Anleitung

Anleitung
r
fü
Ein Qualitätsprodukt aus dem Hause
r
n t
s ei ne ah
se t k ig J
ie is e 4
D kt ge b 1
u g, r a
od eu tle
Pr elz or
i p
Sp ells
od
M
en
.
PLATINUM
professional series
USB SUPPORTED
Die Platinum Regler-Serie ist für Brushless-Motoren und LiPo-/NiMH-Antriebsakkus ausgelegt. Die Elektronik wird durch einen Microprozessor angesteuert. Die Software verfügt über
unzählige Parameter, die sich individuell programmieren lassen. So lassen sich die Regler für
QDKH]XDOOH$QZHQGXQJHQDQSDVVHQXQGELHWHQPD[LPDOH(I¿]LHQ]EHLNRUUHNWHU$XVOHJXQJGHV
Antriebsstrangs.
FEATURES
‡ $XWRPDWLVFKH(UNHQQXQJGHU=HOOHQ]DKOPDQXHOOH(LQVWHOOXQJP|JOLFKIU
Unterspannungsabschaltung NiMH & LiPo
‡ 0RWRU$EVFKDOWYHUKDOWHQLQ6WXIHQSURJUDPPLHUEDU
‡ ([WUHPQLHGULJHU,QQHQZLGHUVWDQG
‡ (LQVWHOOEDUH7DNWIUHTXHQ].+]
‡ 3URJUDPPLHUEDUH%UHPVH6WXIHQ$XV
‡ (LQVWHOOEDUH0RWRUODVWLQ6WXIHQ
‡ 7LPLQJLQ6WXIHQELVƒHLQVWHOOEDU
‡ 7HPSHUDWXUhEHUVWURP$EVLFKHUXQJ
‡ 6DQIWDQODXIIUVFKRQHQGH%HKDQGOXQJGHV*HWULHEHV
‡ *HWDNWHWHV%(&IUKRKH(LQJDQJVVSDQQXQJHQ
‡ :lKOEDUH%(&6SDQQXQJ99
‡ 6WDUW6LFKHUKHLWVV\VWHPPLW$QODXIVFKXW]
‡ 'UHK]DKOUHJOHU0RGXV*RYHUQRU0RGHIU+HOLV
‡ (LQIDFKH3URJUDPPLHUXQJGXUFK3URJUDPPLHUNDUWH
‡ 0RWRUDEVFKDOWXQJEHLIHKOHQGHP6HQGHUVLJQDORGHU)XQNVW|UXQJHQ
‡ +RFKZHUWLJH$QVFKOXVVNDEHOPLW6LOLNRQ,VROLHUXQJ
‡ 3URJUDPPLHUEDUXQGXSGDWHIlKLJEHU86%$QVFKOXVVPLW3URJUDP%R[LQ
‡ 0D[LPDOH0RWRUGUHK]DKOHQ8PLQSRO8PLQSRO8PLQSRO
TECHNISCHE DATEN
ƌƟŬĞůEƌ ƌƟŬĞůEĂŵĞ
ĂƵĞƌƐƚƌŽŵ ^ƉŝƚnjĞŶƐƚ͘хϭϬƐ ͲDŽĚĞ ͲƵƐŐĂŶŐ
>ŝWŽ
EŝD,
ďŵĞƐƐƵŶŐĞŶ 'ĞǁŝĐŚƚ
80030000 ZĞŐůĞƌηWůĂƟŶƵŵWƌŽϰϬ
ϰϬ
ϲϬ
Getaktet
ϱ͕ϮϱsŽĚĞƌϲ͕ϬsďĞŝϯ͕Ϭ ϮͲϲĞůůĞŶ
ϱͲϭϴĞůůĞŶ
ϱϵdžϮϳdžϭϮŵŵ ϯϴŐ
80030020 ZĞŐůĞƌηWůĂƟŶƵŵWƌŽϲϬ
ϲϬ
ϵϬ
Getaktet
ϱ͕ϮϱsŽĚĞƌϲ͕ϬsďĞŝϯ͕Ϭ ϮͲϲĞůůĞŶ
ϱͲϭϴĞůůĞŶ
ϳϬdžϯϰdžϭϲŵŵ ϲϴŐ
ϴϬϬϯϬϬϰϬ ZĞŐůĞƌηWůĂƟŶƵŵWƌŽϴϬ
ϴϬ
ϭϮϬ
Getaktet
ϱ͕ϮϱsŽĚĞƌϲ͕ϬsďĞŝϯ͕Ϭ ϮͲϲĞůůĞŶ
ϱͲϭϴĞůůĞŶ
ϳϬdžϯϰdžϭϲŵŵ ϳϳŐ
80030050 ZĞŐůĞƌηWůĂƟŶƵŵWƌŽϭϬϬ
ϭϬϬ
ϭϱϬ
Getaktet
ϱ͕ϮϱsŽĚĞƌϲ͕ϬsďĞŝϯ͕Ϭ ϮͲϲĞůůĞŶ
ϱͲϭϴĞůůĞŶ
ϳϬdžϯϰdžϭϲŵŵ ϴϮŐ
80030070 ZĞŐůĞƌηWůĂƟŶƵŵWƌŽϭϱϬKWdK
ϭϱϬ
ϮϮϬ
ŽŚŶĞ
ŽŚŶĞ
ϱͲϭϴĞůůĞŶ
ϴϴdžϱϱdžϭϱŵŵ ϭϮϱŐ
ϮͲϲĞůůĞŶ
80030030 ZĞŐůĞƌηWůĂƟŶƵŵWƌŽϳϬ,s
ϳϬ
ϭϬϱ
ŽŚŶĞ
ŽŚŶĞ
ϱͲϭϮĞůůĞŶ ϭϱͲϯϲĞůůĞŶ ϳϬdžϯϰdžϭϲŵŵ ϴϮŐ
80030060 ZĞŐůĞƌηWůĂƟŶƵŵWƌŽϭϮϬ,s
ϭϮϬ
ϭϴϬ
ŽŚŶĞ
ŽŚŶĞ
ϱͲϭϮĞůůĞŶ ϭϱͲϯϲĞůůĞŶ ϴϴdžϱϱdžϭϱŵŵ ϭϮϱŐ
Bedienungsanleitung
Instruction Manual
Vor der ersten Inbetriebnahme, die Anleitung sorgfältig durchlesen! Beachten Sie unbedingt die Sicherheitshinweise!
Bewahren Sie diese Dokumentation an einem sicheren Ort auf!
'LH$ENU]XQJ%(&VWHKWIU³%DWWHU\(OLPLQDWRU&LUFXLW´'XUFKGLHVHQLQWHJULHUWHQ6FKDOWNUHLV
wird der Empfänger aus dem Antriebsakku versorgt. Dadurch ist kein separater Empfängerakku
HUIRUGHUOLFK'LH5HJOHUYHUIJHQEHUHLQJHWDNWHWHV%(&'HU)HUULWNHUQLP(PSIlQJHUNDEHO
0866XQEHGLQJWYHUZHQGHWZHUGHQXP6W|UXQJHQGHU5&$QODJH]XYHUPHLGHQ
5HJOHUW\SHQPLWGHQ1DPHQV]XVlW]HQ³[[[2372´RGHU³[[[+9´KDEHQNHLQHLQWHJULHUWHQ
%(&6FKDOWNUHLVH+LHUPXVVGLH(PSIlQJHUVWURP9HUVRUJXQJGXUFKHLQHQ]XVlW]OLFKHQ
Empfängerakku erfolgen. Ebenso ist ein separater Akku erforderlich, wenn die Regler mit einer
Programmierkarte programmiert werden. Beachten Sie hierzu auch die Hersteller-Hinweise der
Programmierkarte.
ANSCHLUSS-DIAGRAMM
'LH3ODWLQXP$23723ODWLQXP$+9XQG3ODWLQXP$+95HJOHUQXW]HQGLH$QWL
/LFKWERJHQ9HUNDEHOXQJ,QGHUURWHQ=XOHLWXQJ¿QGHQ6LHHLQH6WHFNYHUELOGXQJDXV*ROGNRQWDNWVWHFNHUQXQGHLQHPGQQHQURWHQ'UDKW'LHVHGLHQHQ]XU9HUPHLGXQJHLQHV/LFKWERJHQV
EHLP9HUELQGHQGHV$NNXVPLWGHP5HJOHU
%LWWHJHKHQ6LHEHLP$QVFKOXVVGHV$NNXZLHIROJWYRU
7UHQQHQ6LHEHLGH6WHFNYHUELQGXQJHQLPURWHQ$QVFKOXVVNDEHOGHV5HJOHUV
9HUELQGHQ6LHGHQ$NNXPLWGHP5HJOHU
9HUELQGHQ6LHGLH*ROGNRQWDNWVWHFNHULQQHUKDOEGHUURWHQ$QVFKOXVVOHLWXQJVREDOG6LHGLH
7RQIROJHÄƈ´GHV5HJOHUVK|UHQ
PROGRAMMIERBARE PARAMETER
EMK-Bremse:$XV6RIWKDUWH[WUDKDUW:HUNVHLQVWHOOXQJLVW³$XV´
Batterie-Typ:/LWKLXP/L3RRGHU/L,RQ1L0+:HUNVHLQVWHOOXQJLVW³/LWKLXP´
Unterspannungsschutz (CutOff Mode): 6RIW5HGX]LHUXQJGHU0RWRUOHLVWXQJ+DUW$EVFKDOWXQJGHV$QWULHEV:HUNVHLQVWHOOXQJLVW³6RIW´
Unterspannungsschutz (Spannungsgrenze):7LHI0LWWHO+RFKEHQXW]HUGH¿QLHUW
:HUNVHLQVWHOOXQJLVW³0LWWHO´)U/LWKLXP$NNXVZLUGGLH$EVFKDOWVSDQQXQJIUGDVJHVDPWH
3DFNJHPl‰GHU=HOOHQ]DKOEHUHFKQHW%HL5HJOHUQIU/L3R=HOOHQOLHJHQGLH$EVFKDOWVSDQQXQJHQEHL97LHI90LWWHO9KRFK%HL+95HJOHUQIU/L3R=HOOHQ
OLHJHQGLH$EVFKDOWVSDQQXQJHQEHL97LHI90LWWHO9KRFK
LiPo-Akkus::LUGGLH6SDQQXQJVJUHQ]HDXI³0LWWHO´JHVHW]WOLHJWGLH$EVFKDOWVSDQQXQJIU
HLQHQGUHL]HOOLJHQ/L3R$NNXEHL[ 9
NiMH- & NiCd-Akkus:)U1L0+XQG1L&G$NNXVZLUGGLH$EVFKDOWVSDQQXQJZLHIROJWHLQJHVWHOOW7LHIGHU$NNXVSDQQXQJGHVYROOJHODGHQHQ$NNXV0LWWHOGHU$NNXVSDQQXQJ
GHVYROOJHODGHQHQ$NNXV+RFKGHU$NNXVSDQQXQJGHVYROOJHODGHQHQ$NNXV%HQXW]HUGH¿QLHUW%HLGLHVHU2SWLRQNDQQGLH$EVFKDOWVSDQQXQJEHUHLQH3URJUDPPLHUNDUWHRGHUEHU
GHQ86%$QVFKOXVVLQ6FKULWWHQYRQ9SURJUDPPLHUWZHUGHQ
Seite 2
www.hobbywing.com.de
Platinum Regler Serie
Motoranlauf-Modus:1RUPDO6RIW([WUD6RIW:HUNVHLQVWHOOXQJLVW³1RUPDO´
'LH(LQVWHOOXQJ³1RUPDO´ZLUGHPSIRKOHQIU)OXJ]HXJH'LH(LQVWHOOXQJHQ³6RIW³XQG³([WUD
6RIW³ZHUGHQIU+HOLFRSWHUHPSIRKOHQ%HLGHU(LQVWHOOXQJ³6RIW³GDXHUWHV6HNXQGHQELVGHU
0RWRUYRQDXI/HLVWXQJEHVFKOHXQLJW%HLGHU(LQVWHOOXQJ³([WUD6RIW³GDXHUWGHU9RUJDQJ6HNXQGHQ:LUGGHU*DVNQSSHOZlKUHQGGHV)OXJHVDXI0RWRU$XVJHVWHOOWXQG
LQQHUKDOEYRQ6HNXQGHQZLHGHUEHWlWLJWZLUGGHU0RWRUDQODXI0RGXVWHPSRUlUDXI³1RUPDO³
gesetzt, um in der Luft ein schnelles Ansprechverhalten zu erzielen.
Timing:ƒƒƒƒƒƒƒƒ:HUNVHLQVWHOOXQJLVWƒ
,QGHU5HJHOVLQGPLWWOHUH7LPLQJ:HUWHIUGLHPHLVWHQ0RWRUHQJHHLJQHW'HUH[DNWH7LPLQJwert muss jedoch auf den jeweiligen Motor individuell angepasst werden. Mit dem korrekten
7LPLQJOlXIWGHU0RWRUZHLFKXQGUXFNHOIUHL-HK|KHUGHU7LPLQJZHUWGHVWRK|KHUVLQGGLH
Motorleistung und die Motordrehzahl. Hinweis:1DFKMHGHU9HUlQGHUXQJGHV7LPLQJVPXVVGHU
0RWRUODXIYRUGHP6WDUWGHV0RGHOOVJHWHVWHWZHUGHQ
Drehzahlregler-Mode:$XV'UHK]DKOUHJOHU/RZ'UHK]DKOUHJOHU+LJK:HUNVHLQVWHOOXQJ
LVW³$XV´:HQQGHU'UHK]DKOUHJOHU0RGHDNWLYLHUWLVWYHUVXFKWGHU5HJOHUGLHYRUJHZlKOWH
0RWRUGUHK]DKOLQMHGHU)OXJVLWXDWLRQEHL]XEHKDOWHQ'LH0RWRUGUHK]DKONDQQEHUGLH+|KHGHU
.XUYHYHUlQGHUWZHUGHQ,P'UHK]DKOUHJOHU0RGHZLUGDXWRPDWLVFKGHU0RWRUDQODXI0RGXV
³([WUD6RIW´DNWLYLHUW
'HU'UHK]DKOEHUHLFKGHU(LQVWHOOXQJ³'UHK]DKOUHJOHU/RZ´OLHJW]ZLVFKHQXQG
8PLQIUSRO%/0RWRUHQ'HU'UHK]DKOEHUHLFKGHU(LQVWHOOXQJ³'UHK]DKOUHJOHU+LJK´OLHJW
]ZLVFKHQXQG8PLQIUSRO%/0RWRUHQ8PGLH5RWRUNRSIGUHK]DKOHLQHV
+HOLFRSWHUV]XHUUHFKQHQEHQ|WLJWPDQGLH$Q]DKOGHU0RWRU3ROHXQGGLH*HWULHEHEHUVHW]XQJ
des Modells.
%HLVSLHO6LHÀLHJHQHLQHQSRO0RWRU3RO3DDUHGDV+DXSW]DKQUDGKDW=GDV0RWRUULW]HOKDW='LH5RWRUNRSIGUHK]DKOHUUHFKQHWVLFKZLHIROJW
Rotorkopfdrehzahl = (Motordrehzahl 2-pol Motor x 13) / 3 / 150
%HLP-XVWLHUHQGHU.XUYHPXVVEHUFNVLFKWLJWZHUGHQGDVVGHU0RWRUGLHJHZlKOWH'UHK]DKO
auch unter voller Last erreicht. Bei Unterschreiten der vorgewählten Motordrehzahl um mehr als
ZLUGGHU'UHK]DKOUHJOHU0RGHDXWRPDWLVFKGHDNWLYLHUW
Motor Typ:1RUPDOHU0RWRU6SH]LDO0RWRU6SH]LDO0RWRU:HUNVHLQVWHOOXQJLVW³1RUPDOHU0RWRU´,QGHU5HJHOLVWGLH(LQVWHOOXQJ³1RUPDOHU0RWRU´IUGLHPHLVWHQ0RWRUHQNRUUHNW
)DOOVHLQ0RWRUMHGRFKQLFKWVDXEHUOlXIWN|QQHQGLH(LQVWHOOXQJHQ6SH]LDO0RWRUXQG6SH]LDO
0RWRUYHUZHQGHWZHUGHQ
Platinum Regler Serie
www.hobbywing.com.de
Seite 3
Taktfrequenz:.+].+]:HUNVHLQVWHOOXQJLVW³.+]´(LQLJH+90RWRUHQXQG0RWRUHQ
PLWKRKHU3RO$Q]DKOODXIHQUXKLJHUPLWHLQHU7DNWIUHTXHQ]YRQ.+]-HGRFKPXVVEHUFNVLFKWLJWZHUGHQGDVVGHU5HJOHULP.+]0RGXVGHXWOLFKZlUPHUZLUGLP%HWULHE
BEC-Ausgangsspannung:99:HUNVHLQVWHOOXQJLVW9
Motor-Last:1RUPDO+RFK6HKU+RFK$XWR%HL5HJOHUQIU/L3R=HOOHQLVWGLH:HUNVHLQVWHOOXQJ³1RUPDO´%HL+95HJOHUQIU/L3R=HOOHQLVWGLH:HUNVHLQVWHOOXQJ³$XWR´
:HQQGHU0RWRUVFKODJDUWLJDXI9ROOJDVEHVFKOHXQLJWZLUGXQGGDEHLDEUXSWVWHKHQEOHLEWXQG
JOHLFK]HLWLJHLQHQODXWHQ7RQYHUXUVDFKWPXVVHLQDQGHUHU:HUWJHZlKOWZHUGHQ'LHVNDQQ
SDVVLHUHQZHQQGHU0RWRUGXUFKHLQ*HWULHEHRlPHKU.UDIWXQG=HLWEHQ|WLJWXPDQ]XODXIHQ
XQGDXI'UHK]DKO]XNRPPHQ%HL9HUlQGHUXQJGHU:HUWHDXIKRFKE]ZVHKUKRFKZLUGGDV
=HLWIHQVWHUIUGLH.RPPXWDWLRQYRQ$DXI%YHUJU|‰HUW
Anzahl Zellen des LiPo-Akkus:%HL5HJOHUQIU/L3R=HOOHQN|QQHQGLH:HUWH$XWR6
6666JHZlKOWZHUGHQ:HUNVHLQVWHOOXQJLVW³$XWR´%HL+95HJOHUQIU/L3R
=HOOHQN|QQHQGLH:HUWH$XWR66666JHZlKOWZHUGHQ:HUNVHLQVWHOOXQJLVW
³$XWR´'LHVH2SWLRQLVWIU/LWKLXP$NNXVYHUIJEDU%HLP(LQVFKDOWHQVHQGHWGHU5HJOHUHLQH
$Q]DKOYRQ%HHS6LJQDOHQXPGLH$Q]DKOGHU=HOOHQGHV/L3R3DFNV]XEHVWlWLJHQNXU]H
%HHSVVLJQDOLVLHUHQHLQHV/L3R$NNX%HL+95HJOHUQVWHKWHLQODQJHU%HHSIU=HOOHQ
HLQNXU]HU%HHSVWHKWIUHLQH=HOOH(LQV$NNXZLUGDOVREHL+95HJOHUQPLWHLQHPODQJHQ
und einem kurzen Beep signalisiert. WICHTIG:6ROOWHGLH=HOOHQ]DKOIDOVFKHUNDQQWZRUGHQVHLQ
0866GLH=HOOHQ]DKOLP5HJOHUSURJUDPPLHUWZHUGHQ
Inbetriebnahme des Reglers
hEHUSUIHQ6LHGHQNRUUHNWHQ$QVFKOXVVGHV5HJOHUV$FKWHQ6LHLQVEHVRQGHUHDXIGLHNRUUHNWH
3ROXQJGHV$QWULHEVDNNXV9HUIDKUHQ6LHGDQDFKZLHIROJW
*DVNQSSHODXIQHXWUDO/HHUODXI6WRSVHW]HQXQGGHQ6HQGHUHLQVFKDOWHQ
$NNXDQGHQ5HJOHUDQVFKOLH‰HQ'DQDFKEHJLQQWGHU5HJOHUPLWGHU,QLWLDOLVLHUXQJXQGVHQGHW
HLQH7RQIROJH³ƈ´'LHV]HLJWDQGDVVGLH$NNXVSDQQXQJLP]XOlVVLJHQ%HUHLFKOLHJW'DQDFKZLUGHLQH$Q]DKOYRQ%HHS7|QHQJHVHQGHWXPGLH$Q]DKOGHU=HOOHQGHV/L3R3DFNV]X
EHVWlWLJHQ$EVFKOLH‰HQGZLUGHLQODQJHU%HHS7RQJHVHQGHWXQGGHU5HJOHULVWEHWULHEVEHUHLW
‡)DOOVGHU5HJOHUQDFKGHP$QVFKOXVVNHLQH5HDNWLRQ]HLJWPVVHQDOOH6WHFNYHUELQGXQJHQ
überprüft werden.
‡)DOOVGLHVSH]LHOOH7RQIROJH³ƈ´QDFK]ZHL%HHS6LJQDOHQJHVHQGHWZLUGEH¿QGHWVLFK
GHU5HJOHULP3URJUDPPLHU0RGXV'LHVLVWJHVFKHKHQZHLOGHU*DVNQSSHODXI9ROOJDVVWHKW
bzw. die Servolaufrichtung am Sender falsch programmiert ist.
‡)DOOVGLHURWH/('VFKQHOOEOLQNW[SUR6HNXQGHLVWGLH(LQJDQJVVSDQQXQJ]XKRFKRGHU]X
niedrig und liegt außerhalb des zulässigen Spannungsbereichs.
WICHTIG:-HGHU6HQGHUKDWHLQHQJHULQJIJLJDQGHUHQ5HJHOEHUHLFK'DKHULVWHVHUIRUGHUOLFK
GHQ5HJOHUDXIGHQ6HQGHU]XNDOLEULHUHQ%HDFKWHQ6LHKLHU]XGDVLPVSlWHUHQ9HUODXIIROJHQGH
.DSLWHO³*DV.DOLEULHUXQJ´1DFKNRUUHNWHU.DOLEULHUXQJOHXFKWHWGLHURWH/('DXIZHQQGHU
*DVNQSSHODXI9ROOJDVVWHKW
Warntöne
8Q]XOlVVLJH(LQJDQJVVSDQQXQJ'HU5HJOHUEHUSUIWGLH6SDQQXQJGHV$QWULHEVDNNXVXQPLWWHOEDUQDFKGHP$QVFKOXVV/LHJWGLH6SDQQXQJDX‰HUKDOEGHV]XOlVVLJHQ%HUHLFKVHUW|QWHLQ
%HHS%HHS6LJQDOGDVVLFKMHGH6HNXQGHZLHGHUKROW*OHLFK]HLWLJEOLQNWGLHURWH/('
Seite 4
www.hobbywing.com.de
Platinum Regler Serie
.HLQ6HQGHUVLJQDO:HQQGHU5HJOHUNHLQ6HQGHUVLJQDOHUNHQQWHUW|QWHLQ%HHS%HHS
%HHS6LJQDO'LHVHV6LJQDOHUW|QWDOOH]ZHL6HNXQGHQ
*DVNQSSHOLVWQLFKWDXIQHXWUDO/HHUODXI6WRS:HQQVLFKGHU*DVNQSSHOQLFKWLQGHU
0LQLPXP3RVLWLRQEH¿QGHWZLUGHLQHVFKQHOOH)ROJHYRQ%HHS%HHS%HHS6LJQDOHQPLWHLQHP
,QWHUYDOOYRQFDVJHVHQGHW
Schutz-Funktionen
0RWRUDQODXIEHUZDFKXQJ)DOOVQDFK%HWlWLJXQJGHV*DVNQSSHOVGHU0RWRUQLFKWLQQHUKDOE
von zwei Sekunden ordnungsgemäß angelaufen ist, wird die Stromzufuhr zum Motor automaWLVFKXQWHUEURFKHQ,QGLHVHP)DOO0866GHU*DVNQSSHOZLHGHUDXIGLH0LQLPXP3RVLWLRQ
]XUFNJHVHW]WZHUGHQXQGHUQHXWEHWlWLJWZHUGHQ'LHVHU)DOONDQQHLQWUHWHQZHQQGLH6WHFNHUYHUELQGXQJHQVFKOHFKWVLQGGHU3URSHOOHURGHUGDV*HWULHEHEORFNLHUWZHUGHQ
7HPSHUDWXUVFKXW]:HQQGLH7HPSHUDWXUGHV5HJOHUVGHQ]XOlVVLJHQ:HUWEHUVWHLJWZLUGGLH
Ausgangsleistung des Reglers automatisch reduziert.
6HQGHUVLJQDOEHUZDFKXQJ'HU5HJOHUXQWHUEULFKWGLH6WURP]XIXKU]XP0RWRUZHQQGDV6HQGHUVLJQDOOlQJHUDOV6HNXQGHQQLFKWHUNDQQWZLUG6RZLHGDV6HQGHUVLJQDOZLHGHUHUNDQQW
wird, wird der Motor wieder mit Strom versorgt.
Problemlösungen
Problem
Mögliche Ursache
Lösung
.HLQH5HDNWLRQQDFKGHP$Qschluss des Akkus.
6FKOHFKWHU.RQWDNWGHU6WHFNHUYHU
bindungen.
Steckerverbindungen prüfen und
ggf. erneuern
Nach dem Anschluss des Akkus
EOLQNWGLHURWH/('XQGHVHUW|QW
ein Beep-Beep-Signal in einem
,QWHUYDOOYRQHLQHU6HNXQGH
Die Akkuspannung ist zu hoch oder
zu niedrig.
hEHUSUIHQ6LHGLH$NNXVSDQQXQJ
und verwenden Sie ggf. einen
zulässigen Akku.
Nach dem Anschluss des Akkus
HUW|QWHLQ%HHS%HHS%HHS
6LJQDO'LHVHV6LJQDOHUW|QWDOOH
zwei Sekunden.
Der Regler erkennt kein Sendersignal.
*HULQJH5HLFKZHLWHGHU5&
Anlage, Empfängerkabel des
Reglers defekt
Nach dem Anschluss des Akkus erW|QWHLQ%HHS%HHS%HHS6LJQDO
PLWHLQHP,QWHUYDOOYRQFD
Sekunden.
'HU*DVNQSSHOLVWQLFKWLQ
Leerlauf-Position.
*DVNQSSHOLQ/HHUODXI3RVLWLRQ
bringen.
Nach dem Anschluss des Akkus
ZLUGGLHVSH]LHOOH7RQIROJH³ƈ
´QDFK]ZHL%HHS6LJQDOHQ
gesendet.
'LH/DXIULFKWXQJ6HUYR5HYHUVH
GHU*DV)XQNWLRQDP6HQGHULVW
vertauscht.
/DXIULFKWXQJGHU*DV)XQNWLRQDP
Sender umkehren.
Der Motor dreht sich in der falschen Richtung.
Der Anschluss des Motors am
Regler ist fehlerhaft.
9HUWDXVFKHQ6LH]ZHLEHOLHELJH
Anschlusskabel zwischen Motor
und Regler.
Der Motor bleibt im Betrieb einfach
stehen.
.HLQ6HQGHUVLJQDO
hEHUSUIHQ6LHGLH5HLFKZHLWH
,KUHU)HUQVWHXHUXQJXQGGDV
Anschlusskabel des Reglers.
Der Unterspannungsschutz im
Regler ist aktiv.
Das Modell landen und den Akku
HUQHXWDXÀDGHQRGHUDXVWDXVFKHQ
Schlechte Steckerverbindungen
hEHUSUIHQ6LHVlPWOLFKH6WHFNHUverbindungen am Regler, am Motor
und am Empfänger.
6W|UXQJGHU5&$QODJHGXUFK
DQGHUH6HQGHULQ,KUHU1lKH
.RQWUROOLHUHQ6LH,KUH)UHTXHQ]
und prüfen Sie, ob ein anderer
3LORWDXIGHPJOHLFKHQ.DQDOÀLHJW
'HU0RWRUYHUKlOWVLFKY|OOLJ
unkontrolliert.
Platinum Regler Serie
www.hobbywing.com.de
Seite 5
Normaler Start-Vorgang
*DVNQSSHODXI
Leerlauf stellen
und den Sender
einschalten.
Antriebsakku anVFKOLH‰HQHVHUW|QW
GLH7RQIROJH³ƈ´
die Akkuspannung
wurde als zulässig
erkannt.
0HKUHUH%HHS7|QH
signalisieren die
erkannte Anzahl der
=HOOHQLP/L3R3DFN
(LQODQJHU%HHS7RQ
signalisiert die erfolgUHLFKH,QLWLDOLVLHUXQJ
des Reglers
:LUGGHU*DVNQSSHO
betätigt, läuft der
Motor an.
Antriebsakku anVFKOLH‰HQHVHUW|QW
GLH7RQIROJH³ƈ´
die Akkuspannung
wurde als zulässig
erkannt.
=ZHL%HHS%HHS
6LJQDOHHUW|QHQGLH
9ROOJDV3RVLWLRQZXUde korrekt ermittelt.
*DVNQSSHOLQ/HHUlauf bringen. Mehrere
%HHS7|QHVLJQDOLsieren die erkannte
$Q]DKOGHU=HOOHQLP
LiPo-Pack.
(LQODQJHU%HHS7RQ
HUW|QWGLH/HHUODXI
Position wurde
korrekt ermittelt.
Gas-Kalibrierung
Sender einschalten
XQGGHQ*DVNQSSHO
DXI9ROOJDVVWHOOHQ
Programmierung des Reglers mit dem Gasknüppel am Sender
D5HJOHULQGHQ3URJUDPPLHU0RGXVEULQJHQ
E*HZQVFKWHQ3DUDPHWHUDXVZlKOHQ
F3DUDPHWHUZHUWHHLQVWHOOHQ
G3URJUDPPLHU0RGXVEHHQGHQ
a) Regler in den Programmier-Modus bringen
‡6HQGHUHLQVFKDOWHQ*DVNQSSHODXI9ROOJDV
‡$NNXDQVFKOLH‰HQHVHUW|QWGLH7RQIROJH³ƈ´6HNXQGHQZDUWHQ«
‡=ZHL%HHS%HHS6LJQDOHHUW|QHQ6HNXQGHQZDUWHQ
‡'LHVSH]LHOOH7RQIROJH³ƈ´ZLUGJHVHQGHW'HU5HJOHUEH¿QGHWVLFKQXQLP3URJUDPPLHU
Modus.
b) Gewünschten Parameter auswählen
1DFKGHPGHU5HJOHULP3URJUDPPLHUPRGXVLVWHUW|QHQ*UXSSHQYRQ7|QHQGLHVLFK
ständig wiederholen. Um einen Parameter auszuwählen, muss der Senderknüppel innerhalb
YRQGUHL6HNXQGHQQDFKGHU%HHS7RQIROJHLQGLH/HHUODXISRVLWLRQJHEUDFKWZHUGHQXPGHQ
Parameter auszuwählen.
B
Brake
VKRUWWRQH
BB
%DWWHU\7\SH
VKRUWWRQHV
BBB
&XWRII0RGH
VKRUWWRQHV
BBBB
&XWRII7KUHVKROG
VKRUWWRQHV
Beep—
Start Mode
ORQJWRQH
Beep— B
7LPLQJ
ORQJVKRUW
Beep— BB
*RYHUQRU0RGH
ORQJVKRUW
Beep— BBB
0RWRU7\SH
ORQJVKRUW
Beep— BBBB
3:0)UHTXHQF\
ORQJVKRUW
Beep— Beep—
%XLOWLQ%(&2XWSXW
ORQJWRQHV
Beep— Beep— B
Motor Load
ORQJVKRUW
Beep— Beep— BB
/LSR&HOOV
ORQJVKRUW
Beep— Beep— Beep— B
5HVHW$OO7R'HIDXOWV
ORQJVKRUW
Beep— Beep— Beep— BB Exit
Seite 6
www.hobbywing.com.de
ORQJVKRUW
Platinum Regler Serie
c) Parameterwerte einstellen
1DFKGHPGHUJHZQVFKWH3DUDPHWHUDXVJHZlKOWZXUGHHUW|QWHLQH*UXSSHYRQ7|QHQGLH
VLFKVWlQGLJZLHGHUKROHQ:XUGHGLHJHZQVFKWH7RQIROJHJHVHQGHW]JLJGHQ*DVNQSSHODXI
9ROOJDVEULQJHQ(VHUW|QWGLH7RQIROJH³ƈ´GHU:HUWZXUGHJHVSHLFKHUW%OHLEWGHU.QSSHODXI
9ROOJDVEHJLQQHQZLHGHUGLH*UXSSHQYRQ7|QHQGLHGLH3DUDPHWHUVLJQDOLVLHUHQ:LUGGHU
.QSSHOLQQHUKDOEYRQ]ZHL6HNXQGHQZLHGHUDXI/HHUODXIJHEUDFKWZLUGGHU3URJUDPPLHUPRdus verlassen.
Beep
1 short
2 short
3 short
4 short
*Off
Soft
Hard
9HU\+DUG
*LiPo
NiMH
*Middle
High
&XVWRP
*Normal
Soft
9HU\6RIW
ƒ
ƒ
ƒ
1 long
1 long
1 short
1 long
2 short
1 long
3 short
*15°
ƒ
ƒ
ƒ
Items
Brake
%DWWHU\7\SH
&XWRII0RGH
&XWRII7KUHVKROG
Start Mode
7LPLQJ
*RYHUQRU0RGH
0RWRU7\SH
3:0)UHTXHQF\
%XLOWLQ%(&2XWSXW
Motor Load
/LSR&HOOV
*Soft Cut +DUG&XW
Low
*Off
*Normal
Motor
*12KHz
ƒ
*RYHUQRU *RYHUQRU
Low
High
Special
Special
0RWRU
0RWRU
.+]
.+]
*5.25V
9
*Normal
+HDY\
Normal
Heavy
*Auto
*Auto
*Auto
6
9HU\
+HDY\
Very
Heavy
6
6
6
6
5S
6S
8S
10S
12S
Auto
ĕ)RUQRUPDO(6&
WR6/LSR
ĕ)RUKLJKYROWDJH(6&
WR6/LSR
ĕ)RUQRUPDO(6&
WR6/LSR
ĕ)RUKLJKYROWDJH(6&
WR6/LSR
d) Programmier-Modus verlassen
(VJLEW]ZHL:HJHXPGHQ3URJUDPPLHU0RGXV]XYHUODVVHQ
‡1DFKGHP6SHLFKHUQHLQHV:HUWHVHUW|QWGLH7RQIROJH³ƈ´:LUGGHU.QSSHOLQQHUKDOEYRQ
zwei Sekunden in Leerlauf gebracht, wird der Programmier-Modus verlassen.
‡1DFKGHP3DUDPHWHUODQJHXQG]ZHLNXU]H%HHS7|QHGHQ*DVNQSSHOLQQHUKDOEYRQ
drei Sekunden in die Leerlauf-Position bringen, um den Programmier-Modus zu verlassen.
Platinum Regler Serie
www.hobbywing.com.de
Seite 7
Sicherheitshinweise zu Lithium-Polymer-Akkus und Ladegeräten
1. Allgemein
‡/LWKLXP3RO\PHUNXU]/L3R$NNXVEHGUIHQEHVRQGHUHU$XIPHUNVDPNHLW
‡)HKOEHKDQGOXQJEHL/DGXQJXQG(QWODGXQJN|QQHQ]X)HXHU5DXFKHQWZLFNOXQJ([SORVLRQHQXQG9HUJLIWXQJIKUHQ
‡'LH1LFKWEHDFKWXQJYRQ$QOHLWXQJVXQG:DUQKLQZHLVHQNDQQ]X/HLVWXQJVHLQEX‰HQRGHUVRQVWLJHQ'HIHNWHQIKUHQ
‡'LHXQVDFKJHPl‰H/DJHUXQJEHL]XKRKHQRGHU]XQLHGULJHQ7HPSHUDWXUHQNDQQGLH.DSD]LWlWYHUULQJHUQ
2. Ladung
‡/L3R$NNXVVWHWVQXUDXIHLQHUQLFKWEUHQQEDUHQKLW]HEHVWlQGLJHQXQGQLFKWOHLWHQGHQ8QWHUODJHODGHQ
‡/HLFKWHQW]QGOLFKH*HJHQVWlQGHYRQGHU/DGHDQRUGQXQJIHUQKDOWHQ
‡/DGHYRUJDQJVWHWVQXUXQWHU$XIVLFKW
‡1XUGDVEHLOLHJHQGHRGHUHLQYRQXQVDXVGUFNOLFK]XU/DGXQJGHV$NNXVGLHVHV0RGHOOVIUHLJHJHEHQHV/DGHJHUlWYHUZHQGHQ
‡6SDQQXQJHQYRQEHU9SUR=HOOHIKUHQ]XGDXHUKDIWHU%HVFKlGLJXQJGHU=HOOHXQGN|QQHQ)HXHU5DXFKHQWZLFNOXQJXQG
([SORVLRQ]XU)ROJHKDEHQ
‡$NNXQLFKWYHUSROHQ$QGHUQIDOOVODXIHQDQRUPDOHFKHPLVFKH5HDNWLRQHQDEGLHGHQ$NNX]HUVW|UHQXQGVRJDU]X)HXHU5DXFKHQWZLFNOXQJRGHU([SORVLRQIKUHQN|QQHQ
3. Entladung
‡'HU(QWODGHVWURPGDUIGLHYRP$NNXKHUVWHOOHUYRUJHJHEHQH&5DWHNICHT(!) überschreiten.
‡1LFKWXQWHU9SUR=HOOHHQWODGHQDQGHUQIDOOVZLUG=HOOHGDXHUKDIWJHVFKlGLJW
‡%HWULHEVRIRUWHLQVWHOOHQZHQQ/HLVWXQJGHV0RGHOOVVWDUNDEIlOOW
‡.XU]VFKOVVHXQGKRKH7HPSHUDWXUHQPD[ƒ&YHUPHLGHQGDVRQVW*HIDKUGHU6HOEVWHQW]QGXQJGHV$NNXV
4. Beschädigung des Gehäuses und der Folie
‡*HKlXVHIROLHYRU%HVFKlGLJXQJGXUFKVFKDUIH*HJHQVWlQGHVFKW]HQ
‡%HVFKlGLJXQJHQGHU)ROLHPDFKHQGHQ$NNXXQEUDXFKEDU
‡$NNXYHUIRUPVLFKHULQGDV0RGHOOHLQEDXHQDXFKLP)DOOHHLQHV$EVWXU]HVRGHU&UDVKV
‡7HPSHUDWXUHQEHUƒ&N|QQHQGDV*HKlXVHEHVFKlGLJHQVRGDVV(OHNWURO\WDXVWUHWHQNDQQ,QGLHVHP)DOOZlUHGHU$NNXXQbrauchbar und zu entsorgen.
5. Beschädigte Zellen
‡.HLQH:HLWHUYHUZHQGXQJYRQEHVFKlGLJWHQ=HOOHQ
‡.HQQ]HLFKHQEHVFKlGLJWHU=HOOHQ9HUIRUPXQJEHVFKlGLJWH)ROLH*HUXFKRGHU$XVODXIYRQ(OHNWURO\WHQ
‡*HVHW]OLFKH(QWVRUJXQJVYRUVFKULIWHQ$NNX 6RQGHUPOOEHDFKWHQ
6. Warnhinweise
‡1LFKWLQV)HXHUZHUIHQ
‡1LFKWLQ)OVVLJNHLWHQMHJOLFKHU$UWHLQWDXFKHQMHJOLFKHQ.RQWDNWPLW)OVVLJNHLWHQYHUPHLGHQ
‡$X‰HUKDOEGHU5HLFKZHLWHYRQ.LQGHUQODJHUQ
‡$NNXQLFKWGHPRQWLHUHQ*HIDKUYRQ)HXHU5DXFKXQG([SORVLRQVRZLH9HUlW]XQJHQ
‡-HJOLFKHQ.RQWDNWPLW(OHNWURO\WYHUPHLGHQ6RIHUQGRFK.RQWDNWDXIJHWUHWHQVHLQVROOWHVRIRUWPLWYLHOIULVFKHP:DVVHUDEVSOHQXQG
den Arzt konsultieren.
‡%HL1LFKWEHQXW]XQJGHV0RGHOOVGHQ$NNXLPPHUHQWQHKPHQXQGYRU,QEHWULHEQDKPHUHFKW]HLWLJDXÀDGHQ
‡/DJHUXQJQXUDXIHLQHUKLW]HEHVWlQGLJHQQLFKWEUHQQEDUHQXQGQLFKWOHLWHQGHQ8QWHUODJH
‡7LHIHQWODGHQH$NNXVQLFKWZHLWHUYHUZHQGHQ
7. Garantieausschluss
‡'DGXUFKXQVGLHULFKWLJH/DGXQJXQG(QWODGXQJGHV$NNXVQLFKWEHUZDFKWZHUGHQNDQQZLUGMHJOLFKH*DUDQWLHYRUVRUJOLFKDXVJHschlossen.
8. Haftungsausschluss
‡'DZLUZHGHUGLH(LQKDOWXQJGHU0RQWDJHXQG%HWULHEVDQOHLWXQJLQ=XVDPPHQKDQJPLWGHP0RGHOOQRFKGLH%HGLHQXQJXQG0HWKRGHQEHL,QVWDOODWLRQ%HWULHE9HUZHQGXQJXQG:DUWXQJGHV0RGHOOVQHEVW]XJHK|ULJHU(OHNWURQLNEHUZDFKHQN|QQHQEHUQHKPHQ
ZLUNHLQHUOHL+DIWXQJIU9HUOXVWH6FKlGHQRGHU.RVWHQGLHVLFKDXVGHUIHKOHUKDIWHQ9HUZHQGXQJXQGGHP%HWULHEHUJHEHQRGHULQ
LUJHQGHLQHU:HLVHGDPLW]XVDPPHQKlQJHQ
‡$XVGUFNOLFKOHKQHQZLUDXFKMHJOLFKH)ROJHVFKlGHQGLHVLFKLP=XVDPPHQKDQJPLW,QVWDOODWLRQ%HWULHE9HUZHQGXQJXQG:DUWXQJ
des Modells ergeben, ab.
‡6RZHLWYRP*HVHW]JHEHUQLFKWDQGHUVYRUJHVFKULHEHQLVWXQVHUH9HUSÀLFKWXQJ]XU/HLVWXQJYRQ6FKDGHQHUVDW]±JOHLFKDXVZHOFKHP
5HFKWVJUXQG±DXIGHQ5HFKQXQJVZHUWGHUDQGHPVFKDGHQVWLIWHQGHQ(UHLJQLVXQPLWWHOEDUEHWHLOLJWHQ:DUHQPHQJHEHJUHQ]W'LHVJLOW
QLFKWVRIHUQZLUQDFK]ZLQJHQGHQJHVHW]OLFKHQ9RUVFKULIWHQZHJHQ9RUVDW]RGHUJUREHU)DKUOlVVLJNHLWXQEHVFKUlQNWKDIWHQ
HOBBYWING im Vertrieb der KYOSHO DEUTSCHLAND GMBH
Nikolaus-Otto-Straße 4
D-24568 Kaltenkirchen
Germany
www.hobbywing.net
Seite 8
www.hobbywing.com.de
Platinum Regler Serie
Garantiebedingungen
§ 1 Garantieerklärung
:LUEHUQHKPHQGLH*DUDQWLHGDVVEHLGHQ0RGHOOHQXQG%DXWHLOHQGHU)LUPD+\SHZlKUHQGGHU*DUDQWLHIULVW†NHLQH)DEULNDWLRQV
RGHU0DWHULDOPlQJHO]X7DJHWUHWHQ
'LHVH*DUDQWLHJLOWQXUJHJHQEHU.XQGHQGLHHLQ0RGHOORGHU%DXWHLOGHU)LUPD+\SHEHLHLQHPDXWRULVLHUWHQ)DFKKlQGOHULQGHU
%XQGHVUHSXEOLN'HXWVFKODQGJHNDXIWKDEHQ'LH*DUDQWLHLVWQLFKWEHUWUDJEDU
§ 2 Ausschluss der Garantie
.HLQH*DUDQWLHEHVWHKWDXI9HUVFKOHL‰WHLOHZLH5HLIHQ)HOJHQ/DJHU*OKNHU]HQ.XSSOXQJHQ/DFNLHUXQJHQHWF
'LH*DUDQWLHLVWIHUQHUDXVJHVFKORVVHQZHQQ
XQ]XOlVVLJHV=XEHK|UYHUZDQGWZRUGHQLVWRGHU7XQLQJRGHU$QEDXWHLOHGLHQLFKWDXVGHP+\SH/LHIHUSURJUDPPVWDPPHQRGHUQLFKW
YRQGHU)LUPD+\SHDXVGUFNOLFKDOV]XOlVVLJHV=XEHK|UGHNODULHUWZRUGHQVLQG(VREOLHJWGHP.lXIHUVLFKEHLVHLQHP+\SH)DFKKlQGOHU
diesbezüglich zu informieren.
GULWWH3HUVRQHQZHOFKHQLFKWYRQGHU)LUPD+\SH]X6HUYLFH/HLVWXQJHQDXWRULVLHUWZXUGHQ5HSDUDWXUYHUVXFKHRGHUVRQVWLJH(LQJULIIH
LQGHQ*HJHQVWDQGYRUJHQRPPHQKDEHQ
- die Bauanleitung oder Bedienungsanleitung missachtet, das Modell baulich verändert oder zweckentfremdet wurde oder
GHU)HKOHUDXIORNDOH9HUKlOWQLVVHGHV.XQGHQ]XUFN]XIKUHQLVW
§ 3 Hinweis auf gesetzliche Rechte
'LHVH*DUDQWLHZLUGYRQXQVIUHLZLOOLJXQGRKQHJHVHW]OLFKH9HUSÀLFKWXQJEHUQRPPHQ
:LUZHLVHQ6LHGDUDXIKLQGDVV,KQHQDXFKJHVHW]OLFKH5HFKWH]XVWHKHQZHQQGLHYRQ,KQHQJHNDXIWH6DFKHEHLhEHUJDEHDQ6LH
PDQJHOKDIWLVW'LHVHJHVHW]OLFKHQ0lQJHOUHFKWHULFKWHQVLFKDXVVFKOLH‰OLFKJHJHQ,KUHQ9HUNlXIHUGK,KUHQDXWRULVLHUWHQ+\SH)DFKKlQGOHU
1DFKGHP*HVHW]N|QQHQ6LHYRQ,KUHP9HUNlXIHULQHUVWHU/LQLHHQWZHGHUGLH5HSDUDWXUGHUPDQJHOKDIWHQRGHUGLH/LHIHUXQJHLQHUQHXHQ
6DFKHYHUODQJHQ+LHUIUN|QQHQ6LHGHP9HUNlXIHUHLQHDQJHPHVVHQH)ULVWVHW]HQ.RPPWGHU9HUNlXIHU,KUHP9HUODQJHQQLFKWQDFK
N|QQHQ6LHQDFK$EODXIGHU)ULVWGHQ9HUWUDJUFNDEZLFNHOQGKGLH6DFKH]XUFNJHEHQXQGGHQ.DXISUHLVKHUDXVYHUODQJHQRGHUHLQH
DQJHPHVVHQH+HUDEVHW]XQJGHV.DXISUHLVHVYHUODQJHQ0|JOLFKHUZHLVHVWHKHQ,KQHQDXFK6FKDGHQVHUVDW]DQVSUFKH]XLQVEHVRQGHUH
ZHQQGHU9HUNlXIHUGHQ0DQJHONDQQWHRGHULQIROJHYRQ)DKUOlVVLJNHLWQLFKWNDQQWH
'LHJHJHQGLH)LUPD+\SHEHVWHKHQGHQ5HFKWHDXVGLHVHU*DUDQWLHEHVWHKHQ]XVlW]OLFK]X,KUHQJHVHW]OLFKHQ5HFKWHQXQGVFKUlQNHQ
GLHVH5HFKWHLQNHLQHU:HLVHHLQ
§ 4 Dauer der Garantie
'LH*DUDQWLHIULVWEHWUlJW]ZHL-DKUHXQGEHJLQQWPLWGHP7DJGHV.DXIHVEHL,KUHPDXWRULVLHUWHQ+\SH)DFKKlQGOHU
9RQXQVHUEUDFKWH*DUDQWLHOHLVWXQJHQIKUHQQLFKW]XHLQHP1HXEHJLQQRGHUHLQHU9HUOlQJHUXQJGHU*DUDQWLHIULVW
§ 5 Rechte aus der Garantie
/LHJWHLQ*DUDQWLHIDOOYRUZHUGHQZLUGLHGHIHNWHQ7HLOHQDFKXQVHUHU:DKODXVWDXVFKHQRGHUUHSDULHUHQ$XVWDXVFKWHLOHJHKHQLQGDV
(LJHQWXPGHU)LUPD+\SHEHU
'LH*DUDQWLHOHLVWXQJHQZHUGHQYRQGHU)LUPD+\SH6HUYLFHDEWHLOXQJYRUJHQRPPHQ
'LH0DWHULDOXQG$UEHLWVNRVWHQWUDJHQZLU)DOOVGDV*HUlW]XP=ZHFNHGHU3UIXQJXQG5HSDUDWXUWUDQVSRUWLHUWZLUGJHVFKLHKWGLHV
DXI,KUH*HIDKUXQG,KUH.RVWHQ
:HLWHUJHKHQGH $QVSUFKH JHJHQ XQV LQVEHVRQGHUH DXI 5FNDEZLFNOXQJ GHV 9HUWUDJV +HUDEVHW]XQJ GHV .DXISUHLVHV RGHU
6FKDGHQVHUVDW]EHVWHKHQDXVGLHVHU*DUDQWLHQLFKW
§ 6 Geltendmachung der Garantie
*DUDQWLHDQVSUFKHVLQGXQYHU]JOLFKQDFK)HVWVWHOOXQJHLQHV0DWHULDORGHU+HUVWHOOXQJVIHKOHUVEHLHLQHPDXWRULVLHUWHQ+\SH)DFKKlQGOHU
RGHUEHLGHU)LUPD+\SH6HUYLFHDEWHLOXQJ1LNRODXV2WWR6WUD‰H.DOWHQNLUFKHQJHOWHQG]XPDFKHQ)U'HIHNWHGLHDXIHLQH
YHU]|JHUWH*HOWHQGPDFKXQJGHU*DUDQWLH]XUFN]XIKUHQVLQGEHUQHKPHQZLUNHLQH*DUDQWLH
=XU*HOWHQGPDFKXQJGHU*DUDQWLHLVWGLH9RUODJHHLQHV*DUDQWLHEHOHJVXQGGHVEHDQVWDQGHWHQ0RGHOOVRGHU%DXWHLOVHUIRUGHUOLFK
$OV *DUDQWLHEHOHJ JLOW GHU 6HUYLFHEHJOHLWVFKHLQ VRZLH DXFK GHU 9HUNDXIVEHOHJ ZHQQ DXI GHP 9HUNDXIVEHOHJ GHU 0RGHOOW\S PLW GHU
%HVWHOOQXPPHU YRP DXWRULVLHUWHQ +\SH)DFKKlQGOHU YHUPHUNW LVW XQG GHU 9HUNDXIVEHOHJ PLW 6WHPSHO 'DWXP XQG 8QWHUVFKULIW GHV
)DFKKlQGOHUVJHJHQJH]HLFKQHWLVW
0RGHOOHE]Z7HLOHVLQGLQJHUHLQLJWHP=XVWDQGHLQ]XVHQGHQ]%DXFK%HQ]LQWDQNY|OOLJHQWOHHUHQ:LUEHKDOWHQXQVYRUXQJHUHLQLJWH
7HLOHDXI,KUH.RVWHQ]XUFN]XVHQGHQ
6WHOOWVLFKQDFKHLQHU3UIXQJGHVEHDQVWDQGHWHQ0RGHOOVRGHU%DXWHLOVKHUDXVGDVVNHLQ*DUDQWLHIDOOYRUODJVLQGZLUEHUHFKWLJWGHQ
JHOHLVWHWHQ$UEHLWVDXIZDQGQDFKXQVHUHQDOOJHPHLQHQ6WXQGHQVlW]HQPLQGHVWHQVMHGRFKHLQH$XIZDQGVSDXVFKDOHLQ+|KHYRQ¼
zu berechnen.
Platinum Regler Serie
www.hobbywing.com.de
Seite 9
Thanks for purchasing our Electronic Speed Controller (ESC). High power system for RC model can be very dangerous, so please read this manual
carefully. In that we have no control over the correct use, installation, application, or maintenance of our products, no liability shall be assumed nor
accepted for any damages, losses or costs resulting from the use of the product. Any claims arising from the operating, failure or malfunctioning
etc. will be denied. We assume no liability for personal injury, property damage or consequential damages resulting from our product or our workmanship. As far as is legally permitted, the obligation to compensation is limited to the invoice amount of the affected product.
[Features]
Ź
Ź
Ź
Ź
Ź
Ź
Ź
Ź
Ź
Ź
Ź
+LJKSHUIRUPDQFHPLFURSURFHVVRUEULQJVRXWWKHEHVWFRPSDWLELOLW\ZLWKDOONLQGVRIPRWRUVDQGWKHKLJKHVWGULYLQJHI¿FLHQF\
0D[LPXPPRWRUVSHHG530SROHV530SROHV530SROHV
VWDUWPRGHV1RUPDO6RIW9HU\6RIWFRPSDWLEOHZLWK¿[HGZLQJDLUFUDIWDQGKHOLFRSWHU
7KURWWOHUDQJHFDQEHFRQ¿JXUHGWREHFRPSDWLEOHZLWKDOOWUDQVPLWWHUVFXUUHQWO\DYDLODEOHRQPDUNHW
6PRRWKOLQHDUTXLFNDQGSUHFLVHWKURWWOHUHVSRQVH
6HSDUDWHYROWDJHUHJXODWRU,&IRUPLFURSURFHVVRUWRJHWDEHWWHUDQWLMDPPLQJFDSDELOLW\
0XOWLSOHSURWHFWLRQIHDWXUHV/RZYROWDJHFXWRIISURWHFWLRQRYHUKHDWSURWHFWLRQWKURWWOHVLJQDOORVVSURWHFWLRQ
7KHRXWSXWRIWKHEXLOWLQ%(&LVVZLWFKDEOHE\XVHUSURJUDPPLQJ9RU9
:LWKJRYHUQRUPRGHIRUKHOLFRSWHU
86%VXSSRUWHG7KH¿UPZDUHRIWKH(6&FDQEHXSGDWHGE\WKH86%DGDSWHU
6HYHUDONLQGVRI3URJUDP&DUGVDUHVXSSRUWHG9HU\HDV\WRSURJUDPWKH(6&DWKRPHRUDWWKH¿HOG
Note1: BEC means the “Battery Elimination Circuit”. It is a DC-DC voltage regulator to supply the receiver and other equipments from the main battery pack. With the build-in BEC of an ESC, the receiver needn’t to be supplied with an additional
battery pack.
Note2: The ESC named “xxx-OPTO” or “xxx-HV” hasn’t a built-in BEC, an UBEC (Ultimate-BEC) or an individual battery
pack should be used to power the receiver. And an individual battery pack is needed to power the program card when
setting the programmable values of such ESCs, please read the user manual of program card for reference.
[Wiring Diagram]
7KH3ODWLQXP$23723ODWLQXP$+9DQG3ODWLQXP$+9(6&XVHWKHQHZDQWLVSDUNVWUXFWXUH
7KHUHDUHDSDLURIEXOOHWFRQQHFWRUVDQGDWKLQUHGZLUHDWWDFKHGZLWKWKHSRVLWLYHLQSXWZLUHUHGFRORUWKLFNRIWKH(6&7KH\DUH
XVHGWRHOLPLQDWHVSDUNVZKHQWKHEDWWHU\SDFNLVFRQQHFWLQJZLWKWKH(6&3OHDVHXVHLWLQWKHIROORZLQJVHTXHQFH
'LVFRQQHFWWKHWZREXOOHWFRQQHFWRUVRQWKHSRVLWLYHLQSXWZLUHUHGFRORUWKLFNRIWKH(6&
&RQQHFWEDWWHU\ZLUHV
&RQQHFWWKHEXOOHWFRQQHFWRUVRQWKHSRVLWLYHLQSXWZLUHUHGFRORUWKLFNRIWKH(6&DVVRRQDV\RXKHDUWKHVSHFLDOWRQH³ƈ´
[Programmable Items]
1. Brake Setting:2II6RIW+DUG9HU\+DUGGHIDXOWLV³2II´
2. Battery Type:/LWKLXP/LSRRU/LLRQ1L0+GHIDXOWLV³/LWKLXP´
3. Low Voltage Protection Mode (CutOff Mode):6RIW&XW*UDGXDOO\UHGXFHWKHRXWSXWSRZHU+DUG&XW,PPHGLDWHO\VWRSWKH
RXWSXWSRZHU'HIDXOWLV³6RIW&XW´
4. Low Voltage Protection Threshold (Cutoff Threshold):/RZ0LGGOH+LJK&XVWRPGHIDXOWLV³0LGGOH´
)RUOLWKLXPEDWWHULHVWKHFXWRIIWKUHVKROGRIWKHZKROHEDWWHU\SDFNLVFDOFXODWHGDFFRUGLQJWRWKHFHOOVQXPEHU
)RUQRUPDOYROWDJH(6&VXSSRUWVFHOOV/LSRWKH/RZ0LGGOH+LJKYDOXHIRUHDFKFHOOLV999
)RUKLJKYROWDJH(6&VXSSRUWVFHOOV/LSRWKH/RZ0LGGOH+LJKYDOXHIRUHDFKFHOOLV999
)RUH[DPSOHLIWKHFXWRIIWKUHVKROGLVVHWWR³0LGGOH´WKHQWKHWKUHVKROGIRUDFHOOV/LSREDWWHU\SDFNLV 9
)RU1L0+DQG1L&GEDWWHULHVWKHFXWRIIWKUHVKROGRIWKHZKROHEDWWHU\SDFNLVFDOFXODWHGDVIROORZV
/RZRIWKHEDWWHU\¶VEDWWHU\¶VIXOOFKDUJHGYROWDJH
0LGGOHRIWKHEDWWHU\¶VIXOOFKDUJHGYROWDJH
+LJKRIWKHEDWWHU\¶VIXOOFKDUJHGYROWDJH
,IWKLVSURJUDPPDEOHLWHPLVVHWWR³&XVWRP´WKDWPHDQV\RXFDQVHWWKHFXWRIIWKUHVKROGIRUWKHZKROHEDWWHU\SDFN
YHU\DFFXUDWHO\ZLWKWKHVWHSRI“97KH/&'SURJUDPER[RU3&VRIWZDUHWKURXJK86%DGDSWHULVQHHGHGWR
customize the value.
Seite 10
www.hobbywing.com.de
Platinum Regler Serie
5. Start Mode:1RUPDO6RIW9HU\6RIWGHIDXOWLV³1RUPDO´
³1RUPDO´LVSUHIHUUHGIRU¿[HGZLQJDLUFUDIW³6RIW´RU³9HU\6RIW´DUHSUHIHUUHGIRUKHOLFRSWHUV7KHLQLWLDODFFHOHUDWLRQRIWKH³6RIW´DQG
³9HU\6RIW´PRGHVDUHVORZHUWKDQ³1RUPDO´PRGHXVXDOO\LWWDNHVVHFRQGIRU³6RIW´PRGHRUVHFRQGVIRU³9HU\6RIW´PRGHIURP
WKURWWOHDGYDQFHWRIXOOWKURWWOH$IWHUVWDUWXSLIWKHWKURWWOHLVFORVHGWKURWWOHVWLFNLVPRYHGWRWKHERWWRPSRVLWLRQDQGRSHQHG
DJDLQWKURWWOHVWLFNLVPRYHGXSZDUGVZLWKLQVHFRQGVWKHUHVWDUWZLOOEHWHPSRUDULO\FKDQJHGWR³1RUPDO´PRGHWRJHWULGRIWKH
FKDQFHVRIDFUDVKFDXVHGE\VORZWKURWWOHUHVSRQVH7KLVVSHFLDOGHVLJQLVXVHGIXOIRUDHUREDWLFÀLJKW
6. Timing:ƒƒƒƒƒƒƒƒGHIDXOWLVƒNote3
8VXDOO\ORZWLPLQJYDOXHLVVXLWDEOHIRUPRVWPRWRUV%XWWKHUHDUHPDQ\GLIIHUHQFHVDPRQJVWUXFWXUHVDQGSDUDPHWHUVRIGLIIHUHQW
PRWRUVVRSOHDVHWU\DQGVHOHFWWKHPRVWVXLWDEOHWLPLQJYDOXHDFFRUGLQJWRWKHPRWRU\RXDUHMXVWXVLQJ7KHFRUUHFWWLPLQJYDOXH
PDNHVWKHPRWRUUXQVPRRWKO\$QGJHQHUDOO\KLJKHUWLPLQJYDOXHEULQJVRXWKLJKHURXWSXWSRZHUDQGKLJKHUVSHHG
1RWH$IWHUFKDQJLQJWKHWLPLQJVHWWLQJSOHDVHWHVW\RXU5&PRGHORQJURXQGSULRUWRÁLJKW
7. Governor Mode:2II*RYHUQRU/RZ*RYHUQRU+LJKGHIDXOWLV³2II´
,IWKHJRYHUQRUPRGHLVDFWLYDWHGWKH(6&ZLOOWU\LWVEHVWWRKROGWKHPRWRUVSHHGDWD¿[HGYDOXH8VXDOO\WKHWKURWWOHFXUYHLVD
KRUL]RQWDOOLQH\RXFDQFKDQJHWKHSUHVHWPRWRUVSHHGE\FKDQJLQJWKHKHLJKWRIWKLVOLQH
7KHVSHHGUDQJHRI³*RYHUQRU/RZ´PRGHLV530WR530IRUSROHVEUXVKOHVVPRWRU³*RYHUQRU+LJK´PRGHLV
530WR530IRUSROHVEUXVKOHVVPRWRU,QRUGHUWRFDOFXODWHWKHVSHHGRIWKHPDLQURWRUEODGHVRI\RXUKHOLFRSWHU
\RXQHHGWRNQRZWKHPRWRUSROHVQXPEHUDQGWKHJHDUUDWHRIPDLQGULYHJHDUYVWKHSLQLRQ)RUH[DPSOHLI\RXDUHXVLQJD
SROHVPRWRUWKDWLVSDLUSROHVDQGWKHPDLQGULYHJHDULV7WKHSLQLRQLV7VR\RXFDQFDOFXODWHDVIROORZV
The rotation speed for the main rotor blades = (The speed of 2 poles motor * 13) / 3 / 150
:KHQ\RXDGMXVWWKHWKURWWOHFXUYHSOHDVHPDNHVXUHWKDWWKHPRWRUFDQUXQDWWKLVSUHVHWVSHHGHYHQLIWKHPRWRUORDGLVKHDYLHVW
3OHDVHQRWHWKDWWKHJRYHUQRUPRGHIXQFWLRQLVDXWRPDWLFDOO\GLVDEOHGLIWKHWKURWWOHYROXPHLVOHVVWKDQ
8. Reserved Item #1: Reserved for future.
9. PWM Frequency:.+].+]GHIDXOWLV³.+]´
)RUVRPHPRWRUVZLWKKLJK.9KLJKVSHHGDQGPDQ\SROHVWKH.+]3:0IUHTXHQF\PD\OHWWKHPZRUNPRUHVPRRWKO\%XWWKH
KLJKHU3:0IUHTXHQF\ZLOOPDNHWKH(6&KRWWHU*HQHUDOO\WKH.+]3:0IUHTXHQF\LVVXLWDEOHIRUPRVWPRWRUV
10. Built-In BEC Output:99GHIDXOWLV9
11. Reserved Item #2: Reserved for future.
12. Lipo Cells:
)RUQRUPDOYROWDJH(6&VXSSRUWVFHOOV/LSRWKHYDOXHVDUH$XWR66666WKHGHIDXOWLV³$XWR´Note4
)RUKLJKYROWDJH(6&VXSSRUWVFHOOV/LSRWKHYDOXHVDUH$XWR66666WKHGHIDXOWLV³$XWR´
7KLVSURJUDPPDEOHLWHPLVDYDLODEOHIRUOLWKLXPEDWWHU\,QWKHVWDUWXSSURFHVVWKHPRWRUZLOOHPLWVVHYHUDO³%HHS´WRQHVWRUHSUHVHQWWKH/LSRFHOOVQXPEHULWLVKHOSIXOIRU\RXWRFKHFNZKHWKHULWLVFRLQFLGHQWZLWKWKHDFWXDOEDWWHU\SDFNRUQRWNote5
Note4: If you choose “Auto”, the ESC may mistakenly judge the battery cells when the voltage is less than 3.7V/
Cell, so we strongly suggest setting the “Lipo Cells” manually.
Note5: For high voltage ESC (supports 5 to 12 cells Lipo), when the motor emits the “Beep” tones to represents the
cells number, a long “Beep—” tone = 5 short “Beep-” tone. So 5S = “Beep—”, 6S = ”Beep—Beep-” (1 long 1 short),
8S=”Beep—Beep-Beep-Beep-” (1 long 3 short), 10S= “Beep—Beep—” (2 long), 12S=”Beep—Beep—Beep-Beep-” (2
long 2 short). While for normal voltage ESC (supports 2 to 6 cells Lipo), we still use 5 short “Beep-” tones to represent 5S lipo, and 6 short “Beep-” tones to represent 6S lipo.
[Begin To Use The New ESC]
3OHDVHFKHFNWKHZLULQJDQGFRQQHFWLRQVFDUHIXOO\DQGWKHQVWDUWWKH(6&LQWKHIROORZLQJVHTXHQFHV
0RYHWKHWKURWWOHVWLFNWRWKHERWWRPSRVLWLRQDQGWKHQVZLWFKRQWKHWUDQVPLWWHU
&RQQHFWWKHEDWWHU\SDFNWRWKH(6&WKH(6&EHJLQVWKHVHOIWHVWSURFHVVDVSHFLDOWRQH³ƈ´LVHPLWWHGZKLFKPHDQVWKH
YROWDJHRIWKHEDWWHU\SDFNLVLQQRUPDOUDQJHDQGWKHQ1³%HHS´WRQHVZLOOEHHPLWWHGPHDQVWKHQXPEHURIOLSREDWWHU\FHOOV
)LQDOO\DORQJ³%HHS²´WRQHZLOOEHHPLWWHGZKLFKPHDQVWKHVHOIWHVWLV2.WKHDLUFUDIWRUKHOLFRSWHULVUHDG\WRJRÀ\LQJ
‡,IQRWKLQJLVKDSSHQHGSOHDVHFKHFNWKHEDWWHU\SDFNDQGDOOWKHFRQQHFWLRQV
‡,IDVSHFLDOWRQH³ƈ´LVHPLWWHGDIWHU%HHSWRQHV³%HHS%HHS´PHDQVWKH(6&KDVHQWHUHGWKHSURJUDPPRGHLWLVEHFDXVH
WKHWKURWWOHFKDQQHORI\RXUWUDQVPLWWHULVUHYHUVHGSOHDVHVHWLWFRUUHFWO\
‡,IWKHUHG/('ÀDVKHVYHU\TXLFNO\WLPHVSHUVHFRQGPHDQVWKHLQSXWYROWDJHLVWRRORZRUWRRKLJKSOHDVHFKHFN\RXUEDWWHU\¶V
voltage.
Platinum Regler Serie
www.hobbywing.com.de
Seite 11
3. VERY IMPORTANT ! %HFDXVHGLIIHUHQWWUDQVPLWWHUKDVGLIIHUHQWWKURWWOHUDQJH\RXQHHGWRFDOLEUDWHWKHWKURWWOHUDQJHDQGOHWWKH
(6&UHPHPEHULW3OHDVHUHDGWKHLQVWUXFWLRQRQWKHOHIWERWWRPRIWKLVSDJH³7KURWWOH5DQJH6HWWLQJ´
$IWHUFRUUHFWO\VHWWLQJWKHWKURWWOHUDQJHWKHUHG/('OLJKWVZKHQWKHWKURWWOHVWLFNLVPRYHGWRWKHWRSSRVLWLRQ0D[LPXPWKURWWOH
[Alert Tone]
,QSXWYROWDJHLVDEQRUPDO7KH(6&EHJLQVWRFKHFNWKHYROWDJHZKHQWKHEDWWHU\SDFNLVFRQQHFWHGLIWKHYROWDJHLVQRWLQWKH
DFFHSWDEOHUDQJHVXFKDQDOHUWWRQHZLOOEHHPLWWHG³%HHS%HHS%HHS%HHS´(YHU\³%HHS%HHS´KDVDWLPHLQWHUYDORIDERXW
VHFRQGDQGDWWKHVDPHWLPHWKHUHG/('DOVRÀDVKHV
7KURWWOHVLJQDOLVORVW:KHQWKH(6&FDQ¶WGHWHFWWKHQRUPDOWKURWWOHVLJQDOVXFKDQDOHUWWRQHZLOOEHHPLWWHG³%HHS%HHS
%HHS´(YHU\³%HHS´KDVDWLPHLQWHUYDORIDERXWVHFRQGV
7KURWWOHVWLFNLVQRWLQWKHERWWRPSRVLWLRQ:KHQWKHWKURWWOHVWLFNLVQRWLQWKHERWWRPORZHVWSRVLWLRQDYHU\UDSLGDOHUWWRQHZLOO
EHHPLWWHG³%HHS%HHS%HHS´(YHU\³%HHS´KDVDWLPHLQWHUYDORIDERXWVHFRQG
[Protection Function]
$EQRUPDOVWDUWXSSURWHFWLRQ,IWKHPRWRUIDLOVWRVWDUWZLWKLQVHFRQGVRIWKURWWOHDSSOLFDWLRQWKH(6&ZLOOFXWRIIWKHRXWSXWSRZHU
,QWKLVFDVHWKHWKURWWOHVWLFN0867EHPRYHGWRWKHERWWRPSRVLWLRQDJDLQWRUHVWDUWWKHPRWRU7KLVKDSSHQVLQWKHIROORZLQJ
FDVHV7KHFRQQHFWLRQEHWZHHQ(6&DQGPRWRULVQRWUHOLDEOHWKHSURSHOOHURUWKHPRWRULVEORFNHGWKHJHDUER[LVGDPDJHGHWF
2YHUKHDWSURWHFWLRQ:KHQWKHWHPSHUDWXUHRIWKH(6&LVRYHUDIDFWRU\SUHVHWGHJUHHWKH(6&ZLOOUHGXFHWKHRXWSXWSRZHU
7KURWWOHVLJQDOORVVSURWHFWLRQ7KH(6&ZLOOFXWRIIWKHRXWSXWSRZHULIWKURWWOHVLJQDOLVORVWIRUPRUHWKDQVHFRQGWKHRXWSXW
power will be resumed as soon as the throttle signal is normal again.
[Trouble Shooting]
Trouble
Possible Reason
After power on, motor does not work, no sound is
emitted
After power on, motor does not work, such an
alert tone is emitted and the red LED flashes at
the same time.
“Beep-Beep-, Beep-Beep-” (Every “Beep-Beep-”
has a time interval of about 1 second)
After power on, motor does not work, such an
alert tone is emitted:
“Beep-, Beep-, Beep- ”(Every “Beep-” has a time
interval of about 2 seconds)
After power on, motor does not work, such an
alert tone is emitted:
“Beep-, Beep-, Beep-” (Every “Beep-” has a time
interval of about 0.25 second)
After power on, motor does not work, a special
tone “ƈ
” is emitted after 2 “Beep” tones
(Beep-Beep-)
The motor runs in the opposite direction
The connection between battery
pack and ESC is not correct
Input voltage is abnormal, too high
or too low.
Check the power connection.
Replace the connector with new one
Check the voltage of battery pack
Throttle signal is irregular or lost
Check the receiver and transmitter
Check the control cable of the ESC
The throttle stick is not in the
bottom (lowest) position
Move the throttle stick to bottom position
Set the throttle trimmer to neutral or even
lower.
Direction of the throttle channel is
reversed, so the ESC has entered
the program mode
The connection between ESC and
the motor need to be changed.
Throttle signal is lost
Set the direction of throttle channel correctly
(Please refer to the user manual of your
transmitter)
Swap any two wire connections between
ESC and motor
Check the receiver and transmitter
Check the control cable of throttle channel
Land RC model as soon as possible, and
replace the battery pack
Check all the connections: battery pack
connection, throttle signal cable, motor
connections, etc.
The motor stop running while in working state
Action
ESC has entered Low Voltage
Protection mode
Some connections are not reliable
[Normal Startup Procedure]
MŽǀĞ ƚŚĞ ƚŚƌŽƚƚůĞ
ƐƚŝĐŬ ƚŽ ďŽƚƚŽŵ
ƉŽƐŝƚŝŽŶ ĂŶĚ ƚŚĞŶ
ƐǁŝƚĐŚ ŽŶ LJŽƵƌ
ŽŶŶĞĐƚ ƚŚĞ ďĂƚƚĞƌLJ ƉĂĐŬ ƚŽ
ƚŚĞ^͕ĂƐƉĞĐŝĂůƚŽŶĞ͞ 123”
ĞŵŝƚƐ͕ƚŚĂƚŵĞĂŶƐƚŚĞďĂƚƚĞƌLJ
ƐƵƉƉůLJŝƐK<
^ĞǀĞƌĂů “BĞĞƉ-” ƚŽŶĞƐ
ĞŵŝƚƐ ƚŽ reƉƌĞƐĞŶƚ ƚŚĞ
ŶƵŵďĞƌ ŽĨ ůŝƉŽ ďĂƚƚĞƌLJ
ĐĞůůƐ
Ɛ ƐŽŽŶ ĂƐ ƚŚĞ ƐĞůĨ-ƚĞƐƚ
ƉƌŽĐĞƐƐ ŝƐ ĨŝŶŝƐŚĞĚ͕ Ă ůŽŶŐ
“BĞĞƉ—” ƚŽŶĞ ǁŝůů ďĞ
ĞŵŝƚƚĞĚ
“ĞĞƉ-BĞĞƉ-” ƚŽŶĞ ĞŵŝƚƐ͕
ƚŚĂƚ ŵĞĂŶƐ ƚŚĞ ŚŝŐŚĞƐƚ
ƉŽŝŶƚ ŽĨ ƚŚƌŽƚƚůĞ ƌĂŶŐĞ ŚĂƐ
ďĞĞŶĐŽƌƌĞĐƚůLJĐŽŶĨŝƌŵĞĚ
MŽǀĞ ƚŚƌŽƚƚůĞ ƐƚŝĐŬ ƚŽ ƚŚĞ
ďŽƚƚŽŵ ƉŽƐŝƚŝŽŶ͕ ƐĞǀĞƌĂů
“BĞĞƉ-” ƚŽŶĞƐ ĞŵŝƚƐ ƚŽ
reƉƌĞƐĞŶƚ ƚŚĞ ŶƵŵďĞƌ ŽĨ
DŽǀĞ ƚŚĞ ƚŚƌŽƚƚůĞ
ƐƚŝĐŬ ƵƉǁĂƌĚƐ ƚŽ ŐŽ
ĨůLJŝŶŐŶŽǁ
[Throttle Range Setting]
^ǁŝƚĐŚ ŽŶ ƚŚĞ
ƚƌĂŶƐŵŝƚƚĞƌ͕ ĂŶĚ
ƚŚĞŶ ŵŽǀĞ ƚŚĞ
ƚŚƌŽƚƚůĞ ƐƚŝĐŬ ƚŽ
Seite 12
ŽŶŶĞĐƚ ďĂƚƚĞƌLJ ƉĂĐŬ ƚŽ
ƚŚĞ ^͕ Ă ƐƉĞĐŝĂů ƚŽŶĞ
͞ 123” ĞŵŝƚƐ͕ ƚŚĂƚ ŵĞĂŶƐ
ƚŚĞ ďĂƚƚĞƌLJ ƐƵƉƉůLJ ŝƐ K<͕
www.hobbywing.com.de
ůŽŶŐ“ĞĞƉ—” ƚŽŶĞ
ĞŵŝƚƐ͕ ŵĞĂŶƐ ƚŚĞ
ůŽǁĞƐƚ ƉŽƐŝƚŝŽŶ ŽĨ
ƚŚƌŽƚƚůĞ ƌĂŶŐĞ ŚĂƐ
Platinum Regler Serie
ǏProgram The ESC With The Transmitterǐ(4 Setps)
1.
Enter program mode
Select programmable items
Set item’s value (Programmable value)
Exit program mode
2. Select programmable items:
After entering program mode, you will hear 14 groups of “Beep”
tones in a loop with the following sequence. If you move the throttle
stick to bottom position within 3 seconds after one kind of tones, the
corresponding item will be selected.
Enter program mode
D Switch on transmitter, move the throttle
stick to the top position.
E Connect the battery pack to the ESC, a
special tone “ƈ123” emits, that means the
battery supply is OK.
F Wait for 2 seconds, the motor will emit
“Beep-Beep-” tone.
G Wait for another 5 seconds, special tone
” emits, that means the
like “ƈ
program mode is entered
1
B
Brake
(1 short tone)
2
BB
Battery Type
(2 short tones)
3
BBB
Cutoff Mode
(3 short tones)
4
BBBB
Cutoff Threshold
(4 short tones)
5
Beep—
Start Mode
(1 long tone)
6
Beep— B
Timing
(1 long 1 short)
7
Beep— BB
Governor Mode
(1 long 2 short)
8
Beep— BBB
Reserved Item #1
(1 long 3 short)
9
Beep— BBBB
PWM Frequency
(1 long 4 short)
10 Beep— Beep—
Built-in BEC Output
(2 long tones)
11 Beep— Beep— B
Reserved Item #2
(2 long 1 short)
12 Beep— Beep— BB
Lipo Cells
(2 long 2 short)
13 Beep— Beep— Beep— B
Reset All To Defaults
(3 long 1 short)
14 Beep— Beep— Beep— BB Exit
(3 long 2 short)
Note: “Beep—” means a long “Beep” tone, “B” means a short “Beep”
tone. Usually, 1 long “Beep—” = 5 short “B” .
3. Set item value (Programmable value):
You will hear several “Beep” tones in loop. Set the value matching to a tone by moving the
throttle stick to top position when you hear the tone, then a special tone “ƈ
” emits, that
means the value is set and saved. (Keep the throttle stick at the top position, you will go
back to Step #2 and you can select other items; Or Move the stick to bottom position within
2 seconds will exit program mode directly)
Beep 1 short
2 short
3 short
4 short
1 long
1 long
1 short
1 long
2 short
1 long
3 short
*Off
Soft
Hard
Very Hard
*LiPo
NiMH
Custom
11.25°
*15°
18.75°
22.5°
26.25°
Items
Brake
Battery Type
Cutoff Mode
Cutoff Threshold
Start Mode
Timing
Governor Mode
*Soft Cut Hard Cut
Low
*Middle
High
*Normal
Soft
Very Soft
0°
3.75°
7.5°
*Off
Governor Governor
Low
High
Reserved Item #1
PWM Frequency
*12KHz
8KHz
Built-in BEC Output
*5.25V
6V
*Auto
2S
3S
4S
5S
6S
*Auto
5S
6S
8S
10S
12S
4. Exit program mode
There are 2 ways to exit
the program mode:
D In Step #3, after
special tone “ƈ
”,
please move the
throttle stick to the
bottom position within
2 seconds.
E In Step #2, after tone
Beep—Beep—Beep
—BB” (3 long 2 short
Beep tones, that is
the item #14), move
the throttle stick to the
bottom position within
3 seconds.
Reserved Item #2
Lipo Cells
ĕ For normal ESC
(2 to 6S Lipo)
ĕ For high voltage ESC
(5 to 12S Lipo)
The value with * symbol is the factory-preset value (That is: default value).
Note6: After setting the programmable items by the throttle stick or a Program Card, you will hear 5 long “Beep—” tones when the ESC
exits the program mode. You can restart the ESC after 5 seconds.
Platinum Regler Serie
www.hobbywing.com.de
Seite 13
,MPORTANT SAFETY INSTRUCTIONS AND WARNINGS FOR
LITHIUM-POLYMER-BATTERIES
1. General Guidelines and Warnings
‡ /L3REDWWHULHVDUH127FKDUJHGDV\RXUHFHLYHWKHP7KH\FRQWDLQDSSUR[LPDWHO\RIDIXOOFKDUJHDVUHFRPPHQGHGIRU
shipment and long term storage .
‡ 8VH/LWKLXP3RO\PHUVSHFL¿FFKDUJHUVRQO\'RQRWXVHD1L&GRU1L0KFKDUJHU)DLOXUHWRGRVRPD\FDXVHD¿UHZKLFKPD\
UHVXOWLQSHUVRQDOLQMXU\DQGSURSHUW\GDPDJH
‡ 1HYHUFKDUJHEDWWHULHVXQDWWHQGHG:KHQFKDUJLQJ/L3REDWWHULHV\RXVKRXOGDOZD\VUHPDLQLQFRQVWDQWREVHUYDWLRQWRPRQLWRU
WKHFKDUJLQJSURFHVVDQGUHDFWWRSRWHQWLDOSUREOHPVWKDWPD\RFFXU
‡ 6RPH/L3RFKDUJHUVRQWKHPDUNHWPD\KDYHWHFKQLFDOGH¿FLHQFLHVWKDWPD\FDXVHWKHPWRFKDUJH/L3REDWWHULHVLQFRUUHFWO\,WLV
VROHO\WKHUHVSRQVLELOLW\RIWKHXVHUWRDVVXUHWKDWWKHFKDUJHUXVHGZRUNVSURSHUO\
‡ ,IDWDQ\WLPH\RXZLWQHVVDEDWWHU\VWDUWLQJWREDOORRQRUVZHOOXSGLVFRQWLQXHWKHFKDUJLQJSURFHVVLPPHGLDWHO\'LVFRQQHFWWKH
EDWWHU\DQGSODFHLWLQDVDIHREVHUYDWLRQDUHDIRUDSSUR[LPDWHO\PLQXWHV&RQWLQXLQJWRFKDUJHDEDWWHU\WKDWKDVEHJXQ
WRVZHOOZLOOUHVXOWLQ¿UH
‡ %DWWHU\REVHUYDWLRQVKRXOGRFFXULQDVDIHDUHDRXWVLGHRIDQ\EXLOGLQJRUYHKLFOHDQGDZD\IURPDQ\FRPEXVWLEOHPDWHULDO
7KHPLGGOHRIDFHPHQWGULYHZD\LVDJRRGH[DPSOHRIDVDIHREVHUYDWLRQDUHD
‡ 6KRUWVFDQFDXVH¿UHV,I\RXDFFLGHQWDOO\VKRUWWKHZLUHVWKHEDWWHU\PXVWEHSODFHGLQDVDIHDUHDIRUREVHUYDWLRQIRU
DSSUR[LPDWHO\PLQXWHV$GGLWLRQDOO\EHPLQGIXORIWKHEXUQGDQJHUWKDWPD\RFFXUGXHWRDVKRUWDFURVVMHZHOU\VXFKDV
ULQJVRQ\RXU¿QJHUV
‡ &KHPLFDOUHDFWLRQVDUHQRWLQVWDQWDQHRXVDEDWWHU\WKDWKDVEHHQVKRUWHGPD\QRWLJQLWHIRUPLQXWHV
‡ $OOFUDVKEDWWHULHVHYHQLIQRWGHIRUPHGVKRXOGEHSODFHGLQDVDIHDUHDIRUREVHUYDWLRQIRUDWOHDVWPLQXWHV
‡ ,IIRUDQ\UHDVRQ\RXQHHGWRFXWWKHWHUPLQDOZLUHVFXWHDFKZLUHVHSDUDWHO\HQVXULQJWKHZLUHVGRQRWEHFRPHVKRUWHG
across the cutting tool.
2. Charging Process
‡ 0DNHDYLVXDOLQVSHFWLRQRIWKHSDFN&KHFNLQJIRUDQ\GDPDJHGOHDGVFRQQHFWRUVEURNHQFUDFNHGVKULQNFRYHULQJSXI¿QHVV
or other irregularities.
‡ %HIRUHLQVWDOOLQJRUFKDQJLQJWKHFRQQHFWRUFKHFNWKHYROWDJHRIWKHSDFNXVLQJDGLJLWDOYROWPHWHU$OOQHZSDFNVVKLSDW
DSSUR[LPDWHO\9WR9SHUFHOO)RUH[DPSOH$6SDFNVKRXOGUHDGDSSUR[LPDWHO\9WR9$6SDFNVKRXOGUHDG
DSSUR[LPDWHO\9WR9HWF
‡ ,IDQ\GDPDJHWRWKHSDFNRUOHDGVLVIRXQGRUWKHYROWDJHLVVLJQL¿FDQWO\OHVVIRU\RXUSDFNWKDQVSHFL¿HGDERYHGRQRW
DWWHPSWWRFKDUJHRUÀ\WKHSDFNFRQWDFW$*3RZHUGLUHFWO\DVVRRQDVSRVVLEOH
‡ 1HYHUFKDUJHEDWWHULHVXQDWWHQGHG
‡ &KDUJHLQDQLVRODWHGDUHDDZD\IURPÀDPPDEOHPDWHULDOV
‡ /HWWKHEDWWHU\FRROGRZQWRDPELHQWWHPSHUDWXUHEHIRUHFKDUJLQJ
‡ 'RQRWFKDUJHEDWWHU\SDFNVLQVHULHV&KDUJHHDFKEDWWHU\SDFNLQGLYLGXDOO\2YHUFKDUJLQJRIRQHRUWKHRWKHUEDWWHU\PD\
RFFXUUHVXOWLQJLQ¿UH
‡ :KHQVHOHFWLQJWKHFHOOFRXQWRUYROWDJHIRUFKDUJLQJSXUSRVHVVHOHFWWKHFHOOFRXQWDQGYROWDJHDVLWDSSHDUVRQWKHEDWWHU\
ODEHO6HOHFWLQJDFHOOFRXQWRUYROWDJHRWKHUWKDQWKHRQHSULQWHGRQWKHODEHOPD\UHVXOWLQRYHUFKDUJLQJDQG¿UH$VDVDIHW\
SUHFDXWLRQSOHDVHFRQ¿UPWKDWWKHLQIRUPDWLRQSULQWHGRQWKHEDWWHU\LVFRUUHFW)RUH[DPSOH,IDEDWWHU\ODEHOLQGLFDWHVWKDWLWLV
DFHOOEDWWHU\6LW
VYROWDJHVKRXOGUHDGEHWZHHQDQGYROWV7KLVEDWWHU\PXVWEHFKDUJHGDVDFHOOEDWWHU\
SHDNRI9
‡ <RXPXVWFKHFNWKHSDFNYROWDJHDIWHUHDFKÀLJKWEHIRUHUHFKDUJLQJ'RQRWDWWHPSWWRFKDUJHDQ\SDFNLIWKHXQORDGHG
LQGLYLGXDOFHOOYROWDJHVDUHOHVVWKDQ9)RUH[DPSOH'RQRWFKDUJHDFHOOSDFNLIEHORZ9'RQRWFKDUJHDFHOOSDFN
LIEHORZ9
‡ 1250$/&+$5*,1*7KHFKDUJHUDWHVKRXOGQRWH[FHHG&RQHWLPHVWKHFDSDFLW\RIWKHEDWWHU\XQOHVVRWKHUZLVHQRWHG
+LJKHUVHWWLQJPD\FDXVHSUREOHPVZKLFKFDQUHVXOWLQ¿UH)RUH[DPSOH&KDUJHDP$KEDWWHU\DWRUEHORZ$PSV
&KDUJHDP$KEDWWHU\DWRUEHORZ$PSV
3. Storage & Transportation
‡ 6WRUHEDWWHULHVDWURRPWHPSHUDWXUH
‡ ,IVWRULQJORQJHUWKDQDFRXSOHRIZHHNVEDWWHULHVVKRXOGEHVWRUHGDW9FHOOWR9FHOODSSUR[LPDWHO\FKDUJHG
‡ 'RQRWH[SRVHEDWWHU\SDFNVWRGLUHFWVXQOLJKWKHDWIRUH[WHQGHGSHULRGV
‡ :KHQWUDQVSRUWLQJRUWHPSRUDULO\VWRULQJLQDYHKLFOHWHPSHUDWXUHUDQJHVVKRXOGEHJUHDWHUWKDQFEXWQRPRUHWKDQF
‡ 6WRULQJ/LSREDWWHULHVDWWHPSHUDWXUHVJUHDWHUWKDQFIRUH[WHQGHGSHULRGVRIWLPHPRUHWKDQKRXUVPD\FDXVHGDPDJH
WREDWWHU\DQGSRVVLEOH¿UH
4. Caring for Battery
‡ 2QO\FKDUJHD/L3REDWWHU\ZLWKDJRRGTXDOLW\/LWKLXP3RO\PHUFKDUJHU$SRRUTXDOLW\FKDUJHUFDQEHGDQJHURXV
‡ 6HWYROWDJHDQGFXUUHQWFRUUHFWO\IDLOXUHWRGRVRFDQFDXVH¿UH
‡ 3OHDVHFKHFNSDFNYROWDJHDIWHUWKH¿UVWFKDUJH)RUH[DPSOHD&HOOEDWWHU\VKRXOGPHDVXUH9WRDFHOO
EDWWHU\VKRXOGPHDVXUH9WR
‡ 'RQRWGLVFKDUJHDEDWWHU\WRDOHYHOEHORZ9SHUFHOOXQGHUORDG'LVFKDUJLQJEHORZ9SHUFHOOFDQGHWHULRUDWHEDWWHU\
SHUIRUPDQFH%HVXUHWRVHW\RXU(6&IRUWKHSURSHUFXWRIIYROWDJH9FXWRIIIRU6SDFNV9FXWRIIIRU6SDFNVHWF
‡ 8VHFDXWLRQWRDYRLGSXQFWXUHRIWKHEDWWHU\3XQFWXULQJD/L3REDWWHU\PD\FDXVHD¿UH
‡ $OZD\VDOORZDEDWWHU\WRFRROGRZQWRDPELHQWWHPSHUDWXUHEHIRUHUHFKDUJLQJ
%DWWHULHVWKDWORVHRIWKHLUFDSDFLW\PXVWEHUHPRYHGIURPVHUYLFHDQGGLVSRVHGRISURSHUO\'LVFKDUJHWKHEDWWHU\WR9&HOO
PDNLQJVXUHRXWSXWZLUHVDUHLQVXODWHGWKHQZUDSEDWWHU\LQDEDJIRUGLVSRVDO
Seite 14
www.hobbywing.com.de
Platinum Regler Serie
§ 1 Warranty
:HJXDUDQWHHWKDWWKHUHZLOOEHQRSURGXFWLRQRUPDWHULDOHUURUVRQ+\SHLWHPVGXULQJWKHJXDUDQWHHSHULRG†
7KHJXDUDQWHHLVYDOLGIRUFXVWRPHUVZKRERXJKW+\SHLWHPVRYHUDQDXWKRUL]HGGHDOHU7KLVJXDUDQWHHFDQQRWEHWUDQVIHUUHG
to another person.
§ 2 Exclusion of warranty
:HGRQRWJUDQWDQ\ZDUUDQW\RQZDVWDJHSDUWVOLNHWLUHVZKHHOVEHDULQJVJORZSOXJVFOXWFKV\VWHPVSDLQWLQJVHWF
:HDOVRGRQRWJUDQWDQ\ZDUUDQW\LI
QRQDXWKRUL]HGDFFHVVRU\SDUWVDUHXVHGLQWKHPRGHOWKDWDUHQRWSURGXFHGE\+\SHRUWKDWDUHQRWFOHDUO\DSSURYHGIURP+\SH
DWKLUGSDUW\WKDWLVQRWDXWKRUL]HGE\+\SHWULHVWRUHSDLURUWRPRGLI\WKHSURGXFW
WKHXVHUGLVUHJDUGVWKHLQVWUXFWLRQPDQXDORUPRGL¿HVWKHPRGHOLQDGDPDJLQJZD\
- the error occurs because of local conditions where the model is used.
†1RWL¿FDWLRQRIOHJDOULJKWV
:HJUDQWWKLVZDUUDQW\RQRXUSURGXFWVDOWKRXJKZHDUHQRWIRUFHGE\ODZWRGRVR
3OHDVHQRWHWKDW\RXKDYHDOVROHJDOULJKWVLIDQLWHPLVIDXOW\ZKHQ\RXEX\LW,QFDVHRIGHIHFWVDQGDZDUUDQW\FODLP\RX
KDYHWRFRQWDFW\RXUORFDO+\SHGHDOHU$FFRUGLQJWRWKHODZ\RXFDQDVN\RXUGHDOHUWRUHSODFHRUWRUHSDLUWKHIDXOW\LWHP<RX
FDQPHQWLRQWKHGHDOHUDUHDVRQDEOHGHDGOLQHWRGRVR,QFDVHKHGRHVQRWPDQDJHZLWKLQVXFKDWLPHSHULRG\RXFDQUHWXUQWKH
SURGXFWWRKLPDQGJHW\RXUPRQH\EDFNIURPKLP
<RXUULJKWVDJDLQVWWKHFRPSDQ\+\SHDUHDGGLWLRQDOO\WR\RXUOHJDOULJKWV
§ 4 Period of warranty
:HJUDQW\RXD\HDUVZDUUDQW\RQDOO+\SHSURGXFWV7KLVSHULRGVWDUWVZKHQ\RXEX\WKHLWHPDW\RXUORFDOKREE\VKRS
,QFDVHRIVHUYLFHIHDWXUHWKHZDUUDQW\SHULRGGRHVQRWJHWH[WHQGHG
§ 5 Your warranty rights
,QFDVHRIZDUUDQW\FODLPZHZLOOUHSODFHRUUHSDLUWKHGHIHFWLYHSDUWV7KHGHIHFWLYHSDUWVDUHSURSHUW\RI+\SH
7KHZDUUDQW\DGMXVWPHQWZLOOEHH[HFXWHGE\WKH+\SHVHUYLFHGHSDUWPHQW
:HZLOOFRYHUWKHFRVWVIRUPDWHULDODQGPDQSRZHU7KHULVNDQGWKHFRVWVRIWUDQVSRUWDWLRQDUHFRYHUHGE\WKHFXVWRPHU
7KHUHDUHQRIXUWKHUFODLPVOLNHDQQXOOLQJWKHVDOHVFRQWUDFWSULFHUHGXFWLRQRUFRPSHQVDWLRQDJDLQVWXV
§ 6 Assertion of warranty claims
$Q\ZDUUDQW\FODLPVKDYHWREHQRWL¿HGLPPHGLDWHO\DIWHUUHDOL]LQJDQHUURU7KLVFDQEHGRQHE\\RXUORFDOKREE\VKRSRU
GLUHFWO\WR+\SHVHUYLFHGHSDUWPHQW1LNRODXV2WWR6WUD‰H.DOWHQNLUFKHQ*HUPDQ\:HGRQRWFRYHUDQ\FRQVHFXWLYH
IDXOWVWKDWRFFXUEHFDXVHRIDGHOD\HGQRWL¿FDWLRQ
)RUWKHDVVHUWLRQRIDZDUUDQW\FODLP\RXKDYHWRVHQGXVWKHGHIHFWLYHSDUWDQGDKDUGFRS\RI\RXULQYRLFHZLWKWKHGDWHRI
purchase.
$OOGHIHFWLYHLWHPVKDYHWREHUHWXUQHGLQDFOHDQHGFRQGLWLRQ)XHOWDQNVPXVWEHHPSW\,QFDVHSDUWVDUHKHDYLO\FRQWDPLQDWHG
ZHZLOOUHWXUQWKHSDUWVRQ\RXUFRVWV
LQFDVHWKHUHWXUQHGLWHPLVQRWGHIHFWLYHDQGWKDWWKHUHLVQRFODLPRIZDUUDQW\ZHZLOOFKDUJH\RX¼IRURXUODERUFRVWV
Platinum Regler Serie
www.hobbywing.com.de
Seite 15
Platinum Serie
10/2011
Copyright by Hobbywing Technology Co.,Ltd
7HFKQLVFKHbQGHUXQJHQVLQGRKQHYRUKHULJH$QNQGLJXQJHQP|JOLFK-HGHU1DFKGUXFN
DXFKDXV]XJVZHLVHEHGDUIXQVHUHUDXVGUFNOLFKHQVFKULIWOLFKHQ*HQHKPLJXQJ
+\SH‡1LNRODXV2WWR6WU‡'.DOWHQNLUFKHQ
KHOSGHVN#K\SHUFGH‡ZZZK\SHUFGH‡+HOSGHVN
Was this manual useful for you? yes no
Thank you for your participation!

* Your assessment is very important for improving the work of artificial intelligence, which forms the content of this project

Download PDF

advertisement