+6UW)$GUXQG)3WGDEHLKDQGHOWHVVLFKXP3DUDPHWHU]XUZHUNVLQWHUQHQ9HUZHQGXQJ
3.5
EINSTELLUNG DER PARAMETER DES SERVICE-MENÜS
ist es möglich, auf das Service-Menü zuzugreifen. Bei zweimaligem Drücken erscheint auf dem
0LW+LOIHGHV7DVWHUV.(<
'LVSOD\6(UIU6HUYLFH$VVLVWHQ]
QDFK:DKOGHV6HUYLFH0HQVHUVFKHLQWGLH3DVVZRUWDQIRUGHUXQJ3$6DXIGHP'LVSOD\
%HLP'UFNHQYRQ.(<
Beim Drücken von info/set erscheint 00 auf dem Display, beim erneuten Drücken von info/set für drei Sekunden erscheint 00
LP%OLQNPRGXV*HEHQ6LHGDQDFKGHQ:HUWIU3$6HLQXQGGUFNHQ6LHLQIRVHW]XP%HVWlWLJHQEHLP'UFNHQYRQ0HQ
erscheint PAS auf dem Display, mit den Pfeilen Auf und Ab können alle Parameter des Benutzer-Menüs angezeigt werden.
Beim erneuten Drücken des Tasters info/set erscheint der Wert des Parameters, beim nochmaligen erneuten Drücken von info/
VHWIUGUHL6HNXQGHQEOLQNWGHU:HUWDXIGHP'LVSOD\XQGGHUJHZQVFKWH:HUWNDQQPLWGHQ3IHLOHQ.H\ XQG.H\
,
JHlQGHUWZHUGHQ'UFNHQ6LHLQIRVHW]XP%HVWlWLJHQ'UFNHQ6LH0HQ]XP%HVWlWLJHQXQGGLH3IHLOH]XU:DKOHLQHVDQGHUHQ
Parameters. Gehen Sie auf dieselbe Weise für die übrigen Parameter vor.
Das Verlassen des Menüs erfolgt automatisch innerhalb von 60 Sekunden ohne Drücken irgendeines Tasters oder durch
JOHLFK]HLWLJHV'UFNHQGHUEHLGHQ3IHLOH.H\
XQG.H\
.
Beispiel:
%HL]ZHLPDOLJHP'UFNHQYRQ.H\
erscheint SER auf dem Display
%HL]ZHLPDOLJHP'UFNHQYRQ.H\
, erscheint PAS auf dem Display
%HLP'UFNHQYRQ.H\
, erscheint 00 auf dem Display
%HLP'UFNHQYRQ.H\
, für drei Sekunden blinkt der Wert 00 auf dem Display
%HLP'UFNHQYRQ.H\
RGHU.H\
, wird der auf dem Display angezeigte Wert erhöht oder erniedrigt.
]XP%HVWlWLJHQGHVHLQJHVWHOOWHQ:HUWHVK|UWGDV'LVSOD\DXI]XEOLQNHQ
%HLP'UFNHQYRQ.H\
%HLP'UFNHQYRQ.H\
, zum Beenden erscheint PAS auf dem Display.
%HLP'UFNHQYRQ.H\
RGHU.H\
, wird ein Parameter angezeigt. Die Mnemo-Elemente der Parameter
HUVFKHLQHQQDFKHLQDQGHUDXIGHP'LVSOD\XQGKDOWHQDXIGHP]XlQGHUQGHQ3DUDPHWHU
, für drei Sekunden blinkt der Wert des Parameters auf dem Display
%HLP'UFNHQYRQ.H\
%HLP'UFNHQYRQ.H\
RGHU.H\
NDQQGHU3DUDPHWHUJHlQGHUWZHUGHQ
]XP%HVWlWLJHQGHVHLQJHVWHOOWHQ:HUWHVK|UWGDV'LVSOD\DXI]XEOLQNHQ
%HLP'UFNHQYRQ.H\
, zum Beenden erscheint das Mnemo-Element des letzten Parameters auf dem Display.
%HLP'UFNHQYRQ.H\
%HJLQQHQ6LHZLHGHUEHLP3XQNWXPHLQHQZHLWHUHQ3DUDPHWHU]XlQGHUQ
%HLPJOHLFK]HLWLJHQ'UFNHQYRQ.H\
XQG.H\
wird das Benutzermenü verlassen.
101
DEUTSCHE
3
DEUTSCHE
Nehmen Sie zur Einstellung der Parameter auch Bezug auf die untenstehende Parameterübersichtstabelle.
102
Parameter
MNEMONIK
DISPLAY
MENÜ
(LQVWHOOEHUHLFK
Werkseinstellung
=86b7=/,&+(,11(5(
(/(.75,6&+(:,'(567b1'(
HOHNWULVFKH:LGHUVWlQGH
deaktiviert
HUVWH6WXIHHOHNWULVFKH
:LGHUVWlQGHDNWLYLHUW
HUVWHXQG]ZHLWH6WXIHHOHNWULVFKH
:LGHUVWlQGHDNWLYLHUW
AEH
Service
0,1,2
0
.21752//6(1625)h5
WASSERTEMPERATUR
.RQWUROOHEDVLHUWDXIGHU
Temperatur des einlaufenden Wassers
.RQWUROOHEDVLHUWDXIGHU
Temperatur des auslaufenden
Wassers
LUc
Service
0,1
1
BPHE HEIZER SETPOINT
cHS
Service
-5 bis 5 °C
2°C
FERNSTEUERUNG
QXU%HGLHQHUVFKQLWWVWHOOH
.RPPXQLNDWLRQV3RUWDNWLYLHUW
IHUQVWHXHUEDUHSRWHQWLDOIUHLH
.RQWDNWHDNWLYLHUW
Uɉ7
Service
0,1,2
0
$17,%/2&.,(5)81.7,21)h5
PUMPE BEI AUSGESCHALTETER
PUMPE
$QWLEORFNLHUIXQNWLRQ3XPSH
deaktiviert
$QWLEORFNLHUIXQNWLRQ3XPSH
aktiviert
PPS
Service
0,1
1
PERIODISCHE
$17,%/2&.,(5)81.7,213803(
Pqd
Service
0 -100 Stunden
72
BETRIEBSZEIT PUMPE IN
$17,%/2&.,(5)81.7,21
Pqt
Service
0 - 10 Minuten
0,5
PUMPENWARTUNGSERINNERUNG
3ɉG
Service
0-999 Tage
0
WARTUNGSERINNERUNG
WASSERFILTER
8)ɉ
Service
0-999 Tage
0
ANFORDERUNG ZUR
$.7,9,(581*'(5(;7(51(1
:b50(48(//(
$NWLYLHUXQJVDQIRUGHUXQJ
GHDNWLYLHUW $NWLYLHUXQJVDQIRUGHUXQJ
aktiviert
bc
Service
0,1
0
0LWEF N|QQHQGLH
HOHNWULVFKHQ:LGHUVWlQGH
in der Inneneinheit nicht
aktiviert werden
SCHWELLE
$866(1/8)77(03(5$785)h5
$.7,9,(581*=86b7=/,&+(
(/(.75,6&+(:,'(567b1'(
2'(5(;7(51(:b50(48(//(
otE
Service
-15 bis 20°C
2°C
%HLEF XQG
Außenlufttemperatur
WRW(ZLUGGHUDQGLH
.OHPPHQXQG
DQJHVFKORVVHQH.RQWDNW
JHVFKORVVHQ%HLEF $(+!XQGWRW(NDQQ
der interne elektrische
Widerstand aktiviert
werden.
352'8.7,21921
6$1,7b5:$66(5
3URGXNWLRQGHDNWLYLHUW
3URGXNWLRQDNWLYLHUWEHU
SRWHQWLDOIUHLHQ.RQWDNW
3URGXNWLRQDNWLYLHUWEHU6HQVRU
LP6DQLWlUZDVVHUWDQN
dhU
Service
0,1,2
1
%HLGK8 VWHOOHQ6LH
den Außenthermostat
SRWHQWLDOIUHLHP.RQWDNW
auf eine Temperatur unter
60 °C ein.
KOMMENTARE
Nicht belegt
0LWUɉ7 N|QQHQ
On/Off, C/H nur von
den ferngesteuerten
SRWHQWLDOIUHLHQ.RQWDNWHQ
kontrolliert werden. Diese
Steuerungen werden an
der Bedienerschnittstelle
deaktiviert.
Modi Öko und
Nachtbetrieb,
6DQLWlUZDVVHUSURGXNWLRQ
XQG7$.RQWDNWVLQGVWHWV
aktiviert bei beliebigem
:HUWYRQUɉ7
6WHS 6HNXQGHQ
3
MNEMONIK
DISPLAY
MENÜ
(LQVWHOOEHUHLFK
Werkseinstellung
%(75,(%6$57)81.7,21
$17,/(*,21(//(1=<./86
:lUPHSXPSHHOHNWULVFKH
:LGHUVWlQGH,QQHQHLQKHLW
HOHNWULVFKH:LGHUVWlQGHLP
6DQLWlUZDVVHUWDQN
LdA
Service
0,1
0
PERIODISCHE ANTILEGIONELLEN)81.7,21
/GL )XQNWLRQGHDNWLYLHUW
%HLOGD XQG/GL!LVWGLH)XQNWLRQ
mit elektrischem Widerstand im
6DQLWlUZDVVHUWDQNDNWLYLHUW
Ldi
Service
0 - 30 Tage
0
8+5=(,7$.7,9,(581*
$17,/(*,21(//(1=<./86
Lds
Service
00,0 - 23,5
2,00
TEMPERATUR ANTILEGIONELLEN=<./86
Ldt
Service
50°C - 80°C
65°C
DAUER ANTILEGIONELLEN=<./86
Ldd
Service
0 - 240 Minuten
30
)25&,(57($.7,9,(581*3803(
3XPSHQIRUFLHUXQJQLFKWDNWLYLHUW
3XPSHQIRUFLHUXQJDNWLYLHUW
FPA
Service
0,1
0
Funktion nur mit dem
System in Stand-by aktiv.
9(5=g*(581*$.7,9,(581*
(/(.75,6&+(:,'(567b1'(
INNENEINHEIT
EhP
Service
0 - 60 Minuten
15
Verzögerung zwischen
6WRSSGHU:lUPHSXPSH
XQGGHU.RQWUROOHGHU
Bedingungen für die
Aktivierung der Stufe 1 des
elektrischen Widerstands
falls erforderlich. Bei
Freigabe wird die zweite
Stufe mit 15 Minuten
Verzögerung gegenüber
der ersten Stufe aktiviert
IHVWH=HLW
PERIODISCHE
3803(1$.7,9,(581*:(11'(5
SETPOINT NICHT EINGEHALTEN
WIRD
cPP
Service
0-20 Minuten
0
Wenn der Setpoint
eingehalten wird
.RPSUHVVRUDXV
F33 GLH3XPSHEOHLEW
eingeschaltet
cPP>0: die Pumpe bleibt
aus für cPP Minuten
und wird anschließend
eingeschaltet für eine
Minute. Diese Prüfung
erfolgt auf zyklische
:HLVH]XU.RQWUROOHGHU
Wassertemperatur im
.UHLV
+<67(5(6(7(03(5$785
6$1,7b5:$66(57$1.7
hyS
Service
5°C - 25°C
10°C
Zur Verwendung nur mit
GK8 6HQVRUWLP
6DQLWlUZDVVHUWDQN
./,0$.859(.h+/81*
$866(1/8)7)h50$;,0$/(
WASSERTEMPERATUR
Cc1
Service
-15 – +50°C
20°C
./,0$.859(.h+/81*0$;,0$/(
WASSERTEMPERATUR
Cc2
Service
/XF ƒ&
ƒ&/XF 7°C -27°C
18°C
Werkeinstellung für
9HQWLO.RQYHNWRUHQXQG
Anlagensteuerung /
Wassertemperatur im
$XVJDQJ/8F ./,0$.859(.h+/81*
$866(1/8)7)h50,1,0$/(
WASSERTEMPERATUR
Cc3
Service
-15 – +50°C
40°C
./,0$.859(.h+/81*0,1,0$/(
WASSERTEMPERATUR
Cc4
Service
/XF ƒ&
ƒ&/XF 7°C -27°C
15°C
KOMMENTARE
'H]LPDOVWHOOHQ ]HKQ
0LQXWHQ%VS 0LQXWHQELV Minuten
&F•&F&F•&F
DEUTSCHE
Parameter
103
3
MNEMONIK
DISPLAY
MENÜ
(LQVWHOOEHUHLFK
Werkseinstellung
./,0$.859(+(,=81*
$866(1/8)7)h50$;,0$/(
WASSERTEMPERATUR
Hc1
Service
-15 – +50°C
-5°C
./,0$.859(+(,=81*0$;,0$/(
WASSERTEMPERATUR
Hc2
Service
/XF ƒ&/XF 20-55°C
35°C
./,0$.859(+(,=81*
$866(1/8)7)h50,1,0$/(
WASSERTEMPERATUR
Hc3
Service
-15 – +50°C
20°C
./,0$.859(+(,=81*0,1,0$/(
WASSERTEMPERATUR
Hc4
Service
/XF ƒ&/XF 20-55°C
28°C
3$66:2570(1h6(59,&(
PAS
Service
rtF
Service
±VWHS
0
:(5.6,17(51(
VERWENDUNG, NICHT
9(5b1'(51
Adr
Service
1 – 255
1
$GUHVVH.RPPXQLNDWLRQV
Port RS485 zur
Verwendung mit beliebiger
ferngesteuerter Peripherie
3&XD
Parameter
DEUTSCHE
PERIPHERIEADRESSE
104
KOMMENTARE
Werkeinstellung für
9HQWLO.RQYHNWRUHQXQG
Anlagensteuerung /
Wassertemperatur im
$XVJDQJ/8F +F•+F+F•+F
Wert im Besitz des Olimpia
Splendid Service
3
3.6
DEAKTIVIERUNG UND ABSCHALTUNG FÜR LANGE ZEITRÄUME$EE
*HKHQ6LH]XU'HDNWLYLHUXQJGHU:lUPHSXPSHZLHIROJWYRU
‡ 'UFNHQ6LHGLH7DVWH.H\,DXIGHU%HGLHQWDIHOELVDXIGHP'LVSOD\6W\6WDQGE\HUVFKHLQW
‡ 1HKPHQ6LHGLH6WURPYHUVRUJXQJGHU$X‰HQHLQKHLWZHJ
Auf diese Weise bleibt die Antiblockierfunktion der Umlaufpumpe aktiv.
%HL1LFKWEHQXW]XQJGHU:lUPHSXPSHIUHLQHQODQJHQ=HLWUDXPVLQGIROJHQGH6FKULWWHGXUFK]XIKUHQ
‡ 'UFNHQ6LHGLH7DVWH.H\,DXIGHU%HGLHQHUVFKQLWWVWHOOHELVDXIGHP'LVSOD\6W\6WDQGE\HUVFKHLQW
‡ 1HKPHQ6LHGLH6WURPYHUVRUJXQJGHU,QQHQHLQKHLWPLW+LOIHGHV6FKDOWHUV$EE3RV&DXIGHU%HGLHQWDIHOZHJ
‡ 1HKPHQ6LHGLH6WURPYHUVRUJXQJGHU,QQHQHLQKHLWXQGGHU$X‰HQHLQKHLWPLW+LOIHGHU+DXSWVFKDOWHUZHJ
Bei Wegnahme der Stromversorgung auch von der Inneneinheit bleibt die Antiblockierfunktion der Umlaufpumpe nicht aktiv, und
GLH(QWULHJHOXQJGHUVHOEHQN|QQWHHUIRUGHUOLFKVHLQ$EE
=XU:LHGHULQEHWULHEQDKPHGHU/XIW:DVVHU:lUPHSXPSHQDFKHLQHOlQJHUHQ=HLWGHU,QDNWLYLWlWGHU:lUPHSXPSHHPS¿HKOW
VLFKGHU(LQJULIIGHV7HFKQLVFKHQ.XQGHQGLHQVWHV
3.7
REINIGUNG
'LHHLQ]LJHVHLWHQVGHV9HUDQWZRUWOLFKHQGHU$QODJHHUIRUGHUOLFKH5HLQLJXQJVDUEHLWLVWGDV$EZLVFKHQGHU$X‰HQÀlFKHGHU/XIW
:DVVHU:lUPHSXPSHQXUXQWHU9HUZHQGXQJPLW:DVVHUXQG6HLIHEHIHXFKWHWHU/DSSHQ
%HIHXFKWHQ6LHEHLKDUWQlFNLJHQ)OHFNHQGHQ/DSSHQPLWHLQHU0LVFKXQJDXV:DVVHUXQGGHQDWXULHUWHP$ONRKRORGHUPLW
Spezialprodukten.
7URFNQHQ6LHGLH2EHUÀlFKHQQDFK$EVFKOXVVGHU5HLQLJXQJVRUJIlOWLJ
9HUZHQGHQ6LHNHLQH6FKZlPPHPLWVFKHXHUQGHQ3URGXNWHQRGHU5HLQLJXQJVSXOYHU-HJOLFKHU5HLQLJXQJVHLQJULIIYRU
GHP$EWUHQQHQGHV*HUlWHVYRQGHUHOHNWULVFKHQ6WURPYHUVRUJXQJGXUFK6WHOOHQGHV+DXSWVFKDOWHUVGHU,QQHQHLQKHLW
XQGGHU$X‰HQHLQKHLWDXI³$XV´LVWYHUERWHQ
3.8
PROGRAMMIERTE WARTUNG
'LHUHJHOPl‰LJH:DUWXQJLVWXQYHU]LFKWEDUXPGLH:lUPHSXPSHVWHWVHI¿]LHQWVLFKHUXQGGDXHUKDIW]XYHUOlVVLJ]XKDOWHQ'LH
:DUWXQJNDQQKDOEMlKUOLFKRGHULQEHVWLPPWHQ)lOOHQMlKUOLFKYRP7HFKQLVFKHQ.XQGHQGLHQVWGXUFKJHIKUWZHUGHQGHUWHFKQLVFK
ausgebildet ist und gegebenenfalls Ersatzteile einsetzen kann.
'HU:DUWXQJVSODQGHQGHU7HFKQLVFKH.XQGHQGLHQVWOLIMPIA SPLENDIDRGHUGHU.KOWHFKQLNHU]XEHDFKWHQKDWVLHKWIROJHQGH
MlKUOLFKGXUFK]XIKUHQGHQ(LQJULIIHXQG.RQWUROOHQYRU
‡ 3UIXQJGHV'UXFNVLP([SDQVLRQVJHIl‰
‡ )OOHQGHV:DVVHUNUHLVHV
‡ 9RUKDQGHQVHLQYRQ/XIWLP:DVVHUNUHLV
‡ :LUNVDPNHLWGHU6LFKHUXQJHQ
‡ (OHNWULVFKH9HUVRUJXQJVVSDQQXQJ
‡ (OHNWULVFKH6WURPDXIQDKPH
‡ )HVWHU$Q]XJGHUHOHNWULVFKHQ$QVFKOVVH
‡ 5HLQLJXQJGHU5LVWHGHU9HQWLODWRUHQXQGGHU5LSSHQGHU%DWWHULHGHU$X‰HQHLQKHLW
‡ hEHUSUIXQJ9RUKDQGHQVHLQYRQ6FKPXW]DXIGHP)LOWHUXQGDXIGHP0HWDOOQHW]
3.9
ALARME
$ODUPH'LVSOD\,QQHLQKHLW
Die Tabelle 6 zeigt die Alarme oder Overrides, die auf dem Display der Bedientafel darstellbar sind.
'LH 2YHUULGHV VWHOOHQ .(,1(1 +LQZHLV DXI HLQH %HWULHEVVW|UXQJ GHV 6\VWHPV GDU VRQGHUQ VLJQDOLVLHUHQ HLQHQ
YRUEHUJHKHQGHQEHVRQGHUHQ%HWULHEV]XVWDQG'LH2YHUULGHVHUIRUGHUQ.(,1(1(LQJULIIGHV7HFKQLVFKHQ.XQGHQGLHQVWHV
Beim Auftreten eines Alarms erscheint ein Mnemonik-Element auf den Display. Gleichzeitig leuchtet die Led 5
$ODUPNRQWDNW]ZLVFKHQGHQ.OHPPHQXQGZLUGJHVFKORVVHQ
auf, und der
Mnemonik auf dem
Display
Override #1
Or1
Temperatur des einlaufenden Wassers unter 10 °C
Override #2
Or2
)URVWVFKXW]IXQNWLRQ:lUPHWDXVFKHU
Override #3
Or3
$QIRUGHUXQJ]XU$NWLYLHUXQJGHUDNWLYHQ:lUPHTXHOOH
Override #4
Or4
.RQWDNW7$RIIHQ.OHPPHGHU(OHNWURQLNNDUWH
Override #5
Or5
.DSD]LWlWVEHJUHQ]XQJGHU$X‰HQHLQKHLW
Override #6
Or6
$EWDX]\NOXVOlXIW
Alarm #1
A1
Defekt Sensor Wasser im Auslauf
Alarm #2
A2
Defekt Sensor Wasser im Einlauf
DEUTSCHE
%HVFKUHLEXQJ2YHUULGH$ODUP
Code Override/Alarm
105
3
Alarm #3
A3
'HIHNW6HQVRU6DQLWlUZDVVHUWDQN
Alarm #4
A4
Defekt Sensor Außenluft
Alarm #5
A5
)URVWVFKXW]IXQNWLRQ3ODWWHQZlUPHEHUWUDJHU
Alarm #6
A6
$ODUP)OXVVZlFKWHU
Alarm #7
A7
)HKOHULQGHU.RPPXQLNDWLRQPLW$X‰HQHLQKHLW
Alarm #8
A8
Antilegionellen-Zyklus nicht durchgeführt
Alarm #9
A9
)HKOHULQGHU.RPPXQLNDWLRQ6HULDO3RUW56
Alarm #10
A10
hEHUVWURPVFKXW]$ODUP$X‰HQHLQKHLW
Alarm #11
A11
6FKXW]9HUVRUJXQJVVSDQQXQJ$ODUP$X‰HQHLQKHLW
Alarm #12
A12
3KDVHQVHTXHQ]$X‰HQHLQKHLWIHKOHUKDIW$ODUP$X‰HQHLQKHLW
Alarm #13
A13
'HIHNWGHU6HQVRUHQ$X‰HQHLQKHLW$ODUP$X‰HQHLQKHLW
hEHUSUIHQVLHGHQ$ODUPW\SDXIGHU.DUWHGHU$X‰HQHLQKHLW$EV
Beim Erscheinen eines Alarms überprüfen Sie in der Tabelle 6 die Ursache und beheben Sie die Störung oder rufen Sie den
7HFKQLVFKHQ.XQGHQGLHQVW
=XU(QWIHUQXQJGHU$ODUPHYRQ$ELV$GUFNHQ6LHGHQ7DVWHU.H\ für zehn Sekunden oder rufen Sie den Technischen
.XQGHQGLHQVW
'LH6WHXHUXQJKDWGDUEHUKLQDXVGLH0|JOLFKNHLW]ZHL:DUWXQJVDODUPHIU3XPSHXQG:DVVHU¿OWHU]XDNWLYLHUHQ0LW+LOIHGHV
3DUDPHWHUV3ɉGZLUGGLH$Q]DKO%HWULHEVWDJHYRUGHU$NWLYLHUXQJGHV3XPSHQDODUPVIHVWJHOHJW0LW+LOIHGHV3DUDPHWHUV8)ɉ
wird die Anzahl Betriebstage vor der Aktivierung des Filteralarms festgelegt.
Die Alarme können aktiviert werden, indem der entsprechende Alarm zwischen 1 und 999 Tagen eingestellt wird. Bei Einstellung
ZLUGGHU=lKOHUQLFKWDNWLYLHUW
Wenn der Alarm aktiviert wird, und die Maschine für die eingestellte Anzahl Tage in Betrieb war, erscheint auf dem Display FiL
leuchtet auf.
IUGHQ)LOWHUXQG3ɉ3IUGLH3XPSHGHU3DUDPHWHULVWHLQJHVWHOOWXQGGLH/HG
=XU'HDNWLYLHUXQJGHV$ODUPV)L/IUGHQ)LOWHUXQG3ɉ3IUGLH3XPSHGUFNHQ6LHGHQ7DVWHU.(<
für zehn Sekunden
bis zum Verschwinden des Alarms.
$ODUPH'LVSOD\$X‰HQHLQKHLW
$XIGHU.RQWUROONDUWHGHU$X‰HQHLQKHLWEH¿QGHWHLQ=ZHL'LJLW'LVSOD\GDVYRUKDQGHQH$ODUPHJHJHEHQHQIDOOVDQ]HLJW
Die untenstehende Tabelle zeigt die Alarme der Außeneinheit.
)HKOHUFRGH
DEUTSCHE
E0
106
$ODUPEHVFKUHLEXQJ
Funktionsbeschreibung EEPROM
E2
)HKOHULQGHU.RPPXQLNDWLRQ]ZLVFKHQGHU$X‰HQHLQKHLWXQGGHU,QQHQHLQKHLW
E3
)HKOHULQGHU.RPPXQLNDWLRQPLWH[WHUQHU.DUWH
E4
Defekt Sensor Temperatur Außeneinheit
E5
6FKXW]9HUVRUJXQJVVSDQQXQJ.RPSUHVVRU
E6
6FKXW]GHV0RGXOV3)&QXUIU..PLW3KDVH
P0
6FKXW]7HPSHUDWXU.RPSUHVVRUNRSI
P1
Hochdruck-Schutz
P2
Niederdruck-Schutz
P3
hEHUVWURPVFKXW].RPSUHVVRU
P4
6FKXW]7HPSHUDWXU=XOHLWXQJ.RPSUHVVRU
P5
6FKXW]KRKH.RQGHQVDWLRQV7HPSHUDWXU
P6
Schutz Modul
Was this manual useful for you? yes no
Thank you for your participation!

* Your assessment is very important for improving the work of artificial intelligence, which forms the content of this project

Download PDF

advertisement