Portable Room Air Conditioner and Heat Pump

INSTALLATION, OPERATION
Installation, Operation
&
MAINTENANCE MANUAL
& Maintenance Manual
Portable Room Air Conditioner
and Heat Pump
PS-121B
PSH-141A
Thank you for purchasing our Portable Air Conditioner.
French version of this manual is available on our website
Before using
your air conditioner, please read this instruction
manual carefully and keep it for future reference.
Heat Controller • 1900 Wellworth Ave. • Jackson, MI 49203 • (517)787-2100 • www.heatcontroller.com
READ AND SAVE THESE INSTRUCTIONS!
517.787.2100 • www.marsdelivers.com
Installation, Operation & Maintenance Manual - PS-121B / PSH-141A
Contents
Preparation.............................................................................................................................................2
Safety Precautions.................................................................................................................................3
Cautions..................................................................................................................................................4
Installation..............................................................................................................................................5
Operation................................................................................................................................................9
Maintenance.........................................................................................................................................14
Faults Diagnosis..................................................................................................................................15
Design and Compliance Notes...........................................................................................................16
Installation, Operation & Maintenance Manual - PS-121B / PSH-141A
Preparation
control panel
horizontal louver
blade
(swing automatically)
handle
(both sides)
Caster
front
upper air filter
(behind the grille)
upper air intake
drain outlet
air outlet
lower air filter
lower air intake
drain outlet
(only for pump
heating mode)
power cord outlet
power cord storage clips
power plug socket
bottom tray
drain outlet
rear
2
Installation, Operation & Maintenance Manual - PS-121B / PSH-141A
Safety Precautions
Please read through these instructions before you start the installation process.
Improper installation can cause damage to the unit, your personal property, and
also poses a personal safety hazard.
• Installation must be performed according to the installation instructions. Improper
installation can cause water leakage, electrical shock, or fire.
• Use only the included accessories and parts, and specified tools for the installation. Using
non-standard parts can cause water leakage, electrical shock, fire, and injury or property
damage.
• Make sure that the outlet you are using is grounded and has the appropriate voltage. The
power cord is equipped with a three-prong grounding plug to protect against shock.
Voltage information can be found on the side of the unit, behind the grille.
• Install the unit on a flat, sturdy surface. Failure to do so could result in damage or
excessive noise and vibration.
• The unit must be kept free from obstructions to ensure proper function and to mitigate
safety hazards.
• DO NOT modify the length of the power cord or use an extension cord to power the unit.
DO NOT share a single outlet with other electrical appliances. Improper power supply
can cause fire or electrical shock.
• DO NOT install your air conditioner in a wet room such as a bathroom or laundry room.
Too much exposure to water can cause electrical components to short circuit.
• DO NOT install the unit in a location that may be exposed to combustible gas, as this
could cause fire.
• The unit has wheels to facilitate moving. Make sure not to use the wheels on thick carpet
or to roll over objects, as these could cause tipping.
• DO NOT operate a unit that has been dropped or damaged.
• Only use the included accessories and specified parts for installation. Using nonstandard
parts can cause water leakage, electrical shock, fire, and injury or property damage.
• The unit must be kept free from obstruction to ensure proper function.
• DO NOT allow children to play with the air conditioner. Children must be supervised
around the unit at all times.
• If the air conditioner is knocked over during use, turn off the unit and unplug it from the
main power supply immediately. Visually inspect the unit to ensure there is no damage. If
you suspect the unit has been damaged, contact a technician or customer service for
assistance.
• In a thunderstorm, the power must be cut off to avoid damage to the machine due to
lightning.
3
Installation, Operation & Maintenance Manual - PS-121B / PSH-141A
Cautions
• This appliance can be used by children aged from 8 years and above and person with
reduced physical, sensory or mental capabilities or lack of experience and knowledge if they
have been given supervision or instruction concerning use of the appliance in a safe way and
understand the hazards involved. Children should not play with the appliance. Cleaning and
user maintenance should not be made by children without supervision.
• This appliance is not intended for use by persons (including children) with reduced physical,
sensory or mental capabilities or lack of experience and knowledge, unless they have been
given supervision or instruction concerning use of the appliance by a person responsible for
•
•
•
•
•
•
•
•
•
•
•
•
•
their safety.
Children should be supervised to ensure that they do not play with the appliance.
If the supply cord is damaged, it must be replaced by the manufacturer, its service agent or
similarly qualified persons in order to avoid a hazard.
Prior to cleaning or other maintenance, the appliance must be disconnected from the supply
mains.
Do not install the appliance in a location that may be exposed to combustible gas.
If combustible gas accumulates around the unit, it may cause fire.
Do not run cord under carpeting. Do not cover cord with throw rugs, runners, or similar
coverings. Do not route cord under furniture or appliances. Arrange cord away from traffic
area so it will not be tripping hazard.
Do not operate unit with a damaged cord or plug. Discard unit or return to an authorized
service facility for examination and/or repair.
To reduce the risk of fire or electric shock, do not use this appliance with any solid-state
speed control device.
The appliance shall be installed in accordance with national wiring regulations.
Contact the authorized service technician for repair or maintenance of this unit.
Contact the authorized installer for installation of this unit.
When there are wide differences between "USER'S MANUAL" and "Remote controller
Illustration" on function description, the description on "USER' S MANUAL" shall prevail.
Do not operate your air conditioner in a wet room such as a bathroom or laundry room.
4
Installation, Operation & Maintenance Manual - PS-121B / PSH-141A
Installation
Choosing The Right Location
Your installation location should meet the following
requirements:
• Make sure that you install your unit on an even
surface to minimize noise and vibration.
• The unit must be installed near a grounded
plug, and the Collection Tray Drain (found on
the back of the unit) must be accessible.
• The unit should be located at least 30cm (12”)
from the nearest wall to ensure proper air
conditioning.
• DO NOT cover the Intakes, Outlets or Remote
Signal Receptor of the unit, as this could cause
damage to the unit.
Note About Fluorinated Gases
• This air-conditioning unit is a hermetically sealed unit that contains fluorinated gases.
For specific information on the type of gas and the amount, please refer to the relevant
label on the unit itself.
• Installation, service, maintenance and repair of this unit must be performed by a
certified technician.
• Product un-installation and recycling must be performed by a certified technician.
• If the system has a leak-detection system installed, it must be checked for leaks at least
every 12 months.
• When the unit is checked for leaks, proper record-keeping of all checks is strongly
recommended.
NOTE:
All the illustrations in the manual are for explanation purpose only. Your machine may be
slightly different. The actual shape shall prevail. The unit can be controlled by the unit
control panel alone or with the remote controller. This manual does not include Remote
Controller Operations, see the <<Remote Controller Instruction>> packed with the unit for
details.
5
Installation, Operation & Maintenance Manual - PS-121B / PSH-141A
Installation
Tools Needed
•
•
•
•
Medium Phillips screwdriver
Tape measure or ruler
Knife or scissors
Saw (optional, to shorten window adapter for narrow windows)
Accessories
Your Window Installation Kit fits windows 67.5-123cm (26.5-48”) and can be shortened
for smaller windows.
Part
Quantity
1 pc
Description
LED
TIMER
OFF
TIMER
ON
SWING
FAN
Window Installation Kit Step One:
Preparing the Exhaust Hose
assembly
Press the exhaust hose into the window
slider adapter and unit adapter, clamp
automatically by elastic buckles of the
adapters.
Exhaust hose
Unit adaptor
Exhaust Hose
1 pc
Window Slider Adaptor
1 pc
Bolt
1 pc
Window Slider A
1 pc
Window Slider B
1 pc
Foam Seal A (Adhesive)
2 pc
Foam Seal B (Adhesive)
2 pc
Foam Seal C (Non-adhesive)
1 pc
Security Bracket and 2 Screws
1 set
Drain Hose
1 pc
Drain Hose Adaptor(only for
heat pump mode)
1 pc
Remote Controller and Battery
(For remote control models only) 1 set
SLEEP
SHORT
CUT
MODE
TEMP
ON/OFF
Unit Adaptor
Step Two: Install the Exhaust Hose
assembly to the unit
Insert unit adapter of the Exhaust hose assembly
into the lower groove of the air outlet of the unit
while the hook of the adapter is aligned with the
hole seat of the air outlet and slide down the
Exhaust hose assembly along the arrow
direction for installation.
Exhaust hose
assembly
Hook
Window slider
adaptor
adaptor
6
6
Hole Seat
Lower groove Make sure the adaptor is
inserted into the lower
groove of the air outlet.
Installation, Operation & Maintenance Manual - PS-121B / PSH-141A
Installation
Step Three: Preparing the Adjustable Window Slider
Bolt
1. Depending on the size of your window, adjust the size
of the window slider.
2. If the length of the window requires two window sliders,
use the bolt to fasten the window sliders once they are
adjusted to the proper length.
Window slider A
Window slider B
Note:
Once the Exhaust Hose assembly and Adjustable Window Slider are prepared,
choose from one of the following two installation methods.
Type 1: Hung Window Installation
Foam seal B
(Adhesive type-shorter)
Foam seal C
(Non-adhesive type)
Window slider A
Window slider B
(if required)
Foam seal A
(Adhesive type)
Cut the adhesive foam seal
A and B strips to the proper
lengths, and attach them to
the window sash and frame
as shown.
Insert the window slider
assembly into the window
opening.
Security Bracket
2 Screws
If desired, install the
security bracket with two
screws as shown.
Insert the window slider
adaptor into the hole of
the window slider.
7
Cut the non-adhesive foam
seal C strip to match the
width of the window. Insert
the seal between the glass
and the window frame to
prevent air and insects from
getting into the room.
Installation, Operation & Maintenance Manual - PS-121B / PSH-141A
Installation
Type 2: Sliding Window Installation
Foam seal B
(Adhesive type-shorter)
Foam seal C
(Non-adhesive type)
Window slider B
(if required)
Foam seal A
(Adhesive type)
Window slider A
Cut the adhesive foam seal
A and B strips to the proper
lengths, and attach them to
the window sash and frame
as shown.
Insert the window slider
assembly into the window
opening.
Cut the non-adhesive foam
seal C strip to match the
window height. Insert the
foam seal between the
glass and the window frame
to prevent air and insects
from getting into the room.
Security
Bracket
2 Screws
If desired, install the
security bracket with two
screws as shown.
Insert the window slider
adaptor into the hole of
the window slider.
Note:
To ensure proper function, DO NOT over-extend or bend the hose. Make sure
that there is no obstacle around the air outlet of the exhaust hose (in the range of
500mm) in order for the exhaust system to work properly. All illustrations in this
manual are for explanation purposes only. Your air conditioner may be slightly
different. The actual shape shall prevail.
8
Installation, Operation & Maintenance Manual - PS-121B / PSH-141A
Operation
Swing button
Up (+) and Down (-) buttons
Used to initiate the Auto swing
feature. When the operation is ON,
pressing the SWING button can stop
the louver at the desired angle.
Used to adjust (increasing/decreasing)
temperature settings in 1°C/1°F increments
in a range of 17°C/62°F to 30°C/86°F or
the TIMER setting in a range of 0~24hrs.
Timer button
NOTE: The control is capable of
displaying temperature in degrees
Fahrenheit or degrees Celsius. To
convert from one to the other,
press and hold the Up and Down
buttons at the same time for 3
seconds.
Used to initiate the AUTO ON start
time and AUTO OFF stop time
program, in conjunction with the
+ & - buttons. The timer on/off
indicator light illuminates under the
timer on/off settings
Mode button
Fan/Ion button (Ion is optional)
Selects the appropriate operating
mode. Each time you press the
button, a mode is selected in a
sequence that goes from AUTO,
COOL, DRY, FAN and HEAT
(cooling only models without). The
mode indicator light illuminates
under the different mode settings.
Controls the fan speed. Press to select the
fan speed in four steps-LOW, MID, HIGH
and AUTO. The fan speed indicator light
illuminates under different fan settings.
NOTE: Press this button for 3 seconds to
initiate ION feature. The ion generator is
energized and will help to remove pollen
and impurities from the air, and trap them
in the filter. Press it for 3 seconds again to
stop the ION feature.
Sleep/Eco button
Used to initiate the SLEEP/ECO
operation.
Power button
Power switch on/off.
9
Installation, Operation & Maintenance Manual - PS-121B / PSH-141A
Operation
LED display
Shows the set temperature in °C or °F and the Auto-timer settings. While on
DRY and FAN modes, it shows the room temperature. Shows Error codes and
protection code:
E1-Room temperature sensor error.
E2-Evaporator temperature sensor error.
E3-Condenser temperature sensor error (on some models).
E4-Display panel communication error.
P1-Bottom tray is full--Connect the drain hose and drain the collected water
away. If protection repeats, call for service.
Note: When one of the above malfunctions occurs, turn off the unit and check
for any obstructions. Restart the unit, if the malfunction is still present, turn off
the unit and unplug the power cord. Contact the manufacturer, service agents,
or a similarly qualified person for service.
Operation Instructions
COOL operations
• Press the "MODE" button until the "COOL" indicator light comes on.
• Press the ADJUST buttons "+" or "-" to select your desired room temperature. The
temperature can be set within a range of 17°C~30°C/62°F~86°F.
• Press the "FAN SPEED" button to choose the fan speed.
HEAT operation (cooling only models without)
• Press the "MODE" button until the "HEAT" indicator light comes on.
• Press the ADJUST buttons "+" or "-" to select your desired room temperature. The
temperature can be set within a range of 17°C~30°C/62°F~86°F.
• Press the "FAN SPEED" button to choose the fan speed. For some models, the fan
speed cannot be adjusted under HEAT mode.
DRY operation
• Press the "MODE" button until the "DRY" indicator light comes on.
• Under this mode, you cannot select a fan speed or adjust the temperature. The fan
motor operates at LOW speed.
• Keep windows and doors closed for the best dehumidifying effect.
10
Installation, Operation & Maintenance Manual - PS-121B / PSH-141A
Operation
AUTO operation
• When you set the air conditioner in AUTO mode, it will automatically select cooling,
heating (cooling only models without), or fan only operation depending on what
temperature you have selected and the room temperature.
• The air conditioner will control room temperature automatically around the temperature
point set by you.
• Under AUTO mode, you cannot select the fan speed.
FAN operation
• Press the "MODE" button until the "FAN" indicator light comes on.
• Press the "FAN SPEED" button to choose the fan speed. The temperature cannot be
adjusted.
TIMER operation
• When the unit is on, pressing the Timer button will initiate the Auto-off stop program, the
TIMER OFF indicator light illuminates. Press the UP or DOWN button to select the
desired time. Press the TIMER button again within five seconds, the Auto-on start
program is initiated, and the TIMER ON indicator light illuminates. Press the up or down
button to select the desired Auto-on start time.
• When the unit is off, press the Timer button to initiate the Auto-on start program, press it
again within five seconds to initiate the Auto-off stop program.
• Press or hold the UP or DOWN button to change the Auto time by 0.5 hour increments,
up to 10 hours, then in one hour increments up to 24 hours. The control will count down
the time remaining until start.
• The system will automatically revert back to display the previous temperature setting if
there is no operation in a five second period.
• Turning the unit ON or OFF at any time or adjusting the timer setting to 0.0 will cancel the
Auto Start/Stop timer program.
• When the malfunction occurs, the Auto Start/Stop timed program will also be canceled.
SLEEP/ECO operation
• Press this button and the selected temperature will increase (cooling) or decrease
(heating) by 1°C/1°F 30 minutes. The temperature will then increase (cooling) or decrease
(heating) by another 1°C/1°F after an additional 30 minutes. This new temperature will be
maintained for seven hours before it returns to the originally selected temperature. This
ends the Sleep/Eco mode and the unit will continue to operate as originally programed.
NOTE: This feature is unavailable under FAN or DRY mode.
11
Installation, Operation & Maintenance Manual - PS-121B / PSH-141A
Operation
Other features
FOLLOW ME/TEMP SENSING feature (optional)
NOTE: This feature can be activated from the remote control ONLY. The remote control
serves as a remote thermostat allowing for the precise temperature control at its
location. To activate the Follow Me/Temp Sensing feature, point the remote control
toward the unit and press the Follow Me/Temp Sensing button. The remote display is the
actual temperature at its location. The remote control will send this signal to the air
conditioner every three minutes until you press the Follow Me/Temp Sensing button
again. If the unit does not receive the Follow Me/Temp Sensing signal during any seven
minute interval, the unit will beep to indicate the Follow Me/Temp Sensing mode has
ended.
AUTO-RESTART
If the unit breaks off unexpectedly due to loss of power, it will restart with the previous function
setting automatically when the power resumes.
WAIT THREE MINUTES BEFORE RESUMING OPERATION
After the unit has stopped, it cannot be restarted for three minutes. This is to protect the unit.
Operation will automatically start after three minutes.
AIR FLOW DIRECTION ADJUSTMENT
The louver can be adjusted automatically. Adjust the air flow direction automatically (NOTE: On
some models the louver can be adjusted manually only):
• When the Power is ON, the louver opens fully.
• Press the SWING button on the panel or remote
controller to initiate the Auto swing feature. The
louver will swing up and down automatically.
Remove the
upper drain plug
• Please do not adjust the louver manuall
Continuous
drain hose
Water drainage
• During dehumidifying modes, remove the upper
drain plug from the back of the unit, install the
drain connector (5/8" universal female hose
connections) with 3/4" hose (locally purchased).
For the models without drain a connector, attach
the drain hose to the hole. Place the open end of
the hose directly over the drain area in your
basement floor.
12
√
Installation, Operation & Maintenance Manual - PS-121B / PSH-141A
Operation
• During heat pump mode, remove the lower drain plug
from the back of the unit, install the drain connector
(5/8" universal female hose connection) with 3/4" hose
(locally purchased). For the models without a drain
connector, attach the drain hose to the hole. Place the
open end of the Hose adapter directly over the drain
area in your basement floor.
NOTE: Make sure the hose is secure so there are no
leaks. Direct the hose toward the drain, making sure
that there are no kinks that will stop the water flowing.
Place the end of the hose into the drain and make sure
the end of the hose is down to let the water flow
smoothly.
Remove the
lower drain plug
Continuous
drain hose
drain hose
adaptor
delivery lift <1.8m
(See Figs with √ . Do not allow traps or rise. (See Figs with X ).
When the continuous drain hose is not used, ensure
that the corresponding drain plug and knob are
installed firmly to prevent leakage.
drain hose
adaptor
drain hose
adaptor
√
• When the water level of the bottom tray reaches a
predetermined level, the unit beeps 8 times, the
digital display area shows "P1". At this time the air
conditioning/dehumidification process will immediately
stop. However, the fan motor will continue to operate
(this is normal). Carefully move the unit to a drain
location, remove the bottom drain plug and let the
water drain away. Reinstall the bottom drain plug and
restart the machine until the "P1" symbol disappears. If
the error repeats, call for service.
NOTE: Be sure to reinstall the bottom drain plug firmly
to prevent leakage before using the unit.
13
X
√
Installation, Operation & Maintenance Manual - PS-121B / PSH-141A
Maintenance
Safety Precautions
• Always unplug the unit before cleaning or servicing.
• DO NOT use flammable liquids or chemicals to clean the unit.
• DO NOT wash the unit under running water. Doing so causes electrical danger.
• DO NOT operate the machine if the power supply was damaged during cleaning. A
damaged power cord must be replaced with a new cord from the manufacturer.
Clean the Air Filter
Maintenance Tips
• Be sure to clean the air filter
Upper filter
(take out)
every two weeks for optimal
performance.
• The water collection tray
should be drained
immediately after P1 error
occurs, and before storage
to prevent mold.
• In households with animals,
you will have to periodically
wipe down the grill to
prevent blocked airflow due
to animal hair.
Remove the
screw,then
take the lower
filter out.
Remove the air filter
Clean the Unit
Clean the unit using a damp, lint-free cloth and mild detergent. Dry the unit with a dry, lint-free
cloth.
Store the unit when not in use
• Drain the unit’s water collection tray according to the instructions in the following section.
• Run the appliance on FAN mode for 12 hours in a warm room to dry it and prevent mold.
• Turn off the appliance and unplug it.
• Clean the air filter according to the instructions in the previous section. Reinstall the clean,
dry filter before storing.
• Remove the batteries from the remote control.
Be sure to store the unit in a cool, dark place. Exposure to direct sunshine or
extreme heat can shorten the lifespan of the unit.
14
Installation, Operation & Maintenance Manual - PS-121B / PSH-141A
Faults Diagnosis
Please refer to the following form before requesting service:
Problem
Unit does not turn
on when pressing
ON/OFF button
Unit does not cool
well
The unit is noisy and
vibrates too much
The unit makes a
gurgling sound
Possible Cause
Troubleshooting
P1 Error Code
The Water Collection Tray is full. Turn off
the unit, drain the water from the Water
Collection Tray and restart the unit.
In COOL mode: room
temperature is lower than the
set temperature
Reset the temperature
The air filter is blocked with
dust or animal hair
Turn off the unit and clean the
filter according to instructions
Exhaust hose is not
connected or is blocked
Turn off the unit, disconnect the
hose, check for blockage and
reconnect the hose
The unit is low on refrigerant
Call a service technician to inspect
the unit and top off refrigerant
Temperature setting is too high
Decrease the set temperature
The windows and doors in the
room are open
Make sure all windows and doors are
closed
The room area is too large
Double-check the cooling area
There are heat sources inside
the room
Remove the heat sources if possible
The ground is not level
Place the unit on a flat, level surface
The air filter is blocked with
dust or animal hair
Turn off the unit and clean the filter
according to instructions
This sound is caused by the
flow of refrigerant inside the unit
15
This is normal
Installation, Operation & Maintenance Manual - PS-121B / PSH-141A
Design and Compliance Notes
Design Notice
In order to ensure the optimal performance of our products, the design specifications of the unit
and remote control are subject to change without prior notice.
Energy Rating Information
The Energy Rating for this unit is based on an installation using an un-extended exhaust duct
without adapters A or B (as shown in the Installation section of this manual).
Unit Temperature Range
Mode
Temperature Range
Cool
17-35°C (62-95°F)
Dry
13-35°C (55-95°F)
Heat (pump heat
mode)
Heat (electrical
heat mode)
5-30°C (41-86°F)
≤ 30°C (86°F)
16
'XHWRRQJRLQJSURGXFWLPSURYHPHQWVVSHFLILFDWLRQVDQGGLPHQVLRQVDUH
VXEMHFWWRFKDQJHDQGFRUUHFWLRQZLWKRXWQRWLFHRULQFXUULQJREOLJDWLRQV'HWHUPLQLQJWKH
DSSOLFDWLRQDQGVXLWDELOLW\IRUXVHRIDQ\SURGXFWLVWKHUHVSRQVLELOLW\RIWKHLQVWDOOHU
$GGLWLRQDOO\WKHLQVWDOOHULVUHVSRQVLEOHIRUYHULI\LQJGLPHQVLRQDOGDWDRQWKHDFWXDOSURGXFW
SULRUWREHJLQQLQJDQ\LQVWDOODWLRQSUHSDUDWLRQV
,QFHQWLYHDQGUHEDWHSURJUDPVKDYHSUHFLVHUHTXLUHPHQWVDVWRSURGXFWSHUIRUPDQFH
DQGFHUWLILFDWLRQ$OOSURGXFWVPHHWDSSOLFDEOHUHJXODWLRQVLQHIIHFWRQGDWHRIPDQXIDFWXUH
KRZHYHUFHUWLILFDWLRQVDUHQRWQHFHVVDULO\JUDQWHGIRUWKHOLIHRIDSURGXFW
7KHUHIRUHLWLVWKHUHVSRQVLELOLW\RIWKHDSSOLFDQWWRGHWHUPLQHZKHWKHUDVSHFLILF
PRGHOTXDOLILHVIRUWKHVHLQFHQWLYHUHEDWHSURJUDPV
:HOOZRUWK$YH-DFNVRQ0,‡3K‡ZZZKHDWFRQWUROOHUFRP
1900 Wellworth Ave. • Jackson, MI 49203 • 517.787.2100 • www.marsdelivers.com
12/2016
Download PDF
Similar pages
Connecting to Wi-Fi
How to Change Wireless Channel – Billion 8900AX-2400
Advice on choosing the right screen resolution for you
BlueWalker 10120507 rack accessory
CAD oper manual GB
Candy CBP 61
Tono User Manual