Motherboard
ROG
ZENITH
EXTREME
E13034
First Edition
July 2017
Copyright © 2017 ASUSTeK COMPUTER INC. All Rights Reserved.
No part of this manual, including the products and software described in it, may be reproduced,
transmitted, transcribed, stored in a retrieval system, or translated into any language in any form or by any
means, except documentation kept by the purchaser for backup purposes, without the express written
permission of ASUSTeK COMPUTER INC. (“ASUS”).
Productwarrantyorservicewillnotbeextendedif:(1)theproductisrepaired,modi edoraltered,unless
suchrepair,modi cationofalterationisauthorizedinwritingbyASUS;or(2)theserialnumberofthe
product is defaced or missing.
ASUS PROVIDES THIS MANUAL “AS IS” WITHOUT WARRANTY OF ANY KIND, EITHER EXPRESS
OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE IMPLIED WARRANTIES OR CONDITIONS OF
MERCHANTABILITY OR FITNESS FOR A PARTICULAR PURPOSE. IN NO EVENT SHALL ASUS, ITS
DIRECTORS, OFFICERS, EMPLOYEES OR AGENTS BE LIABLE FOR ANY INDIRECT, SPECIAL,
INCIDENTAL, OR CONSEQUENTIAL DAMAGES (INCLUDING DAMAGES FOR LOSS OF PROFITS,
LOSS OF BUSINESS, LOSS OF USE OR DATA, INTERRUPTION OF BUSINESS AND THE LIKE),
EVEN IF ASUS HAS BEEN ADVISED OF THE POSSIBILITY OF SUCH DAMAGES ARISING FROM ANY
DEFECT OR ERROR IN THIS MANUAL OR PRODUCT.
SPECIFICATIONS AND INFORMATION CONTAINED IN THIS MANUAL ARE FURNISHED FOR
INFORMATIONAL USE ONLY, AND ARE SUBJECT TO CHANGE AT ANY TIME WITHOUT NOTICE,
AND SHOULD NOT BE CONSTRUED AS A COMMITMENT BY ASUS. ASUS ASSUMES NO
RESPONSIBILITY OR LIABILITY FOR ANY ERRORS OR INACCURACIES THAT MAY APPEAR IN THIS
MANUAL, INCLUDING THE PRODUCTS AND SOFTWARE DESCRIBED IN IT.
Products and corporate names appearing in this manual may or may not be registered trademarks or
copyrightsoftheirrespectivecompanies,andareusedonlyforidenti cationorexplanationandtothe
owners bene t,withoutintenttoinfringe.
Offer to Provide Source Code of Certain Software
This product contains copyrighted software that is licensed under the General Public License (“GPL”),
under the Lesser General Public License Version (“LGPL”) and/or other Free Open Source Software
Licenses. Such software in this product is distributed without any warranty to the extent permitted by the
applicable law. Copies of these licenses are included in this product.
Where the applicable license entitles you to the source code of such software and/or other additional data,
you may obtain it for a period of three years after our last shipment of the product, either
(1) for free by downloading it from https://www.asus.com/support/
or
(2) for the cost of reproduction and shipment, which is dependent on the preferred carrier and the location
where you want to have it shipped to, by sending a request to:
ASUSTeK Computer Inc.
Legal Compliance Dept.
15 Li Te Rd.,
Beitou, Taipei 112
Taiwan
In your request please provide the name, model number and version, as stated in the About Box of the
product for which you wish to obtain the corresponding source code and your contact details so that we
can coordinate the terms and cost of shipment with you.
The source code will be distributed WITHOUT ANY WARRANTY and licensed under the same license as
the corresponding binary/object code.
This offer is valid to anyone in receipt of this information.
ASUSTeK is eager to duly provide complete source code as required under various Free Open Source
Software licenses. If however you encounter any problems in obtaining the full corresponding source
codewewouldbemuchobligedifyougiveusanoti cationtotheemailaddressgpl@asus.com, stating
the product and describing the problem (please DO NOT send large attachments such as source code
archives, etc. to this email address).
ii
Contents
Safety information ...................................................................................................... vi
About this guide ........................................................................................................ vii
ROG ZENITH EXTREME specifications summary ................................................... ix
Package contents..................................................................................................... xiv
Installation tools and components .......................................................................... xv
Chapter 1:
1.1
1.1.1
Before you proceed ..................................................................... 1-1
1.1.2
Motherboard layout ..................................................................... 1-2
1.1.3
Central Processing Unit (CPU) ................................................... 1-4
1.1.4
System memory .......................................................................... 1-5
1.1.5
Expansion slots ........................................................................... 1-7
1.1.6
Onboard buttons and switches.................................................... 1-9
1.1.7
Jumper ...................................................................................... 1-13
1.1.8
Onboard LEDs .......................................................................... 1-14
1.1.9
Internal connectors.................................................................... 1-16
1.1.10
ProbeIt....................................................................................... 1-30
Chapter 2:
2.1
2.2
2.3
Product Introduction
Motherboard overview ............................................................................... 1-1
Basic Installation
Building your PC system........................................................................... 2-1
2.1.1
CPU installation........................................................................... 2-1
2.1.2
CPU heatsink and fan assembly installation ............................... 2-3
2.1.3
Motherboard installation .............................................................. 2-4
2.1.4
DIMM installation......................................................................... 2-5
2.1.5
ATX power connection ................................................................ 2-6
2.1.6
SATA device connection ............................................................. 2-6
2.1.7
Front I/O connector ..................................................................... 2-7
2.1.8
Expansion card installation ......................................................... 2-8
2.1.9
M.2 installation .......................................................................... 2-10
2.1.10
Wi-Fi antenna installation .......................................................... 2-11
BIOS update utility ................................................................................... 2-12
Motherboard rear and audio connections ............................................. 2-13
2.3.1
Rear I/O connection .................................................................. 2-13
2.3.2
Audio I/O connections ............................................................... 2-15
2.4
Starting up for the first time .................................................................... 2-17
2.5
Turning off the computer ........................................................................ 2-17
iii
Chapter 3:
3.1
3.2
3.3
BIOS setup program .................................................................................. 3-2
3.2.1
Advanced Mode .......................................................................... 3-3
3.2.2
EZ Mode...................................................................................... 3-6
3.2.3
Q-Fan Control ............................................................................. 3-7
3.2.4
EZTuningWizard ....................................................................... 3-9
My Favorites ............................................................................................. 3-11
3.4
Main menu ................................................................................................ 3-13
3.5
Extreme Tweaker menu ........................................................................... 3-13
3.6
3.7
iv
BIOS Setup
Knowing BIOS ............................................................................................ 3-1
Advanced menu ....................................................................................... 3-14
3.6.1
AMDfTPMcon guration ........................................................... 3-14
3.6.2
ROG Effects .............................................................................. 3-14
3.6.3
SATACon guration .................................................................. 3-15
3.6.4
OnboardDevicesCon guration ................................................ 3-15
3.6.5
APMCon guration .................................................................... 3-17
3.6.6
CPUCon guration .................................................................... 3-17
3.6.7
InternalGOPCon guration ....................................................... 3-17
3.6.8
NetworkStackCon guration..................................................... 3-17
3.6.9
HDD/SSD SMART Information ................................................. 3-18
3.6.10
NVMeCon guration .................................................................. 3-18
3.6.11
USBCon guration .................................................................... 3-18
Monitor menu ........................................................................................... 3-19
3.8
Chipset menu ........................................................................................... 3-19
3.9
Boot menu ................................................................................................ 3-19
3.10
Tool menu ................................................................................................. 3-21
3.10.1
ASUS EZ Flash 3 Utility ............................................................ 3-21
3.10.2
Secure Erase ............................................................................ 3-22
3.10.3
ASUSOverclockingPro le ....................................................... 3-23
3.10.4
ASUS SPD Information ............................................................. 3-23
3.10.5
Graphics Card Information ........................................................ 3-23
3.11
Exit menu .................................................................................................. 3-24
3.12
Updating BIOS .......................................................................................... 3-25
3.12.1
EZ Update ................................................................................. 3-25
3.12.2
ASUS EZ Flash 3 ...................................................................... 3-26
3.12.3
ASUS CrashFree BIOS 3 .......................................................... 3-28
Chapter 4:
4.1
4.2
RAID Support
RAID configurations .................................................................................. 4-1
4.1.1
RAIDde nitions .......................................................................... 4-1
4.1.2
Installing Serial ATA hard disks .................................................. 4-2
Creating a RAID driver disk ...................................................................... 4-2
4.2.1
Creating a RAID driver disk in Windows® ................................... 4-2
Appendix
Notices .................................................................................................................... A-1
ASUS contact information ...................................................................................... A-8
v
Safety information
Electrical safety
Topreventelectricalshockhazard,disconnectthepowercablefromtheelectricaloutlet
before relocating the system.
When adding or removing devices to or from the system, ensure that the power cables
for the devices are unplugged before the signal cables are connected. If possible,
disconnect all power cables from the existing system before you add a device.
Before connecting or removing signal cables from the motherboard, ensure that all
power cables are unplugged.
Seek professional assistance before using an adapter or extension cord. These devices
could interrupt the grounding circuit.
Ensure that your power supply is set to the correct voltage in your area. If you are not
sure about the voltage of the electrical outlet you are using, contact your local power
company.
Ifthepowersupplyisbroken,donottryto xitbyyourself.Contactaquali edservice
technician or your retailer.
Operation safety
vi
Before installing the motherboard and adding devices on it, carefully read all the manuals
that came with the package.
Before using the product, ensure all cables are correctly connected and the power
cables are not damaged. If you detect any damage, contact your dealer immediately.
To avoid short circuits, keep paper clips, screws, and staples away from connectors,
slots, sockets and circuitry.
Avoid dust, humidity, and temperature extremes. Do not place the product in any area
where it may become wet.
Place the product on a stable surface.
Ifyouencountertechnicalproblemswiththeproduct,contactaquali edservice
technician or your retailer.
About this guide
Thisuserguidecontainstheinformationyouneedwheninstallingandcon guringthe
motherboard.
How this guide is organized
This guide contains the following parts:
•
Chapter1:ProductIntroduction
This chapter describes the features of the motherboard and the new technology it
supports. It includes description of the switches, jumpers, and connectors on the
motherboard.
•
Chapter2:BasicInstallation
This chapter lists the hardware setup procedures that you have to perform when
installing system components.
•
Chapter3:BIOSSetup
This chapter tells how to change system settings through the BIOS Setup menus.
Detailed descriptions of the BIOS parameters are also provided.
•
Chapter4:RAIDSupport
ThischapterdescribestheRAIDcon gurations.
Where to find more information
Refer to the following sources for additional information and for product and software
updates.
1.
ASUS website
The ASUS website (www.asus.com) provides updated information on ASUS hardware
and software products.
2.
Optional documentation
Yourproductpackagemayincludeoptionaldocumentation,suchaswarranty yers,
that may have been added by your dealer. These documents are not part of the
standard package.
vii
Conventions used in this guide
To ensure that you perform certain tasks properly, take note of the following symbols used
throughout this manual.
DANGER/WARNING: Information to prevent injury to yourself when trying to
complete a task.
CAUTION: Information to prevent damage to the components when trying to
complete a task.
IMPORTANT: Instructions that you MUST follow to complete a task.
NOTE: Tips and additional information to help you complete a task.
Typography
Bold text
Indicates a menu or an item to select.
Italics
Usedtoemphasizeawordoraphrase.
<Key>
Keys enclosed in the less-than and greater-than sign
means that you must press the enclosed key.
Example: <Enter> means that you must press the Enter or
Return key.
<Key1> + <Key2> + <Key3>
viii
If you must press two or more keys simultaneously, the key
names are linked with a plus sign (+).
ROG ZENITH EXTREME specifications summary
CPU
Chipset
AMD® TR4 socket for AMD®Ryzen Threadripper Processors
* Refer to www.asus.com for CPU support list.
AMD® X399
AMD® Ryzen™ Threadripper™ Processors
Memory
- 8 x DIMM, max. 128GB, DDR4 2800(O.C) / 2666 / 2400 /
2133MHzmemory*
* Please refer to Memory QVL (Qualified Vendors List) for details.
AMD® Ryzen™ Processors
- 4 x PCIe 3.0 x16 (supports x16/x8/x16/x8)
Expansion slots
AMD® X399 chipset
- 1 x PCIe 2.0 x4
- 1 x PCIe 2.0 x1
Multi-GPU support
Supports NVIDIA®4-Way/3-Way/Quad-GPUSLI Technology
Supports AMD®4-Way/3-Way/Quad-GPUCrossFireX Technology
AMD® Ryzen™ Threadripper™ Processors
- 1 x DIMM.2 Card with 2 x M.2 Socket 3 with M Key, type
2242/2260/2280/22110 (PCIE 3.0 x4)
Storage
- 1 x M.2 Socket 3 with M Key, type 2242/2260/2280/
(PCIE 3.0 x4 and SATA modes) storage devices support
- 1 x U.2 port
AMD® X399 chipset
- 6 x SATA 6Gb/s ports
AMD® Ryzen™ Threadripper™ Processors
- 8 x USB 3.1 Gen 1 ports (8 ports at back panel[blue])
AMD® X399 chipset
- 1 x USB 3.1 Gen 2 front panel connector
USB
- 4 x USB 3.1 Gen 1 ports (4 ports at mid-board)
- 2 x USB 2.0 ports (2 ports at mid-board)
ASMedia® 3142 USB 3.1 Gen 2 controller
-2xUSB3.1Gen2ports(1xType-Aand1xType-C atback
panel)
ROG AREION 10G Ethernet Card
LAN
Intel® Ethernet Controller I211-AT
Anti-surge LANGuard
ROG GameFirst IV
(continued on the next page)
ix
ROG ZENITH EXTREME specifications summary
SupremeFX S1220 8-Channel High Definition Audio CODEC
-Supportsupto32-Bit/192kHzplayback*
- High quality 120 dB SNR stereo playback output and 113 dB SNR
recording input
- Impedance sense for front and rear headphone outputs
- SupremeFX Shielding Technology
-DualHeadphoneAmpli ers
Audio
- Jack-detection, Multi-streaming, and Front Panel Jack-retasking
- Optical S/PDIF out port at back panel
ES9018Q2C High Definition DAC
Audio Feature
- Sonic Studio III
- Sonic Radar III
* Due to limitations in HDA bandwidth, 32-Bit/192kHz is not supported for
8-Channel audio.
ASUS Dual Intelligent Processors 5
-5-WayOptimizationtuningkeyperfectlyconsolidatesTPU,EPU,
DIGI+ Power Control, Fan Xpert 4, and Turbo App
ASUS Wi-Fi GO! Module
- 1x1 802.11 ad Wi-Fi
- 2x2 MU-MIMO 802.11 a/b/g/n/ac support dual frequency band
2.4/5GHz
ASUS Exclusive Features
- AI Suite 3
- USB 3.1 Boost
Special Features
- AI Charger+
- Push Notice
ASUS EZ DIY
- ASUS CrashFree BIOS 3
- ASUS EZ Flash 3
- ASUS C.P.R.(CPU Parameter Recall)
ASUS Q-Design
- LIVEDASH OLED
- ASUS Q-Connector
- ASUS SafeSlot
- ASUS SafeDIMM slots
(continued on the next page)
x
ROG ZENITH EXTREME specifications summary
Extreme Engine Digi+
- MicroFine Alloy Choke
- NexFET MOSFETs
- 10K Black Metallic Capacitors
ROG DIMM.2 extension card with two M.2 slots
Pre-mounted IO Shield
OC Zone
- Start Button
- Reset Button
- Safe Boot Button
- ReTry Button
- LN2 Mode
- Slow Mode switch
- PCIe x16 lane switches
ROG Exclusive Features
UEFI BIOS features
- Extreme Tweaker
- Tweakers’ Paradise
- ROG SSD Secure Erase
-O.C.Pro le
- Graphics Card Information Preview
KeyBot II
- One-click overclocking
- DirectKey
- Clr CMOS
- Power On
ROG RAMCache II
ROG Overwolf
ROG CPU-Z
ROG CloneDrive
1 x Clear CMOS Button
1 x BIOS Flashback Button
1 x ASUS Wi-Fi GO! module (1x1 802.11 ad Wi-Fi +
2x2 MU-MIMO 802.11 a/b/g/n/ac and Bluetooth v4.1)
Back I/O Ports
8 x USB 3.1 Gen 1 ports [blue]
2xUSB3.1Gen2ports(1xType-A[red]and1xType-C [black])
1 x Optical S/PDIF out
5 x LED-illuminated audio jacks
(continued on the next page)
xi
ROG ZENITH EXTREME specifications summary
1 x USB 3.1 Gen 2 front panel connector
2 x USB 3.1 Gen 1 header supports additional 4 USB 3.1 Gen 1
ports
1 x USB 2.0 header supports additional 2 USB 2.0 ports
[via ROG_EXT header]
6 x SATA 6Gb/s connectors
1 x U.2 port
1 x DIMM.2 slot
1 x M.2 Socket 3 for M Key, type 2242/2260/2280 storage devices
support (Supports PCIE 3.0 x4 and SATA modes)
1 x 4-Pin CPU fan connector
1 x 4-Pin CPU_OPT fan connector
1 x 4-Pin H_AMP Fan connector
1 x 4-Pin W_PUMP+ connector
2 x 4-Pin Chassis fan connectors
2 x Thermal sensor connectors
Internal I/O Ports
1 x 24-Pin EATX power connector
2 x 8-Pin EATX 12V power connectors
1 x W_IN header
1 x W_OUT header
1 x W_FLOW header
1 x WB_SENSOR header
2 x Aura RGB headers
1 x Aura Addressable header
1 x Front panel audio connector (AAFP)
1 x Start button
1 x Reset button
1 x Safe Boot button
1 x ReTry button
1 x Slow mode Switch
1 x LN2 mode jumper
1 x TPM connector
1 x System panel connector
Wi-Fi802.11ad(WiGig)supportsfrequencyband60GHz*
Up to 4.6Gbps
2x2 MU-MIMO 802.11 a/b/g/n/ac supports dual frequency band
2.4/5GHz
Wireless & Bluetooth
Up to 867Mbps transfer speed
Bluetoothv4.1**
* 802.11ad(WiGig) is only available in certified countries.
** Support for the Bluetooth specification depends on the Windows®
version. Windows® 7/8.1 support up to Bluetooth 4.0.
(continued on the next page)
xii
ROG ZENITH EXTREME specifications summary
BIOS
128 Mb Flash ROM, UEFI AMI BIOS, PnP, WfM2.0, SM BIOS 3.0,
ACPI 6.1, Multi-language BIOS, ASUS EZ Flash 3, CrashFree
BIOS3,F11EZTuningWizard,F6QfanControl,F3MyFavorites,
LastModi edlog,F12PrintScreenandASUSDRAMSPD(Serial
Presence Detect) memory information
Manageability
WfM 2.0, WOL by PME, PXE
Drivers
ROG GameFirst technology
ROG RAMDisk
ROG RAMCache II
ROG CPU-Z
Overwolf
ROG Keybot II
CloneDrive
Kaspersky® Anti-Virus
Software
DAEMON Tools Software
LIVEDASH
Sonic Studio III
Sonic Radar III
Aura
WinZip
Fan Xpert 4
ASUS Utilities
Operating System Support
Windows® 10 64-bit
Form Factor
Extended ATX Form Factor, 12 inch x 10.9 inch (30.5cm x 27.7cm)
Speci cationsaresubjecttochangewithoutnotice.
VisittheASUSwebsiteforthesoftwaremanual.
xiii
Package contents
Check your motherboard package for the following items.
Motherboard
ROG ZENITH EXTREME
1 x 3-in-1 thermistor cable
3 x 2-in-1 SATA 6Gb/s Cables
1 x RGB LED extension cable
Cables
1 x RGB Addressable LED extension cable
1 x Wafer cable
1 x ROG DIMM.2 Card
1 x ROG DIMM.2 fan stand pack
1xSLI HBBridge(2-way-L)
1x3-WaySLI bridge
1x4-WaySLI bridge
1 x ROG AREION 10G Ethernet Card
3 x M.2 Screw Package
1 x FAN_EXT card
Accessories
1 x Bracket for FAN_EXT card
1 x Q-Connector Kit
1 x ROG Coaster
1 x 10-in-1 ROG cable label
1 x ROG big sticker
1 x ROG VGA holder
1 x ASUS 1x1 dual band Wi-Fi moving antenna
(Wi-Fi 802.11ad compliant)
1 x ASUS 2x2 dual band Wi-Fi moving antenna
(Wi-Fi 802.11a/b/g/n/ac compliant)
Application drive
USB drive with utilities and drivers
Documentation
User guide
If any of the above items is damaged or missing, contact your retailer.
xiv
Installation tools and components
1 Bag of screws
Phillips (cross) screwdriver
PC chassis
Power supply unit
AMD® TR4 CPU
AMD® TR4 compatible CPU Fan
DDR4 DIMM
SATA hard disk drive
SATA optical disc drive (optional)
Graphics card (optional)
The tools and components in the table above are not included in the motherboard package.
xv
xvi
Product Introduction
Product Introduction
1.1
Motherboard overview
1.1.1
Before you proceed
1
Chapter 1
Chapter 1:
Takenoteofthefollowingprecautionsbeforeyouinstallmotherboardcomponentsorchange
anymotherboardsettings.
Unplugthepowercordfromthewallsocketbeforetouchinganycomponent.
Beforehandlingcomponents,useagroundedwriststraportouchasafelygrounded
objectorametalobject,suchasthepowersupplycase,toavoiddamagingthemdue
tostaticelectricity.
HoldcomponentsbytheedgestoavoidtouchingtheICsonthem.
Wheneveryouuninstallanycomponent,placeitonagroundedantistaticpadorinthe
bagthatcamewiththecomponent.
Beforeyouinstallorremoveanycomponent,ensurethattheATXpowersupplyis
switchedofforthepowercordisdetachedfromthepowersupply.Failuretodoso
maycauseseveredamagetothemotherboard,peripherals,orcomponents.
ROG ZENITH EXTREME
1-1
1.1.2
Motherboard layout
Chapter 1
Referto1.1.9Internal connectorsand 2.3.1 Rear I/O connectionformoreinformation
aboutrearpanelconnectorsandinternalconnectors.
1-2
Chapter 1: Product Introduction
Layout contents
ROG ZENITH EXTREME
Page
1-28
1-5
1-4
1-23
1-27
Chapter 1
Connectors/Jumpers/Buttons and switches/Slots
1. WaterBlockconnector(9pinWB_SENSOR)
2. DDR4DIMMslots
3. TR4CPUsocket
4. AURARGBheaders(4-pinRGB_HEADER1-2)
5. DIMM.2slot(DIMM.2_SLOT)
6. ATXpowerconnectors(24-pinEATXPWR;8-pinEATX12V1;8-pin
EATX12V2;4-pinEZ_PLUG))
7. CPU,CPUoptional,highamp,waterpump+,extension,cover,andchassis
fanconnectors(4-pinCPU_FAN;4-pinCPU_OPT;4-pinH_AMP_FAN;4-pin
W_PUMP+;3-pinCOV_FAN;5-pinEXT_FAN;4-pinCHA_FAN1-2)
8. Power-onbutton(START)
9. RESETbutton(RESET)
10. PCIex16Laneswitch(PCIEX16_SW)
11. ProbeIt
12. USB3.1Gen2frontpanelconnector(U31G2_1)
13. Thermalsensorconnectors(2-pinT_SENSOR1-2)
14. LEDconnectors(8-pinLED_CON2;13-pinLED_CON3)
15. M.2sockets(M.2_1(Socket3))
16. USB3.1Gen1connector(20-1pinU31G1_910;20-1pinU31G1_1112)
17. LN2Modejumper(3-pinLN2_MODE)
18. AMD®SerialATA6Gb/sconnectors(7-pinSATA6G_12;SATA6G_34;
SATA6G_56)
19. Waterin,waterout,andwater owconnectors
(2-pinW_IN;2-pinW_OUT;3-pinW_FLOW)
20. U.2connector(U.2)
21. Systempanelconnectors(10-1pinF_PANEL;4-pinSPEAKER)
22. ReTrybutton(RETRY_BUTTON)
23. SafeBootbutton(SAFE_BOOT)
24. SlowModeswitch(SLOW_MODE)
25. RSVDswitch(RSVD)
26. USB2.0connector(10-1pinUSB1314)
27. ROGExtensionconnector(18-1pinROG_EXT)
28. AddressableRGBheader(4-1pinADD_HEADER)
29. TPMconnector(14-1pinTPM)
30. Frontpanelaudioconnector(10-1pinAAFP)
31. OLEDconnector(9-pinOLED_HEADER)
1-21
1-20
1-9
1-9
1-12
1-30
1-17
1-19
1-23
1-26
1-18
1-13
1-16
1-28
1-26
1-22
1-10
1-10
1-11
1-11
1-19
1-29
1-24
1-25
1-17
1-25
1-3
1.1.3
Central Processing Unit (CPU)
ThemotherboardcomeswithaTR4socketdesignedfortheAMD®Ryzen Threadripper processors.
Chapter 1
TheTR4sockethasadifferentpinoutdesign.EnsurethatyouuseaCPUdesignedforthe
TR4socket.TheCPU tsinonlyonecorrectorientation.DONOTforcetheCPUintothe
sockettopreventbendingtheconnectorsonthesocketanddamagingtheCPU!
EnsurethatallpowercablesareunpluggedbeforeinstallingtheCPU.
1-4
Chapter 1: Product Introduction
1.1.4
System memory
Chapter 1
ThemotherboardcomeswithfourDoubleDataRate4(DDR4)DualInlineMemoryModules
(DIMM)slots.
ADDR4moduleisnotcheddifferentlyfromaDDR,DDR2,orDDR3module.DONOT
installaDDR,DDR2,orDDR3memorymoduletotheDDR4slot.
Recommended memory configurations
ROG ZENITH EXTREME
1-5
Memory configurations
Youmayinstall2GB,4GB,8GB,and16GBunbufferedandnon-ECCDDR4DIMMsinto
theDIMMsockets.
Chapter 1
1-6
YoumayinstallvaryingmemorysizesinChannelA,ChannelB,ChannelC,and
ChannelD.Thesystemmapsthetotalsizeofthelower-sizedchannelforthequad
channelcon guration.Anyexcessmemoryfromthehigher-sizedchannelisthen
mappedforsingle-channeloperation.
ThismotherboarddoesnotsupportDIMMsmadeupof512Mb(64MB)chipsorless
(MemorychipcapacitycountsinMegabit,8Megabit/Mb=1Megabyte/MB).
ThedefaultmemoryoperationfrequencyisdependentonitsSerialPresenceDetect
(SPD),whichisthestandardwayofaccessinginformationfromamemorymodule.
Underthedefaultstate,somememorymodulesforoverclockingmayoperateata
lowerfrequencythanthevendor-markedvalue.
Forsystemstability,useamoreef cientmemorycoolingsystemtosupportafull
memoryload(4DIMMs)oroverclockingcondition.
AlwaysinstalltheDIMMSwiththesameCASLatency.Foranoptimumcompatibility,
werecommendthatyouinstallmemorymodulesofthesameversionordatacode
(D/C)fromthesamevendor.Checkwiththevendortogetthecorrectmemory
modules.
Chapter 1: Product Introduction
1.1.5
Expansion slots
Slot No.
Chapter 1
Unplugthepowercordbeforeaddingorremovingexpansioncards.Failuretodosomay
causeyouphysicalinjuryanddamagemotherboardcomponents.
Slot Description
1
PCIex16_1slot
2
PCIex8_2slot
3
PCIex4slot
4
PCIex16_3slot
5
PCIex1slot
6
PCIex8/x4_4slot
ROG ZENITH EXTREME
1-7
AMD® Ryzen™ Threadripper™ Processors
VGA Configuration
Single VGA
Chapter 1
PCI Express 3.0 operating mode
3-Way SLI™/
SLI™/CFX
CFX
4-Way SLI™/
CFX
PCIe x16_1
x16
x16
x16
x16
PCIe x8_2
N/A
N/A
x8
x8
PCIe x16_3
N/A
x16
x16
x16
PCIe x8/x4_4
N/A
N/A
N/A
x8*
* The PCIE_X8/X4_4 slot shares bandwidth with U.2. In 4-Way configuration, if the PCIE_X8/X4_4 is used in x8
mode, U.2 port will be disabled.
1-8
Werecommendthatyouprovidesuf cientpowerwhenrunningCrossFireX or
SLI mode.
Connectchassisfanstothemotherboardchassisfanconnectorswhenusingmultiple
graphicscardsforbetterthermalenvironment.
Chapter 1: Product Introduction
1.1.6
Onboard buttons and switches
1.
Chapter 1
Onboardbuttonsandswitchesallowyouto ne-tuneperformancewhenworkingonabareor
open-casesystem.Thisisidealforoverclockersandgamerswhocontinuallychangesettings
toenhancesystemperformance.
Power-on button (START)
Themotherboardcomeswithapower-onbuttonthatallowsyoutopoweruporwake
upthesystem.Thebuttonalsolightsupwhenthesystemispluggedtoapowersource
indicatingthatyoushouldshutdownthesystemandunplugthepowercablebefore
removingorinstallinganymotherboardcomponent.
2.
RESET button (RESET)
Presstheresetbuttontorebootthesystem.
ROG ZENITH EXTREME
1-9
3.
Safe Boot button (SAFE_BOOT)
Chapter 1
TheSafeBootbuttoncanbepressedanytimetoforcethesystemtorebootintothe
BIOSsafemode.ThisbuttontemporarilyappliessafesettingstotheBIOSwhile
retaininganyoverclockedsettingsallowingyoutomodifythesettingscausingboot
failure.Usethisbuttonwhenoverclockingortweakingthesettingsofyoursystem.
4.
ReTry button (RETRY_BUTTON)
TheReTrybuttonisspeciallydesignedforoverclockersandismostusefulduringthe
bootingprocesswheretheResetbuttonisrendereduseless.Whenpressed,itforces
thesystemtorebootwhileretainingthesamesettingstoberetriedinquicksuccession
toachieveasuccessfulPOST.
1-10
Chapter 1: Product Introduction
5.
Slow Mode Switch (SLOW_MODE)
6.
Chapter 1
SlowModeSwitchisemployedduringLN2benching.Thesystemmaycrashdueto
theCPUbeingunstablewhenusingextremeoverclocking,enablingslowmodewill
decreasetheprocessorfrequencyandstabilizethesystem,allowingoverclockersto
keeptrackoftheiroverclockingdata.
RSVD switch (RSVD)
ThisswitchisreservedforASUS-authorizedtechniciansonly.
Ensuretosetthisswitchtodisabled,enablingthisswitchmaycausesystemfailure.
ROG ZENITH EXTREME
1-11
7.
PCIe x16 Lane switch (PCIEX16_SW)
TheseslideswitchesallowsyoutoenableanddisablethecorrespondingPCIex16
slots.WhenoneoftheinstalledPCIex16cardsisoutoforder,youcanusetheslide
switchto ndthefaultyonewithoutremovingthecards.
Chapter 1
1-12
Chapter 1: Product Introduction
1.1.7
1.
Jumper
LN2 Mode jumper (3-pin LN2_MODE)
ROG ZENITH EXTREME
Chapter 1
WithLN2modeactivated,theROGmotherboardisoptimizedtoremedythecold-boot
bugduringPOSTandhelpthesystembootsuccessfully.
1-13
1.1.8
1.
Onboard LEDs
Q LEDs (CPU, DRAM, VGA, BOOT)
Chapter 1
QLEDscheckkeycomponents(CPU,DRAM,VGAcard,andbootingdevices)in
sequenceduringmotherboardbootingprocess.Ifanerrorisfound,thecorresponding
LEDremainslituntiltheproblemissolved.Thisuser-friendlydesignprovidesan
intuitivewaytolocatetherootproblemwithinseconds.
TheorderwhichtheLEDslightupmayvaryperCPU.
TheQLEDsprovidethemostprobablecauseofanerrorcodeasastartingpointfor
troubleshooting.Theactualcausemayvaryfromcasetocase.
2.
Hard Disk LED (HD_LED)
TheHardDiskLEDisdesignedtoindicatetheharddiskactivity.Itblinkswhendata
isbeingwrittenintoorreadfromtheharddiskdrive.TheLEDdoesnotlightupwhen
thereisnoharddiskdriveconnectedtothemotherboardorwhentheharddiskdrive
doesnotfunction.
1-14
Chapter 1: Product Introduction
3.
CPU ready LED (CPU_READY)
Chapter 1
ThisLEDwillindicatethecurrentstatusofyourCPU.AredlightindicatesthattheCPU
isnotreadytoboot,andtheLEDwillturngreenoncetheproblemissolved.ThisuserfriendlydesignhelpsyouquicklyidentifywhetheryourCPUisreadytobootornot.
ROG ZENITH EXTREME
1-15
1.1.9
1.
Internal connectors
®
AMD Serial ATA 6 Gb/s connectors (7-pin SATA6G_12; SATA 6G_34;
SATA 6G_56)
Chapter 1
TheseconnectorsconnecttoSerialATA6.0Gb/sharddiskdrivesviaSerialATA6.0
Gb/ssignalcables.
IfyouinstalledSerialATAharddiskdrives,youcancreateaRAID0,1,and10
con gurationthroughtheonboardAMD®X399chipset.
1-16
Theseconnectorsaresetto[AHCI]bydefault.IfyouintendtocreateaSerialATA
RAIDsetusingtheseconnectors,settheSATAModeSelectionitemintheBIOSto
[RAID].
BeforecreatingaRAIDset,refertosectionRAID configurationsorthemanual
bundledinthemotherboardsupportUSB.
WhenusingNCQ,settheSATAModeintheBIOSto[AHCI].RefertosectionSATA
Configurationfordetails.
Chapter 1: Product Introduction
2.
Front panel audio connector (10-1 pin AAFP)
Chapter 1
Thisconnectorisforachassis-mountedfrontpanelaudioI/OmodulethatsupportsHD
Audio.ConnectoneendofthefrontpanelaudioI/Omodulecabletothisconnector.
Werecommendthatyouconnectahigh-de nitionfrontpanelaudiomoduletothis
connectortoavailofthemotherboard shigh-de nitionaudiocapability.
3.
USB 3.1 Gen 2 front panel connector (U31G2_1)
ThisconnectorallowsyoutoconnectaUSB3.1Gen2moduleforadditionalUSB3.1
Gen2ports.ThelatestUSB3.1Gen2connectivityprovidesdatatransferspeedsof
upto10Gbps.
ROG ZENITH EXTREME
1-17
4.
USB 3.1 Gen 1 connector (20-1 pin U31G1_910; 20-1 pin U31G1_1112)
Chapter 1
TheseconnectorsallowyoutoconnectaUSB3.1Gen1moduleforadditionalUSB
3.1Gen1frontorrearpanelports.WithaninstalledUSB3.1Gen1module,youcan
enjoyallthebene tsofUSB3.1Gen1includingfasterdatatransferspeedsofupto
5Gb/s,fasterchargingtimeforUSB-chargeabledevices,optimizedpoweref ciency,
andbackwardcompatibilitywithUSB2.0.
TheUSB3.1Gen1moduleispurchasedseparately.
1-18
EnsuretoinstalltherelateddrivertofullyusetheUSB3.1Gen1portsunder
Windows®7.
ThepluggedUSB3.1Gen1devicemayrunonxHCIorEHCImodedependingonthe
operatingsystem ssetting.
Chapter 1: Product Introduction
5.
USB 2.0 connector (10-1 pin USB1314)
Chapter 1
ThisconnectorisforUSB2.0ports.ConnecttheUSBmodulecabletothisconnector,
theninstallthemoduletoaslotopeningatthebackofthesystemchassis.ThisUSB
connectorcomplieswithUSB2.0speci cationthatsupportsupto480Mb/sconnection
speed.
Neverconnecta1394cabletotheUSBconnectors.Doingsowilldamagethe
motherboard!
1xUSB2.0port(USB1314)atmid-boardshareswithROGextension(ROG_EXT)port.
6.
Thermal sensor connectors (2-pin T_SENSOR1-2)
Theseconnectorsareforthethermistorcablesthatmonitorthetemperatureofthe
devicesandthecriticalcomponentsinsidethemotherboard.Connectthethermistor
cableandplacethesensoronthedeviceorthemotherboard scomponenttodetectits
temperature.
ROG ZENITH EXTREME
1-19
7.
CPU, CPU optional, high amp, water pump+, extension, cover, and chassis fan
connectors (4-pin CPU_FAN; 4-pin CPU_OPT; 4-pin H_AMP_FAN; 4-pin W_
PUMP+; 3-pin COV_FAN; 5-pin EXT_FAN; 4-pin CHA_FAN1-2)
Chapter 1
Connectthefancablestothefanconnectorsonthemotherboard,ensuringthatthe
blackwireofeachcablematchesthegroundpinoftheconnector.
1-20
DONOTforgettoconnectthefancablestothefanconnectors.Insuf cientair ow
insidethesystemmaydamagethemotherboardcomponents.Thesearenotjumpers!
Donotplacejumpercapsonthefanconnectors!
EnsurethattheCPUfancableissecurelyinstalledtotheCPUfanconnector.
TheCPU_FANconnectorsupportstheCPUfanofmaximum1A(12W)fanpower.
TheEXT_FANconnectorsupports2of5thermalsensorsources.
W_PUMP+functionsupportdependsonwatercoolingdevice.
ConnectthefanofyourwatercoolingkittotheH_AMP_PUMPconnector.
Chapter 1: Product Introduction
8.
ATX power connectors (24-pin EATXPWR; 8-pin EATX12V1; 8-pin EATX12V2;
4-pin EZ_PLUG))
Chapter 1
TheseconnectorsareforATXpowersupplyplugs.Thepowersupplyplugsare
designedto ttheseconnectorsinonlyoneorientation.Findtheproperorientationand
pushdown rmlyuntiltheconnectorscompletely t.
Ensuretoconnectthe8-pinpowerplug
Forafullycon guredsystem,werecommendthatyouuseapowersupplyunit
(PSU)thatcomplieswithATX12VSpeci cation2.0(orlaterversion)andprovidesa
minimumpowerof350W.
WerecommendthatyouuseaPSUwithahigherpoweroutputwhencon guringa
systemwithmorepower-consumingdevices.Thesystemmaybecomeunstableor
maynotbootupifthepowerisinadequate.
Ifyouwanttousetwoormorehigh-endPCIExpressx16cards,useaPSUwith
1000Wpowerorabovetoensurethesystemstability.
ROG ZENITH EXTREME
1-21
9.
Systempanelconnectors(10-1pinF_PANEL;4-pinSPEAKER)
Thisconnectorsupportsseveralchassis-mountedfunctions.
Chapter 1
•
SystempowerLED(2-pinor3-1pinPLED)
The2-pinor3-1pinconnectorisforthesystempowerLED.Connectthechassis
powerLEDcabletothisconnector.ThesystempowerLEDlightsupwhenyouturnon
thesystempower,andblinkswhenthesystemisinsleepmode.
•
HarddiskdriveactivityLED(2-pinHDD_LED)
This2-pinconnectorisfortheHDDActivityLED.ConnecttheHDDActivityLEDcable
tothisconnector.TheHDDLEDlightsupor asheswhendataisreadfromorwritten
totheHDD.
•
Systemwarningspeaker(4-pinSPEAKER)
This4-pinconnectorisforthechassis-mountedsystemwarningspeaker.Thespeaker
allowsyoutohearsystembeepsandwarnings.
•
ATXpowerbutton/soft-offbutton(2-pinPWRSW)
Thisconnectorisforthesystempowerbutton.Pressingthepowerbuttonturnsthe
systemonorputsthesysteminsleeporsoft-offmodedependingontheoperating
systemsettings.Pressingthepowerswitchformorethanfoursecondswhilethe
systemisONturnsthesystemOFF.
•
Resetbutton(2-pinRESET)
This2-pinconnectorisforthechassis-mountedresetbuttonforsystemrebootwithout
turningoffthesystempower.
1-22
Chapter 1: Product Introduction
10.
LED connectors (8-pin LED_CON2; 13-pin LED_CON3)
Chapter 1
TheseconnectorsareforconnectingLEDstripsonyourcover.
11.
AURA RGB headers (4-pin RGB_HEADER1-2)
TheseconnectorsareforRGBLEDstrips.
TheRGBheadersupports5050RGBmulti-colorLEDstrips(12V/G/R/B),withamaximum
powerratingof2A(12V),andnolongerthan2m.
Beforeyouinstallorremoveanycomponent,ensurethattheATXpowersupplyisswitched
offorthepowercordisdetachedfromthepowersupply.Failuretodosomaycausesevere
damagetothemotherboard,peripherals,orcomponents.
ActuallightingandcolorwillvarywithLEDstrip.
IfyourLEDstripdoesnotlightup,checkiftheRGBLEDextensioncableandthe
RGBLEDstripisconnectedinthecorrectorientation,andthe12Vconnectoris
alignedwiththe12Vheaderonthemotherboard.
TheLEDstripwillonlylightupundertheoperatingsystem.
TheLEDstripispurchasedseparately.
ROG ZENITH EXTREME
1-23
12.
Addressable RGB header (4-1 pin ADD_HEADER)
ThisconnectorisforindividuallyaddressableRGBWS2812BLEDstripsorWS2812B
basedLEDstrips.
Chapter 1
TheaddressableRGBheadersupportsWS2812BaddressableRGBLEDstrips(5V/Data/
Ground),withamaximumpowerratingof3A(5V)andamaximumof60LEDs.
Beforeyouinstallorremoveanycomponent,ensurethattheATXpowersupplyisswitched
offorthepowercordisdetachedfromthepowersupply.Failuretodosomaycausesevere
damagetothemotherboard,peripherals,orcomponents.
1-24
ActuallightingandcolorwillvarywithLEDstrip.
IfyourLEDstripdoesnotlightup,checkiftheaddressableRGBLEDstripis
connectedinthecorrectorientation,andthe5Vconnectorisalignedwiththe5V
headeronthemotherboard.
TheaddressableRGBLEDstripwillonlylightupundertheoperatingsystem.
TheaddressableRGBLEDstripispurchasedseparately.
Chapter 1: Product Introduction
13.
OLED connector (9-pin OLED_HEADER)
14.
UsetheROG LiveDash Utilitytocon gureandcustomizetheOLEDpanel.
TheLiveDashOLEDprovidesthemostprobablecauseofanerrorcodeasastarting
pointfortroubleshooting.Theactualcausemayvaryfromcasetocase.
Chapter 1
ThisconnectorisusedtoconnectyourLiveDashOLEDpanel.TheOLEDpanel
providesyouaquickoverviewofthesystemtemperature,powerstatus,andfan
speedswhenyoursystembootsup.Youcanalsouploada.gif leforacustomized
look.
TPM connector (14-1 pin TPM)
ThisconnectorsupportsaTrustedPlatformModule(TPM)system,whichsecurely
storeskeys,digitalcerti cates,passwordsanddata.ATPMsystemalsohelps
enhancenetworksecurity,protectdigitalidentities,andensuresplatformintegrity.
ROG ZENITH EXTREME
1-25
15.
U.2 connector (U.2)
ThismotherboardcomeswithaU.2connectorwhichsupportsPCIe3.0x4NVM
Expressstorage.
Chapter 1
TheU.2connectorsharesbandwidthwiththeM.2_1socket.AdjusttheBIOSsettingsto
useU.2devices.
16.
M.2 sockets (M.2_1(Socket 3))
ThissocketallowsyoutoinstallanM.2SSDmodule.
ForAMD®Ryzen Threadripper Processors,theM.2(SOCKET3)supportsPCIE3.0x4
andSATAmodeMKeydesignandtype2242/2260/2280storagedevices.
TheM.2SSDmoduleispurchasedseparately.
1-26
Chapter 1: Product Introduction
17.
DIMM.2 slot (DIMM.2_SLOT)
Chapter 1
ThissocketallowsyoutoinstallthebundledDIMM.2cardtoconnectM.2SSD
modules.
BeforeyouinstallorremovetheDIMM.2card,ensurethattheATXpowersupplyis
switchedofforthepowercordisdetachedfromthepowersupply.Failuretodoso
maycauseseveredamagetothemotherboardorDIMM.2card.
TheDIMM.2cardisnotchedto tinonlyoneorientation.Ensurethatthenotchon
yourcardisalignedcorrectlywiththeDIMM.2slotbeforeinsertingthecard.
M.2_1socketsupportsPCIe3.0x4MKeydesignandtype2230/2242/2260/2280/
22110PCIestoragedevices.
M.2_2socketsupportsPCIe3.0x4MKeydesignandtype2230/2242/2260/2280/
22110storagedevices.
TheM.2SSDmoduleispurchasedseparately.
ROG ZENITH EXTREME
1-27
18.
Water in, water out, and water flow connectors (2-pin W_IN; 2-pin W_OUT;
3-pin W_FLOW)
Chapter 1
Theseconnectorsallowyoutoconnectsensorstomonitorthetemperatureand ow
rateofyourliquidcoolingsystem.Youcanmanuallyadjustthefansandwaterpumpto
optimizethethermalef ciencyofyourliquidcoolingsystem.
19.
Water Block connector (9-pin WB_SENSOR)
Thisconnectorallowsyoutoconnectawaterblockconnectortomonitorthe
temperature, owrate,andwaterleaksignalsofyourthirdpartymonoblocks.Youcan
manuallyadjustthefansandwaterpumptooptimizethethermalef ciencyofyour
thirdpartymonoblocks.
1-28
Chapter 1: Product Introduction
20.
ROG extension connector (18-1 pin ROG_EXT)
Chapter 1
ThisconnectorisfortheOCPanelI/II.
TheOCPanelI/IIispurchasedseparately.
SupportforOCPanelI/IIvariesoverdifferentplatforms.
Visitwww.asus.comformoreinformationaboutthedevicesandthelatestcompatibility
list.
ROG ZENITH EXTREME
1-29
1.1.10
ProbeIt
TheROGProbeItallowsyoutodetectyoursystem scurrentvoltageandOCsettings.Usea
multimetertomeasuretheProbeItpointsevenduringoverclocking.
Chapter 1
SeetheillustrationbelowtolocatetherespectiveProbeItpoints.
Using ProbeIt
Youcanconnectthemultimetertothemotherboardasshownonthefollowing gure.
Theillustrationaboveisforreferenceonly,theactualmotherboardlayoutandmeasure
pointsmaydifferbymodel.
1-30
Chapter 1: Product Introduction
Chapter 2:
Basic Installation
2
Basic Installation
2.1
Building your PC system
The diagrams in this section are for reference only. The motherboard layout may vary with
models, but the installation steps are the same for all models.
2.1.1
CPU installation
Chapter 2
The AMD® TR4 socket is compatible with AMD® TR4 processors. Ensure you use a CPU
designedfortheTR4socket.TheCPU tsinonlyonecorrectorientation.DONOTforce
the CPU into the socket to prevent bending the connectors on the socket and damaging
the CPU!
Load plate
Rail frame
External cap
External cap
Rail frame
Carrier frame
with CPU
Rail frame
PnP cap
PnP cap
ROG ZENITH EXTREME
2-1
Carrier frame
with CPU
Chapter 2
The load plate screws are T30
models. A torque value of 12 inch-lbf
is recommended.
Apply the Thermal Interface Material
to the CPU heatsink and CPU before
you install the heatsink and fan if
necessary.
2-2
Chapter 2: Basic Installation
2.1.2
CPU heatsink and fan assembly installation
To install the CPU heatsink and fan assembly:
Chapter 2
The heatsink screws are T30 models.
A torque value of 12 inch-lbf is
recommended.
ROG ZENITH EXTREME
2-3
2.1.3
Motherboard installation
Chapter 2
1.
Placethemotherboardintothechassis,ensuringthatitsrearI/Oportsarealignedto
thechassis rearI/Opanel.
2.
Place nine (9) screws into the holes indicated by circles to secure the motherboard to
the chassis.
DONOTovertightenthescrews!Doingsocandamagethemotherboard.
2-4
Chapter 2: Basic Installation
DIMM installation
Chapter 2
2.1.4
To remove a DIMM
ROG ZENITH EXTREME
2-5
2.1.5
ATX power connection
AND
Chapter 2
Ensure to connect both 8-pin power plugs.
2.1.6
SATA device connection
OR
2-6
Chapter 2: Basic Installation
2.1.7
Front I/O connector
To install ASUS Q-Connector
To install USB 3.1 Gen 2 connector
USB 3.1 Gen 2
To install USB 3.1 Gen 1 connector
Chapter 2
Thisconnectorwillonly tinone
orientation. Push the connector until it
clicks into place.
To install USB 2.0 connector
USB 3.1 Gen 1
USB 2.0
To install front panel audio connector
To install system speaker connector
AAFP
ROG ZENITH EXTREME
2-7
2.1.8
Expansion card installation
To install PCIe x16 cards
Chapter 2
To install PCIe x1 cards
2-8
Chapter 2: Basic Installation
Chapter 2
To install FAN EXTENSION CARD
The illustrations in this section are for reference only. The motherboard layout may vary
with models, but the installation steps are the same for all models.
ROG ZENITH EXTREME
2-9
2.1.9
M.2 installation
1
1
1
2
Chapter 2
3
4
5
8
8
8
7
6
Supported M.2 type varies per motherboard.
2-10
Chapter 2: Basic Installation
2.1.10
Wi-Fi antenna installation
Installing the ASUS 2x2 dual band W-Fi and ASUS Wi-Fi 802.11ad(WiGig) antenna
Chapter 2
Connect the bundled ASUS 2x2 dual band Wi-Fi antenna connector to the top two Wi-Fi ports
at the back of the chassis, then connect the Wi-Fi 802.11ad(WiGig) antenna to the bottom
Wi-Fi port.
ASUS 2x2 dual band W-Fi antenna
ASUS Wi-Fi 802.11ad(WiGig) antenna
EnsurethattheASUS2x2dualbandW-FiandASUSWi-Fi802.11ad(WiGig)antenna
is securely installed to the Wi-Fi ports.
Ensurethattheantennaisatleast20cmawayfromallpersons.
Wi-Fi802.11ad(WiGig)isonlyavailableincerti edcountries.
Foroptimumperformance,ensurethattheASUS2x2dualbandW-Fiantennaisat
least 10 cm away from the ASUS Wi-Fi 802.11ad(WiGig) antenna.
Theillustrationaboveisforreferenceonly.TheI/Oportlayoutmayvarywithmodels,but
the Wi-Fi antenna installation procedure is the same for all models.
ROG ZENITH EXTREME
2-11
2.2
BIOS update utility
USB BIOS Flashback
USBBIOSFlashbackallowsyoutoeasilyupdatetheBIOSwithoutenteringtheexisting
BIOSoroperatingsystem.SimplyinsertaUSBstoragedevicetotheUSBport(theUSBport
holemarkedingreenontheI/Oshield)thenpresstheUSBBIOSFlashbackbuttonforthree
secondstoautomaticallyupdatetheBIOS.
To use USB BIOS Flashback:
1.
Insert a USB storage device to the USB Flashback port.
WerecommendyoutouseaUSB2.0storagedevicetosavethelatestBIOSversionfor
better compatibility and stability.
Chapter 2
2.
Visit https://www.asus.com/support/anddownloadthelatestBIOSversionforthis
motherboard.
3.
Renamethe leasZE.CAP, then copy it to your USB storage device.
4.
Shut down your computer.
5.
PresstheBIOSFlashbackbuttonforthreesecondsuntiltheFlashbackLEDblinks
threetimes,indicatingthattheBIOSFlashbackfunctionisenabled.
USB BIOS Flashback button
6.
KeyBot port
USB BIOS Flashback port
Waituntilthelightgoesout,indicatingthattheBIOSupdatingprocessiscompleted.
FormoreBIOSupdateutilitiesinBIOSsetup,refertothesection3.12 Updating BIOS in
Chapter 3.
2-12
Donotunplugportabledisk,powersystem,orpresstheCLR_CMOSbuttonwhile
BIOSupdateisongoing,otherwiseupdatewillbeinterrupted.Incaseofinterruption,
please follow the steps again.
Ifthelight ashesfor vesecondsandturnsintoasolidlight,thismeansthat
theBIOSFlashbackisnotoperatingproperly.Thismaybecausedbyimproper
installationoftheUSBstoragedeviceand lename/ leformaterror.Ifthisscenario
happens, please restart the system to turn off the light.
UpdatingBIOSmayhaverisks.IftheBIOSprogramisdamagedduringtheprocess
and results to the system’s failure to boot up, please contact your local ASUS Service
Center.
Chapter 2: Basic Installation
2.3
Motherboard rear and audio connections
2.3.1
Rear I/O connection
1.
ClearCMOSbutton(CLR_CMOS).PressthisbuttontocleartheBIOSsetup
information only when the systems hangs due to overclocking.
2.
Wi-Fi 802.11 a/b/g/n/ac/ad, Bluetooth V4.1 ports
3.
USB 3.1 Gen 1 ports 5, 6, 7, and 8.
4.
LAN(RJ-45)port*
5.
USB 3.1 Gen 1 ports 1, 2. Upper port supports the KeyBot II feature, and lower port
supportsUSBBIOSFlashbackfunction.
6.
USB 3.1 Gen 2 Type-A port E2
7.
USBBIOSFlashbackbutton
8.
USB 3.1 Gen 1 ports 3, 4
9.
USB 3.1 Gen 2 Type-C™ port EC1
10.
OpticalS/PDIFOUTport
11.
Color-codedLEDAudioJacks**
Chapter 2
Rear panel connectors
* and ** : Refer to the tables on the next page for LAN port LEDs, and audio port definitions.
WhenusingWindows® 7, the USB 3.1 Gen 1 driver must be manually installed before
USB 3.1 Gen 1 devices can be used due to the controller’s limitation.
USB3.1Gen1/Gen2devicescanonlybeusedasdatastorageonly.
Westronglyrecommendthatyouconnectyourdevicestoportswithmatchingdata
transfer rate. Please connect your USB 3.1 Gen 1 devices to USB 3.1 Gen 1 ports and
your USB 3.1 Gen 2 devices to USB 3.1 Gen 2 ports for faster and better performance
for your devices.
WhenKeyBotIIisactivated,USBhotplugfunctionoftheKeyBotport(USB3.1Gen1
port 1) will be temporarily disabled.
ROG ZENITH EXTREME
2-13
* LAN ports LED indications
Activity Link LED
ACT/LINK SPEED
LED
LED
Speed LED
Status
Description
Status
Description
OFF
Nolink
OFF
10 Mbps connection
ORANGE
Linked
ORANGE
100 Mbps connection
BLINKING
Data activity
GREEN
1 Gbps connection
LAN port
** Audio 2, 4, 6 or 8-channel configuration
4-channel
6-channel
8-channel
Orange
Headset
2-channel
LineIn
LineOut
Mic In
–
LineIn
FrontSpeakerOut
Mic In
–
White
–
RearSpeakerOut
LineIn
FrontSpeakerOut
Mic In
Center/Sub
woofer
RearSpeakerOut
FrontSpeakerOut
Mic In
Center/Sub
woofer
RearSpeakerOut
Port
Chapter 2
LightBlue
Lime
Red
2-14
SideSpeakerOut
Chapter 2: Basic Installation
2.3.2
Audio I/O connections
Audio I/O ports
Chapter 2
Connect to Headphone and Mic
Connect to Stereo Speakers
Connect to 2 Speakers
ROG ZENITH EXTREME
2-15
Connect to 4 Speakers
Connect to 6 Speakers
Chapter 2
Connect to 8 Speakers
2-16
Chapter 2: Basic Installation
Starting up for the first time
1.
After making all the connections, replace the system case cover.
2.
Ensure that all switches are off.
3.
Connect the power cord to the power connector at the back of the system chassis.
4.
Connect the power cord to a power outlet that is equipped with a surge protector.
5.
Turn on the devices in the following order:
a.
Monitor
b.
External SCSI devices (starting with the last device on the chain)
c.
System power
6.
Afterapplyingpower,thesystempowerLEDonthesystemfrontpanelcaselightsup.
ForsystemswithATXpowersupplies,thesystemLEDlightsupwhenyoupressthe
ATX power button. If your monitor complies with the “green” standards or if it has a
powerstandby feature,themonitorLEDmaylightuporchangefromorangetogreen
afterthesystemLEDturnson.
Thesystemthenrunsthepower-onselftests(POST).Whilethetestsarerunning,the
BIOSbeeps(refertotheBIOSbeepcodestable)oradditionalmessagesappearon
the screen. If you do not see anything within 30 seconds from the time you turned on
the power, the system may have failed a power-on test. Check the jumper settings and
connections or call your retailer for assistance.
7.
2.5
BIOS Beep
Description
Oneshortbeep
VGA detected
Quick boot set to disabled
Nokeyboarddetected
Onecontinuousbeepfollowedbytwo
short beeps then a pause (repeated)
Nomemorydetected
Onecontinuousbeepfollowedbythree
short beeps
NoVGAdetected
Onecontinuousbeepfollowedbyfour
short beeps
Hardware component failure
Chapter 2
2.4
Atpoweron,holddownthe<Delete>keytoentertheBIOSSetup.Followthe
instructions in Chapter 3.
Turning off the computer
WhilethesystemisON,pressthepowerbuttonforlessthanfoursecondstoputthesystem
onsleepmodeorsoft-offmode,dependingontheBIOSsetting.Pressthepowerbutton
formorethanfoursecondstoletthesystementerthesoft-offmoderegardlessoftheBIOS
setting.
ROG ZENITH EXTREME
2-17
Chapter 2
2-18
Chapter 2: Basic Installation
Chapter 3:
BIOS Setup
BIOS Setup
3.1
Knowing BIOS
3
ThenewASUSUEFIBIOSisaUni edExtensibleInterfacethatcomplieswithUEFI
architecture,offeringauser-friendlyinterfacethatgoesbeyondthetraditionalkeyboardonlyBIOScontrolstoenableamore exibleandconvenientmouseinput.Youcaneasily
navigatethenewUEFIBIOSwiththesamesmoothnessasyouroperatingsystem.The
term BIOS inthisusermanualrefersto UEFIBIOS unlessotherwisespeci ed.
BIOS(BasicInputandOutputSystem)storessystemhardwaresettingssuchasstorage
devicecon guration,overclockingsettings,advancedpowermanagement,andboot
devicecon gurationthatareneededforsystemstartupinthemotherboardCMOS.In
normalcircumstances,thedefaultBIOSsettingsapplytomostconditionstoensure
optimalperformance.DO NOT change the default BIOS settingsexceptinthefollowing
circumstances:
Anerrormessageappearsonthescreenduringthesystembootupandrequestsyouto
runtheBIOSSetup.
YouhaveinstalledanewsystemcomponentthatrequiresfurtherBIOSsettingsor
update.
Chapter 3
InappropriateBIOSsettingsmayresulttoinstabilityorbootfailure.We strongly
recommend that you change the BIOS settings only with the help of a trained service
personnel.
WhendownloadingorupdatingtheBIOS le,renameitasZE.CAPforthismotherboard.
ROG ZENITH EXTREME
3-1
3.2
BIOS setup program
UsetheBIOSSetuptoupdatetheBIOSorcon gureitsparameters.TheBIOSscreen
includenavigationkeysandbriefonscreenhelptoguideyouinusingtheBIOSSetup
program.
Entering BIOS at startup
ToenterBIOSSetupatstartup,press<Delete>or<F2>duringthePower-OnSelfTest
(POST).Ifyoudonotpress<Delete>or<F2>,POSTcontinueswithitsroutines.
Entering BIOS Setup after POST
ToenterBIOSSetupafterPOST:
Press<Ctrl>+<Alt>+<Delete>simultaneously.
Presstheresetbuttononthesystemchassis.
Pressthepowerbuttontoturnthesystemoffthenbackon.Dothisoptiononlyifyou
failedtoenterBIOSSetupusingthe rsttwooptions.
Afterdoingeitherofthethreeoptions,press<Delete>keytoenterBIOS.
Chapter 3
TheBIOSsetupscreensshowninthissectionareforreferencepurposesonly,and
maynotexactlymatchwhatyouseeonyourscreen.
EnsurethataUSBmouseisconnectedtoyourmotherboardifyouwanttousethe
mousetocontroltheBIOSsetupprogram.
IfthesystembecomesunstableafterchanginganyBIOSsetting,loadthedefault
settingstoensuresystemcompatibilityandstability.SelecttheLoad Optimized
DefaultsitemundertheExitmenuorpresshotkey <F5>.Seesection3.11 Exit Menu
fordetails.
IfthesystemfailstobootafterchanginganyBIOSsetting,trytocleartheCMOSand
resetthemotherboardtothedefaultvalue.Seesection 1.1.6 Onboard buttons and
switches forinformationonhowtoerasetheRTCRAMviatheClearCMOSbutton.
TheBIOSsetupprogramdoesnotsupporttheBluetoothdevices.
PleasevisitASUSwebsiteforthedetailedBIOScontentmanual.
BIOS menu screen
TheBIOSSetupprogramcanbeusedundertwomodes:EZ Mode andAdvanced Mode.
YoucanchangemodesfromSetup Mode in Boot menuorbypressingthe<F7>hotkey.
3-2
Chapter 3: BIOS Setup
3.2.1
Advanced Mode
TheAdvancedModeprovidesadvancedoptionsforexperiencedend-userstocon gure
theBIOSsettings.The gurebelowshowsanexampleoftheAdvancedMode.Refertothe
followingsectionsforthedetailedcon gurations.
ThedefaultscreenforenteringtheBIOSsetupprogramcanbechanged.Refertothe
Setup ModeiteminsectionBoot menu fordetails.
MyFavorite(F3)
Scroll bar
Qfan Control(F6) EZ Tuning Wizard(F11) Hot Keys
Chapter 3
Configuration fields
Pop-up Menu
Menu bar
Language
Menu items
General help
Last modified settings
Go back to EZ Mode
Search on the FAQ
Displays the CPU temperature,
CPU, and memory voltage output
ROG ZENITH EXTREME
3-3
Menu bar
Themenubarontopofthescreenhasthefollowingmainitems:
My Favorites
Forsavingthefrequently-usedsystemsettingsandcon guration.
Main
Forchangingthebasicsystemcon guration
Extreme Tweaker
Forchangingtheoverclockingsettings
Advanced
Forchangingtheadvancedsystemsettings
Monitor
Fordisplayingthesystemtemperature,powerstatus,andchanging
thefansettings.
Chipset
Forchangingthecon gurationofthechipsets.
Boot
Forchangingthesystembootcon guration
Tool
Forcon guringoptionsforspecialfunctions
Exit
Forselectingtheexitoptionsandloadingdefaultsettings
Menu items
Thehighlighteditemonthemenubardisplaysthespeci citemsforthatmenu.Forexample,
selectingMainshowstheMainmenuitems.
Theotheritems(MyFavorites,ExtremeTweaker,Advanced,Monitor,Boot,Tool,andExit)
onthemenubarhavetheirrespectivemenuitems.
Submenu items
Agreaterthansign(>)beforeeachitemonanymenuscreenmeansthattheitemhasa
submenu.Todisplaythesubmenu,selecttheitemandpress<Enter>.
Chapter 3
Language
ThisbuttonabovethemenubarcontainsthelanguagesthatyoucanselectforyourBIOS.
ClickthisbuttontoselectthelanguagethatyouwanttodisplayinyourBIOSscreen.
My Favorites(F3)
ThisbuttonabovethemenubarshowsallBIOSitemsinaTreeMapsetup.SelectfrequentlyusedBIOSsettingsandsaveittoMyFavoritesmenu.
Refertosection3.3 My Favorites formoreinformation.
Q-Fan Control(F6)
Thisbuttonabovethemenubardisplaysthecurrentsettingsofyourfans.Usethisbuttonto
manuallytweakthefanstoyourdesiredsettings.
Refertosection3.2.3 Q-Fan Controlformoreinformation.
3-4
Chapter 3: BIOS Setup
EZ Tuning Wizard(F11)
Thisbuttonabovethemenubarallowsyoutoviewandtweaktheoverclockingsettingsof
yoursystem.Italsoallowsyoutochangethemotherboard sSATAmodefromAHCItoRAID
mode.
Refertosection3.2.4 EZ Tuning Wizardformoreinformation.
Search on FAQ
MoveyourmouseoverthisbuttontoshowaQRcode,scanthisQRcodeonyourmobile
devicetoconnecttotheBIOSFAQwebpageoftheASUSsupportwebsite.Youcanalso
scanthefollowingQRcode:
Hot keys
ThisbuttonabovethemenubarcontainsthenavigationkeysfortheBIOSsetupprogram.
Usethenavigationkeystoselectitemsinthemenuandchangethesettings.
Scroll bar
Chapter 3
Ascrollbarappearsontherightsideofamenuscreenwhenthereareitemsthatdonot t
onthescreen.PresstheUp/Downarrowkeysor<PageUp>/<PageDown>keystodisplay
theotheritemsonthescreen.
General help
Atthebottomofthemenuscreenisabriefdescriptionoftheselecteditem.Use<F12>key
tocapturetheBIOSscreenandsaveittotheremovablestoragedevice.
Configuration fields
These eldsshowthevaluesforthemenuitems.Ifanitemisuser-con gurable,youcan
changethevalueofthe eldoppositetheitem.Youcannotselectanitemthatisnot
user-con gurable.
Acon gurable eldishighlightedwhenselected.Tochangethevalueofa eld,selectitand
press<Enter>todisplayalistofoptions.
Last Modified button
Thisbuttonshowstheitemsthatyoulastmodi edandsavedinBIOSSetup.
ROG ZENITH EXTREME
3-5
3.2.2
EZ Mode
TheEZModeprovidesyouanoverviewofthebasicsysteminformation,andallowsyouto
selectthedisplaylanguage,systemperformance,modeandbootdevicepriority.Toaccess
theAdvancedMode,selectAdvanced Modeorpressthe<F7>hotkey fortheadvanced
BIOSsettings.
ToswitchfromAdvancedModetoEZMode,clickEZ Mode(F7)orpressthe<F7>hotkey.
Displays the system properties of the selected mode.
Click < or > to switch EZ System Tuning modes
Displays the CPU/motherboard temperature,
CPU voltage output, CPU/chassis/power fan
speed, and SATA information
Selects the display language
of the BIOS setup program
Creates storage RAID and
configures system overclocking
Chapter 3
Saves the changes
and resets the system
Displays the CPU Fan’s speed. Click
the button to manually tune the fans
Loads optimized
default settings
Click to go to Advanced mode
Search on the FAQ
Click to display boot devices
Selects the boot device priority
Thebootdeviceoptionsvarydependingonthedevicesyouinstalledtothesystem.
3-6
Chapter 3: BIOS Setup
3.2.3
Q-Fan Control
TheQ-FanControlallowsyoutosetafanpro leormanuallycon guretheoperatingspeed
ofyourCPUandchassisfans.
Click to select a fan to be
configured
Click to activate DC Mode
Click to apply the fan setting
Click to undo the
changes
Click to go back to main menu
Chapter 3
Select a profile to
apply to your fans
Click to activate
PWM Mode
Select to manually configure
your fans
ROG ZENITH EXTREME
3-7
Configuring fans manually
SelectManualfromthelistofpro lestomanuallycon gureyourfans operatingspeed.
Speed points
Select to manually
configure your fans
Tocon gureyourfans:
Chapter 3
3-8
1.
Selectthefanthatyouwanttocon gureandtoviewitscurrentstatus.
2.
Clickanddragthespeedpointstoadjustthefans operatingspeed.
3.
ClickApplytosavethechangesthenclickExit (ESC).
Chapter 3: BIOS Setup
3.2.4
EZ Tuning Wizard
EZTuningWizardallowsyoutoeasilyoverclockyourCPUandDRAM,computerusage,and
CPUfantotheirbestsettings.
OC Setup
OC Tuning
TostartOCTuning:
1.
Press<F11>onyourkeyboardorclick
EZTuningWizardscreen.
2.
ClickOC thenclickNext.
3.
SelectaPCscenarioDaily ComputingorGaming/Media Editing,thenclickNext.
ROG ZENITH EXTREME
Chapter 3
fromtheBIOSscreentoopen
3-9
4.
SelectaMainCoolingSystemBOX cooler, Tower cooler, Water cooler,orI’m not
sure,thenclickNext.
5.
AfterselectingtheMainCoolingSystem,clickNextthenclickYestostarttheOC
Tuning.
Chapter 3
3-10
Chapter 3: BIOS Setup
3.3
My Favorites
MyFavoritesisyourpersonalspacewhereyoucaneasilysaveandaccessyourfavorite
BIOSitems.
ROG ZENITH EXTREME
Chapter 3
MyFavoritescomeswithseveralperformance,powersaving,andfastbootrelateditemsby
default.Youcanpersonalizethisscreenbyaddingorremovingitems.
3-11
Adding items to My Favorites
ToaddBIOSitems:
fromtheBIOSscreentoopen
1.
Press<F3>onyourkeyboardorclick
SetupTreeMapscreen.
2.
OntheSetupTreeMapscreen,selecttheBIOSitemsthatyouwanttosaveinMy
Favoritesscreen.
Main menu panel
Selected shortcut
items
Submenu panel
Delete all favorite
items
Recover to default
favorite items
3.
Selectanitemfrommainmenupanel,thenclickthesubmenuthatyouwanttosaveas
favoritefromthesubmenupanelandclick orpress<Enter>onyourkeyboard.
Chapter 3
YoucannotaddthefollowingitemstoMyFavoriteitems:
3-12
Itemswithsubmenuoptions
User-manageditemssuchaslanguageandbootorder
Con gurationitemssuchasMemorySPDInformation,systemtimeanddate.
4.
ClickExit (ESC)orpress<Esc>keytocloseSetupTreeMapscreen.
5.
GotoMyFavoritesmenutoviewthesavedBIOSitems.
Chapter 3: BIOS Setup
3.4
Main menu
TheMainmenuscreenappearswhenyouentertheAdvancedModeoftheBIOSSetup
program.TheMainmenuprovidesyouanoverviewofthebasicsysteminformation,and
allowsyoutosetthesystemdate,time,language,andsecuritysettings.
Security
TheSecuritymenuitemsallowyoutochangethesystemsecuritysettings.
3.5
IfyouhaveforgottenyourBIOSpassword,erasetheCMOSRealTimeClock(RTC)
RAMtocleartheBIOSpassword.Seesection2.3.1 Rear I/O connectionforthe
locationoftheClearCMOSbuttontoclearRTCRAM.
TheAdministratororUserPassworditemsontopofthescreenshowthedefault[Not
Installed].Afteryousetapassword,theseitemsshow[Installed].
Extreme Tweaker menu
TheExtremeTweakermenuitemsallowyoutocon gureoverclocking-relateditems.
BecautiouswhenchangingthesettingsoftheExtremeTweakermenuitems.Incorrect
eldvaluescancausethesystemtomalfunction
Thecon gurationoptionsforthissectionvarydependingontheCPUandDIMMmodelyou
installedonthemotherboard.
Ai Overclock Tuner
[Auto]
Loadstheoptimalsettingsforthesystem.
[Manual]
Allowsyoutoindividuallysetoverclockingparameters.
[D.O.C.P.]
AllowsyoutoselectaDRAMO.C.pro le,andtherelatedparameterswill
beadjustedautomatically.
Chapter 3
AllowsyoutoselecttheCPUoverclockingoptionstoachievethedesiredCPUinternal
frequency.
ThefollowingitemappearsonlywhenyousettheAi Overclocking Tunerto[Manual].
BCLK Frequency
ThisitemallowsyoutosettheBCLKfrequencytoenhancethesystemperformance.
Usethe<+>or<->toadjustthevalue.
WerecommendyoutosetthevaluebasedontheCPUspeci cation,ashighBCLK
frequenciesmaydamagetheCPUpermanently.
ROG ZENITH EXTREME
3-13
Custom CPU Core Ratio
ThisitemallowsyoutosetacustomCPUcoreratio.TheCPUcoreratioiscalculatedwith
theformula:2*FID/DID.
Con gurationoptions:[Auto][Manual]
ThefollowingitemappearsonlywhenyousettheCustom CPU Core Ratioto[Manual].
FID
Thisitemallowsyoutosetthecorefrequencymultiplier.Usethe<+>or<->toadjust
thevalue.
DID
Thisitemallowsyoutosetthecorefrequencydivisor.Usethe<+>or<->toadjustthe
value.
Memory Frequency
Thisitemallowsyoutosetthememoryoperatingfrequency.Thecon gurableoptionsvary
withtheBCLK(baseclock)frequencysetting.Selecttheautomodetoapplytheoptimized
setting.
Con gurationoptions:[Auto][DDR4-1333MHz]-[DDR4-4000MHz]
3.6
Advanced menu
TheAdvancedmenuitemsallowyoutochangethesettingsfortheCPUandothersystem
devices.
Chapter 3
BecautiouswhenchangingthesettingsoftheAdvancedmenuitems.Incorrect eldvalues
cancausethesystemtomalfunction.
3.6.1
AMD fTPM configuration
TheitemsinthismenushowtheAMDfTPMcon gurationoptions.
TPM Device Selection
ThisitemallowsyoutoselecttheTPMdevice.
[FirmwareTPM] EnablesAMDCPUfTPM.
[DiscreteTPM] DisablesAMDCPUfTPM.
3.6.2
ROG Effects
Theitemsinthismenuallowyoutocon guretheLEDsonyourmotherboard.
Onboard LED
ThisitemallowsyoutoenablealltheonboardLEDs.
Con gurationoptions:[Enabled][Disabled]
3-14
Chapter 3: BIOS Setup
3.6.3
SATA Configuration
WhileenteringSetup,theBIOSautomaticallydetectsthepresenceofSATAdevices.The
SATAPortitemsshowNot PresentifnoSATAdeviceisinstalledtothecorrespondingSATA
port.
SATA Port Enable
ThisitemallowsyoutoenableordisabletheSATADevice.
Con gurationoptions:[Disabled][Enabled]
SATA Mode
ThisitemallowsyoutosettheSATAcon guration.
[AHCI]
Setto[AHCI]whenyouwanttheSATAharddiskdrivestousethe
AHCI(AdvancedHostControllerInterface).TheAHCIallowsthe
onboardstoragedrivertoenableadvancedSerialATAfeaturesthat
increasesstorageperformanceonrandomworkloadsbyallowing
thedrivetointernallyoptimizetheorderofcommands.
[RAID]
Setto[RAID]whenyouwanttocreateaRAIDcon gurationfrom
theSATAharddiskdrives.
SMART Self Test
S.M.A.R.T.(Self-Monitoring,AnalysisandReportingTechnology)isamonitoringsystemthat
showsawarningmessageduringPOST(Power-onSelfTest)whenanerroroccursinthe
harddisks.
Con gurationoptions:[On][Off]
SATA6G_1(Gray) - SATA6G_6(Gray)
Chapter 3
SATA6G_1 - SATA6G_6
ThisitemallowsyoutoenableordisabletheselectedSATAport.
Con gurationoptions:[Disabled][Enabled]
Hot Plug
TheseitemsappearsonlywhentheSATA Mode issetto[AHCI]andallowsyouto
enableordisableSATAHotPlugSupport.
Con gurationoptions:[Disabled][Enabled]
3.6.4
Onboard Devices Configuration
TheitemsinthismenuallowyoutoswitchbetweenPCIeLanesandcon gureonboard
devices.
HD Audio Controller
ThisitemallowsyoutousetheAzaliaHighDe nitionAudioController
Con gurationoptions:[Disabled][Enabled]
ROG ZENITH EXTREME
3-15
CPU PCIE Link Mode
ThisitemallowsyoutosettheM.2/PCIElinkspeed.
Con gurationoptions:[Auto][GEN1][GEN2][GEN3]
SB PCIE Link Mode
ThisitemallowsyoutosettheSouthbridgelinkspeed.
Con gurationoptions:[Auto][GEN1][GEN2][GEN3]
PCIEX8/X4_4 Bandwidth
[X8mode]
ThePCIEX8/X4_4slotwillrunatX8modeforhighperformancewiththe
U.2disabled.
[X4mode]
ThePCIEX8/X4_4slotwillrunatX4modewiththeU.2enabled.
Asmedia USB 3.1 Controller
[Disabled]
Disablesthecontroller.
[Enabled]
EnablestherearUSB3.1controller.
USB Type C Power Switch
[Auto]
ThesystemwillautomaticallydetectyourUSBTypeCdevicesandprovide
suitablepowerifneeded.
[Enabled]
TheUSBTypeCportwillalwaysprovidepowertoyourdevices.
RGB LED lighting
When system is in working state
ThisitemallowsyoutoturntheRGBLEDlightingonoroffwhenthesystemisinthe
workingstate.
Con gurationoptions:[On][Off]
Chapter 3
When system is in sleep, hibernate or soft off states
ThisitemallowsyoutoturntheRGBLEDlightingonoroffwhenthesystemisinthe
sleep,hibernateorsoftoffstates.
Con gurationoptions:[On][Off]
Intel LAN Controller
ThisitemallowsyoutoenableordisabletheIntelLANcontrollers.
Con gurationoptions:[Disabled][Enabled]
Wi-Fi Controller
ThisitemallowsyoutoenableordisabletheWi-Ficontroller.
Con gurationoptions:[Disabled][Enabled]
Bluetooth Controller
ThisitemallowsyoutoenableordisabletheIntelBluetoothcontroller.
Con gurationoptions:[Disabled][Enabled]
3-16
Chapter 3: BIOS Setup
3.6.5
APM Configuration
Theitemsinthismenuallowyoutosetsystemwakeandsleepsettings.
ErP Ready
ThisitemallowsyoutoswitchoffsomepoweratS4+S5orS5togetthesystemreadyfor
ErPrequirement.Whensetto[Enabled],allotherPMEoptionsareswitchedoff.
Con gurationoptions:[Disabled][Enable(S4+S5)][Enable(S5)]
Restore On AC Power Loss
ThisitemallowsyoursystemtogotoONstate,OFFstate,orbothstatesafteranACpower
loss.Whensettingyoursystemto[Last State],itgoestothepreviousstatebeforetheAC
powerloss.
Con gurationoptions:[PowerOn][PowerOff][LastState]
Power On By PCI-E/PCI
ThisitemallowsyoutoenableordisabletheWake-on-LANfunctionoftheonboardLAN
controllerorotherinstalledPCI-ELANcards.
Con gurationoptions:[Disabled][Enabled]
Power On By RTC
ThisitemallowsyoutoenableordisabletheRTC(Real-TimeClock)togenerateawake
eventandcon guretheRTCalarmdate.Whenenabled,youcansetthedays,hours,
minutes,orsecondstoscheduleanRTCalarmdate.
Con gurationoptions:[Disabled][Enabled]
3.6.6
CPU Configuration
Chapter 3
TheitemsinthismenushowtheCPU-relatedinformationthattheBIOSautomatically
detects.
TheitemsinthismenumayvarybasedontheCPUinstalled.
SVM Mode
ThisitemallowsyouenableordisableCPUVirtualization.
Con gurationoptions:[Disabled][Enabled]
Node 0 Information
ThisitemallowsyoutoviewmemoryinformationrelatedtoNode0.
3.6.7
Internal GOP Configuration
TheitemsinthismenuallowyoutoselectthemonitoroutputbyGraphicOutputProtocol.
3.6.8
Network Stack Configuration
TheitemsinthismenuallowyoutoenableordisabletheUEFInetworkstack
ROG ZENITH EXTREME
3-17
3.6.9
HDD/SSD SMART Information
ThismenudisplaystheSMARTinformationoftheconnecteddevices.
NVMExpressdevicesdonotsupportSMARTinformation.
3.6.10
NVMe Configuration
YoumayviewtheNVMecontrollerandDriveinformationifanNVMedeviceisconnected.
3.6.11
USB Configuration
TheitemsinthismenuallowyoutochangetheUSB-relatedfeatures.
The Mass Storage Devices itemshowstheauto-detectedvalues.IfnoUSBdeviceis
detected,theitemshowsNone.
Legacy USB Support
[Enabled]
YoursystemsupportstheUSBdevicesinlegacyoperatingsystems.
[Disabled]
YourUSBdevicescanbeusedforBIOSsetuponlyandcannotbe
recognizedinthebootdeviceslist.
[Auto]
YoursystemautomaticallydetectsthepresenceofUSBdevicesatstartup.
IfanyUSBdevicesaredetected,thelegacyUSBsupportisenabled.
XHCI Hand-off
Chapter 3
[Enabled]
EnablesthesupportforoperatingsystemswithoutanXHCIhand-off
feature.
[Disabled]
DisablestheXHCIHand-offsupport.
EHCI Hand-off
[Enabled]
EnablesthesupportforoperatingsystemswithoutanEHCIhand-off
feature.
[Disabled]
DisablestheEHCIHand-offsupport.
USB Mass Storage Driver Support
ThisitemallowsyoutoenableordisableUSBMassStorageDriverSupport.
Con gurationoptions:[Disabled][Enabled]
U31G2_E1 / U31G2_E2
TheseitemsallowyoutoenableordisabletheindividualUSBports.
Refertosection1.1.2 Motherboard layoutforthelocationoftheUSBports.
3-18
Chapter 3: BIOS Setup
3.7
Monitor menu
TheMonitormenudisplaysthesystemtemperature/powerstatus,andallowsyoutochange
thefansettings.
ScrolldowntodisplaytheotherBIOSitems.
Q-fan Configuration
Qfan Tuning
Clickthisitemtoautomaticallydetectthelowestspeedandcon guretheminimum
dutycycleforeachfan.
W_PUMP+ Control
[Disabled]
DisabletheWaterPumpcontrolfeature.
[Auto]
Detectsthetypeofwaterpumpinstalledandautomaticallyswitches
thecontrolmodes.
[DCmode]
EnabletheWaterPumpcontrolinDCmodefor3-pinchassisfan.
[PWMmode]
EnabletheWaterPumpcontrolinPWMmodefor4-pinchassisfan.
3.8
Chipset menu
TheChipsetmenuallowsyoutocon gurethechipsets.
South Bridge
ThismenuallowsyoutosettheSouthBridgeparameters.
North Bridge
ThismenuallowsyoutosettheNorthBridgeparameters.
Chapter 3
GFX Configurations
ThismenuallowsyoutosetGFXcon gurations.
3.9
Boot menu
TheBootmenuitemsallowyoutochangethesystembootoptions.
Fast Boot
[Disabled]
Allowsyoursystemtogobacktoitsnormalbootspeed.
[Enabled]
Allowsyoursystemtoacceleratethebootspeed.
ThefollowingitemsappearonlywhenyousettheFast Bootto[Enabled].
Next Boot after AC Power Loss
[NormalBoot] ReturnstonormalbootonthenextbootafteranACpowerloss.
[FastBoot]
AcceleratesthebootspeedonthenextbootafteranACpowerloss.
ROG ZENITH EXTREME
3-19
Boot Configuration
Boot Logo Display
[Auto]
[FullScreen]
[Disabled]
SetsthebootlogotodisplayduringPOST.
SetsthebootlogodisplayinfullscreenduringPOST.
DisablesthebootlogodisplayduringPOST.
Setup Mode
[AdvancedMode]
[EZMode]
ThisitemallowsyoutogotoAdvancedModeoftheBIOSafter
POST.
ThisitemallowsyoutogotoEZModeoftheBIOSafterPOST.
CSM (Compatibility Support Module)
Thisitemallowsyoutocon guretheCSM(CompatibilitySupportModule)itemstofully
supportthevariousVGA,bootabledevicesandadd-ondevicesforbettercompatibility.
Launch CSM
[Auto]
Thesystemautomaticallydetectsthebootabledevicesandtheaddondevices.
[Enabled]
Forbettercompatibility,enabletheCSMtofullysupportthenon-UEFI
driveradd-ondevicesortheWindows®UEFImode.
[Disabled]
DisabletheCSMtofullysupportthenon-UEFIdriveradd-ondevices
ortheWindows®UEFImode.
ThefollowingitemsappearonlywhenyousettheLaunch CSM to[Enabled].
Chapter 3
Boot Devices Control
Thisitemallowsyoutoselectthetypeofdevicesthatyouwanttoboot.
Con gurationoptions:[UEFIandLegacyOPROM][LegacyOPROMonly]
[UEFIonly]
Boot from Network Devices
Thisitemallowsyoutoselectthetypeofnetworkdevicesthatyouwantto
launch.
Con gurationoptions:[Ignore][Legacyonly][UEFIdriver rst]
Boot from Storage Devices
Thisitemallowsyoutoselectthetypeofstoragedevicesthatyouwantto
launch.
Con gurationoptions:[Ignore][Legacyonly][UEFIdriver rst]
Boot from PCI-E/PCI Expansion Devices
ThisitemallowsyoutoselectthetypeofPCI-E/PCIexpansiondevicesthat
youwanttolaunch.
Con gurationoptions:[Legacyonly][UEFIdriver rst]
Secure Boot
Thisitemallowsyoutocon guretheWindows® SecureBootsettingsandmanageitskeysto
protectthesystemfromunauthorizedaccessandmalwaresduringPOST.
3-20
Chapter 3: BIOS Setup
Boot Option Priorities
Theseitemsspecifythebootdeviceprioritysequencefromtheavailabledevices.The
numberofdeviceitemsthatappearsonthescreendependsonthenumberofdevices
installedinthesystem.
ToaccessWindows®OSinSafeMode,press<F8>afterPOST(Windows®8not
supported).
Toselectthebootdeviceduringsystemstartup,press<F8>whentheASUSLogo
appears.
Boot Override
Theseitemsdisplaystheavailabledevices.Thenumberofdeviceitemsthatappearson
thescreendependsonthenumberofdevicesinstalledinthesystem.Clickanitemtostart
bootingfromtheselecteddevice.
3.10
Tool menu
TheToolmenuitemsallowyoutocon gureoptionsforspecialfunctions.Selectanitemthen
press<Enter>todisplaythesubmenu.
Setup Animator
ThisitemallowsyoutoenableordisabletheSetupanimator.
Con gurationoptions:[Disabled][Enabled]
3.10.1
ASUS EZ Flash 3 Utility
Chapter 3
ThisitemallowsyoutorunASUSEZFlash3.Whenyoupress<Enter>,acon rmation
messageappears.Usetheleft/rightarrowkeytoselectbetween[Yes]or[No],thenpress
<Enter>tocon rmyourchoice.
Formoredetails,refertosection3.12.2 ASUS EZ Flash 3.
ROG ZENITH EXTREME
3-21
3.10.2
Secure Erase
SSDspeedsmaylowerovertimeaswithanystoragemediumduetodataprocessing.
SecureErasecompletelyandsafelycleansyourSSD,restoringittofactoryperformance
levels.
SecureEraseisonlyavailableinAHCImode.EnsuretosettheSATAmodetoAHCI.Click
Advanced > SATA Configuration > SATA Mode > AHCI.
TolaunchSecureErase,clickTool > Secure Erase ontheAdvancedmodemenu.
SecureEraseisonlysupportedonselectedSATASSDs,andcannoteraseNVMestorage
devices.
ThetimetoerasethecontentsofyourSSDmaytakeawhiledependingonitssize.
Donotturnoffthesystemduringtheprocess.
SecureEraseisonlysupportedonAMD®SATAport.Formoreinformationabout
AMD®SATAports,refertosection1.1.2 Motherboard layoutofthismanual.
Displays the
available SSDs
Chapter 3
Status definition:
3-22
•
Frozen.ThefrozenstateistheresultofaBIOSprotectivemeasure.TheBIOS
guardsdrivesthatdonothavepasswordprotectionbyfreezingthempriortobooting.
Ifthedriveisfrozen,apowerofforhardresetofyourPCmustbeperformedto
proceedwiththeSecureErase.
•
Locked.SSDsmightbelockediftheSecureEraseprocessiseitherincomplete
orwasstopped.Thismaybeduetoathirdpartysoftwarethatusesadifferent
passwordde nedbyASUS.YouhavetounlocktheSSDinthesoftwarebefore
proceedingwithSecureErase.
Chapter 3: BIOS Setup
3.10.3
ASUS Overclocking Profile
ThisitemallowsyoutostoreorloadmultipleBIOSsettings.
Load from Profile
ThisitemallowsyoutoloadthepreviousBIOSsettingssavedintheBIOSFlash.Keyinthe
pro lenumberthatsavedyourBIOSsettings,press<Enter>,andthenselectYes.
DONOTshutdownorresetthesystemwhileupdatingtheBIOStopreventthe
systembootfailure!
WerecommendthatyouupdatetheBIOS leonlycomingfromthesamememory/
CPUcon gurationandBIOSversion.
Profile Name
Thisitemallowsyoutokeyinapro lename.
Save to Profile
ThisitemallowsyoutosavethecurrentBIOSsettingstotheBIOSFlash,andcreatea
pro le.Keyinapro lenumberfromonetoeight,press<Enter>,andthenselectYes.
Load/Save Profile from/to USB Drive
Thisitemallowsyoutoloadorsavepro lefromyourUSBdrive,loadandsavepro letoyour
USBdrive.
3.10.4
ASUS SPD Information
3.10.5
Chapter 3
ThisitemallowsyoutoviewtheDRAMSPDinformation.
Graphics Card Information
Thisitemdisplaystheinformationaboutthegraphicscardinstalledinyoursystem.
GPU Post
Thisitemdisplaystheinformationandrecommendedcon gurationforthePCIEslotsthatthe
graphicscardisinstalledinyoursystem.
ThisfeatureisonlysupportedonselectedASUSgraphicscards.
ROG ZENITH EXTREME
3-23
3.11
Exit menu
TheExitmenuitemsallowyoutoloadtheoptimaldefaultvaluesfortheBIOSitems,and
saveordiscardyourchangestotheBIOSitems.
Load Optimized Defaults
ThisoptionallowsyoutoloadthedefaultvaluesforeachoftheparametersontheSetup
menus.Whenyouselectthisoptionorifyoupress<F5>,acon rmationwindowappears.
SelectOKtoloadthedefaultvalues.
Save Changes & Reset
Onceyouare nishedmakingyourselections,choosethisoptionfromtheExitmenuto
ensurethevaluesyouselectedaresaved.Whenyouselectthisoptionorifyoupress<F10>,
acon rmationwindowappears.SelectOKtosavechangesandexit.
Discard Changes & Exit
ThisoptionallowsyoutoexittheSetupprogramwithoutsavingyourchanges.Whenyou
selectthisoptionorifyoupress<Esc>,acon rmationwindowappears.SelectYesto
discardchangesandexit.
Launch EFI Shell from USB drives
ThisitemallowsyoutoattempttolaunchtheEFIShellapplication(shellx64.e )fromoneof
theavailable lesystemdevices.
Chapter 3
3-24
Chapter 3: BIOS Setup
3.12
Updating BIOS
TheASUSwebsitepublishesthelatestBIOSversionstoprovideenhancementsonsystem
stability,compatibility,andperformance.However,BIOSupdatingispotentiallyrisky.If
thereisnoproblemusingthecurrentversionofBIOS,DONOTmanuallyupdatetheBIOS.
InappropriateBIOSupdatingmayresulttosystem sfailuretoboot.Carefullyfollowthe
instructionsinthischaptertoupdateyourBIOSwhennecessary.
Visithttp://www.asus.comtodownloadthelatestBIOS leforthismotherboard.
ThefollowingutilitiesallowyoutomanageandupdatethemotherboardBIOSsetupprogram.
1.
EZUpdate:UpdatestheBIOSinWindows®environment.
2.
ASUSEZFlash3:UpdatestheBIOSusingaUSB ashdrive.
3.
ASUSCrashFreeBIOS3:RestorestheBIOSusingthemotherboardsupportUSB
drivewhentheBIOS lefailsorgetscorrupted.
3.12.1
EZ Update
TheEZUpdateisautilitythatallowsyoutoupdatethemotherboardBIOSinWindows®
environment.
EZUpdaterequiresanInternetconnectioneitherthroughanetworkoranISP
(InternetServiceProvider).
ThisutilityisavailableinthesupportUSBdrivethatcomeswiththemotherboard
package.
Chapter 3
ROG ZENITH EXTREME
3-25
3.12.2
ASUS EZ Flash 3
ASUSEZFlash3allowsyoutodownloadandupdatetothelatestBIOSthroughtheInternet
withouthavingtouseabootable oppydiskoranOS-basedutility.
UpdatingthroughtheInternetvariesperregionandInternetconditions.Checkyourlocal
InternetconnectionbeforeupdatingthroughtheInternet.
To update the BIOS by USB:
Chapter 3
3-26
1.
EntertheAdvancedModeoftheBIOSsetupprogram.GototheToolmenutoselect
ASUS EZ Flash 3 Utilityandpress<Enter>.
2.
InserttheUSB ashdiskthatcontainsthelatestBIOS letotheUSBport.
3.
Selectvia Storage Device(s).
4.
Press<Tab>toswitchtotheDrive eld.
5.
PresstheUp/Downarrowkeysto ndtheUSB ashdiskthatcontainsthelatestBIOS,
andthenpress<Enter>.
6.
Press<Tab>toswitchtotheFolderInfo eld.
7.
PresstheUp/Downarrowkeysto ndtheBIOS le,andthenpress<Enter>toperform
theBIOSupdateprocess.Rebootthesystemwhentheupdateprocessisdone.
Chapter 3: BIOS Setup
ThisfunctioncansupportdevicessuchasaUSB ashdiskwithFAT32/16formatand
singlepartitiononly.
DONOTshutdownorresetthesystemwhileupdatingtheBIOStopreventsystem
bootfailure!
EnsuretoloadtheBIOSdefaultsettingstoensuresystemcompatibilityandstability.Select
theLoadOptimizedDefaultsitemundertheExitmenu.Seesection3.11 Exit Menufor
details.
1.
EntertheAdvancedModeoftheBIOSsetupprogram.GototheToolmenutoselect
ASUS EZ Flash 3 Utilityandpress<Enter>.
2.
Selectvia Internet.
3.
PresstheLeft/RightarrowkeystoselectanInternetconnectionmethod,andthen
press<Enter>.
4.
Followtheonscreeninstructionstocompletetheupdate.
5.
Rebootthesystemwhentheupdateprocessisdone.
Chapter 3
To update the BIOS by Internet:
EnsuretoloadtheBIOSdefaultsettingstoensuresystemcompatibilityandstability.Select
theLoadOptimizedDefaultsitemundertheExitmenu.Seesection3.11 Exit Menufor
details.
ROG ZENITH EXTREME
3-27
3.12.3
ASUS CrashFree BIOS 3
TheASUSCrashFreeBIOS3utilityisanautorecoverytoolthatallowsyoutorestorethe
BIOS lewhenitfailsorgetscorruptedduringtheupdatingprocess.Youcanrestorea
corruptedBIOS leusingthemotherboardsupportUSBdrivethatcontainstheBIOS le.
TheBIOS leinthemotherboardsupportUSBdrivemaybeolderthantheBIOS le
publishedontheASUSof cialwebsite.IfyouwanttousethenewerBIOS le,download
the leathttps://www.asus.com/support/andsaveittoaUSB ashdrive.
Recovering the BIOS
To recover the BIOS:
1.
Turnonthesystem.
2.
InsertthemotherboardsupportUSBdrive,ortheUSB ashdrivecontainingtheBIOS
letotheUSBport.
3.
TheutilityautomaticallychecksthedevicesfortheBIOS le.Whenfound,theutility
readstheBIOS leandentersASUSEZFlash3automatically.
4.
ThesystemrequiresyoutoenterBIOSSetuptorecovertheBIOSsetting.Toensure
systemcompatibilityandstability,werecommendthatyoupress<F5>toloaddefault
BIOSvalues.
DONOTshutdownorresetthesystemwhileupdatingtheBIOS!Doingsocancause
systembootfailure!
Chapter 3
3-28
Chapter 3: BIOS Setup
Chapter 4:
RAID Support
RAID Support
4.1
RAID configurations
4
The motherboard supports RAID 0, RAID 1, and RAID 10 solution.
If you want to install a Windows® operating system to a hard disk drive included in a RAID
set, you have to create a RAID driver disk and load the RAID driver during OS installation.
Refer to section 4.2 Creating a RAID driver disk for details.
4.1.1
RAID definitions
RAID 0 (Data striping) optimizes two identical hard disk drives to read and write data in
parallel, interleaved stacks. Two hard disks perform the same work as a single drive but at a
sustained data transfer rate, double that of a single disk alone, thus improving data access
and storage. Use of two new identical hard disk drives is required for this setup.
RAID 1 (Data mirroring) copies and maintains an identical image of data from one drive to
a second drive. If one drive fails, the disk array management software directs all applications
to the surviving drive as it contains a complete copy of the data in the other drive. This RAID
con gurationprovidesdataprotectionandincreasesfaulttolerancetotheentiresystem.Use
two new drives or use an existing drive and a new drive for this setup. The new drive must be
of the same size or larger than the existing drive.
Chapter 4
RAID 10 is data striping and data mirroring combined without parity (redundancy data) having
tobecalculatedandwritten.WiththeRAID10con gurationyougetallthebene tsofboth
RAID0andRAID1con gurations.Usefournewharddiskdrivesoruseanexistingdrive
and three new drives for this setup.
ROG ZENITH EXTREME
4-1
4.1.2
Installing Serial ATA hard disks
The motherboard supports Serial ATA hard disk drives. For optimal performance, install
identical drives of the same model and capacity when creating a disk array.
To install the SATA hard disks for a RAID configuration:
1.
Install the SATA hard disks into the drive bays.
2.
Connect the SATA signal cables.
3.
Connect a SATA power cable to the power connector on each drive.
4.2
Creating a RAID driver disk
4.2.1
Creating a RAID driver disk in Windows®
To install the RAID driver for Windows® OS:
1.
During the OS installation, click Load Driver to allow you to select the installation
media containing the RAID driver.
2.
Insert the support USB drive with RAID driver into the USB port, and then click
Browse.
3.
Click the name of the device you’ve inserted, go to Drivers > RAID, and then select
the RAID driver for the corresponding OS version. Click OK.
4.
Follow the succeeding screen instructions to complete the installation.
To set up a Windows® UEFI operating system under RAID mode, ensure to load the UEFI
driver for your optical drive.
Chapter 4
4-2
Chapter 4: RAID Support
Appendix
Appendix
Appendix
Notices
Federal Communications Commission Statement
This device complies with Part 15 of the FCC Rules. Operation is subject to the following two
conditions:
This device may not cause harmful interference.
This device must accept any interference received including interference that may cause
undesired operation.
This equipment has been tested and found to comply with the limits for a Class B digital
device, pursuant to Part 15 of the FCC Rules. These limits are designed to provide
reasonable protection against harmful interference in a residential installation. This
equipment generates, uses and can radiate radio frequency energy and, if not installed
and used in accordance with manufacturer’s instructions, may cause harmful interference
to radio communications. However, there is no guarantee that interference will not occur
in a particular installation. If this equipment does cause harmful interference to radio or
television reception, which can be determined by turning the equipment off and on, the user
is encouraged to try to correct the interference by one or more of the following measures:
Reorient or relocate the receiving antenna.
Increase the separation between the equipment and receiver.
Connect the equipment to an outlet on a circuit different from that to which the receiver
is connected.
Consult the dealer or an experienced radio/TV technician for help.
The use of shielded cables for connection of the monitor to the graphics card is required
toassurecompliancewithFCCregulations.Changesormodi cationstothisunitnot
expressly approved by the party responsible for compliance could void the user’s authority
to operate this equipment.
ROG ZENITH EXTREME
A-1
Compliance Statement of Innovation, Science and Economic
Development Canada (ISED)
Appendix
This Class B digital apparatus complies with Canadian ICES-003, RSS-210, and CAN ICES3(B)/NMB-3(B).
This device complies with Industry Canada license exempt RSS standard(s). Operation is
subject to the following two conditions: (1) this device may not cause interference, and (2)
this device must accept any interference, including interference that may cause undesired
operation of the device.
Déclaration de conformité de Innovation, Sciences et
Développement économique Canada (ISED)
Cet appareil numérique de classe B est conforme aux normes canadiennes ICES-003, RSS210 et CAN ICES-3(B)/NMB-3(B).
Cet appareil est conforme aux normes CNR exemptes de licence d’Industrie Canada. Le
fonctionnement est soumis aux deux conditions suivantes : (1) cet appareil ne doit pas
provoquer d’interférences et (2) cet appareil doit accepter toute interférence, y compris celles
susceptibles de provoquer un fonctionnement non souhaité de l’appareil.
VCCI: Japan Compliance Statement
Class B ITE
KC: Korea Warning Statement
A-2
Appendix
REACH
Appendix
Complying with the REACH (Registration, Evaluation, Authorisation, and Restriction of
Chemicals) regulatory framework, we published the chemical substances in our products at
ASUS REACH website at http://csr.asus.com/english/REACH.htm.
DO NOT throw the motherboard in municipal waste. This product has been designed to
enable proper reuse of parts and recycling. This symbol of the crossed out wheeled bin
indicates that the product (electrical and electronic equipment) should not be placed in
municipal waste. Check local regulations for disposal of electronic products.
DO NOT throw the mercury-containing button cell battery in municipal waste. This symbol
of the crossed out wheeled bin indicates that the battery should not be placed in municipal
waste.
ASUS Recycling/Takeback Services
ASUS recycling and takeback programs come from our commitment to the highest standards
for protecting our environment. We believe in providing solutions for you to be able to
responsibly recycle our products, batteries, other components as well as the packaging
materials. Please go to http://csr.asus.com/english/Takeback.htm for detailed recycling
information in different regions.
Regional notice for California
WARNING
Cancer and Reproductive Harm www.P65Warnings.ca.gov
RF exposure warning
This equipment must be installed and operated in accordance with provided instructions and
the antenna(s) used for this transmitter must be installed to provide a separation distance of
at least 20 cm from all persons and must not be co-located or operating in conjunction with
any other antenna or transmitter. End-users and installers must be provided with antenna
installation instructions and transmitter operating conditions for satisfying RF exposure
compliance.
ROG ZENITH EXTREME
A-3
FCC Bluetooth Wireless Compliance
The antenna used with this transmitter must not be co-located or operated in conjunction with
any other antenna or transmitter subject to the conditions of the FCC Grant.
Appendix
Bluetooth Industry Canada Statement
This Class B device meets all requirements of the Canadian interference-causing equipment
regulations.
Cet appareil numérique de la Class B respecte toutes les exigences du Règlement sur le
matériel brouilleur du Canada.
NCC: Taiwan Wireless Statement
Japan RF Equipment Statement
5GHz
5.2GHz 5.3GHz
Google™ License Terms
Copyright© 2017 Google Inc. All Rights Reserved.
LicensedundertheApacheLicense,Version2.0(the License );youmaynotusethis le
except in compliance with the License. You may obtain a copy of the License at:
http://www.apache.org/licenses/LICENSE-2.0
Unless required by applicable law or agreed to in writing, software distributed under the
License is distributed on an “AS IS” BASIS, WITHOUT WARRANTIES OR CONDITIONS OF
ANY KIND, either express or implied.
SeetheLicenseforthespeci clanguagegoverningpermissionsandlimitationsunderthe
License.
A-4
Appendix
ASUSTek Computer Inc.
https://www.asus.com/support/
WiFi
WiGig
,
5150-5350
,
57-66
,
2014/53/EU.
:
:
ASUSTek Computer
.2014/53/EU
https://www.asus.com/support/ :
5150-5350
WiFi
.
,
57-66
,WiGig
:
Опростена декларация за съответствие на ЕС
С настоящото ASUSTek Computer Inc. декларира, че това устройство е
в съответствие със съществените изисквания и другите приложими
постановления на свързаната Директива 2014/53/EC. Пълният текст на ЕС
декларация за съвместимост е достъпен на адрес
https://www.asus.com/support/
WiFi, работеща в диапазон 5150-5350MHz, трябва да се ограничи до
употреба на закрито за страните, посочени в таблицата по-долу:
WiGig работещ на честота 57-66GHz, трябва да не се доближава до
постоянни инсталации на открито за държави, включени в таблицата
по-долу.
Declaração de Conformidade UE Simpliicada
ASUSTek Computer Inc. declara que este dispositivo está em conformidade
com os requisitos essenciais e outras disposições relevantes relacionadas às
diretivas 2014/53/UE. O texto completo da declaração de conformidade CE
está disponível em https://www.asus.com/support/
O WiFi operando na banda 5150-5350MHz deve ser restrito para uso interno
para os países listados na tabela abaixo:
A operação do WiGig na banda de 57-66GHz deve ser restrita de instalações
ixas externas para países listados na tabela abaixo:
ROG ZENITH EXTREME
Pojednostavljena EU Izjava o sukladnosti
ASUSTeK Computer Inc. ovim izjavljuje da je ovaj uređaj sukladan s bitnim
zahtjevima i ostalim odgovarajućim odredbama direktive 2014/53/EU. Cijeli
tekst EU izjave o sukladnosti dostupan je na https://www.asus.com/support/
WiFi koji radi na opsegu frekvencija 5150-5350 MHz bit će ograničen na
upotrebu u zatvorenom prostoru u zemljama na donjem popisu:
WiGig koji radi na opsegu frekvencija 57-66 GHz bit će zabranjen za upotrebu
u iksnim vanjskim instalacijama u zemljama o donjoj tablici:
Zjednodušené prohlášení o shodě EU
Společnost ASUSTek Computer Inc. tímto prohlašuje, že toto zařízení splňuje
základní požadavky a další příslušná ustanovení směrnice 2014/53/ EU. Plné
znění prohlášení o shodě EU je k dispozici na adrese
https://www.asus.com/support/
V zemích uvedených v tabulce je provoz sítě Wi-Fi ve frekvenčním rozsahu 5
150 - 5 350 MHz povolen pouze ve vnitřních prostorech:
V zemích uvedených v tabulce níže je provoz sítě WiGig v pásmu 57 - 66 GHz
zakázán pro pevné venkovní instalace:
Forenklet EU-overensstemmelseserklæring
ASUSTeK Computer Inc. erklærer hermed at denne enhed er i
overensstemmelse med hovedkravene og øvrige relevante bestemmelser i
direktivet 2014/53/EU. Hele EU-overensstemmelseserklæringen kan indes på
https://www.asus.com/support/
Wi-Fi, der bruger 5150-5350 MHz skal begrænses til indendørs brug i lande,
der er anført i tabellen:
WiGig-enheden, der burger båndbredden 57-66 GHz på ikke bruges i
fastspændte udendørsinstallationer i landene, der er anført på listen nedenfor:
Vereenvoudigd EU-conformiteitsverklaring
ASUSTeK Computer Inc. verklaart hierbij dat dit apparaat voldoet aan de
essentiële vereisten en andere relevante bepalingen van Richtlijn 2014/53/EU.
De volledige tekst van de EU-conformiteitsverklaring is beschikbaar op
https://www.asus.com/support/
De WiFi op 5150-5350MHz zal beperkt zijn tot binnengebruik voor in de tabel
vermelde landen:
De WiGig die werkt in de band 57-66GHz moet worden uitgesloten van vaste
installaties buitenshuis voor landen die in de onderstaande tabel zijn vermeld:
Lihtsustatud EÜ vastavusdeklaratsioon
Käesolevaga kinnitab ASUSTek Computer Inc, et seade vastab direktiivi
2014/53/EÜ olulistele nõuetele ja teistele asjakohastele sätetele. EL
vastavusdeklaratsiooni täistekst on saadaval veebisaidil
https://www.asus.com/support/
Sagedusvahemikus 5150-5350 MHz töötava WiFi kasutamine on järgmistes
riikides lubatud ainult siseruumides:
WiGig-i kasutamine sagedusribal 57–66 GHz on keelatud paiksetel
välisseadmetel riikides, mis on loetletud allolevas tabelis:
Eurooppa - EY:n vaatimustenmukaisuusvakuutus
ASUSTek Computer Inc. ilmoittaa täten, että tämä laite on direktiivin 2014/53/
EU olennaisten vaatimusten ja muiden asiaankuuluvien lisäysten mukainen.
Koko EY:n vaatimustenmukaisuusvakuutuksen teksti on luettavissa osoitteessa
https://www.asus.com/support/
5 150 - 5 350 MHz:in taajuudella toimiva WiFi on rajoitettu sisäkäyttöön
taulukossa luetelluissa maissa:
WiGig-käyttö 57 - 66 GHz:in taajuuskaistalla tulee rajoittaa kiinteisiin
ulkoasennuksiin alla olevassa taulukossa luetelluissa maissa:
Appendix
Simpliied EU Declaration of Conformity
ASUSTek Computer Inc. hereby declares that this device is in compliance
with the essential requirements and other relevant provisions of Directive
2014/53/EU. Full text of EU declaration of conformity is available at
https://www.asus.com/support/
The WiFi operating in the band 5150-5350MHz shall be restricted to indoor
use for countries listed in the table below:
The WiGig operating in the band 57-66GHz shall be restricted from ixed
outdoor installations for countries listed in the table below:
Déclaration simpliiée de conformité de l’UE
ASUSTek Computer Inc. déclare par la présente que cet appareil est conforme
aux critères essentiels et autres clauses pertinentes de la directive 2014/53/
EU. La déclaration de conformité de l’UE peut être téléchargée à partir du site
internet suivant : https://www.asus.com/support/
Dans la plage de fréquence 5150-5350 MHz, le Wi-Fi est restreint à une
utilisation en intérieur dans les pays listés dans le tableau ci-dessous:
Dans la plage de fréquence 57-66 GHz, le WiGig est restreint aux installations
en extérieur dans les pays listés dans le tableau ci-dessous:
Vereinfachte EU-Konformitätserklärung
ASUSTek COMPUTER INC erklärt hiermit, dass dieses Gerät mit den
grundlegenden Anforderungen und anderen relevanten Bestimmungen
der Richtlinie 2014/53/EU übereinstimmt. Der gesamte Text der EUKonformitätserklärung ist verfügbar unter: https://www.asus.com/support/
Der WLAN-Betrieb im Band von 5150-5350 MHz ist für die in der unteren
Tabelle aufgeführten Länder auf den Innenbereich beschränkt:
Der WiGig-Betrieb im Band von 57-66 GHz ist für die in der unteren Tabelle
aufgeführten Länder bei festen Installationen im Außenbereich untersagt:
Dichiarazione di conformità UE sempliicata
ASUSTek Computer Inc. con la presente dichiara che questo dispositivo è
conforme ai requisiti essenziali e alle altre disposizioni pertinenti con la
direttiva 2014/53/EU. Il testo completo della dichiarazione di conformità UE è
disponibile all’indirizzo: https://www.asus.com/support/
L’utilizzo della rete Wi-Fi con frequenza compresa nell’intervallo 51505350MHz deve essere limitato all’interno degli ediici per i paesi presenti
nella seguente tabella:
L’utilizzo della rete WiGig operante nella banda di frequenza 57-66GHz deve
essere limitato alle installazioni isse all’esterno degli ediici per i paesi nella
seguente tabella:
ASUSTek Computer Inc
.2014/53/EU
:
.https://www.asus.com/support/
.
.
WiFi
5150-5350
66 57
WiGig
.
Απλοποιημένη Δήλωση Συμμόρφωσης ΕΕ
Διά του παρόντος η ASUSTek Computer Inc. δηλώνει ότι αυτή η συσκευή
είναι σύμμορφη με τις βασικές προϋποθέσεις και άλλες σχετικές διατάξεις της
Οδηγίας 2014/53/ΕE. Το πλήρες κείμενο της δήλωσης συμμόρφωσης της ΕΕ
είναι διαθέσιμο στη διεύθυνση https://www.asus.com/support/
Το WiFi που λειτουργεί στη ζώνη 5150-5350MHz περιορίζεται για χρήση σε
εσωτερικούς χώρους για τις χώρες που αναφέρονται στον παρακάτω πίνακα:
Το WiGig που λειτουργεί στη ζώνη 57-66GHz δεν πρέπει να χρησιμοποιείται
σε σταθερές υπαίθριες εγκαταστάσεις στις χώρες που απαριθμούνται στον
παρακάτω πίνακα:
A-5
:
Appendix
5150-5350MHz
:
.2014/53/EU
ASUSTek Computer Inc.
https://www.asus.com/support/
Wi-Fi
57-66GHz
WiGig :
Egyszerűsített EU megfelelőségi nyilatkozat
Az ASUSTek Computer Inc. ezennel kijelenti, hogy ez az eszköz megfelel az
2014/53/EU sz. irányelv alapvető követelményeinek és egyéb vonatkozó
rendelkezéseinek. Az EU megfelelőségi nyilatkozat teljes szövegét a következő
weboldalon tekintheti meg: https://www.asus.com/support/
Az 5150-5350 MHz-es sávban működő Wi-Fi-t beltéri használatra kell
korlátozni az alábbi táblázatban felsorolt országokban:
Az 57-66 GHz-es sávban működő WiGig-et korlátozni kell a rögzített kültéri
üzembehelyezést illetően az alábbi táblázatban lévő országokban:
Pernyataan Kesesuaian UE yang Disederhanakan
ASUSTeK Computer Inc. dengan ini menyatakan bahwa perangkat ini
memenuhi persyaratan utama dan ketentuan relevan lainnya yang terdapat
pada Petunjuk 2014/53/EU. Teks lengkap pernyataan kesesuaian EU tersedia di:
https://www.asus.com/support/
WiFi yang Beroperasi pada 5150-5350 MHz akan terbatas untuk penggunaan
dalam ruangan di negara yang tercantum dalam tabel
Pengoperasian WiGig pada pita 57-66GHz akan dibatasi dari pemasangan luar
ruangan tetap untuk negara yang tercantum dalam tabel di bawah ini:
Vienkāršota ES atbilstības paziņojums
ASUSTeK Computer Inc. ar šo paziņo, ka šī ierīce atbilst Direktīvas
2014/53/ES būtiskajām prasībām un citiem citiem saistošajiem nosacījumiem.
Pilns ES atbilstības paziņojuma teksts pieejams šeit:
https://www.asus.com/support/
Wi-Fi darbība 5150–5350 MHz ir jāierobežo lietošanai telpās valstīs, kuras
norādītas tālāk.
WiGig, kas darbojas 57-66 GHz joslā, nav atļauts pastāvīgi uzstādīt ārpus
telpām valstīs, kas norādītas nākamajā tabulā.
Supaprastinta ES atitikties deklaracija
Šiame dokumente bendrovė „ASUSTek Computer Inc.“ pareiškia, kad šis
prietaisas atitinka pagrindinius reikalavimus ir kitas susijusias Direktyvos
2014/53/ES nuostatas. Visas ES atitikties deklaracijos tekstas pateikiamas čia:
https://www.asus.com/support/
Toliau nurodytose šalyse „WiFi“ ryšiu, veikiančiu 5 150–5 350 MHz dažnio
juostoje, galima naudotis tik patalpose:
Toliau lentelėje nurodytose šalyse yra ribojamas 57–66 GHz dažnių juostoje
veikiančių „WiGig“ iksuotas įrengimas lauke:
Forenklet EU-samsvarserklæring
ASUSTek Computer Inc. erklærer herved at denne enheten er i samsvar med
hovedsaklige krav og andre relevante forskrifter i direktivet 2014/53/EU.
Fullstendig tekst for EU-samsvarserklæringen innes på:
https://www.asus.com/support/
Wi-Fi-området 5150–5350 MHz skal begrenses til innendørs bruk for landene
som er oppført i tabellen:
Bruk i Wi-Gig-båndet 57–66 GHz skal begrenses til fast utendørs installasjon i
landene som er oppført i følgende tabell:
Uproszczona deklaracja zgodności UE
Firma ASUSTek Computer Inc. niniejszym oświadcza, że urządzenie to jest
zgodne z zasadniczymi wymogami i innymi właściwymi postanowieniami
dyrektywy 2014/53/EU. Pełny tekst deklaracji zgodności UE jest dostępny pod
adresem https://www.asus.com/support/
W krajach wymienionych w tabeli działanie sieci Wi-Fi w paśmie 5150–
5350 MHz powinno być ograniczone wyłącznie do pomieszczeń:
WiGig-enheden, der burger båndbredden 57-66 GHz på ikke bruges i
fastspændte udendørsinstallationer i landene, der er anført på listen
nedenfor:
Declaração de Conformidade Simpliicada da UE
A ASUSTek Computer Inc. declara que este dispositivo está em conformidade
com os requisitos essenciais e outras disposições relevantes da Diretiva
2014/53/UE. O texto integral da declaração de conformidade da UE está
disponível em https://www.asus.com/support/
A utilização das frequências WiFi de 5150 a 5350MHz está restrita a
ambientes interiores nos países apresentados na tabela:
A utilização do WiGig na banda de 57 a 66GHz está restrita a ambientes
interiores nos países apresentados na tabela seguinte:
A-6
Declarație de conformitate UE, versiune simpliicată
Prin prezenta, ASUSTek Computer Inc. declară că acest dispozitiv este în
conformitate cu reglementările esențiale și cu celelalte prevederi relevante
ale Directivei 2014/53/UE. Textul complet al declarației de conformitate UE
este disponibil la adresa https://www.asus.com/support/
Pentru ţările listate în tabelul de mai jos, reţelele WiFi care funcţionează în
banda de frecvenţă de 5.150-5.350 MHz trebuie utilizate doar în interior:
Funcţionarea dispozitivului WiGig în banda de 57 – 66 GHz va i restricţionată
pentru instalaţiile ixe exteriore în ţările din tabelul de mai jos:
Pojednostavljena Deklaracija o usaglašenosti EU
ASUSTek Computer Inc. ovim izjavljuje da je ovaj uređaj usaglašen sa
osnovnim zahtevima i drugim relevantnim odredbama Direktive 2014/53/EU.
Ceo tekst Deklaracije o usaglašenosti EU dostupan je na lokaciji
https://www.asus.com/support/
WiFi koji radi u frekventnom opsegu od 5150 MHz do 5350 MHz ograničen
je isključivo na upotrebu u zatvorenom prostoru za zemlje navedene u
tabeli ispod:
WiGig koji radi u opsegu od 57-66GHz biće ograničen od iksiranih spoljašnjih
instalacija za države navedene u tabeli ispod:
Zjednodušené vyhlásenie o zhode platné pre EÚ
Spoločnosť ASUSTek Computer Inc. týmto vyhlasuje, že toto zariadenie je
v súlade so základnými požiadavkami a ďalšími príslušnými ustanoveniami
smernice č. 2014/53/EÚ. Plné znenie vyhlásenia o zhode pre EÚ je k dispozícii
na lokalite https://www.asus.com/support/
Činnosť WiFi v pásme 5150 - 5350 MHz bude obmedzená na použitie vo
vnútornom prostredí pre krajiny uvedené v tabuľke nižšie:
WiGig, ktorý sa v krajinách uvedených v tabuľke nižšie, prevádzkuje v pásme
57 až 66 GHz, musí byť umiestnený ďalej od pevných vonkajších zariadení.
Poenostavljena izjava EU o skladnosti
ASUSTek Computer Inc. tukaj izjavlja, da je ta naprava skladna s temeljnimi
zahtevami in drugimi relevantnimii določili Direktive 2014/53/EU. Polno
besedilo izjave EU o skladnosti je na voljo na https://www.asus.com/support/
WiFi, ki deluje v pasovnem območju 5150–5350 MHz, mora biti v državah,
navedenih v spodnjem seznamu, omejen na notranjo uporabo:
V državah, ki so navedene v spodnji tabeli, naprave WiGig, ki deluje v 57–66
GHz pasu, ne smete uporabljati kot iksne namestitve na prostem:
Declaración de conformidad simpliicada para la UE
Por la presente, ASUSTek Computer Inc. declara que este dispositivo cumple
los requisitos básicos y otras disposiciones pertinentes de la directiva
2014/53/EU. En https://www.asus.com/support/ está disponible el texto
completo de la declaración de conformidad para la UE.
La conexión WiFi con una frecuencia de funcionamiento de 5150-5350 MHz
se restringirá al uso en interiores para los países enumerados en la tabla:
El funcionamiento de WiGig en la banda de 57-66 GHz se restringirá al uso en
interiores para los países enumerados en la tabla siguiente:
Förenklad EU-försäkran om överensstämmelse
ASUSTek Computer Inc. deklarerar härmed att denna enhet överensstämmer
med de grundläggande kraven och andra relevanta bestämmelser i direktiv
2014/53/EU. Fullständig text av EU-försäkran om överensstämmelse inns på
https://www.asus.com/support/
WiFi som använder 5150-5350 MHz kommer att begränsas för användning
inomhus i de länder som anges i tabellen:
WiGig som används på frekvensbanden 57-66 GHz ska begränsas från fasta
installationer utomhus i länder som inns upptagna i nedanstående tabell:
ASUSTek Computer Inc.
2014/53/EU
https://www.asus.com/support/
WiFi 5150-5350MHz
WiGig
EU
57-66GHz
:
Basitleştirilmiş AB Uyumluluk Bildirimi
ASUSTek Computer Inc., bu aygıtın 2014/53/EU Yönergesinin temel
gereksinimlerine ve diğer ilgili hükümlerine uygun olduğunu bildirir. AB
uygunluk bildiriminin tam metni şu adreste bulunabilir:
https://www.asus.com/support/
5150-5350 MHz arasındaki WiFi çalışması, tabloda listelenen ülkeler için iç
mekân kullanımıyla kısıtlanacaktır.
57-66 GHz bandında çalışan WiGig, aşağıdaki tabloda listelenen ülkelerde
sabit dış mekân kurulumlarından hariç tutulacaktır:
Appendix
AT
BE
BG
CZ
DK
EE
FR
DE
IS
IE
IT
EL
ES
CY
LV
LI
LT
LU
HU
MT
NL
NO
PL
PT
RO
SI
SK
TR
FI
SE
CH
UK
HR
Appendix
Спрощена декларація про відповідність нормам ЄС
ASUSTek Computer Inc. заявляє, що цей пристрій відповідає основним
вимогам та іншим відповідним вимогам Директиви 2014 / 53 / EU.
Повний текст декларації відповідності нормам ЄС доступний на
https://www.asus.com/support/
Робота Wi-Fi на частоті 5150-5350 МГц обмежується використанням у
приміщенні для країн, поданих у таблиці нижче:
Робота WiGig на частоті 57-66 ГГц обмежується фіксованою
інсталяцією просто неба для країн, поданих у таблиці нижче.
QCA9008-TBD1 output power table:
Function
WiFi
Frequency
Maximum Output Power
(EIRP)
2412-2472 MHz
18 dBm
5150-5350 MHz
21 dBm
5470-5725 MHz
19 dBm
WiGig
58.32-62.64 GHz
27 dBm
Bluetooth
2402-2480 MHz
8 dBm
ROG ZENITH EXTREME
A-7
ASUS contact information
ASUSTeK COMPUTER INC.
Appendix
Address
Telephone
Fax
Web site
4F, No. 150, Li-Te Road, Peitou, Taipei 112, Taiwan
+886-2-2894-3447
+886-2-2890-7798
www.asus.com
Technical Support
Telephone
Fax
Online support
+86-21-38429911
+86-21-5866-8722, ext. 9101#
http://qr.asus.com/techserv
ASUS COMPUTER INTERNATIONAL (America)
Address
Telephone
Fax
Web site
800 Corporate Way, Fremont, CA 94539, USA
+1-510-739-3777
+1-510-608-4555
http://www.asus.com/us/
Technical Support
Support fax
Telephone
Online support
+1-812-284-0883
+1-812-282-2787
http://qr.asus.com/techserv
ASUS COMPUTER GmbH (Germany and Austria)
Address
Fax
Web site
Online contact
Harkort Str. 21-23, 40880 Ratingen, Germany
+49-2102-959931
http://www.asus.com/de
http://eu-rma.asus.com/sales
Technical Support
Telephone
Support Fax
Online support
A-8
+49-2102-5789555
+49-2102-959911
http://qr.asus.com/techserv
Appendix
DECLARATION OF CONFORMITY
Appendix
Per FCC Part 2 Section 2. 1077(a)
Asus Computer International
Responsible Party Name:
800 Corporate Way, Fremont, CA 94539.
Address:
Phone/Fax No:
(510)739-3777/(510)608-4555
hereby declares that the product
Product Name : Motherboard
Model Number : ROG ZENITH EXTREME
Conforms to the following specifications:
FCC Part 15, Subpart B, Unintentional Radiators
Supplementary Information:
This device complies with part 15 of the FCC Rules. Operation is subject to the
following two conditions: (1) This device may not cause harmful interference,
and (2) this device must accept any interference received, including interference
that may cause undesired operation.
Representative Person’s Name :
Steve Chang / President
Signature :
Date :
Jul. 10, 2017
Ver. 170324
ROG ZENITH EXTREME
A-9
Appendix
A-10
Appendix
Download PDF
Similar pages
ASUS P4R800-VM User's Manual
ASUS MAXIMUS_IV_EXTREMEZ Owner's Manual
MS-N051
P4BGL-MX Inserts.P65
Specifications
Windows 7 * 64-bit-Logo Verifizierungsbericht
BIOS Setup
CAUTION! Restore Notes