Installation & Operating Manual
NOTICE: SAVE THESE INSTRUCTIONS
!
WARNING
HOT SURFACES!
Glass and other surfaces are hot during
operation and cool down.
Model(s):
Accentra Pellet Insert
Hot glass will cause burns.
• Do not touch glass until it is cooled
• NEVER allow children to touch glass
• Keep children away
• CAREFULLY SUPERVISE children in same room as
stove.
• Alert children and adults to hazards of high temperatures.
High temperatures may ignite clothing or other
flammable materials.
• Keep clothing, furniture, draperies and other flammable
materials away.
NOTE
To obtain a French translation of this manual, please
contact your dealer or visit www.harmanstoves.com
Pour obtenir une traduction française de ce manuel, s’il
vous plaît contacter votre revendeur ou visitez www.
harmanstoves.com
Contact your local dealer with questions on installation,
operation or service.
This Fireplace insert may be installed into a masonry fireplace, an approved manufactured wood burning fireplace
(see page 25), Or, It may be built in to a wall or mantle system when using the optional zero clearance cabinet (see
page 26).
SAFETY NOTICE
Please read this entire manual before you install and use your new room heater. Failure to
follow instructions may result in property damage, bodily injury, or even death.
FOR USE IN THE U.S. AND CANADA. SUITABLE FOR INSTALLATION IN MOBILE HOMES
IF THIS appliance IS NOT PROPERLY INSTALLED, A HOUSE FIRE MAY RESULT. FOR YOUR SAFETY, FOLLOW
INSTALLATION DIRECTIONS. Do not use makeshift compromises.
CONTACT LOCAL BUILDING OR FIRE OFFICIALS ABOUT RESTRICTIONS AND INSTALLATION INSPECTION
REQUIREMENTS IN YOUR AREA.
Contact your local authority (such as municipal building department, fire department, fire
prevention bureau, etc.) To determine the need for a permit.
Cette guide d'utilisation est disponible en francais. Chez votre concessionnaire de Harman.
Save these instructions.
3-90-00674R27_IR11_03/14
5.75”
Modèle:ACCENTRAINSERT
Appareildechauffageàgranulésdebois
Serial No.
No de série:
E
PREVENTION DES INCENDIES
Respecter scrupuleusement les instructions du constructeur pour
l’installation et les consignes de fonctionnement. Respecter les
règles de sécurité en vigueur dans votre région.
AVERTISSEMENT POUR MOBILE HOMES : Ne pas installer dans
une chambre. Il est impératif de prévoir une prise d’air extérieur.
L’intégrité structurale du plancher, du plafond et des murs doit être
strictement préservée.
Se reporter aux instructions du fabricant et aux réglementations
spécifiques locales concernant les précautions requises lors de la
traversée d’un mur ou d’un plafond.
Contrôler et nettoyer fréquemment tout le système d’évacuation des
fumées conformément aux recommandations du constructeur.
Réaliser l’évacuation des fumées en utilisant des conduits « Spécial
granulés » de Ø 125 mm ou de la gaine flexible inox double peau
Ø 125 mm à l’aide d’un adaptateur adéquat comme indiqué dans la
notice d’utilisation.
Ne pas raccorder ce poêle à un conduit de cheminée déjà utilisé
pour un autre appareil.
FONCTIONNE EXCLUSIVEMENT AVEC DES GRANULES DE BOIS.
Consommation maximum : 2,27 kg/h
Caractéristiques électriques :
240 VAC – 50 Hz – Intensité au démarrage 2,0 A
Intensité fonctionnement normal 1,1 A
Tenir le cordon d’alimentation à l’écart du poêle.
DANGER : Risque d’électrocution. Débrancher l’appareil avant toute
intervention.
Pour une information plus complète, se reporter à la notice
d’utilisation.
Ne remplacer la vitre qu’avec une vitre céramique 5 mm de même
qualité disponible auprès de votre revendeur.
Tenir la porte frontale et le couvercle de trémie hermétiquement clos
durant le fonctionnement de l’appareil.
Puissance calorifique émise: Nominale: 10,5 KW Réduite: 1,8 KW
Concentration CO (à 13 % O2)
à puissance nominale: < 0,02 % à puissance réduite: < 0,04 %
Rendement: à puissance nominale: 84 % à puissance réduite: 73%
SA
DANGER: Risk of electrical shock. Disconnect power supply before
servicing.
For further instruction refer to owner’s manual.
Replace glass only with 5mm ceramic available from your dealer.
Keep viewing and ash removal doors tightly closed during operation.
MINIMUM CLEARANCES TO COMBUSTIBLE MATERIAL
Non-combustible floor protector must extend 6” (152 mm) to
the sides and front of the unit, measured from the glass face
(US).
US Environmental Protection Agency
This model is exempt from EPA Certification under 40 CFR 60.531
by definition (wood heater(A) “Air-to-Fuel Ratio”)
Agence Américaine pour la Protection de l’Environnement
Ce modèle est dispensé par EPA certification d’après
40 CFR 60.531 par définition
[ Appareil à bois (A) « Ratio air/combustible »]
352 Mountain House Road
Halifax PA 17032 ( USA)
ECARTS MINIMUM DE SÉCURITÉ
La protection de sol doit être constituée de matériau
incombustible et s’étendre de 457 mm (18”) à l’avant et
203 mm (8”) sur les côtés (CANADA).
12” (305mm) Mantel/Manteau de Cheminée
Sidewall/Mur de Côté
Route power cord away from unit.
BARCODE LABEL
M
Emission of CO in Combustion:
Nominal Heat Output: <.02%, Reduced Heat Output: <.04%
Flue Gas Temperature: 224 C
Thermal Output: 10.5kW
Energy Efficiency: Nominal: 84%, Reduced: 73%
008
PL
Test réalisés par OMNI-Test Laboratories, Inc.
Report #/Rapport #135-S-12-2, 135-S-12b-6
Tested to/Testé à: ASTM E1509-04, ULC/ORD-C1482-M1990,
ULC-S628-93
This pellet burning appliance has been tested and listed for use in
Manufactured Homes in accordance with
OAR 814-23-900 through 814-23-909
Normes Européennes:
NF EN 14785 CETIAT – Déc. 2006
AEMC MESURES EN 50366 – Déc. 2006
EMITECH, APAVE & BFP Electronique – Février 2004
EN 55014-1, EN 55014-2, EN 61000-3-2, EN 61000-3-3
“Prevent House Fires”
Install and use only in accordance with the manufacturer’s installation and operation instructions. Contact local building or fire officials
about restrictions and inspection in your area.
WARNING: FOR MANUFACTURED HOMES: Do not install appliance in a sleeping room. An outside combustion air inlet must be
provided. The structural integrity of the manufactured home floor,
ceiling and walls must be maintained.
Refer to manufacturer’s instructions and local codes for precautions
required for passing chimney through a combustible wall or ceiling.
Inspect and clean exhaust venting system frequently in accordance
with manufacturer’s instructions.
Use a 3” or 4” diameter type “L” or “PL” venting system, or 4” stainless steel flex as per owner’s manual.
Do not connect this unit to a chimney flue servicing another appliance.
FOR USE WITH PELLETIZED WOOD FUEL OR UP TO A 50%
CORN AND PELLET MIXTURE ONLY.
Input Rating Max: 5 lb. fuel/hr.
Electrical Rating: 240 VAC, 50 Hz, Start 2.0 AMPS, Run 1.1 AMPS
US Electrical Rating: 115 VAC, 60 Hz, Start 4.1 AMPS, Run 2.1 AMPS
Trim/Panneau de Moulure
A. Insert Body to side wall - 10” (254 mm)
B. Insert Body to 12” (305mm) Mantel/ Manteau de
Cheminée - 12” (305 mm)
C. Insert Body to combustible trim above - 3/4” (19 mm)
DO NOT REMOVE THIS LABEL/NE PAS
ENLEVER CETTE ÉTIQUETTE
MADE IN THE USA /FABRIQUÉ AUX USA
D. Insert Body to side trim - 6” (152 mm)
E. Floor protection. Measured from glass. - 6” (U.S.) -OR
8” (203mm) to sides and 18” (457mm) in front (CANADA)
Date of Manufacture / Date de fabrication
2013 2014 2015 JAN FEB MAR APR MAY JUN JUL AUG SEP OCT NOV DEC
P.N. 3-90-00676
Manufactured by/Fabriqué par: Hearth and Home Technologies
Rev D
IGN
11”
Portland
Oregon uSA
Tested and
listed by
Introduction
3
The Accentra Pellet Insert will give you more heat, better temperature control and a level of convenience you won’t find in
any other pellet burning insert. The Accentra Insert’s many outstanding features make it the best value pellet insert on the
market today.
The Accentra’s versatile design lets you convert a heat wasting fireplace into an efficient heating source. The Accentra Insert
could also be a fireplace hearth for your home that doesn’t require a chimney. A special zero clearance fireplace kit converts
the Accentra insert into a fireplace that can be placed in virtually any corner or against any wall of your home. The Accentra’s on-board microprocessor constantly senses room temperature and automatically makes adjustments in the
feed rate and air supply so you get just the right amount of heat 24 hours a day. This remarkable technology lets you fill the
hopper, set the desired temperature and walk away. The Accentra insert lights automatically, brings the room up to the exact
temperature and will turn off if no heat is required. No other pellet insert offers such accurate and trouble free temperature
control. The control technology gives you the widest heat output range of any insert on the market making it an ideal choice
to take the chill off in the spring and fall and to heat your home during the coldest months of the winter.
As with all Harman pellet stoves, maintenance is minimal and cleaning is easy. The Accentra Insert lets you burn close to a
ton of pellets before ash removal is needed. And what is even better, the Harman Insert Track System lets you slide the insert
out of the fireplace so that it can be cleaned or serviced without having to disconnect the venting system. This innovative
design is only available on Harman pellet inserts and lets you easily reach key components for cleaning.
5.75”
Please copy your serial number from
the label on your stove to the box below.
Modèle:ACCENTRAINSERT
Tested and
listed by
Portland
Oregon uSA
Appareildechauffageàgranulésdebois
Serial No.
No de série:
Test réalisés par OMNI-Test Laboratories, Inc.
Report #/Rapport #135-S-12-2, 135-S-12b-6
BARCODE LABEL
Tested to/Testé à: ASTM E1509-04, ULC/ORD-C1482-M1990,
ULC-S628-93
This pellet burning appliance has been tested and listed for use in
PREVENTION DES INCENDIES
Manufactured Homes in accordance with
Respecter scrupuleusement les instructions du constructeur pour
OAR 814-23-900 through 814-23-909
l’installation et les consignes de fonctionnement. Respecter les
Normes Européennes:
règles de sécurité en vigueur dans votre région.
NF EN 14785 CETIAT – Déc. 2006
AVERTISSEMENT POUR MOBILE HOMES : Ne pas installer dans
AEMC MESURES EN 50366 – Déc. 2006
une chambre. Il est impératif de prévoir une prise d’air extérieur.
EMITECH, APAVE & BFP Electronique – Février 2004
L’intégrité structurale du plancher, du plafond et des murs doit être
EN 55014-1, EN 55014-2, EN 61000-3-2, EN 61000-3-3
strictement préservée.
“Prevent House Fires”
Se reporter aux instructions du fabricant et aux réglementations
Install and use only in accordance with the manufacturer’s installaspécifiques locales concernant les précautions requises lors de la
tion and operation instructions. Contact local building or fire officials
traversée d’un mur ou d’un plafond.
about restrictions and inspection in your area.
Contrôler et nettoyer fréquemment tout le système d’évacuation des
WARNING: FOR MANUFACTURED HOMES: Do not install applifumées conformément aux recommandations du constructeur.
ance in a sleeping room. An outside combustion air inlet must be
Réaliser l’évacuation des fumées en utilisant des conduits « Spécial
provided. The structural integrity of the manufactured home floor,
granulés » de Ø 125 mm ou de la gaine flexible inox double peau
ceiling and walls must be maintained.
Ø 125 mm à l’aide d’un adaptateur adéquat comme indiqué dans la
Refer to manufacturer’s instructions and local codes for precautions
notice d’utilisation.
required for passing chimney through a combustible wall or ceiling.
Ne pas raccorder ce poêle à un conduit de cheminée déjà utilisé
Inspect and clean exhaust venting system frequently in accordance
pour un autre appareil.
with manufacturer’s instructions.
FONCTIONNE EXCLUSIVEMENT AVEC DES GRANULES DE BOIS.
Use a 3” or 4” diameter type “L” or “PL” venting system, or 4” stainConsommation maximum : 2,27 kg/h
less steel flex as per owner’s manual.
Caractéristiques électriques :
Do not connect this unit to a chimney flue servicing another ap240 VAC – 50 Hz – Intensité au démarrage 2,0 A
pliance.
Intensité fonctionnement normal 1,1 A
FOR USE WITH PELLETIZED WOOD FUEL OR UP TO A 50%
Tenir le cordon d’alimentation à l’écart du poêle.
CORN AND PELLET MIXTURE ONLY.
DANGER : Risque d’électrocution. Débrancher l’appareil avant toute
Input Rating Max: 5 lb. fuel/hr.
intervention.
Electrical Rating: 240 VAC, 50 Hz, Start 2.0 AMPS, Run 1.1 AMPS
Pour une information plus complète, se reporter à la notice
US Electrical Rating: 115 VAC, 60 Hz, Start 4.1 AMPS, Run 2.1 AMPS
d’utilisation.
Ne remplacer la vitre qu’avec une vitre céramique 5 mm de même
Emission of CO in Combustion:
qualité disponible auprès de votre revendeur.
Nominal Heat Output: <.02%, Reduced Heat Output: <.04%
Tenir la porte frontale et le couvercle de trémie hermétiquement clos
Flue Gas Temperature: 224 C
durant le fonctionnement de l’appareil.
Thermal Output: 10.5kW
Puissance calorifique émise: Nominale: 10,5 KW Réduite: 1,8 KW
Energy Efficiency: Nominal: 84%, Reduced: 73%
Concentration CO (à 13 % O2)
Route power cord away from unit.
à puissance nominale: < 0,02 % à puissance réduite: < 0,04 %
DANGER: Risk of electrical shock. Disconnect power supply before
Rendement: à puissance nominale: 84 % à puissance réduite: 73%
servicing.
For further instruction refer to owner’s manual.
ECARTS MINIMUM DE SÉCURITÉ
Replace glass only with 5mm ceramic available from your dealer.
La protection de sol doit être constituée de matériau
Keep viewing and ash removal doors tightly closed during operation.
incombustible et s’étendre de 457 mm (18”) à l’avant et
008
US Environmental Protection Agency
This model is exempt from EPA Certification under 40 CFR 60.531
by definition (wood heater(A) “Air-to-Fuel Ratio”)
Agence Américaine pour la Protection de l’Environnement
Ce modèle est dispensé par EPA certification d’après
40 CFR 60.531 par définition
[ Appareil à bois (A) « Ratio air/combustible »]
352 Mountain House Road
Halifax PA 17032 ( USA)
11”
Table of Contents
203 mm (8”) sur les côtés (CANADA).
12” (305mm) Mantel/Manteau de Cheminée
Sidewall/Mur de Côté
MINIMUM CLEARANCES TO COMBUSTIBLE MATERIAL
Non-combustible floor protector must extend 6” (152 mm) to
the sides and front of the unit, measured from the glass face
(US).
sERIAL nUMBER
Hearth & Home Technologies
352 Mountain House Road
Halifax, PA 17032
www.harmanstoves.com
Trim/Panneau de Moulure
A. Insert Body to side wall - 10” (254 mm)
B. Insert Body to 12” (305mm) Mantel/ Manteau de
Cheminée - 12” (305 mm)
D. Insert Body to side trim - 6” (152 mm)
E. Floor protection. Measured from glass. - 6” (U.S.) -OR
8” (203mm) to sides and 18” (457mm) in front (CANADA)
Date of Manufacture / Date de fabrication
2013 2014 2015 JAN FEB MAR APR MAY JUN JUL AUG SEP OCT NOV DEC
P.N. 3-90-00676
Manufactured by/Fabriqué par: Hearth and Home Technologies
4
Manual Operation6
ESP Control8
Assembly & Installation 9
Venting
21
Maintenance28
C. Insert Body to combustible trim above - 3/4” (19 mm)
DO NOT REMOVE THIS LABEL/NE PAS
ENLEVER CETTE ÉTIQUETTE
MADE IN THE USA /FABRIQUÉ AUX USA
Automatic Operation
Rev D
IGN
Appliance Certification.
Model: Accentra Insert
Test Lab: Omni-Test Laboratories
Type: Pellet Burning Fireplace Insert / Room Heater
Standard(s): ASTM E1509-04, ULC S628-93 and ULC
C1482-M1990. In accordance with OAR 814-23-900
through 814-23-909
Report #: 135-S-12-2
Trouble-Shooting
33
Specifications
34
Wiring Diagram
35
Warranty
36
Power Failures / Back-up
38
Fuel Specifications
39
Corn / Pellet Mixture
40
Note: This appliance is also approved for installation into a
shop.
3-90-00674R27_IR11_03/14
Automatic Start Up
4
Starting First Fire
Igniter Switch to "AUTO" (up position)
Make sure the unit is plugged into a properly grounded, 240
VAC, 50 Hz electrical source. The power light should be the
only light lit.
See Note 7.
1"
Fig. 1
Note: Be sure there is no fuel or other combustibles in
the ash pan prior to lighting.
1. Turn Mode Selector to "OFF".
2. Fill hopper with pellets.
3. Clean burn pot with scraper, if necessary.
4. If starting after an empty hopper, turn Feed Adjuster to
"TEST" (for one 60 second cycle).2 This will flow pellets
into the auger tube and also allow you to check the motors
for operation. NOTE: The auger motor will not operate
with the view door or hopper lid open.
5. Turn Feed Adjuster to #4.4
Fig. 2
6. Flip the Igniter Switch up into the "AUTO" position.
7. Turn the Temperature Dial to the desired room temperature.
1. Fines are small pieces of broken pellets (sawdust). Fines do
not flow easily and often build up on the hopper funnel bottom
angles. These fines can be pushed into the feeder opening and
then fill the hopper with pellets. As the system works, they will
be burned.
2. The "TEST" cycle will operate the feed motor for exactly one
minute. Turning to "TEST" again and again may load too much
fuel into the burn pot causing excessive smoke on start-up.
3. The firebox low pressure switch will not allow the auger motor
or the igniter element to operate if the view door is open.
4. Adjust Feed Rate. If this is your first fire or you are trying different
pellets, set the feed adjuster to #4, Fig. 1. This is a conservative
number and will probably need to be increased. After you know
a feed rate setting that works well, use that setting. Remember,
if your feed rate is too high you may waste fuel.
5. This is usually a weekly maintenance procedure. Cleaning the
burn pot with the scraper with a small amount of new fuel in the
bottom is not a problem. First, scrape the ashes off the front of
the burn pot into the ash pan. Then scrape the holed surface
downward into the burn pot. When the stove feeds, these
scrapings will be pushed out by the feeder.
6. The ash pan can hold the ashes from approximately 1 ton of
premium fuel. This means the ashes will only need to be emptied
a few times a year.
7. Setting the feed adjuster # for maximum burn: With the unit
burning in "AUTO", turn to "Stove Mode" and put the fan on
"H". Set the Temperature Dial to #7. Allow the unit to burn for
about 30 minutes and check ash on front of burn pot. Fig. 2.
If the ash line is larger than 1", turn the feed adjuster from #4
to #5. Allow another 30 minutes of burn time and check again.
If, at #6 setting, a 1" or less ash bed is not obtainable, it is not
a problem. The 1" ash bed is only at maximum burn rate and
during normal operation, the ash bed will be larger.
8. Turn Mode Selector to Room Temperature or Stove
Temperature.
9. Fill hopper with pellets and remove ashes as required.
Keep the hopper lid and firebox doors closed while in
operation. Maintain door seals in good condition. Failure to
do so will affect operation of the appliance and may permit
escape of smoke or gases into the living space.
Warning
Burning garbage, use of improper fuels,
fire starters or altering the stove For
higher heat output may cause damage to the
stove And could result in a House fire. Use
only approved fuels And follow only these
operation guidelines.
Warning
NEVER USE GASOLINE, GASOLINE-TYPE LANTERN
FUEL, KEROSENE, CHARCOAL LIGHTER FLUID, OR
SIMILAR LIQUIDS TO START OR 'FRESHEN UP' A FIRE
IN THIS HEATER. KEEP ALL SUCH LIQUIDS WELL
AWAY FROM THE HEATER, WHILE IN USE.
3-90-00674R27_IR11_03/14
Automatic Ignition/Operation
5
The Accentra Insert is more than just automatic ignition, it is
also automatic temperature control. The automatic system will
allow the fire size to be adjusted to match the heating needs
and even put the fire out if necessary. If heat is needed after
the fire is out, the Accentra Insert will automatically re-ignite
and adjust the fire size to match the heating need. The totally
automatic room sensor mode is recommended because of
its efficiency. The unit can be switched between "AUTO" and
"MANUAL" at any time during operation.
Igniter switch to "AUTO"
Room Temperature Mode
In "Room Temp Mode" heat output is controlled automatically
by the Room Sensing Probe. When the Room Sensing Probe
calls for heat, the stove will increase output. When the Room
Sensing Probe is getting close to the set temperature, the
stove will begin to level off output and keep the fire burning
at just the right temperature to maintain that setting.
Fig. 3
Room Temperature Mode: This setting will produce a room temperature
of 70 degrees with the distribution blower at medium speed.
Stove Temperature Mode
High output is determined by the feed rate setting. This
setting, generally on #4, can be increased if higher burn rates
are necessary (Fig. 1). The unit's maximum burn rate should
not create less than 1" of ash on the burn pot front edge(See
Fig. 2). Overfeeding is not a safety concern, but fuel may be
wasted if unburned pellets fall into the ash pan.
In "Room Temp Mode" a constant fuel consumption rate is
sacrificed for exact room temperature. Therefore, as it gets
colder more pellets will be burned automatically.
The distribution blower speed will vary according to the
position of the mode selector pointer, and fire size. Igniter switch to "AUTO"
This setting will produce medium heat with the
distribution blower on "low".
Stove Temperature Mode
This allows for automatic ignition upon start-up only. The unit
can then be set at any desired setting. The heat output and
fuel consumption will remain constant regardless of room
temperature (See Fig 4). The unit's maximum feed rate
should not create less than 1" of ash on the burn pot front
edge. See Fig 2.
The unit's low burn or maintenance setting is as low as it will
go. It will not go out unless it runs out of fuel or is turned off.
Shut-Down Procedure
To kill the fire or stop burning the stove, turn the Mode
Selector to "OFF". This will cause the fire to diminish and
burn out. When the fire burns out and the stove cools down
everything will stop.
If you pull the plug to shut down the stove, all motors will stop.
This may cause incomplete combustion and smoke in the
firebox. If the load door is opened, the smoke may escape.
The best way to shut down the stove is simply let it run out
of pellets, then the stove will shut down automatically.
This setting will produce continuous maximum heat
output with the distribution blower at full speed.
Fig. 4
3-90-00674R27_IR11_03/14
Manual Start Up
6
Starting First Fire
Fig. 6
Igniter Switch to "MANUAL" (down position) Make
sure the unit is plugged into a 240 VAC, 50 Hz electrical
source. The power light should be the only light lit.
NOTE: Be sure there is no fuel or other combustibles in
the ash pan prior to lighting.
1.Turn FEED ADJUSTER to desired feed rate. No. 4 is good
for most pellets.
Fig. 5
See Note 7.
1"
2.Turn the Mode Selector to “OFF” and then to the
desired mode. This will reset control and start the
combustion motor.
3.Turn the Temperature Dial to the desired setting.
4.Clean burn pot with scraper if necessary.
5.Fill burn pot with pellets, only level with front edge. (Do
Not Over Fill).
6.Add starting gel on top of the pellets. Stir gel into pellets
for fast lighting.
Fig. 7
7.Light starting gel with a match, and close the door. Operation will begin when the fire reaches the proper
temperature.
8.Fill hopper with pellets and remove ashes as required.
1. Fines are small pieces of broken pellets (sawdust). Fines do
not flow easily and often build up on the hopper funnel bottom
angles. These fines can be pushed into the feeder opening and
then fill the hopper with pellets. As the system works, they will
be burned.
2. The "TEST" cycle will operate the feeder motor for exactly one
minute. Turning to "TEST" again and again may load too much
fuel into the burn pot causing excessive smoke on start-up.
3. The firebox low pressure switch will not allow the auger motor
or the igniter element to operate if the view door or the hopper
lid are open.
4. Adjust Feed Rate. If this is your first fire or you are trying different
pellets, set the feed adjuster to #4, Fig. 5. This is a conservative
number and will probably need to be increased. After you know
a feed rate setting that works well, use that setting. Remember,
if your feed rate is too high you may waste fuel.
5. This is usually a weekly maintenance procedure. Cleaning the
burn pot with the scraper with a small amount of new fuel in the
bottom is not a problem. First, scrape the ashes off the front of
the burn pot into the ash pan. Then scrape the holed surface
downward into the burn pot. When the stove is ignited these
scrapings will be pushed out by the feeder.
6. The ash pan can hold the ashes from approximately 1 ton of
premium fuel. This means the ashes will only need to be emptied
a few times a year.
Store fuel in a dry area, away from all ignition sources and
outside all limits of the stove's clearance requirements to
combustibles. Do not store the fuel were it interferes with
the refueling of the stove or emptying of ashes. Do not store
any ashes removed from the stove near the fuel or other
combustible materials.
Warning
Burning garbage, use of improper fuels,
fire starters or altering the stove For
higher heat output may cause damage to the
stove And could result in a House fire. Use
only approved fuels And follow only these
operation guidelines.
Warning
NEVER USE GASOLINE, GASOLINE-TYPE LANTERN
FUEL, KEROSENE, CHARCOAL LIGHTER FLUID, OR
SIMILAR LIQUIDS TO START OR 'FRESHEN UP' A FIRE
IN THIS HEATER. KEEP ALL SUCH LIQUIDS WELL
AWAY FROM THE HEATER WHILE IN USE.
7. Setting the feed adjuster # for maximum burn: With the unit
burning in "AUTO", turn to "Stove Mode" and put the fan on
"H". Set the Temperature Dial to #7. Allow the unit to burn for
about 30 minutes and check ash on front of burn pot. Fig. 9. If
the ash line is larger than 1", turn the feed adjuster from #4 to
#5. Allow another 30 minutes of burn time and check again. If
, at #6 setting, a 1" or less ash bed is not obtainable, it is not
a problem. The 1" ash bed is only at maximum burn rate and
during normal operation, the ash bed will be larger.
3-90-00674R27_IR11_03/14
Manual Ignition/Operation
7
The Accentra Insert is capable of manual operation. This also allows the operator to manually
control operation during an emergency (i.e. igniter failure, when using a 502H battery backup,
or when using certain generators.)
The unit can be switched between "AUTO" and "MANUAL" at any time during operation.
NOTE: When starting the unit in the "AUTO" mode
and switching to "MANUAL", you may switch at any
time. Once an ignition cycle is started, it will continue
regardless of mode.
Igniter Switch to "MANUAL"
Room Temperature Mode
The fire will have to be lit with starting gel and a match, or
started automatically, see "Automatic Operation". Turn to
"Manual" position once the start cycle begins.
Room Temperature Mode: This setting will produce a room temperature
of 70 degrees with the distribution blower at medium speed.
Fig. 8
The difference between "AUTO" Room Temperature Mode
and "Manual" Room Temperature Mode is that the fire will not
go out as the room temperature goes above the control board
setting. The unit can only go to low burn and will remain there
until it runs out of fuel or until more heat is needed and the
feed rate increases. Feed rate adjustments and dial settings
are the same as "AUTO" settings.
Igniter Switch to "MANUAL"
Manual Stove Temperature Mode
Stove Temperature Mode
The advantage of this mode is to allow the operator to have
a large viewing fire without blowing extra heat into the room.
During operation, with the temperature dial set at #4 or less,
the distribution fan will not operate. A #4 on the temperature
dial and a #4 on the feed adjuster is approximately 80%
output. It is not necessary to operate the distribution blower
below this point. Therefore, there can be a higher feed rate
( a larger viewing fire) without an excess of hot air blowing
into the room.
This setting will produce a large viewing fire without a distribution
blower operating.
Fig. 9
An example of when to use the Manual Stove Temperature
Mode is if you want to watch a large fire and the room is
already up to temperature. The Stove Temperature Mode
allows you to have a larger fire and a lower sound level,
without the distribution blower.
NOTE: During the use of this mode, if you keep increasing
the temperature dial setting to increase the fire size, the
distribution blower will automatically come on when the
ESP Temperature reaches 350° F, or 81% output.
3-90-00674R27_IR11_03/14
ESP Control
Feed adjuster
Sets the maximum feed
rate
Power Light
Indicates power to the
control.
Test
Runs all motors at full
speed for one minute
to check operation.
Afterwards the control
will simulate a minimum
burn with the combustion
blower remaining on
low.
Status Light
Will be lit in either stove
or room temp mode
when pointer is not
within off position band
except after normal shut
down. Blinks to indicate
errors listed below.
Igniter switch
Set to appropriate StartUp mode.
Indicates power to
distribution blower.
Distribution Blower
speed adjustment
range.
L = low
H = high
Variable speed
anywhere between L
and H; although as the
stove temp. goes up , so
does the L and H scale.
Indicates power to
combustion blower
Indicates power to the
feed motor.
Indicates igniter is on.
Temp dial
Allows you to adjust the room temperature
setting, in Room Temp Mode, using
the outer scale marked in degrees
Fahrenheit. It also allows you to adjust
the stove temperature setting, while in
Stove Temp Mode, using the inner scale
marked from 1 to 7.
8
Dealer Diagnostic Port
For dealer maintenance only.
Requires special DDM monitor
supplied to Harman Dealers
exclusively.
Mode Selector
Allows you to choose between Room
Temp Mode, Stove Temp Mode, or OFF.
Also allows you to vary the distribution
blower speed by turning the knob to the
high or low side of each mode.
Status light error messages:
3 Blinks: Indicates that the ESP (Exhaust Sensing Probe)
has failed, has a broken connection, or has gone out of range
too many times. This requires a manual reset*.
4 Blinks: Can occur only in Room Temp Mode and
indicates Room Sensing Probe failed or not installed. If a
Room Sensing Probe is then installed, the status light will
automatically reset.
NOTE: Unit will not start in "AUTO" with this status error.
6 Blinks : Indicates that the control has calculated poor or
incomplete combustion occurring for more than 25 minutes.
A six blink status may be set if the stove is allowed to run out
of pellets. To reset, turn mode selector to "OFF" then back
on to the desired mode. If the unit was not out of pellets, see
Troubleshooting section, Page 33, for more details.
* Manual reset- disconnect power cord for a few seconds
and reconnect. If error still occurs call your Dealer.
5 Blinks (In Igniter Auto. Mode Only): Indicates that the unit
has failed to light within the 36 minute start cycle. To reset Turn Mode Selector to "OFF", then turn to either mode again.)
3-90-00674R27_IR11_03/14
Installation
9
How to Reduce the Weight for Installation
1. Remove the top/lid assembly and side panels.
Note: Removal of the cast hopper lid itself is not
necessary or recommended.
Bolts require a
3/8" socket.
Note: The hopper lid must be in the "OPEN" position before
the top/lid assembly can be lifted off or reinstalled on the
stove body.
There are (4) 1/4-20 x 1/2" flange head bolts securing the
top/lid assembly to the stove body. They can be removed
from the underside with a 3/8" socket.
The cast top and lid assembly bolt down bars:
On each side of the stove body, underneath the cast top,
are (2) 1/4" flange head bolts. See Fig. 12.
(View looking up under the cast top.)
These bolts pull the cast top and lid assembly down onto the
hopper gasket to seal the hopper.
They also allow for a small amount of front to back adjustment
for alignment of the top into the wing pockets.
Be careful not
to damage the
distribution blower
located under the
insert. There are
guards on both sides
of the motor to allow
the insert to rest on a
flat surface, however,
extra care should be
taken.
Top bolt down bar
Fig. 12
NOTICE: When removing the top and lid assembly,
first remove the hopper lid position switch from its
mounting bracket. Loosen the switch retainer nut,
and allow the switch to drop out of the bracket. Leave
the bracket in place.
Top and Lid Assembly
Distribution Blower
Fig. 10
Protector Angles: These angles are designed to
protect the blower motor from damage when placed
on a flat surface. Be careful where and how the stove
body is handled.
Center
Medallion
Mounting Shell
Fig. 11
(2) Spring Latches
(One on each side)
Heat
Exchanger
Cover
Ash Pan
Flame Guide
Internal
Cast Iron
(4) pieces
3-90-00674R27_IR11_03/14
Installation
10
3rd: DOWN
1st:UP
2nd: OUT
Flame guide
Fig. 13
Fig. 14
Lasered hinge pin pivoting point
Up and down clearance
adjustment slots.
Cast side
panel hinge
Remove the cast side panels by lifting them upward off of the
hinge pins. See Fig. 13.
How to Reduce the Weight for Installation, cont'd
2. Remove the door by swinging it open approximately 90°
and lift it upward until it clears the hinge pins.
Burn Pot
Removing the Heat Exchanger Covers
• Remove the heat exchanger cover by lifting it upward
about 1/2 inch and move the bottom edge front until it sits
flat on the firebox bottom.
• Rotate the edge of the heat exchanger closest to the
burnpot until it is in front of the burnpot.
• Tip the top of the heat exchanger toward the middle of
the opening until it can be lifted up and out.
3. Remove the ash pan
4. Remove the (4) internal pieces of cast iron. See Fig. 14
and 15.
Lifting tab
Removing the Center Medallion
• Lift up on the 2 bottom corners of the medallion until it is
higher than the top of the flame guide. Fig. 14
• Pull the bottom edge of the medallion front approximately
1 inch.
• Pull downward on the corners of the medallion until the top
is released from the 2 retainers that keep the top aligned
when in place.
Note: The heat exchanger covers will tilt to the front when
the center medallion is removed.
Fig. 15
3-90-00674R27_IR11_03/14
Installation
11
Beginning Installation
3" Outside Air starter collar
IMPORTANT: The mounting frame/surround assembly and
flue piping is the most critical part of the installation and must
be done correctly and installed securely.
Notch
1. Choose the chimney configuration that is best suited for
the installation. See venting section. Page 21
Note: If 100% outside air is desired or required, the outside
air option will need to be installed on the stoves body. (See
instructions included with outside air kit (part #1-00-674080.)
See Page 22.
2. Make sure the unit will fit into the fireplace opening. When
installing in smaller fireplaces, test fit the mounting frame
into the firebox. Note: The unit overhangs to the rear. See
Fig. 17
3. Installing the 3 piece cast surround: Install the left and
right cast sides to the mounting frame using the 1/4-20 x
3/8 bolts supplied. Install (4) 1/4-20 x 3/4" set screws into
the top wing. Then install the top wing onto the frame using
the (4) 1/4-20 nuts. The left and right side should be done
before the center section is installed. Make sure the bolts
are loose. Do not remove the side panel hinges. The left
and right side wings should be standing up aligned with
the side of the mounting frame and slid inward towards
the center. Note: The wings mount on the rear side below
the notch and on the front side above the notch. See Fig.
16 & 18. Slide the cast ash lip onto the frame and check
to make sure it can go against the roped frame rails and
fits into the pockets on the left and right cast sides. See
Fig. 19.
Fig. 16
Ash lip slide rails
Fig. 17
Install the center section.
4. If the wing extension is required, it should be installed
next.
Cast in front of
the frame. Use
(1)1/4-20 x 3/8
flange bolt from
the rear.
Cast behind the
mounting frame
flange. Use (2)
1/4-20x5/8 flange
bolts and nuts
with bolts from
the front.
Fig. 18
NOTE: The stove body extends through the mounting frame in
the rear approximately 2".
Slide the ash lip casting
into the frame, making
certain the ash lip is
sitting on the slide rails
on either side. With
the ash lip in place,
adjust the surround
sides so there is an
even gap where the
ash lip extends into
the surround side and
tighten.
Fig. 19
3-90-00674R27_IR11_03/14
Installation
12
Optional Wing Extension
Connecting the cord retainer to the wing
The optional wing extension is made for fireplace openings
which are larger than the cast wing. The standard wing
extension is 48" wide by 34" high.
With the three wing pieces completed, the cord retainer must
be bolted to the bottom rear of the wing. Either left exit (shown
in fig. 22) or right exit.
Custom sized wing extensions can be purchased from your
dealer, for any fireplace openings larger than the standard
wing extension area.
At the bottom rear edge of the right and left wing there is a
small radius indent for the cord to exit between the wing and
the fireplace face.
These optional wing extensions will have a 1/2 inch return
bend as shown in fig. 20. Custom oversized wing extensions
with a radius top can be ordered with a radius of your
choosing. These radius wing extensions WILL NOT have a
return bend, although they will be made of thicker metal to
reduce warpage.
1/4-20 x 3/8
button head bolts
(5/32" allen
wrench)
(5/32" allen wrench)
Fig. 22
Fig. 20
5. The power cord can be installed exiting the left (standard)
or right side of the surround. If a right side cord is desired,
follow the instructions below.
Ground
Changing the cord exit location from the left
side to the right side:
wire-ties
The cord is located on the left side, standard from Harman.
(See fig 21.)
To route the cord to the right side:
Cut the wire-ties looping the cord to the left
Re-route the cord along the top of the steel angle and down
the right side.
Re-tie (not supplied by Harman) the wire through the notches
provided in the mounting frame. Then down the right side rail.
Do not remove or move the cord retainer, it is made to reach
both the right and left sides.
Nothing can extend
beyond this face to
the back side.
Fig. 21
Do
not
cut.
Fig. 23
6. You must now decide whether to install the room sensor
as a wall sensor or as a return air sensor. Harman highly
recommends that the room sensor be installed. If you are
installing the room sensor as a wall sensor, the long black
2 wire cable must be wire-tied to the power cord. This wire
is long enough to reach the end of the power cord so the
installer can reach past the hearth to the location where
the extension wire (18/2 thermostat wire, not supplied by
Harman) can be spliced to go to the wall location chosen
for the room sensor.
3-90-00674R27_IR11_03/14
Installation
7. If the room sensor is used as a return air sensor
rather than a room thermostat/sensor, the black cable
will not be used. The room sensor itself (gray or black
cable with black and red wires) will be connected to
the blue twisted wires from the control board.
Note: The stove body must be able to slide out of the
shell to the limit of the power cord wires for cleaning and
service. Therefore, if the room sensor is connected as
a return air sensor, the wire should be connected long
enough to allow this, but not too long that it would get
tangled or pinched anywhere.
13
8. Install the (4) 3/8-16 x 1" leveling bolts into the
threaded holes in the bottom pan of the mounting
shell. The front two leveling bolts may not be
necessary, but the back two will need to be used
to level the wing so that it is flush with the fireplace
face. See Fig. 26
1/2" threaded
wedging rods
Notice: The male/female connections between the
mounting shell and the stove body should always be
maintained. Wirenut or taped splices should never be
used.
Connecting the room sensor as a return air sensor
Insert the sensor end of the wire from the rear of the
mounting frame through the hole as shown in fig. 24 .
Wire-tie the sensor end so that the sensing tip is in the
middle of the front return air opening. See Fig. 25.
Wire-tie the sensor wire to the inside of the mounting
frame up to the cord grounding location. Follow the
power wiring to where you make the male/female
terminal connection to the twisted blue wires.
There are (2) crimp-on connectors in the hardware pack
that must be installed on the internal ends of the room
sensor wires.
(5) bolt down holes
Fig. 26
3/8 x 16 tapped
leveling bolt holes
9. Install the completed frame/surround assembly into
the firebox and level/plumb the wing to the fireplace
face using the leveling bolts as jacks.
If needed, the installed HCS ¼-20 x 1 Z5 bolt can be
used to adjust the squareness of the stove body in the
cage.
Fig. 24
Adjust bolt here
Fig. 25
Side Return Air Holes
3-90-00674R27_IR11_03/14
Installation
14
* Floor protection must be used from hearth opening to 6"
(152mm) in front of door glass and 6" (152mm) to each side
of the stove body to protect combustibles from hot ashes. A
minimum size will be 16.5" deep by 30" wide and be made
of a non-combustible material or meet UL approval.
A = to sidewall
B = to 12" mantel
C = to 3/4" trim
D = to 3/4" trim
E = floor protection
12” (305mm) Mantel
B
C
Fig. 28
A
Flue Pipe Stub Assembly
D
There are three different flue pipe stubs available.
E
1. The unit comes standard with the largest, for use with 4”
stainless steel flex pipe.
E
2. Part #1-00-674040 is for use with 4” PL vent starter pipe.
clearances:
ABCDE
From Insert Body:
10”
12”
0”*
6”
6" (From Glass)
*3/4” trim, zero clearance to cast surround
10. Test fit the cast ash lip (See fig. 25) on the shell frame
mounting rails. The ash lip should slide on these side
rails without lifting upward off of the rails as the ash lip is
slid inward. A small clearance of about 1/16" is an ideal
space between the legs of the ash lip and the hearth.
This cast ash lip is a decorative part that does not and
should not support any weight.
11. Tighten the (2) 1/2" threaded rods up against the lintel
of the fireplace opening. It is also recommended to use
some form of anchoring screws through the bottom of the
shell into the hearth. There are up to 5 holes provided.
Note: It is a good idea to check the ash lip again. The
frame may have shifted when the final anchoring was
completed. See fig. 26.
12. Complete the flue piping, and outside air piping, if used.
Make sure the damper area is sealed.
Warning! do not connect this unit to any air
distribution duct or system.
3. Part # 1-00-674039 is for use with 3” PL vent starter pipe
and also for use with 3” aluminum flex duct for outside air
connections.
The flue stub assembly base is a round plate which allows it
to swivel to allow the flue pipe to exit the mounting frame in
other positions rather than straight up. See fig. 28.
14. Install the flue pipe insulation wrap. See Fig. 27. This
ceramic insulation is precut to form around the flue pipe
stub, to reduce heat transfer into the area around the rear
of the hopper and motor area. This insulation must be
installed in all configurations, even if a rear discharge
is used. See Fig. 29.
This picture shows the completed insulation
wrapped around the flue pipe from the
Twisted tie wire
mounting frame upward.
13. If a rear exit flue configuration is used, with or without
outside air, make sure the flue pipe termination clearances
are followed as per the manufacturers recommendations.
Ash lip
mounting
rails
Fig. 29
Fig. 27
Pre-cut ceramic insulation and (2) pieces of tie wire.
With larger flue pipes this bottom edge of the insulation will
need to be trimmed to complete the wrap.
3-90-00674R27_IR11_03/14
Installation
15. Install the cast side panels by sliding them down over
the lasered hinge pin. Note: Check for rotational swing,
but finish with them in the open position. The cast side
panels may need adjustment after the stove body is
latched into place and the front door is closed.
15
Connecting the ground from the wing to the
stove body
The green wire with a female terminal is the stove body
ground. See Fig. 32
On the combustion air inlet box there is a male terminal
ground.
If service is performed on this stove, this ground
connection must be the first one on and the last one off.
Fig. 30
Lasered hinge pin
pivoting point
Up and down clearance
adjustment slots.
Cast side panel
hinge
Fig. 32
16. Place the stove body on the mounting shell gasketed rails
and insert the body into the opening far enough that it
can't tip out. Note: A service rail kit (Part #1-00-08007),
or a pair of 2 x 4's supported in front of the hearth will
make this job easier. See Fig. 31.
17. Complete the following electrical connections (caution:
Disconnect the power cord.) There are 5 connections
that must be completed. See Fig. 33 & 34.
Fig.31
2x4
Connecting the power cord
The white from the mounting frame connects to the white of
the insert body. The black from the mounting frame connects
to the brown of the insert body.
Fig. 33
3-90-00674R27_IR11_03/14
Installation
16
Connecting the Room Sensor
19. Inspect the silicone sponge gasket on the top edge of
the hopper.
• Connecting the room sensor to the blue twisted wires from
the control board:
• If it is okay, put the cast top/hopper lid assembly (see Fig.
35) into place over the hopper.
• (2) 3/16 inch male terminals are provided for the ends of
the room sensor wires.
• Make sure the hopper lid is open to install the top, then
close it to keep from getting pinched in case the lid falls
unexpectedly.
• They will mate with the female terminals on the blue
twisted wires.
• These connections are “not polarity specific.”
• Insert the (4) 1/4-20 x 1/2 flange head bolts into the
mounting hole but do not tighten them. See page 9, fig.
12.
20. "Test" the unit with the stove body pulled out. This will
allow you to see the motors in operation.
• Turn the control to the "OFF" position.
• Plug the unit into a 240 VAC, 50 Hz outlet.
• Turn the control to "test". All of the motors should operate
at full voltage for 60 seconds.
Note: The door must be closed for the feed motor to operate.
• With the "Test" completed, turn the feed adjuster off of
test, and unplug the unit.
21. Inspect the flue docking gasket. See Fig. 36.
Fig. 34
18. Install the front door. Check the latch and gasketing.
Hopper Seal
• Inspect the silicone sponge hopper to top seal gasket.
• Look for tears or areas where the gasket may not seal
properly to the bottom of the cast top. This only needs to
be done when the top is removed. This is NOT necessary
if the cast top is not removed. (Not part of any monthly,
semi-annual or annual maintenance.)
Docking Gasket
Every time the unit is pulled out of the mounting frame, the
orange high temperature docking gasket should be inspected.
Check for tears or signs that the gasket is not sealing properly.
Docking Gasket
Hopper seal gasket (gray or orange)
Fig. 36
Fig. 35
3-90-00674R27_IR11_03/14
Installation
22. Slide the stove body into the mounting frame.
• Note: The two spring latches on the bottom right and left side of the body must be in the proper position to enter the latch holes. (See fig. 37).
17
Cast Side Panel Installation
• The stove body must be pulled out of the mounting frame
several inches to install the cast side panels.
• Latch the (2) spring latches into place.
• Slide the cast side panel down over the hinge pins.
23. Shift the cast top/hopper lid assembly inward as far as
possible to achieve a parallel fit with the surround sides.
See Fig. 39. Tighten the cast top/hopper lid assembly
bolts with a 3/8" socket. See page 9, Fig. 12.
Note: The cast side panels must be left in the open position
to allow access to the latches.
24. Install and adjust the side panel magnets.
• In the hardware pack are (2) magnets, (2) spacers and
(2) 10-32 x 1 1/4" bolts and nuts.
• Bolt the magnets through the holes provided in the cast
ash lip. Important: The spacer must be on top of the hole, the magnet
on top of the spacer, with the bolt going, down, through the
hole, with the nut at the bottom, under the ash lip. See fig. 38.
25. Check the fit of the cast ash lip to make sure that it can
be slid in and out easily. The cast ash lip can remain in
place at this time. Note: The cast side panel hinges can
be moved upward if necessary to gain clearance for the
cast ash lip.
Latch Hole
Spring Latch
Fig. 37
• Slide the stove body in and latch into place.
• Slide the ash lip into place. (This would be inward until the
rear of the cast iron touches the mounting frame front.)
• Close the cast side panels.
• Check the gap alignment and the top and bottom gap
spacing.
• The top and bottom spacing can be adjusted by loosening
the 3 bolts and sliding the hinge up or down until the
spacing suits.
• With the front door closed and latched, check the vertical
space alignment. The only method of changing or
adjusting this gap is by bending (slightly) the hinge angle.
See fig. 39.
• Due to the use of all cast iron parts, some small amounts of
misalignment are expected. Since some parts are angled
and some have rounded edges, this misalignment is very
seldom noticeable.
• It is very important that the cast side panels open and
close freely for control board access.
Magnet
Fit cast
top/hopper
lid parallel
with
surround.
Magnet
Fig. 38
Fig. 39
Side panel gap
3-90-00674R27_IR11_03/14
Installation
Wiring
18
Log Set Option
Always disconnect the power cord before the unit is
pulled from the mounting frame.
As you can see, the control board is easily accessible from
the rear with the body pulled out of the frame, even if it is
only pulled out several inches.
• Always inspect the wiring harness of the 11 pin socket
(large white flat plug where all of the power wires
terminate.)
• Always inspect the wiring harness where the wires transfer
from the control to the rear inside of the body.
• Make sure there are no worn or frayed areas.
Inspect the wiring harness transition area: This is the area
that comes closest to the mounting frame as the unit is slid
in and out of the frame.
Thumb
Screws
Fig. 42
Install the log bracket with the two thumb screws provided.
6 amp
glass
fuse
11 pin
socket
on rear
of control
board
Fig. 40
REMINDERS
• Do not allow pellets or sawdust to build up on the
hopper lip.
• Inspect the hopper lid gasket for damage. A good
hopper lid seal is very important for proper operation.
Fig. 43
Center the log in the firebox opening with the bottom front
edge over the thumb screws. The log branch tips only rest
on the bracket arms for easy installation and removal.
IMPORTANT NOTE: BEFORE CLEANING THE HEAT
EXCHANGERS, THE LOG AND THE LOG BRACKET
MUST BE REMOVED.
Hopper lid foam
gaskets
Cast Top
Fig. 41
3-90-00674R27_IR11_03/14
Low Draft Voltage Adjustment
19
After the installation is completed, but before the first fire is lit, check and record the
high and low draft readings.
Combustion Motor
Speed Control
Low draft only set
point.
The small straight
screwdriver slot is
plastic; therefore,
the unit can be
adjusted while in
operation.
Fig. 44
These units are pre-tested at the factory with exactly 240 VAC,
50 Hz. They are checked and adjusted for firebox tightness,
gasket leakage, motor operation and igniter operation. The
stove is then factory set at a high adjustment. NOTE: Low
draft adjustment may be required. The factory low draft
setting may not be correct for the unit's permanent
installation conditions.
The control board on the Accentra Insert is equipped with a
low draft adjustment port. Located on the control face just
to the right of the igniter light. See Figure 44. This voltage
adjustment is provided to allow the unit to be adjusted for the
household voltage where the unit is going to be in permanent
operation. NOTE: The line voltage varies from area to area
and often home to home.
The low draft voltage should be adjusted to achieve the most
efficient burn on low burn or "maintenance". This voltage
adjustment allows the installer to change the low voltage
set point approximately 15 volts. This adjustment should
be done by the installer during set up because a draft meter
reading is required to insure proper set up.
If the unit is not adjusted properly, it does not cause a safety
concern. If the unit is adjusted too high, only efficiency is lost.
If the unit is adjusted too low, the low draft pressure switch
will not allow the feeder motor or the igniter to operate.
Fig. 45
Draft Meter bolt hole location
The head of the plug bolt can be accessed through the bottom
distribution air inlet with the cast ash lip removed.
A simple draft test should be performed after completing the
flue pipe installation. To record the results for future reference:
1. Plug unit into a 240 VAC, 50 Hz outlet.
2. Close the hopper lid and front view door. Neither pellets
or a fire are required for this test.
3. With the mode selector in the "OFF" position, turn the feed
adjuster to "TEST".
4. Record the high draft_____in. W.C. (Normal is -.45 to
-.55) The control will be on the High Draft for a total of 1
minute.
5. After 1 minute, the combustion motor will go down to low
draft and the distribution blower will go on high. Allow
approximately 15 seconds to pass for the combustion
motor to slow before checking the low draft.
6. If the low draft is between .30 and .35, record the reading
_____ in. W.C. If the reading is higher, slowly turn the
set screw counter-clockwise until the draft lowers. If the
reading is lower, very slowly turn the set screw clockwise
until the draft increases.
NOTE: In some cases, the draft may not go as low as .30
even with the set screw completely counter-clockwise.
3-90-00674R27_IR11_03/14
Mobile Home Installation
20
Mobile Home Installation
Safety Reminders
Mobile home installation should be done in accordance
with the Manufactured Home and Safety Standard (HUD),
CFR 3280, Part 24.
When installing and operating your Harman Accentra Insert,
respect basic safety standards. Read these instructions
carefully before you attempt to install or operate the Accentra
Insert. Failure to do so may result in damage to property or
personal injury and may void the product warranty.
When installing the Accentra in a mobile home several
requirements must be followed:
1. The unit must be bolted to the floor. This can be done
with 1/4" lag screws through the 5 holes in the base
plate shown in Fig. 26.
2. The unit must also be connected to outside air. See
page 22. All mobile home installations require the use
of outside air, this will increase the heating efficiency of
the unit and keep it from suffering any effects associated
with room air starvation such as poor combustion and or
erratic operation. Periodically check the air inlet for any
obstructions such as snow or ice build up.
Kitchen exhaust fans, clothes dryers and other similar
devices may cause improper operation of the pellet
stove, if, while in use, it keeps the room in a negative
pressure, thus allowing pipe joints, not completely sealed,
to leak exhaust into the room. Be sure to allow adequate
ventilation while using such appliances
3. Floor protection and clearances must be followed. Floor
protection and clearances to combustibles must be
followed as per installation instructions for the stove.
Clearances may only be reduced by means approved by
the regulatory authority.
4. Unit must be grounded to the metal frame of the mobile
home.
5. Smoke alarms and smoke detectors are recommended
to be used with wood and biomass fueled stoves. When
opening the firebox door some exhaust may escape into
the room and set off the alarm. If this should happen
ventilate the room to remove the smoke and reset the
alarm, if the alarm would go off when no one was working
with the stove ventilate the room and have your home
checked to find the source of the leak.
Warning
mobile/manufactured home guidelines do
not allow installation in a sleeping room.
CAUTION
THE STRUCTURAL INTEGRITY OF THE MOBILE
HOME FLOOR, WALL, AND CEILING/ROOF MUST BE
MAINTAINED.
Consult with your local building code agency and insurance
representative before you begin your installation to ensure
compliance with local codes, including the need for permits
and follow-up inspections.
CAUTION: This appliance must be vented to the outside.
Due to high temperatures, this stove should be placed out of
traffic and away from furniture and draperies.
Children and adults should be alerted to the hazards of high
surface temperatures and should stay away to avoid burn
to skin and/or clothing.
Young children should be carefully supervised when they are
in the same room as the stove.
Clothing and other flammable materials should not be placed
on or near this stove.
Installation and repair of this stove should be done by a
qualified service person. The appliance should be inspected
before use and at least annually by a qualified service person.
More frequent cleaning will be required. It is imperative
that control compartments, burners, and circulating air
passageways of this stove be kept clean.
CAUTION
The stove is hot while in operation.
Keep children, clothing and furniture away.
Contact may cause skin burns.
WARNING
Keep combustible materials such as grass,
leaves, etc. at least 3 feet away from the
point directly under the vent termination.
Warning
Use of improper fuels, fire starters or
altering the stove for higher heat output
may cause damage to the stove and could
result in a House fire. Use only approved
fuels and operation guidelines
3-90-00674R27_IR11_03/14
Venting
In flue pipe
+
Inside
hopper
-
Use only the specified venting components. Use of any
other components will void the product warranty and
may pose a hazard.
Do Not Install A Flue Damper In The Exhaust Venting
System Of This Appliance.
DO NOT CONNECT THIS UNIT TO A CHIMNEY FLUE
SERVING ANOTHER APPLIANCE.
In fan
chamber
& starter
collar
Avoiding Smoke and Odors
-
+
Fig.46
21
Inside
firebox
+ = Positive static pressure
O
- = Negative static pressure
O
Negative Pressure, Shut-down, and Power Failure:
To reduce the probability of back-drafting or burn-back in
the pellet burning appliance during power failure or shutdown conditions, the stove must be able to draft naturally
without exhaust blower operation. Negative pressure in the
house will resist this natural draft if not accounted for in the
pellet appliance installation.
A combustion blower is used to extract the combustion
gases from the firebox. This causes a negative pressure in
the firebox and a positive pressure in the venting system as
shown in fig. 46. The longer the vent pipe and more elbows
used in the system, the greater the flow resistance.
Heat rises in the house and leaks out at upper levels. This
air must be replaced with cold air from outdoors, which flows
into lower levels of the house. Vents and chimneys into
basements and lower levels of the house can become the
conduit for air supply, and reverse under these conditions.
The recommended maximum flue lengths for the
Accentra Insert are as follows:
Outside Air:
4" Stainless Steel Flex: 30 Lineal ft. Vertical*
4" PL Vent Pipe:
4" Pl Vent Pipe: 30 Lineal ft. Vertical*
4" Pl Vent Pipe: 14 ft. Vertical w/1-90 ° and 4 lineal ft.
horizontal*
If additional 4" PL Vent fittings are required, the overall
length must be reduced by:
Vertical 90° or T: 2.5'
Vertical 45°:
1.5'
Horizontal 90° or : 5.0'
Horizontal 45°: 2.5'
3" PL Vent Pipe:
20 Lineal ft. vertical*
8 Lineal ft. vertical w/1-90° & 4 lineal ft. horizontal*
If additional 3" PL Vent fittings are required, the overall
length must be reduced by:
Vertical 90° or T: 2.0'
Vertical 45°:
1.0'
Horizontal 90° or T: 4.0'
Horizontal 45°: 2.0'
* Long runs of flex or PL vent pipe installed directly vertical
from the flue stub may require more frequent cleaning due
to fly ash falling off inside and collecting directly above the
combustion blower outlet.
Hearth & Home Technologies recommend attaching
outside air in all installations, especially lower level and
main floor locations.
Per national building codes, consideration must be given to
combustion air supply to all combustion appliances. Failure
to supply adequate combustion air for all appliance demands,
may lead to back-drafting of those and other appliances.
When the appliance is side-wall vented: The air intake is best
located on the same exterior wall as the exhaust vent outlet
and located lower on the wall than the exhaust vent outlet.
When the appliance is roof vented: The air intake is best
located on the exterior wall oriented towards the prevailing
wind direction during the heating season.
The outside air connection will supply the demands of the
pellet appliance, but consideration must be given to the
total house demand. House demand may consume some
air needed for the stove, especially during a power failure. It
may be necessary to add additional ventilation to the space in
which the pellet appliance is located. Consult with your local
HVAC professional to determine the ventilation demands for
your house.
Any use of horizontal venting will require more frequent
cleaning. It is the responsibility of the installer to make sure
the entire flue configuration is accessible for cleaning.
4" stainless steel flex vent piping is only allowed for use
in masonry fireplaces and chimneys or factory built wood
burning fireplaces with class A metal chimneys. All pellet vent
pipe must be secured together either by means provided by
pipe manufacturer or by 3 screws at each joint.
3-90-00674R27_IR11_03/14
Venting
22
100% Outside Air Kit
Vent Pipe
100% Outside Air Kit
# 1-00-674080
1/8" Fiberglass Gasket
1/2" Silicone Gasket
4" stainless steel flex vent piping is only allowed for use
in masonry fireplaces and chimneys or factory built wood
burning fireplaces with class A metal chimneys.
Where passing through an exterior wall or roof, be sure to use
the appropriate pass-through device providing an adequate
vapor barrier. Venting manufacturers generally provide these
pas-through devices.
2 3/8" ID Flex Pipe
Intake Box
Fig. 47
Adjustable Chimney Intake Extension Part # 1-00-674104
18 1/8”
22 1/8”
18”
18”
Pellet venting pipe (also known as Type L or PL vent) is
constructed of two layers with air space between the layers.
This air space acts as an insulator and reduces the outside
surface temperature to allow a clearance to combustibles of
only 3 inches. The sections of pipe lock together to form an
air tight seal in most cases; however, in some cases a perfect
seal is not achieved. For this reason and the fact that the
Accentra Insert operates with a positive vent pressure, we
specify that the joints also be sealed with silicone.
Designed for 3" flex pipe
18 1/8”
Be sure to use approved pellet vent pipe wall and ceiling
pass- through fittings to go through combustible walls and
ceilings. Be sure to use a starting collar to attach the venting
system to the stove. The starting collar must be secured to
the flue stub with at least three screws, and sealed with high
temp silicone caulking.
Harman® SS Chimney Top Intake Assembly
18”
22 1/8”
Outside Air
The outside air kit consists of a flue stub pipe, fiberglass
gasket, silicone gasket, intake box and a section of flex pipe.
See Fig. 47.
An adjustable chimney intake extension, part # 1-00-674104
is available to be used on masonry chimneys only. See Fig.
48.
Additional information and diagrams can be found on pages
23 thru 27, under venting.
To install outside air, use kit part number 1-10-674080. Follow
the installation instructions provided with the kit.
Vent Configurations:
Masonry Flue Liner
To reduce probability of reverse drafting during shutMasonry Chimney
down conditions, Hearth & Home Technologies strongly
recommends:
• Installing the pellet vent with a minimum vertical run of five
feet, preferably terminating above the roof line.
• Installing the outside air intake at least four feet below the vent termination.
4”
6”
1”
Chimney cap and flex termination with
flashing plate (by installer) THIS CAP
MUST BE Stainless Steel
With the intake assenbly anchored into
place, finish the 4” SS flex liner and cap
(by installer) by screwing the cap’s flashing
plate to the top of the intake assenbly.
A waterproofing sealant can be used to
seal the corners and irregularities in the top
of the masonry chimney.
After adjusting the intake assembly
for the flue size, secure the
assembly to the top of the chimney
with some form of anchors or
screws.
Fig. 48
To prevent soot damage to exterior walls of the house and to prevent re-entry of soot or ash into the house:
• Maintain specified clearances to windows, doors, and air inlets, including air conditioners.
• Vents should not be placed below ventilated soffits. Run the vent above the roof.
• Avoid venting into alcove locations.
• Vents should not terminate under overhangs, decks or onto covered porches.
• Maintain minimum clearance of 12 inches from the vent termination to the exterior wall. If you see deposits developing
on the wall, you may need to extend this distance to accommodate your installation conditions.
Hearth & Home Technologies assumes no responsibility for, nor does the warranty extend to, smoke damage caused
by reverse drafting of pellet appliances under shut-down or power failure conditions.
3-90-00674R27_IR11_03/14
Venting
The chimney top must be capped
to prevent rain and/or snow from
entering the chimney.
See Page 22. for information on
the optional Harman Adjustable
Stainless Steel Intake Extension.
The damper area must be
sealed with a steel plate and it
is recommended that Kaowool,
Mineral wool or an equivalent
non
combustible
insulation
is used on top of the plate
to reduce the possibility of
condensation. Insulation alone
should not be used to seal the
damper opening.
23
#1 Installing into an existing fireplace chimney
This method provides excellent venting with 100% outside air
which is the most efficient operation of this unit. This method
also provides natural draft in the event of a power failure.
A 4 inch stainless steel flex pipe is needed for the flue pipe,
and 3" aluminum or Stainless Steel Flex Pipe is used for
the intake.
WARNING
CHIMNEY CONNECTOR PIPE MAY NOT PASS
THROUGH CONCEALED SPACES INCLUDING AN
ATTIC, ROOF SPACE, CLOSET, FLOOR OR CEILING.
Height of existing
hearth
Fig. 49
The chimney top must be capped
to prevent rain and/or snow from
entering the chimney.
#2 Installing into an existing fireplace chimney
This method provides excellent venting for normal operation. This method also provides natural draft in the event of a
power failure.
A cap should be installed on the chimney to keep out rain.
The damper area may be
sealed with a steel plate. If
so, it is recommended that
Kaowool, Mineral wool or an
equivalent non combustible
insulation is used on top of the
plate to reduce the possibility of
condensation. Insulation alone
should not be used to seal the
damper opening.
Fig. 50
Combustion air is provided from the living area and enters the
feed system from around the wing and stove body spaces.
3-90-00674R27_IR11_03/14
Venting
The chimney top must be capped
to prevent rain and/or snow from
entering the chimney.
The damper area must be
sealed with a steel plate and it
is recommended that Kaowool,
Mineral wool or an equivalent
non combustible insulation
is used on top of the plate
to reduce the possibility of
condensation. Insulation alone
should not be used to seal the
damper opening.
24
#3 Installing into an existing chimney
This method provides excellent venting for normal operation. This method also provides natural draft in the event of a
power failure. If the chimney condition is questionable you
may want to install a liner as in method #2.
This is the minimum allowed vent pipe using 4" stainless
steel flex pipe.
The vent pipe must extend past the damper sealing area by
at least 12 inches.
Note: The insulation material must not be allowed to expand
to the point that it covers the end of the flex pipe. The chimney should be capped with any style cap that will
not allow rain or snow to enter.
In some places in the US and Canada, it is required that the
vent pipe extend all the way to the top of the chimney. Check
your local codes.
WARNING
CHIMNEY CONNECTOR PIPE MAY NOT PASS
THROUGH CONCEALED SPACES INCLUDING AN
ATTIC, ROOF SPACE, CLOSET, FLOOR OR CEILING.
Fig. 51
Chimney top
Must be sealed
Fiberglass insulation
packed above the
damper opening and
sealed plate. (Not a
Harman product.)
#4 Preferred method
This method provides excellent venting for normal operation
and in a fireplace with inadequate flue space, or a height of
over 30 feet. A 3" or 4" PL vent pipe should be used with the
needed swivel flue stub.
NOTE: The flue stub insulation wrap must still be used with
this method. See page 14, Fig. 27 & 29. With a 100% outside
air kit the outside air can be installed in the same manner
as the flue pipe.
Stainless Steel Outside Air Inlet Cover
part# 1-10-09542
12" min
3" Flex pipe
36"
CAUTION
12" min.
Keep combustibles (such as grass, leaves,
etc.) at least 3 feet away from the flue
outlet on the outside of the building.
Fig. 52
3-90-00674R27_IR11_03/14
Venting
25
Installing the Accentra Insert into an existing
factory built wood burning fireplace
When installing the Accentra Insert into a factory built wood
burning fireplace, the Manufactured Fireplace Installation
Kit # 1-00-674205 must be used. In addition, several things
need to be taken into consideration.
The size of the fireplace opening. Will the unit fit into the
opening? Many of these units have metal smoke shields
inside the top that can be removed to gain height. Often the
side and rear refractory can be removed to gain depth and
width. In some circumstances, the front lower lip or grill work
may also be removed. Be sure and follow the guidelines in
the kit instructions. Because of the special track system, it is
also permitted to remove the floor refractory and/or insulation
in the bottom of the manufactured fireplace, right down to
the outer sheet metal, which must be left in place for floor
protection under the insert mounting frame. Floor protection
guidelines, as listed on page 14 must also be followed.
Fig. 53
Note: If the Harman Accentra Insert is installed into a factory built wood burning fireplace, this label (Harman
part # 3-90-00675) must be attached to the altered fireplace. This label is included in the Manufactured fireplace
installation kit.
Fig. 54
Optional Hopper Configurations for smaller fireplace
openings:
The Harman Accentra Insert can be factory built with shorter hopper
configurations.
The standard requires a 24" opening. Part #1-90-00674
Option 1: Requires a 22" opening height. Part #1-90-00675
Option 2: Requires a 20" opening height. Part #1-90-00676
Keep in mind the hopper capacities will decrease with the optional heights.
3-90-00674R27_IR11_03/14
Accentra Insert Zero Clearance Cabinet
26
Sample Mantel System
Harman Zero
Clearance cabinet (top
flue only)
Part #1-00-674070
Insert Body
Insert Wing & Mounting
Frame
See your dealer for part details and installation
instructions.
Fig. 55
Be sure to use approved pellet
vent pipe wall and ceiling passthrough fittings to go through
combustible walls and ceilings. Be
sure to use a starting collar to attach
the venting system to the flue stub
and seal the connection with high
temperature silicone.
When using 3" or 4" PL vent pipe,
there must be a 3" clearance to
combustibles.
Harman Zero Clearance Box Flue
Pipe Rough-In Support (optional)
Part # 1-00-674119
See note below & refer to page 14
for floor protection requirements.
Fig. 56
Note: Combustible materials are allowed to touch the cabinet anywhere behind the front mounting flanges except vent
clearance areas. The hearth substructure may be built of combustible material although a non-combustible hearth surface
(tile, stone, metal, glass) must extend as far as shown on the appliance's Testing Label.
3-90-00674R27_IR11_03/14
Venting
Requirements for Terminating the Venting
27
H.A vent must not be installed within 3 feet (90 cm) above
a gas meter/regulator assembly when measured from the
horizontal center-line of the regulator.
WARNING: Venting terminals must not be recessed into
a wall or siding.
I. The clearance to service regulator vent outlet must be a
minimum of 6 feet.
NOTE: Only PL or L vent pipe wall pass-throughs and fire
stops should be used when venting through combustible
materials.
J. The clearance to a non-mechanical air supply inlet to the
building or the combustion air inlet to any other appliance
must be a minimum of 48”.
NOTE: Always take into consideration the effect the
prevailing wind direction or other wind currents will
cause with flyash and /or smoke when placing the
termination.
K. The clearance to a mechanical air supply inlet must be a
minimum of 10 feet. (with outside air installed, 6 feet )
In addition, the following must be observed:
L. The clearance above a paved sidewalk or a paved
driveway located on public property must be a minimum
of 7 feet.
A. The clearance above grade must be a minimum of 12".
B. The clearance to a window or door that may be opened
must be a minimum of 48" to the side and 48" below
the window/door, and 12" above the window/door. (with
outside air installed, 18” to side and below)
M.The clearance under a veranda, porch, deck or balcony
must be a minimum of 12 inches. (B. also)
C.A 12" clearance to a permanently closed window is recommended to prevent condensation on the window.
D.The vertical clearance to a ventilated soffit located above
the terminal within a horizontal distance of 2 feet (60 cm)
from the center-line of the terminal must be a minimum
of 18".
NOTE: The clearance to vegetation and other exterior
combustibles such as mulch is 36” as measured from
the center of the outlet or cap. This 36” radius continues
to grade or a minimum of 7 feet below the outlet.
Certain Canadian and or Local codes or regulations may
require different clearances.
A vent shall not terminate directly above a side-walk or
paved driveway which is located between two single  family
dwellings and serves both dwellings.
E. The clearance to an unventilated soffit must be a minimum
of 12".
Only permitted if veranda, porch, deck, or balcony is fully
open on a minimum of 2 sides beneath the floor.
F. The clearance to an outside corner is 11" from center of
pipe.
NOTE: Where passage through a wall, or partition of
combustible construction is desired, the installation
shall conform to CAN/CSA-B365. (If in Canada)
G.The clearance to an inside corner is 12".
Inside Corner
Detail
Do
or
Fixed
Closed
Openable
Fixed
Closed
Porch or Deck
Openable or Fixed
Openable
Sidewalk
V =Vent Terminal
A =Air Supply Inlet
=Area where termination is not permitted
3-90-00674R27_IR11_03/14
Maintenance - Cleaning Glass on View Door
28
The glass used in your stove is manufactured to exact standards to withstand the high heat of the fire, but like all glass, it
must be treated with common sense and care. Never abuse the glass by slamming the door shut or striking the glass with
a heavy object. If the glass is broken or damaged, do not operate the stove until it has been replaced.
Glass - Replacement
If the stove’s glass is cracked or broken, you must replace it before operating your stove. Remove pieces carefully. Replace
glass only with Harman replacement glass; do not use substitutes.
Carefully remove damaged glass, gasket material, and hold down clips (set aside).
Install the self adhesive 1/4"” gasket material around the front face of the glass. Set the glass panel and gasket gently onto
the door. Install the hold down clips and tighten with bolts.
Glass - Cleaning
Sometimes it will be necessary to clean accumulated ash from the glass surface; allowing this ash to remain on the glass
for long periods can result in “etching” due to the acidity of the ash. Never clean the glass while it is hot, and do not use
abrasive substances. Wash the surface with cool water, and rinse thoroughly. You may wish to use a non-abrasive cleaner
specifically designed for use on stove glass. In any case, dry thoroughly before relighting your stove.
Disposal of ashes: Ashes should be placed in a metal container with a tight fitting lid. The closed container of ashes should
be placed on a non-combustible floor or on the ground, well away from all combustible materials, pending final disposal. If
the ashes are disposed of by burial in soil or otherwise locally dispersed, they should be retained in the closed container
until all cinders have thoroughly cooled.
Soot and fly ash: Formation and need for removal. The products of combustion contain small particles of fly ash. The
fly ash will collect in the exhaust venting system and will restrict the flow of the flue gases. Pellet fuels have different ash
contents depending on what type of wood has been used to make the pellets. We recommend to clean the system
after approximately 1 ton of pellets have been burned and judge from that how often the stove should be cleaned,
remember if you change pellets it may change how often you have to clean your stove.
When burning wood slowly, the potential exists for creosote to form. The venting system should be inspected periodically
throughout the heating season to determine if a creosote buildup has occurred. If a significant layer of creosote has accumulated
(3mm or more), it should be removed to reduce the risk of a chimney fire. If a fire occurs, call the fire department, shut down
the stove, and evacuate the residence. Before using the appliance, have the venting system thoroughly inspected and
replace any damaged components.
Replace glass only with high
temperature ceramic glass.
Fig. 57
Glass Gasket
Inspect door gasket during
cleaning and inspection
3-90-00674R27_IR11_03/14
Maintenance - Burn Pot
29
Burn Pot Cleaning and Maintenance
Whenever adding fuel, take the opportunity to clean the burn
pot.(Weekly at minimum)
• Scrape the top holed surface and sides of the burn
pot down to auger tube.(Fig 58) It is not necessary to
completely remove all material from the burn pot. The
excess will be pushed out during the next use.
Monthly, or after each ton of fuel burned:
• Loosen the (2) wing thumb screws on the lower front angle
of the burn pot. (Fig. 59)
• Lift off the clean-out cover (Fig. 59) to open the bottom
clean-out chamber. (Fig. 60)
Fig.58
DANGER
Disconnect the power to the unit before removing
cover.
• Clean ash buildup from inside the chamber while cover
is off. Use the scraper to tap on the top front edge of the
burn pot. This will help knock pieces of ash, loosened
by the scraping process, down through the holes. It also
helps knock scale off of the igniter element.
Figure 60
The igniter is made to be removable for service by insulated
male/female wire connectors. These connections between
the hot leads (the wires inside the burn pot) and the cold
leads (the wires from the control board) are always pulled
to the inside rear of the feeder body. (Not coiled inside the
burn pot.)
Fig. 59
Burn pot igniter
Igniter hot lead wires
(High temperature)
It is very important that these connections are to the inside
rear of the feeder body. Also, the extra wire of the igniter wire
service loop must be pulled out through the rear of the feeder
and tied up so that it will not be damaged by any moving parts.
WARNING
Use caution when cleaning burn pot clean-out
chamber. Do not damage the high temperature igniter
wires.
Note: The hot lead/cold lead connection must always be
pulled to the rear of the feeder body before operation.
Fig. 60
Viewed from below through the ash pan opening.
3-90-00674R27_IR11_03/14
Maintenance - Cleaning
30
Monthly Cleaning- continued:
There is a 2" square exhaust tube on each side (lower left
and right corners) of the firebox. They can only be seen with
the cast heat exchanger covers removed.
Cleaning the Heat Exchanger tubes
Using the cleaning brush provided, clean these tubes after
every 1 ton of pellets are used.
These tubes are an important part of the heat exchanger.
Efficiency will be lost if they are not properly maintained. The
right side tube is a straight passage to the combustion blower
chamber. The Left side tube follows straight back then makes
a right turn, across the back, to the combustion chamber.
You will need to use the entire length of the cleaning brush
handle to properly clean this tube.
Fig. 61
Cleaning the Heat Exchanger
The accordion heat exchanger surfaces are the primary
source of heat transfer into the room. Therefore, it is very
important to keep them clean from flyash and soot buildup.
• The heat exchanger surfaces should be cleaned after
approximately every 1 ton of pellets are used.
• Use the scraper provided to clean all the way into the
point.
• Note: An old paint brush works well to clean these
surfaces.
• Note: The unit “must be cold” before using anything other
than a wire brush.
Fig. 62
• There are 2 primary air inlet holes on the rear flange of
the burnpot. They should be checked for blockage and
cleaned with a vacuum if necessary. Note: The bottom of
the flame guide has 2 notches that match the holes.
Primary Air Inlets
Fig. 63
3-90-00674R27_IR11_03/14
Maintenance - Cleaning
31
Feeder Chamber
Feeder rear chamber/
clean out cover
This chamber may get a buildup of fines from the feeder
mechanism movement. This area should be checked and
cleaned at least once a year.
To remove the feeder cover:
• Remove the 5/16" wing nut.
• Slide the cover off of the threaded stud.
Fig. 64
• Inspect and clean the inner chamber if necessary. See
Fig. 65.
5/16" Wing Nut
ESP
• Reinstall the cover making certain it is centered on the
feeder body and tighten as tightly as you can by hand.
The combustion blower is made to be removed easily for
inspection and cleaning. See Fig. 67.
Pellet Metering Slide Plate
Possible pellet fines
buildup area.
The combustion blower is mounted on a precision cut
gasketless mounting plate. This plate is held into place
with (3) thumb screws. See Fig. 67.
To remove the combustion blower:
• Turn the thumb screws counterclockwise approximately 5
turns. Rotate the entire assembly counter clockwise until
the points of the retaining slots are visible.
Fig. 65
Mating
Surface
Close Tolerance
Close Tolerance
• Remove the blower assembly with the fan blade by pulling
it directly away from the blower housing.
• The cord on the motor is long enough to allow the motor
to be set down on the black plastic fan cover. This allows
for easy access to inspect and clean the area. See Fig.
66.
• With the blower assembly out, inspection should be done
on the surfaces of the blower assembly and the housing
opening where they meet. These surfaces MUST be
clean and free from dirt, grit, flyash, soot or nicks in the
metal. This gasketless seal relies on an extremely close
tolerance. Therefore, anything other than a clean joint
may cause exhaust gases and/or flyash to escape.
• The assembly can only be reinstalled in one position: with
the motor winding in the upward location. See Fig. 67. The
mounting plate will not allow for any other position.
• Always make sure that the assembly is fully seated and
the (3) thumb screws are tightened before operating the
unit.
Fig. 66
Motor Winding in
upward position
Fig. 67
3-90-00674R27_IR11_03/14
Motor & Component Locations
32
Accentra Insert Motor & Component Locations
Silicone sponge docking gasket
Low Draft Pressure Switch
Combustion Motor
Feed Motor
Backdraft Damper Assembly
Always check to see if the damper plate
swings freely inward and that the seating
edges are not covered with dirt or lint.
Hopper Lid Position Switch
Accentra Pellet Insert Safety Devices
The Control Board/ESP combination
is responsible for all high limit safety
control. There are 2 high limits, one normal
operation high limit and one backup
high limit. The control has an automatic
diagnostic circuit that continuously
monitors the ESP and Room Sensor for
faults. If a fault should occur, the control
sends a status alert and at the same
time the unit goes down to minimum feed/
minimum burn as a safety condition.
The Hopper Lid Position Switch is found
in the rear corner of the hopper opening.
If the hopper lid is not fully closed, the
switch opens, interrupting the power to
the feed motor and the igniter circuits. This
prevents possible injury from reaching into
the feeder mechanism during operation.
The Low Draft Pressure Switch is a
differential pressure switch that monitors
the negative pressure (Draft) in the
firebox. If the draft becomes too low for
proper combustion, the switch opens,
cutting power to the feed motor and the
igniter circuits. This switch is connected
into the AC (high voltage) wiring.
Distribution Blower (under unit) See Fig. 10, Page 9.
3-90-00674R27_IR11_03/14
Trouble-Shooting
33
STOVE DOES NOT FEED
1. No fuel in hopper.
2. Firebox draft may be too low for sensing switch in feeder
circuit to operate. Check for closed doors, loose or
missing gasket on doors or hopper lid.
3. Hopper lid must contact the lid position switch.
4. Feed motor will not run until the ESP control senses a
certain temperature. Maybe you did not put enough fuel
or starting gel in the burn pot before manually lighting the
fire.
5. Restriction in the hopper or feeder. Remove all fuel and
examine. Clear the obstruction.
6. Feed motor has failed.
SMOKE IS VISIBLE COMING OUT OF VENT
1. Air-fuel ratio is too rich.
a. Feed rate too high.
b. Draft too low caused by a gasket leak.
PARTIALLY BURNED PELLETS
1. Feed rate too high.
2. Poor air to fuel mixture. (Check burn pot clean-out cover
and air intake).
3. Burn pot or heat exchanger tubes may need to be
cleaned.
4. Combination of all the above.
5. #6 status blink: A 6 blink control board status indication
is caused by poor or incomplete combustion. The circuit
board has the ability to track the combustion through feed
settings and ESP temperatures. When the control board
has calculated poor or incomplete combustion, it will shut
down the unit as a safety feature. (Poor or incomplete
combustion is a contributor of creosote which may cause
a chimney fire)
Cleaning Burn Pot
Whenever your stove is not burning, take the opportunity to
scrape the burn pot to remove carbon buildup. A vacuum
cleaner is handy to remove the residue. Be sure the stove
is cold if you use a vacuum.
Carbon buildup can be scraped loose with the fire burning
using the special tool provided with your stove. Scrape the
floor and sides of the burn pot. The carbon will be pushed out
by the incoming fuel. Always wear gloves to do this.
A 6 blink status may be caused by several things:
1. Blocked or partially blocked flue.
2. Blocked or partially blocked inlet air.
a. Backdraft damper on the inlet pipe may be stuck
closed.
b. If outside air is installed, the inlet cover may be
blocked.
3. The air chamber under the burnpot may be filled with fines
and small bits of ash.
4. The holes in the burnpot may be getting filled with ash or
carbon buildup.
5. Combustion blower fan blades may need cleaned.
6. Fuel restrictions as noted above.
SMOKE SMELL
Seal the vent pipe joints and connection to stove with silicone.
The exhaust vent is the only part of the system that is under
positive pressure.
FIRE HAS GONE OUT- Check for status light.
1. No fuel in hopper.
2. Draft is too low, blocked flue.
3..Something is restricting fuel flow.
4. Hopper lid not closed properly.
5. Feed motor or combustion blower has failed.
LOW HEAT OUTPUT
1. Feed rate too low
2. Draft too low because of gasket leak.
3. Poor quality or damp pellets
4. Combination of 1 and 2.
Helpful Hints
Removing Ashes
Turn the Temp Dial to number 1 approximately 30 minutes
before removing ashes. This will result in a cooler stove and
ash pan.
Maximum Feed Adjuster settings are not needed in most
cases. Operating in the normal range (#4) is recommended
when maximum heat output is not required. The ESP probe
prevents the stove from being over-fired.
Keep the stove free of dust and dirt.
Fuel
The Accentra is approved for burning any grade of pelletized
bio-mass fuel. It is also approved for burning shelled corn in
a mixture with wood pellets, up to 50%.(See Page 46)
It should be noted, however, that higher ash content will
require more frequent ash removal, scraping of the burn pot,
and may provide less BTU's per pound.
The moisture content of pellets must not exceed 8%, and
corn must not exceed 15%. Higher moisture will rob BTU's
and may not burn properly.
Fuel should not be stored within the stove installation
clearances or within the space required for charging and ash
removal. See Page 14.
3-90-00674R27_IR11_03/14
Specifications
Unit #1-90-00674 - Hopper Capacity
Unit #1-90-00675 - Hopper Capacity
Unit #1-90-00676 - Hopper Capacity
31 5/16
32 1/8
57 lbs. - 25.85 kg
48 lbs. - 21.75 kg
38 lbs. - 17.25 kg
34
41 3/4
12 5/8
24 1/2
19 1/2
14 3/8
24"
22"
20"
19 3/8
25 7/8
16 7/16
1 1/2
16 1/4
14 3/8
26 7/8
Weight
450 lbs.
Blower 180 cfm
Hopper Capacity
57 lbs. (24" hopper #1-90-00674)
FuelWood Pellets
Outside Air Size
3 inches
Fuse Rating6 amp
BTU Range
0 to 42,000
Feed Rate .75 lbs./hr. on minimum(on maintenance)
5 lbs./ hr. on maximum
Vent Size
4 inch Pellet Vent Pipe, standard,
3 inch Pellet Vent Pipe, option
Maximum Wattage
440 Watts (Start cycle and test)
Start Cycle Wattage
340 Watts
Normal Run Wattage
255 Watts
3-90-00674R27_IR11_03/14
E
K
BLAC
CONNECTIONS
MALE/FEMALE
LOW PRESSURE SWITCH
N.O. CONTACTS
GREEN/YELLOW
BL
UE
BR
N
OW
CONNECTIONS
N
OW
MALE/FEMALE
BL
UE
BR
ROOM SENSOR Wires
twisted pair wire
FEEDER MOTOR
CONNECTIONS
MALE/FEMALE
BLUE
N.O. CONTACTS
IGNITER ELEMENT
HOPPER LID SWITCH
3-20-232108
GREEN WIRE IS GROUND
BONDED TO STOVE BODY
BLUE
250 VOLTS A.C. 50 HZ.
LINE
-- 2.3 Amp --
DISTRIBUTION BLOWER
COMBUSTION MOTOR
ORANGE
BLUE
BONDED TO STOVE WING
IEC950
LINE FILTER
575 WATTS
WHIT
GREEN WIRE IS GROUND
JAUNE/VERT
HARNESS THROUGH BODY
CONNECTION NOT COLOR SPECIFIC
BLUE
230 VAC/50 HZ.
BLUE
ACCENTRA INSERT # 1-90-00465
BLACK
FILTER
250 V.A.C. 50 HZ.
IEC 950 comp.
YELLOW
POWER CORD
RED
K
BLAC
LOAD
1
2
3
4
5
6
7
8
9
10
11
PLUGGED
BLUE
BLUE
BLUE
BLUE
EMPTY
YELLOW
ORANGE
RED
BLACK
ESP PROBE
PART NO. 3-90-09322
1
BROWN
8
9
10
11
3
4
5
6
FUSE
3 AMP
ESP
CONTROL
BOARD
WHITE 11 PIN PLUG
HARMAN - WIRING DIAGRAM
Accentra Insert Wiring Diagram
35
3-90-00674R27_IR11_03/14
hearth & home Technologies
lImITEd lIFETImE wArrANTY
Hearth&HomeTechnologies,onbehalfofitshearthbrands(”HHT”),extendsthefollowingwarrantyforHHT
gas,wood,pellet,coalandelectrichearthappliancesthatarepurchasedfromanHHTauthorizeddealer.
wArrANTY COvErAgE:
HHTwarrantstotheoriginalowneroftheHHTapplianceatthesiteofinstallation,andtoanytransfereetakingownership
oftheapplianceatthesiteofinstallationwithintwoyearsfollowingthedateoforiginalpurchase,thattheHHTappliance
willbefreefromdefectsinmaterialsandworkmanshipatthetimeofmanufacture.Afterinstallation,ifcoveredcomponentsmanufacturedbyHHTarefoundtobedefectiveinmaterialsorworkmanshipduringtheapplicablewarrantyperiod,
HHTwill,atitsoption,repairorreplacethecoveredcomponents.HHT,atitsowndiscretion,mayfullydischargeallofits
obligationsundersuchwarrantiesbyreplacingtheproductitselforrefundingtheverifiedpurchasepriceoftheproduct
itself.Themaximumamountrecoverableunderthiswarrantyislimitedtothepurchasepriceoftheproduct.Thiswarranty
issubjecttoconditions,exclusionsandlimitationsasdescribedbelow.
wArrANTY PErIOd:
Warrantycoveragebeginsonthedateoforiginalpurchase.Inthecaseofnewhomeconstruction,warrantycoverage
beginsonthedateoffirstoccupancyofthedwellingorsixmonthsafterthesaleoftheproductbyanindependent,
authorizedHHTdealer/distributor,whicheveroccursearlier.Thewarrantyshallcommencenolaterthan24months
followingthedateofproductshipmentfromHHT,regardlessoftheinstallationoroccupancydate.Thewarrantyperiodfor
partsandlaborforcoveredcomponentsisproducedinthefollowingtable.
Theterm“LimitedLifetime”inthetablebelowisdefinedas:20yearsfromthebeginningdateofwarrantycoveragefor
gasappliances,and10yearsfromthebeginningdateofwarrantycoverageforwood,pellet,andcoalappliances.These
timeperiodsreflecttheminimumexpectedusefullivesofthedesignatedcomponentsundernormaloperatingconditions.
WarrantyPeriod
Parts
Labor
1Year
2years
HHTManufacturedAppliancesandVenting
Gas
X
X
Wood
X
X
X
3years
Pellet
EPA
Wood
Coal
X
X
X
X
X
X
X
X
X
ComponentsCovered
Electric Venting
X
X
Allpartsandmaterialexceptas
coveredbyConditions,
Exclusions,andLimitations
listed
Igniters,electroniccomponents,
andglass
Factory-installedblowers
Moldedrefractorypanels
X
Firepotsandburnpots
5years
1year
7years
3years
10
years
1year
X
Limited
3years
Lifetime
X
X
X
X
X
90Days
X
X
X
X
X
X
X
X
Castingsandbaffles
X
X
Manifoldtubes,
HHTchimneyandtermination
Burners,logsandrefractory
Fireboxandheatexchanger
X
X
Allreplacementparts
beyondwarrantyperiod
Seeconditions,exclusions,andlimitationsonnextpage.
4021-645F02-18-13
Page1of2
3-90-00674R27_IR11_03/14
wArrANTY CONdITIONS:
•
ThiswarrantyonlycoversHHTappliancesthatarepurchasedthroughanHHTauthorizeddealerordistributor.Alistof
HHTauthorizeddealersisavailableontheHHTbrandedwebsites.
• ThiswarrantyisonlyvalidwhiletheHHTapplianceremainsatthesiteoforiginalinstallation.
•ThiswarrantyisonlyvalidinthecountryinwhichtheHHTauthorizeddealerordistributorthatsoldtheappliance
resides.
• Contactyourinstallingdealerforwarrantyservice.Iftheinstallingdealerisunabletoprovidenecessaryparts,contact
thenearestHHTauthorizeddealerorsupplier.Additionalservicefeesmayapplyifyouareseekingwarrantyservice
fromadealerotherthanthedealerfromwhomyouoriginallypurchasedtheproduct.
• Checkwithyourdealerinadvanceforanycoststoyouwhenarrangingawarrantycall.Travelandshippingcharges
forpartsarenotcoveredbythiswarranty.
wArrANTY EXCluSIONS:
Thiswarrantydoesnotcoverthefollowing:
• Changesinsurfacefinishesasaresultofnormaluse.Asaheatingappliance,somechangesincolorofinteriorand
exteriorsurfacefinishesmayoccur.Thisisnotaflawandisnotcoveredunderwarranty.
• Damagetoprinted,plated,orenameledsurfacescausedbyfingerprints,accidents,misuse,scratches,melteditems,
orotherexternalsourcesandresiduesleftontheplatedsurfacesfromtheuseofabrasivecleanersorpolishes.
• Repairorreplacementofpartsthataresubjecttonormalwearandtearduringthewarrantyperiod.Theseparts
include:paint,wood,pelletandcoalgaskets,firebricks,grates,flameguides,batteriesandthediscolorationofglass.
• Minorexpansion,contraction,ormovementofcertainpartscausingnoise.Theseconditionsarenormalandcomplaintsrelatedtothisnoisearenotcoveredbythiswarranty.
• Damagesresultingfrom:(1)failuretoinstall,operate,ormaintaintheapplianceinaccordancewiththeinstallation
instructions,operatinginstructions,andlistingagentidentificationlabelfurnishedwiththeappliance;(2)failureto
installtheapplianceinaccordancewithlocalbuildingcodes;(3)shippingorimproperhandling;(4)improperoperation,abuse,misuse,continuedoperationwithdamaged,corrodedorfailedcomponents,accident,orimproperly/
incorrectlyperformedrepairs;(5)environmentalconditions,inadequateventilation,negativepressure,ordrafting
causedbytightlysealedconstructions,insufficientmake-upairsupply,orhandlingdevicessuchasexhaustfansor
forcedairfurnacesorothersuchcauses;(6)useoffuelsotherthanthosespecifiedintheoperatinginstructions;(7)
installationoruseofcomponentsnotsuppliedwiththeapplianceoranyothercomponentsnotexpresslyauthorized
andapprovedbyHHT;(8)modificationoftheappliancenotexpresslyauthorizedandapprovedbyHHTinwriting;
and/or(9)interruptionsorfluctuationsofelectricalpowersupplytotheappliance.
• Non-HHTventingcomponents,hearthcomponentsorotheraccessoriesusedinconjunctionwiththeappliance.
• Anypartofapre-existingfireplacesysteminwhichaninsertoradecorativegasapplianceisinstalled.
• HHT’sobligationunderthiswarrantydoesnotextendtotheappliance’scapabilitytoheatthedesiredspace.Informationisprovidedtoassisttheconsumerandthedealerinselectingtheproperappliancefortheapplication.Considerationmustbegiventoappliancelocationandconfiguration,environmentalconditions,insulationandairtightnessof
thestructure.
This warranty is void if:
•
•
•
Theappliancehasbeenover-firedoroperatedinatmospherescontaminatedbychlorine,fluorine,orotherdamaging
chemicals.Over-firingcanbeidentifiedby,butnotlimitedto,warpedplatesortubes,rustcoloredcastiron,bubbling,
crackinganddiscolorationofsteelorenamelfinishes.
Theapplianceissubjectedtoprolongedperiodsofdampnessorcondensation.
Thereisanydamagetotheapplianceorothercomponentsduetowaterorweatherdamagewhichistheresultof,but
notlimitedto,improperchimneyorventinginstallation.
lImITATIONS OF lIAbIlITY:
•
Theowner’sexclusiveremedyandHHT’ssoleobligationunderthiswarranty,underanyotherwarranty,expressor
implied,orincontract,tortorotherwise,shallbelimitedtoreplacement,repair,orrefund,asspecifiedabove.Inno
eventwillHHTbeliableforanyincidentalorconsequentialdamagescausedbydefectsintheappliance.Somestates
donotallowexclusionsorlimitationofincidentalorconsequentialdamages,sotheselimitationsmaynotapplytoyou.
Thiswarrantygivesyouspecificrights;youmayalsohaveotherrights,whichvaryfromstatetostate.EXCEPTTO
THEEXTENTPROVIDEDBYLAW,HHTMAKESNOEXPRESSWARRANTIESOTHERTHANTHEWARRANTY
SPECIFIEDHEREIN.THEDURATIONOFANYIMPLIEDWARRANTYISLIMITEDTODURATIONOFTHE
EXPRESSEDWARRANTYSPECIFIEDABOVE.
4021-645F02-18-13
Page2of2
3-90-00674R27_IR11_03/14
Power Failures / Back-up Power
38
Addendum
Minimizing Smoke During Loss of Power Using Battery Back-up
Harman® strongly recommends installing battery back-up to minimize entry of smoke into the
room in the event of power loss.
Your pellet/biomass burning appliance relies on a combustion blower to remove exhaust. A power failure
will cause the combustion blower to stop. This may lead to exhaust seeping into the room. Vertical rise
in the venting may provide natural draft. It is, however, no guarantee against leakage.
There are two Harman® approved battery back-up options for your appliance:
Uninterruptible Power Supply (UPS) UPS battery back-ups are available online or at computer and
office equipment stores. Your Harman® appliance with Rev E or later software available beginning in
November 2010 may be plugged directly into a Harman® approved UPS:
• The APC (American Power Conversion) model #BE750G and the TrippLite model
INTERNET750U are tested and approved. Other brands or models may not be compatible.
When power is lost, a fully charged UPS will power a safe, combustion blower only shut-down. Your
appliance will pulse the blower every few seconds to clear exhaust until the fire is out. NOTE: The UPS
provides safe shut-down only. It is not intended for continued operation.
Your appliance will recognize when power is restored. What happens depends on ESP temperature
and whether it is equipped with automatic ignition:
• In “Automatic” setting, units equipped with automatic ignition will respond to the set point
and ESP temperature and resume normal operation.
• In “Manual” setting or for units without automatic ignition:
• If the ESP is cool, the appliance will remain shut down.
• If the fire is out and the ESP is still warm, the feeder may restart. Since the fire is out, the
ESP temperature will not rise. The unit will then shut-down, and may flash a six-blink status
error. (See ESP error codes)
• If the fire is still burning, it will resume normal operation.
Contact your dealer if you have questions about UPS compatibility with your appliance.
Harman® Surefire 512H Battery Back-up The 512H connects to a 12 volt deep cycle battery that will
run your appliance for up to eight (8) hours. It includes a trickle charge feature that keeps your battery
charged when power is available. NOTE: If the power is out for longer than battery life, smoke
leakage may still occur unless your stove has been safely shut down.
CAUTION! Always keep appliance doors and hopper lid closed and latched during operation
and during power failures to minimize risk of smoke or burn-back.
CAUTION! Use only Harman® approved battery back-up devices. Other products may not
operate properly, can create unsafe conditions or damage your appliance.
3-90-00674R27_IR11_03/14
Fuel Specification Details
Fuel and Fuel Storage
Pellet fuel quality can fluctuate from manufacturer to
manufacturer, and even from bag to bag.
Hearth & Home Technologies recommends using only fuel
that is certified by the Pellet Fuels Institute (PFI).
Fuel Material
• Made from sawdust and/or other wood by-products
• Shelled field corn (when mixed with wood pellets)
• Source material typically determines ash content
Higher Ash Content Material
• Hardwoods with high mineral content
• Bark and leaves as source material
• “Standard” grade pellets, corn and other biomass
Lower Ash Content Material
• Softwood; pine, fir, etc.
• Materials with lower mineral content
• “Premium” grade pellets
Shelled field corn
• Must be 15% moisture content or less
• Must be clean and free of debris
• Must be mixed with wood pellets. (Up to 50%)
• Stalk parts, excessive fines and cob remnants may
cause feed system jams or blockage
CAUTION! Do not burn fuel that contains an additive;
(such as soybean oil)
• May cause hopper fire
• Damage to product may result
Read the list of ingredients on the packaging. If you are
buying field corn, the only ingredient listed should be field
corn.
WARNING! Risk of Chemical Poisoning!
Do NOT burn treated seed corn
• Chemical pesticides are harmful or fatal if swallowed
• Burning treated seed corn will void the product warranty
Clinkers
Minerals and other non-combustible materials, like sand,
will turn into a hard glass-like substance when heated.
Trees from different areas will vary in mineral content. For
this reason, some fuels will produce more clinkers than
others.
Moisture
Always burn dry fuel. Burning fuel with high moisture
content takes energy to dry and tends to cool the appliance
thus, robbing heat from your home. Damp pellet fuel could
turn back into sawdust which does not flow properly through
the feed system.
39
Size
• Pellets are either 1/4 inch or 5/16 inch (6-8mm) in
diameter
• Length should be no more than 1-1/2 inches (38mm)
• Pellet length can vary from lot to lot from the same
manufacturer
Performance
• Higher ash content requires more frequent maintenance.
• “Premium” grade pellets will produce the highest heat
output.
• Burning pellets longer than 1-1/2 inches (38mm) can
cause inconsistent feeding and/or ignition.
We recommend that you buy fuel in multi-ton lots whenever
possible. However, we do recommend trying different
brands prior to purchasing multi-ton lots, to ensure your
satisfaction.
CAUTION! Tested and approved for use with wood pellets
and a mixture of shelled field corn and wood pellets ONLY.
Burning of any other fuel will void your warranty.
When changing from wood pellets to a corn/pellet mixture,
the FEED ADJUSTER will likely need adjusted to a lower
setting. When under maximum demand, ensure there is no
unburned fuel being pushed into the ash pan.
Storage
• Wood pellets should be left in their original sealed bag
until ready to use, to prevent moisture.
• Shelled corn should be stored in a tightly sealed
container to prevent moisture and to deter pests
• Do not store fuel within the specified clearance areas,
or in a location that will interfere with routine cleaning
and maintenance procedures.
CAUTION
Tested and approved for use with wood pellets and a
mixture of shelled field corn and wood pellets ONLY.
Burning of any other fuel will void your warranty.
NOTICE
Hearth & Home Technologies is not responsible for stove
performance or extra maintenance required as a result of
using fuel with higher ash or mineral content.
3-90-00674R27_IR11_03/14
Addendum for Burning Corn and Pellet Fuel Mixture
Harman pellet burning, free-standing stoves and inserts have been tested to ASTM E1509 for burning shelled corn
in a mixture with wood pellets. The listing approves up to a 50% corn and 50% pellet mixture. Different mixtures of
corn will have distinctively different burn characteristics depending upon moisture content and variety. The operator
should closely monitor the stove’s operation when burning a new corn/pellet mixture or a different variety of corn,
and make any necessary adjustments to feed rate. Since corn is typically higher in ash and moisture content, cleaning
and ash removal will be needed more frequently.
Operation in Stove Temp mode
Set feed adjuster to # 3. Set temperature knob to #3, Turn mode selector knob onto “Stove Temp” mode. After the fire
has lit, watch that the fuel does not feed too fast that it pushes the red glowing fuel bed off of the burn pot grate. If it
does, lower the feed adjuster setting or use a lower percentage of corn in the mixture. After the stove has burned for
10 minutes and the entire fuel bed is burning, the feed adjuster and temperature knobs may be adjusted for higher
heat output if desired. Maximum feed has been reached when the fire bed is about ½ to 1 inch from the end of the
burn pot. Settings will vary with different types, moisture levels and mix ratios of corn. If you are having difficulty burning a 50% corn / 50% wood pellet mixture, try a lower percentage of corn.
Operation in Room Temp mode
Set feed adjuster to # 2 or # 3. Set temperature knob to desired amount. Turn mode selector knob onto “Room Temp”
mode. After the fire has lit, watch that the fuel does not feed too fast that it pushes the red glowing fuel bed off of the
burn pot grate. After the stove has burned for 10 minutes and the entire fuel bed is burning, the feed adjuster may be
set to a higher output level if desired. Maximum feed has been reached when the fire bed is about ½ to 1 inch from
the end of the burn pot. It is recommended that after burning at the desired settings, turn the stove off and allow it to
cool, then turn it back on in “Room Temp” mode and watch the stove restart and verify correct operation. Settings will
vary with different types, moisture levels and mix ratios of corn. If you are having difficulty burning a 50% corn 50%
wood pellet mixture, try a lower percentage of corn.
Changes to Maintenance Schedule
Wood pellets average around 6% moisture content or less. Corn will be 14 or 15% moisture. With more moisture in
the fuel, more maintenance will be incurred. Burn pot scraping may need to be done once per day. The ash pan will fill
more quickly and may need emptied weekly. Most importantly, remove the burn pot cleanout cover weekly to clean
the air passage and the igniter element. Excessive buildup on the igniter may lead to shortened igniter life.
Venting Consideration: Check with your venting manufacturer regarding possible exclusions when a mixture of corn
and pellets is burned.
Loosen these two wing screws for access
to clean the air passage and igniter.
* For P38+ model, follow Stove Temp instructions. Keep feed rate on #3 or
above when using a wall thermostat.
Service & Maintenance Log
Date Of Service
Performed By
41
Description Of Service
3-90-00674R27_IR11_03/14
At Harman, we build each product to a standard, not a price.
This powerful heating appliance boasts uncompromising
attention to detail and helps preserve our planet by using
environmentally responsible fuels.
(Signature of Boxer)
Your premium quality hearth product designed and assembled
by the experienced and skilled members at Harman in Halifax,
PA, USA.
Proudly Printed On 100% Recycled Paper