Pompeii Wood Pellet Boiler Owners &

economical
clean air approved
leading design
Pompeii Wood Pellet Boiler
Owners & Installation Manual
PLEASE READ THIS ENTIRE MANUAL BEFORE INSTALLATION, AND USE OF THIS WOOD PELLET BOILER.
FAILURE TO FOLLOW THESE INSTRUCTIONS COULD RESULT IN PROPERTY DAMAGE, BODILY INJURY,
OR EVEN DEATH.
Contact your local building or fire official about restrictions and installation requirement in your area.
ATTENTION
If you are a not a registered pellet re installer, and do not
have legitimate access to the necessary passwords to install
and program the Pompeii Wood Pellet Boiler, you MUST NOT
install or attempt to install this re.
The Pompeii Wood Pellet Boiler requires technical programming
and individualised air pressure adjustments to ensure it will
operate safely and efciently, and to avoid possible damage
to the re or the home.
Installation of the Pompeii Wood Pellet Boiler by a non-registered
installer will void the warranty, and may result in your local
authority refusing to approve the necessary permits.
If you require a registered Pellet Fire Solutions Installer,
please contact us directly on info@pelletfiresolutions.co.nz
Owner’s Section - Table of Contents
1.
Introduction.............................................................................................. 3
............................................................................................................... 3
2.
Safety Warnings & Recommendations .................................................. 4
2.1
Installation .................................................................................................................... 4
2.2
Deciding where to locate your wood pellet burning boiler ..................................... 5
2.3
Ash ................................................................................................................................ 5
2.4
Clinkering ...................................................................................................................... 5
2.5
Filling Fuel Hopper ....................................................................................................... 5
2.6
Flammable Liquids ....................................................................................................... 6
2.7
Operating Instructions ................................................................................................. 6
2.8
Safety Devices .............................................................................................................. 6
2.9
Responsibility ............................................................................................................... 6
2.10
Spare Parts ................................................................................................................... 6
3.
What are Wood Pellets?.......................................................................... 7
4.
The Components of the Stove................................................................ 7
4.1
5.
2
Pellet Combustion ........................................................................................................ 8
Maintenance and Cleaning ..................................................................... 9
5.1
Cleaning the surfaces ................................................................................................. 9
5.2
Automatic cleaning system ...................................................................................... 9
5.3
Cleaning the Ash Drawer............................................................................................ 10
5.4
Cleaning the combustion chamber ...........................................................................10
5.5
Cleaning the Flue .......................................................................................................10
5.6
Access to the inspection hatches for cleaning the smoke ....................................11
5.7
Frequency of Component Cleaning ..........................................................................11
5.8
How to clean the Tubulators ......................................................................................12
1
6.
Operating your Pellet Fire..................................................................... 13
6.1
Preliminary Operation ............................................................................................... 13
6.2
Description of Handheld Set ................................................................................... 13
6.3
Handheld Touch Radio Initialization ....................................................................... 14
6.4
Description of the Display .... .................................................................................... 15
6.5
Time and Date Settings ............................................................................................ 15
6.6
Loading the Auger .................................................................................................... 16
6.7
Setting Ambient and Boiler Water Temp ................................................................. 17
6.8
Turning the Device on ............................................................................................... 17
6.9
Operating Phases of the Stove ................................................................................. 18
6.9.1 Alarms ......................................................................................................................... 28
7.
Maintenance Record ............................................................................ 30
8.
Warranty Information ............................................................................ 31
9.
2
8.1
Warranty Coverage ..................................................................................................... 31
8.2
Warranty Period
8.3
Warranty Exclusions ..................................................................................................32
..................................................................................................... 31
Proof of Purchase/Warranty ................................................................. 33
3
1.
Introduction
This manual is designed for both the technician and the home owner.
Please read this entire manual before installing or operating your Ravelli Pompeii Freestanding
Wood Pellet Burning Stove. Failure to follow these instructions may result in property damage, bodily
of the appliance, or use of replacement parts not
injury or even death. Any unauthorized
recommended by the manufacturer is prohibited. All national and local regulations shall be complied
with when installing this appliance. Your local Pellet Fire Solutions dealer will be happy to assist
you in obtaining information with regards to your local building codes and installation restrictions.
1.1
1.1.1
Rating label Location
Ravelli Pompeii Freestanding: The rating label is located on the back of the unit.
* Note: Consumption will vary with the type of fuel used.
Testing Standard
Description
Class I IP-20
AS/NZS 5078:2007
Appliance: AS/NZS 4866:2007
Residential Wood Pellet Stove
Voltage 220- 240 Volt
Current: 2.92 – 3.18 Amps
Frequency: 50Hz
Max Power Requirement
550 watts
Unit with full hopper: 213kg
Hopper Capacity: 23kg
Mean Flue Gas Temp –
High: 156 degrees
Mean Flue Gas TempMedium: 117 degrees
Mean Flue Gas TempLow: 78 degrees
Fuel Consumption –
High: 4.0 kg per hour
Fuel Consumption –
Medium: 2.5kg per hour
Fuel Consumption –
Low: 1.0kg per hour
Heat/Power Output –
High: 17.2kw
Heat/Power Output –
Medium: 10.3kw
Heat/Power Output –
Low: 3.4kw
Average Particular Emissions (dry weight)
0.23 gms per kg
Average Emissions Rate
14mg/MJ
Average Efficiency
84%
Gross
20.1MJ/kg
Value of pellets (dry weight)
Fuel Type:
Wood pellets – 6mm dia, - complying
with draft standard AS/NZS 4014.6
2008
IMPORTANT: The above values were found during testing and may vary with the fuel type, climate and
installation style.
3
2.
Safety Warnings & Recommendations
Pellet quality is important, please read the following:
Your pellet heater has been designed to burn ¼” (6mm) diameter wood pellets, manufactured to the
AS/NZS 4014.6 only.
DO NOT use this appliance as an incinerator.
DO NOT use unsuitable and non recommended fuels, including liquid fuels, as this will void any
warranties stated in the manual.
The performance of your pellet stove is greatly affected by the type and quality of wool pellets being
burned. As the heat output of various quality wood pellets differs, so will the performance and heat
output of the pellet stove.
Caution: It is important to select and use only pellets that are dry and free of dirt, or any impurities such
as high salt content. Wood pellets manufactured to the AS/NZS 4014.6 standard are recommended.
Dirty fuel will adversely affect the operation and performance of the unit and will void the warranty. The
Pellet Fuel Industries (PFI) has established standards for wood pellet manufacturers. We recommend
the use of pellets that meet or exceed these standards. Ask your dealer for a recommended pellet type.
2.1
Installation
The stove must be installed and tested by specialised personnel approved by Pellet Fire Solutions.
Please read this manual before installing or operating the stove. If you require further information,
please contact your Pellet Fire Solutions dealer. Installation must be performed by authorized
personnel, who must give the purchaser a declaration of conformity of the appliance, and who will
installed. It is also necessary to take into consideration all the laws and national, regional, provincial
and local regulations present in the country in which the appliance has been installed. In the
event of failure to respect these precautions, Pellet Fire Solutions declines all responsibility.
IMPORTANT:
•
The place of installation of the stove must comply with local & national regulations. The
stove must be fuelled only with quality pellets manufactured to standard AS/NZS4014.6.
The stove cannot operate with traditional wood.
•
The stove must not be used as an incinerator.
•
Before connecting the stove electrically, the connection of the exhaust spigot must be
joins must be sealed with maniseal exhaust cement).
•
The protection grill inside the pellet tank must never be removed.
•
open the door of the stove whilst it is functioning.
4
•
When the stove is operating, the surfaces, the glass, the handle and the pipes become
overheated: during functioning, these parts must only be touched with the adequate
protection.
•
Do not light the stove without having first performed the daily inspection as described in
the MAINTENANCE & CLEANING chapter of this manual (see page 9).
•
Scrupulously follow the maintenance program.
•
Do not turn the stove off by disconnecting the electricity mains supply (use the
remote control.
5
•
Do not clean the stove until the structure and the ashes have cooled down completely.
Carry out all operations with maximum safety.
.
Pompeii should be installed in a centrally located position within the home. This will assist
the appliance to perform to the level required. As the Pompeii heats space by convecting air across
the top of the unit, the heater should face the majority of the area to be heated.
Pompeii requires a power source to function. This is standard mains feed 240v plug - if this
is unavailable in close proximity, a grounded extension lead may be used.
Pompeiii is to be installed on a non-combustible surface, which must have a forward projection of
a minimum of 150mm from the glass door.
Please check all clearances to combustibles as listed on page 37 and page 38 of this Owner’s/
Technical manual.
In accordance with the requirements of AS/NZS 2918:2001, Pompeii must be secured by
seismic restraint.
2.2
Deciding where to locate your wood pellet burning stove
1.
2.
3.
2.3
Do not install the pellet stove in a bedroom or room where people sleep.
Locate the pellet stove in a large and open room that is centrally located in the house.
This will optimise heat circulation.
Check clearances to combustibles (refer page 37).
Ash
The ash content of the fuel and operation of your stove will directly determine the frequency of cleaning.
The use of high ash fuels may result in the stove needing to be cleaned daily. A low ash fuel may allow
longer intervals between cleaning.
2.4
Clinkering
Clinkers are silica (sand) or other impurities in the fuel that will form a hard mass during the burning
through the burn pot liner, and affect the performance
process. This hard mass will block the air
of the stove. Any fuel, even approved types, may clinker. Check the burn pot liner daily to ensure
that the holes are not blocked with clinkers. Refer to the Routine Cleaning and Maintenance section.
2.5
Filling Fuel Hopper
Check hopper for foreign objects, then empty the bag of pellets into the hopper. DO NOT OVER FILL,
as miscellaneous pellets could smoke if left to rest on an operating stove.
Store pellets at least one metre (1m) away from the pellet stove.
Warning: parts of the appliance, especially the external surfaces, will be hot to touch when in operation
so use due care.
6
5
2.6
Flammable Liquids
Never use gasoline, gasoline – type lantern fuel, kerosene, charcoal lighter fluid or similar liquids to
start or “freshen” up a fire in the stove. Keep all such liquids well away from the stove while it is use.
2.7
Operating Instructions
The stove is completely automated and will self-regulate the ignition phase, two levels of power and
the switching off phase, guaranteeing safe functioning. The burn pot used for combustion allows most
of the ashes produced by the combustion of the pellets to fall into the collection drawer. However,
it is recommended that you check the burn pot every day, as not all pellets have high standards of
quality, and could leave residue that is difficult to remove. The glass has special air circulation for selfa diameter of 6mm, manufactured to the AS/NZ4014.6 or higher must be used with the stove.
2.8
Safety Devices
The stove is fitted with a sophisticated safety systems so that, in the case of breakage of one of the
individual parts, or defects in the flue, no damage will be caused to the stove and the room in which it
is installed. In any case, when a problem arises, the pellets stop falling immediately and the switch off
phase is activated. The corresponding alarm will be shown on the display. The details can be seen in
the chapter on the alarms (see page 28).
2.9
Responsibility
Pellet Fire Solutions declines all responsibility, both civil and criminal, with the delivery of this
manual, for any accidents deriving from partial or total failure, to observe the instructions it contains.
Pellet Fire Solutions declines all responsibility deriving from the improper use of the stove, from its
incorrect use by the user, by unauthorised modifications and/or repairs, or from the use of spare parts
which are not original. The manufacturer declines all direct, civil or criminal responsibility due to:
•
Poor maintenance.
•
Failure to observe the instructions in the manual.
•
Use not compliant with the safety instructions.
•
Installation that is not compliant with the regulations in force in the country.
•
Installation by personnel who are not qualified or authorised.
manufacturer.
•
2.10
•
Use of spare parts that are not original.
•
Exceptional events.
Spare Parts
Use original spare parts only. Do not wait for the components to be worn before replacing them.
Replace a worn component before it is completely broken, to prevent any accidents caused by the
sudden breakage of components. Perform the periodic maintenance checks as described in the
dedicated chapter on “Maintenance and Cleaning” on page 9.
6
7
3.
What are Wood Pellets?
Wood pellets are made from sawdust and wood shavings. The material used cannot contain any foreign
substance such as glue, varnish or synthetic substances. Subjecting it to high pressure, the wood is
pressed through a plate with holes, and due to the high pressure, the sawdust is heated activating the
natural binders of the wood. Thus, the pellets keep their shape even without the addition of bonding
substances. The density of the wood pellet varies according to the type of wood and can be 1.5 – twice
greater than that of natural wood. The diameter of the cylindrical rods is 6-10 mm and their length can
vary between 10 and 50 mm. Their weight is equal to about 650 kg/m. Due to the low content of water
(approx 8%) they have a high energy content. The standards AS/NZS4014.6 de ne the quality of the
pellets:
Do not put the bag of pellets on the cast parts during the loading operations.
The pellets must be transported and stored in a dry place. They swell on contact with any moisture
and cannot be used. They must always be protected from moisutre, both during transport and in
storage. Ravelli recommends using a pellet with a diameter of 6 mm for the stove.
4.
The Components of the Stove
1
8
8
9
2
3
14
4
6
10
11
12
7
13
5
1
Pellet tank cover
2
Design coating
3
Pellet tank
4
Pelelt infeed screw
5
Smoke extractor
6
Pellet gear motor
7
meter
8
Hot air output grid
9
Vermiculite
10
Water pump
11
Ignition resistance
12
Cast iron brazier
13
Fume duct
14
Stove base
15
Heat exchange pipe
7
4.1
Pellet Combustion
Combustion is simply a chemical reaction between combustible and carburant. The result of this
reaction is the heat.
The three elements that are required for combustion are:
OX
YG
E
-Ignition (electrical resistance for ignition)
AT
-Carburant (oxygen available in the air)
HE
N
-Combustible (pellet)
PELLET
To achieve combustion, the combustible and the carburant must be available in the correct proportions.
The reaction between combustible and carburant is made by an external starter. Ignition can be created
by direct contact with a heat source, or by a spark. Incorret combustion is evident when the flame is
too tight, and there are too many incandescent pellets in the firepot.
INCORRECT combustion - the flame is weak and there are a lot of unburned
pellets in the firepot. Check first that the ash pan is properly closed. Then
adjust set pellet/air increasing the air percentage (from 0 up to +5). If this
doesn’t work, try increasing the loading quantity of the pellet (from 0 up to -5)
to reach the flame condition shown in picture 3.
If with the adjustments done, the flame is not reaching the condition shown
in picture 3, contact After Sales Service.
The combustion is NOT CORRECT, the flame is weak and a lot of unburned
pellet wood in the firepot. Check first that the ash pan is properly closed.
Then adjust set pellet/air increasing the air percentage (from 0 up to +5); in
the event this is not enough, increase the loading quantity of the pellet (from
0 up to -5) to reach the flame condition shown in picture 3.
If with the adjustments done, the flame is not reaching the condition shown
in picture 3, contact After Sales Service.
The combustion IS CORRECT, full flame, yellow/white, and minimum
quantity of pellet in the firepot.
The combustion is fine, and no ash.
The picture 3 shows a flame with a stove working at power P5.
8
9
5.
Maintenance and Cleaning
Before carrying out any maintenance, take the following precautions:
•
Make sure that the stove has been turned off, and that the general power supply has been disconnected
(Ensure that the plug is disconnected from the socket, thus avoiding accidental electric shocks).
•
Make sure that all parts of the pellet stove are cold.
•
Make sure that the ashes have cooled completely.
•
Make sure that the general switch is in the zero position (off).
•
Always use appropriate tools for maintenance.
•
When you have nished, re-install all safety guards before using the pellet stove again.
The pellet stove requires little maintenance if quality wood pellets are used, which is why we recommend
pellet fuel that is manufactured to the AS/NZS4014.6.
5.1
Cleaning the surfaces
To clean the surfaces on the painted metal parts, use a damp cloth.
Important: the use of aggressive detergents or abrasive cleaners can damage the surfaces of the stove.
5.2
Automatic cleaning system
The main characteristic of this model is the automatic cleaning of the firepot. Consequently there is
no more need to clean the firepot periodociallly or at every start of the stove.
Cleaner working (rotation 360°)
Ash-drawer: ashes are released underneath the
epot
Cleaning the ash pan:
The cleaner sets every time the stove is turned on (2 rotations by default) and after 8 hours working
(default value). The timing for this operation (work/cleaning/restart) takes about 10 minutes without
affecting the heat exchange in the room, being its parts in cast iron.
Pull out the drawer from the stove and remove the ash using a special vacuum cleaner; be very
careful to the brazier, it may still be hot and may damage the equipment used for cleaning.
Cleaning operations of the stove depend on the quality of the pellets used and the frequency of use.
It may be necessary to carry out these operations on a daily basis.
Ash pan that needs
to be emptied
Drawer
ash
Cleaning glass
The glass of the door should be cleaned with the stove cooled down using a cotton cloth or paper towel.
Usually, we recommend you clean the glass with a damp (water) cloth and ash collected after burning (having an abrasive function).
10
9
5.8
Cleaning the Ashes Draw
The ashes drawer must be cleaned every 2 days, depending on the length of time the stove is used,
and the type of pellet used. To access the drawer, open the door (see figure 1) and extract the
ashes drawer (see figure 2)
N.B.: The operation must be
carried out when the stove is
cold, using a drum-type vacuum
cleaner.
2
1
The pellet stove is a generator of heat, with a solid fuel, and as such requires servicing by qualified
personnel at least once a year at the start of the season. This maintenance has the purpose of
ascertaining and ensuring the
and safety of all the components.
We recommend you draw up an annual contract for maintenance of the product with your
installer/dealer.
5.4
Cleaning the combustion chamber
The stove requires simple but frequent cleaning to guarantee an
yield and correct functioning.
Therefore, clean the combustion chamber every day using a drum-type vacuum cleaner, making sure
that the ashes are cold
5.5
Cleaning the Flue
The flue will require cleaning only once each winter (or every 1000 hours) providing that the correct
fuel is used. You should arrange for this when booking your annual service with your local Pellet
Fire Solutions Service Agent. Use a drum type vacuumn cleaner only.
10
5.6
Access to the inspection hatches for cleaning the smoke
Remove the side panels and release the two screws that secure the hatches to the body of the pellet
stove. Clean the inside using a drum type vacuum cleaner.
INSPECTION HATCH
GASKET
INSPECTION HATCH
GASKET
5.7
Frequency of Component Cleaning
Parts/Frequency
Daily
Burn pot
•
30 Days
Yearly
Performed By
Owner
Ash Drawer
•
Owner
Glass
•
Owner
Flu
•
Technician
Door gasket
•
Technician
Tubulators scraper
•
Owner
Combustion chamber
•
Owner
Vacuum Hopper
•
Owner
Clean T discharge
12
2-3 Days
•
Technician
11
5.8
How to Clean the Tubulators
Pull to clean exchanger
tube bundle
12
Vers. 01 del 07/04/15
Manuale utente PALMARE IDRO TOUCH RADIO
Pag.22
Vers. 01 del 07/04/15
Manuale utente PALMARE IDRO TOUCH RADIO
Preliminary
Operations
6.1 Preliminary Operations
Pag.22
Wiring
Preliminary Operations
&RQQHFWWKHSRZHUFRUGWRWKHEDFNRIWKHVWRYHDQGWKHQWRDZDOOVRFNHW7KH,2VZLWFKLQWKH¿JXUH
Wiring
VKRXOGEHVHWWR,WRSRZHUWKHVWRYH,IYROWDJHLVQRWVXSSOLHGFKHFNWKHVWDWHRIWKHIXVHLQVWDOOHGLQ
WKHER[EHORZWKHVZLWFK$IXVH'XULQJWKHSHULRGVRILQDFWLYLW\ZHUHFRPPHQG\RXGLVFRQQHFWWKH
&RQQHFWWKHSRZHUFRUGWRWKHEDFNRIWKHVWRYHDQGWKHQWRDZDOOVRFNHW7KH,2VZLWFKLQWKH¿JXUH
power cord of the stove.
VKRXOGEHVHWWR,WRSRZHUWKHVWRYH,IYROWDJHLVQRWVXSSOLHGFKHFNWKHVWDWHRIWKHIXVHLQVWDOOHGLQ
WKHER[EHORZWKHVZLWFK$IXVH'XULQJWKHSHULRGVRILQDFWLYLW\ZHUHFRPPHQG\RXGLVFRQQHFWWKH
What to check befor turning
on the stove
power cord of the stove.
0DNHVXUH\RXKDYHUHPRYHGDOOSDUWVWKDWSRVHWKHULVNRIEXUQVIURPWKHFRPEXVWLRQFKDPEHURUJODVVYDULRXVLQVWUXFWLRQVRU
stickers).
What
to check befor turning on the stove
%HIRUHWXUQLQJRQWKHVWRYHPDNHVXUH\RXKDYH¿WWHGWKHJUDWHRQWKHVXSSRUWEDVHDQGFKHFNWKDWWKHGRRUDQGWKHDVKGUDZHU
0DNHVXUH\RXKDYHUHPRYHGDOOSDUWVWKDWSRVHWKHULVNRIEXUQVIURPWKHFRPEXVWLRQFKDPEHURUJODVVYDULRXVLQVWUXFWLRQVRU
are properly close.
stickers).
How
to load the pellets
%HIRUHWXUQLQJRQWKHVWRYHPDNHVXUH\RXKDYH¿WWHGWKHJUDWHRQWKHVXSSRUWEDVHDQGFKHFNWKDWWKHGRRUDQGWKHDVKGUDZHU
)XHOVXSSO\FRQVLVWVLQWKHLQVHUWLRQRISHOOHWVIURPWKHWRSRIWKHVWRYHE\RSHQLQJWKHGRRU'XULQJSHOOHWORDGLQJSUHYHQWWKHSHOare properly close.
OHWEDJIURPFRPLQJLQWRFRQWDFWZLWKKRWVXUIDFHV
How to load the pellets
)XHOVXSSO\FRQVLVWVLQWKHLQVHUWLRQRISHOOHWVIURPWKHWRSRIWKHVWRYHE\RSHQLQJWKHGRRU'XULQJSHOOHWORDGLQJSUHYHQWWKHSHO1(9(5,16(57,1727+(7$1.27+(5.,1'2))8(/27+(5)5207+(3(//(76
OHWEDJIURPFRPLQJLQWRFRQWDFWZLWKKRWVXUIDFHV
COMPLYING WITH THE SPECIFICATIONS BELOW
Description1(9(5,16(57,1727+(7$1.27+(5.,1'2))8(/27+(5)5207+(3(//(76
of the handheld set:
COMPLYING WITH THE SPECIFICATIONS BELOW
The handheld set is shown in the picture below:
6.2
Description of the handheld set:
Description of the handheld set:
The handheld set is shown in the picture below:
1
21
23
4
1
Increase button “UP” (selection key)
Decrease key “DOWN” (selection key)
45
2
1
3
Decrease
Display key “DOWN” (selection key)
56
2
4
3
5
6
4
6
5
Display
Confirmation key
6
3
Increase
button
key) key.
ON/OFF or
reset“UP”
from(selection
“Sleep” mode
ON/OFF
or reset from
“Sleep”and
mode
key.
Key for accessing
the MENU
back
Key for accessing the MENU and back
In
“Sleep” mode, the handheld set
Confirmation key
screen is obscured, keeping however
active the radio communication with
In
mode,
thebattery
handheld
the“Sleep”
stove to
reduce
con-set
screen
is obscured, keeping however
sumption.
active the radio communication with
the stove to reduce battery consumption.
The information below will allow you to become familiar with the product and achieve the best performance.
How to insert the batteries in the handheld set:
The information below will allow you to become familiar with the product and achieve the best performance.
5HPRYHWKHSURWHFWLYHFRYHURIWKHEDWWHU\RQWKHEDFNRIWKHUHPRWHFRQWURODVVKRZQLQ)LJXUH$DQGLQVHUWWKHEDWWHULHV
PLQLSHQVW\OHEDWWHU\$$$9LQWKHKRXVLQJRIWKHKDQGKHOGVHWDQGREVHUYHWKHSROHV,QVWDOOWKHEDWWHU\SURWHFWLYHFRYHU
How to insert the batteries in the handheld set:
DVVKRZQLQ¿JXUH%
5HPRYHWKHSURWHFWLYHFRYHURIWKHEDWWHU\RQWKHEDFNRIWKHUHPRWHFRQWURODVVKRZQLQ)LJXUH$DQGLQVHUWWKHEDWWHULHV
PLQLSHQVW\OHEDWWHU\$$$9LQWKHKRXVLQJRIWKHKDQGKHOGVHWDQGREVHUYHWKHSROHV,QVWDOOWKHEDWWHU\SURWHFWLYHFRYHU
DVVKRZQLQ¿JXUH%
Figure A
Figure B
7KHKDQGKHOGVHWDIWHUDVKRUWVFUHHQVKRZLQJWKH5DYHOOLORJRZLOOOLVWWKHODQJXDJHVDYDLODEOHLQWKHPHQX
Figure A
Figure B
7KHKDQGKHOGVHWDIWHUDVKRUWVFUHHQVKRZLQJWKH5DYHOOLORJRZLOOOLVWWKHODQJXDJHVDYDLODEOHLQWKHPHQX
ITALIANO
DEUTSCH
ENGLISH
FRANCAIS
DANSK
NEDERLANDS
6HOHFWWKHGHVLUHGODQJXDJHXVLQJWKHVFUROONH\VDQGFRQ¿UP\RXUVHOHFWLRQZLWKWKHFRQ¿UPDWLRQEXWWRQ
ESPANICE
6HOHFWWKHGHVLUHGODQJXDJHXVLQJWKHVFUROONH\VDQGFRQ¿UP\RXUVHOHFWLRQZLWKWKHFRQ¿UPDWLRQEXWWRQ
13
Vers. 01 del 07/04/15
Manuale utente PALMARE IDRO TOUCH RADIO
Pag.23
6.3
touch radio initialization
HandheldHandheld
touch radio initialization
In order to operate correctly, the handheld set should be interfaced with the electronic board installed inside the stove. For this
UHDVRQRQGLVSOD\DSSHDUVWKHIROORZLQJPHVVDJH
FIRST INSTALLATION?
YES
,IWKHKDQGKHOGVHWLVXVHGIRUWKH¿UVWWLPHVHOHFWYESXVLQJWKHVHOHFWLRQNH\VDQGFRQ¿UPZLWKWKHGHGLFDWHGNH\
2QWKHGLVSOD\RIWKHKDQGKHOGVHWDSSHDUVWKHIROORZLQJ
PRESS THE KEY RADIO
ADJ ON THE STOVE
+ROGGRZQIRUDIHZVHFRQGVWKHEXWWRQRIUDGLRFRPPXQLFDWLRQ5$',2$'-RIWKH3&%ORFDWHGRQWKHEDFNRIWKHVWRYHWR
initialize the device.
7KHÀDVKLQJ\HOORZ/('LQGLFDWHVWKDWWKHFLUFXLWERDUGLVZDLWLQJWRUHFHLYHWKHVLJQDOIURPWKHKDQGKHOGVHW
%\SUHVVLQJWKHHQWHUNH\RQWKHKDQGKHOGVHWWKHFRPSRQHQWVVWDUWFRPPXQLFDWLQJZLWKHDFKRWKHU$FKHFNVLJQRQWKHGLVSOD\
DFFRPSDQLHGE\DVRXQGVLJQDOVKRZVWKDWWKHLQLWLDOL]DWLRQRIWKHKDQGKHOGVHWKDVEHHQFRPSOHWHGVXFHVVIXOO\
When you replace the batteries, you do not have to run the initialization procedure of the handheld set. In this case, when
on display appears the message “FIRST INSTALLATION ?”, select NODQGSUHVVWKHFRQ¿UPDWLRQNH\
Description of the display
The display of the handheld set is described below (in stand-by mode):
1
2
3
After 5 minutes of inactivity, the display of the handheld set turns dark, switching to “SLEEP” mode, while maintaining the
radio connection with the stove. By pressing the key ON/OFF, the display becomes active again.
7KH¿UVWSUHVVXUHRIDQ\NH\ZLWKWKHGLVSOD\DFWLYHOLJKWVXSLWVEDFNOLJKWEXWLWLVQRWKRZHYHU
considered a command.
14
When you replace the batteries, you do not have to run the initialization procedure of the handheld set. In this case, when
on display appears the message “FIRST INSTALLATION ?”, select NODQGSUHVVWKHFRQ¿UPDWLRQNH\
6.4
Description of the display
Description of the display
The display of the handheld set is described below (in stand-by mode):
1
2
3
Manuale utente PALMARE IDRO TOUCH RADIO
Vers. 01 del 07/04/15
The display
is minutes
subdivided
into threethe
parts:
Pag.24the
After 5
of inactivity,
display of the handheld set turns dark, switching to “SLEEP” mode, while maintaining
Vers. 01 del 07/04/15
radio connection with the stove.
By pressing
the key
ON/OFF, theIDRO
displayTOUCH
becomes active
again.
Manuale
utente
PALMARE
RADIO
It shows
current room
you will
11.
The
displaythe
is subdivided
intotemperature
three parts:measured by the handheld set. Moreover, if you press the DOWN scroll keyPag.24
display the temperature settings that can be changed using the two UP/DOWN keys. Any change made is confirmed automatically
7KH¿UVWSUHVVXUHRIDQ\NH\ZLWKWKHGLVSOD\DFWLYHOLJKWVXSLWVEDFNOLJKWEXWLWLVQRWKRZHYHU
Vers.
01 del con3 seconds
from the
change
or by pressing
theby
confirmation
key.set.
A sound
signal
indicates
that
change
has
been
1. It shows
the current
room
temperature
measured
the
handheld
Moreover,
if you
press
the the
DOWN
scroll
key
you 07/04/15
will
1within
considered
a command.
Manuale
utente
PALMARE
IDRO
TOUCH
RADIO
firmed.
display
the temperature
thatparts:
can be changed using the two UP/DOWN keys. Any change made is confirmed Pag.24
automatically
The
display
is subdividedsettings
into three
Vers. 01 del 07/04/15
within 3 seconds from the change or by pressing the confirmation key. A sound signal indicates that the change has
been conManuale utente PALMARE IDRO TOUCH RADIO
firmed.
1.
Itdisplay
shows
the
current room
temperature
measured
by
the
handheld
set.
Moreover,
if
you
press
the
DOWN
scroll
key
you will
1The
The
displayis
issubdivided
subdivided
into
three
parts:
Pag.24
into three parts
display the temperature settings that can be changed using the two UP/DOWN keys. Any change made is confirmed automatically
3 seconds
from the
change
or by pressing
theby
confirmation
key.set.
A sound
signal
indicates
change
has
been
1. It shows
the current
room
temperature
measured
the handheld
Moreover,
if you
pressthat
the the
DOWN
scroll
key
you conwill
1within
firmed.
display the temperature settings that can be changed using the two UP/DOWN keys. Any change made is confirmed automatically
within 3 seconds from the change or by pressing the confirmation key. A sound signal indicates that the change has been confirmed.
2
2
2
2
In the inactive phases (combined with the 3rd part of the display) indicates the state of the stove.
In the active phases, it indicates the operating power of the stove.
In
by phases
pressing(combined
the DOWNwith
scroll
can display)
display the
powerthe
settings,
that
be edited using the two scroll
In addition,
the inactive
thebutton,
3rd partyou
of the
indicates
state of
thecan
stove.
keys
In the active phases, it indicates the operating power of the stove.
UP/DOWN:
The
confirmation
of anyscroll
change
takesyou
place
withinsettings,
3 seconds
changeusing
or bythe
pressing
the conIn
addition, by
pressing
the DOWN
button,
canautomatically
display the power
thatfrom
can the
be edited
two scroll
firmation key. A sound signal indicates that the change has been confirmed.
keys
In the inactive phases (combined with the 3rd part of the display) indicates the state of the stove.
UP/DOWN:
confirmation
of any
takes
place
automatically
within 3 seconds from the change or by pressing the conIn
the activeThe
phases,
it indicates
the change
operating
power
of the
stove.
firmation
key.
Apressing
sound signal
indicates
thatbutton,
the change
hasdisplay
been confirmed.
In
addition,
by
the
DOWN
scroll
you
can
the
power
settings,
that
be edited using the two scroll
In the inactive phases (combined with the 3rd part of the display) indicates the
state of
thecan
stove.
keys
In the active phases, it indicates the operating power of the stove.
UP/DOWN:
The
confirmation
of anyscroll
change
takesyou
place
withinsettings,
3 seconds
changeusing
or bythe
pressing
the conIn addition, by
pressing
the DOWN
button,
canautomatically
display the power
thatfrom
can the
be edited
two scroll
firmation
key. A sound signal indicates that the change has been confirmed.
keys
UP/DOWN: The confirmation of any change takes place automatically within 3 seconds from the change or by pressing the confirmation key. A sound signal indicates that the change has been confirmed.
Time and date setting
Below
given the
steps
for accessing
6.5 areTime
and
date
settingthe relative menu.
Time and date setting
Press
the
key
from
STAND-BY
to menu.
quickly display the real and active states of the stove as shown in the figure
Below
are
given the steps for
accessing
the mode
relative
below:
Press
from STAND-BY mode to quickly display the real and active states of the stove as shown in the figure
Time the
andkey
date setting
below:
Below are given the steps for accessing the relative menu.
Time and date setting
POWER
POWERMOD
Press
the
key
from
STAND-BY
to menu.
quickly display the real and active states of the stove as shown in the figure
Below
are
given the steps for
accessing
the mode
relative
PUMP
PUMPON
below:
POWER
Press the key
from STAND-BY mode toVAL
quickly
displayRISC
the real and active states of the stove as shown in the figure
3 VIE
PUMP
below:
PRESSURE 1.1 bar
POWER: It shows the real power that can be
POWER: It shows the real power that can be
PRESSURE 1.1 bar
POWER
PRESSURE
1.1 bar
PUMP
POWER
- MIN: minimum settable power (see power selection menu);
- MAX: maximum settable power (see power selection menu);
PUMP
the 1.1
stove
is set topower
maximum
each timemenu);
it is turned on
PRESSURE
bar
- MIN: minimum
settable
(see power selection
--MOD:
modulation
set (see
parameters
reached; menu);
MAX: stove
maximum
settablewith
power
power selection
- SANI: ifthe
the1.1
quick
kitmaximum
is provided,
as soon
there
a request
PRESSURE
bar
stove
isDHW
set to
power
eachas
time
it isisturned
on for
domestic
hot water,
the
stove
switches
to DHW
power
--MOD:
stove
modulation
with
set(see
parameters
reached;
MIN: minimum
settable
power
power
selection
menu);
automatically;
--SANI:
the quicksettable
DHW kitpower
is provided,
as soon
as there
is a request for
MAX: ifmaximum
(see power
selection
menu);
domestic
hot
water,
the (see
stovepower
switches
DHW
power
the
stovesettable
is set
topower
maximum
eachtotime
it is
turned on
POWER: It shows the real power that can be
- MIN: minimum
selection
menu);
PUMP: the writing ON indicates that the circulator is active
andstove
enables
water
circulation
within
house
system;menu);
automatically;
--MOD:
modulation
with
set (see
parameters
reached;
MAX:
maximum
settable
power
power
selection
- SANI: ifthe
thestove
quick isDHW
kitmaximum
is provided,
as soon
there
a request
set to
power
eachas
time
it isisturned
on for
3-WAY VALVE:
it shows
the position
of any
3-way valve
installed,
if there
is a water,
quick
heatswitches
exchanger
installed
or a DHW boiler
PUMP:
the writing
ON indicates
that the
circulator
is active
andstove
enables
water
circulation
within
house
system;
domestic
hot
the
to DHW
power
- MOD:
modulation
withDHW
setstove
parameters
reached;
- SANI: ifautomatically;
the quick DHW kit is provided, as soon as there is a request for
PRESSURE:
it indicates
the position
actual pressure
of thevalve
system
readdomestic
byif the
transducer
onswitches
the stove.
3-WAY VALVE:
it shows the
of any 3-way
installed,
there
is a water,
quickinstalled
DHW
heat
exchanger
installed
or a DHW boiler
hot
the stove
to DHW
power
PUMP: the writing ON indicates that the circulator is active and automatically;
enables water circulation within house system;
PRESSURE: it indicates the actual pressure of the system read by the transducer installed on the stove.
3-WAY
it shows
the position
of any
3-way valve
installed,
if therewater
is a quick
DHW within
heat exchanger
installed or a DHW boiler
PUMP: VALVE:
the writing
ON indicates
that the
circulator
is active
and enables
circulation
house system;
Press this key to return to STAND-BY page.
PRESSURE:
it indicates
the position
actual pressure
of thevalve
system
read byif the
transducer
on exchanger
the stove. installed or a DHW boiler
3-WAY
VALVE:
it shows the
of any 3-way
installed,
there
is a quickinstalled
DHW heat
Press this key to return to STAND-BY page.
15
PRESSURE: it indicates the actual pressure of the system read by the transducer installed on the stove.
POWER: It shows the real power that can be
Manuale utente PALMARE IDRO TOUCH RADIO
Vers. 01 del 07/04/15
date setting
Time andTime
and date setting
Manuale utente PALMARE IDRO TOUCH RADIO
Vers. 01 del 07/04/15
Pag.25
Pag.25
Below are given the steps for accessing the relative menu.
Time and date setting
Below are given the steps MENU
for accessing the relative menu.
Press the key
“access menu” to
access the
MENU page
Press the key
“access menu” to
access the
MENU page
USER
MANUFACTURER’S
MENU
TECHNICIAN
USER
MANUFACTURER’S
TECHNICIAN
DATE – TIME
USER
CHRONOTHERMOSTAT
USER
SCREW
LOADING
POWER
SETTING
SET AIR-PELLET
CHRONOTHERMOSTAT
SCREW LOADING
Press the key
“confirm”
to access the
USER page
Press the key
“confirm”
to access the
USER page
SET AIR-PELLET
ENABLE EXT. T.
SEASON
CONTRAST
DATE
– TIME
FW VERSION
ENABLE
EXT. T.
LANGUAGE
SEASON
ADJUST
CONTRAST
FW VERSION
LANGUAGE
ADJUST
Press the key
“confirm” to
access the
SETUP
Press
the key
page
“confirm” to
access the
SETUP
page
POWER SELECTION
POWER SETTING
POWER SELECTION
Press the key “selection” for
several times
to go to the second
page of the USER menu
Press theand
keyselect
“selection” for
several
times
SETTINGS.
to go to the second
page of the USER menu
and select
SETTINGS.
Press the key
“confirm”
to access the
page DATE-TIME
Press the key
“confirm”
to access the
page DATE-TIME
Press the increase key to change every single value
Press
Press the
the increase
increase key
key to
to change
change every
every single
single value
value
Press “confirm” to confirm the settings and switch to the next option.
Press the increase key to change every single value
Press
“confirm”
confirm
and switch
to display
the nextthe
option.
By
pressing
the to
key
“back”the
for settings
several times
you will
stand-by page.
By pressing the key “back” for several times you will display the
stand-by page.
Loading the auger
Carry out this operation to facilitate the first start-up phases of the stove; Also check that pellets have been fed into the tank and wait for the
Loading the auger
stove to reach the “SHUTDOWN” or “FINAL CLEANING” status. The the number expressed in seconds indicates the rotation time of the
Loading the auger
infeed screw during the first loading cycle. After this time, the infeed screw stops immediately and then pellets are emptied from the grate
Carry
this operation
to facilitate the first start-up phases of the stove; Also check that pellets have been fed into the tank and wait for the
beforeout
turning
on the equipment.
stove to reach the “SHUTDOWN” or “FINAL CLEANING” status. The the number expressed in seconds indicates the rotation time of the
Below are given the steps for accessing the relative menu.
infeed screw during the first loading cycle. After this time, the infeed screw stops immediately and then pellets are emptied from the grate
before turning on the equipment.
SCREW LOADING
6.6
MENU
Below are given the steps for accessing the relative menu.
At
Press the key
“access menu” to
access the
MENU page
Press the key
the
end
of the
“access
menu”
to
access the
MENU page
USER
MANUFACTURER’S
MENU
TECHNICIAN
USER
MANUFACTURER’S
TECHNICIAN
auger loading, the display
USER
POWER SETTING
CHRONOTHERMOSTAT
USER
SCREW
LOADING
POWER
SETTING
SET AIR-PELLET
SCREW LOADING
CHRONOTHERMOSTAT
Press the key
“confirm”
to access the
USER page
Press the key
shows“confirm”
0 “and
to access the
USER page
SCREW LOADING
SET AIR-PELLET
Press the key
“confirm” to enable the
rotation of the infeed screw
Press the key
automatically switches to the USER
menu
page.
“confirm”
to enable
the
rotation of the infeed screw
Press the key for several times until the Stand-by page is displayed.
At the end of the auger loading, the display shows 0 “and automatically switches to the USER menu page.
UNLIKE
THE
PROVIDED
WITH
CLEANING
DEVICE, IN THIS CASE ALWAYS REMEMBER TO EMPTY THE
Press the
keyMODELS
for several
times until
theAUTOMATIC
Stand-by page
is displayed.
GRATE BEFORE TURNING ON THE STOVE AND CHECK THAT ALL ITS HOLES ARE FREE OF OBSTRUCTIONS. NEVER EMPTY
THE GRATE INTO THE HOPPER. FIRE HAZARD.
UNLIKE THE MODELS PROVIDED WITH AUTOMATIC CLEANING DEVICE, IN THIS CASE ALWAYS REMEMBER TO EMPTY THE
GRATE BEFORE TURNING ON THE STOVE AND CHECK THAT ALL ITS HOLES ARE FREE OF OBSTRUCTIONS. NEVER EMPTY
THE GRATE INTO THE HOPPER. FIRE HAZARD.
16
Manuale utente PALMARE IDRO TOUCH RADIO
6.7 ambient
Settingand
ambient
andtemperature:
boiler water
Setting
boiler water
temperature:
Manuale
PALMARE
IDRO
TOUCH
Set the two values following the indications
givenutente
in the chapter
“Description
of the
display”
RADIO
Vers. 01 del 07/04/15
Pag.26
Vers. 01 del 07/04/15
Pag.26
Turning
the device
on water temperature:
Setting ambient
and boiler
Keep
thetwo
keyvalues
ON/OFF
pressed
a few seconds
to the
turnchapter
on the stove.
Set the
following
thefor
indications
given in
“Description of the display”
The message
6.8
theon“ADJUST
device THE
on RDS SYSTEM” indicates that the initial parameter testing and calibration procedure has
TurningTurning
the device
been completed unsuccessfully. This indication does not block the stove (see section WARNING POP-UP).
Keep the key ON/OFF pressed for a few seconds to turn on the stove.
On the display
the handheld
set appears
the SYSTEM”
following: indicates that the initial parameter testing and calibration procedure has
Theofmessage
“ADJUST
THE RDS
been completed unsuccessfully. This indication does not block the stove (see section WARNING POP-UP).
On the display of the handheld set appears the following:
Press and hold the ON/OFF button to turn off the stove and reset any alarms triggered. If the In case the infeed screw operations
described above have not been executed, the stove may fail to turn on.
Empty the brazier, reset the alarm and turn the stove on again. If the stove still fails to turn on, make sure the grate is perfectly fixed
to the support base; also check that there are no deposits that prevent the air to flow correctly and promote the ignition.
and holdpersists,
the ON/OFF
button
to turn service.
off the stove and reset any alarms triggered. If the In case the infeed screw operations
IfPress
the problem
contact
the support
described above have not been executed, the stove may fail to turn on.
Empty the brazier, reset the alarm and turn the stove on again. If the stove still fails to turn on, make sure the grate is perfectly fixed
to the support base; also check that there are no deposits that prevent the air to flow correctly and promote the ignition.
If the problem persists, contact the support service.
For models with automatic cleaning system, the active stove enables a cleaning cycle of the brazier upon ignition and before
IGNITION. In the event of FAILED IGNITION, it is not necessary to remove the unburnt pellet from the inside of the brazier
before turning on the stove again. As soon as the user restarts the stove, the operating system runs the operation without
enabling the cleaning device and without reactivating the pellet loading phase.
For models with automatic cleaning system, the active stove enables a cleaning cycle of the brazier upon ignition and before
IGNITION. In the event of FAILED IGNITION, it is not necessary to remove the unburnt pellet from the inside of the brazier
before turning on the stove again. As soon as the user restarts the stove, the operating system runs the operation without
What loading
happens
if the batteries are empty?
Sequence
of ignition
phases device and without reactivating the pellet
enabling
the cleaning
phase.
SWITCH-ON- initial pellet loading
phase;
Sequence of ignition phases
WAIT FLAME - flame development
wait
phase; initial pellet loading
SWITCH-ONphase; PHASE - flame
FLAME
stabilization
and
reduction
of
WAIT FLAME
- flame
development
combustion
wait phase;inside the brazier;
FLAME PHASE - flame
stabilization and reduction of
WORK - operating
phase
combustion
inside the
brazier;
described in the dedicated chapter;
If the battery is empty, inside the “drop”
will be displayed
a symbol indicating
What happens if the batteries
are empty?
the “almost empty” state of the same,
maintaining the handheld unit functions
If the battery is empty, inside the “drop”
active.
will be displayed a symbol indicating
the “almost empty” state of the same,
maintaining
thelevel
handheld
functions
As
soon as the
of theunit
battery
active. the radio communication the
prevents
handheld set displays on full screen the
picture of empty battery and all device
As soon as
thelocked
level of
thethe
battery
functions
are
until
batteries
prevents
the radio communication the
are
replaced
handheld set displays on full screen the
picture of empty battery and all device
functions are locked until the batteries
are replaced
WORK - operating phase
described in the dedicated chapter;
Changing the power of the stove
MENU
USER
Changing the power of
the stove
Press the key
“access menu” to
access the
MENU page
Press the key
“access menu” to
access the
MENU page
MANUFACTURER’S
MENU
TECHNICIAN
USER
MANUFACTURER’S
TECHNICIAN
USER
POWER SELECTION
CHRONOTHERMOSTAT
SCREW
LOADING
USER
POWER SELECTION
POWER SETTING
SET
AIR-PELLET
POWER
SETTING
Press the key
“confirm”
to access the
USER page
Press the key
“confirm”
to access the
USER page
CHRONOTHERMOSTAT
SCREW LOADING
SET AIR-PELLET
Press the key
“confirm”
to access the
POWER SETTING page
Press the key
“confirm”
to access the
POWER
SETTINGkey
page
the
following
Use the UP/DOWN keys to change the operating power.
By pressing
you will confirm the data
and go back to USER MENU
Use the UP/DOWN keys to change the operating power.
By pressing the following key you will confirm the data
and go back to USER MENU
The power can be selected only when the stove is operating Upon every start-up, the stove operates with maximum power in order to
ensure greater heat input to the heating system.
The power can be selected only when the stove is operating Upon every start-up, the stove operates with maximum power in order to
ensure greater heat input to the heating system.
17
Vers. 01 del 07/04/15
Manuale utente PALMARE IDRO TOUCH RADIO
6.9 Operating
of the
Operating
phases ofphases
the appliance
Pag.27
appliance
Modulation
During the work phases, the appliance is aimed at reaching the room/water temperature set by the user;
when one of these conditions is met, the stove switches to MODULE WORK phase, in which fuel consumption is minimised.
Should it be necessary to measure the room temperature using an external thermostat (optional), the latter must be
connected to the dedicated connector to the rear of the stove; therefore, the user will be able to enable temperature reading
in the dedicated menu “SETTINGS - ENABLE THERMOSTAT”. On display appears the writing TON / TOFF based on
thermostat request.
CONNECT AN EXTERNAL THERMOSTAT WITH A SIMPLE DRY CONTACT, THEREFORE, NOT POWERED.
MOREOVER, WE RECOMMEND YOU USE A THERMOSTAT WITH A MINIMUM OFFSET OF 3°C
IF YOU INTEND TO USE THE COMFORT CLIMA FUNCTION.
Comfort climate
The activation of this function enables the stove to reduce pellet consumption by activating the modulation phases, after the desired
temperature has been reached. Subsequently, the stove checks that the temperature is maintained steady for a preset time. If this
condition is met, it automatically switches off, and on display appears the writing ECO. The stove turns on again when the temperature
drops below the set threshold.
Below are given the steps for accessing the relative menu.
MENU
USER
USER
MANUFACTURER’S
TECHNICIAN
STOVE STATE
CHRONOTHERMOSTA
SCREW LOADING
COMFORT CLIMA
SETTINGS
SET AIR-PELLET
Press the key
“confirm”
to access the
USER page
Press the key
“access menu” to
access the
MENU page
USER
POWER SETTING
Press the key “selection” for
several times
to go to the second
page of the USER menu
and select
CLIMATE COMFORT.
Once you have accessed the Climate Comfort menu, it is possible to operate on the 4 types of settings dedicated to the function:
COMFORT CLIMA
ENABLE COMFORT
ENABLE COMFORT
ENABLE COMFORT
COMFORT CONTROL
RESTART DELTA
SHUTDOWN DELAY
COMFORT CLIMA
ENABLE COMFORT
COMFORT CONTROL
RESTART DELTA
SHUTDOWN DELAY
COMFORT CLIMA
AIR
WATER
COMFORT CLIMA DELTA
Select the control type
Comfort Clima on t°C
Water or room temperature
using the key
UP/DOWN key
“V” key to confirm the
selection
COMFORT CLIMA DELTA
ENABLE COMFORT
COMFORT CONTROL
RESTART DELTA
SHUTDOWN DELAY
COMFORT CLIMA
ENABLE COMFORT
SHUTDOWN DELAY
COMFORT CONTROL
RESTART DELTA
SHUTDOWN DELAY
Press the key for several times until the Stand-by page is displayed.
18
SHUTDOWN DELAY
Vers. 01 del 07/04/15
Manuale utente PALMARE IDRO TOUCH RADIO
Pag.28
Vers. 01 del 07/04/15
Manuale
utente
PALMARE
IDRO
TOUCH
RADIO
The first setting allows you to enable
the COMFORT
CLIMA
function which
is aimed
at checking
that the temperature set for room/
Pag.28
water is maintained at the set value for a maximum period of X minutes (SHUTDOWN DELAY: 5 MIN) before switching to before
The first setting
allows
you
to enable
COMFORT
CLIMA
function
is aimed
at checking
that thedrops
temperature
set set
for room/
switching
to ECO
STOP
phase.
The the
stove
remains in
this state
untilwhich
the room
or water
temperature
below the
value
water is maintained
at the
set value
forThe
a maximum
period
of X minutes
(SHUTDOWN
DELAY:
5 MIN) the
before
switching
tooffbefore
(CLIMATE
COMFORT
DELTA
: 5 ° C).
COMFORT
CONTROL
function
allows the user
to program
stove
to switch
when
switching
to ECO
STOP
phase. The
stove
this state until
the room(set
orby
water
temperature drops below the set value
the
set values
of AIR
temperature
rather
thanremains
WATERintemperature
are reached
the user).
(CLIMATE
COMFORT
DELTA
: 5 ° C). The
function
allows
thetemperature
user to program
the stove
switchwhen
off when
For
example,
with the room
temperature
at COMFORT
21 ° C, the CONTROL
stove switches
off when
this
is reached
and to
restarts
the
the
set values
of AIR temperature
temperature are reached (set by the user).
temperature
reaches
15°C (21°C -rather
5°C - than
0.5°CWATER
tolerance).
° C,the
thestove
stoveswitches
switches off
off when
when this
this temperature
temperature is
is reached
reached and restarts when the
For example, with the room
room temperature
temperature at
at 21
65°C,
15°C(21°C
(21°C- -5°C
5°C- -0.5°C
0.5°Ctolerance).
tolerance).
temperature reaches 59℃
For example,
with thethe
room
temperature
65°C, the
stove switches
whenthat
thisthis
temperature
is reached
and restarts
when the
You
can also activate
function
using anatexternal
thermostat,
keepingoff
in mind
does not include
the value
of the hysteresis.
temperature reaches 59℃ (21°C - 5°C - 0.5°C tolerance).
You can also activate the function using an external thermostat, keeping in mind that this does not include the value of the hysteresis.
We recommend you use an external thermostat with a histeresys value that can be set to maximum 3°C.
Stove’s operation may enable the switch on/off phase for several times during the day; this may compromise the shelf life
Wethe
recommend
you use an external thermostat with a histeresys value that can be set to maximum 3°C.
of
ignition resistance.
Stove’s operation may enable the switch on/off phase for several times during the day; this may compromise the shelf life
of DIFFERENZA
the ignition resistance.
A
DEI MODELLI CHE DISPONGONO DI PULITORE AUTOMATICO, UTILIZZANDO QUESTA
MODALITA’ E’ NECESSARIO VERIFICARE CHE DOPO OGNI SPEGNIMENTO AUTOMATICO IL BRACIERE
A DIFFERENZA
DEI MODELLI
CHE
DI PULITORE
AUTOMATICO,
UTILIZZANDO
QUESTA
RIMANGA
SEMPRE
BEN PULITO
INDISPONGONO
MODO DI GARANTIRE
UNA CORRETTA
ACCENSIONE
AUTOMATICA.
MODALITA’ E’ NECESSARIO VERIFICARE CHE DOPO OGNI SPEGNIMENTO AUTOMATICO IL BRACIERE
RIMANGA SEMPRE BEN PULITO IN MODO DI GARANTIRE UNA CORRETTA ACCENSIONE AUTOMATICA.
Stand-by
The STAND-BY mode is activated when the temperature of the water reaches 85℃, this function is aimed at protecting the circuit
Stand-by when COMFORT CLIMATE function is not active on boiler H2O. If the boiler is not in this condition
especially
STAND-BY
mode is activated
the temperature
the
water reaches
85℃,boiler
this function
,The
it switches
to STAND-BY
mode to when
guarantee
protection ofofthe
hydraulic
circuit. The
restarts is aimed at protecting the circuit
especially when
COMFORT
CLIMATE
function
is not
active
on boiler
H2O. If the boiler is not in this condition
automatically
after
it cooled down,
on the
condition
that
heating
is requested.
, it switches to STAND-BY mode to guarantee protection of the hydraulic circuit. The boiler restarts
automatically after
it cooled
down, on the condition that heating is requested.
Description
of menu
functions
Description of menu functions
Press the key to access the MENU page
Press the key to access the MENU page
MENU
USER
MENU
USER
MANUFACTURER’S
TECHNICIAN
MANUFACTURER’S
TECHNICIAN
The TECHNICIAN and MANUFACTURER menus are protected by password.
The TECHNICIAN and MANUFACTURER menus are protected by password.
Chronothermostat
With the Chrono-thermostat function you can program the automatic switch ON/OFF of the stove for each day of the week for each
day of the week in 4 independent time intervals (SET CHRONO 1-2-3-4).Below are given the steps for accessing the relative menu
With
thefrom
Chrono-thermostat
starting
Stand-By mode.function you can program the automatic switch ON/OFF of the stove for each day of the week for each
day of the week in 4 independent time intervals (SET CHRONO 1-2-3-4).Below are given the steps for accessing the relative menu
starting from Stand-By mode.
Chronothermostat
MENU
Press the key
“access menu” to
access
Press
thethe
key
MENUmenu”
page to
“access
USER
MENU
MANUFACTURER’S
USER
TECHNICIAN
MANUFACTURER’S
TECHNICIAN
USER
CHRONO
ENABLE CHRONO
CHRONO
SET
CHRONO 1
ENABLE
CHRONO
SET CHRONO
2
SET CHRONO 31
SET CHRONO 2
4
SET CHRONO 3
SET CHRONO 4
POWER SETTING
USER
USER
CHRONOTHERMOSTAT
POWER SETTING
SCREW
LOADING
CHRONOTHERMOSTAT
SET AIR-PELLET
SCREW LOADING
Press the key
“confirm”
to access
the
Press
the key
USER
page
“confirm”
SET AIR-PELLET
to access the
USER page
access the
MENU page
USER
POWER SETTING
CHRONOTHERMOSTAT
POWER SETTING
SCREW
LOADING
CHRONOTHERMOSTAT
SET AIR-PELLET
SCREW LOADING
Press the key
several times
to quickly
switch
Press the
key to
CRONO-THERMOSTAT.
several times
SET AIR-PELLET
to quickly switch to
CRONO-THERMOSTAT.
ENABLE CHRONO
ENABLE CHRONO
ENABLE CHRONO
ENABLE CHRONO
CHRONO
ENABLE CHRONO
SET
CHRONO 1
CHRONO
ENABLE
CHRONO
SET CHRONO
2
SET CHRONO 31
4
SET CHRONO 2
SET CHRONO 3
SET CHRONO 4
19
Vers. 01 del 07/04/15
Manuale utente PALMARE IDRO TOUCH RADIO
1
2
4
3
5
6
Pag.29
1
Orario di accensione impostabile
2
Orario di spegnimento impostabile
3
Giorno della settimana con programma attivo
4
Numero programma “crono” (1-2-3-4)
5
Settaggio della temperatura ambiente
6
Settaggio della temperatura acqua caldaia
By pressing the Increment key you can change each value and, at step 3, enable the days of the week;
By pressing the Increment key you can change each value and, at step 3, enable the days of the week;
Press “confirm” to confirm the settings and switch to the next value;
Press the “back” button to return to the CHRONO-THERMOSTAT page.
As per the above example, it has been set as CHRONO 1 an ignition from 08.30 to 21.30 from MONDAY to FRIDAY with room
temperature set to 21°C and hot water temperature set to 51°C.
Follow the same steps to set the programs 2-3-4.
To exit the CHRONO-THERMOSTAT function and return to Stand-by page, press the button repeatedly.
.
AIR / PELLETS setting
Setting of the PELLET-FLOW mix enables you to immediately change the quantity of pellet loaded in the brazier and the air inflow.
The stove is tested and approved with DIN PLUS certified pellets. If non-certified pellets are used you may need to regulate
combustion. Usually, the variation involves the FLOW percentage to regulate the air inflow and therefore combustion; if the flow
regulation is not sufficient, it may be required to change PELLETS feeding rate as well.
Below are given the steps for accessing the relative menu starting from Stand-By mode.
MENU
USER
USER
POWER SETTING
USER
MANUFACTURER’S
TECHNICIAN
Press the key
“confirm”
to access the
USER page
Press the key
“access menu” to
access the
MENU page
POWER SETTING
CHRONOTHERMOSTAT
SCREW LOADING
CHRONOTHERMOSTAT
SCREW LOADING
SET AIR-PELLET
SET AIR-PELLET
Press the key
several times
to quickly switch to
SET AIR / PELLETS.
Pellet
Pellet
Flow
Flow
Pellet
Pellet
Flow
Flow
As per the above example, you have set a percentage of -2 for PELLETS and +3 for the FLOW, an indication that a setting like this
is a consequence of the fact that the oxygen needed for combustion is insufficient and pellet size is smaller than the average size of
2 cm.
To exit the SET AIR - PELLET function and return to Stand-by page, press the button repeatedly.
NOTE: The number indicated during the change of parameters refers only to a percentage value that acts on the default
parameters set on the electronic board (exclusively in the WORK phase). These values must be changed in the event of
poor combustion, due in many cases to the purchase of pellets differing from those used during stove testing.
20
Manuale utente PALMARE IDRO TOUCH RADIO
Vers. 01 del 07/04/15
Pag.30
Stove State
Below are given the steps for accessing the relative menu starting from Stand-By mode.
MENU
USER
USER
POWER SETTING
USER
MANUFACTURER’S
TECHNICIAN
STOVE STATE
CHRONOTHERMOSTAT
SCREW LOADING
COMFROT CLIMA
SETTING
SET AIR-PELLET
Press the key
“confirm”
to access the
USER page
Press the key
“access menu” to
access the
MENU page
STOVE STATE
ACTIVE PARTS
ACTUAL STATES
STATE TEMPERATURE
H20 TEMPERATURE
STOVE STATE
STOVE STATE
ACTIVE PARTS
ACTIVE PARTS
ACTIVE PARTS
ACTUAL STATES
ACTUAL STATES
ACTUAL STATES
STATE TEMPERATURE
STATE TEMPERATURE
STATE TEMPERATURE
H20 TEMPERATURE
v
H20 TEMPERATURE
POWER MOD
PUMP
Press the key
several times
to quickly switch to
Stove STATUS.
3-WAY VALVE HEAT
PRESSURE 1.1 BAR
SHUTDOWN
HH T …
EXT.T …
FLAME T 340°C
FUME T 120°C
F. EX. T 30°C
C. EX. T 55°C
EL B. T---25°C
STOVE STATE
T. CALDERA
T.PUFFER H
T.PUFFER L
In this mode you can check the proper operation of the most important parameters of the appliance. Here is a list of real data of the
stove useful for service during inspection.
- Circulator state (ON running)
- Position of 3-way valve DHW (domestic hot water) or HEAT (heating);
- System pressure;
- Stove state;
- Current boiler power;
- Flow read by the flow meter;
- Fume extractor speed;
- Actual flow set;
- Temperature read by the handheld unit;
- External thermostat (request ON);
- Flame temperature (combustion chamber);
- Combustion fume exhaust temperature;
- Inlet flow meter temperature;
- Heated flow meter temp.;
- Electronic board temperature;
- Boiler water temperature (SUPPLY);
- Boiler water temperature (optional) - RETURN from the system;
- Boiler DHW temperature;
- Puffer temperature - average warm point;
- Puffer temperature second reading (low temp.).
To exit the STOVE STATE page and return to Stand-by page, press the button repeatedly.
Settings
Below are given the steps for accessing the relative menu starting from Stand-By mode.
USER
MENU
USER
MANUFACTURER’S
TECHNICIAN
Press the key
“access menu” to
access the
MENU page
USER
POWER SETTING
STOVE STATE
CHRONOTHERMOSTAT
SCREW LOADING
COMFROT CLIMA
SETTING
SET AIR-PELLET
Press the key
“confirm”
to access the
USER page
After following the procedure above step by step, you can set the following functions:
Press the key
“selection” to switch to
second menu page
to the function
SETTINGS.
21
Manuale utente PALMARE IDRO TOUCH RADIO
Vers. 01 del 07/04/15
Pag.31
Settings > Enable thermostat
DATE-TIME
DATE-TIME
ENABLE EXT. T
SEASON
CONTRAST
FW VERSION
LANGUAGE
ADJUST
FW VERSION
LANGUAGE
ADJUST
Press the key
“selection” to switch to
ENABLE THERMOSTAT.
Press the “enter” key
to access the
SETTINGS
ENABLE THERMOSTAT
Press the key
“confirm”
to enable the function.
ENABLE THERMOSTAT
ENABLE EXT. T
SEASON
CONTRAST
Press the key
“confirm”
to access the function
In Stand-By mode, instead of room temperature measured
and settable, appears the line T ON if the room in which
the thermostat is installed has not reached the temperature
requested or the writing T OFF if the temperature in the
room is reached.
Press the key for several
times
to return to
“STAND BY” page
Settings > Season
DATE-TIME
DATE-TIME
ENABLE EXT. T
SEASON
CONTRAST
ENABLE EXT. T
SEASON
CONTRAST
FW VERSION
LANGUAGE
ADJUST
Press the key
“confirm” to
access the
SETUP
SETTINGS
WINTER
FW VERSION
LANGUAGE
ADJUST
Press the key
“confirm”
to access the function
Press the key
“selection” to switch
to the function
CONTRAST.
Use the UP/DOWN keys to change the WINTER/
SUMMER season. Function that can be set when
working with DHW puffer (Boiler).
See chap. Evolved hydraulic diagrams
SUMMER
By pressing the following key you will confirm of data
and switch to the page within SETTINGS menu.
Settings > Contrast
ENABLE EXT. T
SEASON
CONTRAST
FW VERSION
LANGUAGE
ADJUST
FW VERSION
LANGUAGE
ADJUST
Press the key
“confirm” to
access the
SETUP
SETTINGS
CONTRAST
DATE-TIME
DATE-TIME
ENABLE EXT. T
SEASON
CONTRAST
Press the key
“confirm”
to access the function
Press the key
“selection” to switch
to the function
CONTRAST.
Use the UP/DOWN keys to change contrast setting and obtain
a better visualisation of the information shown on the handheld
set.
The value can vary from 0 to 100. 50 with respect to the
standard value.
By pressing the following key you will confirm of data
and switch to the page within SETTINGS menu.
Settings > Firmware version
DATE-TIME
DATE-TIME
ENABLE EXT. T
SEASON
CONTRAST
FW VERSION
FW VERSION
LANGUAGE
ADJUST
Press the “enter” key to
access the
SETTINGS
FIRMWARE
ENABLE EXT. T
SEASON
CONTRAST
LANGUAGE
ADJUST
Press the key
“selection” to switch to
CONTRAST.
Press the key
“confirm”
to access the function
By pressing the button you will confirm the data and switch to the page within the SETTINGS menu.
22
Vers. 01 del 07/04/15
Manuale utente PALMARE IDRO TOUCH RADIO
Pag.32
Settings > Language
To access the next setting, follow the steps given above or simply remove and replace the batteries.
The device resets and prompts you again to select the language you want to set.
Settings > Adjust
ADJUST
DATE-TIME
DATE-TIME
ENABLE EXT. T
SEASON
CONTRAST
ENABLE EXT. T
SEASON
CONTRAST
FW VERSION
LANGUAGE
ADJUST
FW VERSION
LANGUAGE
ADJUST
Press the key
“confirm” to
access the
SETUP
SETTINGS
Press the key
“confirm”
to access the function
Press the key
“selection” to switch
to the function
VERSION FW.
Use the UP/DOWN keys to change the value read by the
room temperature probe installed inside the handheld
set, with respect to a reference value.
The value can vary from -10°C to 10°C.
The standard value is 0°C.
By pressing the following key you will confirm of data
and switch to the page within SETTINGS menu
VENTILATION menu (function only for models in which the same is specified in the dedicate user’s manual)
The stoves equipped with ventilation system can heat the area in which are installed through the heat generated by the window and
the room temperature fan installed inside them.
Below are the messages shown on display when the stove is equipped with ventilation system.
The temperature read by the handheld unit controls the modulation of the stove. If you want to adjust the ventilation by
adjusting the stove, set the fan to A mode as shown in the relative chapter.
USER
MENU
POWER SETTING
USER
MANUFACTURER’S
TECHNICIAN
CHRONOTHERMOSTAT
SCREW LOADING
SET AIR-PELLET
Press the key
“confirm”
to access the
USER page
Press the key
“access menu” to
access the
MENU page
Press the key
“confirm”
to quickly switch to
VENTILATION.
VENTILATION POW.
Press the increase/decrease keys
“increase/decrease”
to change the ventilation.
To exit the page and return to Stand-by page, press the button repeatedly.
Control: ventilation can be set from 0 to AUTO where 0 indicates that the same is disabled, setting from MIN to MAX enables selecting
the heat distribution speed. If set to AUTO, the ventilation follows the power set on the stove.
Chrono function
By enabling the chrono function, it is possible to control the ventilation speed for each program as shown in the logic above.
USER
MENU
USER
MANUFACTURER’S
TECHNICIAN
Press the key
“access menu” to
access the
MENU page
USER
POWER SETTING
POWER SETTING
CHRONOTHERMOSTAT
CHRONOTHERMOSTAT
SCREW LOADING
SCREW LOADING
SET AIR-PELLET
Press the key
“confirm”
to access the
USER page
SET AIR-PELLET
Press the key
several times
to quickly switch to
CRONO-THERMOSTAT.
23
Vers. 01 del 07/04/15
Manuale utente PALMARE IDRO TOUCH RADIO
CHRONO
Pag.33
ENABLE CHRONO
ENABLE CHRONO
ENABLE CHRONO
SET CHRONO 1
SET CHRONO 2
SET CHRONO 3
SET CHRONO 4
CHRONO
VENTILATION POW.
ENABLE CHRONO
SET CHRONO 1
SET CHRONO 2
SET CHRONO 3
SET CHRONO 4
Press the key
“enter” at the end of the
setting, from the following
CHRONO page
Press the increase/decrease keys
“increase/decrease”
to change the ventilation.
The exit key shows the CHRONO menu to set other variables related to the menu functions.
To exit the page and return to Stand-by page, press the button repeatedly.
Pages displayed upon the activation of advanced layouts
By activating a layout different from the standard (layout 0), even if maintaining the same functions of the menu, the “Stand-by” page will
display all connected utilities such as the temperature of the boiler of the puffer.
Below is shown the new display mode and the function of every icon for every layout, to change the various settings.
If the type of system designed requires controlling the 3-way valve (diagram 1 and 3), it is necessary to purchase the
optional kit from the retailer or the authorized Ravelli dealer.
Layout 1 (DHW Boiler + heating control)
The following layout can be used when you have a boiler that is not equipped with plate heat exchanger and you intend to buy a puffer
that should be connected to the circuit to produce hot domestic water.
In this type of circuit, room temperature is controlled however by the handheld unit which, being a radio device, acts as a remote
chronothermostat. The boiler is managed by the thermostove through a contact or immersion probe (not supplied) connected directly
to the back of the stove. Below is shown the new “Stand-by” mode.
T°C Boiler
From STAND BY mode, press
the ARROW key UP
to set the
room T°C
and DHW boiler T°C that you
desire.
Boiler water T°C
From STAND BY mode, press
the ARROW key DOWN
to set
the boiler water T°C
that you desire.
POWER
MOD
PUMP
3-WAY VALVE
HEAT
PRESSURE 1.1 BAR
HH T .
21°C
Press the key
“V” from STAND BY page
to display the actuale states and
the room temperature
The operation is the same as for the basic layout except for the fact that in this layout, the boiler exchanges heat directly in the
boiler (priority); when the temperature set is reached, the 3-way valve changes its position and the boiler starts exchanging heat within
the heating circuit. From this moment, the stove is controlled by the radio handheld unit for contolling the room
temperature or via H2 setting (see the operation with layout 0 to find the data on modulation, eco stop etc.).
The 3-way valve is directed again into the boiler when:
- there is a request from the Boiler;
- there is a requested from the flow switch (optional, if connected).
The stove restarts from Eco-stop or Stand by mode according to heating requests or boiler requests.
By setting the SUMMER function, the 3-way valve remains fixed in a single position, enabling the release of heat output
by the stove exclusively inside the boiler. As soon as this condition is reached, the boiler switches to ECO STOP mode.
24
Vers. 01 del 07/04/15
Manuale utente PALMARE IDRO TOUCH RADIO
Pag.34
Layout 2 (storage puffer management)
In this type of circuit, the storage puffer is managed by the stove due to a contact or immersion probe (optional) connected to the
back of the stove.
Below is shown the new “Stand-by” mode.
T°C Puffer
From STAND BY mode, press
the ARROW key to
set the desired puffer T°C
POWER MOD
PUMP
3-WAY VALVE
PUFFER
PRESSURE 1.1 BAR
HH T .
21°C
Boiler water T°C
CANNOT BE CHANGED
Press the key
“V” from STAND BY page
to display the actual states and
the room temperature
The operation is the same as for the basic layout except for the fact that in this layout, the boiler exchanges heat directly in the puffer;
when the temperature set is reached, the stove switches to ECO STOP mode and then restarts if the temperature drops below a
restart value (set by the installer upon testing).
Layout 3 (DHW boiler + storage puffer management)
The following layout combines the functions of the previous layouts and is recommended to stoves provided with a puffer without
internal coil preset for domestic hot water.
In this type of circuit, the boiler is managed by the stove due to a contact or immersion probe (optional) to be connected to the back
of the stove. The same applies to the control of the puffer that is provided by the thermostove through a contact or immersion probe
(not supplied) connected directly to the back of the stove.
Below is shown the new “Stand-by” mode.
T°C Boiler
From STAND BY mode, press
the ARROW key UP
to set the
DHW boiler T°C
that you desire.
T°C Puffer
From STAND BY mode, press
the ARROW key DOWN
to set
the desired puffer T°C
POWER
MOD
PUMP
3-WAY VALVE HEAT
3-WAY VALVE BOILER
HH T .
21°C
Press the key
“V” from STAND BY page
to display the actual states and
the room temperature
The operation is the same as for the basic layout except for the fact that in this layout, the boiler exchanges heat directly in the boiler
(priority); when the temperature set is reached, the 3-way valve changes its position and the boiler starts exchanging heat within the
puffer. When the set temperature is reached, the stove enters in ECO STOP mode; it restarts if the temperature drops below a restart
value (set by the installer upon testing).
The 3-way valve is directed again into the boiler when:
- there is a request from the Boiler;
- there is a requested from the flow switch (optional, if connected).
The stove restarts from Eco-stop or Stand by mode according to storage puffer requests or boiler requests.
By setting the SUMMER function, the 3-way valve remains fixed in a single position, enabling the release of heat output
by the stove exclusively inside the boiler. As soon as this condition is reached, the stove switches to ECO STOP mode.
25
Manuale utente PALMARE IDRO TOUCH RADIO
Vers. 01 del 07/04/15
Pag.35
Stove phase general layout
FASE
FINAL CLEANING
SWITCH ON
WAITING FOR FLAME
FLAME PHASE
WORK AT MAX P
WORK AT MIN P
The stove is in the switch off phase and the cooling phase has not been completed yet.
The heater pre-heating phase has started and the pellets start to fall into the grate.
The pellets ignite and take advantage of the heat in the intake air that passes through the
incandescent heater tube.
The flame develops in the grate.
The stove has completed the switch on phase and runs at maximum set power
The stove works at the operating power set after ignition.
WORK AT DHW P
The stove works at an operating capacity dedicated to DHW
(flow switch request with DHW kit or DHW boiler)
MODULATE H2O
The desired boiler water set temperature has been reached.
ROOM TEMPERATURE
MODULATION
THE GRATE
ECO STOP
The room temperature set has been reached.
Brazier cleaning phase is active (periodic function).
With Climate Comfort active, the stove switches to automatic switch-off mode when
the room temperature set is reached (see the dedicated section).
START/RESTART WAIT
Switch-on is requested but with the stove in cooling phase; once this condition is met,
it restarts automatically.
SWITCH ON RESTART
The HOT restart phase is activated.
Functioning is similar to the SWITCH ON phase
HOT SMOKE
26
DESCRIZIONE
The maximum fume temperature threshold has been reached. To facilitate cooling, the stove
brings the capacity to a minimum with ventilation at power level 5, leading to a decrease in
fume temperature.
Manuale utente PALMARE IDRO TOUCH RADIO
PHASE
OFF
WAIT FOR PELLETS
OUT OF
INFEED SCREW
OVERFLOW
GENERIC ALARM
ANOMALY (general)
AUTOMATIC CLEANING
SYSTEM ACTIVE
Vers. 01 del 07/04/15
Pag.36
DESCRIPTION
The stove is off
When the switch-on request from ECO-STOP mode coincides with an automatic switch-off
condition (from the TIMER), the stove turns on ensuring total cleaning of the brazier before
switching to FINAL CLEANING.
CONDITION: when the pellet setting (set pellets +5) is near the continuous load condition.
SOLUTION: Set the value back to 0.
The stove is in alarm state; refer to the troubleshooting chapter.
The stove has detected an anomaly; refer to the troubleshooting chapter.
For models with automatic cleaning system it indicates the operating state of the same.
STAND BY
Forced shutdown state when the boiler water reaches 85°C. The stove restarts automatically if the restart conditions are met.
ANOMALIA
DESCRIZIONE
Warning Pop-Up
Adjust RDS
system
RD SYSTEM REGULATION
REQUEST
(only if the RDS system is
installed)
It shows that the testing procedure and initial parameter calibration have been completed
incorrectly.
This indication, however, does not block the stove.
FLOW METER FAILURE
(only if the RDS system is
installed)
It shows a failure of the air flow meter and the stove switches to minimum capacity
disabling the RDS system.
SERVICE REQUEST
SIGNALLING
CLEAN
THE GRATE
(only if the RDS
system is installed)
The threshold value of set work hours has been reached. The symbol displayed remains
active throughout the work phase. Non-routine maintenance is required on the stove.
REASON
SOLUTION
• The door and the ash box are not closed correctly
• Make sure they are closed properly.
• Poor combustion in grate.
• Switch off the stove, clean the brazier and check the cleanliness of the
support bench, clean the tube bundle by activating the turbolators and adjust
the combustion through pellet/air settings.
• Presence of foreign body in air intake tube.
• Check if present and remove foreign body
• The air flow meter may be dirty.
• Clean the flow meter with the stove in “Switched off” state
• Contact the Support Service
The appearance of the message “ADJUST THE RDS SYSTEM” indicates that the initial parameter testing procedure and
calibration has been unsuccessfully. This indication does not block the stove.
27
Manuale utente PALMARE IDRO TOUCH RADIO
6.9.1 Alarms (table with reference codes)
Vers. 01 del 07/04/15
Pag.37
Alarms (table with reference codes)
TITLE
TRIAL.
REASON
- No voltage during work phase
AL 01
BLACK OUT
SOLUTION
- Press the switch off key and switch on the stove
again
- If the problem persists, contact the Support Service
AL 02
AL 03
K PROBE FAILURE
OVERTEMP. K
- The K probe is malfunctioning
- Contact the Support Service
- The K probe is disconnected from the electronic
board
- Contact the Support Service
- Combustion in the brazier is not optimal due to
clogging or obstructions of internal stove ducts
inside the stove
- Switch off the stove, clean the brazier and the tube
bundle and adjust the combustion setting the Pellet/
Air values
- The tangential fan (if provided) is
malfunctioning or damaged
- Contact the Support Service
- If the problem persists, contact the Support Service
AL 04
AL 05
AL 06
FUME EXHAUST DAMAGED
NO SWITCH-ON
PELLETS FINISHED
- Fume exhaust encoder is not working or is
connected incorrectly
- Contact the Support Service
- No power to fume extractor.
- Contact the Support Service
- The fume extractor is blocked.
- Contact the Support Service
- The pellet tank is empty.
- Check for the presence of pellets in the container.
Top up, if necessary.
- Pellet calibration and suction during switch on phase
is incorrect.
- Contact the Support Service
- The ignition coil is faulty or positioned
incorrectly
- Contact the Support Service
- The pellet tank is empty.
- Check for the presence of pellets in the container.
Top up, if necessary.
- The gear motor is not loading pellets.
- Empty the tank to see if there are any objects inside
that may prevent proper operation of the auger.
- Not enough pellets loaded
- Regulate pellets setting from “SET AIR/PELLETS”
- If the problem persists, contact the Support Service
AL 07
RESETTABLE THERMAL
BREAKER
- The manual reset thermostat connected to the hopper
has been triggered
- Reset the thermostat by pressing the button on the
back of the stove
- Combustion in the brazier is not optimal due to
clogging or obstructions of internal stove ducts inside
the stove
- Switch off the stove, clean the brazier and the tube
bundle and adjust the combustion setting the Pellet/
Air values
• Contacter le Service d’Assistance
- The flue is blocked.
- Check the flue is free and clean
- The vacuum meter is faulty.
- Check the mains voltage.
- Check the mains voltage.
AL 08
DEPRESSION
AL 12
FUME EXHAUST SYSTEM
FAILURE
- The fume exhaust system has a loss of performance
due to fan obstruction or voltage drop.
AL 14
SCREW PHASE
- No cable connection to power the gear motor screw
- Check the mains voltage.
SCREW TRIAC
- An internal part of the electronic board that controls
the pellet infeed screw is faulty.
- Check the flue is free and clean
AL 15
AL 17
AL 19
NO FLOW
(only if the RDS system is
installed)
CLEANER FAILURE
(for models equipped with
cleaner)
- Possible voltage drops or incorrect input voltage
- Check the mains voltage.
- The flow meter does not measure an input air flow
- Check whether the door and the drawer are
properly closed, correctly and check if the air
inlet pipe is obstructed.
- If the problem persists, contact the Support
Service
- The cleaner did not complete the movement
and is not in the correct position
- Reset the alarm and wait for the stove to switch
to SHUTDOWN mode. Cut off and power again,
the system reactivates the cleaner searching the
correct position again.
- If the problem persists, contact the Support Service
AL 10
OVERTEMP. H2O
AL 11
H2O PROBE FAILURE
AL16
PRESSURE
• The boiler water temperature exceeds 90 °C.
- Check the mains voltage.
• The boiler water probe is malfunctioning.
- Check the mains voltage.
- The boiler water probe is disconnected from the
electronic board.
- Check the mains voltage.
• The pressure of the system is greater or lower than a
preset value, allowed values from bar to 2.5 bar. (We
recommend at cold circuit a pressure of about 1.0 bar)
• Fill the system or vent it to bring the pressure
to the value requested for correct operation.
• If the problem persists, contact the Support Service
28
Vers. 01 del 07/04/15
Pag.38
EACH ALARM CAUSES THE IMMEDIATE SWITCHING OFF OF THE STOVE. PRESS THE SWITCH-ON BUTTON
TO RESET THE ALARM. BEFORE SWITCHING ON THE STOVE, MAKE SURE THE SIGNAL HAS BEEN REMOVED
AND (UNLIKE MODELS EQUIPPED WITH AUTOMATIC CLEANER) THAT THE BRAZIER IS PROPERLY CLEANED TO
ENSURE CORRECT RESTART.
Termico a riarmo manuale
Svitare il tappo di protezione e premere
il pulsante per riarmare il termico
In the case of alarm 07 THERMAL BREAKER below shows the location
where to operate to reset the thermal switch with manual reset.
Cleaning should be provided by the user
Before any cleaning operation on the stove, implement the following precautions:
- switch off the stove and disconnect the power cord with the stove in “SWITCHED OFF” state;
- make sure all the parts of the stove are cold;
- make sure the ash is completely cooled.
To clean the surfaces of the coated metal parts, use a cloth soaked in water or water and soap.
Use of abrasive detergents or diluents can damage the surface of the stove.
SI PREGA DI SEGUIRE ATTENTAMENTE LE SEGUENTI ISTRUZIONI PER UNA CORRETTA PULIZIA.
LA NON ADEMPIENZA POTREBBE CAUSARE MALFUNZIONAMENTI ALLA Termostufa.
Cleaning the ash pan
Pull out the drawer from the stove and remove the ash using a special vacuum cleaner; be very careful to the brazier that may still be
hot that may damage the equipment used for cleaning.
Cleaning operations of the stove depend on the quality of the pellets used and the frequency of use.
It may be necessary to carry out these operations on a daily basis.
Drawer
ash
Ash pan that needs
to be emptied
Cleaning glass
The glass of the door should be cleaned with the stove cooled down using a cotton cloth or paper towel.
Usually, we recommend you clean the glass with a damp (water) cloth and ash collected after burning (having an abrasive function).
NO PONGA EN MARCHA la Termoestufa YA QUE PODRÍAN PRODUCIRSE DAÑOS EN EL VIDRIO.
CONTACTE AL SERVICIO DE ASISTENCIA PARA SUSTITUIRLO.
Manual tube bundle cleaning(where applicable)
Operate the up/down pins to keep the tube bundle clean and ensure the best water heat
exchange in the stove.
Pins to be operated
“Up/Down”
This is a manual containing general information. Therefore, all assembly/disassebly and cleaning operations of the
stove are given in the dedicated manual of the stove, together with the following general manual.
29
7. Maintenance Record
DATE
30
WORK CARRIED OUT
SIGNATURE
Page 16
25
8. Warranty Information
Pellet Fire Solutions and its partner Ravelli ,
manufacturers of the Ravelli range of pellet fires
extends the following warranty for their wood pellet fires
when purchased from an authorised Pellet Fire
Solutions dealer.
8.1
Warranty Coverage
Pellet Fire Solutions warrants to the original owner of
the pellet fire at the site of installation, and to any
transferee taking ownership of the pellet fire at the
original site of installation within two years following the
date of original purchase, that the pellet fire will be free
from defects in materials and workmanship at the time of
manufacture. After installation, if any covered components
manufactured by Ravelli are found to be defective in
materials or workmanship during the applicable warranty
period, Pellet Fire Solutions will, at its option, repair or
replace the covered components. Pellet Fire Solutions, at
its own discretion, may fully discharge all of its
obligations under such warranties by replacing the
product itself or refunding the verified purchase price of
the product itself. The maximum amount recoverable
under this warranty is limited to the purchase price of
the product. This warranty is subject to conditions,
exclusions and limitations as described below.
This warranty only covers pellet fires that are purchased
and installed through an authorised Pellet Fire Solutions
dealer or distributor. A list of authorised dealers is
available on the Pellet Fire Solutions website
(www.pelletfiresolutions.co.nz).
This warranty is only valid while the pellet fire remains at
the site of original installation.
Contact your installing dealer for warranty service. If the
installing dealer is unable to provide necessary parts,
contact the nearest authorised Pellet Fire Solutions
dealer or supplier. Additional service fees may apply if
you are seeking warranty service from a dealer other
than the dealer from whom you originally purchased the
product.
Check with your dealer in advance for any costs to you
when arranging a warranty call. Travel and shipping
charges for parts are not covered by this warranty.
8.2
Parts
Period
Comments
Fireplace,
stovebody and
parts covering:
Full
replacement
5 years
parts
Surface
finishes,
burnpot liner
and ceramic
panels are
covered
separately (see
clarifications
and exclusions
below).
2 years
labour
Firebox, firebox
panel, & burnpot
Heat exchanger
Pedestals,
Panels & Legs
Electrical items covering
Ignitor (including
tube)
Full
replacement
Auger Motor
2 years
parts &
labour
Circuit Board,
decal & mounting
bracket
Blowers
(Convection and
Combustion)
Timers
Sensors
Vacuum Switch
Wire harness
Replacement/spare Parts
All replacement
parts beyond
their original
warranty period
or purchased
new from a
Dealer
Full
replacement
1 year
Evidence of
parts only the original
purchase date
will be required
e.g. a copy of
the original
invoice.
Clarifications and exceptions
Burnpot Liner
and Brick Liner
Full
replacement
1 years
parts &
labour
Paint on the
brick firebox
lining may peel
over time due
to the extreme
conditions and
is not a flaw.
Exterior
Full
surface finishes
replacement
(including plating,
enamel or paint)
1 years
parts &
labour
Colour changes
with heating
and tarnish,
discolourisation
and wear
(including
scratches,
fingerprints etc.)
are not covered
under warranty.
Warranty Period
Warranty coverage begins at the date of installation. In
the case of new home construction, warranty coverage
begins on the date of first occupancy of the dwelling, or six
months after the sale of the product by an independent,
authorised, Pellet Fire Solutions dealer/distributor,
whichever occurs earlier. The warranty period for parts
and labour for covered components is explained in
the following table.
Page 17
26
Component(s)
Exclusions
Glass
No warranty
Vermiculite (Firex
600) & ceramic
panels (cast
majolica)
No warranty
Fibreglass rope
gaskets
No warranty
31
8.3
Warranty Exclusions
This warranty does not cover the following:
• Changes in surface finishes as a result of normal use.
As a heating appliance, some changes in colour of
interior and exterior surfaces may occur. This is not a
flaw and is not covered under warranty.
• Damage to printed, plated, or enamelled surfaces
caused by fingerprints, accidents, misuse, scratches,
melted items, or other external sources and residues
left on the plated surfaces from the use of abrasive
cleaners or polishes.
• Repair or replacement of parts that are subject to
normal wear and tear during the warranty period.
These parts include: paint, gaskets, FIREX, flame
guides, and the discolouration of glass.
• Minor expansion, contraction, or movement of certain
parts causing noise. These conditions are normal and
complaints related to noise are not covered by this
warranty.
• Damages resulting from: (1) failure to install, operate
or maintain the pellet fire in accordance with the
installation instructions, operating instructions and
data plate furnished with the pellet fire; (2) failure to
install the pellet fire in accordance with local building
codes; (3) shipping or improper handling; (4) improper
operation, abuse, misuse, continued operation with
damaged, corroded or failed components, accident,
or improperly/incorrectly performed repairs; (5)
environmental conditions, inadequate ventilation,
negative pressure, or drafting caused by tightly sealed
constructions, insufficient make-up air supply, or
handling devices such as exhaust fans or forced air
furnaces or other such causes; (6) use of fuels other
than those specified in the operating instructions;
(7) installation or use of components not supplied
with the pellet fire or any appliance not expressly
authorised and approved by Pellet Fire Solutions /
Ravelli; (8) modification of, interruptions to or
fluctuations of the electrical power supply to the pellet
fire.
The warranty is void if:
The pellet fire has been over-fired or operated in
atmospheres contaminated by chlorine, fluorine, or other
damaging chemicals. Over firing can be identified by, but
not limited to, warped plates or tubes, rust coloured cast
iron, bubbling, cracking and discolouration of steel or
enamel finishes.
The pellet fire is subjected to prolonged periods of
dampness or condensation.
There is any damage to the pellet fire or other components
due to water or weather damage which is the result of, but
not limited to, improper chimney or venting installation.
The owner’s exclusive remedy and Pellet Fire
Solutions / Ravelli’s sole obligation under this
warranty, under any other warranty, express or
implied, or in contract, tort or otherwise, shall be
limited to replacement, repair, or refund, as specified
above. In no event will Pellet Fire Solutions / Ravelli
be liable for any incidental or consequential
damages caused by defects in the appliance. Some
countries do not allow exclusions or limitation of
incidental or consequential damages, so these
limitations may not apply to you. This warranty gives
you specific rights, you may also have other rights,
which vary from country to country. EXCEPT TO THE
EXTENT PROVIDED BY LAW, Pellet Fire Solutions /
Ravelli MAKES NO EXPRESS WARRANTIES OTHER
THAN THE WARRANTY SPECIFIED HEREIN. THE
DURATIONOF ANY IMPLIED WARRANTY IS LIMITED
TO DURATION OF THE EXPRESSED WARRANTY
SPECIFIED ABOVE.
• Non Pellet Fire Solutions approved venting
components, hearth components or other
accessories used in conjunction with the appliance.
• Any part of a pre-existing fireplace system
• Pellet Fire Solutions / Ravelli’s obligation under
this warranty does not extend to the pellet fires’
capability to heat the desired space. Information is
provided to assist the consumer and the dealer in
selecting the proper appliance for the application.
Consideration must be given to appliance location and
configuration, environmental conditions, insulation and
air tightness of the structure.
32
Page 18
27
9. Proof of Purchase/Warranty
Use this page to note down the details of your wood pellet fire purchase, and attach the receipt and any other documents/
business cards from the retailer that sold you the fire.
Name of Store where Pellet fire was purchased: .......................................................................................................
Date of Purchase:
.......................................................................................................
Amount Paid:
$ ......................................................................................................
Payment Method:
o Credit Card
o
EFTPOS
o
Cash
o
Other
Attach receipt and other documents here
Page 19
28
33
Installation Section
Table of Contents
1.
2.
Dimensions Ravelli Pompeii ............................................................... 35
1.1
Deciding where to locate your wood pellet burning stove: ...................................36
1.2
Clearances to Combustibles – Ravelli Pompeii Freestanding .............................. 36
1.3
Exhaust and Fresh Air Intake Locations ...................................................................36
Installation.............................................................................................. 37
2.1
Dimensions – Pompeii Freestanding ....................................................................37
2.2
Clearances & Specifications .....................................................................................37
2.3
Minimum Clearance to Combustibles ...... ............................................................... 38
2.4
Location of the Pellet Stove .......................................................................................38
2.5
Positioning the stove:.................................................................................................38
2.6
Location of a power source .......................................................................................38
2.7
Internal Standard Flue Kit (50) ...................................................................................39
2.8
External Standard Flue Kit (51) ..................................................................................40
2.9
Seismic Restraint ........................................................................................................41
2.10
Fixing to Timber Floor Framing .................................................................................41
2.11
Installation ...................................................................................................................41
2.12
How to mount the side panels ..................................................................................42
2.13
Seismic Restraint Locations ......................................................................................43
2.14
Hydraulic Installation ................................................................................................. 44
2.15
Examples of Hydraulic Installation ........................................................................... 45
3.
Installation Data Sheet .......................................................................... 47
4.
Maintenance Record ............................................................................. 48
Producer Statement and Warranty Registration Form ..................... 49
NOTE TO INSTALLER - PLEASE ENSURE THE “INSTALLATION DATA SHEET” ON PAGE 47 IS
COMPLETED ONCE THE UNIT IS INSTALLED.
34
29
1.
Dimensions (Ravelli Pompeii)
Unit of Measurement
Height
mm
1133
Width
mm
476
Depth
mm
581
Weight
Kg
190
Diameter of smoke exhaust
duct
mm
80
Min.-max.calorofic power
kW
3.4 - 17.2
Min.-max. hourly consumption of pellets
Kg/h
Electrical power absorbed
during operation
W
240
V - Hz
220 – 50
Tank capacity
Kg
23
Space Heating
%
84
Supply
1.0 – 4.0
The data shown above are indicative and not binding. Ravelli reserves the right to make any
for the purpose of improving the performances of the product.
581
81
1133
FLOW 3/4
RETURN 3/4
28
50
363
266
222
80
35
1.1
Deciding where to locate your wood pellet burning stove:
1.
2.
3.
1.2
Do not install the pellet stove in a bedroom or room where people sleep.
Locate the pellet stove in a large and open room that is centrally located in the house.
This will optimize heat circulation.
Check clearances to combustibles.
Clearances to Combustibles – Ravelli Pompeii Freestanding
This pellet stove requires floor protection which must be non-combustible, extending beneath the
stove the full width and depth of the unit including (150mm) in front for ember protection.
AS/NZS 2918:2001 states that a 300mm forward projecting and 200mm side projecting floor protector
must be used from any door opening extremity as an absolute minimum. Due to the operating nature of
the Pompeii pellet stove, where opening the door causes a loss of vacuum and the fire will shut
down completely, meaning the likelihood of any hot embers or burning fuel escaping from the
combustion chamber is extremely minimal. Therefore a 150mm forward projecting
protector will
be sufficeint.
Hearth testing of the Ravelli Pompeii (SR 0484) showed that on exposed combustible
surfaces front of the freestanding stove, .no measured locations exceeded the temperture limits
specified in AS/NZS 2918:2001
From the body of the stove to the side wall
100mm
From the rear of the stove to wall (external flue)
100mm
From the rear of unlined
50 mm
to wall (internal flue)
Rear corners to wall (corner installation)
Exhaust and Fresh Air Intake Locations
Exhaust
Insert
Hearth to centre of exhaust outlet
222mm
Side of unit to centre of exhaust outlet
233mm
Centre of unit to centre of exhaust outlet
centre
RETURN
Fresh Air Intake
80
Centre of unit to center of intake
36
INSTALL VENT AT
MANUFACTURER
363
82mm
50
Side of unit to centre of intake
266mm
266
Hearth to centre of intake
IMPORTANT
81
FLOW
222
1.3
100mm
150mm
CLEARANCES
SPECIFIED
BY
THE
VENTING
31
29
2.
Installation
2.1
Dimensions – Pompeii Freestanding
1133
581
Refer to Safety Test SR 0484 for all clearances to combustible.
2.2
Clearances &
Minimum clearances shown are in millimetres. All Ravelli
Specifications were correct at time of printing but may alter, and those detailed below should be used as
a guide only. Refer to the Installation and Operation Manual supplied with every Ravelli Pellet Fire or
if in doubt, consult your Pellet Fire Solutions Retailer.
Pompeii Pellet Fire
Clearance to Combustibles
Freestanding
Clearances
Internal Flue
Location
B
B
Dimension
(mm)
A
100
B
150
E
A
F
E
G
D
G
C
F
External Flue
B
B
F
A
E
J
JI
J
F
50
D
n/a
E
100
F
100
G*
50
H
100
I*
50
J*
25
* from shielded flue
* 75mm to unlined flue
E
H
C*
Note: AS/NZS 2918
requires a minimum
of 100mm clearance
for any side requiring
access.
Note: These are
minimum clearances to
combustibles. Actual
installation distances
may be greater.
test 05/1185.
30
32
37
2.3
Minimum Clearance to Combustibles
Side of Unit (A)
Rear wall to Lined Flue (C, G, I)
Rear wall to Unlined Flu (C,G, I)
Rear of Unit (H)
Rear corners (Corner Installation) (F)
Floor protection (from glass) (B)
2.4
100mm
25mm
75mm
100mm
100mm
150mm
Location of the Pellet Fire
Installation of the Ravelli Pompeii Freestanding Wood Pellet Burning Stove should
be undertaken by an experienced installer. Please read the Pompeii
Owners/Technical Manual thoroughly before commencing installation, as failure to follow
the instruction could cause damage to the pellet stove or property.
2.5
Generally the Pompeii should be installed in a centrally located position within the home.
When deciding where to position the appliance in your room, you need to consider the
following:
2.6
Location of a power source
•
The Pompeii has a convection fan which blows air across the top of the unit in the
direction that the fire faces, for optimum performance this location should be in a
large room centrally located.
•
The Pompeii must be installed on a non-combustible surface. This surface must
•
The Pompeii has been Safety Tested to AS/NZS 2918:2001 using the Davins
manufactured
Test Report ARS 05/1185. Installation is not exclusive to these
should only be considered following
nominated kits, though alternative
consultation with your local council.
Please see “Clearances & Specifications” on page 37 for the required clearances to
combustible material, also ensure the position of structural elements near the proposed
riveted.
•
Seismic Restraint: Please see “Seismic Restraint” on page 43 for requirements.
•
Warranty: To validate warranty following installation a copy of the completed Warranty/
Producers Statement must be forwarded to:
Pellet Fire Solutions - info@pelletfiresolutions.co.nz
38
33
31
2.7
Internal Standard Flue Kit (50)
50SBPom Internal Standard Flue Kit Pompeii
600mm from
roof
penetration
This flue kit may be used in new and replacement
applications in rooms with stud height of 2.4m. The
overall height of the flue is 3.6m. The visible flue is
finished in black and the ceiling plate is white. The
support angles for securing the liner to the ceiling are
not shown. Kit is supplied in a carton.
Each 50SBPom Internal Standard Flue Kit contains:
Part No
1
Description
Quantity
Galvanised outer liner
ø100mm x 900mm long
1
2
1sb
Stainless
steel inner
linerliner
Black
Stovebright
outer
ø75mm xx900mm
o100mm
900mmlong
long
34
24sb
Black
Stovebright
oute
Stainless
steel inner
Iiner rliner
o75mm
ø100mmx x900mm
900mmlong
long
43
5
Inner/outer flue liner spacer
2
6c
Ceiling thimble ø107mm hole
1
7c
Ceiling decor plate
ø107mm hole – white
1
8
46
Rain
Veloccap
ity c75mm
one
1
9
Rain Cap 100mm
1
T-adaptor/cleanout – ø75mm
– black (painted)
1
Support angle 950mm long
– 40mm x 40mm sides
2
15sb
702
25mm minimum clearance if lined:
75mm minimum clearance if unlined
Heat-resistant
protector
Seismic restraint
(to be
Note: The Davin 50 S/B Internal Standard Flue
Kit complies with AS/NZS 2918:2001 as per
Applied Research Test Report 05/1185, dated
15 September 2005.
All
must be installed by a
installer as per the manufacturer’s
instructions and AS/NZS2918:2001.
39
2.8
External Standard Flue Kit (51)
51
External Standard Flue Kit
This flue kit may be used in new and replacement
applications with the flue penetrating the wall behind
the fire, running vertically up an outside wall and
penetrating the soffit. The overall height of the flue is
3.6m. All visible flue has a galvanised finish, and can be
powdercoated on request. Kit is supplied in a carton.
600mm from
roof penetration
Each 51 External Standard Flue Kit (Pompeii)
contains:Part No
1
Description
Quantity
Galvanised outer liner
ø100mm x 900mm long
4
Stainless steel inner liner
ø75mm x 900mm long
4
5
Inner/outer flue liner spacer
2
6w
Wall thimble – 2 pieces
ø102mm holes
1
6s
Soffit thimble ø102mm hole
1
7w
Wall decor plate
ø102mm hole – white
1
8
46
Rain
cap cone
75mm
Velocity
1
9
Rain Cap 100mm
1
26
Lined T-adaptor
1
73
76-80mm Adaptor
1
2
25mm minimum clearance if lined:
75mm minimum clearance if unlined
Heat-resistant
floor protector
40
Seismic restraint
(to be fitted)
Note: The Davin 51 External Standard Flue
Kit complies with AS/NZS 2918:2001 as per
Applied Research Test Report 05/1185, dated
15 September 2005.
All fires must be installed by a qualified
installer as per the manufacturer’s
instructions and AS/NZS2918:2001.
35
2.9
Seismic Restraint
All installation scenarios for Pompeii require the use of hold-down anchors (one on each side).
Fixing to Concrete Floor:
2.10
•
Minimum M8 expansion anchors (M10 recommended) or min M8 epoxy- set anchors.
•
Approved Anchors: Expansion Anchors-Ramset Dynabolt and Trubolt, Hilti HAS.
•
Epoxy-set Anchors – Ramset Epcon, Ramset Chemset and Hilti HVU.
Fixing to Timber Floor Framing
Minimum 14g x 60 screws (6.3mm diameter) or M10 X 90 coach-screws. These shall be xed a minimum
of 40mm into the centre-line of the existing oor joists. If screws cannot be installed directly into an
existing oor joist, solid blocking between joists (min size 90x45) shall be provided.
2.11
Installation
Pompeii should be installed in a centrally located position within the home. This will assist
the appliance to perform to the level required. As Pompeii heats space by convecting air across
the top of the unit, the heater should face the area the majority of the area to be heated.
Pompeii requires a power source to function. This is standard mains feed 240v plug - if this
is unavailable in close proximity, a grounded extension lead may be used.
Pompeii is to be installed on a non-combustible surface which must have a forward projection of
a minimum of 150mm from the glass door.
Ensure all 75mm ue joins are sealed with a high temp silicon (Maniseal).
Please check all clearances to combustibles as listed on page 37 and page 38 of this Owners’/
Technical manual.
In accordance with the requirements of AS/NZS 2918:2001 Pompeii must be secured by seismic
restraint.
34
36
41
2.12
How to mount the side panels
1
x4
2
42
2.13
Seismic Restraint Locations
INSPECTION HATCH
SEISMIC RESTRAINT
LOCATION
INSPECTION HATCH
SEISMIC RESTRAINT
LOCATION
36
38
43
Manuale utente PALMARE IDRO TOUCH RADIO
2.14 Hydraulic installation
Pag.19
Hydraulic installation
PLUMBING MUST ALWAYS BE CARRIED OUT BY QUALIFIED PERSONNEL, ABLE TO CARRY OUT A STATE-OF-THEART INSTALLATION IN COMPLIANCE WITH THE LAWS IN FORCE IN THE COUNTRY OF INSTALLATION, AFTER HAVING
READ THE NEXT CHAPTER. RAVELLI DENIES ALL LIABILITIES FOR DAMAGES TO PEOPLE OR PROPERTY ARISING
FROM MALFUNCTIONS DUE TO FAILURE TO COMPLY WITH THIS WARNING
Pellet Fire Solutions, along with Ravelli, only recommend the use of a closed loop system when installing the Pompeii Pellet Boiler.
Safety devices for closed tank system
According to the standard UNI 10412-2 (2006) in force in Italy, closed systems must be equipped with:
• Safety valve
• Circulator command thermostat
• Acoustic alarm activation thermostat
• Temperature indicator
• Pressure indicator
• Acoustic alarm
• Automatic regulation thermal switch
• Automatic blocking thermal switch (blocking thermostat)
• Circulation system
• Expansion system
• Safety dissipation system built into the generator with thermal safety valve (self-activated), in case the the equipment is not provided
with an automatic temperature regulation system.
The appliances for domestic heating with automatic feeding system must be equipped with a block thermostat for the fuel or with a cooling
circuit provided by the manufacturer of the device, activated by a thermal safety valve that ensures that the compliant temperature threhold
set is not exceeded. Connection between the power supply unit and the valve must be without shut-offs. Pressure upstream of the cooling
circuit must at least be 1.5 bar.
Installation advice
After placing the boiler and installing all fume exhaust pipes, you can connect the hydraulic system. It is recommended to connect the
boiler to the system by means of ball valves or gate valves, in order to enable easy detachment, if needed. Before connection we strongly
recommend you carry out a thorough cleaning of the system. We recommend that you connect the vent of the safety valve through a
special pipe in order to prevent damage in case of overpressure or increase in temperature.
When filling the boiler, check that the Jolly valve (picture on the left) is working properly by venting the system. The
maximum Loading pressure with COLD water should be of 1 bar.
In order to ensure proper operation with HOT water, the pressure in the stove should be 1.5 bar.
For installation of an additional expansion tank, remember that normally 1 litre of expansion tank compensates 10 litres of
the system and at least two litres are always dedicated to the water inside the stove.
FILLING MUST BE CARRIED OUT USING A “T“ JOINT PLACED ON THE HEATING SUPPLY, LOADING TO A MAXIMUM
OF 1 BAR WITH COLD WATER PERIODICALLY CHECK ON THE CONTROL CONSOLES THE PRESSURE IN THE
STOVE, AND KEEP IT STEADY AT 1 BAR.
Correctly connect the stove to the hydraulic system, bringing pressure of the system to 0.8 or max 1 bar when the stove has not yet been
switched on (in the event the system is not a closed tank system, but has an open tank, it is necessary to change the setting on the menu,
which is reserved to authorised technician).
Now proceed to bleed the hydraulic system using the valve assembled on the boiler or using the valves assembled on the radiators. This
operation can be carried out multiple times, even after activation of the boiler since, from the time the temperature of the water starts to
increase, the air bubbles move towards the high part of the boiler. Once you have completed this operation, close the feeding valve.
While bleeding the boiler, ensure the electrical parts near the valve are not wet!
In the event this occurs, do not turn on the boiler, but proceed to dry the electronic board using a hairdryer.
THE HYDRAULIC CONNECTION PROVIDES EXCLUSIVELY THE PRESENCE OF OUR CIRCULATOR INTO THE
STOVE AT SYSTEM RETURN LINE. REFER TO THE DEDICATED SECTION TO SEE HOW TO CONNECT EVERY
SINGLE MODEL.
44
Vers. 01 del 07/04/15
Manuale
utente PALMARE IDRO TOUCH RADIO
2.15 Examples of hydraulic
installation
Pag.20
Examples of hydraulic installation
Direct circuit to the system
Pellet boiler
Distribution heating collectors
Radiators
Thermometer
Manometer
Anti-condensation valve
Non-return valve
Direct distribution unit
Thermostatic distribution unit
Radiating panel (floor heating)
Shut-off valves
Ambient thermostat
Area 1
Area 2
Pellet boiler
Distribution heating collectors
Radiators
Thermometer
Manometer
Anti-condensation valve
Non-return valve
Direct distribution unit
Thermostatic distribution unit
Radiating panel (floor heating)
Shut-off valves
Ambient thermostat
Expansion vessel
Solar pump unit
Solar collector
Thermostatic mixing valve
Potential divider unit
Motorized three-way valve
Motorized three-way valve with spring return
Flow switch
Storage tank boiler
Gas boiler
Area 1
Area 2
Aqueduct
45
Vers. 01 del 07/04/15
Manuale utente PALMARE IDRO TOUCH RADIO
Pellet boiler
Distribution heating collectors
Radiators
Thermometer
Manometer
Anti-condensation valve
Non-return valve
Direct distribution unit
Thermostatic distribution unit
Radiating panel (floor heating)
Shut-off valves
Ambient thermostat
Expansion vessel
Solar pump unit
Solar collector
Thermostatic mixing valve
Recirculation pump
Puffer pipe in tank with DHW
Pag.21
Motorized three-way valve with spring return
Gas boiler
Area 1
Area 2
Aqueduct
Pellet boiler
Distribution heating collectors
Radiators
Thermometer
Manometer
Anti-condensation valve
Non-return valve
Direct distribution unit
Thermostatic distribution unit
Radiating panel (floor heating)
Shut-off valves
Ambient thermostat
Expansion vessel
Solar pump unit
Solar collector
Thermostatic mixing valve
Recirculation pump
Storage puffer
Motorized three-way valve with spring return
Gas boiler
Potential divider unit
Motorized three-way valve
Cylinder
Flow switch
Area 1
Aqueduct
Aqueduct
46
Area 2
3.
Installation Data Sheet
Name of Owner:
Name of Dealer:
________________________________
________________________________
Address:
Address:
________________________________
________________________________
________________________________
________________________________
________________________________
________________________________
________________________________
________________________________
Phone:
Phone:
________________________________
________________________________
Model: __________________________
Name of Installer:
Serial Number:____________________
Date of Purchase: __________
(dd/mm/yy)
________________________________
Address:
________________________________
Date of Installation: _________
(dd/mm/yy)
Magnehelic at Install: _______________
________________________________
________________________________
________________________________
Installer’s Signature:
Phone:
________________________________
________________________________
WARRANTY: If you have concerns with your unit please contact the dealer where you
purchased the stove.
3947
37
4.
Maintenance Record
DATE
38
48
40
WORK CARRIED OUT
SIGNATURE
PRODUCER REGISTRATION FORM
This form must be completed and returned for every installation to qualify for warranty.
Post to:
P O Box 11-245, Sockburn, Christchurch
Email to:
info@pelletfiresolutions.co.nz
Customer Details:
Customer Name:
Postal Address:
Installation Address:
Phone Number
Cell Phone
Email Address
Declaration by Owner: I hereby certify the above particulars are true and correct. My Pellet Fire
Technician has demonstrated to me the correct operation of my Pellet Fire.
I understand that warranty conditions require an authorised Pellet Fire Solutions Installer to complete the
installation
Signed:
Date:
Installation Details:
Pellet Fire Model & Serial Number:
Installation Date:
Freestanding Flue Kit:
Internal
External Standard
Fireplace Insert Flue Kit:
Insert
BIH
Installer Details:
Installers Name:
Passed Inspection
Phone Number:
Yes/No (if no, why)
Declaration by Approved Technician: I
hereby certify that the above appliance has been installed and commissioned in compliance with
Manufacturers Installation requirements and appropriate New Zealand Standards/Local Council
requirements.
Signed:
Date:
49
41