BA COM Uni3, V1, 105x210 mm, 1c, Entwurf 01, CS2.indd

BA COM Uni3, V1, 105x210 mm, 1c, Entwurf 01, CS2.indd
3
Universal
remote control
UniversalFernbedienung
Télécommande
universelle
Telecomando
universale
Mando a
distancia universal
Universele
afstandsbediening
GB
USER MANUAL
2
D
BEDIENUNGSANLEITUNG
10
F
MODE D´EMPLOI
18
I
MANUALE D’USO
26
E
INSTRUCCIONES DE USO
34
GEBRUIKSAANWIJZING
42
CODES STB
50
CODES SAT
52
CODES TV
55
BRAND LIST STB + SAT
61
BRAND LIST TV1
62
NL
GB
USER MANUAL
GB
Com Uni 3 Universal remote control
USER MANUAL
Com Uni 3 Universal remote control
The STB/SAT/TV database contains following functions:
Print
STB and SAT Function
TV Function
LED
Mode Indication
STB
green
orange
1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
21
22
23
24
25
26
27
28
29
30
31
32
33
34
35
36
16:9
3
2
Key
1
2
3
4
5
6
7
8
9
FAV - / - 0
MENU AV
V+
Ÿ
P+
Ż
OK
Ź
V–
ź
P–
Ɣ
Ɣ
Ɣ
Ɣ
INFO
EPG
EXIT
RECALL
TV / RADIO
LANG
AUDIO
SUB-T
PAUSE
37
STB
38
SAT
39
TV
40
TTX
SAT
red
Standby (On/Off)
1
2
3
4
5
6
7
8
9
FAV
0
Menu
Volume +
Cursor up
Program/Channel +
Cursor left
OK
Cursor right
Volume –
Cursor down
Program/Channel –
red
green
yellow
blue
Info
EPG
Mute
Exit
Back
TV / Radio
Language
Audio
Sub-T
Pause
Switch: to STB Mode and
Program key STB Codes (DB)
Switch: to SAT-Mode and
Program key SAT Codes (DB)
Standby (On/Off)
1
2
3
4
5
6
7
8
9
-/-0
AV
Volume +
Cursor up
Program/Channel +
Cursor left
OK
Cursor right
Volume –
Cursor down
Program/Channel –
red
green
yellow
blue
Info
Zoom +
Mute
Teletext off
16:9 / Zoom –
Digital / Analog
Clock
Switch: to TV Mode and
Program key TV Codes (DB)
Teletext on
Teletext on
3
GB
USER MANUAL
Com Uni 3 Universal remote control
Congratulations on purchasing this high performance Com Uni 3 remote control. Great
care has been taken of the design and manufacture of this product and in normal use
it will give many years of satisfying service. The following pages describe how to get
the best from your new remote control, but if in doubt please contact your retailer.
About your Com Uni 3 remote control
With your new Com Uni 3 remote control you can not only control all functions of your
STB or SAT receiver, but also the core functions of your TV set.
How does the Com Uni 3 remote control work?
By pressing any button on the remote control a command ist been sent to the device
being controlled, using an infrared beam. At the front of this command is a 3-digit
code, which is unique to that particular unit. This means that when you point a
controller at the TV, for example, the VCR will not respond!
The set-up of your remote control requires the programming of this unique 3-digitcode.
The 10-second rule
The Com Uni 3 remote control initially needs your assistance to work properly.
All programming is based on the 10-second rule: every step in these instructions must
be completed within 10 seconds after the previous step. Otherwise, the remote control
returns to standard operating mode. This rule ensures that your Com Uni 3 remote
control is not reprogrammed by another user by accident.
Inserting and changing the batteries
Your Com Uni 3 remote control is powered by two alkaline 1.5 V batteries (IEC LR 03,
AAA). Wherever possible, ensure that new batteries are used.
Never mix old and new batteries together as this will effect the performance of the
remote control and shorten the battery life.
Please note:
Insert the batteries following the markings inside the battery compartment.
Immediately dispose of any leaking batteries.
Dispose old batteries as per manufacturer’s instruction.
Testing Com Uni 3 remote control the for operation
Once the batteries have been inserted, press any button to ensure that the green LED
ÀDVKHVWKLVFRQ¿UPVFRUUHFWLQVHUWLRQRIWKHEDWWHULHV,IIRUDQ\UHDVRQWKHUHLVQR
response from the remote control please check the battery insertion or the condition
of the batteries. If during operation the operating range diminishes the batteries may
need to be replaced. Your Com Uni 3 remote control has an inbuilt special feature
which allows you to change batteries without losing pre-programmed information. After
replacing the batteries all programmed functions will continue working as before.
4
GB
USER MANUAL
Com Uni 3 Universal remote control
A. Key assignment
The Com Uni 3 remote control has three operating modes, the STB mode, SAT mode
and TV mode. Pressing the keys “STB”, “SAT” or “TV” select the particular mode. A
LED shows the activated mode (green for STB, red for SAT and orange for TV). All
modes STB, TV and SAT are pre-programmed by factory settings.
STB and SAT mode
The STB and SAT mode contain following functions:
• Power / Standby
• Numbers 0 to 9
• Channel +/–
• Volume +/–
• FLOF colours (red, green, yellow and blue)
• Teletext on/off
• Mute
• Info
• EPG
• List
• Back
• Menu
• Exit
• OK
• Cursor
• TV/Radio
• Recall
• FAV
• LANG
• SUB-T
• Pause
• Audio
TV mode
The TV mode contains following functions:
• Power / Standby
• Numbers 0 to 9
• AV
• -/- • Channel +/–
• Volume +/–
• OK
• Cursor
• FLOF colours (red, green, yellow and blue)
• Teletext on
• Teletext off
• Mute
• 16:9
• Info
5
GB
USER MANUAL
Com Uni 3 Universal remote control
B. Setup of the STB, SAT and TV mode
1. Insert two new 1.5V AAA/LR03 batteries (correct position is indicated at the base
of the battery slot).
2. Switch on your device (to programme the remote control for the TV set, ensure that
the television shows a picture).
/
RRNDW\RXU79VHWDQG¿QGRXWZKLFKEUDQGLWLVLH0LWVXELVKL6RQ\3DQDVRQLF
etc.
/
RRNXSWKHEUDQGQDPHLQ\RXUFRGHOLVWVHFWLRQ<RXZLOO¿QGRQHRUPRUHGLJLW
codes for your TV brand.
3
UHVVWKH79NH\DQGNHHSLWSUHVVHGXQWLOWKHJUHHQ/('ÀDVKHVWZLFHLQTXLFN
succession (after approx. 3 seconds).
:
LWKLQVHFRQGVRIVHHLQJWKHÀDVKHVDERYHHQWHUWKHGLJLWFRGHIRU\RXU
device.
$
IWHU\RXKDYHHQWHUHGWKHFRGHWKHJUHHQ/('ZLOOÀDVKWZLFHLQGLFDWLQJWKDW
the code has been accepted by your Com Uni 3 remote control. This does not
necessarily mean it is the correct code for your model of device.
8. Press the standby key to check whether your Com Uni 3 remote control is working
properly. If your TV is thereby not set to standby mode, refer to the next code in the
list and repeat the programming procedure from step 3.
9. If your TV is set to standby check all other functions of the TV. If certain functions
are not available or not working properly, refer to the next code in the list and
repeat the programming procedure from step 3.
To program the STB mode please proceed as described in the programming
instructions for television sets, but instead of “TV” key use the “STB” key as
well as the codes from the STB section.
To program the SAT mode please proceed as described in the programming
instructions for television sets, but instead of “TV” key use the “SAT” key as
well as the codes from the SAT section.
C. Brand code scan
If the listed codes are not working or if the manufacturer of your device is not listed,
you have the option to search for a suitable code by means of the brand code scan.
GB
USER MANUAL
Com Uni 3 Universal remote control
After all saved codes have been scanned by your Com Uni 3 remote control, the red
/('ÀDVKHV¿YHWLPHVDQGWKHFRGHVFDQTXLWV
To start the brand code scan for the STB and SAT mode please proceed as
described in the brand code scan for television sets, but instead of “TV” key use
the “STB” or “SAT” key as well as the brand codes from the STB/SAT section.
D. Complete code scan
,IQHLWKHUWKHOLVWHGFRGHVDUHZRUNLQJQRUWKHEUDQGFRGHVFDQGLG¿QGWKHGHVLUHG
code or if the manufacturer of your device is not listed, you have the option to let the
&RP8QLUHPRWHFRQWURO¿QGDVXLWDEOHFRGHE\PHDQVRIWKHFRPSOHWHFRGHVFDQ
1. Insert the batteries (correct position is indicated at the base of the battery slot).
2. Switch on your TV set.
3UHVVWKH79NH\DQGNHHSLWSUHVVHGXQWLOWKHJUHHQ/('ÀDVKHVWZLFHLQTXLFN
succession. (after approx. 3 seconds).
:LWKLQVHFRQGVRIVHHLQJWKHÀDVKHVDERYHHQWHUWKHFRGH0 0 1, the green
/('ÀDVKHVWZLFHDJDLQ
$IWHUWKH/('KDVÀDVKHGWZLFHSUHVVWKH6WDQGE\NH\DQGNHHSLWSUHVVHGXQWLO
the device has switched off. Please consider that the complete code scan can take
XSWRWHQPLQXWHV'XULQJWKHFRGHVFDQWKH/('ÀDVKHVHYHU\VHFRQGVWKLV
indicates that the automatic scan is in progress. After the device has switched off,
switch it on again to check the other functions of the device. If all functions work as
desired, press the “OK” key to save the found code.
6. If certain functions are not available or not working properly, repeat the code scan
procedure (steps 2 to 5) until you have found the best code.
After all saved codes have been scanned by your Com Uni 3 remote control, the red
/('ÀDVKHV¿YHWLPHVDQGWKHFRGHVFDQTXLWV
To start the complete code scan for the STB and SAT mode please proceed as
described in the complete code scan for television sets, but instead of “TV”
key use the “STB” or “SAT” key as well as the brand codes from the STB/SAT
section.
1. Insert the batteries (correct position is indicated at the base of the battery slot).
2. Switch on your TV set.
3
UHVVWKH79NH\DQGNHHSLWSUHVVHGXQWLOWKHJUHHQ/('ÀDVKHVWZLFHLQTXLFN
succession (after approx. 3 seconds).
4. Within the next 10 seconds enter the code 0 0 3WKHJUHHQ/('ÀDVKHVWZLFH
again.
5. Within the next 10 seconds enter the 3 digit brand code of your device, the green
/('ÀDVKHVWZLFHLQFDVHDZURQJFRGHZDVHQWHUHGWKHUHG/('OLJKWVXSIRUWZR
seconds.
$IWHUWKH/('KDVÀDVKHGWZLFHSUHVVWKH6WDQGE\NH\DQGNHHSLWSUHVVHG
XQWLOWKHGHYLFHKDVVZLWFKHGRII'XULQJWKHFRGHVFDQWKH/('ÀDVKHVHYHU\
2 seconds, this indicates that the automatic scan is in progress. After the device
has switched off, switch it on again to check the other functions of the device. If all
functions work as desired, press the “OK” key to save the found code.
7. If certain functions are not available or not working properly, repeat the code scan
procedure (steps 2 to 6) until you have found the best code.
6
7
GB
USER MANUAL
GB
Com Uni 3 Universal remote control
E. Identifying the 3 digit code
USER MANUAL
Com Uni 3 Universal remote control
G. Additional functions
To identify the currently programmed 3 digit code, please follow the steps below.
Key and mode lock
3
UHVVWKH79NH\DQGNHHSLWSUHVVHGXQWLOWKHJUHHQ/('ÀDVKHVWZLFHLQTXLFN
succession. (after approx. 3 seconds).
:
LWKLQVHFRQGVRIVHHLQJWKHÀDVKHVDERYHHQWHUWKHFRGH0 0 2, the green
/('ÀDVKHVWZLFHDJDLQ
7RLGHQWLI\WKHFXUUHQWO\VDYHGFRGHSUHVVWKHQXPEHUNH\³´IRUWKH¿UVWGLJLW
“2” for the second digit and “3” for the third digit. After each digit key has been
SUHVVHGFRXQWWKHQXPEHURIWLPHVWKH/('ÀDVKHV
After a successful programming (STB, SAT or TV mode) certain keys can be locked.
(Protection against faulty operation)
3UHVVWKH79NH\DQGNHHSLWSUHVVHGXQWLOWKHJUHHQ/('ÀDVKHVWZLFHLQTXLFN
succession. (after approx. 3 seconds).
:LWKLQVHFRQGVRIVHHLQJWKHÀDVKHVDERYHHQWHUWKHFRGH 0 9 9, the green
/('ÀDVKHVWZLFHDJDLQ
1RZ\RXFDQGHDFWLYDWHVLQJOHNH\VE\SUHVVLQJWKHP7KH/('ÀDVKHVDWHDFK
NH\SUHVVWRFRQ¿UPWKHLQSXW
Please note: you have the possibility to lock the complete mode by pressing the mode
selection key (STB, SAT or TV).
4. After deactivating the last desired key press “TV” in order to complete the
procedure.
If no button is pressed within 10 seconds after the previous step, the remote control
UHWXUQVWRVWDQGDUGRSHUDWLQJPRGHWKHUHG/('ÀDVKHVXSIRUWZRVHFRQGV
Please note:
,IWKH/('GRHVQRWÀDVKDIWHU\RXKDYHSUHVVHGRQHRIWKHDERYHVHOHFWLRQNH\VWKH
respective code digit is 0.
Example:
‡ 3
UHVVNH\³´IRUKXQGUHGV7KH/('ÀDVKHVWKUHHWLPHV7KH¿UVWGLJLWRI\RXU
3-digit code is thus 3.
‡ 3UHVVNH\³´IRUWHQV7KH/('ÀDVKHVRQFH7KHVHFRQGGLJLWRI\RXUGLJLWFRGH
is thus 1.
‡ 3UHVVNH\³´IRUXQLWV7KH/('ÀDVKHVVL[WLPHV7KHWKLUGGLJLWRI\RXUGLJLW
code is thus 6.
In this example, the code is thus 316.
To apply the single key lock for the STB and SAT mode please proceed as described
for the TV mode, but instead of “TV” key use the “STB” or “SAT” key.
Only the function „Reset“ (Code 0 0 0) cancels the single key lock.
Please note: After a reset, the code needs to be programmed again.
We recommend that you write down the codes for your devices in the respective
¿HOGLQWKLVPDQXDOVRWKDWWKH\DUHDYDLODEOHLQFDVH\RXQHHGWRUHSURJUDP\RXU
Com Uni 3 remote control. The programmed codes retain in the memory even in case
of a battery change.
Following keys are excluded from the single key lock procedure:
• Standby
• Numbers 0 to 9
• Cursor
• P+ / P–
• V+ / V–
• Mode keys (STB / SAT / TV)
To identify the code for the STB and SAT mode please proceed as described above for
television sets, but instead of “TV” key use the “STB” or “SAT” key.
Code lock
After a successful programming (STB, SAT or TV mode) each mode can be protected,
so that your remote control is not reprogrammed by another user by accident.
3UHVVWKH79NH\DQGNHHSLWSUHVVHGXQWLOWKHJUHHQ/('ÀDVKHVWZLFHLQTXLFN
succession (after approx. 3 seconds).
:LWKLQVHFRQGVRIVHHLQJWKHÀDVKHVDERYHHQWHUWKHFRGH0 8 8, the green
/('ÀDVKHVWZLFHDJDLQ
Now the TV mode is protected against reprogramming by accident.
Write down the 3-digit codes here:
STB
SAT
TV
F.
Reset
This functionality resets all settings to the factory settings.
3UHVVWKH79NH\DQGNHHSLWSUHVVHGXQWLOWKH/('ÀDVKHVWZLFHLQTXLFNVXFFHVVLRQ
DIWHUDSSUR[VHFRQGV:LWKLQVHFRQGVRIVHHLQJWKHÀDVKHVDERYHHQWHU
the code 0 0 0WKH/('ÀDVKHVWZLFHDJDLQ$IWHUWKLVSURFHGXUHWKH79PRGHRIWKH
Com Uni 3 remote control is reset to the factory settings.
To reset the STB and SAT mode please proceed as described for resetting the TV
mode, but instead of “TV” key use the “STB” or “SAT” key.
8
To remove the code lock follow the same procedure (unlocking).
3UHVVWKH79NH\DQGNHHSLWSUHVVHGXQWLOWKHJUHHQ/('ÀDVKHVWZLFHLQTXLFN
succession (after approx. 3 seconds).
:LWKLQVHFRQGVRIVHHLQJWKHÀDVKHVDERYHHQWHUWKHFRGH0 8 8, the green
/('ÀDVKHVWZLFHDJDLQ
Now the TV mode can be programmed.
To apply the code lock for the STB and SAT mode please proceed as described for the
TV mode, but instead of “TV” key use the “STB” or “SAT” key.
Volume function#
In the SAT and STB mode you have also the possibility to control the volume of the
TV-set.
SUHVVWKH³6$7RU67%´NH\IRUPLQLPXPVHFRQGVXQWLOWKH/('ÀDVKHVWZLFH
ZLWKLQWHQVHFRQGVRIVHHLQJWKHÀDVKHVDERYHHQWHUWKHFRGH0 0 4, the LED
ÀDVKHVWZLFHDJDLQWRDFNQRZOHGJHWKHIXQFWLRQ
To deactivate this function enter the code 0 0 5.
9
D
BEDIENUNGSANLEITUNG
BEDIENUNGSANLEITUNG
D
Com Uni 3 Universal-Fernbedienung
Com Uni 3 Universal-Fernbedienung
Die STB-/SAT-/TV-Datenbank (DB) beinhaltet die folgenden Funktionen:
Aufdruck
STB- und SAT-Funktion
TV-Funktion
LED
Mode-Anzeige
STB
grün
orange
1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
21
22
23
24
25
26
27
28
29
30
31
32
33
34
35
36
16:9
3
10
Taste
1
2
3
4
5
6
7
8
9
FAV - / - 0
MENU AV
V+
Ÿ
P+
Ż
OK
Ź
V–
ź
P–
Ɣ
Ɣ
Ɣ
Ɣ
INFO
EPG
EXIT
RECALL
TV / RADIO
LANG
AUDIO
SUB-T
PAUSE
37
STB
38
SAT
39
TV
40
TTX
SAT
rot
Standby (Ein/Aus)
1
2
3
4
5
6
7
8
9
FAV
0
Menü
Lautstärke +
Cursor aufwärts
Programm +
Cursor links
OK
Cursor rechts
Lautstärke –
Cursor abwärts
Programm –
rot
grün
gelb
blau
Info
EPG
Stummschaltung
Exit
Zurück
TV / Radio
Sprache
Audio
Sub-T
Pause
Umschaltung: auf STB-Mode und
Programmiertaste STB-Codes (DB)
Umschaltung: auf SAT-Mode und
Programmiertaste SAT Codes (DB)
Standby (Ein/Aus)
1
2
3
4
5
6
7
8
9
-/-0
AV
Lautstärke +
Cursor aufwärts
Programm +
Cursor links
OK
Cursor rechts
Lautstärke –
Cursor abwärts
Programm –
rot
grün
gelb
blau
Info
Zoom +
Stummschaltung
Teletext aus
16:9 / Zoom –
Digital / Analog
Uhr
Umschaltung: auf TV-Mode und
Programmiertaste TV-Codes (DB)
Teletext ein
Teletext ein
11
D
BEDIENUNGSANLEITUNG
Com Uni 3 Universal-Fernbedienung
Herzlichen Glückwunsch zum Kauf der neuartigen Com Uni 3 Fernbedienung.
Beim Design und bei der Produktion dieses Produktes wurde mit größter Sorgfalt
vorgegangen, und bei normalem Gebrauch wird die Com Uni 3 Fernbedienung viele
Jahre zu Ihrer vollsten Zufriedenheit ihre Dienste leisten. Auf den folgenden Seiten ist
beschrieben, wie Sie Ihre Com Uni 3 Fernbedienung am besten einsetzen können.
Sollten dennoch Probleme auftreten kontaktieren Sie bitte Ihren Händler.
Grundsätzliches zur Com Uni 3 Fernbedienung
Die Com Uni 3 Fernbedienung ist vorwiegend als Ersatz für die Fernbedienung Ihres
STB- oder SAT-Receivers bestimmt. Ab sofort können Sie die Funktionen des STBReceivers und zusätzlich auch noch die Basisfunktionen eines TV-Gerätes und eines
SAT-Receivers mit nur einer einzigen Fernbedienung steuern. Wenn Sie also wollen,
können Sie die Original-Fernbedienungen Ihres digitalen terrestrischen und SatellitenReceivers sowie jene des TV-Gerätes/SAT-Receivers durch Ihre neue Com Uni 3
Fernbedienung ersetzen.
Wie arbeitet Ihre Com Uni 3 Fernbedienung?
Die von den verschiedenen Herstellern unterschiedlich verwendeten Frequenzen der
Infrarot-Signale haben wir nahezu komplett in Ihrer Com Uni 3 Infrarot-Fernbedienung
abgespeichert. Zur Steuerung der von Ihnen ausgewählten Geräte brauchen Sie die
in Ihrer Com Uni 3 Fernbedienung bereits abgespeicherten Daten nur noch aktivieren.
Diese Aktivierung erfolgt durch die einfache Eingabe eines 3-stelligen Zifferncodes,
welcher der jeweiligen Marke und dem jeweiligen Gerät zugeordnet ist, und schon
sendet Ihre Com Uni 3 Fernbedienung das ausgehende Infrarotsignal in der für das
ausgewählte Gerät richtigen Frequenz.
Die 10-Sekunden-Regel
Die Com Uni 3 Fernbedienung braucht Ihre Hilfe, um für die zu steuernden Geräte zu
funktionieren. Bitte lesen Sie vor der Einstellung der Com Uni 3 Fernbedienung diese
Bedienungsanleitung sorgfältig durch. Die Basis zur Programmierung Ihrer Com Uni 3
Fernbedienung ist die 10-Sekunden-Regel. Jeder Schritt der Einstellung Ihrer
Com Uni 3 Fernbedienung muss innerhalb von 10 Sekunden abgeschlossen sein,
denn sonst wird Ihre Com Uni 3 Fernbedienung in den normalen Bedienungsmodus
zurückgesetzt.
Einlegen und Wechseln der Batterien
Ihre Com Uni 3 Fernbedienung wird durch zwei 1,5-Volt-Alkali-Batterien (IEC LR 03,
AAA) versorgt. Wir empfehlen Ihnen nur neue Batterien zu verwenden. Auf jeden
Fall sollten Sie niemals alte und neue Batterien gemischt verwenden, weil das die
/HLVWXQJVIlKLJNHLW,KUHU)HUQEHGLHQXQJVWDUNEHHLQÀXVVHQNDQQXQGGDUEHUKLQDXV
die Lebensdauer der Batterien wesentlich verkürzt.
Bitte beachten
Legen Sie die Batterien entsprechend der im Batteriefach angezeigten Markierung
ein. Achten Sie besonders auf die Richtigkeit der Polung. Entfernen Sie umgehend
eventuell auslaufende Batterien! Entsorgen Sie die Altbatterien entsprechend den
Anweisungen des jeweiligen Herstellers.
Test für Betriebsbereitschaft
Nachdem Sie die Batterien eingelegt haben drücken Sie bitte eine Taste und prüfen
6LHREGLHJUQH/HXFKWGLRGHDXÀHXFKWHW'LHVLVWGLH%HVWlWLJXQJGDVVGLH%DWWHULHQ
richtig eingelegt wurden. Falls Ihre Fernbedienung aus irgend einem Grund nicht
reagiert, überprüfen Sie den Zustand der Batterien und auch, ob diese wirklich richtig
eingelegt sind. Sollte sich nach einiger Zeit die Sendereichweite Ihrer Fernbedienung
erheblich verkürzen, ist es Zeit die Batterien zu wechseln.
In Ihrer Com Uni 3 Fernbedienung ist ein Zwischenspeicher eingebaut, der verhindert,
dass während des Batteriewechsels die einprogrammierten Codes verloren gehen.
Nach dem Batteriewechsel sollten alle programmierten Geräte wieder funktionieren.
12
D
BEDIENUNGSANLEITUNG
Com Uni 3 Universal-Fernbedienung
A. Allgemeine Funktionsbeschreibung
Die Com Uni 3 Fernbedienung hat drei Betriebsarten, den STB-Modus sowie eine
SAT- und eine TV-Ebene. Mit den Tasten „STB“, „SAT“ und „TV“ können Sie zwischen
den jeweiligen Betriebsarten umschalten. Eine LED zeigt dabei den aktivierten Modus
an (grün für STB, rot für SAT und orange für TV). Die STB-, TV- und SAT-Ebenen sind
ab Werk vorprogrammiert.
STB und SAT-Ebene
Die STB- und SAT-Ebene beinhaltet folgende Funktionen:
• Standby
• Ziffern 0 bis 9
• Kanal +/–
• Laustärke +/–
• FLOF-Farben (rot, grün, gelb und blau)
• Teletext ein/aus
• Mute (Stummschaltung)
• Info
• EPG
• List
• Zurück
• Menu
• Exit
• OK
• Cursor
• TV/Radio
• Recall
• FAV
• LANG
• SUB-T
• Pause
• Audio
TV-Ebene
Die TV-Ebene beinhaltet folgende Funktionen:
• Standby
• Ziffern 0 bis 9
• AV
• -/- • Kanal +/–
• Lautstärke +/–
• OK
• Cursor
• FLOF-Farben (rot, grün, gelb und blau)
• Teletext ein
• Teletext aus
• (Mute) Stummschaltung
• 16:9 Bildformat
• Info
13
D
BEDIENUNGSANLEITUNG
Com Uni 3 Universal-Fernbedienung
B. Programmierung der STB-, SAT- und TV-Ebene
1. Legen Sie zwei neue 1,5-V-Alkali-Batterien des Typs „AAA/LR 03“ ein. Achten Sie
dabei auf die richtige Polung der Batterien.
2. Schalten Sie Ihr TV-Gerät ein.
3. Suchen Sie in der mitgelieferten Codeliste nach dem Hersteller Ihres TV-Geräts
(z.B. Sony).
4. Neben dem Herstellernamen sind einer oder mehrere dreistellige Codes
aufgelistet. Dieser Code muss entsprechend der folgenden Anleitung eingegeben
werden, damit Sie mit der Com Uni 3 Fernbedienung Ihr TV-Gerät bedienen
können.
5. Drücken Sie die „TV“-Taste für mindestens drei Sekunden, bis die grüne LED
zweimal blinkt.
6. Geben Sie nun innerhalb von zehn Sekunden den dreistelligen Code ein.
7. Wenn der Code richtig eingegeben wurde, blinkt die grüne LED zweimal, um eine
erfolgreiche Programmierung anzuzeigen
8. Zielen Sie nun mit der Com Uni 3 Fernbedienung auf Ihr TV-Gerät und drücken Sie
die Standby-Taste. Wenn Ihr TV-Gerät nicht reagiert, wiederholen Sie die Schritte
3 bis 8 mit dem nächsten Code des Herstellers Ihres TV-Geräts aus der Liste.
9. Wenn sich Ihr TV-Gerät ausgeschaltet hat, haben Sie einen passenden Code
gefunden. Überprüfen Sie anschließend alle weiteren Funktionen. Sollten mehrere
Tasten nicht funktionieren, beginnen Sie erneut bei Punkt 3 und nehmen Sie den
nächsten Code des Herstellers Ihres TV-Geräts aus der Liste.
Die Programmierung der STB-Ebene funktioniert gleich, jedoch muss anstelle
der „TV“-Taste die „STB“-Taste gedrückt werden und die Codes aus der STBListe verwendet werden.
Die Programmierung der SAT-Ebene funktioniert gleich, jedoch muss anstelle
der „TV“-Taste die „SAT“-Taste gedrückt werden und die Codes aus der SATListe verwendet werden.
C. Hersteller-/Brand-Suchlauf
Wenn Sie mit der in Abschnitt B beschriebenen Vorgehensweise keinen passenden
Code gefunden haben, können Sie mit dem Hersteller-Suchlauf nach einem
passenden Code suchen.
1. Versichern Sie sich, dass in der Com Uni 3 Fernbedienung volle Batterien
eingelegt sind.
2. Schalten Sie Ihr TV-Gerät ein.
3. Drücken Sie die „TV“-Taste für mindestens drei Sekunden, bis die grüne LED
zweimal blinkt.
4. Geben Sie innerhalb von zehn Sekunden den Code 0 0 3 ein, die grüne LED blinkt
danach zweimal.
5. Geben Sie innerhalb von zehn Sekunden den dreistelligen Code für den Hersteller
(Brand) des TV-Geräts ein. Wenn der Code richtig eingegeben wurde blinkt die
grüne LED zweimal, wenn nicht leuchtet die LED einmal für zwei Sekunden rot auf.
6. Drücken und halten Sie die Standby-Taste so lange, bis sich Ihr TV-Gerät
ausschaltet. Wenn Sie die Standby-Taste loslassen wird der Suchlauf angehalten,
und Sie können auch die anderen Funktionen testen. Wenn für fünf Sekunden
keine Taste gedrückt wird, wird der Suchlauf abgebrochen und die Com Uni 3
)HUQEHGLHQXQJNHKUWLQGLHQRUPDOH(EHQH]XUFNGLH/('OHXFKWHWHLQPDOURWIU
zwei Sekunden. Wenn sich das TV-Gerät während des automatischen Suchlaufs
ausschaltet, lassen Sie die Standby-Taste unverzüglich los und drücken Sie „OK“,
damit die gefundene Einstellung gespeichert wird. Die LED blinkt danach zweimal
grün.
14
D
BEDIENUNGSANLEITUNG
Com Uni 3 Universal-Fernbedienung
7. Es kann passieren, dass die Com Uni 3 Fernbedienung während des Suchlaufs
PHKUHUH&RGHV¿QGHWDXIGLH,KU79*HUlWDQVSULFKWDEHUQLFKWEHLMHGHP&RGH
alle Tasten funktionieren. In diesem Fall sollten Sie den Suchlauf erneut starten
(Schritte 2 bis 6), bis Sie den besten Code gefunden haben.
Wenn die Com Uni 3 Fernbedienung alle Codes, die zum Hersteller Ihres
Geräts passen, durchsucht hat, blinkt die LED fünfmal rot, und der Suchlauf wird
abgebrochen.
Der Hersteller/Brand-Suchlauf der STB- und SAT-Ebene funktioniert gleich,
jedoch müssen an Stelle der „TV“-Taste die „ STB“-Taste oder für SAT die
„SAT“-Taste gedrückt werden und die Codes aus der STB-/SAT-Brandliste
verwendet werden.
D. Kompletter Code-Suchlauf
Wenn Sie mit den in Abschnitt B und C beschriebenen Vorgehensweisen keinen
passenden Code für Ihr Gerät gefunden haben, können Sie den kompletten CodeSuchlauf durchführen.
1. Versichern Sie sich, dass in der Com Uni 3 Fernbedienung volle Batterien
eingelegt sind.
2. Schalten Sie Ihr TV-Gerät ein.
3. Drücken Sie die „TV“-Taste für mindestens drei Sekunden bis die grüne LED
zweimal blinkt.
4. Geben Sie innerhalb von zehn Sekunden den Code 0 0 1 ein, die grüne LED blinkt
danach zweimal.
5. Drücken und halten Sie die Standby-Taste so lange, bis sich Ihr TV-Gerät
ausschaltet. Bitte beachten Sie, dass dieser Vorgang bis zu zehn Minuten dauern
kann. Wenn innerhalb von zehn Sekunden keine Taste gedrückt wird, wird der
Suchlauf abgebrochen, und die LED leuchtet rot einmal für zwei Sekunden auf.
Wenn sich das TV-Gerät während des automatischen Suchlaufs ausschaltet,
lassen Sie die Standby-Taste unverzüglich los und drücken Sie „OK“, damit die
gefundene Einstellung gespeichert wird. Die LED blinkt danach zweimal.
6. Sollten einige Tasten nicht funktionieren starten Sie den Suchlauf erneut (Schritte
2 bis 5) bis Sie einen besseren Code gefunden haben. Bitte beachten Sie, dass in
diesem Fall die Com Uni 3 Fernbedienung den Suchlauf bei dem zuletzt gefunden
Code weiterführt und nicht beim allerersten Code.
Wenn die Com Uni 3 Fernbedienung alle Codes durchsucht hat, blinkt die LED fünfmal
rot, und der Suchlauf wird abgebrochen.
Der komplette Code-Suchlauf funktioniert für die STB- und SAT-Ebene gleich,
jedoch muss anstelle der „TV“-Taste die „STB“-Taste und für SAT die „SAT“Taste gedrückt werden.
15
D
BEDIENUNGSANLEITUNG
Com Uni 3 Universal-Fernbedienung
E. Code-Abfrage
BEDIENUNGSANLEITUNG
Com Uni 3 Universal-Fernbedienung
G. Sonderfunktionen
Den eingestellten Code auslesen
1. Drücken Sie die „TV“-Taste für mindestens drei Sekunden bis die grüne LED
zweimal blinkt.
2. Geben Sie innerhalb von zehn Sekunden den Code 0 0 2 ein, die grüne LED blinkt
danach zweimal.
3. Um den eingestellten Code auszulesen, drücken Sie die Ziffer „1“, um die erste
Codestelle auszulesen, „2“ für die zweite und „3“ für die dritte. Nachdem Sie eine
dieser Ziffern gedrückt haben, zählen Sie wie oft die LED blinkt, das entspricht der
Nummer der Codestelle.
Achtung:
Wenn die LED nicht blinkt nachdem Sie die Ziffern „1“, „2“ oder „3“ gedrückt haben, so
ist die entsprechende Codestelle 0.
Beispiel:
• Drücken Sie die Taste „1“ für die Hunderterstelle. Wenn z.B. die LED dreimal blinkt
ist die erste Stelle 3.
• Drücken Sie die Taste „2“ für die Zehnerstelle. Wenn z.B. die LED einmal blinkt ist
die zweite Stelle 1.
• Drücken Sie die Taste „3“ für die Einerstelle. Wenn z.B. die LED sechsmal blinkt ist
die letzte Stelle 6.
In diesem Beispiel ist der Code 316.
Wir empfehlen, dass Sie sich die Codes für STB/SAT und TV aufschreiben für den
Fall, dass Sie später Ihre Com Uni 3 Fernbedienung wieder einmal programmieren
müssen. Die eingestellten Codes bleiben nach einem Wechsel der Batterien erhalten.
Die Code-Abfrage für STB und SAT funktioniert gleich wie für TV, jedoch muss anstelle
der „TV“-Taste die „STB“-Taste und für SAT die „SAT“-Taste gedrückt werden.
Notieren Sie sich die 3-stelligen Codenummern für zukünftige Einstellungen.
STB
SAT
TV
F.
D
Reset
Einstellungen löschen
Drücken Sie die „TV“-Taste für mindestens drei Sekunden, bis die LED zweimal blinkt.
Geben Sie danach den Code 0 0 0 ein. Die LED blinkt zweimal, wenn der Code
eingegeben wurde. Nach diesem Vorgang wird die Com Uni 3 Fernbedienung in der
TV-Ebene in den Neuzustand (Lieferzustand) zurückgesetzt.
Tasten- und Ebenensperre
Nach der richtigen Programmierung (STB-/SAT- oder TV-Ebene) können Sie
bestimmte Tasten sperren (Schutz gegen Fehlbedienung).
1. Drücken Sie die „TV“-Taste für mindestens drei Sekunden, bis die grüne LED
zweimal blinkt.
2. Geben Sie innerhalb von zehn Sekunden den Code 0 9 9 ein, die grüne LED blinkt
danach zweimal, um die Eingabe zu bestätigen.
3. Nun können Sie durch Drücken der einzelnen Tasten diese deaktivieren (die LED
leuchtet bei jeder Tastenbetätigung, um die Eingabe zu bestätigen).
Hinweis: Sie haben die Möglichkeit durch Drücken der nicht benötigten Umschalttaste
(STB, SAT oder TV) die gesamte Ebene zu sperren.
4. Nach Betätigung der letzten Taste wird durch drücken der „TV“-Taste die Eingabe
abgeschlossen.
Wenn innerhalb von zehn Sekunden keine Taste gedrückt wird, so wird die Eingabe
automatisch abgeschlossen (die LED leuchtet einmal rot für zwei Sekunden auf).
Die Einzeltastensperre für STB und SAT funktioniert gleich wie für TV, jedoch muss
anstelle der „TV“-Taste die „STB“-Taste und für SAT die „SAT“-Taste gedrückt werden.
Mit der Funktion „Reset“ Einstellungen löschen (Code 0 0 0) heben Sie die
Tastensperre auf.
Achtung: Anschließend muß die entsprechende Ebene gegebenenfalls neu
programmiert werden.
Folgende Tasten sind von der Tastensperre ausgenommen:
• Standby
• Ziffern 0 bis 9
• Cursor
• P+ / P–
• V+ / V–
• Umschalttasten (STB / SAT / TV)
Codesperre
Nach der richtigen Programmierung (STB-/SAT- oder TV-Ebene) können Sie diese
Ebene gegen Umprogrammierung sperren.
1. Drücken Sie die „TV“-Taste für mindestens drei Sekunden, bis die grüne LED
zweimal blinkt.
2. Geben Sie innerhalb von zehn Sekunden den Code 0 8 8 ein, die grüne LED blinkt
danach zweimal, um die Eingabe zu bestätigen.
Nun ist diese Ebene gegen eine Umprogrammierung gesperrt.
Um die Sperrung aufzuheben gehen Sie gleich vor (entsperren).
1. Drücken Sie die „TV“-Taste für mindestens drei Sekunden, bis die grüne LED
zweimal blinkt.
2. Geben Sie innerhalb von zehn Sekunden den Code 0 8 8 ein, die grüne LED blinkt
danach zweimal, um die Eingabe zu bestätigen.
Nun ist diese Ebene frei für eine neue Programmierung.
Die Sperre für STB und SAT funktioniert gleich wie für TV, jedoch muss anstelle der
„TV“-Taste die „STB“-Taste und für SAT die „SAT“-Taste gedrückt werden.
Das Löschen für STB und SAT funktioniert gleich wie für TV, jedoch muss anstelle der
„TV“-Taste die „STB“-Taste und für SAT die „SAT“-Taste gedrückt werden.
Lautstärke-Funktion
In der SAT- und STB-Ebene haben Sie auch die Möglichkeit die Lautstärke des TVGerätes zu steuern.
1. Drücken Sie die „SAT- oder STB“-Taste für mindestens drei Sekunden, bis die LED
zweimal blinkt.
2. Geben Sie innerhalb von zehn Sekunden den Code 0 0 4 ein, die LED blinkt
danach zweimal, um die Aktivierung dieser Funktion zu bestätigen.
Die Deaktivierung dieser Funktion erfolgt mit der Code-Eingabe 0 0 5.
16
17
F
MODE D´EMPLOI
MODE D´EMPLOI
F
Com Uni 3 Télécommande universelle
Com Uni 3 Télécommande universelle
La base de données STB/SAT/TV comprend les fonctions suivantes :
Touche Impression
LED
1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
21
22
23
24
25
26
27
28
29
30
31
32
33
34
35
36
16:9
$I¿FKDJHPRGH
1
2
3
4
5
6
7
8
9
FAV - / - 0
MENU AV
V+
Ÿ
P+
Ż
OK
Ź
V–
ź
P–
Ɣ
Ɣ
Ɣ
Ɣ
INFO
EPG
EXIT
RECALL
TV / RADIO
LANG
AUDIO
SUB-T
PAUSE
37
STB
38
SAT
39
TV
40
TTX
3
18
Fonctions STB et SAT
Fonction TV
STB
vert
orange
SAT
rouge
Standby (Marche/Arrêt)
1
2
3
4
5
6
7
8
9
FAV
0
Menu
Volume +
Curseur vers le haut
Canal +
Curseur vers la gauche
OK
Curseur vers la droite
Volume –
Curseur vers le bas
Programm –
rouge
vert
jaune
bleu
Info
EPG
Mise en sourdine
Exit
Retour
TV / Radio
Langue
Audio
Sub-T
Pause
Commutation sur le mode STB /
touche de programmation codes
STB (DB)
Commutation sur le mode SAT /
touche de programmation SAT (DB)
Standby (Marche/Arrêt)
1
2
3
4
5
6
7
8
9
-/-0
AV
Volume +
Curseur vers le haut
Canal +
Curseur vers la gauche
OK
Curseur vers la droite
Volume –
Curseur vers le bas
Programm –
rouge
vert
jaune
bleu
Info
Zoom +
Mise en sourdine
Arrêt télétexte
16:9 / Zoom –
Numérique / analogique
heure
Commutation sur le mode TV /
touche de programmation codes
TV (DB)
Télétexte marche
Télétexte marche
19
F
MODE D´EMPLOI
Com Uni 3 Télécommande universelle
Félicitations pour votre achat de la nouvelle télécommande Com Uni 3. Ce produit a
été conçu et produit avec le plus grand soin. Utilisée dans des conditions normales, la
télécommande Com Uni 3 vous donnera satisfaction pendant de nombreuses années.
Vous trouverez dans les pages suivantes des consignes vous permettant d’utiliser
la télécommande Com Uni 3 de façon optimale. En cas de problèmes, merci de
contacter votre distributeur.
Remarques générales relatives à la télécommande Com Uni 3
La télécommande Com Uni 3 vise avant tout à remplacer la télécommande de votre
récepteur STB ou SAT. Vous pouvez dès maintenant commander les fonctions du
récepteur STB ainsi que les fonctions de base d’un téléviseur et d’un récepteur SAT
à l’aide d’une seule télécommande. Si vous le souhaitez, vous pouvez remplacer les
télécommandes d’origine de votre récepteur numérique terrestre et satellite et celle de
votre téléviseur/récepteur SAT par votre nouvelle télécommande Com Uni 3.
Comment fonctionne votre télécommande Com Uni 3 ?
Nous avons mémorisé dans votre télécommande à infrarouge Com Uni 3 presque
toutes les fréquences des signaux infrarouges utilisées différemment par l’ensemble
GHVIDEULFDQWV$¿QGHFRPPDQGHUOHVDSSDUHLOVVpOHFWLRQQpVSDUYRVVRLQVYRXV
devez simplement activer les données préalablement sauvegardées dans votre
télécommande Com Uni 3. Cette activation s’effectue via la saisie d’un code à 3
chiffres attribué à la marque et à l’appareil correspondants. Votre télécommande
Com Uni 3 envoie alors immédiatement le signal infrarouge sortant à la fréquence
adaptée à l’appareil sélectionné.
Règle des 10 secondes
Votre intervention sur la télécommande Com Uni 3 est nécessaire pour garantir
le fonctionnement des appareils à commander. Avant de procéder au réglage de
la télécommande Com Uni 3, merci de lire attentivement ce mode d’emploi. La
programmation de votre télécommande Com Uni 3 repose sur la règle des 10
secondes. Chaque étape du réglage de votre télécommande Com Uni 3 doit être
effectuée dans un délai de 10 secondes. Dans le cas contraire, votre télécommande
Com Uni 3 repasse au mode de fonctionnement normal.
Mise en place/remplacement des piles
Votre télécommande Com Uni 3 est alimentée par deux piles alcalines de 1,5 volt
(IEC LR 03, AAA). Nous vous recommandons d’utiliser exclusivement de nouvelles
piles. Dans tous les cas, n’utilisez jamais un mélange de piles usagées et de nouvelles
piles, les performances de votre télécommande pourraient alors s’en trouver fortement
altérées et la durée de vie de vos piles nettement réduite.
Remarque importante :
LQWURGXLVH]OHVSLOHVFRQIRUPpPHQWDXPDUTXDJHTXL¿JXUHGDQVOHXUFRPSDUWLPHQW
Veillez à bien respecter la polarité. Retirez immédiatement les éventuelles piles
présentant des fuites ! Éliminez les piles usagées dans le respect des consignes du
fabricant.
Test de disponibilité opérationnelle
8QHIRLVTXHYRXVDYH]LQVpUpOHVSLOHVDSSX\H]VXUXQHWRXFKHHWYpUL¿H]TXHOD
diode lumineuse verte s’allume. Si c’est le cas, les piles ont été insérées correctement.
Si, pour une raison quelconque, votre télécommande n’émet aucune réaction,
YpUL¿H]O¶pWDWGHVSLOHVHWOHXULQVHUWLRQFRUUHFWH6LDSUqVTXHOTXHVWHPSVODSRUWpH
d’émission de votre télécommande se réduit de façon importante, il convient de
remplacer les piles.
Une mémoire intermédiaire prévenant la perte des codes programmés lors du
remplacement des piles est intégrée dans votre télécommande Com Uni 3. Une fois le
remplacement des piles effectué, tous les appareils programmés doivent de nouveau
fonctionner normalement.
20
F
MODE D´EMPLOI
Com Uni 3 Télécommande universelle
A. Description générale du fonctionnement
La télécommande Com Uni 3 dispose de trois modes de fonctionnement : le mode
STB, une plage SAT et une plage TV. Les touches « STB », « SAT » et « TV » vous
permettent de commuter entre les différents modes. Une LED indique le mode activé
(vert pour STB, rouge pour SAT et orange pour TV). Les plages STB, TV et SAT sont
pré-programmées en usine.
Plages STB et SAT
Les plages STB et SAT contiennent les fonctions suivantes :
• Stand-by
• Chiffres 0 à 9
• Canal +/–
• Volume +/• Couleurs FLOF (rouge, vert, jaune et bleu)
• Télétexte marche/arrêt
• Mute (mise en sourdine)
• Info
• EPG
• Liste
• Retour
• Menu
• Exit
• OK
• Curseur
• TV/Radio
• Rappel
• FAV
• LONG
• SUB-T
• Pause
• Audio
Plage TV
Cette plage contient les fonctions suivantes :
• Stand-by
• Chiffres 0 à 9
• AV
• -/- • Canal +/–
• Volume +/–
• OK
• Curseur
• Couleurs FLOF (rouge, vert, jaune et bleu)
• Télétexte marche
• Télétexte arrêt
• (Mute) Mise en sourdine
• 16:9
• Info
21
F
MODE D´EMPLOI
Com Uni 3 Télécommande universelle
B. Programmation des plages STB, SAT et TV
1. Insérez deux nouvelles piles alcalines 1,5 volt de type « AAA/LR 03 ». Veillez à
bien respecter la polarité des piles.
2. Mettez votre téléviseur en marche.
3. Recherchez le fabricant de votre téléviseur dans la liste des codes fournie (Sony p.
ex.).
8QRXSOXVLHXUVFRGHVjWURLVFKLIIUHV¿JXUHQWjF{WpGXQRPGXIDEULFDQW&H
code doit être saisi conformément à la consigne suivante pour vous permettre de
commander votre téléviseur à l’aide de la télécommande Com Uni 3.
5. Appuyez sur la touche « TV » pendant au moins trois secondes jusqu’à ce que la
LED verte clignote deux fois.
6. Saisissez le code à trois chiffres dans un laps de temps inférieur à dix secondes.
7. Si le code a été correctement saisi, la LED verte clignote deux fois pour signaler la
programmation réussie.
8. Visez votre téléviseur avec votre télécommande Com Uni 3 et appuyez sur la
touche Standby. Si votre téléviseur ne réagit pas, renouvelez les étapes 3 à 8 avec
le code du fabricant de votre téléviseur qui vient ensuite sur la liste.
9. Si votre téléviseur s’est éteint, c’est que vous avez trouvé un code adéquat.
&RQWU{OH]HQVXLWHWRXWHVOHVDXWUHVIRQFWLRQV6LSOXVLHXUVWRXFKHVQHIRQFWLRQQHQW
pas, recommencez l’opération au point 3 et utilisez le code du fabricant de votre
téléviseur qui vient ensuite sur la liste.
La programmation de la plage STB fonctionne de façon identique. La touche «
STB » doit toutefois être activée à la place de la touche « TV » et les codes de la
liste STB doivent être utilisés.
La programmation de la plage SAT fonctionne immédiatement. La touche « TV »
doit toutefois être activée à la place de la touche « SAT » et les codes de la liste
SAT doivent être utilisés.
C. Recherche de fabricant/marques
Si la procédure décrite au paragraphe B ne vous a pas permis de trouver un code
adéquat, vous pouvez effectuer une recherche par fabricant.
1. Assurez-vous que la télécommande est bien équipée de piles chargées.
2. Mettez votre téléviseur en marche.
3. Appuyez sur la touche « TV » pendant au moins trois secondes jusqu’à ce que la
LED verte clignote deux fois.
4. Saisissez le code 0 0 3 dans un délai de dix secondes. La LED verte clignote alors
à deux reprises.
5. Saisissez le code à trois chiffres du fabricant (marque) du téléviseur dans un laps
de temps inférieur à dix secondes. Si le code a été correctement saisi, la LED
verte clignote à deux reprises. Dans le cas contraire, la LED rouge clignote à une
seule reprise pendant deux secondes.
6. Appuyez sur la touche Standby et maintenez-la enfoncée jusqu’à ce que votre
téléviseur se mette à l’arrêt. Si vous relâchez la touche Standby, la recherche est
stoppée et vous pouvez également tester les autres fonctions. Si vous n’appuyez
sur aucune touche pendant cinq secondes, la recherche est interrompue et la
WpOpFRPPDQGH&RP8QLUHSDVVHVXUVDSODJHQRUPDOHOD/('URXJHFOLJQRWHj
une reprise pendant deux secondes. Si le téléviseur s’éteint pendant la recherche
automatique, relâchez immédiatement la touche Standby et appuyez sur « OK »
D¿QGHPpPRULVHUOHUpJODJHWURXYp/D/('YHUWHFOLJQRWHDORUVjGHX[UHSULVHV
22
F
MODE D´EMPLOI
Com Uni 3 Télécommande universelle
7. Il est possible que la télécommande Com Uni 3 trouve pendant la recherche
plusieurs codes auxquels votre téléviseur réagit sans pour autant que toutes les
touches fonctionnent avec chaque code. Il convient alors de relancer la recherche
(étapes 2 à 6) jusqu’à ce que vous ayez trouvé le meilleur code.
Une fois que la télécommande Com Uni 3 a recherché tous les codes correspondant
au fabricant de votre téléviseur, la LED rouge clignote à cinq reprises et la recherche
est interrompue.
La recherche fabricant/marque des plages STB et SAT fonctionne de la même
façon. La touche « STB » ou « SAT » doit simplement être activée à la place de la
touche « TV » et les codes de la liste de marques STB/SAT doivent être utilisés.
D. Recherche de codes complète
Si les procédures décrites aux paragraphes B et C ne vous ont pas permis de trouver
un code adéquat pour votre appareil, vous pouvez effectuer une recherche de codes
complète.
1. Assurez-vous que la télécommande est bien équipée de piles chargées.
2. Mettez votre téléviseur en marche.
3. Appuyez sur la touche « TV » pendant au moins trois secondes jusqu’à ce que la
LED verte clignote deux fois.
4. Saisissez le code 0 0 1 dans un délai de dix secondes. La LED verte clignote alors
à deux reprises.
5. Appuyez sur la touche Standby et maintenez-la enfoncée jusqu’à ce que votre
téléviseur se mette à l’arrêt. Veuillez noter que cette opération peut nécessiter
jusqu’à dix minutes. Si aucune touche n’est activée dans un laps de temps de
dix secondes, la recherche est interrompue et la LED rouge clignote à une seule
reprise pendant deux secondes.
Si le téléviseur s’éteint pendant la recherche automatique, relâchez
LPPpGLDWHPHQWODWRXFKH6WDQGE\HWDSSX\H]VXU©2.ªD¿QGHPpPRULVHUOH
réglage trouvé. La LED clignote alors à deux reprises.
6. Si quelques touches ne fonctionnent pas, relancez la recherche (étapes 2 à 5)
jusqu’à ce que vous ayez trouvé un meilleur code. Veuillez noter que dans ce
cas, la télécommande Com Uni 3 poursuit la recherche à partir du code trouvé en
dernier lieu et non à partir du tout premier code.
Une fois que la télécommande Com Uni 3 a recherché tous les codes, la LED rouge
clignote à cinq reprises et la recherche est interrompue.
La recherche de codes complète fonctionne de façon identique pour la plage
STB et SAT. Les touches « STB » et « SAT » doivent toutefois être activées à la
place de la touche « TV ».
23
F
MODE D´EMPLOI
Com Uni 3 Télécommande universelle
E. Appel de code
MODE D´EMPLOI
Com Uni 3 Télécommande universelle
G. Fonctions spéciales
Lire le code paramétré
1. Appuyez sur la touche « TV » pendant au moins trois secondes jusqu’à ce que la
LED verte clignote deux fois.
2. Saisissez le code 0 0 2 dans un délai de dix secondes. La LED verte clignote alors
à deux reprises.
3. Pour lire le code paramétré, appuyez sur le chiffre « 1 » pour la première position
de code, « 2 » pour la deuxième et « 3 » pour la troisième. Une fois que vous avez
activé un de ces chiffres, comptez la fréquence de clignotement de la LED : celleci correspond au numéro de la position de code.
Attention :
Si la LED ne clignote pas après l’activation des chiffres « 1 », « 2 » ou « 3 », la
position de code correspondante est 0.
Exemple :
• Appuyez sur la touche « 1 » pour la position des centaines. Si la LED clignote p.
ex. trois fois, le numéro de la première position est 3.
• Appuyez sur la touche « 2 » pour la position des dizaines. Si la LED clignote p. ex.
une fois, le numéro de la deuxième position est 1.
• Appuyez sur la touche « 3 » pour la position des unités. Si la LED clignote p. ex.
six fois, le numéro de la dernière position est 6.
Dans le présent exemple, le code est 316.
Nous vous recommandons de noter les codes STB/SAT et TV au cas où vous devriez
ultérieurement reprogrammer votre télécommande Com Uni 3. Les codes paramétrés
sont conservés après le remplacement des piles.
La recherche de codes STB et SAT fonctionne de façon identique à celle des codes
TV. Les touches « STB » et « SAT » doivent toutefois être activées à la place de la
touche « TV ».
Prenez note des codes à 3 chiffres pour les réglages ultérieurs.
STB
SAT
TV
F.
F
Blocage de touches ou de mode
Une fois la programmation correcte effectuée (Plage STB/SAT ou TV), vous avez la
possibilité de verrouiller les touches (protection contre les erreurs de commande).
1. Appuyez sur la touche « TV » pendant au moins trois secondes jusqu’à ce que la
LED verte clignote deux fois.
2. Saisissez le code 0 9 9 dans un délai de dix secondes. La LED verte clignote alors
jGHX[UHSULVHVD¿QGHFRQ¿UPHUODVDLVLH
3. Vous pouvez à présent appuyer sur les différentes touches pour les désactiver (la
/('FOLJQRWHjFKDTXHDFWLYDWLRQGHWRXFKHD¿QGHFRQ¿UPHUODVDLVLH
Remarque : vous pouvez bloquer un mode complet (SAT, TV..) en appuyant sur les
touches de commutation non désirée (STB, SAT ou TV).
4. Après l’activation de la dernière touche, la saisie est achevée via une pression sur
la touche « TV ».
Si aucune touche n’est activée dans un laps de temps de dix secondes, la saisie se
termine automatiquement (la LED rouge clignote à une seule reprise pendant deux
secondes).
Le verrouillage des plages STB et SAT fonctionne de façon identique à la plage TV.
Les touches « STB » et « SAT » doivent toutefois être activées à la place de la touche
« TV ». La fonction « Reset » effacement des réglages (Code 0 0 0) désactive le
verrouillage des touches.
Attention : Le cas échéant, la plage correspondante doit ensuite être de nouveau
programmée.
Les touches suivantes ne font pas l’objet d’un verrouillage :
• Stand-by
• Chiffres 0 à 9
• Curseur
• P+ / P–
• V+ / V–
• Touches de commutation (STB / SAT / TV)
Verrouillage des codes
Une fois la programmation correcte effectuée (Plage STB/SAT ou TV), vous avez la
possibilité de verrouiller cette plage contre une nouvelle programmation.
1. Appuyez sur la touche « TV » pendant au moins trois secondes jusqu’à ce que la
LED verte clignote deux fois.
2. Saisissez le code 0 8 8 dans un délai de dix secondes. La LED verte clignote alors
jGHX[UHSULVHVD¿QGHFRQ¿UPHUODVDLVLH
La plage est à présent verrouillée contre une nouvelle programmation.
Pour supprimer le verrouillage, procédez de façon identique (déverrouillage).
1. Appuyez sur la touche « TV » pendant au moins trois secondes jusqu’à ce que la
LED verte clignote deux fois.
2. Saisissez le code 0 8 8 dans un délai de dix secondes. La LED verte clignote alors
jGHX[UHSULVHVD¿QGHFRQ¿UPHUODVDLVLH
La plage est à présent disponible pour une nouvelle programmation.
Le verrouillage des plages STB et SAT fonctionne de façon identique à la plage TV. Les
touches « STB » et « SAT » doivent toutefois être activées à la place de la touche « TV ».
Reset
Effacement des réglages
Appuyez sur la touche « TV » pendant au moins trois secondes jusqu’à ce que la LED
clignote deux fois. Saisissez ensuite le code 0 0 0. La LED clignote à deux reprises
une fois que le code a été saisi. Après cette opération, la télécommande Com Uni 3
repasse à un nouvel état (état de livraison) dans la plage TV.
L’effacement des codes STB et SAT fonctionne de façon identique à celle des codes
TV. Les touches « STB » et « SAT » doivent toutefois être activées à la place de la
touche « TV ».
24
Fonction volume
En mode SAT et STB, vous avez la possibilité de régler le volume.
1. Appuyez sur la touche SAT ou STB pendant au moins trois secondes, jusqu‘à ce
que la led clignote deux fois.
2. Dans les dix secondes qui suivent, rentrez le code 0 0 4, la LED clignote alors
GHX[IRLVFHTXLFRQ¿UPHOµDFWLYDWLRQGHFHWWHIRQFWLRQ
Pour la désactiver, rentrez le code 0 0 5.
25
I
MANUALE D’USO
MANUALE D’USO
I
Telecomando universale Com Uni 3
Telecomando universale Com Uni 3
La banca dati STB-/SAT-/TV (DB) comprende le seguenti funzioni:
6HULJUD¿D
Funzioni STB e SAT
Funzione TV
LED
Indicazione
modalità
STB
verde
arancione
1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
21
22
23
24
25
26
27
28
29
30
31
32
33
34
35
36
16:9
3
26
Tasto
1
2
3
4
5
6
7
8
9
FAV - / - 0
MENU AV
V+
Ÿ
P+
Ż
OK
Ź
V–
ź
P–
Ɣ
Ɣ
Ɣ
Ɣ
INFO
EPG
EXIT
RECALL
TV / RADIO
LANG
AUDIO
SUB-T
PAUSE
37
STB
38
SAT
39
TV
40
TTX
SAT
rosso
Standby (Acceso/Spento)
1
2
3
4
5
6
7
8
9
FAV
0
Menu
Volume +
Tasto cursore su
Canale +
Tasto cursore sinistro
OK
Tasto cursore destro
Volume –
Tasto cursore giù
Canale –
rosso
verde
giallo
blu
Info
EPG
Mute
Exit
Indietro
TV / Radio
Lingua
Audio
Sub-T
Pause
Commutazione in modalità STB /
tasto programmazione codici STB
(DB)
Commutazione in modalità SAT /
tasto programmazione codici SAT
(DB)
Standby (Acceso/Spento)
1
2
3
4
5
6
7
8
9
-/-0
AV
Volume +
Tasto cursore su
Canale +
Tasto cursore sinistro
OK
Tasto cursore destro
Volume –
Tasto cursore giù
Canale –
rosso
verde
giallo
blu
Info
Zoom +
Mute
Teletext spento
16:9 / Zoom –
Digital / Analog
Ora
Commutazione in modalità
TV / tasto programmazione codici
TV (DB)
Teletext acceso
Teletext acceso
27
I
MANUALE D’USO
Telecomando universale Com Uni 3
Congratulazioni per l’aquisto di questo innovativo telecomando Com Uni 3. È stata
posta particolare attenzione al design ed alla realizzazione del prodotto, onde
garantirne una durata di vita estesa a molti anni in condizioni di normale impiego.
Nelle seguenti pagine viene descritto il corretto utilizzo del vostro telecomando
Com Uni 3. Se tuttavia doveste incontrare dei problemi vi preghiamo di contattare il
vostro rivenditore.
Informazioni generiche sul telecomando Com Uni 3
Il telecomando Com Uni 3 è prevalentemente destinato a sostituire il telecomando del
vostro ricevitore STB o SAT. Da subito potete gestire le funzioni del ricevitore STB ed
in aggiunta le funzioni base di un TV e ricevitore SAT mediante un’unico telecomando.
Se lo desiderate potete pertanto sostituire i telecomandi del vostro ricevitore
digitale terrestre e satellitare, oltre a quello del TV, con il vostro nuovo telecomando
Com Uni 3.
Come lavora il vostro telecomando Com Uni 3?
Le varie frequenze dei segnali infrarossi utilizzate dai diversi produttori di apparecchi
sono state memorizzate quasi interamente nel vostro telecomando ad infrarossi
&RP8QL3HUSRWHUHFRQWUROODUHJOLDSSDUHFFKLGLYRVWUDVFHOWDqSHUWDQWRVXI¿FLHQWH
attivare i dati memorizzati nel vostro telecomando Com Uni 3. L’attivazione avviene
mediante la semplice immissione di un codice a 3 cifre, associato al relativo marchio
e modello di apparecchio. Successivamente il telecomando Com Uni 3 trasmette il
segnale infrarosso nella frequenza corrispondente all’apparecchio selezionato.
La regola dei 10 secondi
Il telecomando Com Uni 3 necessita del vostro aiuto onde potere funzionare con gli
apparecchi da controllare. Vi preghiamo di leggere attentamente il presente manuale
d’uso prima di passare alla programmazione del vostro telecomando Com Uni 3. La
base per la programmazione del vostro telecomando Com Uni 3 è la regola dei 10
secondi. Ogni passo durante la programmazione del telecomando Com Uni 3 deve
essere eseguito entro 10 secondi, altrimenti il telecomando Com Uni 3 torna nella
normale modalità di utilizzo.
Inserimento e cambio batterie
Il vostro telecomando Com Uni 3 viene alimentato attraverso 2 batterie alcaline da
1,5V (IEC LR 03, AAA). Vi consigliamo di utilizzare esclusivamente batterie nuove.
In ogni caso dovreste sempre evitare di mischiare batterie vecchie e nuove, dato
che ciò può compromettere in maniera pesante il corretto funzionamento del vostro
telecomando, oltre a ridurre notevolmente la durata delle batterie stesse.
Da osservare
Inserite le batterie seguendo le relative indicazioni presenti nel vano batterie. Prestate
particolare attenzione alla corretta polarità. Togliete immediatamente le batterie in
caso di fuoriuscita di liquidi! Smaltite le batterie seguendo le indicazioni del relativo
produttore.
Prova di operabilità
Dopo avere inserito le batterie premete un tasto qualsiasi ed assicuratevi che il LED si
illumini. Ciò è la conferma del corretto inserimento delle batterie. Se per una qualsiasi
UDJLRQHLOYRVWURWHOHFRPDQGRQRQUHDJLVFHYHUL¿FDWHORVWDWRGLFDULFDGHOOHEDWWHULH
ed anche il loro corretto inserimento. Se la portata del telecomando dopo un certo
periodo di tempo diminuisce notevolmente, è ora di sostituire le batterie.
Nel vostro telecomando Com Uni 3 è presente una memoria tampone che evita la
perdita dei codici programmati durante il cambio batterie. Dopo il cambio delle batterie
tutti gli apparecchi programmati dovrebbero essere nuovamente pilotabili.
28
I
MANUALE D’USO
Telecomando universale Com Uni 3
A. Descrizione generale del funzionamento
Il telecomando Com Uni 3 supporta tre modalità di utilizzo, la modalità STB ed i livelli
TV e SAT. Mediante i tasti “STB”, “SAT” e “TV” potete commutare tra le rispettive
modalità. Un LED indica la modalità attualmente attiva (verde per STB, rosso per SAT
e arancione per TV). I livelli STB, TV e SAT sono preprogrammati dalla fabbrica.
Livello STB: Ricevitore ID SAT modello TR 2001
Livello SAT: Ricevitore ID SAT modello FREE 1003
Livello TV: Televisori Humax con telecomando NR 101
Livelli STB e SAT
I livelli STB e SAT prevedono le seguenti funzioni:
• Standby
• Numeri da 0 a 9
• Canale +/–
• Volume +/–
• Colori FLOF (rosso, verde, giallo e blu)
• Teletext acceso/spento
• Mute (silenziamento audio)
• Info
• EPG
• List
• Back
• Menu
• Exit
• OK
• Cursore
• TV/Radio
• Recall
• FAV
• LANG
• SUB-T
• Pausa
• Audio
Livello TV
Il livello TV prevede le seguenti funzioni:
• Standby
• Numeri da 0 a 9
• AV
• -/- • Canale +/–
• Volume +/–
• OK
• Cursore
• Colori FLOF (rosso, verde, giallo e blu)
• Teletext acceso
• Teletext spento
• Mute (silenziamento audio)
• 16:9
• Info
29
I
MANUALE D’USO
Telecomando universale Com Uni 3
B. Programmazione dei livelli STB, SAT e TV
1. Inserite 2 nuove batterie alcaline da 1.5V del tipo „AAA/LR 03“. Rispettate la
corretta polarità delle batterie.
2. Accendete il vostro TV.
3. Cercate il produttore del vostro TV nell’elenco codici allegato (p.es. Sony).
$
¿DQFRGHOQRPHGHOSURGXWWRUHWURYHUHWHXQRRSLFRGLFLDFLIUH4XHVWLFRGLFL
devono essere inseriti nel telecomando Com Uni 3, onde abilitarlo alla gestione del
vostro TV.
3UHPHWHLOWDVWR³79´SHUXQPLQLPRGLVHFRQGLHFRPXQTXH¿QRDTXDQGRLO/('
lampeggia verde due volte.
6. Inserite il codice a 3 cifre preso dall’elenco entro 10 sec.
7. Dopo avere inserito il codice, il LED lampeggerà verde due volte per indicare che
la programmazione è avvenuta con successo.
8. Orientate il telecomando Com Uni 3 in direzione del vostro TV e premete il tasto
Standby. Se il vostro TV non risponde al comando, ripetete i passi da 3 ad 8 ed
inserite il codice successivo che trovate nell’elenco.
9. Se il vostro TV si è spento, avete trovato un codice compatibile. Provate adesso
tutte le altre funzioni. Se vari tasti non dovessero funzionare, riprendete dal passo
3 ed utilizzate il codice successivo che trovate nell’elenco.
La procedura di programmazione del livello STB è identica, ma al posto del tasto
“TV” dovete premere il tasto “STB” ed utilizzare i codici che trovate nell’elenco
STB.
La procedura di programmazione del livello SAT è identica, ma al posto del tasto
“TV” dovete premere il tasto “SAT” ed utilizzare i codici che trovate nell’elenco
SAT.
C. Ricerca codice per costruttore/brand
Se mediante la procedura di programmazione descritta nella sezione B non siete
riusciti a trovare un codice compatibile, potete provare la scansione dei codici per
costruttore.
1. Assicuratevi che il telecomando Com Uni 3 sia dotato di batterie cariche.
2. Accendete il vostro TV.
3
UHPHWHLOWDVWR³79´SHUXQPLQLPRGLVHFRQGLHFRPXQTXH¿QRDTXDQGRLO/('
lampeggia verde due volte.
4. Inserite il codice 0 0 3 entro 10 secondi. Il LED successivamente lampeggerà
verde 2 volte.
5. Inserite il codice a 3 cifre relativo al costruttore (brand) del TV. Se il codice è stato
inserito correttamente il LED lampeggerà verde due volte, in caso contrario si
illuminerà di rosso e rimarrà acceso per 2 sec.
3
UHPHWHHWHQHWHSUHPXWRLOWDVWR³6WDQGE\´¿QRDTXDQGRLOYRVWUR79VLVSHJQH
Se rilasciate il tasto “Standby” la ricerca viene fermata e potete provare anche
le altre funzioni. Se nessun tasto viene premuto entro 5 sec., la ricerca viene
interrotta ed il telecomando Com Uni 3 torna nella modalità di normale utilizzo. Ciò
viene segnalato dal LED, che si illumina di rosso per 2 secondi.
Se il vostro TV entra in modalità di Standby durante la ricerca, rilasciate
immediatamente il tasto Standby e premete il tasto “OK” per memorizzare il codice
trovato. Il LED successivamente lampeggerà verde due volte.
30
I
MANUALE D’USO
Telecomando universale Com Uni 3
7. Può capitare che durante la ricerca codice per costruttore il telecomando
Com Uni 3 trovi vari codici ai quali il vostro TV risponde, ma che non tutti i tasti
funzionino correttamente con ciascuno dei codici. In questo caso dovreste
ULSUHQGHUHODULFHUFDFRGLFHSHUPDUFKLRSDVVLGDD¿QRDTXDQGRWURYDWHLO
codice migliore.
Se il telecomando Com Uni 3 ha passato tutti i codici relativi al costruttore del vostro
apparecchio, il LED lampeggia rosso per 5 volte e la ricerca viene terminata.
La procedura di ricerca codice per costruttore/brand dei livelli STB e SAT è
identica, ma al posto del tasto “TV” dovete premere rispettivamente il tasto
“STB” o “SAT” ed utilizzare i codici che trovate nei relativi elenchi costruttori
STB/SAT.
D. Ricerca codice con scansione di tutti i codici
Se mediante le procedure descritte nelle sezioni B e C non siete riusciti a trovare un
codice compatibile, potete provare la scansione di tutti i codici.
1. Assicuratevi che il telecomando Com Uni 3 sia dotato di batterie cariche.
2. Accendete il vostro TV.
3UHPHWHLOWDVWR³79´SHUXQPLQLPRGLVHFRQGLHFRPXQTXH¿QRDTXDQGRLO/('
lampeggia verde due volte.
4. Inserite il codice 0 0 1 entro 10 secondi. Il LED successivamente lampeggerà
verde 2 volte.
3UHPHWHHWHQHWHSUHPXWRLOWDVWR³6WDQGE\´¿QRDTXDQGRLOYRVWUR79VLVSHJQH
9LSUHJKLDPRGLRVVHUYDUHFKHTXHVWDSURFHGXUDSXzGXUDUH¿QRDPLQXWL6H
nessun tasto viene premuto entro 10 sec., la ricerca viene interrotta ed il LED
si illumina di rosso per 2 secondi. Se il vostro TV entra in modalità di Standby
durante la ricerca, rilasciate immediatamente il tasto Standby e premete il tasto
“OK” per memorizzare il codice trovato. Il LED successivamente lampeggerà due
volte.
6. Se alcuni tasti non dovessero funzionare correttamente, dovete riprendere la
ULFHUFDFRGLFHSDVVLGDD¿QRDTXDQGRWURYDWHXQFRGLFHPLJOLRUH9L
preghiamo di notare che in questo caso la telecomando Com Uni 3 riprende la
ricerca dall’ultimo codice trovato e non inizia dal primissimo codice.
Se il telecomando Com Uni 3 ha passato tutti i codici relativi al costruttore del vostro
apparecchio, il LED lampeggia rosso per 5 volte e la ricerca viene terminata.
La procedura di ricerca codice con scansione di tutti i codici dei livelli STB e
SAT è identica, ma al posto del tasto “TV” dovete premere rispettivamente il
tasto “STB” o “SAT”.
31
I
MANUALE D’USO
Telecomando universale Com Uni 3
E. Richiamo codice
MANUALE D’USO
Telecomando universale Com Uni 3
G. Funzioni speciali
Lettura del codice impostato
3
UHPHWHLOWDVWR³79´SHUXQPLQLPRGLVHFRQGLHFRPXQTXH¿QRDTXDQGRLO/('
lampeggia verde due volte.
2. Inserite il codice 0 0 2 entro 10 secondi. Il LED successivamente lampeggerà
verde per 2 volte.
3. Per la lettura del codice impostato premete il tasto numerico “1” per leggere la
prima cifra che compone il codice, “2” per la seconda e “3” per la terza. Dopo
avere premuto uno dei tasti numerici contate il numero di lampeggi del LED, che a
sua volta corrisponde alla relativa cifra del codice.
Attenzione:
Se il LED non lampeggia dopo che avete premuto i tasti numerici “1”, “2” o “3”, la cifra
corrispondente è 0.
Esempio:
• Premete il tasto “1” per le centinaia. Se il LED ad esempio lampeggia 3 volte, la
prima cifra del codice è 3.
• Premete il tasto “2” per le decine. Se il LED ad esempio lampeggia 1 volta, la
seconda cifra del codice è 1.
• Premete il tasto “3” per le unità. Se il LED ad esempio lampeggia 6 volta, la terza
cifra del codice è 6.
In questo esempio il codice è 316.
Vi consigliamo di annotarvi i codici per STB/SAT e TV, in quanto vi potranno servire
per riprogrammare il vostro telecomando Com Uni 3.
I codici impostati rimangono comunque memorizzati anche dopo il cambio delle
batterie.
La lettura codici dei livelli STB e SAT è identica, ma al posto del tasto “TV” dovete
premere rispettivamente il tasto “STB” o “SAT”.
Annotatevi quì i codici a 3 cifre per future impostazioni.
STB
SAT
TV
F.
I
Reset
Cancellazione delle impostazioni
3UHPHWHLOWDVWR³79´SHUDOPHQRVHFRQGLHFRPXQTXH¿QRDTXDQGRLO/('
lampeggia due volte. Inserite successivamente il codice 0 0 0. Il LED lampeggerà 2
volte. Dopo l’esecuzione di questa operazione il livello TV del telecomando Com Uni 3
verrà riportato allo stato di fabbrica.
La lettura codici dei livelli STB e SAT è identica, ma al posto del tasto “TV” dovete
premere rispettivamente il tasto “STB” o “SAT”.
32
Blocco di tasti e livelli
Dopo avere programmato correttamente il telecomando (livelli STB/SAT e TV) potete
bloccare determinati tasti (protezione contro utilizzo errato).
3
UHPHWHLOWDVWR³79´SHUXQPLQLPRGLVHFRQGL¿QRDTXDQGRLO/('ODPSHJJLD
verde due volte.
2. Inserite il codice 0 9 9 entro 10 secondi. Il LED successivamente lampeggerà
verde per 2 volte.
3. Adesso potete premere i tasti che intendete disattivare (il LED emette un
lampeggio di conferma ad ogni pressione di un tasto).
Avviso: Avete la possbilità di bloccare un intero livello, premendo il relativo tasto di
selezione (STB, SAT o TV).
4. Dopo avere premuto l’ultimo tasto da disattivare, premete il tasto “TV” per
terminare l’operazione di blocco singoli tasti.
Se nessun tasto viene premuto entro 10 sec., l’operazione viene terminata
automaticamente (il LED si illumina di rosso per 2 secondi).
L’operazione di blocco singoli tasti dei livelli STB e SAT è identica, ma al posto del
tasto “TV” dovete premere rispettivamente il tasto “STB” o “SAT”.
Con la funzione “Reset” Cancellazione delle impostazioni (codice 0 0 0) potete
annullare il blocco dei tasti.
ATTENZIONE: Successivamente il relativo livello deve eventualmente essere
riprogrammato.
I seguenti tasti sono esclusi dal blocco singoli tasti:
• Standby
•
Numeri da 0 a 9
• Cursore
•
P+ / P–
• V+ / V–
•
Tasti selezione livello (STB / SAT / TV)
Blocco codice
Dopo avere programmato correttamente il telecomando (livelli STB/SAT e TV) potete
bloccare la programmazione per il livello attivo.
3UHPHWHLOWDVWR³79´SHUXQPLQLPRGLVHFRQGL¿QRDTXDQGRLO/('ODPSHJJLD
verde due volte.
2. Inserite il codice 0 8 8 entro 10 secondi. Il LED successivamente lampeggerà
verde per 2 volte.
Adesso il livello è bloccato per la programmazione.
Per togliere il blocco dovete agire nella stessa maniera (sblocco).
3UHPHWHLOWDVWR³79´SHUXQPLQLPRGLVHFRQGL¿QRDTXDQGRLO/('ODPSHJJLD
verde due volte.
2. Inserite il codice 0 8 8 entro 10 secondi. Il LED successivamente lampeggerà
verde per 2 volte.
Adesso il livello è sbloccato e può essere nuovamente programmato.
L’operazione di blocco dei livelli STB e SAT è identica, ma al posto del tasto “TV”
dovete premere rispettivamente il tasto “STB” o “SAT”.
Funzione di regolazione volume
Avete la possibilità di regolare il volume del vostro TV anche quando vi trovate nei
livelli SAT e STB.
3UHPHWHLOWDVWR³6$7R67%´SHUDOPHQRVHFRQGL¿QRDTXDQGRLO/('
lampeggia due volte.
2. Inserite il codice 0 0 4 entro 10 secondi. Il LED emetterà due lampeggi a conferma
dell’attivazione della funzione.
Inserite il codice 0 0 5 per distattivare questa funzione.
33
E
INSTRUCCIONES DE USO
INSTRUCCIONES DE USO
E
Mando a distancia universal Com Uni 3
Mando a distancia universal Com Uni 3
La base de datos STB (TDT)/SAT/TV (DB) contiene las siguientes funciones:
Tecla
Inscripción
Funciones STB (TDT) y SAT
Función TV
LED
Indicación de
función
STB (TDT)
verde
naranja
1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
21
22
23
24
25
26
27
28
29
30
31
32
33
34
35
36
16:9
1
2
3
4
5
6
7
8
9
FAV - / - 0
MENU AV
V+
Ÿ
P+
Ż
OK
Ź
V–
ź
P–
Ɣ
Ɣ
Ɣ
Ɣ
INFO
EPG
EXIT
RECALL
TV / RADIO
LANG
AUDIO
SUB-T
PAUSE
37
STB
38
SAT
39
TV
40
TTX
3
34
SAT
rojo
Standby (Encendido/Apagado)
1
2
3
4
5
6
7
8
9
FAV
0
Menú
Volumen +
Cursor arriba
Canal +
Cursor izquierda
OK
Cursor derecha
Volumen –
Cursor abajo
Canal –
rojo
verde
amarillo
azul
Info
EPG
Enmudecimiento
Exit
Atrás
TV / Radio
Idioma
Audio
Sub-T
Pause
Conmutación a modo STB (TDT)
y tecla de programación de códigos
STB (DB)
Conmutación a modo SAT y tecla de
programación de códigos SAT (DB)
Standby (Encendido/Apagado)
1
2
3
4
5
6
7
8
9
-/-0
AV
Volumen +
Cursor arriba
Canal +
Cursor izquierda
OK
Cursor derecha
Volumen –
Cursor abajo
Canal –
rojo
verde
amarillo
azul
Info
Zoom +
Enmudecimiento
Teletexto desactivado
16:9 / Zoom –
Digital / analógico
hora
Conmutación a modo TV y tecla de
programación de códigos TV (DB)
Teletexto activado
Teletexto activado
35
E
INSTRUCCIONES DE USO
Mando a distancia universal Com Uni 3
Muchas felicidades por la compra del nuevo mando a distancia Com Uni 3. Durante
el diseño y la producción de este producto se ha procedido con un gran esmero
y, con un uso normal, el mando a distancia Com Uni 3 le va a durar muchos años
ofreciéndole todos sus servicios. En las siguientes páginas se describe la mejor
manera de utilizar el mando a distancia Com Uni 3. En caso de que surgieran
problemas, póngase en contacto con el establecimiento especializado.
Aspectos básicos del mando a distancia Com Uni 3
El mando a distancia Com Uni 3 está destinado principalmente para sustituir el mando
a distancia de su receptor de televisión digital terrestre o el receptor de satélite. Desde
ahora mismo puede controlar las funciones del receptor de televisión digital terrestre
y también las funciones básicas de un televisor así como de un receptor de satélite
con un único mando a distancia. Por tanto, si lo desea, puede sustituir los mandos a
distancia originales de su receptor de televisión digital terrestre y de su receptor de
satélite, así como del televisor por este nuevo mando a distancia Com Uni 3.
¿Cómo funciona el mando a distancia Com Uni 3?
Hemos almacenado en el mando a distancia Com Uni 3 prácticamente todas las
frecuencias de señales de infrarrojos utilizadas por los distintos fabricantes. Para
controlar los aparatos que ha seleccionado, sólo necesita activar los datos ya
almacenados en el mando a distancia Com Uni 3. La activación tiene lugar mediante
la simple introducción de un código numérico de 3 cifras asignado a cada marca y a
cada aparato, con lo cual su mando a distancia Com Uni 3 ya puede enviar la señal
de infrarrojos saliente en la frecuencia correcta para el aparato seleccionado.
La regla de los 10 segundos
El mando a distancia Com Uni 3 necesita su ayuda para hacer funcionar los aparatos
que se desean controlar. Lea atentamente estas instrucciones de uso antes de
FRQ¿JXUDUHOPDQGRDGLVWDQFLD&RP8QL/DEDVHSDUDSURJUDPDUHOPDQGRD
distancia Com Uni 3 es la regla de los 10 segundos. Cada paso de ajuste en el
PDQGRDGLVWDQFLD&RP8QLGHEH¿QDOL]DUVHHQPHQRVGHVHJXQGRVSXHVGHOR
contrario el mando a distancia Com Uni 3 pasa al modo de funcionamiento normal.
Inserción y cambio de las pilas
El mando a distancia Com Uni 3 funciona con dos pilas alcalinas de 1,5 V (IEC LR 03,
AAA). Le recomendamos que sólo utilice pilas nuevas. En cualquier caso, no combine
nunca pilas nuevas con viejas, ya que el rendimiento del mando a distancia puede
verse afectado fuertemente y, en consecuencia, acortar de manera considerable la
vida útil de las pilas.
Atención:
Introduzca las pilas en el compartimento de las pilas según la marca indicada.
Asegúrese de que la polaridad es correcta. ¡Retire inmediatamente las pilas que
pudieran haberse gastado! Elimine las pilas usadas conforme a las indicaciones del
fabricante.
Prueba de funcionamiento
Una vez introducidas las pilas, pulse una tecla y compruebe si el diodo luminoso
YHUGHVHHQFLHQGH(VWRHVODFRQ¿UPDFLyQGHTXHODVSLODVVHKDQLQWURGXFLGR
correctamente. En caso de que el mando a distancia, por cualquier motivo, no
reaccionara, compruebe el estado de las pilas y también si realmente se han
introducido de forma correcta. Si después de cierto tiempo el alcance de emisión del
mando a distancia se acorta considerablemente, es tiempo de cambiar las pilas.
El mando a distancia Com Uni 3 lleva incorporada una memoria intermedia que evita
que los códigos programados se pierdan mientras se cambian las pilas. Después de
cambiar las pilas, los aparatos programados deberían volver a funcionar.
36
E
INSTRUCCIONES DE USO
Mando a distancia universal Com Uni 3
A. Descripción general del funcionamiento
El mando a distancia Com Uni 3 tiene tres modos de funcionamiento: STB (TDT), SAT
y TV. Con las teclas „STB“, „SAT“ y „TV“ se puede conmutar entre los distintos tipos
de funcionamiento. Al mismo tiempo, un LED indica el modo activado (verde para STB
(TDT), rojo para SAT y naranja para TV). Los niveles de STB (TDT), TV y SAT están
preprogramados de fábrica.
Niveles STB (TDT) y SAT
Los niveles STB (TDT) y SAT contienen las siguientes funciones:
• Standby
• Cifras del 0 al 9
• Canal +/–
• Volumen +/–
• Colores FLOF (rojo, verde, amarillo y azul)
• Teletexto activado/desactivado
• Mute (enmudecimiento)
• Info
• EPG
• Lista
• Atrás
• Menú
• Exit
• OK
• Cursor
• TV/Radio
• Recall
• FAV
• LANG
• SUB-T
• Pause
• Audio
Nivel TV
El nivel TV contiene las siguientes funciones:
• Standby
• Cifras del 0 al 9
• AV
• -/- • Canal +/–
• Volumen +/–
• OK
• Cursor
• Colores FLOF (rojo, verde, amarillo y azul)
• Teletexto activado
• Teletexto desactivado
• (Mute) enmudecimiento
• 16:9
• Info
37
E
INSTRUCCIONES DE USO
Mando a distancia universal Com Uni 3
B. Programación de los niveles STB (TDT), SAT y TV
1. Introduzca dos pilas alcalinas nuevas de 1,5 V del tipo „AAA/LR 03“. Asegúrese de
que la polaridad de las pilas es correcta.
2. Encienda el aparato de TV.
3. Busque en la lista de códigos suministrada el fabricante de su aparato de TV (p.
ej. Sony).
- XQWRDOQRPEUHGHOIDEULFDQWH¿JXUDXQRRYDULRVFyGLJRVGHWUHVFLIUDV(VWH
código se debe introducir siguiendo las siguientes instrucciones para que pueda
controlar su aparato de TV con el mando a distancia Com Uni 3.
5. Mantenga pulsada la tecla „TV“ al menos tres segundos hasta que el LED verde
parpadee dos veces.
6. Introduzca dentro de los diez segundos siguientes el código de tres cifras.
7. Si el código se ha introducido correctamente, el LED verde parpadea dos veces
para indicar que la programación se ha realizado con éxito
8. Apunte ahora con el mando a distancia Com Uni 3 hacia su aparato de TV y pulse
la tecla Standby. Si el aparato de TV no reacciona, repita los pasos 3 hasta 8 con
el siguiente código del fabricante de su televisor en la lista.
9. Si el aparato de TV se ha desconectado, habrá encontrado el código adecuado.
Compruebe a continuación todas las demás funciones. Si hubiera teclas que no
funcionaran, comience de nuevo en el punto 3 y marque el siguiente código del
fabricante de su aparato de TV en la lista.
La programación del nivel STB (TDT) funciona igual, aunque en lugar de la tecla
„TV“ se pulsa la tecla „STB“ y se utilizan los códigos de la lista STB (TDT).
La programación del nivel SAT funciona igual, aunque en lugar de la tecla „TV“
se pulsa la tecla „SAT“ y se utilizan los códigos de la lista SAT.
C. Búsqueda de fabricante/marca
Si con el procedimiento descrito en el apartado B no encuentra ningún código
adecuado, podrá buscar el código con la búsqueda por fabricante.
1. Asegúrese de que se hayan introducido pilas nuevas en el mando a distancia
Com Uni 3.
2. Encienda el aparato de TV.
3. Mantenga pulsada la tecla „TV“ al menos tres segundos hasta que el LED verde
parpadee dos veces.
4. Introduzca dentro de los siguientes diez segundos el código 0 0 3, el LED verde
parpadeará dos veces a continuación.
5. Introduzca dentro de los diez segundos siguientes el código de tres cifras del
fabricante (marca) del aparato de TV. Si se ha introducido correctamente el
código, el LED verde parpadea dos veces, en caso contrario, el LED se enciende
una vez en rojo durante dos segundos.
6. Mantenga pulsada la tecla Standby hasta que el aparato de TV se desconecte.
Si suelta la tecla Standby, se detiene la búsqueda y podrá comprobar también
las otras funciones. Si durante cincos segundos no se pulsa ninguna tecla, se
LQWHUUXPSHODE~VTXHGD\HOPDQGRDGLVWDQFLD&RP8QLUHJUHVDDOQLYHOQRUPDO
el LED se enciende en rojo una vez durante dos segundos. Si el aparato de TV
se desconecta durante la búsqueda automática, suelte inmediatamente la tecla
Standby y pulse „OK“ para que se guarde el ajuste encontrado. El LED parpadea
seguidamente dos veces en verde.
38
E
INSTRUCCIONES DE USO
Mando a distancia universal Com Uni 3
7. Puede ocurrir que el mando a distancia Com Uni 3 encuentre varios códigos
durante la búsqueda con los que su aparato de TV reaccione, pero no funcionen
todas las teclas con cada código. En ese caso debe iniciar de nuevo la búsqueda
(pasos 2 hasta 6) hasta que haya encontrado el código más apropiado.
Una vez el mando a distancia Com Uni 3 ha examinado todos los códigos disponibles
para el fabricante de su aparato, el LED parpadea cinco veces en rojo y se interrumpe
la búsqueda.
La búsqueda de fabricante/marca del nivel STB (TDT) y SAT funciona igual,
aunque se debe pulsar la tecla „STB“ en lugar de „TV“ o la tecla „SAT“ para SAT
y utilizar los códigos de la lista de marcas STB (TDT)/SAT.
D. Búsqueda completa de códigos
Si con los procedimientos descritos en el apartado B y C no encuentra ningún código
adecuado para su aparato, proceda a ejecutar la búsqueda completa de códigos.
1. Asegúrese de que se hayan introducido pilas nuevas en el mando a distancia
Com Uni 3.
2. Encienda el aparato de TV.
3. Mantenga pulsada la tecla „TV“ al menos tres segundos hasta que el LED verde
parpadee dos veces.
4. Introduzca dentro de los siguientes diez segundos el código 0 0 1, el LED verde
parpadeará dos veces a continuación.
5. Mantenga pulsada la tecla Standby hasta que el aparato de TV se desconecte.
Tenga en cuenta que este proceso puede durar hasta diez minutos. Si dentro de
diez segundos no se pulsa ninguna tecla, se interrumpirá la búsqueda y el LED se
encenderá en rojo una vez durante dos segundos.
Si el aparato de TV se desconecta durante la búsqueda automática, suelte
inmediatamente la tecla Standby y pulse „OK“ para que se guarde el ajuste
encontrado. El LED parpadea seguidamente dos veces.
6. Si hubiera teclas que no funcionaran, inicie de nuevo la búsqueda (pasos 2
hasta 5) hasta que encuentre un código mejor. Tenga en cuenta que en ese
caso el mando a distancia Com Uni 3 continúa la búsqueda en el último código
encontrado y no en el primer código de todos.
Una vez el mando a distancia Com Uni 3 ha examinado todos los códigos, el LED
parpadea cinco veces en rojo y se interrumpe la búsqueda.
La búsqueda completa de código funciona igual para los niveles de STB (TDT) y
SAT, aunque en lugar de la tecla „TV“ se pulsa la tecla „STB“ y para SAT la tecla
„SAT“.
39
E
INSTRUCCIONES DE USO
Mando a distancia universal Com Uni 3
E. Consulta de código
E
INSTRUCCIONES DE USO
Mando a distancia universal Com Uni 3
G. Funciones especiales
Leer el código ajustado
1. Mantenga pulsada la tecla „TV“ al menos tres segundos hasta que el LED verde
parpadee dos veces.
2. Introduzca dentro de los siguientes diez segundos el código 0 0 2, el LED verde
parpadeará dos veces a continuación.
3. Para leer el código ajustado, pulse la cifra „1“ para leer la primera cifra del código,
„2“ para la segunda y „3“ para la tercera. Una vez ha pulsado una de estas
cifras, cuente con qué frecuencia parpadea el LED, lo cual indicará el número
correspondiente a cada posición del código de 3 cifras.
Atención:
Si el LED no parpadea después de que haya pulsado cualquiera de las cifras „1“, „2“ ó
„3“, esto indica que el número correspondiente a la posición del código seleccionada
es el 0.
Ejemplo:
• Pulse la tecla „1“ para la posición de las centenas. Si por ejemplo el LED parpadea
tres veces la primera posición es 3.
• Pulse la tecla „2“ para la posición de las decenas. Si por ejemplo el LED parpadea
una vez la segunda posición es 1.
• Pulse la tecla „3“ para la posición de las unidades. Si por ejemplo el LED parpadea
seis veces la última posición es 6.
En este ejemplo el código es 316.
Bloqueo de teclas o funciones
Tras la programación correcta (niveles STB (TDT)/SAT o TV) puede bloquear
determinadas teclas (protección contra un manejo equivocado).
1. Mantenga pulsada la tecla „TV“ al menos tres segundos hasta que el LED verde
parpadee dos veces.
2. Introduzca dentro de los siguientes diez segundos el código 0 9 9, el LED verde
SDUSDGHDUiGRVYHFHVDFRQWLQXDFLyQSDUDFRQ¿UPDUODHQWUDGD
3. Para desactivar/bloquear la tecla deseada simplemente tiene que pulsarla
HO/('VHHQFLHQGHFRQFDGDDFFLRQDPLHQWRGHODVWHFODVSDUDFRQ¿UPDUVX
desactivación).
Nota : se puede bloquear una función entera (SAT, TV..) pulsando las teclas de
conmutación no requeridas (STB, SAT ou TV).
4. Para cancelar el modo de desactivación de teclas, pulse la tecla „TV“.
Si dentro de diez segundos no se pulsa ninguna tecla, se cerrará automáticamente la
entrada (el LED se encenderá en rojo una vez durante dos segundos).
El bloqueo de teclas individual para STB (TDT) y SAT funciona igual que para TV,
aunque en lugar de la tecla „TV“ se pulsa la tecla „STB“ y para SAT la tecla „SAT“.
Con la función Ä5HVHW³%RUUDUFRQ¿JXUDFLyQFyGLJR se anula el bloqueo de
teclas.
Atención: seguidamente se tiene que programar de nuevo el nivel correspondiente si
fuera necesario.
Le recomendamos que anote los códigos de STB (TDT)/SAT y TV para el caso de que
en un futuro tenga que volver a programar el mando a distancia Com Uni 3. El código
introducido permanece almacenado incluso durante el proceso de cambio de pilas, sin
riesgo de desprogramación del mando a distancia!
Las siguientes teclas están excluidas del bloqueo de teclas:
• Standby
• Cifras del 0 al 9
• Cursor
• P+ / P–
• V+ / V–
• Teclas de conmutación – STB (TDT) / SAT / TV
La consulta de códigos para los niveles STB (TDT) y SAT funciona igual que para TV,
aunque en lugar de la tecla „TV“ se pulsa la tecla „STB“ y para SAT la tecla „SAT“.
Bloqueo de código
Tras la programación correcta – niveles STB (TDT)/SAT o TV – puede bloquear este
nivel para evitar la desprogramación del código introducido, por error.
1. Mantenga pulsada la tecla „TV“ al menos tres segundos hasta que el LED verde
parpadee dos veces.
2. Introduzca dentro de los siguientes diez segundos el código 0 8 8, el LED verde
SDUSDGHDUiGRVYHFHVDFRQWLQXDFLyQSDUDFRQ¿UPDUODHQWUDGD
Este nivel se encuentra ahora bloqueado contra una desprogramación.
Anote los números de los códigos de 3 cifras para ajustes futuros.
STB (TDT)
SAT
TV
F.
Para anular el bloqueo, proceda de la misma manera (desbloquear).
1. Mantenga pulsada la tecla „TV“ al menos tres segundos hasta que el LED verde
parpadee dos veces.
2. Introduzca dentro de los siguientes diez segundos el código 0 8 8, el LED verde
SDUSDGHDUiGRVYHFHVDFRQWLQXDFLyQSDUDFRQ¿UPDUODHQWUDGD
Este nivel se encuentra ahora libre para una nueva programación.
El bloqueo para STB (TDT) y SAT funciona igual que para TV, aunque en lugar de la
tecla „TV“ se pulsa la tecla „STB“ y para SAT la tecla „SAT“.
Reset
%RUUDUFRQ¿JXUDFLyQ
Mantenga pulsada la tecla „TV“ al menos tres segundos hasta que el LED parpadee
dos veces. Introduzca a continuación el código 0 0 0. El LED parpadea dos veces
cuando se ha introducido el código. Tras este proceso, el mando a distancia
Com Uni 3 regresa al nivel TV original (estado de entrega).
El borrado para los niveles de STB (TDT) y SAT funciona igual que para TV, aunque
en lugar de la tecla „TV“ se pulsa la tecla „STB“ y para SAT la tecla „SAT“.
40
Ajustar el volumen
En posición SAT y STB, tenemos la posibilidad de ajustar el volumen.
1. pulse la tecla SAT o STB durante tres segundos, hasta que el led parpadee dos
veces.
2. En los próximos diez segundos entre el código 0 0 4, el LED parpadea dos veces,
SDUDFRQ¿UPDUODDFWLYDFLyQ
Para desactivar esta función, entre el código 0 0 5.
41
NL
GEBRUIKSAANWIJZING
GEBRUIKSAANWIJZING
NL
Com Uni 3 Universele afstandsbediening
Com Uni 3 Universele afstandsbediening
De STB-/SAT-/TV-databank (DB) bevat de volgende functies:
Opdruk
STB- en SAT-functie
TV-functie
LED
Modusaanduiding
STB
groen
oranje
1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
21
22
23
24
25
26
27
28
29
30
31
32
33
34
35
36
16:9
3
42
Toets
1
2
3
4
5
6
7
8
9
FAV - / - 0
MENU AV
V+
Ÿ
P+
Ż
OK
Ź
V–
ź
P–
Ɣ
Ɣ
Ɣ
Ɣ
INFO
EPG
EXIT
RECALL
TV / RADIO
LANG
AUDIO
SUB-T
PAUSE
37
STB
38
SAT
39
TV
40
TTX
SAT
rood
Standby (aan/uit)
1
2
3
4
5
6
7
8
9
FAV
0
Menü
Volume +
Cursor omhoog
Programma +
Cursor links
OK
Cursor rechts
Volume –
Cursor naar beneden
Programma –
rood
groen
geel
blauw
Info
EPG
Mute
Exit
Terug
TV / Radio
Taal
Audio
Sub-T
Pauze
Omschakeling: op STB-mode en
programmeertoets STB-codes (DB)
Omschakeling: op SAT-mode en
programmeertoets SAT codes (DB)
Standby (aan/uit)
1
2
3
4
5
6
7
8
9
-/-0
AV
Volume +
Cursor omhoog
Programma +
Cursor links
OK
Cursor rechts
Volume –
Cursor naar beneden
Programma –
rood
groen
geel
blauw
Info
Zoom +
Mute
Teletext uit
16:9 / Zoom –
Digitaal/Analoog
Klok
Omschakeling: op TV-mode en
programmeertoets TV-codes (DB)
Teletext aan
Teletext aan
43
NL
GEBRUIKSAANWIJZING
Com Uni 3 Universele afstandsbediening
Van harte geluk gewenst met de aankoop van de nieuwe Com Uni 3 afstandsbediening.
Bij het design en bij het produceren van dit product is met de grootste zorgvuldigheid
te werk gegaan, en bij normaal gebruik zal de Com Uni 3 afstandsbediening vele jaren
tot uw volle tevredenheid dienst doen. Op de volgende bladzijden staat beschreven,
hoe u uw Com Uni 3 afstandsbediening het beste kunt gebruiken. Mochten zich toch
problemen voordoen, neemt u dan contact op met uw leverancier.
Elementaire informatie over de Com Uni 3 afstandsbediening
De Com Uni 3 afstandsbediening is in de eerste plaats bedoeld als vervanging voor
de afstandsbediening van uw STB- of SAT-ontvanger. Vanaf nu kunt u de functies
van de STB-ontvanger en daarbij ook nog de basisfuncties van een TV-toestel en een
SAT-ontvanger met slechts één enkele afstandsbediening besturen. Als u dat dus wilt,
kunt u de originele afstandsbedieningen van uw digitale aardse en satellietontvanger
en die van het TV-toestel/ de SAT-ontvanger vervangen door uw nieuwe Com Uni 3
afstandsbediening.
Hoe werkt uw Com Uni 3 afstandsbediening?
De door de verschillende producenten verschillend gebruikte frequenties van
de infraroodsignalen hebben wij nagenoeg compleet in uw Com Uni 3 infraroodafstandsbediening opgeslagen. Voor de besturing van de door u gekozen apparaten
behoeft u de in uw Com Uni 3 afstandsbediening reeds opgeslagen data alleen nog
maar te activeren. Deze activering gebeurt door het simpelweg intoetsen van een
code van 3 cijfers, die is toegekend aan het betreffende merk en het betreffende
toestel, en dan zendt uw Com Uni 3 afstandsbediening het uitgaande infraroodsignaal
in de juiste frequentie voor het gekozen toestel.
De 10-secondenregel
De Com Uni 3 afstandsbediening heeft uw hulp nodig, om te werken voor de te
bedienen apparaten. Leest u voor het instellen van de Com Uni 3 afstandsbediening
deze gebruiksaanwijzing s.v.p. zorgvuldig door. De basis voor het programmeren van
uw Com Uni 3 afstandsbediening is de 10-secondenregel. Iedere stap in de instelling
van uw Com Uni 3 afstandsbediening moet binnen 10 seconden afgesloten zijn,
want anders wordt uw Com Uni 3 afstandsbediening in de normale bedieningsmodus
teruggezet.
Plaatsen en vervangen van de batterijen
Uw Com Uni 3 afstandsbediening wordt gevoed door twee 1,5-Volts-alkalinebatterijen
(IEC LR 03, AAA). Wij adviseren u om alleen nieuwe batterijen te gebruiken. In
ieder geval mag u nooit oude en nieuwe batterijen door elkaar gebruiken, omdat dat
het vermogen van uw afstandsbediening sterk kan beïnvloeden en bovendien de
levensduur van de batterijen aanzienlijk verkort.
Attentie s.v.p.
Zet de batterijen erin overeenkomstig de in het batterijvak aangegeven markering. Let
vooral op de juistheid van de poling. Verwijder meteen eventueel uitlopende batterijen!
Verwijder de oude batterijen volgens de aanwijzingen van de betreffende producent.
Test voor het bedrijfsklaar zijn
Nadat u de batterijen erin heeft gezet kunt u een toets indrukken en controleren of de
groene lichtdiode gaat branden. Dat is de bevestiging dat de batterijen er goed zijn
ingezet. Als uw afstandsbediening om een of andere reden niet reageert, moet de
toestand van de batterijen controleren en ook, of die er echt goed zijn ingezet. Als na
enige tijd de zendradius van uw afstandsbediening aanzienlijk minder wordt, is het tijd
om de batterijen te vervangen.
In uw Com Uni 3 afstandsbediening is een tussengeheugen ingebouwd, dat voorkomt
dat tijdens het vervangen van de batterijen de ingeprogrammeerde codes verloren
gaan. Na het vervangen van de batterijen moeten alle geprogrammeerde apparaten
weer functioneren.
44
NL
GEBRUIKSAANWIJZING
Com Uni 3 Universele afstandsbediening
A. Algemene beschrijving van de werking
De Com Uni 3 afstandsbediening heeft drie modi, de STB-modus en een SAT- en
een TV-level. Met de toetsen „STB“, „SAT“ en „TV“ kunt u omschakelen tussen de
betreffende modi. Een LED geeft daarbij de geactiveerde modus aan (groen voor
STB, rood voor SAT en oranje voor TV). De STB-, TV- en SAT-levels zijn af fabriek
voorgeprogrammeerd.
STB en SAT-level
Het STB- en SAT-level heeft de volgende functies:
• Standby
• Cijfers 0 tot 9
• Kanaal +/–
• Geluidssterkte +/–
• FLOF-kleuren (rood, groen, geel en blauw)
• Teletext aan/uit
• Mute (uitschakelen geluid)
• Info
• EPG
• List
• Terug
• Menu
• Exit
• OK
• Cursor
• TV/Radio
• Recall
• FAV
• LANG
• SUB-T
• Pauze
• Audio
TV-level
Het TV-level heeft de volgende functies:
• Standby
• Cijfers 0 tot 9
• AV
• -/- • Kanaal +/–
• Geluidssterkte +/–
• OK
• Cursor
• FLOF-kleuren (rood, groen, geel en blauw)
• Teletext aan
• Teletext uit
• Mute (uitschakelen geluid)
• 16:9
• Info
45
NL
GEBRUIKSAANWIJZING
Com Uni 3 Universele afstandsbediening
B. Programmeren van het STB-, SAT- en TV-level
1. Zet twee er nieuwe 1,5-V-alkalinebatterijen van het type „AAA/LR 03“ in. Let
daarbij op de juiste poling van de batterijen.
2. Schakel uw TV-toestel in.
3. Zoek in de bijgeleverde codelijst naar de producent van uw TV-apparaat (b.v.
Sony).
4. Naast de naam van de producent staan er een of meer driecijferige codes in de
lijst. Deze code moet volgens de volgende handleiding worden ingegeven, wilt u
met de Com Uni 3 afstandsbediening uw TV-toestel kunnen bedienen.
5. Druk minstens drie seconden op de „TV“-toets, tot de groene LED tweemaal
knippert.
6. Toets nu binnen tien seconden de driecijferige code in.
7. Als de code juist is ingetoetst, knippert de groene LED tweemaal, om een
succesvolle programmering aan te geven
8. Richt nu met de Com Uni 3 afstandsbediening op uw TV-apparaat en druk op de
standby-toets. Als uw TV-toestel niet reageert, herhaalt u de stappen 3 tot 8 met de
volgende code van de producent van uw TV-toestel uit de lijst.
9. Als u uw TV-toestel hebt uitgeschakeld, hebt u een goede code gevonden.
Controleer daarna alle andere functies. Als meerdere toetsen niet mochten werken,
begint u opnieuw bij punt 3 en neemt u de volgende code van de producent van
uw TV-toestel uit de lijst.
De programmering van het STB-level functioneert op dezelfde manier, alleen
moet in plaats van de „TV“-toets de „STB“-toets worden ingedrukt en moeten de
codes uit de STB-lijst worden gebruikt.
De programmering van het SAT-level functioneert op dezelfde manier, alleen
moet in plaats van de „TV“-toets de „SAT“-toets worden ingedrukt en moeten de
codes uit de SAT-lijst worden gebruikt.
C. Producent-/Brand-zoekloop
Als u met de in hoofdstuk B beschreven methode geen goede code hebt gevonden,
kunt u met de producent-zoekloop naar een goede code zoeken.
1. Verzeker u ervan dat er in de Com Uni 3 afstandsbediening volle batterijen zijn
gezet.
2. Schakel uw TV-toestel in.
3. Druk minstens drie seconden op de „TV“-toets, tot de groene LED tweemaal
knippert.
4. Toets binnen tien seconden de code 0 0 3 in, de groene LED knippert daarna
tweemaal.
5. Toets binnen tien seconden de driecijferige code voor de producent (brand) van
het TV-toestel in. Als de code goed is ingetoetst knippert de groene LED twee keer,
zo niet gaat de LED een maal twee seconden rood branden.
6. Druk de standby-toets in en houd die zo lang ingedrukt tot uw TV-toestel is
uitgeschakeld. Als u de standby-toets loslaat, stopt de zoekloop en u kunt ook de
andere functies testen. Als er vijf seconden geen toets wordt ingedrukt, wordt de
zoekloop afgebroken en de Com Uni 3 afstandsbediening keert terug naar het
QRUPDOHOHYHOGH/('EUDQGWppQPDDOWZHHVHFRQGHQODQJURRG$OVKHW79
toestel tijdens de automatische zoekloop uitgaat, laat u de standby-toets meteen
los en drukt u op „OK“, zodat de gevonden instelling wordt opgeslagen. De LED
knippert daarna tweemaal groen.
46
NL
GEBRUIKSAANWIJZING
Com Uni 3 Universele afstandsbediening
7. Het kan gebeuren, dat de Com Uni 3 afstandsbediening tijdens de zoekloop
meerdere codes vindt waarop uw TV-apparaat reageert, maar niet bij iedere code
alle toetsen werken. In dat geval moet u de zoekloop opnieuw starten (stappen 2
tot 6), tot u de beste code hebt gevonden.
Als de Com Uni 3 afstandsbediening alle codes heeft doorlopen, die bij de producent
van uw toestel passen, knippert de LED vijf maal rood, en de zoekloop wordt
afgebroken.
De producent/brand-zoekloop van het STB- en SAT-level werk op dezelfde
manier, alleen moet er in plaats van de „TV“-toets op de „ STB“-toets of voor
SAT op de „SAT“-toets worden gedrukt en de codes uit de STB-/SAT-brandlijst
moeten worden gebruikt.
D. Complete code-zoekloop
Als u met de in hoofdstuk B en C beschreven methoden geen geschikte code voor uw
toestel gevonden hebt, kunt u de complete code-zoekloop doorvoeren.
1. Vergewis u ervan dat er volle batterijen in de Com Uni 3 afstandsbediening zijn
gezet.
2. Schakel uw TV-toestel in.
3. Druk minstens drie seconden op de „TV“-toets tot de groene LED twee keer
knippert.
4. Toets binnen tien seconden de code 0 0 1 in, de groene LED knippert daarna twee
keer.
5. Druk net zolang op de standby-toets en houd die ingedrukt tot uw TV-toestel
uitgaat. Houdt u er s.v.p. rekening mee dat dit wel tien minuten kan duren. Als er
binnen tien seconden geen toets wordt ingedrukt, wordt de zoekloop afgebroken,
en de LED gaat één maal twee seconden rood branden.
Als het TV-toestel tijdens de automatische zoekloop uitgaat, laat u de standbytoets meteen los en drukt u op „OK“, zodat de gevonden instelling wordt
opgeslagen. De LED knippert daarna tweemaal.
6. Als enkele toetsen niet mochten functioneren start u de zoekloop opnieuw (stap
2 tot 5) tot u een betere code hebt gevonden. Houdt u er rekening mee, dat in dat
geval de Com Uni 3 afstandsbediening de zoekloop bij de laatst gevonden code
voortzet en niet bij de allereerste code.
Als de Com Uni 3 afstandsbediening alle codes heeft doorzocht, knippert de LED vijf
maal rood, en de zoekloop wordt afgebroken.
De complete code-zoekloop werkt voor het STB- en SAT-level op dezelfde
manier, alleen moet in plaats van de „TV“-toets de „STB“-toets en voor SAT de
„SAT“-toets worden ingedrukt.
47
NL
GEBRUIKSAANWIJZING
Com Uni 3 Universele afstandsbediening
E. Code opvragen
GEBRUIKSAANWIJZING
Com Uni 3 Universele afstandsbediening
G. Speciale functies
De ingestelde code uitlezen
1. Druk de „TV“-toets minstens drie seconden in tot de groene LED tweemaal
knippert.
2. Toets binnen tien seconden de code 0 0 2 in, de groene LED knippert daarna
tweemaal.
3. Om de ingestelde code uit te lezen, drukt u op cijfer „1“, om het eerste cijfer van de
code uit te lezen, op „2“ voor het tweede en „3“ voor het derde. Nadat u op een van
deze cijfers hebt gedrukt, telt u hoe vaak de LED knippert, dat komt overeen met
het nummer van het cijfer van de code.
Let op:
Als de LED niet knippert nadat u op de cijfers „1“, „2“ of „3“ hebt gedrukt, is het
bijbehorende codecijfer 0.
Voorbeeld:
• Druk op toets „1“ voor het cijfer van de honderden. Als b.v. de LED driemaal
knippert is het eerste cijfer 3.
• Druk op toets „2“ voor het cijfer van de tienen. Als b.v. de LED eenmaal knippert is
het tweede cijfer 1.
• Druk op toets „3“voor het cijfer van de enen. Als b.v. de LED zesmaal knippert is
het laatste cijfer 6.
In dit voorbeeld is de code 316.
Wij adviseren u de codes voor STB/SAT en TV op te schrijven voor het geval, dat
u later uw Com Uni 3 afstandsbediening weer een keer moet programmeren. De
ingestelde codes blijven na vervanging van de batterijen bewaard.
De code-opvraag voor STB en SAT werkt net als voor TV, alleen moet in plaats van de
„TV“-toets de „STB“-toets en voor SAT de „SAT“-toets worden ingedrukt.
Noteert u de 3-cijferige codenummers voor toekomstige instellingen.
STB
SAT
TV
F.
NL
Reset
Instellingen wissen
Druk minstens drie seconden op de „TV“-toets, tot de LED tweemaal knippert. Voer
daarna de code 0 0 0 in. De LED knippert tweemaal, als de code is ingevoerd. Hierna
wordt de Com Uni 3 afstandsbediening in het TV-level in de nieuwe staat (staat van
levering) teruggezet.
Toets- en functieblokkering
Na goede programmering (STB-/SAT- of TV-level) kunt u bepaalde toetsen blokkeren
(beveiliging tegen foutieve bediening).
1. Druk minstens drie seconden op de „TV“-toets, tot de groene LED tweemaal
knippert.
2. Toets binnen tien seconden de code 0 9 9 in, de groene LED knippert daarna
tweemaal, om de invoer te bevestigen.
3. Nu kunt u door te drukken op de afzonderlijke toetsen deze deactiveren (de LED
brandt bij iedere druk op een toets, om de invoer te bevestigen).
Tip: U heeft de mogelijkheid door op de niet benodigde omschakeltoets (STB, SAT of
TV) het complete niveau te blokkeren.
4. Na het drukken op de laatste toets wordt door te drukken op de „TV“-toets de
invoer afgesloten.
Als er binnen tien seconden geen toets wordt ingedrukt, wordt de invoer automatisch
afgesloten (de LED gaat eenmaal twee seconden rood branden).
De blokkade voor afzonderlijke toetsen voor STB en SAT werkt net als voor TV, alleen
moet in plaats van de „TV“-toets de „STB“-toets en voor SAT de „SAT“-toets worden
ingedrukt.
Met de functie „reset“ de instellingen wissen (code 0 0 0) heft u de toetsenblokkade op.
Let op: Daarna moet het bijbehorende level eventueel opnieuw worden
geprogrammeerd.
De volgende toetsen zijn uitgezonderd van de toetsenblokkade:
• Standby
• Cijfers 0 bis 9
• Cursor
• P+ / P–
• V+ / V–
• Omschakeltoetsen (STB / SAT / TV)
Codeblokkade
Na goed programmeren (STB-/SAT- of TV-level) kunt u dit level blokkeren tegen
omprogrammeren.
1. Druk minstens drie seconden op de „TV“-toets, tot de groene LED tweemaal
knippert.
2. Toets binnen tien seconden de code 0 8 8 in, de groene LED knippert daarna
tweemaal, om de invoer te bevestigen.
Nu is dit level geblokkeerd tegen omprogrammeren.
Om de blokkade op te heffen handelt u op dezelfde manier (deblokkeren).
1. Druk minstens drie seconden op de „TV“-toets, tot de groene LED tweemaal
knippert.
2. Toets binnen tien seconden de code 0 8 8 in, de groene LED knippert daarna
tweemaal, om de invoer te bevestigen.
Nu is dit level vrij voor een nieuwe programmering.
De blokkade voor STB en SAT werkt net als voor TV, alleen moet in plaats van de
„TV“-toets de „STB“-toets en voor SAT de „SAT“-toets worden ingedrukt.
Het wissen voor STB en SAT werkt net als voor TV, alleen moet in plaats van de „TV“toets op de „STB“-toets en voor SAT op de „SAT“-toets worden gedrukt.
Volume-functie
In de functie SAT- en STB heeft u ook de mogelijkheid het volume van de TV te
wijzigen.
1. Druk minimaal 3 seconden op de toets „SAT- of STB“, totdat het LED twee keer
knippert.
2. Voer binnen 10 seconden de code 0 0 4 in, het LED knippert daarna twee keer, om
de activering van deze functie te bevestigen.
U kunt deze functie weer deactiveren door code 0 0 5 in te voeren.
48
49
STB
STB
CODES STB
Brand
Code
Brand
Code
STB
MOSER
MOTOROLA
MULTICHOICE
MVISION
MWC
MX ONDA
215
352 766 778
291 820
716
215
493
STYLUS
SUNNY
SUNNY DAP
SUNSTECH
418
507 508 799
508
548
Brand
A
ADB
AKAI
ALBA
ALICE
AMINO
AMSTRAD
ANTARES
ANYSAT
AON
ARCOM
ARCON
ARENA
ARION
ARTDIO
ARTEC
ASCI
ASTON
ASTRA
ASTRO
AUDIOTON
AVAIL MEDIA
AVER MEDIA
AXIL
AXIS
B
BAFF
BIRMINGHAM CABLE
BLACK WIDOW
BLAUPUNKT
BLUEWIN
BOOM
BOTECH
BOTECH SIYAH
BRAINWAVE
BRUNS
BUSH
C
CABLE
CABLECOM
CABLETIME
CAMBRIDGE
CANAL DIGITAL
CANAL+ CANALSATELLITE
STB
Code
388
611
611
399
775
293
419
566
398
405
235
512
569
709
443
322
607
464
215
215
319
552
475
365
697
789
429
204
288
414
682
448
324
216
611
CARLTON
CASEMA
CITYCOM
CLARKE-TECH
CMX/COMMAX
COMTEC
COSHIP
355
620
780
611
315
273
378
789
630
497
431
423
501
411
D
DAEWOO
DCO
DECSAT
DELTACOM
DENVER
DIGIALITY
DIGICAG
DIGIFREE
DIGIQUEST
DIGITAL
DIGITAL DTH
DIGITALSAT
DIGITALWORLD
DIGITURK
DILOG
DRAKE SEOUL
DREAM MULTIMEDIA
166
321
636
141
487
161
689
357
554
430
818
268
703
387
392
585
382
E
EASTERN
ECHOSAT
ECHOSTAR
ELIUM
ELMAK
ENERGY SISTEM
ENGEL
ESKI
EUSKALTEL
EXATOR
EYCOS
445
511
182
379
244
573
520
653
761
611
528
F
FAIRFIELD
FAVAL
FERGUSON
FIDELITY
FILMNET CABLECRYPT
FINEPASS
FINLUX
FONESTAR
FORCE
714
410
240
581
811
315
170
417
172
396 760
349 512 521 580 581 582
587
302 674 795
524 525
H
HAMA
HANDAN
HATHWAY
HAUPPAUGE
HB
HEIRU
HIRSCHMANN
HITACHI
HOMECAST
HOMECHOICE
HUMAX
205 215
773
690
692
760
782 789 804
274 275 315 364 376 377
811
162 163 510 799
718
297 323 799
705 772
383 384 385 390
685
316 589 651 797
380
624 631
524 525
692
568 589 730
715
241 463 581 587
394 395
171
524 525 591
301 391 512
517
314
498
490
294
215
611
SAT
BRAND
GOODMANS
GRANADA
GRUNDIG
740 747 799
661 662 663 664
798
Code
FORTEC STAR
FRANCE TELECOM
FREECOM
FTC
FTE
FUBA
G
GALAXIS
GLOBO
GOLDBOX
GOLDMASTER
GOLDY
776
557
265 553 587 594 698
523 525 554 685 736
Brand
631
402 415 484 501 658
276 279 280 294 459 462
656
365 366 542
718 799
273 274
318
796
CODE-NR.
535
207
133 196 198 199 201 203 204
205 206 207 208 209 210 211
212 213 214 215 321 353 392
HUTH
HYUNDAI
407
393
564
289
461
215
215
207
687
287
236
541
561
610
435
I
I3
ID DIGITAL
ID SAT
IKUSI
ILLUSION
IM INTERNET
IMPERIAL
INVERTO
IRIS
ITALTEL
ITV
319
442
486
683
285
777
267
322
400
812
298
J
JERROLD
JVC
183 767
117 133 184 611
K
KABEL DIGITAL
KAON
KATEK
KATHREIN
421 799
321 521 556 649 685 686
300 465 733
714 715
442 536 537 538 539 540
542 543 544 545 551 560
562 565 567 650 681 771
752
507
537 539 540 541 543
503 554 693 799
286 573
323 486 693
591
769
KENWOOD
KJAERULFF
KOSCOM
KREILING
KREISELMEYER
KYOTO
KYOTO BEYAZ
KYOTO SIYAH
245
688
743
146
290
743
273
161
428
299
215
478
478
513
L
LASAT
LEMON
LENSON
LG
LOEWE
LUXOR
321 518
296 322 325
279
473
368
105 106
M
MACAB
MAGNAVOX
MATSUI
MAXIMUM
MEDIA TV
MEDIASTAR
MEDION
METRONIC
METZ
MICROSOFT
MINERVA
MIRAGE
MITSUBISHI
M-NET
50
480
295
152
162
685
216
789
282
449
215
768
133
705
207
811
375
689 726 727
197
351
744
274
162
554
743
200 204 210 215 276
360 407 434 482 717
745
665 706 707
574 602
555 558
481 512
204
320 445 507 528 585 684
706 707 713 731 799
505 506 507 685 724
483
773
N
NECKERMANN
NET
NEXT
NIKKO
NOKIA
NOMEX
NOOS
NORMCAST
NTL
208
632
504
308
104
256
703
278
572
714
270
O
OCEANIC
ONO
OPENTEL
OPTEX
OPTICUM
ORANGE
ORBIT
ORBITECH
OSAT
OTF
OTTO VERSAND
113
765
497
234
718
623
342
268
581
302
208
Ö
ÖTZÜRK
590
P
PACE
212
508 653 694 695 704
249 250 252 253 254 255
260 274 362 363 364 368
313
546 685
537 626
271 297
311
212 581
PIONEER
PLANET
PLATINIUM
PMB
POLSAT
PREMIERE
PRO BASIC
PROLINE
PX
168
581
797
190
709
273
303
321
340
237
510
485
411
244
381
418
534
680
Q
QUADRO
QUELLE
QUIERO
420 659
581
631
R
RADIX
RCA
REGAL
RFT
RIMAX
ROVER
528 530 645
370
281
216 272 302
432 509
400
PALCOM
PANASONIC
PEACOCK
PHILIPS
S
SAGEM
SALORA
SAMSUNG
SANYO
SCHAUB LORENZ
SCHNEIDER
SCHWAIGER
SCIENTIFIC ATLANTA
SCREENLANT TFT
SEG
SHOWTIME
SIEMENS
SIGMA
SILVA SCHNEIDER
SILVERCREST
SIMPLYTV
SKY
SKY ITALIA
SKY PLUS
SKYMASTER
SKYPLUS
SKYTEK
SMART
SONY
STARSAT
STINO
STRONG
249
634
114
122
427
491
413
283
411
799
120
283
279
702
204
323
799
282
621
770
348
349
799
318
799
282
505
403
525
173
576
292
169
501
678
169 348 349 361 375 389
617 618
191 192
274
304
329
341
239
276
305
330
349
273
277
306
336
356
274
282
307
337
381
371
297 298
309 314
338 339
631
418 422 458 462
624 625 631
T
TBOSTON
TDC KABEL TV
TEAC
TECHNISAT
TECHNOTREND
TECHSTAR
TELE+1
TELECOM ITALIA
TELEKOM AUSTRIA
TELENET
TELEPIU
TELESTAR
TELESYSTEM
TELETECH
TELEVES
TERRATEC
TEVEBOX
TEVION
TEXAT
T-HOME
THOMSON
TUDI
TV CABO
411
623
703
267
323
504
811
399
774
396
811
268
796
331
326
666
335
317
712
397
240
369
581
581
119
323
453
397
476
196
624
240
557
266
284
U
UMA
UNITYDIGITALTV
UNIVERS
UNIVERSUM
UPC
215
323
415
215 222 294
358 359
V
VANTAGE
VAOVA
VARIOSAT
VELSAT
VESTEL
VIDEOWAY
VIOSIONNET
VISIONETICS
VISIONNET
VISIOPASS
VISIOSAT
VIVANCO
550
680
215
406
293
355
716
620
716
314 631
294 514 526 621 791
424
THORN
THORN-FERGUSON
TIME WARNER
TIVIDI
TONBURY
T-ONLINE
TOPFIELD
TOSHIBA
TPS
TRIAX
W
WELA
367 623 624 625 631 633
635
229 230 231 232 381 401
451 452 467 468 492 624
611
461 547 554
497 521 522 527 573 689
121 122
280 293 294 801
207 208 209 212 214 215
372 373 374 670 799
422 475 660
627
268 271 272 297 302 793
657
271 297 486 693 779 799
512 621 689 791 799
416 797
241 242 243 244 246 247
381 412 581 624 631
454
477 665 684 706 707 708
720
269 274 294 327 328 460
631 703 787 795
WESTMINSTER CABLE
WHIRLPOOL
WISI
WORLDSAT
172 474 521 557 559 649 685
781
809
246
215 466 546 554 575 685 686
759
X
XSAT
XTREME
146
689
Y
YAKUMO
YUMATU
443
691 710
Z
ZEHNDER
ZIPPER
ZODIAC
293 294 524 525 799
549
411 422 524 525 563 588 796
Others
283
349
350 386
462 556 586 649 714 797
404 405 408 409 410 433
526 557 571 573 701
343 344 345 346 347
696
274 279 435 436 438 444
604 631 654 655 676 677
679 711 759 796 800
51
204 206 271 274 334 472
SAT
CODES SAT
SAT
Brand
A
ACTION
ADB
AKAI
ALBA
ALDES
ALICE
ALLSAT
ALLSONIC
AMINO
AMSTRAD
SAT
Code-Nr.
AUDIOTON
AVAIL MEDIA
AVER MEDIA
AXIL
AXIS
131
388
611
140
675
399
185
264
775
118
580
615
228
419
723
566
398
723
177
405
228
594
512
569
668
709
443
322
125
607
105
215
742
215
319
552
475
264
B
BAFF
BANG & OLUFSEN
BARCOM
BEST
BIRMINGHAM CABLE
BLACK WIDOW
BLAUPUNKT
BLUE SKY
BLUEWIN
BOCA
BOKA
BOOM
BOTECH
BOTECH SIYAH
BRAIN WAVE
BRAINWAVE
BRUNS
BUSH
697
354
104
228
789
429
140
140
288
597
597
414
682
448
446
324
216
140
ANKARO
ANTARES
ANTTRON
ANYSAT
AON
APOLLO
ARCAM
ARCOM
ARCON
ARENA
ARION
ARMSTRONG
ARTDIO
ARTEC
ASCI
AST
ASTON
ASTRA
ASTRO
C
CABLE
CABLECOM
CABLETIME
CAMBRIDGE
CANAL DIGITAL
CANAL+ CANALSATELLITE
396 760
179 181 611 723 817
755
755
293 349 512 521 578 579
581 582 583 584 597 603
616
264 751 755
776
557
235 265 553 587 592 593
629 698 732
587
740
127
661
464
264
746
264
747 799
155
662 663 664
302 502 674 675 739
795
675
524 525
365 749
228
264
773
668
690
692
750 751 754
181 611 817
CLARKE-TECH
CLATRONIC
CMX/COMMAX
CNT
COMMLINK
COMTEC
CONDOR
CONRAD
CONTEC
CONTINENTAL
CONTINENTAL EDISON
COSHIP
CROWN
CRYPTOVISION
D
DAEWOO
DANSAT
DCO
DECSAT
DELTACOM
DENVER
DIGIALITY
DIGICAG
137 166 798
185
321
636
141
487
161 162 163 510 799
689
CARLTON
CASEMA
CITIZEN
CITYCOM
DIGIFREE
DIGIQUEST
DIGITAL
DIGITAL DTH
DIGITALSAT
DIGITALWORLD
DIGITURK
DILOG
DISK EXPRESS
DNT
DRAKE SEOUL
DREAM MULTIMEDIA
357
554
430
818
268
703
387
392
228
101
585
382
E
EASTERN
EBEN
ECHOSAT
ECHOSTAR
EDISON
EDISON MINERVA
EINHELL
ELEKTA
ELIUM
ELMAK
ELTA
EMANON
EMME ESSE
ENERGY SISTEM
ENGEL
EP SAT
ESKI
EUROLINE
EUROPA
EUROSKY
EUROSTAR
EUSKALTEL
EXATOR
EYCOS
445
185
511
182
140
140
599
675
379
244
264
723
264
573
520
817
653
156
489
264
668
761
611
528
FIDELITY
FILMNET CABLECRYPT
FINEPASS
FINLANDIA
FINLUX
FONESTAR
FORCE
FORTEC STAR
FRANCE TELECOM
FREECOM
FTC
FTE
FUBA
204 205 215
355
620
780
611
315
273
378
789
630
175
143
554
431
446
423
675
755
501
264
736
638
140
140
411
668
102
Code-Nr.
F
FAIRFIELD
FAVAL
FERGUSON
G
GALAXIS
760
782 789 804
274 275 315 364 376 377
811
144 167 497 516 523 525
638 641 647 685 735 736
GLOBO
GMI
GOLDBOX
GOLDMASTER
GOLDSTAR
GOLDY
GOODMANS
GRAETZ
GRANADA
GROTHUSEN
GRUNDIG
GRUNDIG
G-SAT
H
HAMA
HANDAN
HANSEATIC
HANTOR
HANURI
HATHWAY
HAUPPAUGE
HB
HEIRU
HIRSCHMANN
HISAWA
HITACHI
HOMECAST
52
Code-Nr.
Brand
HOMECHOICE
HOUSTON
HUMAX
HYUNDAI
287
755
236
541
561
610
751
435
I
I3
ID DIGITAL
ID SAT
IKUSI
ILLUSION
IM INTERNET
IMPERIAL
INTERNATIONAL
INVERTO
IRIS
ITALTEL
ITT
ITV
319
442
486
683
285
777
181
224
322
400
812
105
298
N
NAVEX
NECKERMANN
NET
NETWORK
NEUHAUS
NEULING
NEVELING
NEXT
NIKKO
NOKIA
J
JERROLD
JOHANSSON
JVC
183 263 767
446
117 133 184 580 611
HUTH
Brand
714
410
185
817
581
811
315
104
110
417
172
517
314
471
490
294
101
276
628
718
297 323 799
705 772
195 642
383 384 385 390
685
316 570 589 642 651 797
668 723 755
K
KABEL DIGITAL
KAON
KATEK
KATHREIN
380
624 631
723
KATHREIN
524 525
692
KENWOOD
KJAERULFF
KOSCOM
KOSMOS
KOSMOS SAT
KREILING
KREISELMEYER
KYOSTAR
KYOTO
KYOTO BEYAZ
KYOTO SIYAH
500 755
668
723
568 589 730
715
240 241 463 581 587 815
615
394
110
170
524
301
395
171 218 261 817
525 591
391 512
631
498 515 722 723
402
194
279
642
415
195
280
644
425
215
294
645
484
220
459
656
501 658
228 264
462 611
723
125
609
718
668
273
318
140
600
535
111
105
471
133
199
206
213
185
264 365 366 455 542 608
610 732 755
799
407
393
728
723
675
564
289
461
215
106
321
556
738
446
110
817
687
421 799
274
471
796
207
723
140
201
207
214
151
203
208
215
157
204
209
321
164 196 198
205
210 211 212
353 392 817
148 174 215 217 219 221
440 441 479 494 516 521
577 645 649 685 686 736
176 207 300 465 733 814
823
714 715
SAT
Brand
L
LASAT
LEMON
LENCO
LENSON
LG
LIFESAT
LOEWE
LORENZEN
LORRAINE
LUPUS
LUXOR
M
MACAB
MAGNAVOX
MANHATTAN
MASCOM
MASPRO
MATSUI
MAXIMUM
MEDIA SAT
MEDIA TV
MEDIAMARKT
MEDIASTAR
MEDION
METRONIC
METZ
MICRO TECHNOLOGY
MICROSOFT
MINERVA
MIRAGE
MITSUBISHI
MNE
M-NET
MORGAN‘S
MOSER
MOTOROLA
MSL IRLAND
MULTICHOICE
MULTISTAR
MURATTO
MVISION
MWC
MX ONDA
442
542
562
612
752
507
536
543
565
613
754
537
544
567
614
755
538
545
650
622
539
551
681
668
540
560
771
750
537 539 540 541 543
503 554 693 799
286 573
267 323 486 693
591
769
245
688
739
132
215
407
469
641
742
273
161
428
471
425
299
215
723
478
478
513
375
689
743
143
276
425
470
647
743
274
162
554
137
457
735
296
471
279
473
264
368
597
471
264
101
261
144
518
736
322
723
480
295
675
675
469
140
162
685
803
216
668
789
156
449
215
100
768
133
705
207
224
811
599
215
352
815
291
425
125
716
215
493
481 512
726
746
146
290
426
482
648
744
727
197
351
434
494
717
745
200
360
437
495
736
746
204 210
439 441
502 638
739 741
748
665 706 707
574 602
NOMEX
NONAME
NOOS
NORDMENDE
NORMCAST
NOVIS
NTL
446
208
632
185
755
600
180
504
136
101
109
252
259
364
115
597
572
181
714
446
270
O
OCEANIC
OCTAGON
OKANO
OLYMPIC
ONO
OPENTEL
OPTEX
OPTICUM
ORANGE
ORBIT
ORBITECH
ORION
OSAT
OTF
OTTO
OTTO VERSAND
108
137
441
755
765
497
234
718
623
127
268
233
581
302
728
208
Ö
ÖTZÜRK
441
743
P
PACE
755
817
817
152 204 802
320 445 507 528 585 684
706 707 713 731 799
282 505 506 507 685 724
483 723 755
224
773
140
601 629 668
766 778
820
456 488
471
803
195
508
156
103
110
253
260
368
278
653
308
104
112
254
261
703
313
694 695 699 704
105
221
255
262
817
106
249
256
274
107
250
257
362
108
251
258
363
629 675 723 810 816 817
725
109 113
723 755
668
546 685
638
155 342 537 626
271 297 729 783
311
212 581 728
590
PHOENIX
PHONOTREND
PIONEER
PLANET
PLATINIUM
PMB
POLSAT
POLYTRON
PREDKI
PREMIERE
PRIESNER
PRO BASIC
PROLINE
PROMAX
PROSAT
PROVISION
PX
Q
QUADRAL
QUADRO
QUELLE
QUIERO
264 755 757
420 659
425 581 615
631
R
RADIX
RCA
RED STAR
REGAL
RFT
RIMAX
RITAR
ROVER
528 530 642 644 645
370
264
281
216 272 302 750 751 754 755
432 509
103
400
PALCOM
PALLADIUM
PALSAT
PALTEC
PANASONIC
PANDA
PEACOCK
PHILIPS
531 732 763
103 104 105 106 109 110
262 805
212
168
349
619
822
628
668
786
195
190
817
709
132
282
307
336
356
736
178
637
237
510
485
411
244
638
446
381
668
418
534
817
181
675
680
555 558
189 264 321 446 456
519 606 668 671 675
794
325
755 758
Code-Nr.
S
SABA
SABRE
SAGEM
SALORA
53
130
450
817
249
634
101
259
169 185 186 187 188 348
361 375 389 581 617 618
813 815 816 817 819 821
797
191 192
151
297
309
337
381
817
152
298
310
338
533
273
303
314
339
631
274
304
321
340
643
276
305
329
341
734
277
306
330
349
735
755
239 273 274 371
418 422 458 462
624 625 631
755
145 147 150 160 181 185
721 735 752 817
367 623 624 625 631 633
635
103 104 105 110 114 116
SAT
SAT
Brand
Code-Nr.
SAMSUNG
122
427
624
491
125
185
446
762
105
283
185
527
799
120
283
642
224
446
129
176
702
202
215
598
799
282
621
770
348
349
799
156
714
282
505
753
597
140
403
525
173
668
723
446
576
292
142
438
639
679
418
668
507
508
668
548
SANYO
SAT
SATEC
SATPARTNER
SATPLUS
SCHAUB LORENZ
SCHNEIDER
SCHWAIGER
SCIENTIFIC ATLANTA
SCREENLANT TFT
SEEMANN
SEG
SETEC
SHARP
SHOWTIME
SIEMENS
SIGMA
SILVA SCHNEIDER
SILVERCREST
SIMPLYTV
SKY
SKY ITALIA
SKY PLUS
SKYMASTER
SKYPLUS
SKYTEK
SKYTWIN
SL
SMARAGD
SMART
SONY
SR
STAR
STARRING
STARSAT
STINO
STRONG
STYLUS
SUMIDA
SUNNY
SUNNY DAP
SUNSTAR
SUNSTECH
T
TANTEC
TBOSTON
TDC KABEL TV
TEAC
TECHNISAT
TECHNOTREND
TECHSTAR
TECO
TELE+1
TELECO
TELECOM ITALIA
TELEFUNKEN
TELEKA
TELEKOM AUSTRIA
TELEMASTER
TELENET
TELEPIU
TELESTAR
TELESYSTEM
TELETECH
TELEVES
TENSAI
TERRATEC
TEVEBOX
TEVION
TEXAT
T-HOME
THOMSON
THORENS
THORN
THORN-FERGUSON
TIME WARNER
TIOKO
TIVIDI
TONBURY
T-ONLINE
TONNA
TOPFIELD
TOSHIBA
TPS
TRAID
TRIAD
817
411
623
703
193
728
323
504
668
811
312
399
181
425
774
488
396
811
268
796
331
326
137
666
335
317
712
397
149
246
624
605
165
581
119
638
323
453
397
817
476
196
624
127
125
229
451
629
611
127
756
471
764
110
643
225
573
817
121
230 231 232 381 401
452 467 468 492 577
723
155 581
817
675 723
413 461 547 554
411 450 497 521 522
638 641 647 652 689
122
668
238 264 279 280 293 294
723 801
332
204 207 208 209 212 214
323 372 373 374 595 597
667 669 670 672 799
283 471
349
350 386
318 333 462 556 586 649
749 753 755 763 797 799
404 405 408 409 410 433
526 557 571 573 600 701
343 344 345 346 347
696
169
444
640
711
264
479
654
719
274
501
655
723
279
532
676
759
435
604
677
796
436
631
678
800
508 799
Brand
Code-Nr.
TRIAX
123
327
784
806
266
284
TRIAX
TUDI
TV CABO
TV
Brand
215
193
228 446
323
415
164 215 222 294 735 736
358 359
V
VANTAGE
VAOVA
VARIOSAT
VELSAT
VESTEL
VIDEOWAY
VIOSIONNET
VISIONETICS
VISIONNET
VISIOPASS
VISIOSAT
VIVANCO
VORTEC
V-TECH
550
680
215
406
293
355
716
620
716
314
294
424
577
125
W
WELA
WITTENBERG
WOORISAT
WORLDSAT
156
597
736
809
817
246
446
124
145
227
646
185
675
759
X
XSAT
XTREME
146
689
WESTMINSTER CABLE
WEWASAT
WHIRLPOOL
WINERSAT
WISI
Z
ZEHNDER
267 268 271 272 297 302
729 783 786 790 792 793
CODES TV
228 240 269 274 294
447 460 557 631 703
787 795
808
U
UMA
UNIDEN
UNITOR
UNITYDIGITALTV
UNIVERS
UNIVERSUM
UPC
Y
YAKUMO
YUMATU
422 475 660
627
220
328
785
807
ZIPPER
ZODIAC
Others
657
723 817
441 499 668 729
675
271 297 486 693 779 799
512 621 689 791 799 817
416 797
181 240 241 242 243 244
247 248 369 381 412 581
631 673 735 736 817
223 581 817
631
514 526 596 621 791
629 723
126 127 138 155
172 474 521 529 557 559
598 645 649 685 700 732
737 781
125
153
466
685
616
127
154
546
686
128
159
554
736
129
160
575
788
134 135
215 226
642 645
817
443
691 710
125 139 158 167 264 293 294
425 446 469 524 525 648 675
799
549
411 422 524 525 563 588 796
105 115 118 152 202 204 206
223 224 271 274 334 472 479
496 519 581 721 805
2
2M ELECTRONICS
A
A.R.SYSTEMS
ACCENT
ACTION
ADMIRAL
ADVENT
ADYSON
AEG
AGASHI
AGAZI
AGB
AIKO
AIM
AIOSTAY
AIRIS
AIWA
AKAI
AKIBA
AKIRA
AKURA
ALBA
ALBIRAL
ALCYON
ALFA
ALLORGAN
ALLSTAR
ALPHATRONIK
ALTUS
AMERICAN HIGH
AMERICANA
AMSTRAD
ANDERSSON
ANGLO
ANITECH
ANSONIC
ANTECNO
AOC
ARC EN CIEL
ARCON
ARCTIC
ARISTONA
ART TECH
ASA
ASBERG
ASORA
ASTRA
ASUKA
ATEC
ATLANTIC
ATLAS
ATORI
ATORO
AUDIO TECHNICA
AUDIOSONIC
AUDIOTON
AUDIOVOX
AUSIND
AUTOVOX
AVER MEDIA
AWA
AXXION
B
BANG
BANG & OLUFSEN
BASIC LINE
BAUER
BAUR
454
477 665 684 706 707 708
720
BAYSONIC
BAZIN
BEC
BECRESE
BEKO
155
127 155 471
BELL & HOWELL
BENCHMARK-BEAUMARK
54
TV
Code-Nr.
253
216
736
150
150
103
431
686
299
494
431
292
210
150
426
216
604
161
103
144
304
426
497
141
426
109
116
264
431
216
361
426
106
431
576
484
288
288
113
474
135
140
431
150
474
141
304
223
556
484
251
453
431
272
358
150
150
141
344
269
430
150
150
206
141
150
431
361
106
652
150
140
245
431
106
423
581
295
103
175
373
521
292
118
103
103
634
264
485
745
197
150
287 292 431 453 502 512
426
288 304 431 634 725
107 113 133 150 197 292
542 707
304 431
706
244
106
150
378
429
602
431
107
217
381
431
636
110
244
392
452
688
112
254
414
474
725
116
274
419
484
738
698
124
128
284
450
431
141
135
292
660
716
150
141
334
683
722
264
150
336
707
292 431
154 217
414 423
708
141
284
423
485
745
661 738
502
485
142 150 373 559 730
292
292 299 304 358 361
722
264 265 292 414 423
494 505 516 708 722
431
742 747
723
485
276 351 425 426 430 431
281 282 361 363 546
361 431 707 722
431
292
431 738
BONDSTEC
BOSCH
BOSCH-BAUER
BOXFORD
BRANDT
BRANDT ELECTRONIQUE
BRAUN
BRENDSTAR
BRINKMANN
BRIONVEGA
BROCKWOOD
BROKSONIC
BROTHER
BRUNS
BSR
BTC
BUSH
C
CAMPLE
CAMPOMATIC
CANAL+ CANALSATELLITE
CANDLE
CAPEHART
CAPSONIC
CARREFOUR
CARVER
CASIO
CATHAY
CCI
CENTURION
CENTURY
CGE
CGM
CHARPY
CIATE
CIE
CIHAN
CIMLINE
CINEX
CIRCUIT CITY
CITIZEN
CITY
CLARIVOX
CLAUD
CLUBINTERNET
CMX/COMMAX
COLORTYME
COMBI
COMPUTEC
COMPUTRON
CONCORDE
CONDOR
220 361 738
431
150 284
529
140
431
706
543
141 144 150 153 414
473 484 485 492 494
708
106
244
426
586
107
245
430
591
431
304
639
273
490
641
431
264
116
150
722
221
288
117
248
277
504
141
474
642
220
276
121
495
107
223
434
150
707
113
107
107
292
106
118
141
103
284
424
CLATON
CLATRONIC
150 264 265 292 431
210
107
636
265
486
Code-Nr.
BENQ
BEON
BEST
BESTAR
BIGSTON
BLACK PANTHER
BLACK STAR
BLACKSTRIPE
BLAUPUNKT
BLAUTECH
BLUE SKY
431
542
150
150
502
221
492
Brand
111 150 171 173
248 251 254 357
431 434 457 488
592
634 725
357 431 586 592
410 414 437 484
638 639 705 708
431 580
288 304 431
CONIC
CONRAC
CONSTRUCTA
CONTEC
CONTINENTAL
CONTINENTAL EDISON
CORFUNG
CORONADO
COSMEL
CRAIG
CROSLEY
CROSSWOOD
CROWN
CRYSTAL
CS ELECTRONICS
CTC CLATRONIC
CURTIS
CURTIS MATHES
CYBERPIX
55
107
597
409
304
304
292
361
431
431
431
564
431
221
116
361
140
606
542
150
425
150
505
107
288
150
210
727
414
121
358
425
594
650
288
656
513
150
150
121
707
304
703
453
140
154
154
292
304
150
431
137
542
414
107
304
426
141
121
431
288
473
707
265
264 431
580
144
251
278
586
154
254
280
592
228 242 244 245
255 259 275 276
430 761
154 414 423 431 448 473
484 485 492 494 505 516
672 706 708
501 668
223 310 742 745 747 756
742 747 752 756
758
354 429 431 514 542 718
304
304
265 542 720 722
135 661
116 128 135 141 154 217
289 292 336 367 414 423
431 450 484 660 708
304
431 725
431
431
542
118 150 221 278 279 358
374 707 761
150
153 220 559
660
516
304
304 431 592
214 216 221 356 431 711
735
423
135 141 150 221 264 284
431 484 485 707 722
431
431
140 150 221 264 431 502
722
431 634
704
150 301 309
223 742 747 756
221
634
423
135
358
452
220
221
508
304
264 278 358 361 431
150 197 264 265 267
361 431 715 722
221
707 722
707
431 580 592
TV
Brand
D
DAEWOO
DAICHI
DAIMOND
DAINICHI
DALCO
DANSAI
DANTAX
DAVIS
DAWA
DAYTRON
DCE
DE GRAAF
DECA
DECCA
DELL
DENVER
DESMET
DIAMOND
DIGILINE
DIGITALSAT
DIGITECH
DIGITURK
DIXI
DMTECH
DORIC
DREAM MULTIMEDIA
DTS
DUAL
DUMONT
DYNAMIC
DYNATECH
E
EATON
ECROM
ECRON
EDISON
EDISON MINERVA
EKSPERTEN VEST
ELBE
ELBIT
ELBIT FRABA
ELCIT
ELECS
ELECTRATUNE
ELECTRO TECH
ELECTROHOME
ELECTRONIKA
ELEKTA
ELEKTRONIKA
ELEMIS
ELIN
ELITE
ELMAK
ELMAN
ELTA
E-MAX
EMERSON
EON
EPSON
ERRES
ETERNITY
ETRON
EURO-FEEL
EUROLINE
EUROMAN
EUROMANN
EUROPHON
EXCELSIOR
EXPERT
F
FENNER
FERGUSON
FIDELIS
FIDELITY
FILSAI
FINLANDIA
FINLUX
FIRST LINE
TV
Code-Nr.
150
222
150
426
141
697
304
265
426
431
150
414
103
505
211
541
701
150
150
150
708
409
373
423
150
414
137
420
150
106
373
454
107
150
107
288
414
448
154
154
257
113
451
724
425
440
221
426
304
150
107
267
140
267
264
106
121
592
404
135
116
643
107
304
494
288
313
244
689
106
292
431
431
265
116
722
409
106
150
106
171
245
310
426
521
638
747
150
106
150
103
135
283
383
431
713
106
170
473
708
153 157 159 160 161 162
304 428 431 444 450 502
698
426 484 485
463
304
423
107
516
307
713
431 437 455 505 516
729
431
429
Brand
Code-Nr.
FISHER
106
300
720
431
568
121
197
264
103
306
738
107
704
113
512
107
127 137 156 175 264 272
301 357 542 580 582 586
721
HITACHI
264
264
150
103
431
752
106
106
634
103
150
150
150
141
343
431
251
150
150
409
150
429
128
244
426
574
698
141
303
425
473
264
141
141
103
414
505
103
181
282
425
459
624
106
150
116
107
244
258
356
421
459
414
150
132
264
707 722
707 722
103
123
251
383
447
586
614
621
628
635
713
616
414
410
668
425
425
141
261
431
646
707
118
476
150
158
698
FLINT
FORCE
FORMENTI
FORTRESS
FRABA
FRONTECH
FUJITSU GENERAL
FULTON
FUNAI
G
GALAXIS
GALAXY
GALERIA
GBC
GE
GEBER
GEC
431 720
423 473 475 555
526
113 141 150 268 269 357
426 429 431 437 445 450
272 304 361 542 707 722
304
423
135 216 268 414 423 431
453 492 494 553 667 669
GELOSO
GEMSOUND
GENERAL
GENERAL TECHNIC
GENEXXA
GERICOM
GIANT
GITEM
GM
GMG
GOLDBOX
GOLDHAND
GOLDI
GOLDSTAR
GOLDY
GOODMANS
426 431
722
304
431
150
426
265
150
141
580 634
437
292
431 437
437
722
150
689
116
414
542
438 706
745
431
GORENJE
GPM
GRADIN
GRAETZ
GRAN PRIX
GRANADA
272 431 502
280 288 304 431 580
121 141 264 265 284
423 431 484 485 492
708 722 735
342 665
351 425 426 430 431 520
150 431
484 485
292 431
135 210 217 218 221 431
724
269 383 738
431
107
173
254
356
430
586
639
751
431
708
109
175
272
369
431
592
657
752
118
150
361
386
455
717
113
216
484
282
211
363
389
505
722
116
221
485
113
181
278
376
432
599
713
756
581
221
378
392
516
118
216
281
399
437
632
726
760
752
272
379
395
542
132
224
301
401
451
633
729
761
281
380
426
692
133
244
309
425
502
634
745
762
282
381
430
707
TV
Code-Nr.
FUJI
FUJITSU
586
447
TV
Brand
GRANDIN
GRENADIER
GRONIC
GRUNDIG
GRUNKEL
GTT
GUTTRONIC
GZE UNIMOR
H
HAIER
HALIFAX
HALLMARK
HANSEATIC
HANTAREX
HARLEY DAVIDSON
HARRAD
HARVARD
HB INGELEN
HCM
HEATHKIT
HEMMERMANN
HIFIVOX
HILINE
HINARI
HISAWA
HISENSE
HIT
121 135 150 153
414 423 430 431
502 581 650 661
56
186
292
107
103
251
450
150
107
107
107
414
140
431
106
223
150
106
141
650
542
689
217 361 426 431
304
128 135 150 213 221 292
113 176 238 269 304 703
725 738
269 738
150 176 292 304 419 661
133 135 137 150 214 222
107 117 118 137 211 431
713
133 135 137 141 150 222
698
431
680
426 431 452 747 752
707
135
264
431
634
147
269
452
709
150 154 213 220
288 292 304 359
458 484 485 502
725
150
332
430
502
265
150
150
106
423
516
107
194
356
426
580
631
414
431
431
149
245
260
358
429
478
423
707
153
336
431
551
161
369
444
602
162
406
446
645
166
414
447
688
284
423
460
708
431
110 117 118 132 137
118
195
368
431
581
636
423
119
211
383
437
591
713
708
120
228
385
440
592
725
137
264
392
453
621
729
144
265
409
456
623
752
154
247
262
360
430
504
240
248
263
361
431
528
241
251
267
365
437
660
242
254
271
366
448
689
243
255
334
410
451
290 294 298 459 580
304
106
265
452
214
288
304
304
423
141
128 135 137 150 161
268 357 426 431 437
468 502 661 709 718
431
304
484
150 265 292
742 747
141 150 303 309 431 502
651
HITACHI FUJIAN
HOHER
HÖHER
HOME ELECTRONICS
HORIZONT
HORNYPHON
HOSHAI
HOTEL INTERNATIONAL
HQ
HUMAX
HUSPI ELEKTRONIK
HYPER
HYPERVISION
HYPSON
HYUNDAI
I
I.V.
IBERVISAO
ICE
IEKEI
IM INTERNET
IMA
IMPERIAL
INDESIT
INDIANA
INFINITY
INFRATEX
INGELEN
INGERSOLL
INNO HIT
INNOHIT
INTERACTV
INTERBUY
INTERCORD
INTERDISCOUNT
INTERFUNK
INTERTRONIC
INTERVISION
IRRADIO
ISKRA
IST
ISUKAI
ITC
ITL
ITS
ITT
ITV
J
JACSON
JAMO
JBL
JDB
JEC
JETPOINT
JINLIPU
JRC
JUMBOTRONIC
JVC
K
KAIDO
KAISER
KAISUI
KAMBROOK
KAON
KAPSCH
KARCHER
KATHREIN
KAWA
KDS
KENDO
KENMARK
KENNEDY
KENNEX
KENWOOD
KERION
KEYMAT
431
106
141
569
702
107
103
278
751
431
431
291
708
106
150
137
141
713
481
150
357
175
103
137
426
707
449
103
265
141
502
135
141
141
135
150
141
101
197
580
292
212
677
431
668
592
288
150
116
431
200
207
128
431
141
310
206
103
150
724
244
284
228
103
452
723
417
113
444
242
431
345
106
133
304
414
450
592
615
622
629
636
718
107
137
310
423
455
608
616
623
630
637
725
111
161
328
431
459
609
617
624
631
638
742
112
162
357
439
473
610
618
625
632
639
756
117
197
374
442
474
612
619
626
633
640
118
211
378
444
563
613
620
627
634
694
423 473 484 485
414 423 448 474
706
431
647 648 649 671 678
150 217 220 284 431
292 431
290 293 504 686 690 691
Brand
Code-Nr.
KIMAY
KIOTA
KITON
KLH
KLOSS
KNEISSEL
292
150
414
107
288
113
667
150
107
150
141
116
681
264
552
107
304
106
106
KOBIC
KOLSTER
KONICHI
KONKA
KORPEL
KORTEK
KÖRTING
KOTRON
KTV
KUASHO
KUBA
KUBA ELECTRONIC
L
LAVIS
LEADER
LEGEND
LENCO
135
150 213 217 284 292 431
LENOIR
LESA
LEVEL
LEXUS
LEYCO
LG
304
116 118 130 135 221 264
358 361 431 707
LGIK
LIESENKÖTTER
LIFE
LIFETEC
337 431 450 695 696 706
710 731 734 736
110 117 132 137 667 705
LINITRON
LLOYD‘S
LOCATEL
LODOS
LOEWE
150 210 359 431 713
150 210 213 284 359 431
725
221 292 299
310
106
221
430
747
426
107
264
431
452
110
276
452
747
117
277
540
752
132
351
546
756
133
364
586
116 135 141 220 221 264
292 299 453 693 709 722
150 220 356 359 361 431
722
217 431
431
150
103
244
586
502
213
106
309
660
LOGIK
LÖGIK
LOVE
LUMA
LUMATRON
LUX-MAY
LUXOR
LUXOR
LXI
M
M ELECTRONICS
MACYS
MAGASIN
MAGNADYNE
284
107 116 133 195
356 378 383 392
717 718 742
713
426 452
284
201 202 203 204 205 206
208 209 284 431 580 717
150 431
756
107 117 132 137 269 738
265 267 431 502 505 516
245
453
113 133 150 414 423 431
486 502 660 667 718 722
738 740
137 141 269 738
304 409
567 596 605 607
MAGNAFON
MAGNASONIC
MAGNAVOX
MAGNEX
MAGNUM
MANDOR
MANESTH
MARANTZ
MARK
MARSHAL
MASCOM
MASCOT
MATCH ITALIA
MATSUI
MAVA
MAXAM
MAXELL
MAXWELL
MC MICHAEL
MCE
MCPERSON
MEDIA STATION
MEDIA TV
MEDIATOR
MEDION
MEGAS
MEGATRON
MELBOX
MELECTRONIC
MEMOREX
MEMORY
MEMPHIS
MERCURY
57
116
150
150
106
431
106
221
653
292
292
448
572
307
276
150
141
450
197
107
239
423
210
435
542
307
224
216
103
113
116
101
117
150
383
455
197
106
386
304
574
106
431
137
761
150
353
431
448
292
292
357
153
485
141
505
221
431
106
176
309
502
304
150
150
722
634
150
507
601
443
351
378
484
704
667
636
727
383
150
473
150
150
423
304 725
153 216 268 431 444 553
708 711
141 220 431 722
165 284 297 549
431
265 267 542
304
431
107 357
357
153 431 437 448 711
431
150 151 153 164 292 426
722
150 431
431 661 725
473 484 485 502 558 571
573 574 575 577 682
426 452
150 153 292 414 423 431
708
304
137 150 304 356
228
436
545
309
307
310 412 425 426 434
437 438 457 464 496
113
269
284
103
118
281
386
500
431
133
414
431
106
123
282
389
509
580
657
309 376 431
150
419
735
107
126
359
390
717
269 431 738
423 708 738
110 111 112
137
364 378 381
395 414 423
725
150 222 272 282 357 383
389 392 395 431 745
137 150 210 220 221 222
502 542 707 722
210 217 361 431 722 724
197 304 431 502 580
430 431 441 453 634
515
431 660
422 426 431
265 414 423 431 457 484
516
128
217
336
559
130
244
338
580
135
245
339
599
137
248
340
657
150
284
414
660
154
307
423
663
431
379 414 423 429 450 473
485 492 494 602 688 703
708
386 388 392
292 580
725
431
TV
TV
TV
Brand
Code-Nr.
Brand
Code-Nr.
Brand
MERRIT
METEOR
METZ
103
724
244
254
423
542
426
414
304
154
361
431
149
176
150
254
444
414
214
288
361
197
107
305
148
722
414
103
358
137
OTAVA
OTF
OTRUM
OTTO VERSAND
461
150
425
103
135
175
221
284
430
520
718
498
R
R LINE
RADIO SHACK
RADIOLA
RADIOMARELLI
RADIONETTE
RADIOTONE
METZ
MGA
MICROMAXX
MIDLAND
MINERVA
MINOKA
MINSONIC
MIRAI
MITSUBISHI
MITSUBUSHI
MIVAR
MONITOR
MOTION
MOTOROLA
MTC
MULTICHOICE
MULTIMEDIA
MULTISTANDARD
MULTITEC
MULTITECH
MURPHY
N
NAGOYA
NAMSUNC
NAONIS
NAP
NATIONAL
NATIONAL STAR
NEC
NECKERMANN
NEI
NEOVIA
NESCO
NEW WORLD
NEWTECH
NIKKAI
NIKKEI
NIKKO
NISSAN
NOBLEX
NOBLIKO
NOGAMATIC
NOKIA
NOKIA
NONAME
NORDMENDE
NORDWAY
NORTEK
NORTHERN STAR
NOVA
NOVATRONIC
NUCLEONIC
O
O GENERAL
OCEANIC
OKANO
OLYMPIC
ONCEAS
ONIDA
ONWA
OPERA
OPTANKA
ORAVA
ORBIT
ORBITECH
ORBITER
ORIAN
ORIENT
ORION
OSAKI
OSO
OSUME
OTAKE
118
150
103
425
431
698
150
676
103
173
251
430
542
141
331
222
141
150
141
431
502
288
150
217
223
100
110
131
281
377
386
387
395
107
461
116
429
750
216
431
678
106
150
116
150
101
137
580
150
150
150
431
141
431
197
431
431
409
264
697
150
106
150
309
414
437
689
141
141
725
660
106
245
256
474
544
246
304
502
546
249 250 251 252
396 397 398 414
540
547 548 703
423
244 245 251 254 355 356
OVP
554
179
301
459
423
217
180 181 182 183 244
302 309 375 426 431
542
219 268 359 362 719
431
264 288 304 457
478 666 700 759
423
107 128 150 221 304 309
431 722
272 367
133
288
678
107
175
264
431
660
431
502
304 309 565 674 675
111
202
267
450
661
735
680
113
210
276
452
128
221
277
502
133
244
357
520
150
245
426
521
431
292 304 431 592 725
358
747
102
115
133
283
381
388
431
116
472
132
431
752
389
542
128
502
195
742
756
722
103
117
136
284
382
106
118
137
288
383
107
120
140
292
384
108
129
150
364
385
390
580
140
562
223
744
392
586
286
661
310
745
393 394
707 717
437 440
311 340
746 747
679
272 431
431
102
198
661
264
103 106 107 108 118
383 386 389 392 395
738
714
222
217 284
PHILEX
PHILIPS
PLANTRON
PLATINIUM
PLAYSONIC
POLICOM
POLSAT
POPPY
PORTLAND
PRANDONI PRINCE
PRIMA
PRIMA
PRINCESS
PRINGSTON
PRINZ
PRO BASIC
PRO VISION
PROELCO
PROFEX
PROFILO
PROFITRONIC
PROLINE
PROSCAN
PROSONIC
PROTEC
PROTECH
PROTON
PROVISION
PULSER
PYE
PYMI
Q
QTY1
QUADRO
441
429
107
173
312
423
451
741
431
PANAVISION
PANAVOX
PANORAMA
PANORAMIC
PATHE
PATHE CINEMA
PATHE MARCONI
PAUSA
PCE/PEC
PEACOCK
PENNEY
PERFEKT
PERFORMANCE
PERSHIN
PHILCO
PHOCUS
PHOENIX
PHONOLA
PHONOTREND
PIONEER
737
156
356
742
101
112
132
282
378
P
PACIFIC
PAEL
PALLADIUM
PALSONIC
PANAMA
PANASHIBA
PANASONIC
QUASAR
QUELLE
118
184
336
425
453
122
185
337
426
559
125
292
339
429
660
135
304
340
431
661
141
307
349
433
663
725
58
340
217
103
431
150
150
103
226
233
251
699
150
150
747
135
135
223
150
288
344
288
431
309
356
116
278
711
426
117
375
408
422
431
459
520
410
426
351
687
106
431
539
150
654
414
722
352
150
304
103
361
150
592
150
484
357
662
643
265
106
491
431
161
551
288
484
103
414
150
453
150
426
150
431
406
473
150
103
150
228
269
280
356
386
423
457
660
760
506 510 511 512
106
140
194
228
301
431
521
741
499
107
144
195
244
306
434
586
745
111
150
197
245
357
450
592
752
116
171
198
251
373
452
660
121
173
218
254
425
453
661
128
174
220
265
426
502
709
356 502
244 251 264 414 423 431
221 292 431
132
227
234
254
137
228
235
276
143
229
236
426
144
230
237
431
145 225
231 232
244 250
713
742 747
304 580 586 592
555 641
304 357 592
ROYAL NEC
RUNCO
118 135 137 150 221 264
358 361 431 542 634 707
244
377
413
426
433
471
592
251
403
415
427
437
490
634
269
404
416
428
451
502
725
310
405
417
429
452
518
742
351
407
418
430
453
519
756
431
431
310 347 348 350 409 426
452 534 535 536 537 538
756
292 431
423 484 485
747
431
133 135 137 210 221 284
502 722
288 292 304 431 580
485
150
423
304
484
288
431
414
474
221
106
171
244
272
281
359
389
425
502
661
S
SABA
SAGEM
SAISHO
SAIVOD
SAKIO
SAKURA
SALORA
SAMBERS
SAMPO
SAMSUNG
SAMSUX
SANKY
SANSUI
SANY
SANYO
485
725
431
116
492
502
409
644
RICE CLUB
RMB
ROADSTAR
ROBOTRON
ROOMBASE
ROSITA
ROSNER
ROWA
ROYAL
268 742 747
175
376
409
425
432
463
533
RADIX
RANK
RCA
REALCOLOR
REALISTIC
RECOR
RECORD
RED STAR
REDIFFUSION
REGENTE
RELISYS
REVOX
REX
RFT
128 150 358 722
494 505 516
722
444 455 493 505 517
718
SANYO
SBR
SCHAUB LORENZ
SCHNEIDER
512
221 292 431 722
431 453 708
485 502
304 431 634 725
452
419
643
722
113
173
245
275
282
361
392
426
520
708
423 447 449 469
658 659 712
116
175
251
276
300
363
395
430
521
714
128
177
254
277
301
373
414
431
559
721
135
202
264
278
304
374
419
434
586
738
144
220
267
279
309
383
422
452
592
752
SCHWAIGER
SCOTLAND
SCOTT
SCREENLANT TFT
SEA
SEARS
SEG
SELECO
SEMUA
SENCORA
SENTRA
SERINO
SHARP
SHINTOM
TV
Code-Nr.
431
197
351
210
106
150
708
586
137
288
213
580
426
146
505
106
150
603
361
103
106
720
288
304
141
423
511
245
557
150
213
150
140
431
484
288
103
210
485
752
667
106
559
414
505
150
150
101
119
383
434
210
724
304
106
288
317
324
409
487
725
304
304
150
452
310
106
300
474
580
587
713
351
103
106
220
358
430
450
480
505
476
116
107
442
473
580
135
304
473
103
430
740
304
150
106
667
187
194
301
718
502
304
425
221
137
265
580
426 430 431 459
222 426
292 414 423 431 502
361 367
530 531
Brand
Code-Nr.
SHINTOSHI
SHIVAKI
SHORAI
SHOW
SIAREM
SICATEL
SICE
SIEMENS
502
146
661
150
137
264
244
244
276
459
448
448
351
264
288
592
431
135
473
141
131
502
103
340
542
706
103
346
404
154
431
492
106
152
264
595
150
101
264
167
174
309
523
141
505
107
150
153
304
580
141
290
697
150
150
720
103
292
352
141
155
150
431
150
426
150
106
150
304
150
295
680
150
431
107
301
SIENA
SIERA
SIERRA
SIESTA
SIGMAX
SIGNATURE
SILMA
SILVA SCHNEIDER
431
265 426 431 437
516
137
425 431 457
113 133 268 269 532 738
141 265 268 270 429 542
SILVER
SINGER
SINOTEC
SINUDYNE
150 265 292 336 414 419
426 431 448 453 484 485
SINUDYNE
SKANTIC
SKY
SKY ITALIA
SMARAGD
SNYDER
SOGO
SOLAVOX
SOLE
SONITRON
SONIX
SONOKO
SONOLOR
SONTEC
SONY
141 150 244 265 291 292
485
106
223
722
753
107
245
739
754
117
310
742
755
132
311
744
756
134 137
368 401
745 747
757
128 213 307 309 426 452
660
423 473 484 485 492 494
516 708
292
103
132
386
491
356
150
292
318
325
411
488
106
133
388
580
358
151
296
319
326
426
489
107
282
389
717
359
155
304
320
327
431
502
110
359
391
725
361
156
306
321
328
446
503
111 118
378 379
392 395
502 722
213
315
322
330
452
713
264
316
323
359
462
714
288 292 304 309 426 431
756
137
301
485
581
599
720
431
106
113
268
373
431
451
484
507
150
309
505
582
213
357
516
583
264
414
542
584
268
423
578
585
272
473
579
586
137
137
292
423
442
462
492
516
414
141
351
425
447
465
494
708
423
150
357
426
448
467
502
721 725
110
131
269
402
436
453
485
513
117
132
284
414
437
459
491
515
304 655
465
141
358
708
113
431
742
150
406
720
114
481
752
SOUND & VISION
SOUNDCOLOR
SOUNDESIGN
SOUNDMASTER
SPECTRA
SPECTRICIAN
SR2000
STANDARD
STAR
STAR GENERAL
STARLITE
STARLUX
STASSFURT
STERN
STRATO
STRONG
SUNKAI
SUNRISE
SUNSTAR
SUNWATT
SUNWOOD
SUPERSONIC
SUPERTEC
SUPERTECH
SUPRA
SUPREMACY
SUTRON
SWISSTEC
SYC LINE
SYLVANIA
SYMPHONIC
SYMPHONIE
T
TADISTAR
TALENT
TANDBERG
TANDY
TARGA
TASHIKO
TATUNG
TEAK
TEC
177
414
722
133
718
759
213 221 292
419 423 424
TECHLINE
TECHNICA
268 269 301
723 732 738
TECHNICS
TECHNILAND
TECHNISAT
TECHNOL
TECHNOSONIC
TECHNOTREND
TECHWOOD
TECNIMAGEN
TECNISON
TECO
TEDELEX
TEKNANT
141 592
188 189 190 191 192 193
195 196 197 198 199 223
302 304 426 431 592 628
59
502
244
113
118
329
103
211
437
512
106
113
269
419
288
706
228
431
409
150
429
687
190
422
150
139
150
150
426 452 502
210
728
254
245
277
460
214 542 722
248 251 254 262 275
280 300 304 426 431
472 505 516 735
426 431
265
150 414 429 442 447 465
491 492 494 502 505 516
302
150 221 431 542 722
106
426
559
722
113
429
660
724
131 133 137 175
431 433 448 452
661
741
561 670 689
466
494
580
689
292
103
431
168
175
426
524
722
516
288
581 582 586
431
137
169
177
430
525
170 171 172 173
178 277 301 308
431 520 521 522
527
304
431
150 222
431 502 659 698
502
113 133 268 269 738
660 661
431
431
116 150 431
550 560 561 566 570 670
687 689
304
254
250 414 747
141 197 221 725
303
309
440
516
150
116
735
722
304
634
418
455
541
426
135
425
491
639
431
150
426 429 431
501 505 509
713 725 729
153 220 221
414 423 473 492 494
431
429 706 733
426 431
288 406 414 421 423 473
429 448 485
502
431
431
TV
TV
BRAND LIST STB + SAT
Brand
Code-Nr.
Brand
Code-Nr.
TEKON
TELEAVIA
TELECO
TELEFAC
TELEFUNKEN
150
223
482
150
107
369
703
748
105
110
150
106
244
150
150
103
137
505
105
505
150
121
272
722
150
425
414
566
150
107
278
372
747
106
181
272
351
437
632
752
106
244
426
760
288
150
422
155
698
161
302
414
586
598
288
304
103
431
140
150
426
352
265
141
304
150
VIDITEL
VIEWSONIC
VISION
VISON
VOGELLS
VORTEC
VOXSON
VTQ
292
341 664
121 150
431
569
431
103 133 361 431 502 542
720
TELEKOM
TELEKOM AUSTRIA
TELEOPTA
TELERENT
TELESERVICE
TELESTAR
TELETECH
TELETON
TELEVIDEON
TELEVIEW
TELKOM
TELRA
TEMPEST
TENSAI
TENSON
TESLA
TEVION
THOMAS
THOMSON
THORN
THORN
THORN-FERGUSON
TMK
TOBO
TOKAI
TOKYO
TOSHEBIA
TOSHIBA
TOSONIC
TOTEVISION
TOWADA
TRANSONIC
TRC
TREVI
TRIAD
TRIAX
TRILUX
TRISTAR
TRIUMPH
TRIVISION
U
UHER
ULTRA
ULTRAVOX
UMA
UNIC
UNIC RADIO
UNIMOR
UNITED
UNIVERSUM
UNIVOX
UPC
URANYA
V
VANGUARD
VASILINEC
VECO
VEGA
VESTEL
VEXA
VICTOR
VIDECON
VIDEO SYSTEM
VIDEOLOGIQUE
VIDEOSAT
VIDEOSEVEN
VIDEOTON
VIDION
121
722
725
137
103
264
356
264
106
265
336
106
262
282
414
437
106
470
150
107
150
150
542
116
431
150
206
431
431
141
221
176
104
756
150
288
310 742 745 747
221
374
738
750
276
254
409
221
107
274
392
739
751
278
400
742
752
279
401
745
756
310
431
746
760
311
479
747
761
W
WALKIE
WALTHAM
WARDS
WATSON
457
429 505 516
414 423 517 708
269 738
516
516
135 141 150 213 217 222
426 431 452 502 661 709
431
423
602
288
163
310
376
748
113
216
281
356
502
634
753
113
251
431
761
483
450
678
304
216
356
401
751
118
224
283
376
584
713
756
137
254
726
506
484
688
431
223
368
462
752
132
244
285
425
586
726
761
173
278
745
542
485
708
634
224
369
726
756
133
254
301
426
592
745
706
505 516
725
244
370
742
760
136
272
371
745
761
175
302
431
598
747
309
432
599
751
175 216 224
310 356 376
747 751 756
431 725
288
244
316
423
588
599
304
245
333
426
589
600
247
335
431
590
673
248
336
484
591
684
288
361
485
592
685
301
367
580
593
WATTRADIO
WEGA
WEGAVOX
WELLTECH
WELSTAR
WELTBLICK
WHIRLPOOL
WHITE WESTINGHOUSE
WINDSOR
WINSTON
WINTERNITZ
WIZJA
WORLD OF VISION
WORLD-TECH
WORLDVIEW
Y
YAMAHA
YAMO
YEVICI
YOKAN
YOKO
Others
177 269 357 361 431 457
738
266
437
150
264
292
419
452
222
426
484
175
265
301
423
477
431
485
221
272
309
424
502
542
244
276
356
426
708
722
244 254
307 310
756
251
278
379
430
738
431 707
473 561
459
414 423 426 431 447
722
708
343
426 431 452
116 301 302
103 133 738
431
361 559
542
141
280
747
150 280 414 419 423
485 708
217 502 707 722 724
Z
ZANELA
ZANUSSI
ZENITH
431 452
505
409 426 431 444 708
431
137
279
742
369
217
707
423
431
125 310
YORK
YORX
YOSHITA
YOTAKA
150 502
221
133
278
452
122
431
141
484
137
542
221
485
423
403
141
150
431
128
431
431
141
431
431
135 722
217
106
275
426
269
103
206
121
431
106
301
150
484
414
431
368
121
580
414
150
150
418
314
153
150
254
281
392
431
722
150
431
406 414 415 419 423 424
447 473 474 708
431
107
215
414
580
591 593 611 615 620
135 141 150 153 267 292
580 747
586
116
244
425
621
128
286
426
713
132 138 140 150
309 310 354 376
431 490 502 503
749
STB + SAT
STB + SAT
STB + SAT
Brand
Brand
Brand
Code-Nr.
A
ADB
ALBA
ALDES
ALLSONIC
AMSTRAD
ANKARO
AON
ARCOM
ARCON
ARION
ASCI
AST
ASTON
ASTRA
ASTRO
AUDIOTON
AXIL
AXIS
150
197
195
183
214
183
100
211
202
101
156
196
168
130
200
200
175
183
B
BARCOM
BEST
BLAUPUNKT
BLUEWIN
BOCA
BOOM
BOTECH
BRUNS
BUSH
133
183
227
131
195
102
128
208
197
C
CABLECOM
CABLETIME
CANAL+ CANALSATELLITE
CITYCOM
150
157
193
209
D
DAEWOO
DIGIALITY
DIGITAL
DIGITALSAT
DIGITALWORLD
DNT
DREAM MULTIMEDIA
182
204
129
198
134
220
169
E
ECHOSAT
ECHOSTAR
EINHELL
ELIUM
ELMAK
ELTA
ENGEL
ESKI
EUROPA
EUROSKY
EXATOR
EYCOS
154
186
195
103
199
201
175
128
151
216
197
158
F
FAIRFIELD
FERGUSON
FIDELITY
FINEPASS
FINLANDIA
FINLUX
FONESTAR
FORCE
FRANCE TELECOM
FREECOM
FTE
FUBA
136
192
147
135
206
177
175
159
104
184
187
220
G
GALAXIS
GLOBO
GOLDBOX
GOLDSTAR
GOLDY
GRANADA
GROTHUSEN
GRUNDIG
203
129
172
167
105
130
195
227
H
HAMA
HIRSCHMANN
HITACHI
HOMECAST
HUMAX
HUTH
HYUNDAI
176
225
194
136
223
208
176
Code-Nr.
I
ID DIGITAL
ID SAT
ILLUSION
IMPERIAL
IRIS
ITV
223
198
137
170
106
107
J
JERROLD
JVC
138
171
K
KABEL DIGITAL
KAON
KATEK
KATHREIN
KENWOOD
KJAERULFF
KOSCOM
KOSMOS SAT
KREILING
KYOTO
108
160
152
232
172
204
161
174
152
139
L
LASAT
LEMON
LENCO
LIFESAT
LORENZEN
LUXOR
216
140
195
162
195
206
M
MACAB
MANHATTAN
MASPRO
MATSUI
MAXIMUM
MEDION
METRONIC
MICRO TECHNOLOGY
MICROSOFT
MINERVA
MORGAN S
MOTOROLA
MULTICHOICE
MULTISTAR
MURATTO
141
197
166
163
207
188
182
109
131
227
195
142
110
153
196
N
NECKERMANN
NEUHAUS
NEVELING
NEXT
NIKKO
NOKIA
NOMEX
NORDMENDE
NTL
164
132
111
189
143
230
144
197
112
O
OCEANIC
OCTAGON
OKANO
OPENTEL
OPTEX
ORBIT
ORBITECH
OTF
OTTO VERSAND
145
182
174
154
113
196
212
114
164
P
PACE
PALCOM
PANASONIC
PHILIPS
PHONOTREND
PIONEER
PMB
POLSAT
PROSAT
226
155
146
231
132
172
185
199
151
Q
QUADRAL
QUADRO
QUELLE
183
115
147
R
RADIX
RFT
RIMAX
173
208
116
205
199
206
217
117
196
166
184
118
178
167
215
148
119
201
120
221
167
226
149
210
211
179
121
229
176
T
TBOSTON
TDC KABEL TV
TECHNISAT
TECHSTAR
TELEFUNKEN
TELEKA
TELEMASTER
TELESTAR
TELEVES
TEVION
THOMSON
THORN
TONBURY
TOPFIELD
TOSHIBA
TRAID
TRIAD
TRIAX
185
122
212
123
197
174
153
198
190
155
222
165
124
204
125
196
196
224
U
UNITOR
UNIVERSUM
UPC
133
180
126
V
VISIOPASS
VISIOSAT
VORTEC
V-TECH
104
181
217
196
W
WELA
WISI
WITTENBERG
218
228
166
Y
YUMATU
127
Z
ZEHNDER
ZODIAC
213
191
OTHER BRANDS
OTHERS
233
219
689
118 122 125 310 707 743
60
Code-Nr.
S
SABA
SAGEM
SALORA
SAMSUNG
SANYO
SAT
SATEC
SATPARTNER
SATPLUS
SCHAUB LORENZ
SCHNEIDER
SCHWAIGER
SCIENTIFIC ATLANTA
SEEMANN
SEG
SHARP
SIEMENS
SILVA SCHNEIDER
SKY
SKY ITALIA
SKYMASTER
SMART
SONY
STARSAT
STRONG
SUNNY
61
TV
BRAND LIST TV
TV
Brand
Brand
TV
Code-Nr.
A
A.R.SYSTEMS
ACCENT
ACTION
ADMIRAL
ADYSON
AEG
AIM
AIOSTAY
AIWA
AKAI
AKIRA
AKURA
ALBA
ALBIRAL
ALLORGAN
ALLSTAR
ALTUS
AMSTRAD
ANGLO
ANITECH
ANSONIC
AOC
ARC EN CIEL
ARCON
ARCTIC
ARISTONA
ASA
ASBERG
ASTRA
ASUKA
ATLANTIC
AUDIOSONIC
AUTOVOX
AWA
AXXION
159
211
216
221
219
170
180
100
133
240
132
183
232
189
208
200
172
176
221
219
231
219
191
101
172
180
155
189
183
219
184
183
171
183
136
B
BANG & OLUFSEN
BASIC LINE
BAUR
BEC
BECRESE
BEKO
BELL & HOWELL
BENCHMARK-BEAUMARK
BEON
BEST
BESTAR
BLACKSTRIPE
BLAUPUNKT
BLUE SKY
BOXFORD
BRANDT
BRANDT ELECTRONIQUE
BRAUN
BRIONVEGA
BROCKWOOD
BROKSONIC
BRUNS
BSR
BUSH
133
214
215
144
221
225
195
216
189
168
212
175
230
231
123
224
191
102
153
175
175
168
134
197
C
CAMPLE
CAPEHART
CAPSONIC
CARREFOUR
CENTURY
CGE
CGM
CIE
CIMLINE
CINEX
CIRCUIT CITY
CITIZEN
CLARIVOX
CLATON
CLATRONIC
COLORTYME
COMPUTRON
CONDOR
CONIC
CONRAC
CONTEC
CONTINENTAL EDISON
CROSLEY
CROSSWOOD
CROWN
CRYSTAL
CS ELECTRONICS
CTC CLATRONIC
CURTIS
CURTIS MATHES
175
216
183
189
236
212
136
176
222
231
175
195
210
213
200
216
183
200
216
165
136
151
210
213
236
192
212
200
189
195
Brand
D
DAEWOO
DALCO
DANTAX
DAVIS
DAYTRON
DCE
DE GRAAF
DECA
DECCA
DESMET
DIGITALSAT
DIXI
DMTECH
DREAM MULTIMEDIA
DUAL
DUMONT
DYNATECH
TV
Code-Nr.
181
132
214
156
175
213
184
231
164
183
152
183
145
103
211
236
175
E
ECROM
ELBE
ELBIT
ELCIT
ELECTROHOME
ELECTRONIKA
ELEKTA
ELEKTRONIKA
ELEMIS
ELIN
ELITE
ELMAK
ELMAN
ELTA
E-MAX
EMERSON
EPSON
ERRES
ETRON
EUROLINE
EUROMANN
EUROPHON
EXPERT
213
194
180
183
175
178
219
178
168
239
192
127
134
203
113
225
115
180
203
172
183
210
171
F
FENNER
FERGUSON
FIDELIS
FINLANDIA
FINLUX
FIRST LINE
FISHER
FORCE
FORMENTI
FORTRESS
FRONTECH
FUJITSU
FUJITSU GENERAL
FUNAI
239
250
183
138
233
203
186
113
157
195
221
165
184
195
G
GALAXIS
GALAXY
GBC
GEC
GELOSO
GENERAL
GENEXXA
GERICOM
GITEM
GMG
GOLDSTAR
GOODMANS
GORENJE
GPM
GRADIN
GRAETZ
GRAN PRIX
GRANADA
GRANDIN
GRENADIER
GRONIC
GRUNDIG
GRUNKEL
GTT
200
200
236
185
236
132
183
114
178
200
216
226
168
183
183
185
231
243
214
183
212
242
213
200
H
HAIER
HALLMARK
HANSEATIC
HANTAREX
HARLEY DAVIDSON
HARRAD
HARVARD
HB INGELEN
HCM
146
175
201
236
175
175
175
231
219
Brand
TV
Code-Nr.
HIFIVOX
HINARI
HISENSE
HITACHI
HOHER
HÖHER
HOME ELECTRONICS
HORNYPHON
HUMAX
HYPER
HYPSON
HYUNDAI
IBERVISAO
191
219
104
252
231
158
123
180
147
179
183
160
201
I
ICE
IMA
IMPERIAL
INFRATEX
INGELEN
INNO HIT
INNOHIT
INTERBUY
INTERDISCOUNT
INTERFUNK
INTERVISION
IRRADIO
ISKRA
IST
ISUKAI
ITS
ITT
ITV
179
175
212
173
185
179
179
183
178
206
212
219
134
179
183
179
198
159
J
JACSON
JETPOINT
JRC
JVC
105
192
225
182
K
KAISUI
KAMBROOK
KAPSCH
KARCHER
KATHREIN
KDS
KENDO
KENNEDY
KENWOOD
KEYMAT
KITON
KLH
KNEISSEL
KOLSTER
KONKA
KORPEL
KÖRTING
KTV
KUASHO
KUBA
KUBA ELECTRONIC
183
224
184
219
161
106
222
184
135
139
213
165
194
219
140
212
168
175
219
215
215
L
LAVIS
LEGEND
LENCO
LENOIR
LEYCO
LG
LIESENKÖTTER
LIFETEC
LINITRON
LLOYD S
LOEWE
LOGIK
LÖGIK
LUMA
LUMATRON
LUX-MAY
LUXOR
LXI
148
183
211
203
195
177
206
211
195
175
187
227
141
184
169
225
234
195
M
M ELECTRONICS
MAGNADYNE
MAGNAFON
MAGNASONIC
MAGNAVOX
MAGNUM
MANESTH
MARANTZ
MARK
MASCOM
MATSUI
MEDIATOR
208
236
189
195
180
107
232
157
172
231
227
180
62
Brand
Code-Nr.
MEDION
MELECTRONIC
MEMOREX
MEMPHIS
MERCURY
MERRIT
METZ
MICROMAXX
MINERVA
MIRAI
MITSUBISHI
MITSUBUSHI
MIVAR
MOTOROLA
MTC
MULTICHOICE
MULTITEC
MULTITECH
MURPHY
NAONIS
196
220
195
216
183
185
209
213
161
122
190
213
154
195
175
142
213
221
155
169
N
NEC
NECKERMANN
NEI
NEOVIA
NEWTECH
NIKKAI
NIKKO
NOBLEX
NOBLIKO
NOGAMATIC
NOKIA
NONAME
NORDMENDE
NORTHERN STAR
NOVA
NOVATRONIC
192
235
225
124
183
195
124
132
137
191
248
174
191
108
239
183
O
OCEANIC
OKANO
ONCEAS
ONWA
ORAVA
ORBITECH
ORION
OSAKI
OTAVA
OTTO VERSAND
OVP
208
183
236
179
180
152
241
195
143
249
109
P
PAEL
PALLADIUM
PANAMA
PANASONIC
PATHE
PATHE MARCONI
PCE/PEC
PEACOCK
PENNEY
PHILCO
PHILIPS
PHOENIX
PHONOLA
PIONEER
PLANTRON
PLAYSONIC
POLICOM
PORTLAND
PRANDONI PRINCE
PRIMA
PRINGSTON
PRINZ
PROELCO
PROFEX
PROFILO
PROFITRONIC
PROLINE
PROSONIC
PROTEC
PROTECH
PROTON
PROVISION
PULSER
PYE
137
172
183
223
151
191
175
116
175
210
247
180
180
188
183
231
224
219
236
195
172
157
183
221
231
200
166
150
183
158
175
150
216
192
Q
QUADRO
QUASAR
QUELLE
193
183
251
TV
Code-Nr.
R
RADIO SHACK
RADIOLA
RADIOMARELLI
RADIONETTE
RADIOTONE
RANK
RCA
RECOR
RECORD
RED STAR
REDIFFUSION
REVOX
REX
RFT
ROADSTAR
ROYAL
ROYAL NEC
195
180
128
185
239
155
125
180
178
231
185
189
169
168
214
219
172
S
SABA
SAISHO
SAIVOD
SAKIO
SALORA
SAMBERS
SAMSUNG
SANSUI
SANY
SANYO
SBR
SCHAUB LORENZ
SCHNEIDER
SCOTT
SCREENLANT TFT
SEG
SELECO
SENTRA
SHARP
SHIVAKI
SIAREM
SICATEL
SICE
SIEMENS
SIERRA
SIESTA
SILVA SCHNEIDER
224
163
231
221
220
219
244
192
224
237
180
185
246
135
231
232
222
126
204
178
236
183
161
230
180
168
231
Brand
SILVER
SINGER
SINUDYNE
SKY
SKY ITALIA
SOGO
SONITRON
SONIX
SONOKO
SONOLOR
SONTEC
SONY
SOUND & VISION
SOUNDCOLOR
SOUNDESIGN
SPECTRICIAN
STANDARD
STAR
STARLITE
STERN
SUNKAI
SUNWOOD
SUPERTEC
SUPERTECH
SWISSTEC
SYMPHONIC
T
TALENT
TANDBERG
TANDY
TASHIKO
TATUNG
TEAK
TEC
TECHLINE
TECHNICA
TECHNICS
TECHNISAT
TECHNOL
TECHWOOD
TECNIMAGEN
TECNISON
TEDELEX
TEKNANT
TEKON
TELEAVIA
TV
Code-Nr.
126
236
205
129
110
231
237
122
183
208
212
218
219
231
175
219
236
195
200
169
117
183
183
203
167
175
161
130
195
144
202
211
176
232
170
223
152
211
170
131
200
183
183
216
224
Brand
TV
Code-Nr.
TELEFUNKEN
TELERENT
TELESERVICE
TELESTAR
TELETECH
TELETON
TELEVIEW
TELRA
TENSAI
TESLA
TEVION
THOMAS
THOMSON
THORN
THORN-FERGUSON
TOKAI
TOKYO
TOSHIBA
TOSONIC
TOWADA
TRC
TRIAD
TRIAX
TRILUX
TRIUMPH
228
118
161
152
211
184
231
231
213
236
196
216
229
245
207
157
125
238
175
236
200
192
111
156
119
U
UHER
ULTRAVOX
UMA
UNIMOR
UNITED
UNIVERSUM
UNIVOX
URANYA
171
236
199
156
150
239
236
183
V
VANGUARD
VECO
VESTEL
VEXA
VIDEOSEVEN
VIDEOTON
VIEWSONIC
VISION
VOXSON
175
183
193
183
122
162
112
200
184
Notes:
63
Brand
Code-Nr.
W
WALTHAM
WARDS
WATSON
WATTRADIO
WEGA
WEGAVOX
WELLTECH
WELSTAR
WHIRLPOOL
WHITE WESTINGHOUSE
WINDSOR
WINSTON
WORLD OF VISION
WORLDVIEW
162
182
213
189
186
200
172
145
120
213
214
183
114
192
Y
YAMAHA
YOKO
YORK
149
200
221
Z
ZANELA
ZANUSSI
121
169
OTHER BRANDS
OTHERS
253
217
GB
Note on environmental protection:
After the implementation of the European Directive 2002/96/EU in the national legal system, the
following applies:
Electrical and electronic devices may not be disposed of with domestic waste.Consumers are
obliged by law to return electrical and electronic devices at the end of their service lives to the
SXEOLFFROOHFWLQJSRLQWVVHWXSIRUWKLVSXUSRVHRUSRLQWRIVDOH'HWDLOVWRWKLVDUHGH¿QHGE\WKH
national law of the respective country. This symbol on the product, the instruction manual or
the package indicates that a product is subject to these regulations. By recycling, reusing the
materials or other forms of utilising old devices, you are making an important contribution to
protecting our environment.
D
Hinweis zum Umweltschutz:
Ab dem Zeitpunkt der Umsetzung der europäischen Richtlinie 2002/96/EU in nationales Recht
gilt folgendes:
Elektrische und elektronische Geräte dürfen nicht mit dem Hausmüll entsorgt werden. Der
9HUEUDXFKHU LVW JHVHW]OLFK YHUSÀLFKWHW HOHNWULVFKH XQG HOHNWURQLVFKH *HUlWH DP (QGH LKUHU
Lebensdauer an den dafür eingerichteten, öffentlichen Sammelstellen oder an die Verkaufstelle
zurückzugeben. Einzelheiten dazu regelt das jeweilige Landesrecht. Das Symbol auf dem
Produkt, der Gebrauchsanleitung oder der Verpackung weist auf diese Bestimmungen hin. Mit
GHU :LHGHUYHUZHUWXQJ GHU VWRIÀLFKHQ 9HUZHUWXQJ RGHU DQGHUHU )RUPHQ GHU 9HUZHUWXQJ YRQ
Altgeräten leisten Sie einen wichtigen Beitrag zum Schutz unserer Umwelt.
F
Remarques concernant la protection de l‘environnement :
&RQIRUPpPHQW j OD GLUHFWLYH HXURSpHQQH &( HW D¿Q G‹DWWHLQGUH XQ FHUWDLQ QRPEUH
G‹REMHFWLIV HQ PDWLqUH GH SURWHFWLRQ GH O‹HQYLURQQHPHQW OHV UqJOHV VXLYDQWHV GRLYHQW rWUH
appliquées.
(OOHVFRQFHUQHQWOHVGpFKHWVG‹pTXLSHPHQWpOHFWULTXHVHWpOHFWURQLTXHV/HSLFWRJUDPPHÄSLFWR³
SUpVHQW VXU OH SURGXLW VRQ PDQXHO G‹XWLOLVDWLRQ RX VRQ HPEDOODJH LQGLTXH TXH OH SURGXLW HVW
soumis à cette réglementation. Le consommateur doit retourner le produit usager aux points
GH FROOHFWH SUpYXV j FHW HIIHW ,O SHXW DXVVL OH UHPHWWUH j XQ UHYHQGHXU(Q SHUPHWWDQW HQ¿Q OH
recyclage des produits, le consommateur contribuera à la protection de notre environnement.
&‹HVWXQDFWHpFRORJLTXH
I
Informazioni per protezione ambientale:
Dopo l‘implementazione della Direttiva Europea 2002/96/EU nel sistema legale nazionale, ci sono
le seguenti applicazioni:
,GLVSRVLWLYLHOHWWULFLHGHOHWWURQLFLQRQGHYRQRHVVHUHFRQVLGHUDWLUL¿XWLGRPHVWLFL,FRQVXPDWRUL
VRQR REEOLJDWL GDOOD OHJJH D UHVWLWXLUH , GLVSRVLWLYL HOHWWULFL HG HOHWWURQLFL DOOD ¿QH GHOOD ORUR YLWD
utile ai punti di raccolta collerici preposti per questo scopo o nei punti vendita. Dettagli di quanto
ULSRUWDWRVRQRGH¿QLWLGDOOHOHJJLQD]LRQDOLGLRJQLVWDWR4XHVWRVLPERORVXOSURGRWWRVXOPDQXDOH
d‘istruzioni o sull‘imballo indicano che questo prodotto è soggetto a queste regole. Dal riciclo, e
re-utilizzo del material o altre forme di utilizzo di dispositivi obsoleti, voi renderete un importante
contributo alla protezione dell‘ambiente.
E
Nota sobre la protección medioambiental:
Después de la puesta en marcha de la directiva Europea 2002/96/EU en el sistema legislativo
nacional, Se aplicara lo siguiente:
Los aparatos eléctricos y electrónicos, así como las pilas y las pilas recargables, no se deben
evacuar en la basura doméstica. El usuario está legalmente obligado a llevar los aparatos
HOpFWULFRV\HOHFWUyQLFRVDVtFRPRSLODV\SLODVUHFDUJDEOHVDO¿QDOGHVXYLGDWLODORVSXQWRVGH
UHFRJLGDFRPXQDOHVRDGHYROYHUORVDOOXJDUGRQGHORVDGTXLULy/RVGHWDOOHVTXHGDUDQGH¿QLGRV
por la ley de cada país. El símbolo en el producto, en las instrucciones de uso o en el embalaje
hace referencia a ello. Gracias al reciclaje, al reciclaje del material o a otras formas de reciclaje
de aparatos usados, contribuye Usted de forma importante a la protección de nuestro medio
ambiente.
NL
Notitie aangaande de bescherming van het milieu
Ten gevolge van de invoering van de Europese Richtlijn 2002/96/EU in het nationaal juridisch
system, is het volgende van toepassing:
Electrische en electronische toestellen mogen niet weggegooid worden tesamen met het
huishoudelijk afval. Consumenten zijn wettelijk verplicht om electrische en elctronische
apparaten op het einde van gebruik in te dienen bij openbare verzamelplaatsen speciaal opgezet
YRRU GLW GRHOHLQGH RI ELM HHQ YHUNRRSSXQW 9HUGHUH VSHFL¿FDWLHV DDQJDDQGH GLW RQGHUZHUS
zijn omschreven door de nationale wet van het betreffende land. Dit symbool op het product,
de gebruiksaanwijzing of de verpakking duidt erop dat het product onderworpen is aan deze
richtlijnen. Door te recycleren, hergebruiken van materialen of andere vormen van hergebruiken
van oude toestellen, levert u een grote bijdrage aan de bescherming van het mileu.
64
992 797 00
Was this manual useful for you? yes no
Thank you for your participation!

* Your assessment is very important for improving the work of artificial intelligence, which forms the content of this project

Download PDF

advertising