Sony | DVP-NC615 | Sony DVP-NC615 Instrucciones de funcionamiento

3-074-252-31(2)
Reproductor de
Videodiscos
Digitales y
Discos
Compactos
Manual de instrucciones
IMPORTANTE
POR FAVOR LEA DETALLADAMENTE ESTE MANUAL
DE INSTRUCCIONES ANTES DE CONECTAR Y OPERAR
ESTE EQUIPO.
DVP-NC615
© 2002 Sony Corporation
ADVERTENCIA
¡Bienvenido!
1RPEUHGHOSURGXFWR5HSURGXFWRU
GH&''9'
0RGHOR'931&
*UDFLDVSRUDGTXLULUHOUHSURGXFWRU
&''9'GH6RQ\$QWHVGH
XWLOL]DUHVWHUHSURGXFWRUOHDHVWH
PDQXDODWHQWDPHQWH\FRQVpUYHOR
SDUDFRQVXOWDUORHQHOIXWXUR
3DUDHYLWDUHOULHVJRGH
LQFHQGLRVRHOHFWURFXFLyQQR
H[SRQJDODXQLGDGDODOOXYLD
QLDODKXPHGDG
3DUDHYLWDUGHVFDUJDV
HOpFWULFDVQRDEUDHODSDUDWR
6ROLFLWHDVLVWHQFLDWpFQLFD
~QLFDPHQWHDSHUVRQDO
HVSHFLDOL]DGR
35(&$8&,¾1
(OXVRGHLQVWUXPHQWRVySWLFRVFRQ
HVWHSURGXFWRDXPHQWDHOULHVJRGH
GDxRVRFXODUHV3XHVWRTXHHOKD]
OiVHUXWLOL]DGRHQHVWHUHSURGXFWRU
GH&''9'HVSHUMXGLFLDOSDUDORV
RMRVQRLQWHQWHGHVPRQWDUOD
FDUFDVD
6ROLFLWHDVLVWHQFLDWpFQLFD
~QLFDPHQWHDSHUVRQDO
HVSHFLDOL]DGR
2
Precauciones
‡ /RVUHTXLVLWRVGHDOLPHQWDFLyQ\HOFRQVXPR
GHHQHUJtDGHHVWHUHSURGXFWRUVHLQGLFDQHQ
HOSDQHOSRVWHULRUGHOUHSURGXFWRU9HULILTXH
TXHODWHQVLyQRSHUDWLYDGHOUHSURGXFWRUVHD
LGpQWLFDDVXVXPLQLVWURGHHQHUJtDHOpFWULFD
ORFDO
5HTXLVLWRVGH
DOLPHQWDFLyQ\FRQVXPR
GHHQHUJtDt
X
DVP–XXXX
00V 00Hz
00W
NO.
0-000-000-00
Seguridad
‡ 3UHFDXFLyQ±(OXVRGHLQVWUXPHQWRVySWLFRV
FRQHVWHSURGXFWRDXPHQWDHOULHVJRGH
GDxRVRFXODUHV
‡ 3DUDHYLWDUHOULHVJRGHLQFHQGLRVR
HOHFWURFXFLyQQRFRORTXHREMHWRVFRQ
OtTXLGRVVREUHHODSDUDWRFRPRIORUHURV
‡ 6LLQWURGXFHDOJ~QREMHWRVyOLGRRFDH
OtTXLGRVREUHHOUHSURGXFWRUGHVHQFK~IHOR\
KiJDORUHYLVDUSRUSHUVRQDOHVSHFLDOL]DGR
DQWHVGHYROYHUDXWLOL]DUOR
Fuentes de alimentación
‡ (OUHSURGXFWRUQRHVWDUiGHVFRQHFWDGRGHOD
IXHQWHGHDOLPHQWDFLyQGHFDPLHQWUDVHVWp
FRQHFWDGRDODWRPDGHSDUHGDXQTXHHO
UHSURGXFWRUHVWpDSDJDGR
‡ &XDQGRQRYD\DDXWLOL]DUHOUHSURGXFWRU
GXUDQWHPXFKRWLHPSRDVHJ~UHVHGH
GHVFRQHFWDUORGHODWRPDGHSDUHG3DUD
GHVFRQHFWDUHOFDEOHGHDOLPHQWDFLyQGHFD
WLUHGHODFODYLMDQXQFDGHOFDEOH
‡ 6LHVSUHFLVRFDPELDUHOFDEOHGH
DOLPHQWDFLyQGHFDKDJDTXHORVXVWLWX\DQ
~QLFDPHQWHHQXQFHQWURGHVHUYLFLRWpFQLFR
HVSHFLDOL]DGR
Ubicación
‡ ,QVWDOHHOUHSURGXFWRUHQXQOXJDUFRQ
YHQWLODFLyQDGHFXDGDSDUDHYLWDUHO
UHFDOHQWDPLHQWRLQWHUQRGHOPLVPR
‡ 1RFRORTXHHOUHSURGXFWRUVREUHXQD
VXSHUILFLHEODQGDFRPRXQDDOIRPEUDTXH
SXHGDEORTXHDUORVRULILFLRVGHYHQWLODFLyQ
GHODEDVH
‡ 1RFRORTXHHOUHSURGXFWRUFHUFDGHIXHQWHV
GHFDORUQLHQOXJDUHVVXMHWRVDODOX]VRODU
GLUHFWDSROYRH[FHVLYRRJROSHVPHFiQLFRV
‡ 1RLQVWDOHHOUHSURGXFWRUHQXQDSRVLFLyQ
LQFOLQDGD)XHGLVHxDGRSDUDRSHUDUORVyOR
HQSRVLFLyQKRUL]RQWDO
‡ 0DQWHQJDHOUHSURGXFWRU\ORVGLVFRV
DOHMDGRVGHHTXLSRVFRQSRWHQWHVLPDQHV
FRPRORVKRUQRVPLFURRQGDVRDOWDYRFHV
JUDQGHV
‡ 1RFRORTXHREMHWRVSHVDGRVHQHO
UHSURGXFWRU
Para el modelo provisto con el adaptador
de clavija de ca
6LODFODYLMDGHFDGHVXXQLGDGQRFDO]DHQOD
WRPDGHSDUHGFRORTXHHODGDSWDGRUGHOD
FODYLMDGHFDSURYLVWR
Utilización
‡ 6LWUDVODGDHOUHSURGXFWRUGLUHFWDPHQWH
GHVGHXQOXJDUIUtRDXQRFiOLGRRVLOR
LQVWDODHQXQDVDODPX\K~PHGDHVSRVLEOH
TXHVHFRQGHQVHKXPHGDGHQODVOHQWHVGHVX
LQWHULRU6LHVWRRFXUUHHOUHSURGXFWRUSXHGH
QRIXQFLRQDUFRUUHFWDPHQWH(QHVWHFDVR
H[WUDLJDHOGLVFR\GHMHHOUHSURGXFWRU
HQFHQGLGRGXUDQWHPHGLDKRUD
DSUR[LPDGDPHQWHKDVWDTXHODKXPHGDGVH
HYDSRUH
‡ &XDQGRYD\DDPRYHUHOUHSURGXFWRU
H[WUDLJDORVGLVFRV6LQRORKDFHORVGLVFRV
SRGUtDQGDxDUVH
Ajuste del volumen
1RDXPHQWHHOYROXPHQPLHQWUDVHVFXFKDXQD
SDUWHFRQHQWUDGDVGHQLYHOPX\EDMRRVLQ
VHxDOHVGHDXGLR6LORKDFHORVDOWDYRFHV
SXHGHQGDxDUVHDOUHSURGXFLUVHDOJXQDSDUWH
GHQLYHOGHPi[LPR
Limpieza
/LPSLHHOH[WHULRUHOSDQHO\ORVFRQWUROHV
FRQXQSDxRVXDYHOLJHUDPHQWHKXPHGHFLGR
FRQXQDVROXFLyQGHWHUJHQWHSRFR
FRQFHQWUDGD1RXWLOLFHHVWURSDMRVDEUDVLYRV
GHWHUJHQWHHQSROYRQLGLVROYHQWHVFRPR
DOFRKROREHQFLQD
Limpieza de los discos
1RXWLOLFHGLVFRVGHOLPSLH]DGLVSRQLEOHVHQ
HOPHUFDGR3XHGHQSURGXFLUIDOORVGH
IXQFLRQDPLHQWR
3
AVISO IMPORTANTE
3UHFDXFLyQ(VWHUHSURGXFWRUGH'9'HV
FDSD]GHPDQWHQHULQGHILQLGDPHQWHHQOD
SDQWDOODGHO79LPiJHQHVILMDVGHYLGHRR
LQGLFDFLRQHVHQSDQWDOOD6LODVLPiJHQHV
ILMDVGHYLGHRRODVLQGLFDFLRQHVHQSDQWDOOD
SHUPDQHFHQPRVWUDGDVHQHO79GXUDQWH
PXFKRWLHPSRODSDQWDOODGHpVWHSRGUtD
GDxDUVHSHUPDQHQWHPHQWH/RVWHOHYLVRUHV
GHSUR\HFFLyQVRQHVSHFLDOPHQWH
VXVFHSWLEOHV
Transporte del reproductor
$QWHVGHWUDQVSRUWDUHOUHSURGXFWRUVLJDHO
SURFHGLPLHQWRTXHVHGHWDOODDFRQWLQXDFLyQ
SDUDGHYROYHUORVPHFDQLVPRVLQWHUQRVDVXV
SRVLFLRQHVRULJLQDOHV
1
([WUDLJDWRGRVORVGLVFRVGHODEDQGHMDGH
GLVFRV
2
3UHVLRQHZSDUDFHUUDUODEDQGHMDGH
GLVFRV
$VHJ~UHVHGHTXHHOPHQVDMH³12',6&´
1RKD\GLVFRDSDUH]FDHQHO
YLVXDOL]DGRUGHOSDQHOIURQWDO
3
3UHVLRQH?1SDUDDSDJDUHOUHSURGXFWRU
(OUHSURGXFWRUDFWLYDHOPRGRGHHVSHUD\
HOLQGLFDGRUGHDOLPHQWDFLyQVHLOXPLQD
HQURMR
4
'HVFRQHFWHHOFDEOHGHDOLPHQWDFLyQGH
FD
6LGHVHDUHDOL]DUDOJXQDFRQVXOWDRVROXFLRQDU
DOJ~QSUREOHPDUHODFLRQDGRFRQHO
UHSURGXFWRUSyQJDVHHQFRQWDFWRFRQHO
SURYHHGRU6RQ\PiVSUy[LPR
4
Contenidos
$'9(57(1&,$ £%LHQYHQLGR 3UHFDXFLRQHV $FHUFDGHHVWHPDQXDO (VWHUHSURGXFWRUSXHGHUHSURGXFLUORVVLJXLHQWHVGLVFRV 1RWDVVREUHORVGLVFRV ËQGLFHGHFRPSRQHQWHV\FRQWUROHV *XtDGHLQGLFDFLRQHVHQSDQWDOOD%DUUDGHFRQWURO Guía básica de inicio . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 15
'HVFULSFLyQJHQHUDOUiSLGD 3DVR'HVHPEDODMH
3DVR,QVHUFLyQGHODVSLODVHQHOFRQWUROUHPRWR 3DVR&RQH[LRQHVGHO79 3DVR5HSURGXFFLyQGHGLVFRV Conexiones . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 18
&RQH[LyQGHOUHSURGXFWRU 3DVR&RQH[LyQGHORVFDEOHVGHYLGHR 3DVR&RQH[LyQGHORVFDEOHVGHDXGLR 3DVR&RQH[LyQGHOFDEOHGHDOLPHQWDFLyQ 3DVR&RQILJXUDFLyQUiSLGD
Reproducción de discos . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 28
5HSURGXFFLyQGHGLVFRV %~VTXHGDGHXQSXQWRGHWHUPLQDGRGHXQGLVFR([SORUDFLyQ
5HSURGXFFLyQDFiPDUDOHQWD%~VTXHGD&RQJHODFLyQ
GHIRWRJUDPDV 5HDQXGDFLyQGHODUHSURGXFFLyQDSDUWLUGHOSXQWRHQHOTXHGHWXYRHOGLVFR
5HDQXGDFLyQGHUHSURGXFFLyQ5HDQXGDFLyQPXOWLGLVFR 8VRGHOPHQ~GHO'9' 5HSURGXFFLyQGHGLVFRV9,'(2&'FRQIXQFLRQHV3%&
5HSURGXFFLyQ3%& 5HSURGXFFLyQGHSLVWDVGHDXGLR03 'LVWLQWDVIXQFLRQHVGHPRGRGHUHSURGXFFLyQ5HSURGXFFLyQGHSURJUDPD
DOHDWRULDUHSHWLGDUHSHWLFLyQ$% Búsqueda de escenas . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 43
%~VTXHGDGHWtWXORVFDStWXORVSLVWDVtQGLFHVHVFHQDV
0RGRGHE~VTXHGD Visualización de la información sobre el disco . . . . . . . . . . . . . . . 44
&RPSUREDFLyQGHOWLHPSRGHUHSURGXFFLyQ\GHOUHVWDQWH Ajustes de sonido . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 46
&DPELRGHOVRQLGR $MXVWHVGHVRQLGR799LUWXDO6XUURXQG796 5
Visualización de películas . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 50
&DPELRGHORViQJXORV 9LVXDOL]DFLyQGHORVVXEWtWXORV $MXVWHGHODFDOLGDGGHLPDJHQ%15 $MXVWHODLPDJHQGHUHSURGXFFLyQ02'2'(9,68$/,=$&,21
3(5621$/,=$'2 5HDOFHODLPDJHQGHUHSURGXFFLyQ(1$/7(&('259,'(2',*,7$/ Uso de distintas funciones adicionales . . . . . . . . . . . . . . . . . . . . 55
%ORTXHRGHGLVFRV5(352'8&&,21352+,%,'$3(5621$/&21752/
'(%/248(2 &RQWUROGHO79FRQHOFRQWUROUHPRWRVXPLQLVWUDGR Ajustes . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 61
8VRGHODSDQWDOODGHDMXVWHV $MXVWHGHOLGLRPDGHODVLQGLFDFLRQHVRGHODSLVWDGHVRQLGR$-867('(
,',20$ $MXVWHVGHODSDQWDOOD$-867(3$17$//$ $MXVWHVSHUVRQDOL]DGRV$-867(3(5621$/,=$'2 $MXVWHVGHVRQLGR
$-867($8',2 Información complementaria . . . . . . . . . . . . . . . . . . . . . . . . . . . 68
6ROXFLyQGHSUREOHPDV )XQFLyQGHDXWRGLDJQyVWLFR&XDQGRDSDUHFHQOHWUDVQ~PHURVHQHO
YLVXDOL]DGRU *ORVDULR (VSHFLILFDFLRQHV /LVWDGHFyGLJRVGHLGLRPDV ËQGLFHDOIDEpWLFR 6
Acerca de este manual
Verifique su modelo
/DVLQVWUXFFLRQHVHQHVWHPDQXDO
FRUUHVSRQGHQDOPRGHOR'931&HQ
YHQWDHQORV((88&DQDGi$PpULFD
/DWLQD$VLD\2FHDQtD/DVGLIHUHQFLDV
HQWUHORVPRGHORVGH((88&DQDGi
$PpULFD/DWLQD\ORVPRGHORVGH$VLD
2FHDQtDFRQVLVWHQHQHOFRQWUROUHPRWR
SURYLVWRHO507'$SDUDORVPRGHORV
GH((88&DQDGi$PpULFD/DWLQDRHO
507'(SDUDORVPRGHORVGH$VLD
2FHDQtDORVQRPEUHVGHODVWRPDVHQHO
SDQHOWUDVHUR\DOJXQDVLQGLFDFLRQHVHQ
SDQWDOOD
(OPRGHORSDUD((88&DQDGi$PpULFD
/DWLQDVHXWLOL]DDILQHVLOXVWUDWLYRVDPHQRV
TXHVHHVSHFLILTXHORFRQWUDULR&XDOTXLHU
GLIHUHQFLDGHIXQFLRQDPLHQWRVHLQGLFD
FODUDPHQWHHQHOWH[WRSRUHMHPSOR³6yOR
SDUDPRGHORVGH$VLD2FHDQtD´
‡ /DVLQVWUXFFLRQHVGHHVWHPDQXDOGHVFULEHQ
ORVFRQWUROHVGHOFRQWUROUHPRWR7DPELpQ
SXHGHXWLOL]DUORVFRQWUROHVGHOUHSURGXFWRU
VLSUHVHQWDQORVPLVPRVQRPEUHVR
VLPLODUHVDORVGHOFRQWUROUHPRWR
‡ (OVLJQLILFDGRGHORVLFRQRVXWLOL]DGRVHQ
HVWHPDQXDOVHGHVFULEHDFRQWLQXDFLyQ
,FRQR
6LJQLILFDGR
)XQFLRQHVGLVSRQLEOHVSDUD
'9'9,'(2VR'9'5V
'9'5:VGLVFRVGHYLGHR
GLJLWDOJUDEDEOHVUHJUDEDEOHV
HQPRGRGHYLGHR
)XQFLRQHVGLVSRQLEOHVSDUD
9,'(2&'VR&'5V
&'5:VGLVFRVFRPSDFWRV
JUDEDEOHVUHJUDEDEOHVIRUPDWR
GHYLGHR&'
)XQFLRQHVGLVSRQLEOHVSDUD&'
'('$726&'520V
&'5V&'5:VGLVFRV
FRPSDFWRVGHVyOROHFWXUD
JUDEDEOHVUHJUDEDEOHVTXH
FRQWLHQHQSLVWDVGHDXGLR03
)XQFLRQHVGLVSRQLEOHVSDUD
&'VGHP~VLFDR&'5V
&'5:VGLVFRVFRPSDFWRV
JUDEDEOHVUHJUDEDEOHVHQ
IRUPDWRGH&'GHP~VLFD
0303(*DXGLRFDSDHVXQIRUPDWR
HVWiQGDUGHILQLGRSRU03(*GH,62
2UJDQL]DFLyQLQWHUQDFLRQDOGHQRUPDOL]DFLyQ
TXHFRPSULPHGDWRVGHDXGLR
Este reproductor puede
reproducir los siguientes
discos
)RUPDWRGHGLVFRV
'9'9,'(2
9,'(2&'
&'GHP~VLFD
(OORJRWLSR³'9'9,'(2´HVXQDPDUFD
FRPHUFLDO
Código de región
(OUHSURGXFWRUWLHQHXQFyGLJRGHUHJLyQ
LPSUHVRHQODSDUWHWUDVHUDGHODXQLGDG\VyOR
UHSURGXFLUiGLVFRV'9'9,'(2VyOR
UHSURGXFFLyQTXHSUHVHQWHQFyGLJRVGH
UHJLyQLGpQWLFRV(VWHVLVWHPDVHXWLOL]DSDUD
SURWHJHUORVGHUHFKRVGHDXWRU
/RVGLVFRV'9'TXHLQFOX\DQODHWLTXHWD ALL WDPELpQVHUHSURGXFLUiQHQHVWHUHSURGXFWRU
6LLQWHQWDUHSURGXFLUFXDOTXLHURWURWLSRGH
'9'HOPHQVDMH³5HSURGXFFLyQGHHVWHGLVFR
SURKLELGDSRUOtPLWHVGH]RQD´DSDUHFHUiHQOD
SDQWDOODGHO79$OJXQRVGLVFRV'9'SXHGHQ
QRSUHVHQWDUODHWLTXHWDGHLQGLFDFLyQGH
FyGLJRGHUHJLyQDXQTXHVXUHSURGXFFLyQHVWp
SURKLELGDSRUOtPLWHVGH]RQD
X
&yGLJRGHUHJLyQ
DVP–XXXX
00V 00Hz
00W
NO.
0-000-000-00
Ejemplo de discos que el
reproductor no puede reproducir
(OUHSURGXFWRUQRSXHGHUHSURGXFLUORV
VLJXLHQWHVGLVFRV
‡ 7RGRVORV&'520VGLVFRVFRPSDFWRVGH
VyOROHFWXUDLQFOX\HQGRORV3+272&'V
IRWRJUDItDGHORVGLVFRVFRPSDFWRV&'
5V&'5:VGLVFRFRPSDFWRJUDEDEOH
UHJUDEDEOHGLVWLQWRVGHORVJUDEDGRVHQORV
VLJXLHQWHVIRUPDWRV
±IRUPDWRGH&'GLVFRFRPSDFWRGHP~VLFD
±IRUPDWRGH&'GLVFRFRPSDFWRGHYLGHR
7
‡
‡
‡
‡
‡
±)RUPDWR03FRQIRUPHDODQRUPD
,621LYHO1LYHORVXIRUPDWR
H[WHQGLGR-ROLHW
3DUWHGHGDWRVGH&'([WUDV
'9'5:VGLVFRVGHYLGHRGLJLWDO
UHJUDEDEOHHQPRGR95
'9'520VGLVFRVGHYLGHRGLJLWDOGH
VyOROHFWXUD
'LVFRVGHDXGLR'9'GLVFRGHYLGHRGLJLWDO
&DSD+'DOWDGHQVLGDGHQ6XSHU$XGLR
&'VGLVFRVFRPSDFWRV6XSHU$XGLR
8QIRUPDWROyJLFRGHDUFKLYRV\FDUSHWDVHQ&'
520VGHILQLGRSRU,622UJDQL]DFLyQ
,QWHUQDFLRQDOGH1RUPDOL]DFLyQ
,JXDOPHQWHHOUHSURGXFWRUQRSXHGH
UHSURGXFLUORVVLJXLHQWHVGLVFRV
‡ 'LVFRV'9'FRQXQFyGLJRGHUHJLyQ
GLIHUHQWH
‡ 'LVFRVFRQIRUPDVQRHVWiQGDUHVSRU
HMHPSORWDUMHWDFRUD]yQ
‡ 'LVFRVFRQSDSHORDGKHVLYRV
‡ 'LVFRVTXHD~QWHQJDQHODGKHVLYRGHFLQWD
GHFHORIiQRDGKHVLYRV
6yORSDUDPRGHORVGH$PpULFD/DWLQD
‡ (OUHSURGXFWRUQRSRGUiUHSURGXFLUGLVFRV
JUDEDGRVHQXQVLVWHPDGHFRORUGLVWLQWRGH
176&&RPLVLyQGHO6LVWHPDGH7HOHYLVLyQ
1DFLRQDOSRUHMHPSOR3$//tQHDGH
$OWHUQDQFLDGH)DVHR6(&$06LVWHPD
6HFXHQFLDOFRQ0HPRULDD&RORUHVWH
UHSURGXFWRUFXHQWDFRQXQVLVWHPDGHFRORU
176&
UHSURGXFWRUUHSURGXFHGLVFRV'9'\9,'(2
&'HQIXQFLyQGHOFRQWHQLGRGHORVPLVPRV
GLVHxDGRSRUORVSURGXFWRUHVGHVRIWZDUH
FLHUWDVIXQFLRQHVGHUHSURGXFFLyQSXHGHQQR
HQFRQWUDUVHGLVSRQLEOHV&RQVXOWHWDPELpQODV
LQVWUXFFLRQHVVXPLQLVWUDGDVFRQORVGLVFRV
'9'\9,'(2&'
Derechos de autor
(VWHSURGXFWRLQFRUSRUDWHFQRORJtDGH
SURWHFFLyQGHGHUHFKRVGHDXWRUFRS\ULJKW
DPSDUDGDVSRUGHPDQGDVGHFLHUWDVSDWHQWHVGH
((88RWURVGHUHFKRVGHSURSLHGDG
LQWHOHFWXDOGH0DFURYLVLRQ&RUSRUDWLRQ\RWURV
SURSLHWDULRV(OXVRGHGLFKDWHFQRORJtD
SURWHJLGDSRUGHUHFKRGHDXWRUGHEHFRQWDUFRQ
ODDXWRUL]DFLyQGH0DFURYLVLRQ&RUSRUDWLRQ\
HV~QLFDPHQWHSDUDXVRGRPpVWLFR\RWURVXVRV
GHYLVXDOL]DFLyQOLPLWDGRVDPHQRVTXH
0DFURYLVLRQ&RUSRUDWLRQDXWRULFHORFRQWUDULR
(VWiSURKLELGDODLQJHQLHUtDLQYHUVDR
GHVPRQWDMHGHODXQLGDG
Notas sobre los discos
‡ 3DUDPDQWHQHUOLPSLRHOGLVFRDJiUUHORSRU
ORVERUGHV1RWRTXHVXVXSHUILFLH
1RWD
$OJXQRV&'5GLVFRVFRPSDFWRVJUDEDEOHV&'
5:GLVFRVFRPSDFWRVUHJUDEDEOHV'9'5
GLVFRVGHYLGHRGLJLWDOJUDEDEOHVR'9'5:
GLVFRVGHYLGHRGLJLWDOUHJUDEDEOHVHQPRGRGH
YLGHRQRSRGUiQUHSURGXFLUVHHQHVWHUHSURGXFWRU
GHELGRDODFDOLGDGGHODJUDEDFLyQRHOHVWDGRItVLFR
GHOGLVFRRODVFDUDFWHUtVWLFDVGHJUDEDFLyQGHO
GLVSRVLWLYR
$GHPiVHOGLVFRQRVHUHSURGXFLUiVLQRVHKD
ILQDOL]DGRFRUUHFWDPHQWH3DUDREWHQHUPiV
LQIRUPDFLyQFRQVXOWHHOPDQXDOGHLQVWUXFFLRQHV
GHOGLVSRVLWLYRGHJUDEDFLyQ
7HQJDHQFXHQWDTXHORVGLVFRVFUHDGRVHQIRUPDWR
3DFNHW:ULWHQRVHSXHGHQUHSURGXFLU
‡ 1RH[SRQJDORVGLVFRVDODOX]VRODUGLUHFWD
QLDIXHQWHVGHFDORUFRPRFRQGXFWRVGH
DLUHFDOLHQWHQLORVGHMHHQXQDXWRPyYLO
DSDUFDGREDMRODOX]VRODUGLUHFWD\DTXH
SXHGHSURGXFLUVHXQFRQVLGHUDEOHDXPHQWR
GHWHPSHUDWXUDHQHOLQWHULRUGHGLFKR
DXWRPyYLO
‡ 'HVSXpVGHODUHSURGXFFLyQJXDUGHHOGLVFR
HQVXFDMD
‡ /tPSLHORFRQXQSDxRVXDYH
+iJDORGHVGHHOFHQWURKDFLDORVERUGHV
Nota sobre operaciones de
reproducción de discos DVD y
VIDEO CD
(VSRVLEOHTXHFLHUWDVRSHUDFLRQHVGH
UHSURGXFFLyQGHGLVFRV'9'\9,'(2&'
HVWpQH[SUHVDPHQWHGHWHUPLQDGDVSRUORV
SURGXFWRUHVGHVRIWZDUH3XHVWRTXHHVWH
8
‡ 1RXWLOLFHGLVROYHQWHVFRPREHQFLQD
GLOX\HQWHOLPSLDGRUHVGLVSRQLEOHVHQHO
PHUFDGRQLDHURVROHVDQWLHVWiWLFRVSDUD
GLVFRVGHYLQLOR
Índice de componentes y controles
3DUDREWHQHUPiVLQIRUPDFLyQFRQVXOWHODVSiJLQDVLQGLFDGDVHQWUHSDUpQWHVLV
Panel frontal
A %RWyQLQGLFDGRU[1 HQFHQGLGR
HVSHUD
6HLOXPLQDHQFRORUYHUGHFXDQGROD
DOLPHQWDFLyQHVWiHQFHQGLGD2Q\HQ
URMRFXDQGRHOUHSURGXFWRUHVWiHQPRGR
GHHVSHUD6WDQGE\
B %RWRQHV',6&6(/(&7VHOHFFLRQDU
GLVFR±
C VHQVRUUHPRWR
D 9LVXDOL]DGRUGHOSDQHOIURQWDO
E %RWyQHUHSURGXFFLyQ
(OERWyQHWLHQHXQSXQWRWiFWLO
F %RWyQXSDXVD
G %RWyQxSDUDGD
H %RWRQHV.>DQWHULRUVLJXLHQWH
I %RWyQADSHUWXUDFLHUUH
J %RWyQ',6&6.,3RPLWLUGLVFR
K %RWyQ(;&+$1*(LQWHUFDPELDU
L %DQGHMDGHGLVFRV
M %RWyQ6855281'VXUURXQG
N %RWyQ/2$'FDUJD
O %RWyQ3,&785(02'(PRGR
LPDJHQ
8WLOLFHHOSXQWRWiFWLOFRPRUHIHUHQFLDFXDQGR
RSHUHHOUHSURGXFWRU
c FRQWLQ~D
9
Visualizador del panel frontal
Al reproducir un DVD
(VWDGRGHUHSURGXFFLyQ
6HLOXPLQDDOFDPELDUHO
iQJXOR
7LHPSRGH
1~PHURVGHGLVFRV
7LSRGH
GLVFR
UHSURGXFFLyQ
'LVFRDFWXDO
6HxDOGHDXGLR
7tWXOR\Q~PHURGH
DFWXDO
FDStWXORDFWXDO
0RGRDFWXDOGH
0RGRWRGRVORV
UHSURGXFFLyQ
GLVFRV
6yORSDUDPRGHORVGH$VLD
2FHDQtD
6HLOXPLQDFXDQGRHOUHSURGXFWRU
HPLWHODVHxDOHQIRUPDWR176&
Al reproducir un VIDEO CD con Playback Control (PBC (Control de reproducción)) (33)
(VWDGRGH
UHSURGXFFLyQ 1~PHURVGHGLVFRV
7LSRGH
(VFHQDDFWXDO
GLVFR
'LVFRDFWXDO
0RGRWRGRVORV
GLVFRV
6HHQFLHQGHGXUDQWH$%5HSHDW3OD\
5HSURGXFFLyQUHSHWLGD$%
7LHPSRGH
UHSURGXFFLyQ
6yORSDUDPRGHORVGH$VLD
2FHDQtD
6HLOXPLQDFXDQGRHOUHSURGXFWRU
HPLWHODVHxDOHQIRUPDWR176&
Al reproducir un CD, un CD DE DATOS (audio en formato MP3), o un VIDEO CD (sin PBC)
(VWDGRGH
UHSURGXFFLyQ 1~PHURVGHGLVFRV
7LSRGH
'LVFRDFWXDO
GLVFR
0RGRWRGRVORV
GLVFRV
6HLOXPLQDFXDQGRUHSURGXFH
SLVWDVGHDXGLR03
0RGRDFWXDOGHUHSURGXFFLyQ
10
3LVWDHtQGLFH
DFWXDO
7LHPSRGHUHSURGXFFLyQ
6yORSDUDPRGHORVGH$VLD2FHDQtD
6HLOXPLQDFXDQGRHOUHSURGXFWRU
HPLWHODVHxDOHQIRUPDWR176&
Panel posterior
A 7RPD',*,7$/287&2$;,$/
VDOLGDGLJLWDOFRD[LDO
B 7RPD/,1(287/5$8',2
VDOLGDGHDXGLRL]TXLHUGDGHUHFKD
C 7RPD/,1(2879,'(2VDOLGDGH
YLGHR
D 7RPD69,'(2287VDOLGDGH
YLGHR 6
E 7RPD&20321(179,'(2287
VDOLGDGHYLGHRFRPSRQHQWH
/RVQRPEUHVGHORVWRPDVYDULDUiQGH
DFXHUGRFRQORVPRGHORV
0RGHORVGH$PpULFD/DWLQD<3%35
0RGHORVSDUD$VLD2FHDQtD<&%&5
c FRQWLQ~D
11
Control remoto
A %RWyQ79[1HQFHQGLGRHVSHUDGHO
79
B %RWyQZ23(1&/26(DSHUWXUD
FLHUUH
C %RWRQHVQXPpULFRV
D
E
F
G
H
I
J
K
L
M
N
O
(OERWyQQ~PHURWLHQHXQSXQWRWiFWLO
%RWyQ&/($5ERUUDU
%RWyQ68%7,7/(VXEWtWXOR
%RWyQ$8',2DXGLR
%RWRQHV.> 35(91(;7
DQWHULRUVLJXLHQWH
%RWRQHV mM 6&$1
6/2:H[SORUDFLyQUHSURGXFFLyQD
FiPDUDOHQWD
%RWyQX3$86(SDXVD
%RWyQH3/$<UHSURGXFFLyQ
(OERWyQHWLHQHXQSXQWRWiFWLO
%RWRQHVCXxc
%RWyQ',63/$<LQGLFDFLyQ
%RWyQ7230(18PHQ~GHWtWXORV
%RWyQ [1HQFHQGLGRHVSHUD
%RWRQHV92/YROXPHQ±
(OERWyQWLHQHXQSXQWRWiFWLO
P %RWyQ799,'(2WHOHYLVLyQYLGHR
Q %RWyQ7,0(7(;7WLHPSRWH[WR
R %RWyQ',6&6.,3RPLWLUGLVFR
S %RWyQ$1*/(iQJXOR
T %RWyQ3,&785(02'(PRGR
LPDJHQ
U %RWyQ685VXUURXQG
V %RWyQ5(3($7UHSHWLFLyQ
W %RWyQ5(3/$<UHSHWLFLyQ
X %RWyQ6($5&+02'(PRGRGH
E~VTXHGD
Y %RWyQx6723SDUDGD
Z %RWyQ(17(5LQWURGXFFLyQ
wj %RWyQO5(7851YROYHU
wk %RWyQ0(18PHQ~
8WLOLFHHOSXQWRWiFWLOFRPRUHIHUHQFLDFXDQGR
RSHUHHOUHSURGXFWRU
12
7 8 9 q;
Guía de indicaciones en
pantalla (Barra de control)
$FRQWLQXDFLyQVHGHVFULEHODEDUUDGH
FRQWURO/DEDUUDGHFRQWUROVHXWLOL]DSDUD
DMXVWDUORVYDORUHVRYLVXDOL]DUODLQIRUPDFLyQ
GXUDQWHODUHSURGXFFLyQ
/RVFRQWHQLGRVYLVXDOL]DGRVGLILHUHQGH
DFXHUGRFRQHOWLSRGHGLVFRUHSURGXFLGR/RV
Q~PHURVHQWUHSDUpQWHVLVLQGLFDQODVSiJLQDV
GHUHIHUHQFLD
Como visualizar la barra de
control durante la reproducción
/DVVLJXLHQWHVSDQWDOODVDSDUHFHQDOSUHVLRQDU
HOERWyQ',63/$<LQGLFDFLyQYDULDVYHFHV
GXUDQWHODUHSURGXFFLyQ3XHGHVHOHFFLRQDU
ORVYDORUHVTXHPHMRUVHDMXVWHQDOHOHPHQWR
GHUHSURGXFFLyQDFWXDO\YLVXDOL]DUOD
LQIRUPDFLyQUHODFLRQDGD
◆Pantalla 1
6HSXHGHQDMXVWDUORVVLJXLHQWHVPRGRVGH
UHSURGXFFLyQ1a5(OLQGLFDGRUVHLOXPLQD
HQD]XOFXDQGRVHDFWLYD
(MHPSOR$OVHOHFFLRQDU5HSURGXFFLyQ
UHSHWLGD/DSDQWDOODVHUiGLIHUHQWHVLDMXVWD
ODIXQFLyQ5HSURGXFFLyQUHSHWLGD$%
1 2 3 4 5
6
CAPITULO
A
B
C
D
E
F
0RGRGHGLVFRV
5HSURGXFFLyQUHSHWLGD
5HSURGXFFLyQDOHDWRULD
5HSURGXFFLyQGHSURJUDPD
5HSURGXFFLyQUHSHWLGD$%
8QLGDGUHSHWLGDHQHVWHHMHPSOR
m
◆Pantalla 2
6HSXHGHQDMXVWDUORVVLJXLHQWHVPRGRVGH
UHSURGXFFLyQ7a0(OLQGLFDGRUVHLOXPLQD
HQD]XOFXDQGRVHDFWLYD
(MHPSOR$ODMXVWDUHOYDORUHQ³796´
qa
G 796
H ³%15´
I ³02'2'(9,68$/,=$&,21
3(5621$/,=$'2´
J ³(1$/7(&('259,'(2
',*,7$/´
K (VWDGRGHUHSURGXFFLyQ
N5HSURGXFFLyQX3DXVDx3DUDGD
HWF
m
◆Pantalla 3
6HYLVXDOL]DODVLJXLHQWHLQIRUPDFLyQGH
UHSURGXFFLyQ
(MHPSOR$OUHSURGXFLUXQ'9'
qs
qd
qf
qg
3:DVD T41 – 8
L
M
N
O
P
qh
T 1:01:57
,FRQR7,0(7(;7WLHPSRWH[WR
1~PHUR\WLSRGHGLVFR
1~PHURGHOWtWXORGHO'9'
1~PHURGHOFDStWXORGHO'9'
7LHPSRGHUHSURGXFFLyQRUHVWDQWHGHO
GLVFR
m
◆Pantalla 46yORSDUDUHSURGXFFLyQHQ'9'
DOLBY DIGITAL 3/2.1
qj
Q )RUPDWRGHODVHxDOGHDXGLRDFWXDO
m
◆Sin pantalla
m
◆Volver a pantalla 1
c FRQWLQ~D
13
Cómo visualizar la barra de
control en el modo Parar
/DVVLJXLHQWHVSDQWDOODVDSDUHFHQDOSUHVLRQDU
HOERWyQ',63/$<LQGLFDFLyQYDULDVYHFHV
GXUDQWHHOPRGRSDUDU3XHGHHIHFWXDUDMXVWHV
EiVLFRV\SHUVRQDOL]DUHOUHSURGXFWRUGH
DFXHUGRFRQVXVSUHIHUHQFLDVGH
YLVXDOL]DFLyQ
m
◆Pantalla 4
0XHVWUDODPLVPDLQIRUPDFLyQTXHOD
3DQWDOOD GXUDQWHODUHSURGXFFLyQ
3:DVD T41 – 8
◆Pantalla 1
6HSXHGHQDMXVWDUORVVLJXLHQWHVSDUiPHWURV
m
◆Sin pantalla
m
RÁPIDO
A
◆Volver a pantalla 1
$-867(
‡ 6HOHFFLRQH5È3,'2FRQHOILQGHUHDOL]DUHO
Q~PHURPtQLPRGHDMXVWHVEiVLFRVSDUD
XWLOL]DUHOUHSURGXFWRU
‡ 6HOHFFLRQH3(5621$/,=$'2SDUD
UHDOL]DUODJDPDFRPSOHWDGHDMXVWHV
‡ 6HOHFFLRQH5(67$85$5SDUDUHFXSHUDU
ORVYDORUHV$-867(SRURPLVLyQ
B
&21752/'(%/248(2
‡ (VWDEOH]FDHVWHHOHPHQWRSDUDOLPLWDUOD
UHSURGXFFLyQGHGLVFRVVHOHFFLRQDGRVHQ
HVWHUHSURGXFWRU
m
◆Pantalla 2
0XHVWUDODPLVPDLQIRUPDFLyQTXHOD
3DQWDOOD GXUDQWHODUHSURGXFFLyQ
CAPITULO
m
◆Pantalla 3
0XHVWUDODPLVPDLQIRUPDFLyQTXHOD
3DQWDOOD GXUDQWHODUHSURGXFFLyQ
14
T 1:01:57
*XtDEiVLFDGHLQLFLR
/DGHVFULSFLyQJHQHUDOUiSLGDRIUHFLGDHQHVWD
JXtDOHSURSRUFLRQDUiVXILFLHQWHLQIRUPDFLyQ
SDUDFRPHQ]DUDXWLOL]DUHOUHSURGXFWRU3DUD
XWLOL]DUODVIXQFLRQHVGHVRQLGRHQYROYHQWHGH
HVWHUHSURGXFWRUFRQVXOWH³&RQH[LRQHV´HQOD
SiJLQD (VSRVLEOHFRQWURODUHOUHSURGXFWRUFRQHO
FRQWUROUHPRWRVXPLQLVWUDGR,QVHUWHGRVSLODV
GHWDPDxR$$5GHIRUPDTXHORV
H[WUHPRV3\#GHGLFKDVSLODVFRLQFLGDQ
FRQODVPDUFDVGHOLQWHULRUGHO
FRPSDUWLPLHQWR&XDQGRHPSOHHHOFRQWURO
UHPRWRRULpQWHORKDFLDHOVHQVRUUHPRWR GHOUHSURGXFWRU
Guía básica de inicio
Descripción general
rápida
Paso 2: Inserción de las
pilas en el control
remoto
1RWDV
‡ 1RHVSRVLEOHFRQHFWDUHVWHUHSURGXFWRUDXQ79
TXHQRGLVSRQJDGHWRPDGHHQWUDGDGHYLGHR
‡ $VHJ~UHVHGHGHVDFWLYDUODDOLPHQWDFLyQGHWRGRV
ORVFRPSRQHQWHVDQWHVGHUHDOL]DUODVFRQH[LRQHV
Paso 1: Desembalaje
&RPSUXHEHTXHGLVSRQHGHORVVLJXLHQWHV
DFFHVRULRV
‡ &DEOHGHDXGLRYLGHRFODYLMDGHSLQHV×
yFODYLMDGHSLQHV×
‡ &RQWUROUHPRWR
‡ 3LODVGHWDPDxR$$5
‡ 6HLQFOX\HXQDGDSWDGRUGHFODYLMDFRQ
DOJXQRVPRGHORV
1RWDV
‡ 1RGHMHHOFRQWUROUHPRWRHQOXJDUHV
H[WUHPDGDPHQWHFiOLGRVRK~PHGRV
‡ 1RSHUPLWDTXHFDLJDQREMHWRVH[WUDxRVVREUHHO
FRQWUROUHPRWRSDUWLFXODUPHQWHFXDQGRVXVWLWX\D
ODVSLODV
‡ 1RH[SRQJDHOVHQVRUUHPRWRDODOX]GLUHFWDGHO
VROQLDGLVSRVLWLYRVGHLOXPLQDFLyQ6LORKDFH
SXHGHQSURGXFLUVHIDOORVGHIXQFLRQDPLHQWR
‡ &XDQGRQRYD\DDXWLOL]DUHOFRQWUROUHPRWR
GXUDQWHPXFKRWLHPSRH[WUDLJDODVSLODVSDUD
HYLWDUSRVLEOHVGDxRVSRUIXJDV\FRUURVLyQGHODV
PLVPDV
15
Paso 3: Conexiones del TV
&RQHFWHHOFDEOHGHDXGLRYLGHR\HOGHDOLPHQWDFLyQVXPLQLVWUDGRVHQHORUGHQ1a3
PRVWUDGRDFRQWLQXDFLyQ$VHJ~UHVHGHFRQHFWDUHOFDEOHGHDOLPHQWDFLyQHQ~OWLPROXJDU
5HSURGXFWRUGH&''9'
/,1(287
VDOLGDGHDXGLR
D/,1(287
/5$8',2
VDOLGDGH
DXGLR
L]TXLHUGD
GHUHFKD
1&DEOHGHDXGLR
YLGHRVXPLQLVWUDGR
l)OXMRGHVHxDOHV
D/,1(2879,'(2
VDOLGDGHYLGHR
DHQWUDGDGH
YLGHR
79
DHQWUDGDGH
DXGLR
Dependiendo del tipo de TV, la imagen de
algunos disco puede no llenar la pantalla
del TV.
6LGHVHDFDPELDUODUHODFLyQGHDVSHFWR
FRQVXOWHODSiJLQD Cuando lo conecte a un TV monofónico
8WLOLFHXQFDEOHGHFRQYHUVLyQGHHVWpUHRD
PRQRIyQLFRQRVXPLQLVWUDGR&RQHFWHOD
WRPD/,1(2879,'(2VDOLGDGHYLGHR
GHOUHSURGXFWRUDODWRPDGHHQWUDGDGHYLGHR
GHO79\FRQHFWHODVWRPDVGH/,1(287/5
$8',2VDOLGDGHDXGLRL]TXLHUGDGHUHFKD
DODWRPDGHHQWUDGDGHDXGLRGHO79
16
3)XHQWHGHDOLPHQWDFLyQ
2)XHQWHGHDOLPHQWDFLyQ
Sólo para modelos de Asia/Oceanía
Para cambiar el sistema de color
(OVLVWHPDGHFRORUGHOUHSURGXFWRUVHDMXVWD
HQ176&R3$/6LHOPHQ~HQSDQWDOODGHO
UHSURGXFWRUQRDSDUHFHHQHO79FDPELHHO
VLVWHPDGHFRORUGHOUHSURGXFWRUDOPLVPR
VLVWHPDGHFRORU3$/R176&GHVX79
3DUDFDPELDUHOVLVWHPDGHFRORUPDQWHQJD
SUHVLRQDGR?1XQRVVHJXQGRVPLHQWUDV
SUHVLRQDXHQHOUHSURGXFWRU
z &RQVHMR
3DUDYHULILFDUODFRQILJXUDFLyQDFWXDOGHO
UHSURGXFWRUSUHVLRQH?1(OLQGLFDGRU?1VH
LOXPLQDHQYHUGH&XDQGRDSDUHFHHOWH[WR³176&´
HQODSDQWDOODGHOSDQHOIURQWDOHOVLVWHPDGHFRORU
GHOUHSURGXFWRUHVWiFRQILJXUDGRHQ176&&XDQGR
QRDSDUHFH³176&´HQODSDQWDOODGHOSDQHOIURQWDO
HOVLVWHPDGHFRORUHVWiFRQILJXUDGRHQ3$/
Paso 4: Reproducción de discos
Guía básica de inicio
1~PHURGHFRPSDUWLPLHQWRGHGLVFR
&RQODFDUDGHUHSURGXFFLyQKDFLDDEDMR
A Encienda el TV.
B Presione [/1 en el reproductor.
C Cambie el selector de entrada de
su TV, para que la señal del
reproductor aparezca en la
pantalla del TV.
D Presione A en el reproductor para
abrir la bandeja de discos.
E Coloque el disco en la bandeja con
la cara de reproducción hacia
abajo.
F Presione H.
Después del Paso 6
&RQDOJXQRVGLVFRVSXHGHYLVXDOL]DUVHXQ
PHQ~HQODSDQWDOODGHO79'HVHUDVt
VHOHFFLRQHODRSFLyQTXHGHVHDGHOPHQ~\
UHSURGX]FDHOGLVFR'9'SiJLQD RHO
9,'(2&'SiJLQD Para detener la reproducción
3UHVLRQHx
Para extraer el disco
3UHVLRQHA
Para apagar el reproductor
3UHVLRQH[1(OUHSURGXFWRUDFWLYDHOPRGR
GHHVSHUD\HOLQGLFDGRUGHDOLPHQWDFLyQVH
LOXPLQDHQURMR
/DEDQGHMDGHGLVFRVVHFLHUUD\HO
UHSURGXFWRUFRPLHQ]DDUHSURGXFLUHO
GLVFR
17
&RQH[LRQHV
Conexión del reproductor
5HDOLFHORVSDVRVDSDUDFRQHFWDU\DMXVWDUORVYDORUHVGHOUHSURGXFWRU
$QWHVGHFRPHQ]DUGHVFRQHFWHORVFDEOHVGHDOLPHQWDFLyQFRPSUXHEHTXHGLVSRQHGHWRGRVORV
DFFHVRULRVVXPLQLVWUDGRVHLQVHUWHODVSLODVHQHOFRQWUROUHPRWRSiJLQD 1RWDV
‡ (QFKXIHORVFDEOHVILUPHPHQWHSDUDHYLWDUUXLGRVQRGHVHDGRV
‡ &RQVXOWHHOPDQXDOGHLQVWUXFFLRQHVVXPLQLVWUDGRFRQORVFRPSRQHQWHVTXHYDDFRQHFWDU
Paso 1: Conexión de los cables de video
&RQHFWHHOUHSURGXFWRUDOPRQLWRUGH79SUR\HFWRURDPSOLILFDGRUGH$9UHFHSWRUPHGLDQWH
XQFDEOHGHYLGHR6HOHFFLRQHXQRGHORVSDWURQHVADCVHJ~QODWRPDGHHQWUDGDGHOPRQLWRU
GH79SUR\HFWRURDPSOLILFDGRUGH$9UHFHSWRU
DPDULOOR
&DEOHGH
DXGLRYLGHR
VXPLQLVWUDGR
&DEOHGHOYLGHR
FRPSRQHQWHQR
VXPLQLVWUDGR
YHUGH
D]XO
URMR
79SUR\HFWRURDPSOLIL
FDGRUGH$9UHFHSWRU
79SUR\HFWRURDPSOLIL
FDGRUGH$9UHFHSWRU
DPDULOOR
D/,1(2879,'(2
VDOLGDGHYLGHR
YHUGH
D]XO
URMR
5HSURGXFWRUGH
&''9'
l)OXMRGHVHxDOHV
18
&DEOHGH69,'(2
QRVXPLQLVWUDGR
79SUR\HFWRURDPSOLILFDGRU
GH$9UHFHSWRU
A Si lo conecta a una toma de entrada de video
&RQHFWHODVFODYLMDVDPDULOODVGHOFDEOHGHDXGLRYLGHRVXPLQLVWUDGRDODVWRPDVDPDULOODV
YLGHR'LVIUXWDUiGHLPiJHQHVGHFDOLGDGHVWiQGDU
$PDULOOR9LGHR
%ODQFRL]TXLHUGR
%ODQFRL]TXLHUGR
5RMRGHUHFKR
5RMRGHUHFKR
8WLOLFHODVFODYLMDVURMDV\EODQFDVSDUDFRQHFWDUODVDODVWRPDVGHHQWUDGDGHDXGLRSiJLQD 6LJDHVWDVLQVWUXFFLRQHVVLHVWiFRQHFWDQGRHOUHSURGXFWRUVyORDXQ79
Conexiones
$PDULOOR9LGHR
B Si lo conecta a una toma de entrada S VIDEO
&RQHFWHHOFDEOH69,'(2YLGHR6QRVXPLQLVWUDGR'LVIUXWDUiGHLPiJHQHVGHDOWDFDOLGDG
C Si lo conecta a un monitor, proyector o amplificador de AV (receptor) que
disponga de tomas de entrada de video componente (Y/PB/PR o Y/CB/CR)
&RQHFWHHOFRPSRQHQWHPHGLDQWHODVWRPDV&20321(179,'(2287VDOLGDGHYLGHR
FRPSRQHQWHFRQXQFDEOHGHYLGHRFRPSRQHQWHQRVXPLQLVWUDGRRFRQWUHVFDEOHVGHYLGHRQR
VXPLQLVWUDGRVGHOPLVPRWLSR\ORQJLWXG2EWHQGUiXQDUHSURGXFFLyQSUHFLVDGHOFRORUH
LPiJHQHVGHDOWDFDOLGDG
9HUGH
9HUGH
$]XO
$]XO
5RMR
5RMR
1RWDV
‡ &RQHFWHHOUHSURGXFWRUGLUHFWDPHQWHDOD793XHGHQRUHFLELULPiJHQHVQtWLGDVHQODSDQWDOODGHO79VL
WUDQVPLWHODVVHxDOHVGHOUHSURGXFWRUPHGLDQWHODYLGHRJUDEDGRUD
9LGHRJUDEDGRUD
5HSURGXFWRUGH
&''9'
&RQHFWDU
GLUHFWDPHQWH
79
‡ 6yORSDUDPRGHORVGH$VLD2FHDQtD
3XHGHFDPELDUHOVLVWHPDGHFRORUGHOUHSURGXFWRUSDUDTXHFRUUHVSRQGDFRQHOVLVWHPDGHFRORUGHO79
FRQHFWDGRSiJLQD c FRQWLQ~D
19
Paso 2: Conexión de los cables de audio
&RQVXOWHODVLJXLHQWHWDEODSDUDVHOHFFLRQDUODFRQH[LyQTXHPHMRUVHDGDSWHDVXVLVWHPD
7DPELpQDVHJ~UHVHGHOHHUODVLQVWUXFFLRQHVGHORVFRPSRQHQWHVTXHGHVHDFRQHFWDU
Seleccione una conexión
6HOHFFLRQHXQDGHODVVLJXLHQWHVFRQH[LRQHVGH A D D &RPSRQHQWHVTXHYDQDFRQHFWDUVH
6XFRQILJXUDFLyQ
79
‡ (IHFWRVHQYROYHQWHV796',1È0,&2
SiJLQD 796(192/9(17(SiJLQD A SiJLQD (MHPSOR
$PSOLILFDGRUHVWpUHRUHFHSWRU\GRVDOWDYRFHV
‡ (IHFWRVHQYROYHQWHV796(67$1'$5
SiJLQD R
3ODWLQDGH0''$70LQL'LVFRV&LQWDGH
DXGLRGLJLWDO
‡ (IHFWRVHQYROYHQWHVQLQJXQR
B SiJLQD (MHPSOR
$PSOLILFDGRUGH$9UHFHSWRUFRQ
GHFRGLILFDGRU'ROE\6XUURXQG3UR/RJLF\
GHDDOWDYRFHV
‡ (IHFWRVHQYROYHQWHV'ROE\6XUURXQG3UR
/RJLFSiJLQD C SiJLQD (MHPSOR
$PSOLILFDGRUGH$9UHFHSWRUFRQHQWUDGD
GLJLWDOTXHGLVSRQJDGHGHFRGLILFDGRU'ROE\
'LJLWDODXGLR03(*R'76\DOWDYRFHV
‡ (IHFWRVHQYROYHQWHV'ROE\'LJLWDOFDQDOHV
SiJLQD '76FDQDOHVSiJLQD DXGLR03(*FDQDOHVSiJLQD D SiJLQD (MHPSOR
)DEULFDGREDMROLFHQFLDGH'ROE\/DERUDWRULHV
³'ROE\´³3UR/RJLF´\HOVtPERORGHODGREOH
'VRQPDUFDVFRPHUFLDOHVGH'ROE\
/DERUDWRULHV
³'76´\³'76'LJLWDO2XW´VRQPDUFDV
FRPHUFLDOHVGH'LJLWDO7KHDWHU6\VWHPV,QF
20
&RQH[LyQ
A
Conexión al TV
(VWDFRQH[LyQXWLOL]DUiORVDOWDYRFHVGHO79SDUDHOVRQLGR
5HSURGXFWRUGH&''9'
Conexiones
DPDULOOR
DPDULOOR
EODQFR
EODQFR
URMR
URMR
&DEOHGHDXGLR
YLGHRVXPLQLVWUDGR
D/,1(287/5$8',2
VDOLGDGHDXGLRL]TXLHUGD
GHUHFKD
79
DHQWUDGDGHDXGLR
l)OXMRGHVHxDOHV
/DFODYLMDDPDULOODVHXWLOL]DSDUDVHxDOHVGHYLGHR
SiJLQD z &RQVHMR
&XDQGRFRQHFWHHOUHSURGXFWRUDXQ79
PRQRIyQLFRXWLOLFHXQFDEOHGHFRQYHUVLyQGH
HVWpUHRDPRQRIyQLFRQRVXPLQLVWUDGR&RQHFWH
ODVWRPDV/,1(287/5$8',2VDOLGDGH
DXGLRL]TXLHUGDGHUHFKDDODWRPDGHHQWUDGDGH
DXGLRGHO79
c FRQWLQ~D
21
B Conexión a un amplificador estéreo (receptor) y 2 altavoces/Conexión a
una platina de MD (Mini Discos) o DAT (Cinta de audio digital)
Si el amplificador estéreo (receptor) sólo dispone de tomas de entrada de audio izquierda y
derecha, utilice B-1 . Si el amplificador (receptor) dispone de toma de entrada digital, o cuando
lo conecte a una platina de MD (Mini Discos) o DAT (Cinta de audio digital), utilice B-2 . En
este caso, también puede conectar el reproductor directamente a la platina de MD (Mini Discos)
o DAT (Cinta de audio digital) sin utilizar el amplificador estéreo (receptor).
Reproductor de CD/DVD
Cable de audio
estéreo (no
suministrado)
Cable de conexión
digital coaxial (no
suministrado)
(blanco)
o
(rojo)
a DIGITAL OUT
(COAXIAL) (salida
digital (coaxial))
a LINE OUT L/R (AUDIO)
(salida de audio
izquierda/derecha)
(blanco)
(rojo)
a entrada digital
coaxial
[Altavoces]
Amplificador estéreo (receptor)
Frontal (izquierdo)
Frontal (derecho)
l: Flujo de señales
z Consejo
En la conexión B-1 , puede utilizar el cable de
audio/video suministrado en lugar de emplear un
cable de audio independiente.
22
a entrada de audio
Platina de MD/DAT
(Mini Discos/Cinta de
audio digital)
C Conexión a un amplificador de AV (receptor) con decodificador Dolby
Surround (Pro Logic) y de 3 a 6 altavoces
5HSURGXFWRUGH&''9'
Conexiones
6yORSRGUiGLVIUXWDUGHORVHIHFWRV'ROE\6XUURXQGDOUHSURGXFLUGLVFRVGHVRQLGR'ROE\
6XUURXQGRPXOWLFDQDO'ROE\'LJLWDO
6LHODPSOLILFDGRUUHFHSWRUVyORGLVSRQHGHWRPDVGHHQWUDGDGHDXGLRL]TXLHUGD\GHUHFKD
XWLOLFH C-1 6LHODPSOLILFDGRUUHFHSWRUGLVSRQHGHWRPDGHHQWUDGDGLJLWDOXWLOLFH C-2 &DEOHGHDXGLR
&DEOHGHFRQH[LyQ HVWpUHRQR
GLJLWDOFRD[LDOQR VXPLQLVWUDGR EODQFR
VXPLQLVWUDGR
R
URMR
D',*,7$/287
&2$;,$/VDOLGDGLJLWDO
FRD[LDO
D/,1(287/5$8',2
VDOLGDGHDXGLRL]TXLHUGD
GHUHFKD
EODQFR
DHQWUDGDGHDXGLR
DHQWUDGDGLJLWDOFRD[LDO
>$OWDYRFHV@
URMR
$PSOLILFDGRUUHFHSWRUFRQ
GHFRGLILFDGRU'ROE\6XUURXQG
3RVWHULRU 3RVWHULRU
L]TXLHUGR GHUHFKR
$OWDYR]
SRWHQFLDGRU
GHJUDYHV
l)OXMRGHVHxDOHV
>$OWDYRFHV@
)URQWDO
)URQWDO
L]TXLHUGR GHUHFKR
&HQWUDO
3RVWHULRUPRQR
1RWD
&XDQGRFRQHFWHDOWDYRFHVVXVWLWX\DHODOWDYR]
SRVWHULRUPRQRIyQLFRSRUXQDOWDYR]FHQWUDO
DOWDYRFHVSRVWHULRUHV\XQDOWDYR]SRWHQFLDGRUGH
JUDYHV
c FRQWLQ~D
23
D Conexión a un amplificador de AV (receptor) con entrada digital que
disponga de decodificador Dolby Digital, audio MPEG o DTS y 6 altavoces
(VWDFRQH[LyQSHUPLWHXWLOL]DUODIXQFLyQGHGHFRGLILFDGRU'ROE\'LJLWDODXGLR03(*R'76
GHODPSOLILFDGRUGH$9UHFHSWRU1RSRGUiGLVIUXWDUGHORVHIHFWRVGHVRQLGRHQYROYHQWHGHO
UHSURGXFWRU
5HSURGXFWRUGH&''9'
D',*,7$/287
&2$;,$/VDOLGD
GLJLWDOFRD[LDO
&DEOHGHFRQH[LyQ
GLJLWDOFRD[LDOQR
VXPLQLVWUDGR
DHQWUDGDGLJLWDO
FRD[LDO
>$OWDYRFHV@
3RVWHULRU
L]TXLHUGR
$PSOLILFDGRUGH$9UHFHSWRU
FRQGHFRGLILFDGRU
$OWDYR]SRWHQFLDGRU
GHJUDYHV
3RVWHULRUGHUHFKR
>$OWDYRFHV@
)URQWDOL]TXLHUGR
&HQWUDO
)URQWDOGHUHFKR
l)OXMRGHVHxDOHV
1RWDV
‡ 7UDVILQDOL]DUODFRQH[LyQDVHJ~UHVHGHDMXVWDU
³'2/%<',*,7$/´HQ³'2/%<',*,7$/´\
³'76´HQ³6,´HQOD&RQILJXUDFLyQUiSLGD
SiJLQD (QFDVRFRQWUDULRQRVHRLUiHO
VRQLGRSRUORVDOWDYRFHV
24
‡ 6yORSDUDPRGHORVGH$VLD2FHDQtD
6LHODPSOLILFDGRUGH$9UHFHSWRUGLVSRQHGH
GHFRGLILFDGRUGHDXGLR03(*DMXVWH³03(*´HQ
³03(*´SiJLQD (QFDVRFRQWUDULRQRVH
RLUiHOVRQLGRSRUORVDOWDYRFHV
Paso 3: Conexión del cable de alimentación
&RQHFWHORVFDEOHVGHDOLPHQWDFLyQGHOUHSURGXFWRU\GHO79DXQDWRPDGHFD
5HDOLFHORVVLJXLHQWHVSDVRVSDUDOOHYDUDFDERODPtQLPDFDQWLGDGGHDMXVWHVEiVLFRVFRQHOILQ
GHXWLOL]DUHOUHSURGXFWRU
3DUDRPLWLUXQDMXVWHSUHVLRQH>3DUDUHFXSHUDUHODMXVWHDQWHULRUSUHVLRQH.
/DVLQGLFDFLRQHVGHSDQWDOODVHUiQGLIHUHQWHVGHSHQGLHQGRGHOPRGHORGHOUHSURGXFWRU
Conexiones
Paso 4: Configuración rápida
4 Presione ENTER (introducción) sin
insertar ningún disco.
$SDUHFHODSDQWDOODGHDMXVWHVSDUD
VHOHFFLRQDUHOLGLRPDXWLOL]DGRHQODV
LQGLFDFLRQHVGHSDQWDOOD
/RVLGLRPDVGLVSRQLEOHVGLILHUHQ
GHSHQGLHQGRGHOPRGHORGHUHSURGXFWRU
AJUSTE DE IDIOMA
MENU PANTALLA:
MENU:
AUDIO:
SUBTITULO :
1 Encienda el TV.
2 Presione [1.
3 Cambie el selector de entrada de
su TV, para que la señal del
reproductor aparezca en la
pantalla del TV.
(OPHQVDMH³7RTXH>(17(5@SDUD
$-867(5È3,'2´DSDUHFHHQODSDUWH
LQIHULRUGHODSDQWDOOD6LHVWHPHQVDMHQR
DSDUHFHVHOHFFLRQH³5È3,'2´HQ
³$-867(´HQODEDUUDGHFRQWUROSDUD
HMHFXWDU&RQILJXUDFLyQUiSLGD
SiJLQD ESPAÑOL
ESPAÑOL
PORTUGUESE
INGLES
FRANCES
5 Presione X/x para seleccionar un
idioma.
(OUHSURGXFWRUXWLOL]DHOLGLRPD
VHOHFFLRQDGRDTXtSDUDPRVWUDUHOPHQ~\
ORVVXEWtWXORV
6 Presione ENTER (introducción).
$SDUHFHODSDQWDOODGHDMXVWHVSDUD
VHOHFFLRQDUODUHODFLyQGHDVSHFWRGHO79
TXHYD\DDFRQHFWDU
AJUSTE PANTALLA
4:3 LETTER BOX
TIPO TV:
PROTECTOR PANTALLA: 4:3 LETTER BOX
4:3 PAN SCAN
FONDO:
16:9
c FRQWLQ~D
25
7 Presione X/x para seleccionar el
ajuste correspondiente a su tipo
de TV.
◆ Si tiene un TV estándar 4:3
‡ /(77(5%2;R3$16&$1
SiJLQD ◆ TV de pantalla panorámica o TV
estándar 4:3 con modo de pantalla
panorámica
10Presione X/x para seleccionar el
tipo de señal Dolby Digital que
desea enviar a su amplificador
(receptor).
(OLMDODVHxDOTXHFRLQFLGDFRQOD
FRQH[LyQGHDXGLRVHOHFFLRQDGDHQ
SiJLQDV D B D D AJUSTE AUDIO
ATENUACION DE AUDIO:
NO
AUDIO DRC:
ESTANDAR
MEZCLA:
DOLBY SURROUND
SALIDA DIGITAL:
SI
D-PCM
DOLBY DIGITAL:
D-PCM
DTS:
DOLBY DIGITAL
‡ SiJLQD 8 Presione ENTER (introducción).
$SDUHFHODSDQWDOODGHDMXVWHVSDUD
VHOHFFLRQDUHOWLSRGHWRPDXWLOL]DGDSDUD
FRQHFWDUHODPSOLILFDGRUUHFHSWRU
B-2
¿DVD conectado a receptor-amp?
Elija tipo de toma utilizado.
C-2
‡ '3&0SiJLQD D
SI
AUDIO OUTPUT L/R (AUDIO)
DIGITAL OUTPUT
NO
9 Presione X/x para seleccionar el
tipo de toma (si la hubiere) que
está utilizando para conectar a un
amplificador (receptor), luego
presione ENTER (introducción).
‡ '2/%<',*,7$/VyORVLHO
DPSOLILFDGRUUHFHSWRUGLVSRQHGH
GHFRGLILFDGRU'ROE\'LJLWDO
SiJLQD 11Presione ENTER (introducción).
³'76´HVWiVHOHFFLRQDGR
AJUSTE AUDIO
ATENUACION DE AUDIO:
NO
AUDIO DRC:
ESTANDAR
MEZCLA:
DOLBY SURROUND
SALIDA DIGITAL:
SI
D-PCM
DOLBY DIGITAL:
DTS:
NO
NO
SI
(OLMDHOHOHPHQWRTXHFRLQFLGDFRQOD
FRQH[LyQGHDXGLRVHOHFFLRQDGDHQ
SiJLQDV D A D D A
‡ 6LVyORFRQHFWDXQ79\QDGDPiV
VHOHFFLRQH³12´/DFRQILJXUDFLyQ
UiSLGDILQDOL]y\ODVFRQH[LRQHV
WDPELpQVHFRPSOHWDURQ
B-1 C-1
‡ 6HOHFFLRQH³/,1(287387/5
$8',2´/D&RQILJXUDFLyQUiSLGD
ILQDOL]y\ODVFRQH[LRQHVWDPELpQVH
FRPSOHWDURQ
B-2
C-2
D
‡ 6HOHFFLRQH³',*,7$/287387´
$SDUHFHODSDQWDOODGHDMXVWHVSDUD
³'2/%<',*,7$/´
26
12Presione X/x para seleccionar si
desea enviar o no la señal DTS a
su amplificador (receptor).
(OLMDHOHOHPHQWRTXHFRLQFLGDFRQOD
FRQH[LyQGHDXGLRVHOHFFLRQDGDHQ
SiJLQDV D B D D B-2
C-2
‡ 12SiJLQD D
‡ 6,VyORVLHODPSOLILFDGRUUHFHSWRU
GLVSRQHGHGHFRGLILFDGRU'76
SiJLQD 13Presione ENTER (introducción).
/D&RQILJXUDFLyQUiSLGDKDILQDOL]DGR
7RGDVODVFRQH[LRQHV\RSHUDFLRQHVGH
FRQILJXUDFLyQVHKDQFRPSOHWDGR
Conexiones
6yORSDUDPRGHORVGH$VLD2FHDQtD
6LVXDPSOLILFDGRUGH$9UHFHSWRU
GLVSRQHGHGHFRGLILFDGRUGHDXGLR
03(*UHJXOHHODMXVWH³03(*´
SiJLQD Obtención de los efectos de
sonido envolvente
3DUDGLVIUXWDUGHORVHIHFWRVGHVRQLGR
HQYROYHQWHGHHVWHUHSURGXFWRURGHO
DPSOLILFDGRUUHFHSWRUGHEHQDMXVWDUVHORV
VLJXLHQWHVHOHPHQWRVFRPRVHGHVFULEHD
FRQWLQXDFLyQSDUDODFRQH[LyQGHDXGLR
VHOHFFLRQDGDHQSiJLQDV D B D
D &DGDXQRGHHOORVVRQORVYDORUHVSRU
RPLVLyQ\QRHVQHFHVDULRDMXVWDUORVDO
FRQHFWDUHOUHSURGXFWRUSRUSULPHUDYH]
&RQVXOWHHOSiJLQD SDUDXWLOL]DUODSDQWDOOD
GHDMXVWHV
Conexión de audio (páginas 21 a 24)
A
‡ 1RHVQHFHVDULRUHDOL]DUDMXVWHVDGLFLRQDOHV
B-1
C-1
‡ $MXVWH³0(=&/$´D³'2/%<
6855281'´SiJLQD ‡ 6LHOVRQLGRVHGLVWRUVLRQDLQFOXVRFRQHO
YROXPHQGLVPLQXLGRDMXVWH
³$7(18$&,21'($8',2´HQ³6,´
SiJLQD B-2 C-2 D
‡ $MXVWH³0(=&/$´D³'2/%<
6855281'´SiJLQD ‡ $MXVWH³6$/,'$',*,7$/´D³6,´
SiJLQD 27
4 Presione A en el reproductor y
coloque un disco en la bandeja de
discos.
5HSURGXFFLyQGHGLVFRV
Reproducción de discos
$OJXQDVRSHUDFLRQHVSXHGHQVHUGLVWLQWDVR
HVWDUOLPLWDGDVHQIXQFLyQGHO'9'R9,'(2
&'
&RQVXOWHODVLQVWUXFFLRQHVGHXVR
VXPLQLVWUDGDVFRQHOGLVFR
,QGLFDGRUGH
DOLPHQWDFLyQ
H
3DUDFRORFDURWURVGLVFRVHQODEDQGHMD
SUHVLRQH',6&6.,3RPLWLUGLVFR\
FRORTXHORVGLVFRVHQHORUGHQHQHOTXH
GHVHDUHSURGXFLUORV
&DGDYH]TXHSUHVLRQH',6&6.,3RPLWLU
GLVFRODEDQGHMDJLUDSDUDTXHSXHGD
FRORFDUORVGLVFRVHQORVFRPSDUWLPLHQWRV
YDFtRV(OUHSURGXFWRUUHSURGXFHHO~OWLPR
GLVFRFRORFDGRHQODEDQGHMD
A
DISC SKIP
1~PHURGH
&RQODFDUDGHUHSURGXFFLyQ FRPSDUWLPLHQWR
GHGLVFR
KDFLDDEDMR
5 Presione H.
/DEDQGHMDGHGLVFRVVHFLHUUD\HO
UHSURGXFWRUFRPLHQ]DDUHSURGXFLUHO
GLVFRUHSURGXFFLyQFRQWLQXD$MXVWHHO
YROXPHQGHO79RGHODPSOLILFDGRU
UHFHSWRU
&RQDOJXQRVGLVFRVSXHGHYLVXDOL]DUVH
XQPHQ~HQODSDQWDOODGHO793DUD
'9'FRQVXOWHODSiJLQD 3DUD
9,'(2&'FRQVXOWHODSiJLQD Para apagar el reproductor
3UHVLRQH[1(OUHSURGXFWRUHQWUDHQPRGR
GHHVSHUD
1 Encienda el TV.
2 Presione [/1.
(OUHSURGXFWRUVHHQFLHQGH\HOLQGLFDGRU
GHDOLPHQWDFLyQVHLOXPLQDHQYHUGH
3 Cambie el selector de entrada de
su TV, para que la señal del
reproductor aparezca en la
pantalla del TV.
◆ Al utilizar un amplificador (receptor)
(QFLHQGDHODPSOLILFDGRUUHFHSWRU\
VHOHFFLRQHHOFDQDODGHFXDGRSDUDTXH
SXHGDRtUHOVRQLGRGHVGHHOUHSURGXFWRU
28
z &RQVHMR
(OUHSURGXFWRUVHDSDJDUiDXWRPiWLFDPHQWHFXDQGR
ORGHMHHQPRGRGHSDUDGDSRUPiVGHPLQXWRV
)XQFLyQ$XWR3RZHU2II±'HVFRQH[LyQDXWR
Notas sobre la reproducción de pistas de
sonido DTS de un CD
‡ $OUHSURGXFLUGLVFRVFRPSDFWRVFRGLILFDGRV
FRQ'76VHRLUiXQUXLGRH[FHVLYR
SURFHGHQWHGHODVWRPDVHVWpUHRDQDOyJLFDV
3DUDHYLWDUSRVLEOHVGDxRVHQHOVLVWHPDGH
DXGLRHOXVXDULRGHEHWRPDUODV
SUHFDXFLRQHVDSURSLDGDVFXDQGRODVWRPDV
HVWpUHRDQDOyJLFDVGHOUHSURGXFWRUHVWpQ
FRQHFWDGDVDXQVLVWHPDGHDPSOLILFDFLyQ
3DUDUHDOL]DUODUHSURGXFFLyQ'76'LJLWDO
6XUURXQGŒGHEHFRQHFWDUVHXQVLVWHPDGH
GHFRGLILFDGRUH[WHUQRGHFDQDOHVDODV
WRPDVGLJLWDOHVGHOUHSURGXFWRU
Notas sobre la reproducción de discos
DVD con pista de sonido DTS
‡ /DVVHxDOHVGHDXGLR'76VHHPLWHQ
VRODPHQWHPHGLDQWHODWRPD',*,7$/287
&2$;,$/VDOLGDGHDXGLRFRD[LDO
‡ $OUHSURGXFLUXQ'9'FRQSLVWDVGHVRQLGR
'76DMXVWH³'76´HQ³6,´GHQWURGH
³$-867($8',2´SiJLQD ‡ 6LFRQHFWDHOUHSURGXFWRUDXQHTXLSRGH
DXGLRVLQGHFRGLILFDGRU'76QRDMXVWH
³'76´HQ³6,´GHQWURGH³$-867(
$8',2´SiJLQD /RVDOWDYRFHVSXHGHQ
SURGXFLUXQUXLGRH[FHVLYRDIHFWDQGRDVXV
RtGRVRFDXVDQGRGDxRVDORVDOWDYRFHV
Operaciones adicionales
./>
LOAD
DISC SELECT
H X
x
A
DISC SKIP
3DUD
2SHUDFLyQ
6HOHFFLRQDUXQGLVFR
3UHVLRQH',6&
6(/(&7±
VHOHFFLRQDUGLVFR
±HQHOUHSURGXFWRU
3DUDU
3UHVLRQHx
,QWURGXFLUSDXVDV
3UHVLRQHX
5HDQXGDUOD
3UHVLRQHXRH
UHSURGXFFLyQGHVSXpV
GHODSDXVD
,UDOGLVFRVLJXLHQWH
3UHVLRQH',6&6.,3
RPLWLUGLVFR
3DVDUDOFDStWXORSLVWD 3UHVLRQH>
RHVFHQDVLJXLHQWHHQ
HOPRGRGH
UHSURGXFFLyQFRQWLQXD
Reproducción de discos
‡ $MXVWHHOVRQLGRHQ³(67(5(2´XWLOL]DQGR
HOERWyQ$8',2FXDQGRUHSURGX]FDSLVWDV
GHVRQLGR'76GHXQ&'SiJLQD ‡ 1RUHSURGX]FDODVSLVWDVGHVRQLGR'76VLQ
KDEHUFRQHFWDGRSUHYLDPHQWHHOUHSURGXFWRU
DXQFRPSRQHQWHGHDXGLRHTXLSDGRFRQ
GHFRGLILFDGRU'76LQFRUSRUDGR
(OUHSURGXFWRUHQYtDODVHxDO'76DWUDYpV
GHODWRPD',*,7$/287&2$;,$/
VDOLGDGLJLWDOFRD[LDODXQTXHHO
HOHPHQWR³'76´HQ³$-867($8',2´HVWp
DMXVWDGRHQ³12´HQODSDQWDOODGHDMXVWHV
'LVSOD\SiJLQD \SXHGHDIHFWDUDVXV
RtGRVRGDxDUORVDOWDYRFHV
5HWURFHGHUDO
3UHVLRQH.
FDStWXORSLVWDR
HVFHQDDQWHULRUHQHO
PRGRGHUHSURGXFFLyQ
FRQWLQXD
'HWHQHUOD
UHSURGXFFLyQ\
H[WUDHUHOGLVFR
3UHVLRQHZ
5HSHWLUXQDHVFHQD
DQWHULRUVyOR'9'
3UHVLRQH5(3/$<
UHSHWLFLyQ
9HULILTXHVLKD\XQ
GLVFRHQHO
FRPSDUWLPLHQWRSDUD
GLVFRV
3UHVLRQH/2$'
FDUJDHQHO
UHSURGXFWRU
6HLOXPLQDQORV
LQGLFDGRUHV±GHO
Q~PHURGHGLVFRHQHO
YLVXDOL]DGRUGHOSDQHO
IURQWDO
z &RQVHMRV
‡ /DIXQFLyQ5HSHWLFLyQUHVXOWD~WLOFXDQGRGHVHH
YLVXDOL]DUXQDHVFHQDRHVFXFKDUXQGLiORJRTXH
KD\DSDVDGRGHVDSHUFLELGR
‡ $QWHVGHFDUJDUORVGLVFRVVHSXHGHLOXPLQDUXQ
LQGLFDGRUGHOQ~PHURGHGLVFR
1RWD
(VSRVLEOHTXHQRSXHGDXWLOL]DUODIXQFLyQ
5HSHWLFLyQFRQDOJXQDVHVFHQDV
c FRQWLQ~D
29
Reemplazo de discos mientras
reproduce uno (EXCHANGE
(intercambiar))
3XHGHDEULUODEDQGHMDGHGLVFRVPLHQWUDV
UHSURGXFHXQGLVFRSDUDTXHSXHGDYHULILFDUHO
GLVFRTXHUHSURGXFLUiOXHJR\UHHPSOD]DU
RWURVGLVFRVVLQLQWHUUXPSLUODUHSURGXFFLyQ
GHOGLVFRDFWXDO
EXCHANGE
1
2
3
4
5
3XHGHEORTXHDUODEDQGHMDGHGLVFRVSDUD
HYLWDUTXHORVQLxRVODDEUDQ
DISC SKIP
Presione EXCHANGE (intercambiar).
/DEDQGHMDGHGLVFRVVHDEUH\DSDUHFHQ
GRVFRPSDUWLPLHQWRV$~QVLKXELHUD
DOJ~QGLVFRHQUHSURGXFFLyQHO
UHSURGXFWRUQRVHGHWHQGUi
Reemplace los discos en los
compartimientos con discos nuevos.
Presione DISC SKIP (omitir disco).
/DEDQGHMDGHGLVFRVVHDEUH\DSDUHFHQ
RWURVGRVFRPSDUWLPLHQWRV
Reemplace los discos en los
compartimientos con discos nuevos.
Presione EXCHANGE (intercambiar).
6HFLHUUDODEDQGHMDGHGLVFRV
z &RQVHMR
0LHQWUDVODEDQGHMDGHGLVFRVHVWiDELHUWD
± 6LILQDOL]DODUHSURGXFFLyQGHOGLVFRDFWXDOHO
UHSURGXFWRUVHGHWLHQH6LVHUHSURGXFHHOGLVFRHQ
PRGR5HSURGXFFLyQUHSHWLGDGHXQGLVFR
SiJLQD HOGLVFRDFWXDOFRPLHQ]DDVX
UHSURGXFFLyQQXHYDPHQWH
± (QHOPRGRGH5HSURGXFFLyQDOHDWRULDGHWRGRV
ORVGLVFRVSiJLQD VHUHSURGXFHQGHPDQHUD
DOHDWRULDORVWtWXORVSLVWDVFDStWXORVVyORGHOGLVFR
DFWXDO
± (QHOPRGRGH5HSURGXFFLyQGHSURJUDPD
SiJLQD VHUHSURGXFHQORVWtWXORVSLVWDV
FDStWXORVVyORGHOGLVFRDFWXDO
1RWD
1RHPSXMHODEDQGHMDGHGLVFRVSDUDFHUUDUODHQHO
3DVR\DTXHSRGUtDGDxDUHOUHSURGXFWRU
30
Bloqueo de la bandeja de discos
(Control de bloqueo)
Cuando el reproductor está en modo
espera, presione O RETURN (volver),
ENTER (introducción) y luego [/1 en el
control remoto.
(OUHSURGXFWRUVHHQFLHQGH\HOPHQVDMH
³/2&.('´EORTXHDGRDSDUHFHHQHO
YLVXDOL]DGRUGHOSDQHOIURQWDO
/RVERWRQHVA\(;&+$1*(HQHO
UHSURGXFWRUHQHOFRQWUROUHPRWR\HOERWyQZ
QRIXQFLRQDQFRQHOFRQWUROGHEORTXHR
DFWLYDGR
Para desactivar el bloqueo de la bandeja
de discos
&XDQGRHOUHSURGXFWRUHVWiHQPRGRHVSHUD
SUHVLRQHO 5(7851YROYHU(17(5
LQWURGXFFLyQ\[1QXHYDPHQWH
1RWD
$~QFXDQGRVHOHFFLRQH³5(67$85$5´HQ
³$-867(´HQODEDUUDGHFRQWUROSiJLQD OD
EDQGHMDGHGLVFRVFRQWLQXDUiEORTXHDGD
Búsqueda de un punto
determinado de un disco
(Exploración, Reproducción a cámara
lenta, Búsqueda, Congelación de
fotogramas)
/DYHORFLGDGGHUHSURGXFFLyQGH³×B´³×b´
HVDSUR[LPDGDPHQWHHOGREOHGHODYHORFLGDG
QRUPDO/DYHORFLGDGGHUHSURGXFFLyQ³M´
³m´HVPD\RUTXH³M´³m´
Visualización cuadro por cuadro
(Reproducción a cámara lenta)
3UHVLRQH mRM FXDQGRHO
UHSURGXFWRUHVWpHQHOPRGRGHSDXVD3DUD
UHFXSHUDUODUHSURGXFFLyQQRUPDOSUHVLRQH
H
&DGDYH]TXHSUHVLRQHHOERWyQ mR
M GXUDQWHODUHSURGXFFLyQDFiPDUD
OHQWDODYHORFLGDGGHUHSURGXFFLyQFDPELDUi
+D\GRVYHORFLGDGHVGLVSRQLEOHV&DGDYH]
TXHSUHVLRQHHOERWyQFRUUHVSRQGLHQWHOD
LQGLFDFLyQFDPELDUiGHODVLJXLHQWHIRUPD
Reproducción de discos
3XHGHORFDOL]DUUiSLGDPHQWHXQSXQWR
GHWHUPLQDGRGHXQGLVFRREVHUYDQGROD
LPDJHQRUHSURGXFLHQGRDFiPDUDOHQWD
6HQWLGRFRQWUDULR
×b6yOR'9'tmtm
6HQWLGRGHUHSURGXFFLyQ
y
1RWD
&RQDOJXQRV'9'9,'(2&'TXL]iVQRSXHGD
UHDOL]DUDOJXQDVGHODVRSHUDFLRQHVGHVFULWDV
Localización rápida de un punto
reproduciendo el disco hacia
delante o hacia atrás
rápidamente (Exploración)
6HQWLGRFRQWUDULRVyOR'9'
y
/DYHORFLGDGGHUHSURGXFFLyQGH³y´
³
´HVPiVOHQWDTXH³y´³ ´
3UHVLRQH mRM PLHQWUDVVH
UHSURGXFHXQGLVFR&XDQGRHQFXHQWUHHO
SXQWRTXHGHVHHSUHVLRQHHSDUDUHFXSHUDU
ODYHORFLGDGQRUPDO&DGDYH]TXHSUHVLRQHHO
ERWyQ mRM GXUDQWHOD
H[SORUDFLyQODYHORFLGDGGHUHSURGXFFLyQ
FDPELDUi+D\WUHVYHORFLGDGHVGLVSRQLEOHV
&DGDYH]TXHSUHVLRQHHOERWyQ
FRUUHVSRQGLHQWHODLQGLFDFLyQFDPELDUiGHOD
VLJXLHQWHIRUPD
6HQWLGRGHUHSURGXFFLyQ
×B6yOR'9'&'tMtM
31
Reanudación de la
reproducción a partir del
punto en el que detuvo el
disco (Reanudación de
reproducción/Reanudación
multidisco)
(OUHSURGXFWRUUHFXHUGDHOSXQWRHQHOTXH8G
GHWXYRODUHSURGXFFLyQGHOGLVFR
1RWDV
‡ (OSXQWRHQHOTXHKD\DGHWHQLGRODUHSURGXFFLyQ
VHERUUDUiVL
± FDPELDHOPRGRGHUHSURGXFFLyQ
± XVD5HSURGXFFLyQGHSURJUDPPDR5HSURGXFFLyQ
DOHDWRULD
± FDPELDORVYDORUHVGHODSDQWDOODGHDMXVWHV
‡ &XDQGRUHSURGX]FDXQ&'VHERUUDUiHOSXQWRHQ
HOTXHGHWXYRODUHSURGXFFLyQFXDQGRVHDEUDOD
EDQGHMDGHGLVFRVRVHGHVFRQHFWHHOFDEOHGH
DOLPHQWDFLyQ
‡ &XDQGRUHSURGX]FDXQ&''('$726VH
ERUUDUiHOSXQWRHQHOTXHGHWXYRODUHSURGXFFLyQ
FXDQGRHOUHSURGXFWRUHQWUHHQPRGRGHHVSHUDVH
DEUDODEDQGHMDGHGLVFRVRVHGHVFRQHFWHHOFDEOH
GHDOLPHQWDFLyQ
‡ 4XL]iVHVWDIXQFLyQQRHVWpGLVSRQLEOHHQDOJXQRV
GLVFRV
Almacenamiento del punto en el
que Ud. detuvo la reproducción
del disco (Reanudación
multidisco)
Reanudación de la reproducción
del disco actual (Resume Play)
(OUHSURGXFWRUUHFXHUGDHOSXQWRHQHOTXH8G
GHWXYRODUHSURGXFFLyQGHOGLVFRD~QFXDQGR
HOUHSURGXFWRUKD\DHQWUDGRHQPRGRGH
HVSHUDSUHVLRQDQGR[1
1 Mientras se reproduce un disco,
presione x para detener la
reproducción.
³5(680(´DSDUHFHHQHOYLVXDOL]DGRU
GHOSDQHOIURQWDO
2 Presione H.
(OUHSURGXFWRULQLFLDODUHSURGXFFLyQD
SDUWLUGHOSXQWRHQTXHGHWXYRHOGLVFRHQ
HO3DVR
z &RQVHMR
3DUDUHSURGXFLUHOGLVFRGHVGHHOSULQFLSLRSUHVLRQH
xGRVYHFHV\DFRQWLQXDFLyQSUHVLRQHH
32
(OUHSURGXFWRUDOPDFHQDHOSXQWRHQHOTXH
8GGHWXYRHOGLVFR\UHDQXGDODUHSURGXFFLyQ
HQHOPLVPRSXQWRODSUy[LPDYH]TXHLQVHUWH
HOPLVPRGLVFR(OUHSURGXFWRUUHFXHUGDHO
SXQWRGRQGHHOGLVFRKDSDUDGRLQFOXVR
GHVSUXpVGHTXHKD\DUHSURGXFLGRRWURV
GLVFRVHQODEDQGHMD
6HDOPDFHQDQSXQWRVSDUDODUHDQXGDFLyQGH
UHSURGXFFLyQHQODPHPRULDGHKDVWDGLVFRV
'9'9,'(2GLIHUHQWHVVLVHGHVFRQHFWDHO
FDEOHGHDOLPHQWDFLyQ&XDQGRVHDOPDFHQD
XQSXQWRSDUDODUHDQXGDFLyQGHUHSURGXFFLyQ
GHOGLVFRQ~PHURVHERUUDHOSXQWRGH
UHDQXGDFLyQGHUHSURGXFFLyQGHOSULPHU
GLVFR
z &RQVHMRV
‡ 3DUDUHSURGXFLUHOGLVFRGHVGHHOSULQFLSLRSUHVLRQH
xGRVYHFHV\DFRQWLQXDFLyQSUHVLRQHH
‡ 3DUDGHVDFWLYDUODIXQFLyQ5HDQXGDFLyQ
PXOWLGLVFRDMXVWH³5($18'$&,21
08/7,',6&2´HQ³$-867(
3(5621$/,=$'2´D³12´SiJLQD /D
UHSURGXFFLyQFRPLHQ]DQXHYDPHQWHHQHOSXQWR
GHUHDQXGDFLyQSDUDHOGLVFRDFWXDOHQHO
UHSURGXFWRU
1RWD
4XL]iVHVWDIXQFLyQQRHVWpGLVSRQLEOHHQDOJXQRV
GLVFRV
Uso del menú del DVD
/DUHSURGXFFLyQ3%&&RQWUROGH
UHSURGXFFLyQSHUPLWHUHSURGXFLUGLVFRV
9,'(2&'GHIRUPDLQWHUDFWLYDVLJXLHQGR
ODVLQVWUXFFLRQHVGHOPHQ~PRVWUDGRHQOD
SDQWDOODGHO79
%RWRQHV
QXPpULFRV
Reproducción de discos
/RVGLVFRV'9'VHGLYLGHQHQODUJDV
VHFFLRQHVGHXQDLPDJHQRGHP~VLFD
GHQRPLQDGDV³WtWXORV´$OUHSURGXFLUXQ
'9'TXHFRQWHQJDYDULRVWtWXORVSRGUi
VHOHFFLRQDUHOWtWXORTXHGHVHHPHGLDQWHHO
ERWyQ7230(18PHQ~GHWtWXORV
$OUHSURGXFLUGLVFRV'9'TXHOHSHUPLWHQ
VHOHFFLRQDUHOHPHQWRVFRPRHOLGLRPDGHORV
VXEWtWXORV\GHOVRQLGRPHGLDQWHHOERWyQ
0(18PHQ~
Reproducción de discos
VIDEO CD con funciones
PBC (Reproducción PBC)
%RWRQHV
QXPpULFRV
1 Inicie la reproducción de un VIDEO
CD con funciones PBC.
1 Presione TOP MENU (menú de
títulos) o MENU (menú).
$SDUHFHHOPHQ~GHOGLVFRHQODSDQWDOOD
GHO79
(OFRQWHQLGRGHOPHQ~YDUtDVHJ~QHO
GLVFR
2 Presione C/X/x/c o los botones
numéricospara seleccionar el
elemento que desea reproducir o
cambiar.
3 Presione ENTER (introducción).
$SDUHFHHOPHQ~FRUUHVSRQGLHQWHDOD
VHOHFFLyQ
2 Seleccione el número de
elemento y la pista que desea
utilizando X/x o los botones
numéricos.
3 Presione ENTER (introducción).
4 Siga las instrucciones del menú
para realizar operaciones
interactivas.
&RQVXOWHODVLQVWUXFFLRQHVVXPLQLVWUDGDV
FRQHOGLVFR\DTXHHOSURFHGLPLHQWRGH
RSHUDFLyQSXHGHYDULDUHQIXQFLyQGHO
9,'(2&'
Para volver al menú
3UHVLRQHO 5(7851YROYHU
c FRQWLQ~D
33
z &RQVHMR
$ILQGHUHDOL]DUODUHSURGXFFLyQVLQXWLOL]DU3%&
SUHVLRQH.>PLHQWUDVHOUHSURGXFWRUHVWp
SDUDGRSDUDVHOHFFLRQDUXQDSLVWD\DFRQWLQXDFLyQ
SUHVLRQH HR(17(5LQWURGXFFLyQ
/DSDQWDOODGHO79PXHVWUD³5HSURGXFFLyQVLQ
3%&´\HOUHSURGXFWRULQLFLDODUHSURGXFFLyQ
FRQWLQXD1RHVSRVLEOHUHSURGXFLULPiJHQHVILMDV
FRPRXQPHQ~
3DUDUHFXSHUDUHOPRGRGHUHSURGXFFLyQ3%&
SUHVLRQHxGRVYHFHV\DFRQWLQXDFLyQH
Reproducción de pistas
de audio MP3
3XHGHUHSURGXFLU&'V'('$726>&'
520VGLVFRVFRPSDFWRVGHVROROHFWXUD&'
5VGLVFRVFRPSDFWRVJUDEDEOHV&'5:V
GLVFRVFRPSDFWRVUHJUDEDEOHV@JUDEDGRVHQ
IRUPDWR0303(*$XGLR&DSD
1RWDV
‡ 'HSHQGLHQGRGHO9,'(2&'SXHGHQDSDUHFHU
ORVVLJXLHQWHVPHQVDMHV³3UHVLRQH(17(5
LQWURGXFFLyQ´HQHOSDVR\³3UHVLRQH6(/(&7
VHOHFFLRQDU´HQODVLQVWUXFFLRQHVVXPLQLVWUDGDV
FRQHOGLVFR(QHVWHFDVRSUHVLRQHH
‡ /DVIXQFLRQHV3%&GHORV6XSHU9&'VQRHVWiQ
GLVSRQLEOHVHQHVWHUHSURGXFWRU6HSXHGHQ
UHSURGXFLU6XSHU9&'VVyORHQPRGR
UHSURGXFFLyQFRQWLQXD
1 Presione Z y coloque un CD DE
DATOS en la bandeja de discos.
2 Presione H.
/DEDQGHMDGHGLVFRVVHFLHUUD\HO
UHSURGXFWRUFRPLHQ]DDUHSURGXFLUOD
SULPHUDSLVWDGHDXGLRHQIRUPDWR03
HQHOSULPHUiOEXPGHOGLVFR
1RWDV
‡ (ORUGHQGHUHSURGXFFLyQSXHGHVHUGLIHUHQWHGHO
RUGHQGHHGLFLyQ&RQVXOWH³(ORUGHQGH
UHSURGXFFLyQGHODVSLVWDVGHDXGLR03´D
FRQWLQXDFLyQSDUDREWHQHUPD\RULQIRUPDFLyQ
‡ (VWHUHSURGXFWRUSXHGHUHSURGXFLUSLVWDVGHDXGLR
03JUDEDGDVHQODVVLJXLHQWHVIUHFXHQFLDVGH
PXHVWUHR
N+]N+]N+]
34
Selección de álbum y pista
1 Presione MENU (menú).
$SDUHFHUiHQSDQWDOODODOLVWDGHiOEXPHV
03JUDEDGRVHQHO&''('$726
1( 30)
2 Seleccione un álbum con X/x y
presione ENTER (introducción).
$SDUHFHUiODOLVWDGHSLVWDVTXHFRQWLHQH
HOiOEXP
JAZZ
1 ( 90 )
0
0
0
0
0
0
0
1
2
3
4
5
6
7
SHE IS SPECIAL
ALL YOU NEED IS ...
SPICY LIFE
HAPPY HOUR
RIVER SIDE
5
TAKE TIME,TAKE TIME
3 Seleccione una pista con X/x y
presione ENTER (introducción).
/DSLVWDVHOHFFLRQDGDFRPHQ]DUiD
UHSURGXFLUVH
&XDQGRVHHVWiUHSURGXFLHQGRXQDSLVWDR
iOEXPVXWtWXORHVWiVRPEUHDGR
3XHGHUHSURGXFLUSLVWDVGHDXGLR03HQHO
&'520GLVFRFRPSDFWRGHVyOROHFWXUD
&'5GLVFRFRPSDFWRJUDEDEOHR&'5:
GLVFRFRPSDFWRUHJUDEDEOH6LQHPEDUJR
ORVGLVFRVGHEHQHVWDUJUDEDGRVFRQIRUPHDOD
QRUPD,62QLYHOQLYHORIRUPDWR
-ROLHWSDUDTXHHOUHSURGXFWRUUHFRQR]FDODV
SLVWDV
7DPELpQSXHGHUHSURGXFLUGLVFRVJUDEDGRV
HQ0XOWL6HVVLRQVHVLRQHVP~OWLSOHV
&RQVXOWHODVLQVWUXFFLRQHVGHOGLVSRVLWLYR
&'55:RGHOVRIWZDUHGHJUDEDFLyQQR
VXPLQLVWUDGRSDUDREWHQHULQIRUPDFLyQVREUH
HOIRUPDWRGHJUDEDFLyQ
Reproducción de discos
ROCK BEST HIT
KARAOKE
JAZZ
R&B
MY FAVORITE SONGS
CLASSICAL
SALSA OF CUBA
BOSSANOVA
Acerca de las pistas de audio
MP3
Para reproducir un CD Multi Session
(VWHUHSURGXFWRUSXHGHUHSURGXFLU&'V0XOWL
6HVVLRQFXDQGRXQDSLVWDGHDXGLR03HVWp
XELFDGDHQODSULPHUDVHVLyQ7DPELpQVH
SRGUiUHSURGXFLUFXDOTXLHUSLVWDGHDXGLR
03JUDEDGDVHQVHVLRQHVSRVWHULRUHV
&XDQGRVHJUDEDQSLVWDVGHDXGLRHLPiJHQHV
FRQIRUPDWRGH&'GHP~VLFDRGH&'GH
YLGHRHQODSULPHUDVHVLyQVyORVHSRGUi
UHSURGXFLUHVWDSULPHUDVHVLyQ
1RWDV
‡ 6LDJUHJDODH[WHQVLyQ³03´DGDWRVTXHQR
HVWiQHQIRUPDWR03HOUHSURGXFWRUQRORV
UHFRQRFHUiDGHFXDGDPHQWH\JHQHUDUiXQUXLGR
IXHUWHTXHSXHGHGDxDUHOVLVWHPDGHDOWDYRFHV
‡ (OUHSURGXFWRUQRSXHGHUHSURGXFLUSLVWDVGH
DXGLRHQIRUPDWR03352
Para ir a la página siguiente o anterior
3UHVLRQHcRC
Para volver a la pantalla anterior
3UHVLRQHO 5(7851YROYHU
Para apagar el reproductor
3UHVLRQH0(18PHQ~
1RWDV
‡ 6yORVHSXHGHQXWLOL]DUOHWUDVGHODOIDEHWR\
Q~PHURVSDUDORVQRPEUHVGHiOEXPRSLVWDV
&XDOTXLHURWURFDUDFWHUVHUiYLVXDOL]DGRFRPRXQ
DVWHULVFR
‡ 1RSRGUiQYLVXDOL]DUVHHWLTXHWDV,'
c FRQWLQ~D
35
El orden de reproducción de las pistas de
audio MP3
(ORUGHQGHUHSURGXFFLyQGHORViOEXPHV\
SLVWDVJUDEDGRVHQXQ&''('$726HVHO
VLJXLHQWH
◆Estructura del contenido del disco
7UHH 7UHH 7UHH 7UHH 7UHH
iUERO iUERO iUERO iUERO iUERO
‡ 6LDJUHJDQ~PHURVHWFGHODQWHGHORV
QRPEUHVGHODVSLVWDVODVSLVWDVVHUHSURGXFLUiQ
HQHVHRUGHQ
‡ &RPRXQGLVFRFRQPXFKRViUEROHVUHTXLHUHPiV
WLHPSRSDUDFRPHQ]DUVXUHSURGXFFLyQFRORTXH
VXViOEXPHVGHQWURGHORVSULPHURVGRViUEROHV
1RWDV
‡ 'HSHQGLHQGRGHOVRIWZDUHTXHXWLOLFHSDUDFUHDU
XQ&''('$726HORUGHQGHUHSURGXFFLyQVHUi
GLIHUHQWHGHOTXHVHLOXVWUDHQODLPDJHQDQWHULRU
‡ (ORUGHQGHUHSURGXFFLyQDQWHVPHQFLRQDGR
SXHGHQRDSOLFDUVHVLKD\XQWRWDOGHPiVGH
iOEXPHV\SLVWDVHQHO&''('$726
‡ (OUHSURGXFWRUSXHGHUHFRQRFHUKDVWD
iOEXPHVHOUHSURGXFWRUVyORFRQWDUiiOEXPHV
LQFOX\HQGRDTXHOORVTXHQRFRQWHQJDQSLVWDVGH
DXGLRHQIRUPDWR03(OUHSURGXFWRUQRSRGUi
UHSURGXFLUQLQJ~QiOEXPGHVSXpVGHORVSULPHURV
iOEXPHV'HORVSULPHURViOEXPHVHO
UHSURGXFWRUUHSURGXFLUiXQPi[LPRGHHQWUH
iOEXPHV\SLVWDV
ROOT
iOEXP
SLVWD
&XDQGRLQVHUWDXQ&''('$726\SUHVLRQD
HODVSLVWDVHQXPHUDGDVVHUiQUHSURGXFLGDV
XQDGHVSXpVGHRWUDGHVGHODSLVWD1DOD7
&XDOTXLHUVXEiOEXPSLVWDGHQWURGHXQ
iOEXPVHOHFFLRQDGRDFWXDOPHQWHWHQGUi
SULRULGDGVREUHHOVLJXLHQWHiOEXPHQHO
PLVPRiUERO(MHPSORCFRQWLHQHDGH
PDQHUDWDOTXH4VHUiUHSURGXFLGRDQWHVTXH
5
&XDQGRSUHVLRQD0(18PHQ~\ODOLVWDGH
iOEXPHV03DSDUHFHHQSDQWDOOD
SiJLQD ORViOEXPHVHVWDUiQRUGHQDGRV
GHODVLJXLHQWHPDQHUDAtBtCt
DtFtG/RViOEXPHVTXHQR
FRQWHQJDQSLVWDVFRPRHOiOEXPEQR
DSDUHFHUiQHQODOLVWD
36
z &RQVHMRV
Distintas funciones de
modo de reproducción
1
Presione DISPLAY (indicación)
durante la reproducción (o dos veces
durante el modo parada).
$SDUHFHODVLJXLHQWHEDUUDGHFRQWURO
0RGRGHGLVFRV
(Reproducción de programa,
aleatoria, repetida, repetición A-B)
2
Presione ENTER (introducción) para
seleccionar el modo de disco.
3XHGHVHOHFFLRQDU
8QGLVFRR
7RGRVORVGLVFRV
1RWD
(OPRGRGHUHSURGXFFLyQVHFDQFHODUiVL
± DEUHODEDQGHMDGHGLVFRV
± HOUHSURGXFWRUHQWUDHQHOPRGRGHHVSHUD
SUHVLRQDQGR[1
Selección del modo del disco (Un
disco o Todos los discos)
3XHGHUHSURGXFLUXQGLVFRRWRGRVORVGLVFRV
HQHOUHSURGXFWRU$QWHVGHDMXVWDUOD
UHSURGXFFLyQHQ5HSURGXFFLyQGHSURJUDPD
DOHDWRULDRUHSHWLGDGHEHVHOHFFLRQDUVLGHVHD
DSOLFDUHVRVPRGRVGHUHSURGXFFLyQDXQRRD
WRGRVORVGLVFRV
Reproducción de discos
3XHGHHVWDEOHFHUORVVLJXLHQWHVPRGRVGH
UHSURGXFFLyQ
‡ 5HSURGXFFLyQGHSURJUDPDSiJLQD ‡ 5HSURGXFFLyQDOHDWRULDSiJLQD ‡ 5HSURGXFFLyQUHSHWLGDSiJLQD ‡ 5HSHWLFLyQ$%SiJLQD Creación de su propio programa
(Reproducción de programa)
3XHGHUHSURGXFLUHOFRQWHQLGRGHOGLVFRHQHO
RUGHQTXHGHVHHHVWDEOHFLHQGRHORUGHQGHORV
WtWXORVFDStWXORVRSLVWDVGHOPLVPRSDUD
FUHDUVXSURSLRSURJUDPD3XHGHSURJUDPDU
KDVWDHOHPHQWRV$OVHOHFFLRQDUHOPRGR
7RGRVORVGLVFRVSiJLQD SXHGHFUHDUXQ
SURJUDPDSDUDWRGRVORVGLVFRVHQHO
UHSURGXFWRU
%RWRQHV
QXPpULFRV
1
Presione DISPLAY (indicación) dos
veces con el reproductor en el modo
de parada.
$SDUHFHODVLJXLHQWHEDUUDGHFRQWURO
c FRQWLQ~D
37
2
3UHVLRQHXx RORVERWRQHVQXPpULFRV
SDUDHOHJLU³´EDMR³7´\SUHVLRQH
(17(5LQWURGXFFLyQ
Presione C/c para elegir
(PROGRAMA), y presione ENTER
(introducción).
$SDUHFHODSDQWDOODGHSURJUDPDFLyQ
PROGRAMA
– : ––––
BORRAR TODO
1. – – – – –
2. – – – – –
3. – – – – –
4. – – – – –
5. – – – – –
6. – – – – –
3
PROGRAMA
3 : DVD
BORRAR TODO
1. – – – – –
2. – – – – –
3. – – – – –
4. – – – – –
5. – – – – –
6. – – – – –
T
++
(OUHSURGXFWRUHVWiOLVWRSDUDSURJUDPDU
HOSULPHUGLVFR
BORRAR TODO
1. – – – – –
2. – – – – –
3. – – – – –
4. – – – – –
5. – – – – –
6. – – – – –
++
01
02
03
04
05
06
C
++
01
02
03
04
05
06
$FRQWLQXDFLyQSUHVLRQHXxRORV
ERWRQHVQXPpULFRVSDUDHOHJLU³´EDMR
³&´\SUHVLRQH(17(5LQWURGXFFLyQ
Presione c.
PROGRAMA
– : ––––
T
PROGRAMA
– : ––––
BORRAR TODO
1. 3DVD –T02–C03
2. – – – – –
3. – – – – –
4. – – – – –
5. – – – – –
6. – – – – –
T
++
T
++
'LVFRWtWXOR\FDStWXORVHOHFFLRQDGRV
4
◆ Al reproducir un VIDEO CD o CD
3RUHMHPSORVHOHFFLRQHODSLVWD³´
3UHVLRQHXx RORVERWRQHVQXPpULFRV
SDUDHOHJLU³´EDMR³7´\SUHVLRQH
(17(5LQWURGXFFLyQ
Seleccione el disco que desea
programar utilizando los botones
numéricos o X/x, luego presione
ENTER (introducción).
(OFXUVRUVHGHVSOD]DDODILOD³7´GHO
WtWXORRSLVWDHQHVWHFDVR³´
PROGRAMA
– : ––––
7LSRGH 7tWXORVRSLVWDV
JUDEDGDVHQXQGLVFR
GLVFR
PROGRAMA
3 : DVD
BORRAR TODO
1. – – – – –
2. – – – – –
3. – – – – –
4. – – – – –
5. – – – – –
6. – – – – –
T
++
01
02
03
04
05
06
C
++
01
02
03
04
05
06
&DStWXORVJUDEDGRVHQXQGLVFR
³"´DSDUHFHFXDQGRHOUHSURGXFWRUQR
UHSURGXMRHOGLVFR
5
Seleccione el título, capítulo o pista
que desea programar.
◆ Al reproducir un DVD
3RUHMHPSORVHOHFFLRQHHOFDStWXOR³´
GHOWtWXOR³´
38
BORRAR TODO
1. 3DVD –T02–C03
2. 2VCD –T02
3. – – – – –
4. – – – – –
5. – – – – –
6. – – – – –
0:15:30
T
++
'LVFR\SLVWDVHOHFFLRQDGRV
6
Para programar más discos, títulos,
capítulos o pistas, repita los Pasos 3 a
5.
/RVGLVFRVWtWXORVFDStWXORV\SLVWDV
SURJUDPDGRVDSDUHFHQHQHORUGHQ
VHOHFFLRQDGR
7
Presione H para iniciar la
reproducción de programa.
/DUHSURGXFFLyQGHSURJUDPDVHLQLFLD
&XDQGRHOSURJUDPDILQDOLFHSXHGH
UHLQLFLDUHOPLVPRSURJUDPDGHQXHYR
SUHVLRQDQGRH
3UHVLRQH&/($5ERUUDU
Para apagar el reproductor
3UHVLRQH',63/$<LQGLFDFLyQYDULDVYHFHV
KDVWDTXHVHGHVDFWLYHODSDQWDOODGHDMXVWHV
3XHGHUHSURGXFLUGHPDQHUD³DOHDWRULD´ORV
WtWXORVFDStWXORVRSLVWDV$OHVWDEOHFHU
SRVWHULRUPHQWHRWURRUGHQ³DOHDWRULR´HV
SRVLEOHTXHVHREWHQJDXQRUGHQGH
UHSURGXFFLyQGLIHUHQWH$OVHOHFFLRQDUHO
PRGR7RGRVORVGLVFRVSiJLQD SXHGH
UHSURGXFLUWRGRVORVGLVFRVGHPDQHUD
DOHDWRULDHQHOUHSURGXFWRU
Para cancelar o cambiar un programa
1
6LJDORVSDVRVDOGH³&UHDFLyQGHVX
SURSLRSURJUDPD5HSURGXFFLyQGH
SURJUDPD´
2
6HOHFFLRQHHOQ~PHURGHSURJUDPDGHO
GLVFRWtWXORFDStWXORRSLVWDTXHGHVHH
FDQFHODURFDPELDUPHGLDQWHXxRORV
ERWRQHVQXPpULFRV\SXOVHc
3
3DUDFDQFHODUHOSURJUDPDSXOVHC\
OXHJR&/($53DUDFDPELDUHO
SURJUDPDVLJDHO3DVRSDUDQXHYD
SURJUDPDFLyQ
1
Para cancelar todos los discos, títulos,
capítulos o pistas en el orden programado
1
6LJDORVSDVRVDOGH³&UHDFLyQGHVX
SURSLRSURJUDPD5HSURGXFFLyQGH
SURJUDPD´
2
3UHVLRQHX \VHOHFFLRQH³%255$5
72'2´
3
3UHVLRQH(17(5LQWURGXFFLyQ
z &RQVHMR
3XHGHUHDOL]DUXQDUHSURGXFFLyQUHSHWLGDRDOHDWRULD
GHORVWtWXORVFDStWXORVRSLVWDVSURJUDPDGRV
'XUDQWHODUHSURGXFFLyQGHSURJUDPDVLJDORV
SDVRVSDUD³5HSURGXFFLyQUHSHWLGD´SiJLQD R
³5HSURGXFFLyQDOHDWRULD´SiJLQD Reproducción de discos
Para detener la Reproducción de
programa
Reproducción en orden aleatorio
(Reproducción aleatoria)
Presione DISPLAY (indicación)
durante la reproducción.
$SDUHFHODVLJXLHQWHEDUUDGHFRQWURO
2
Presione C/c para seleccionar
(ALEATORIA), luego presione ENTER
(introducción) varias veces para
seleccionar el elemento que quiere
reproducir de manera aleatoria.
TITULO
1RWDV
‡ $OUHSURGXFLU6XSHU9&'VHOWLHPSRWRWDOGHODV
SLVWDVSURJUDPDGDVQRDSDUHFHHQODSDQWDOOD
‡ 1RSXHGHXVDUHVWDIXQFLyQFRQ&''('$726
◆ Al reproducir un DVD
‡ ',6&2
‡ 7,78/2
‡ &$3,78/2
c FRQWLQ~D
39
◆ Al reproducir un VIDEO CD o CD
‡ ',6&2
‡ 3,67$
◆ Al reproducir un CD DE DATOS
‡ ',6&2
◆ Cuando la Reproducción de programa
está activada
‡ 6,LQGLFDGHPDQHUDDOHDWRULDWtWXORV
FDStWXORVRSLVWDVVHOHFFLRQDGDVFRQ
5HSURGXFFLyQGHSURJUDPD
3XHGHVHOHFFLRQDU³',6&2´VyORHQHOPRGR
7RGRVORVGLVFRV
Reproducción de forma repetida
(Reproducción repetida)
3XHGHUHSURGXFLUWRGRVORVWtWXORViOEXPHVR
SLVWDVGHXQGLVFRRVyORXQWtWXORFDStWXOR
iOEXPRSLVWDGHIRUPDUHSHWLGD
3XHGHXWLOL]DUXQDFRPELQDFLyQGHORVPRGRV
GHUHSURGXFFLyQDOHDWRULDRGHSURJUDPD$O
VHOHFFLRQDUHOPRGR7RGRVORVGLVFRV
SiJLQD SXHGHUHSHWLUWRGRVORVGLVFRVGH
PDQHUDDOHDWRULDHQHOUHSURGXFWRU
Para recuperar la reproducción normal
3UHVLRQH&/($5ERUUDURVHOHFFLRQH³12´
HQHO3DVR
Para desactivar la barra de control
3UHVLRQH',63/$<LQGLFDFLyQYDULDVYHFHV
KDVWDTXHODEDUUDGHFRQWUROVHGHVDFWLYH
z &RQVHMRV
‡ 3XHGHDMXVWDU5HSURGXFFLyQDOHDWRULDPLHQWUDVHO
UHSURGXFWRUHVWiSDUDGR'HVSXpVGHVHOHFFLRQDU
ODRSFLyQ³$/($725,$´SUHVLRQHH6HLQLFLD
ODUHSURGXFFLyQDOHDWRULD
‡ (VSRVLEOHUHSURGXFLUKDVWDFDStWXORVGHXQ
GLVFRHQRUGHQDOHDWRULRVLVHVHOHFFLRQD
³&$3,78/2´
1
Presione DISPLAY (indicación)
durante la reproducción.
$SDUHFHODVLJXLHQWHEDUUDGHFRQWURO
2
Presione C/c para seleccionar
(REPETICION), luego presione ENTER
(introducción) varias veces para
seleccionar el elemento que quiere
repetir.
CAPITULO
40
◆ Al reproducir un DVD
‡ ',6&2UHSLWHWRGRVORVWtWXORVGHO
GLVFRDFWXDOHQPRGR8QGLVFRRGH
WRGRVORVGLVFRVHQHOPRGR7RGRVORV
GLVFRV
‡ 7,78/2UHSLWHHOWtWXORDFWXDOGHXQ
GLVFR
‡ &$3,78/2UHSLWHHOFDStWXORDFWXDO
3XHGHUHSURGXFLUXQDSDUWHHVSHFtILFDGHXQ
WtWXORFDStWXORRSLVWDGHIRUPDUHSHWLGD(VWD
IXQFLyQUHVXOWD~WLOSDUDPHPRUL]DUODOHWUDGH
ODVFDQFLRQHVHWF
Reproducción de discos
◆ Al reproducir un VIDEO CD o CD
‡ ',6&2UHSLWHWRGRVORVWtWXORVGHO
GLVFRDFWXDOHQPRGR8QGLVFRRGH
WRGRVORVGLVFRVHQHOPRGR7RGRVORV
GLVFRV
‡ 3,67$UHSLWHODSLVWDDFWXDO
Repetición de una parte
específica (Repetición A-B)
◆ Al reproducir un CD DE DATOS (audio
MP3)
‡ ',6&2UHSLWHWRGRVORViOEXPHVGHO
GLVFRDFWXDOHQPRGR8QGLVFRRGH
WRGRVORVGLVFRVHQHOPRGR7RGRVORV
GLVFRV
‡ $/%80UHSLWHHOiOEXPDFWXDO
‡ 3,67$UHSLWHODSLVWDDFWXDO
◆ Cuando la Reproducción de programa
o la aleatoria está activada
‡ 6,UHSLWHODUHSURGXFFLyQGHSURJUDPD
RODDOHDWRULD
1
Presione DISPLAY (indicación)
durante la reproducción.
$SDUHFHODVLJXLHQWHEDUUDGHFRQWURO
Para recuperar la reproducción normal
3UHVLRQH&/($5ERUUDURVHOHFFLRQH³12´
HQHO3DVR
Para desactivar la barra de control
2
3UHVLRQH',63/$<LQGLFDFLyQYDULDVYHFHV
KDVWDTXHODEDUUDGHFRQWUROVHGHVDFWLYH
3
z &RQVHMRV
‡ 3XHGHDMXVWDU5HSURGXFFLyQDOHDWRULDPLHQWUDVHO
UHSURGXFWRUHVWiSDUDGR'HVSXpVGHVHOHFFLRQDU
ODRSFLyQ³5(3(7,&,21´SUHVLRQHH6H
LQLFLDODUHSURGXFFLyQUHSHWLGD
‡ 3XHGHVHOHFFLRQDU³5(3(7,&,21´GLUHFWDPHQWH
SUHVLRQDQGR5(3($7
Presione C/c para seleccionar
(A-B REPETICION).
Durante la reproducción, presione
ENTER (introducción) cuando
encuentre el punto de inicio (punto A)
de la parte que desea reproducir de
forma repetida.
(OSXQWRGHLQLFLRSXQWR$TXHGD
DMXVWDGR
A13 – 0:27:34 B
4
Cuando llegue al punto final (punto B),
presione ENTER (introducción) de
nuevo.
$SDUHFHQORVSXQWRVDMXVWDGRV\HO
UHSURGXFWRUFRPLHQ]DDUHSHWLUHVWDSDUWH
HVSHFtILFD
c FRQWLQ~D
41
Para recuperar la reproducción normal
3UHVLRQH&/($5ERUUDU
Para desactivar la barra de control
3UHVLRQH',63/$<LQGLFDFLyQYDULDVYHFHV
KDVWDTXHODEDUUDGHFRQWUROVHGHVDFWLYH
1RWD
$OGHILQLUODUHSURGXFFLyQUHSHWLGD$%ORVDMXVWHV
FRUUHVSRQGLHQWHVDODVUHSURGXFFLRQHVDOHDWRULD
UHSHWLGD\GHSURJUDPDVHFDQFHODQ
42
2 Presione SEARCH MODE (modo de
%~VTXHGDGHHVFHQDV
búsqueda) varias veces para
seleccionar el método de búsqueda.
◆ Al reproducir un DVD
7,78/2
&$3,78/2
7,(0327(;72
6HOHFFLRQH³7,(0327(;72´SDUD
EXVFDUXQSXQWRGHLQLFLRLQWURGXFLHQGR
HOFyGLJRGHWLHPSR
3XHGHEXVFDUHQORVGLVFRV'9'PHGLDQWH
WtWXORRFDStWXOR\HQORVGLVFRV9,'(2&'R
&'PHGLDQWHSLVWDtQGLFHRHVFHQD3XHVWR
TXHDORVWtWXORV\SLVWDVVHOHVDVLJQDQ
Q~PHURV~QLFRVHQHOGLVFRSXHGHVHOHFFLRQDU
HOTXHGHVHHLQWURGXFLHQGRVXQ~PHUR2
SXHGHEXVFDUHVFHQDVXWLOL]DQGRHOFyGLJRGH
WLHPSR
◆ Al reproducir un VIDEO CD
3,67$R
,1',&(
%RWRQHV
QXPpULFRV
◆ Al reproducir un VIDEO CD con
reproducción PBC
(6&(1$R
,1',&(
Búsqueda de escenas
Búsqueda de títulos/
capítulos/pistas/índices/
escenas (Modo de búsqueda)
◆ Al reproducir un CD
3,67$R
,1',&(
◆ Al reproducir un CD DE DATOS (audio
MP3)
$/%80R
3,67$
3 Seleccione el número del título,
pista, escena, código de tiempo,
etc. que desea, utilizando los
botones numéricos.
1 Presione SEARCH MODE (modo de
búsqueda)
$SDUHFHODVLJXLHQWHSDQWDOOD
³´DSDUHFHMXQWRDOLFRQRVH
UHILHUHDXQQ~PHUR
(OQ~PHURHQWUHSDUpQWHVLVLQGLFDHO
Q~PHURWRWDOGHWtWXORVSLVWDV
tQGLFHVHVFHQDVHWFGHOGLVFR
3RUHMHPSORSDUDEXVFDUODHVFHQD
VLWXDGDDKRUDVPLQXWRV\
VHJXQGRVGHOSULQFLSLRVHOHFFLRQH
³7,(0327(;72´HQHO3DVRH
LQWURGX]FD³´
Si comete un error
&DQFHOHHOQ~PHURSUHVLRQDQGR&/($5
ERUUDU\GHVSXpVVHOHFFLRQHRWURQ~PHUR
4 Presione ENTER (introducción).
(OUHSURGXFWRULQLFLDODUHSURGXFFLyQD
SDUWLUGHOQ~PHURVHOHFFLRQDGR
– – (10)
z &RQVHMR
&XDQGRODSDQWDOODHVWpDSDJDGDSXHGHEXVFDUXQ
FDStWXOR'9'RXQDSLVWD&'SUHVLRQDQGRORV
ERWRQHVQXPpULFRV\(17(5LQWURGXFFLyQ
43
9LVXDOL]DFLyQGHODLQIRUPDFLyQ
VREUHHOGLVFR
Comprobación del
tiempo de reproducción
y del restante
3XHGHYHULILFDUHOWLHPSRGHUHSURGXFFLyQ\HO
WLHPSRUHVWDQWHGHOWtWXORFDStWXORRSLVWD
DFWXDO7DPELpQSXHGHYHULILFDUHOWH[WRGHO
'9'&'RHOQRPEUHGHODSLVWDDXGLR03
JUDEDGRHQHOGLVFR
‡ 7±
7LHPSRUHVWDQWHGHOWtWXORDFWXDO
‡ &
7LHPSRGHUHSURGXFFLyQGHOFDStWXOR
DFWXDO
‡ &±
7LHPSRUHVWDQWHGHOFDStWXORDFWXDO
◆ Al reproducir un VIDEO CD (con
funciones PBC)
‡ 7LHPSRGHUHSURGXFFLyQGHODHVFHQD
DFWXDO
◆ Al reproducir un VIDEO CD (sin
funciones PBC) o CD
‡ 7
7LHPSRGHUHSURGXFFLyQGHODSLVWDDFWXDO
‡ 7±
7LHPSRUHVWDQWHGHODSLVWDDFWXDO
‡ '
7LHPSRGHUHSURGXFFLyQGHOGLVFR
DFWXDO
‡ ' ±
7LHPSRUHVWDQWHGHOGLVFRDFWXDO
◆ Al reproducir un CD DE DATOS (audio
MP3)
‡ 7LHPSRGHUHSURGXFFLyQGHODSLVWD
DFWXDO
◆ Al reproducir un Super VCD (Sólo para
1 Presione DISPLAY (indicación)
varias veces durante la
reproducción hasta que aparezca
(TIEMPO/TEXTO).
7tWXORSLVWD&'
1~PHUR\
9,'(2&'HVFHQDR
WLSRGHGLVFR Q~PHURGHiOEXP
3:DVD T41 – 8
T 1:01:57
,QIRUPDFLyQ
&DStWXORtQGLFHR
SLVWD&''('$726 GHWLHPSR
2 Presione ENTER (introducción)
varias veces para cambiar la
información de tiempo.
/DLQGLFDFLyQ\ORVWLSRVGHWLHPSRTXH
SXHGHQFDPELDUGHSHQGHQGHOGLVFRTXH
UHSURGX]FD
◆ Al reproducir un DVD
‡ 7
7LHPSRGHUHSURGXFFLyQGHOWtWXORDFWXDO
44
modelos de Asia/Oceanía)
‡ 7
7LHPSRGHUHSURGXFFLyQGHODSLVWDDFWXDO
Para desactivar la barra de control
3UHVLRQH',63/$<LQGLFDFLyQYDULDVYHFHV
KDVWDTXHODEDUUDGHFRQWUROVHGHVDFWLYH
Para verificar el texto del DVD/CD o el
nombre de la pista (MP3 audio)
3UHVLRQH(17(5LQWURGXFFLyQYDULDVYHFHV
HQHO3DVRSDUDYLVXDOL]DUHOWH[WRJUDEDGR
HQHO'9'&'&''('$726
(OWH[WRGHO'9'&'DSDUHFHVyORFXDQGRHO
WH[WRHVWiJUDEDGRHQHOGLVFR1RSXHGH
FDPELDUHOWH[WR6LHOGLVFRQRFRQWLHQHWH[WR
DSDUHFHHQSDQWDOODODOH\HQGD³127(;7´
(Q&''('$726VyORDSDUHFHHQSDQWDOODHO
QRPEUHGHODSLVWDGHDXGLRHQIRUPDWR03
BRAHMS SYMPHONY
Comprobación de la información
en el visualizador del panel
frontal
3XHGHYLVXDOL]DUODLQIRUPDFLyQGHOWLHPSR\
HOWH[WRYLVXDOL]DGRHQODSDQWDOODGHO79
WDPELpQHQHOYLVXDOL]DGRUGHOSDQHOIURQWDO
/DLQIRUPDFLyQHQHOYLVXDOL]DGRUGHOSDQHO
IURQWDOFDPELDFRPRVHGHVFULEHD
FRQWLQXDFLyQFXDQGRFDPELDODLQIRUPDFLyQ
GHOWLHPSRHQODSDQWDOODGHVX79
Al reproducir un VIDEO CD (sin funciones
PBC) o CD
7LHPSRGHUHSURGXFFLyQGHSLVWD\
Q~PHURGHGLVFRDFWXDOSLVWDHtQGLFH
7LHPSRUHVWDQWH
GHODSLVWDDFWXDO
7LHPSRGHUHSURGXFFLyQGHOGLVFR
Al reproducir un DVD
7LHPSRUHVWDQWHGHOGLVFR
7LHPSRUHVWDQWHGHOWtWXORDFWXDO
7H[WR
7LHPSRGHUHSURGXFFLyQ\Q~PHURGHO
FDStWXORDFWXDO
Al reproducir un CD DE DATOS (audio
MP3)
7LHPSRUHVWDQWH
GHOFDStWXORDFWXDO
7LHPSRGHUHSURGXFFLyQGHSLVWD\
Q~PHURGHOGLVFRDFWXDOiOEXP\SLVWD
7H[WR
1RPEUHGHODSLVWD
Visualización de la información sobre el disco
7LHPSRGHUHSURGXFFLyQGHOWtWXOR\
Q~PHURGHGLVFRDFWXDOWtWXOR\FDStWXOR
z &RQVHMRV
‡ $OUHSURGXFLUGLVFRV9,'(2&'FRQIXQFLRQHV
3%&DSDUHFHHOQ~PHURGHGLVFRHVFHQD\HO
WLHPSRGHUHSURGXFFLyQ
‡ (OWH[WRODUJRTXHQRHQWUHHQXQDVRODOtQHDVH
GHVSOHJDUiDORODUJRGHOYLVXDOL]DGRUGHOSDQHO
IURQWDO
‡ 7DPELpQSXHGHYHULILFDUODLQIRUPDFLyQGHO
WLHPSR\HOWH[WRSUHVLRQDQGRYDULDVYHFHV7,0(
7(;7WLHPSRWH[WR
1RWDV
‡ 'HSHQGLHQGRGHOWLSRGHGLVFRTXHUHSURGX]FDHV
SRVLEOHTXHHOWH[WRRHOQRPEUHGHODSLVWDGHO
'9'&'QRDSDUH]FDQHQSDQWDOOD
‡ (VWHUHSURGXFWRUVyORSXHGHPRVWUDUHOSULPHU
QLYHOGHWH[WRGHO'9'&'FRPRORVWtWXORVR
QRPEUHVGHGLVFRV
‡ (OWLHPSRGHUHSURGXFFLyQGHODVSLVWDVGHDXGLRHQ
IRUPDWR03SXHGHQYLVXDOL]DUVHLQFRUUHFWDPHQWH
45
2 Presione AUDIO (audio) varias
$MXVWHVGHVRQLGR
Cambio del sonido
&XDQGRUHSURGX]FDXQ'9'JUDEDGRHQ
YDULRVIRUPDWRVGHDXGLR3&0'ROE\
'LJLWDODXGLR03(*R'76SXHGHFDPELDU
HOIRUPDWRGHDXGLR6LHO'9'HVWiJUDEDGR
FRQSLVWDVHQYDULRVLGLRPDVSRGUiFDPELDUHO
LGLRPDTXHGHVHH
&RQXQ&'&''('$726R9,'(2&'
SXHGHVHOHFFLRQDUHOVRQLGRGHOFDQDOGHUHFKR
RL]TXLHUGR\HVFXFKDUHOVRQLGRGHOFDQDO
VHOHFFLRQDGRPHGLDQWHORVDOWDYRFHVGHUHFKR
HL]TXLHUGR3RUHMHPSORDOUHSURGXFLUXQ
GLVFRTXHFRQWHQJDXQDFDQFLyQFRQHOVRQLGR
YRFDOHQHOFDQDOGHUHFKR\HOLQVWUXPHQWDOHQ
HOL]TXLHUGRHVSRVLEOHVHOHFFLRQDUHOFDQDO
L]TXLHUGR\HVFXFKDUHOLQVWUXPHQWDOSRU
DPERVDOWDYRFHV
AUDIO
DISPLAY
1 Presione AUDIO (audio) durante la
reproducción.
$SDUHFHODVLJXLHQWHSDQWDOOD
(OQ~PHURHQWUHSDUpQWHVLVLQGLFDOD
FDQWLGDGWRWDOGHVHxDOHVGHDXGLR
GLVSRQLEOHV
1(4):INGLES
46
veces para seleccionar la señal de
audio que desee.
◆ Al reproducir un DVD
/DHOHFFLyQGHLGLRPDYDUtDVHJ~QHO
'9'
6LDSDUHFHQGtJLWRVLQGLFDUiQHOFyGLJR
GHLGLRPD&RQVXOWH³/LVWDGHFyGLJRVGH
LGLRPDV´HQODSiJLQD SDUDYHUORV
FyGLJRVGHFDGDLGLRPD6LHOPLVPR
LGLRPDDSDUHFHGRVRPiVYHFHVVLJQLILFD
TXHHO'9'HVWiJUDEDGRHQYDULRV
IRUPDWRVGHDXGLR
◆ Al reproducir un VIDEO CD, CD, o CD
DE DATOS (audio en formato MP3)
(ODMXVWHSRURPLVLyQDSDUHFHVXEUD\DGR
‡ (67(5(26RQLGRHVWpUHRHVWiQGDU
‡ ,=46RQLGRGHOFDQDOL]TXLHUGR
PRQRIyQLFR
‡ '(56RQLGRGHOFDQDOGHUHFKR
PRQRIyQLFR
◆ Al reproducir un Super VCD (Sólo para
modelos de Asia/Oceanía)
(ODMXVWHSRURPLVLyQDSDUHFHVXEUD\DGR
‡ (67(5(2(OVRQLGRHVWpUHRGHOD
SLVWDGHDXGLR
‡ ,=4(OVRQLGRGHOFDQDOL]TXLHUGR
GHODSLVWDGHDXGLRPRQRIyQLFR
‡ '(5(OVRQLGRGHOFDQDOGHUHFKR
GHODSLVWDGHDXGLRPRQRIyQLFR
‡ (67(5(2(OVRQLGRHVWpUHRGHOD
SLVWDGHDXGLR
‡ ,=4(OVRQLGRGHOFDQDOL]TXLHUGR
GHODSLVWDGHDXGLRPRQRIyQLFR
‡ '(5(OVRQLGRGHOFDQDOGHUHFKR
GHODSLVWDGHDXGLRPRQRIyQLFR
1RWD
&XDQGRUHSURGX]FDXQ6XSHU9&'HQHOTXHODSLVWD
GHDXGLRQRHVWXYLHUDJUDEDGDQRVHRLUiQLQJ~Q
VRQLGRFXDQGRVHOHFFLRQH³(67(5(2´³,=4´
R³'(5´
Comprobación del formato de
señal de audio
Si presiona DISPLAY (indicación) dos veces
durante la reproducción, el formato de la
señal de audio actual (Dolby Digital, audio
MPEG, DTS, PCM, etc.) aparecerá como se
muestra a continuación.
Ejemplo:
Dolby Digital de 5,1 canales
Posterior (izquierdo/derecho)
DOLBY DIGITAL
Al conectar un TV estéreo o 2 altavoces
frontales, TVS (TV Virtual Surround)
permite obtener efectos de sonido envolvente
utilizando imagen de sonido para crear
altavoces posteriores virtuales a partir del
sonido de los altavoces frontales
(L: izquierdo, R: derecho) sin utilizar
altavoces posteriores reales. TVS fue
desarrollado por Sony para producir sonido
envolvente para el hogar utilizando sólo un
TV estéreo.
LFE (Efecto de baja
frecuencia)
Ajustes de sonido
Frontal
(izquierdo/
derecho)
+ Central
3 / 2 .1
Ajustes de sonido TV
Virtual Surround (TVS)
Acerca de las señales de audio
Las señales de audio grabadas en un disco
contienen los elementos sonoros (canales)
mostrados a continuación. Cada canal se
emite mediante un altavoz.
• Frontal (izquierdo)
• Frontal (derecho)
• Central
• Posterior (izquierdo)
• Posterior (derecho)
• Posterior (monofónico): Esta señal puede
ser la procesada con Dolby Surround Sound
o la de audio posterior monofónica del
sonido Dolby Digital.
• Señal LFE (Efecto de baja frecuencia)
1 Presione DISPLAY (indicación)
dos veces durante la
reproducción.
Aparece la siguiente barra de control.
Nota
Si “DTS” se ajusta en “NO” en “AJUSTE AUDIO”,
no aparecerá en pantalla la opción de selección de
pistas DTS aunque el disco contenga pistas DTS
(página 67 ).
c continúa
47
2 Presione C/c para seleccionar
TV
(SURROUND), luego
presione ENTER (introducción)
varias veces para seleccionar uno
de los sonidos TVS.
Consulte las descripciones
proporcionadas para cada elemento.
• TVS DINÁMICO
• TVS ENVOLVENTE
• TVS NOCTURNO
• TVS ESTANDAR
TVS DINÁMICO
Para cancelar el ajuste
Seleccione “NO” en el Paso 2.
Para desactivar la barra de control
Presione DISPLAY (indicación) varias veces
hasta que la barra de control se desactive.
◆TVS NOCTURNO
Los sonidos fuertes, como las explosiones, se
suprimen, aunque los sonidos más silenciosos
no se ven afectados. Esta función es útil
cuando quiera oír el diálogo y disfrutar de los
efectos del sonido envolvente de la función
“TVS ENVOLVENTE” con volumen bajo.
◆TVS ESTANDAR
Crea altavoces posteriores virtuales a partir
del sonido de los altavoces frontales
(izquierdo/derecho) sin utilizar altavoces
posteriores reales. Los altavoces virtuales se
reproducen según se muestra en la siguiente
figura. Utilice este ajuste cuando desee
utilizar TVS con 2 altavoces separados.
L
◆TVS DINÁMICO
Crea altavoces posteriores virtuales a partir del
sonido de los altavoces frontales (izquierdo/
derecho) sin utilizar altavoces posteriores
reales (como se indica a continuación).
Este modo resulta efectivo cuando hay poca
distancia entre los altavoces frontales izquierdo
y derecho, como en el caso de los altavoces
incorporados de los televisores estéreo.
TV
◆TVS ENVOLVENTE
Crea altavoces posteriores virtuales a partir del
sonido de los altavoces frontales (izquierdo/
derecho) sin utilizar altavoces posteriores
reales. Los altavoces virtuales se reproducen
según se muestra en la siguiente figura.
Este modo resulta efectivo cuando hay poca
distancia entre los altavoces frontales
izquierdo y derecho, como en el caso de los
altavoces incorporados de los televisores
estéreo.
48
R
L (izquierda): Altavoz frontal (izquierdo)
R (derecha): Altavoz frontal (derecho)
:
Altavoz virtual
z Consejo
También podrá cambiar el ajuste presionando varias
veces SUR (surround) (o SURROUND) en el
reproductor).
Notas
• Si la señal de reproducción no contiene una señal
para los altavoces posteriores, es posible que
resulte difícil percibir los efectos de sonido
envolvente.
• Cuando seleccione uno de los modos TVS,
desactive el ajuste envolvente del TV o
amplificador (receptor) conectado.
• Compruebe que su posición de audición se
encuentra entre los altavoces a la misma distancia
de éstos y que dichos altavoces están situados en
entornos similares.
• “TVS NOCTURNO” sólo funciona con discos
Dolby Digital y audio MPEG. No obstante, no
todos los discos responden a la función “TVS
NOCTURNO” de la misma forma.
Ajustes de sonido
49
9LVXDOL]DFLyQGHSHOtFXODV
Cambio de los ángulos
6LKD\YDULRViQJXORVJUDEDGRVSDUDXQD
HVFHQDHQHO'9'³$1*/(´iQJXOR
DSDUHFHUiHQHOYLVXDOL]DGRUGHOSDQHOIURQWDO
(VWRVLJQLILFDTXHSXHGHFDPELDUHOiQJXORGH
YLVXDOL]DFLyQ
Visualización de los
subtítulos
&RQGLVFRVHQORVTXHKD\DJUDEDGRV
VXEWtWXORVHVSRVLEOHDFWLYDU\GHVDFWLYDU
GLFKRVVXEWtWXORVFXDQGRORGHVHHGXUDQWHOD
UHSURGXFFLyQGHXQ'9'
SUBTITLE
ANGLE
1 Presione SUBTITLE (subtítulo)
durante la reproducción.
1 Presione ANGLE (ángulo) durante
la reproducción.
/DFDQWLGDGGHiQJXORVDSDUHFHHQOD
SDQWDOOD
(OQ~PHURHQWUHSDUpQWHVLVLQGLFDOD
FDQWLGDGWRWDOGHiQJXORV
2(7)
$SDUHFHODVLJXLHQWHSDQWDOOD
(OQ~PHURHQWUHSDUpQWHVLVLQGLFDHOWRWDO
GHVXEWtWXORVGLVSRQLEOHV
1(8):INGLES
2 Presione SUBTITLE (subtítulo)
varias veces para seleccionar el
idioma.
2 Presione ANGLE (ángulo) varias
veces para seleccionar el número
del ángulo.
/DHVFHQDFDPELDDOiQJXORVHOHFFLRQDGR
1RWD
&RQFLHUWRVGLVFRV'9'HVSRVLEOHTXHQRSXHGD
FDPELDUORViQJXORVDXQTXHKD\DYDULRVJUDEDGRV
HQGLFKRVGLVFRV
50
/DHOHFFLyQGHLGLRPDYDUtDVHJ~QHO
'9'
6LDSDUHFHQGtJLWRVLQGLFDUiQHOFyGLJR
GHLGLRPD&RQVXOWH³/LVWDGHFyGLJRVGH
LGLRPDV´HQODSiJLQD SDUDYHUORV
FyGLJRVGHFDGDLGLRPD
Para desactivar los subtítulos.
6HOHFFLRQH³12´HQHO3DVR
1RWD
&RQFLHUWRVGLVFRV'9'HVSRVLEOHTXHQRSXHGD
FDPELDUORVVXEWtWXORVDXQTXHKD\DVXEWtWXORV
PXOWLOLQJHVJUDEDGRVHQORVPLVPRV8GWDPELpQ
SXHGHGHVDFWLYDUORV
Ajuste de la calidad de
imagen (BNR)
/DIXQFLyQ%155HGXFFLyQGHUXLGRHQ
EORTXHDMXVWDODFDOLGDGGHLPDJHQ
UHGXFLHQGRHO³UXLGRHQEORTXH´RSDWURQHV
WLSRPRVDLFRTXHDSDUHFHQHQODSDQWDOODGHO
79
dos veces durante la
reproducción.
Visualización de películas
1 Presione DISPLAY (indicación)
$SDUHFHODVLJXLHQWHEDUUDGHFRQWURO
2 Presione C/c para seleccionar
(BNR), luego presione
ENTER (introducción) varias veces
para seleccionar un nivel.
1
‡ UHGXFHHO³UXLGRHQEORTXH´
‡ UHGXFHHO³UXLGRHQEORTXH´PiV
TXH ‡ UHGXFHHO³UXLGRHQEORTXH´PiV
TXH c FRQWLQ~D
51
Para cancelar el ajuste“BNR”
6HOHFFLRQH³12´HQHO3DVR
Para desactivar la barra de control
3UHVLRQH',63/$<LQGLFDFLyQYDULDVYHFHV
KDVWDTXHODEDUUDGHFRQWUROVHGHVDFWLYH
1RWDV
‡ 6LHOFRQWRUQRGHODVLPiJHQHVHQSDQWDOODHV
ERUURVRDMXVWH³%15´HQ³12´
‡ 'HSHQGLHQGRGHOGLVFRRGHODHVFHQDHQ
UHSURGXFFLyQHVSRVLEOHTXHHOHIHFWR³%15´
DSHQDVVHDSUHFLH
Ajuste la imagen de
reproducción (MODO DE
VISUALIZACION PERSONALIZADO)
3XHGHDMXVWDUODVHxDOGHYLGHRGH'9'R
9,'(2&'GHOUHSURGXFWRUSDUDREWHQHUOD
FDOLGDGGHLPDJHQTXHGHVHD(OLMDHODMXVWH
TXHPHMRUVHDGDSWHDOSURJUDPDTXHHVWi
PLUDQGR
1 Presione DISPLAY (indicación) dos
veces durante la reproducción.
$SDUHFHODVLJXLHQWHEDUUDGHFRQWURO
2 Presione C/c para seleccionar
(MODO DE VISUALIZACION
PERSONALIZADO), luego presione
ENTER (introducción) (varias veces
para seleccionar el ajuste que
desea.
(ODMXVWHSRURPLVLyQDSDUHFHVXEUD\DGR
DINÁMICO 1
52
‡ (67$1'$5PXHVWUDXQDLPDJHQ
HVWiQGDU
‡ ',1È0,&2 SURGXFHXQDLPDJHQ
GLQiPLFDHQQHJULWDVDXPHQWDQGRHO
FRQWUDVWHGHODLPDJHQ\ODLQWHQVLGDG
GHOFRORU
‡ ',1È0,&2 SURGXFHXQDLPDJHQ
PiVGLQiPLFDTXH',1È0,&2 DXPHQWDQGRHOFRQWUDVWHGHODLPDJHQ\
ODLQWHQVLGDGGHOFRORU
‡ &,1( UHDO]DORVGHWDOOHVHQiUHDV
RVFXUDVDXPHQWDQGRHOQLYHOGHQHJUR
‡ &,1( ORVFRORUHVEODQFRVVHYXHOYHQ
PiVEULOODQWHV\ORVQHJURVPiV
LQWHQVRVHOFRQWUDVWHGHFRORUVH
LQFUHPHQWD
Realce la imagen de
reproducción (ENALTECEDOR
VIDEO DIGITAL)
/DIXQFLyQ'9((QDOWHFHGRUGHYLGHR
GLJLWDOSHUPLWHREWHQHULPiJHQHVPiVQtWLGDV
\PDUFDGDVPHGLDQWHHOUHDOFHGHORV
FRQWRUQRVGHODVLPiJHQHVGHODSDQWDOODGHO
79,JXDOPHQWHHVWDIXQFLyQSXHGHVXDYL]DU
ODVLPiJHQHVHQSDQWDOOD
Para desactivar la barra de control
z &RQVHMR
‡ &XDQGRPLUHXQDSHOtFXODVHUHFRPLHQGD
³&,1( ´R³&,1( ´
‡ 7DPELpQSXHGHVHOHFFLRQDUHODMXVWH³02'2'(
9,68$/,=$&,213(5621$/,=$'2´
SUHVLRQDQGRYDULDVYHFHV3,&785(02'(
PRGRLPDJHQ
ENTER
DISPLAY
1 Presione DISPLAY (indicación) dos
Visualización de películas
3UHVLRQH',63/$<LQGLFDFLyQYDULDVYHFHV
KDVWDTXHODEDUUDGHFRQWUROVHGHVDFWLYH
veces durante la reproducción.
$SDUHFHODVLJXLHQWHEDUUDGHFRQWURO
2 Presione C/c para seleccionar
(ENALTECEDOR VIDEO
DIGITAL), luego presione ENTER
(introducción) varias veces para
seleccionar un nivel.
1
‡
‡
‡
‡
UHDO]DHOFRQWRUQR
UHDO]DHOFRQWRUQRPiVTXH
UHDO]DHOFRQWRUQRPiVTXH
68$9(VXDYL]DODLPDJHQVyOR'9'
c FRQWLQ~D
53
Para cancelar el ajuste“ENALTECEDOR
VIDEO DIGITAL”
6HOHFFLRQH³12´HQHO3DVR
Para desactivar la barra de control
3UHVLRQH',63/$<LQGLFDFLyQYDULDVYHFHV
KDVWDTXHODEDUUDGHFRQWUROVHGHVDFWLYH
1RWD
'HSHQGLHQGRGHOGLVFRRGHODHVFHQDHQ
UHSURGXFFLyQVHSRGUiSHUFLELUHOUXLGRGHOGLVFR
FRQPD\RULQWHQVLGDG6LHVWRRFXUUHVHUHFRPLHQGD
XWLOL]DUODIXQFLyQ%15SiJLQD FRQODIXQFLyQ
'9(6LHOHVWDGRQRPHMRUDUHGX]FDHOQLYHOGH
(QDOWHFHGRUGHYLGHRGLJLWDORVHOHFFLRQH
³68$9(´VyOR'9'HQHOSDVRDQWHV
PHQFLRQDGR
54
8VRGHGLVWLQWDVIXQFLRQHV
DGLFLRQDOHV
RÁPIDO
Bloqueo de discos
(REPRODUCCION PROHIBIDA
PERSONAL, CONTROL DE BLOQUEO)
Reproducción prohibida
personal
3XHGHHVWDEOHFHUODPLVPDFRQWUDVHxDGH
UHSURGXFFLyQSURKLELGDSHUVRQDOSDUDXQ
Pi[LPRGHGLVFRV6LDMXVWDHOGLVFR
Q~PHURHOSULPHUGLVFRVHFDQFHODUi
%RWRQHV
QXPpULFRV
3
Presione X/x para elegir
(CONTROL DE BLOQUEO) y presione
ENTER (introducción).
$SDUHFHQODVRSFLRQHVSDUD³&21752/
'(%/248(2´
NO
SI
REPRODUCTOR
CONTRASEÑA
4
Presione X/x para elegir “SI t” y
presione ENTER (introducción).
◆ Si no ha introducido ninguna contraseña
$SDUHFHUiODSDQWDOODGHUHJLVWURGH
FRQWUDVHxDVQXHYDV
CONTROL DE BLOQUEO
Introduzca una contraseña nueva de
4 dígitos y oprima ENTER .
Uso de distintas funciones adicionales
3XHGHHVWDEOHFHUGRVWLSRVGHUHVWULFFLRQHVGH
UHSURGXFFLyQSDUDHOGLVFRTXHGHVHH
‡ 5HSURGXFFLyQSURKLELGDSHUVRQDO
3XHGHHVWDEOHFHUODVUHVWULFFLRQHVGH
UHSURGXFFLyQSDUDTXHHOUHSURGXFWRUQR
UHSURGX]FDGLVFRVLQDSURSLDGRV
‡ &RQWUROGHEORTXHR
(VSRVLEOHOLPLWDUODUHSURGXFFLyQGHFLHUWRV
GLVFRV'9'DXQQLYHOSUHGHWHUPLQDGRFRPR
ODHGDGGHORVXVXDULRV6HSXHGHQEORTXHDUR
UHHPSOD]DUHVFHQDVFRQRWUDVGLIHUHQWHV
6HXWLOL]DODPLVPDFRQWUDVHxDSDUDHOFRQWURO
GHEORTXHR\ODUHSURGXFFLyQSURKLELGD
SHUVRQDO
,QWURGX]FDXQDFRQWUDVHxDGHGtJLWRVFRQ
ORVERWRQHVQXPpULFRV\DFRQWLQXDFLyQ
SUHVLRQH(17(5LQWURGXFFLyQ
$SDUHFHODSDQWDOODGHFRQILUPDFLyQGH
FRQWUDVHxD
◆ Si ya ha registrado una contraseña
$SDUHFHODSDQWDOODGHLQWURGXFFLyQGHOD
FRQWUDVHxD
1
2
Inserte el disco que desee bloquear.
6LHOGLVFRHVWiUHSURGXFLpQGRVH
SUHVLRQHxSDUDGHWHQHUODUHSURGXFFLyQ
CONTROL DE BLOQUEO
Ingrese contraseña y oprima
ENTER
.
Presione DISPLAY (indicación) con el
reproductor en el modo de parada.
$SDUHFHODVLJXLHQWHEDUUDGHFRQWURO
c FRQWLQ~D
55
5
Introduzca o vuelva a introducir la
contraseña de 4 dígitos con los
botones numéricos y, a continuación,
presione ENTER (introducción).
/DOH\HQGD³5HSURGXFFLyQSURKLELGD
SHUVRQDODMXVWDGD´DSDUHFHHQSDQWDOOD
FXDQGRLQJUHVDODFRQWUDVHxD
Para desactivar la función de control de
reproducción prohibida personal
1
6LJDORVSDVRVDOGH³5HSURGXFFLyQ
SURKLELGDSHUVRQDO´
2
3UHVLRQHXxSDUDHOHJLU³12t´\
SUHVLRQH(17(5LQWURGXFFLyQ
3
,QWURGX]FDODFRQWUDVHxDGHGtJLWRVFRQ
ORVERWRQHVQXPpULFRV\DFRQWLQXDFLyQ
SUHVLRQH(17(5LQWURGXFFLyQ
Control de bloqueo (Limitación
de la reproducción)
(VSRVLEOHOLPLWDUODUHSURGXFFLyQGHFLHUWRV
GLVFRV'9'DXQQLYHOSUHGHWHUPLQDGRFRPR
ODHGDGGHORVXVXDULRV/DIXQFLyQ
³&21752/'(%/248(2´SHUPLWH
DMXVWDUHOQLYHOGHOLPLWDFLyQGHUHSURGXFFLyQ
TXHVHGHVHH
%RWRQHV
QXPpULFRV
Reproducción del disco bloqueado con
Reproducción prohibida personal
1
,QVHUWHHOGLVFREORTXHDGRFRQ
5HSURGXFFLyQSURKLELGDSHUVRQDO
$SDUHFHODSDQWDOOD³5(352'8&&,21
352+,%,'$3(5621$/´
1
Presione DISPLAY (indicación) con el
reproductor en el modo de parada.
$SDUHFHODVLJXLHQWHEDUUDGHFRQWURO
REPRODUCCION PROHIBIDA PERSONAL
RÁPIDO
Reproducción prohibida personal ya
ajustada. Ingrese contraseña y
oprima ENTER .
2
,QWURGX]FDODFRQWUDVHxDGHGtJLWRVFRQ
ORVERWRQHVQXPpULFRV\DFRQWLQXDFLyQ
SUHVLRQH(17(5LQWURGXFFLyQ
(OUHSURGXFWRUHVWiSUHSDUDGRSDUDOD
UHSURGXFFLyQ
z &RQVHMR
6LROYLGDODFRQWUDVHxDLQWURGX]FDHOQ~PHURGH
GtJLWRV³´FXDQGR³5(352'8&&,21
352+,%,'$3(5621$/´VROLFLWHODFRQWUDVHxD
\DFRQWLQXDFLyQSUHVLRQH(17(5LQWURGXFFLyQ
/DSDQWDOODVROLFLWDUiTXHLQWURGX]FDXQDFRQWUDVHxD
QXHYDGH GtJLWRV
56
2
Presione X/x para elegir
(CONTROL DE BLOQUEO) y presione
ENTER (introducción).
$SDUHFHQODVRSFLRQHVSDUD³&21752/
'(%/248(2´
NO
SI
REPRODUCTOR
CONTRASEÑA
3
Presione X/x para elegir
“REPRODUCTOR t” y presione
ENTER (introducción).
CONTROL DE BLOQUEO
NIVEL:
ESTANDAR:
◆ Si no ha introducido ninguna contraseña
$SDUHFHUiODSDQWDOODGHUHJLVWURGH
FRQWUDVHxDVQXHYDV
6
CONTROL DE BLOQUEO
Introduzca una contraseña nueva de
4 dígitos y oprima ENTER .
,QWURGX]FDXQDFRQWUDVHxDGHGtJLWRV
FRQORVERWRQHVQXPpULFRV\D
FRQWLQXDFLyQSUHVLRQH(17(5
LQWURGXFFLyQ
$SDUHFHODSDQWDOODGHFRQILUPDFLyQGH
FRQWUDVHxD
7
ENTER
NO
NO
8:
7:
6:
5:
.
Introduzca o vuelva a introducir la
contraseña de 4 dígitos con los
botones numéricos y, a continuación,
presione ENTER (introducción).
$SDUHFHODSDQWDOODGHDMXVWHGHOQLYHOGH
OLPLWDFLyQGHUHSURGXFFLyQ
NC17
R
Seleccione el nivel que desee
mediante X/x y después presione
ENTER (introducción).
(ODMXVWHGH&RQWUROGHEORTXHRVHKD
FRPSOHWDGR
CONTROL DE BLOQUEO
NIVEL:
ESTANDAR:
4:
Uso de distintas funciones adicionales
CONTROL DE BLOQUEO
NIVEL:
ESTANDAR:
8
CONTROL DE BLOQUEO
NIVEL:
ESTANDAR:
Presione X/x para elegir “NIVEL”, y
presione ENTER (introducción).
$SDUHFHQORVHOHPHQWRVGHVHOHFFLyQSDUD
³1,9(/´
CONTROL DE BLOQUEO
4
Presione X/x para seleccionar un
área geográfica como nivel de
limitación de la reproducción y, a
continuación, presione ENTER
(introducción).
(OiUHDTXHGDVHOHFFLRQDGD
&XDQGRVHOHFFLRQH³27526 t´HOLMDH
LQWURGX]FDHOFyGLJRHVWiQGDUGHODWDEOD
HQSiJLQD ◆ Si ya ha registrado una contraseña
$SDUHFHODSDQWDOODGHLQWURGXFFLyQGHOD
FRQWUDVHxD
Ingrese contraseña y oprima
NO
EE.UU.
EE.UU.
OTROS
PG13
EE.UU.
NO
EE.UU.
&XDQWRPHQRUVHDHOYDORUPiVHVWULFWD
VHUiODOLPLWDFLyQ
5
Presione X/x para elegir
“ESTANDAR”, y presione ENTER
(introducción).
$SDUHFHQORVHOHPHQWRVGHVHOHFFLyQSDUD
³(67$1'$5´
Para desactivar la función de Control de
bloqueo
$MXVWH³1,9(/´HQ³12´HQHO3DVR
c FRQWLQ~D
57
Reproducción del disco bloqueado con
control de bloqueo
Código de zona
1
,QVHUWHHOGLVFR\SUHVLRQHH
$SDUHFHODSDQWDOODGHLQWURGXFFLyQGHOD
FRQWUDVHxD
(VWiQGDU
2
,QWURGX]FDODFRQWUDVHxDGHGtJLWRVFRQ
ORVERWRQHVQXPpULFRV\DFRQWLQXDFLyQ
SUHVLRQH(17(5LQWURGXFFLyQ
(OUHSURGXFWRULQLFLDODUHSURGXFFLyQ
z &RQVHMR
6LROYLGDODFRQWUDVHxDH[WUDLJDHOGLVFR\UHSLWDORV
3DVRVDGH³&RQWUROGHEORTXHR/LPLWDFLyQGH
ODUHSURGXFFLyQ´&XDQGRHOVLVWHPDVROLFLWHXQD
FRQWUDVHxDLQWURGX]FD³´XWLOL]DQGRORV
ERWRQHVQXPpULFRV\SUHVLRQH(17(5
LQWURGXFFLyQ/DSDQWDOODVROLFLWDUiTXHLQWURGX]FD
XQDFRQWUDVHxDQXHYDGHGtJLWRV7UDVLQWURGXFLU
XQDQXHYDFRQWUDVHxDGHGtJLWRVHQHO3DVR
YXHOYDDLQVHUWDUHOGLVFRHQHOUHSURGXFWRU\
SUHVLRQHH,QJUHVHODQXHYDFRQWUDVHxDFXDQGROD
SDQWDOODVHORVROLFLWH
1RWD
6LUHSURGXFHGLVFRV'9'TXHQRGLVSRQJDQGHOD
IXQFLyQ&RQWUROGHEORTXHRQRVHUiSRVLEOHOLPLWDU
ODUHSURGXFFLyQHQHVWHUHSURGXFWRU
1~PHUR
GH
FyGLJR
(VWiQGDU
1~PHUR
GH
FyGLJR
$OHPDQLD
,QGRQHVLD
$UJHQWLQD
,WDOLD
$XVWUDOLD
-DSyQ
$XVWULD
0DODVLD
%pOJLFD
0p[LFR
%UDVLO
1RUXHJD
&DQDGi
1XHYD=HODQGD
&KLOH
3DtVHV%DMRV
&KLQD
3DNLVWiQ
&RUHD
3RUWXJDO
'LQDPDUFD
5HLQR8QLGR
(VSDxD
5XVLD
)LOLSLQDV
6LQJDSXU
)LQODQGLD
6XHFLD
)UDQFLD
6XL]D
,QGLD
7DLODQGLD
Cambio de la contraseña
1
Presione DISPLAY (indicación) con el
reproductor en el modo de parada.
$SDUHFHODEDUUDGHFRQWURO
2
Presione X/x para elegir
(CONTROL DE BLOQUEO) y presione
ENTER (introducción).
$SDUHFHQODVRSFLRQHVSDUD³&21752/
'(%/248(2´
3
Presione X/x para elegir
“CONTRASEÑA t” y presione ENTER
(introducción).
$SDUHFHODSDQWDOODGHLQWURGXFFLyQGHOD
FRQWUDVHxD
4
5
58
Introduzca la contraseña de 4 dígitos
con los botones numéricos y, a
continuación, presione ENTER
(introducción).
Introduzca una contraseña nueva de 4
dígitos con los botones numéricos y, a
continuación, presione ENTER
(introducción).
6
Para confirmar la contraseña,
introdúzcala de nuevo mediante los
botones numéricos y presione ENTER
(introducción).
Si comete un error al introducir la
contraseña
3UHVLRQHCDQWHVGHSUHVLRQDU(17(5
LQWURGXFFLyQHLQWURGX]FDHOQ~PHUR
FRUUHFWR
Control del TV con el
control remoto
suministrado
3XHGHFRQWURODUHOQLYHOGHVRQLGRODIXHQWH
GHHQWUDGD\HOLQWHUUXSWRUGHDOLPHQWDFLyQGH
VX796RQ\FRQHOFRQWUROUHPRWR
VXPLQLVWUDGR
Si comete un error
3UHVLRQHO 5(7851YROYHU
Para apagar el reproductor
3UHVLRQH',63/$<LQGLFDFLyQYDULDVYHFHV
KDVWDTXHVHGHVDFWLYHODSDQWDOODGHDMXVWHV
%RWRQHV
QXPpULFRV
$OSUHVLRQDU
3RGUi
79[1
(QFHQGHURDSDJDUHO79
92/±
$MXVWDUHOYROXPHQGHO79
799,'(2
&DPELDUODIXHQWHGHHQWUDGD
GHO79HQWUHpVWH\RWUDV
IXHQWHVGHHQWUDGD
Uso de distintas funciones adicionales
3XHGHFRQWURODUHO79PHGLDQWHORVVLJXLHQWHV
ERWRQHV
1RWD
'HSHQGLHQGRGHODVXQLGDGHVTXHFRQHFWHHV
SRVLEOHTXHQRSXHGDFRQWURODUHO79FRQDOJXQRV
GHORVVLJXLHQWHVERWRQHV
c FRQWLQ~D
59
Control de otros TVs con el
control remoto
7DPELpQSXHGHFRQWURODUHOQLYHOGHVRQLGR
ODIXHQWHGHHQWUDGD\HOLQWHUUXSWRUGH
DOLPHQWDFLyQGH79GHRWUDVPDUFDVFRQHO
FRQWUROUHPRWRVXPLQLVWUDGR
6LVX79VHHQFXHQWUDHQODWDEODD
FRQWLQXDFLyQDMXVWHHOFyGLJRGHOIDEULFDQWH
FRUUHVSRQGLHQWH
1
2
Mientras mantiene presionado TV
[/1, presione los botones numéricos
para seleccionar el código del
fabricante del TV (consulte la tabla a
continuación).
Deje de presionar TV [/1.
Códigos de televisores controlables
6LDSDUHFHPiVGHXQFyGLJRLQWURG~]FDORV
XQRWUDVRWURKDVWDHQFRQWUDUHOTXHIXQFLRQD
FRQVX79
◆Para modelos de América Latina (RMT-
D143A)
)DEULFDQWH
1~PHURGHFyGLJR
6RQ\YDORUSRU
RPLVLyQ
-9&
3DQDVRQLF
3KLOLSV
5&$
6DPVXQJ
6DQ\R
6KDUS
Verificación del nombre del modelo de su
control remoto
7RVKLED
(OFRQWUROUHPRWRVXPLQLVWUDGRHVGLIHUHQWH
GHSHQGLHQGRGHOPRGHORGHOUHSURGXFWRU
9HULILTXHHOQRPEUHGHOPRGHORGHVXFRQWURO
UHPRWR507'$R507'(SDUD
TXHSXHGDLQJUHVDUHOQ~PHURGHFyGLJRGHO
IDEULFDQWHFRUUHFWRHQVXFRQWUROUHPRWR
=HQLWK
◆Para modelos de Asia/Oceanía
1RPEUHGHO
PRGHOR
(RMT-D143E)
)DEULFDQWH
1~PHURGHFyGLJR
6RQ\YDORUSRU
RPLVLyQ
-9&
/*
3DQDVRQLF
3KLOLSV
6DPVXQJ
6KDUS
7RVKLED
1RWDV
‡ 6LLQWURGXFHXQQXHYRFyGLJRVHERUUDUiHOFyGLJR
LQWURGXFLGRDQWHULRUPHQWH
‡ $OVXVWLWXLUODVSLODVGHOFRQWUROUHPRWRHVSRVLEOH
TXHHOFyGLJRGHO79HVWDEOHFLGRVHUHDMXVWHHQHO
YDORUSRURPLVLyQ9XHOYDDDMXVWDUHOFyGLJR
DSURSLDGR
60
2 Presione X/x para elegir
(AJUSTE) y presione ENTER
(introducción).
$MXVWHV
Uso de la pantalla de
ajustes
(OXVRGHODSDQWDOODGHDMXVWHVSHUPLWHUHDOL]DU
GLVWLQWRVDMXVWHVGHHOHPHQWRVFRPRODLPDJHQ\
HOVRQLGR7DPELpQSXHGHHVWDEOHFHUXQLGLRPD
SDUDORVVXEWtWXORV\ODSDQWDOODGHDMXVWHVHQWUH
RWUDVFRVDV/DVLQGLFDFLRQHVGHSDQWDOODVHUiQ
GLIHUHQWHVGHSHQGLHQGRGHOPRGHORGHO
UHSURGXFWRU3DUDREWHQHULQIRUPDFLyQGHWDOODGD
VREUHFDGDXQRGHORVHOHPHQWRVGHODSDQWDOOD
GHDMXVWHVFRQVXOWHODVSiJLQDV D
1RWD
/RVDMXVWHVGHUHSURGXFFLyQDOPDFHQDGRVHQHO
GLVFRWLHQHQSULRULGDGUHVSHFWRGHORVDMXVWHVGHOD
3DQWDOODGHDMXVWHV\SUREDEOHPHQWHQRWRGDVODV
IXQFLRQHVGHVFULWDVHVWpQGLVSRQLEOHV
3 Presione X/x para elegir
“PERSONALIZADO”, y presione
ENTER (introducción).
$SDUHFHODSDQWDOODGHDMXVWHV
AJUSTE DE IDIOMA
MENU PANTALLA:
MENU:
AUDIO:
SUBTITULO:
ESPAÑOL
ESPAÑOL
ORIGINAL
ESPAÑOL
4 Presione X/x para seleccionar el
$SDUHFHHOHOHPHQWRGHDMXVWH
(MHPSOR³$-867(3$17$//$´
Ajustes
elemento de ajuste en la lista
mostrada: “AJUSTE DE IDIOMA”,
“AJUSTE PANTALLA”, “AJUSTE
PERSONALIZADO”, o “AJUSTE
AUDIO”. A continuación presione
ENTER (introducción).
AJUSTE PANTALLA
TIPO TV:
4:3 LETTER BOX
PROTECTOR PANTALLA:
SI
IMAGEN ÍNDICE
FONDO:
(OHPHQWRVHOHFFLRQDGR
1 Presione DISPLAY (indicación)
con el reproductor en el modo de
parada.
$SDUHFHODEDUUDGHFRQWURO
RÁPIDO
(OHPHQWRVGHDMXVWH
5 Seleccione un elemento con X/x y
presione ENTER (introducción).
$SDUHFHQODVRSFLRQHVFRUUHVSRQGLHQWHV
DOHOHPHQWRVHOHFFLRQDGR
(MHPSOR³7,3279´
AJUSTE PANTALLA
4:3 LETTER BOX
TIPO TV:
PROTECTOR PANTALLA: 4:3 LETTER BOX
4:3 PAN SCAN
FONDO:
16:9
2SFLRQHV
c FRQWLQ~D
61
6 Seleccione un ajuste con X/x y
presione ENTER (introducción).
(ODMXVWHTXHGDVHOHFFLRQDGR\OD
FRQILJXUDFLyQILQDOL]D
(MHPSOR³´
AJUSTE PANTALLA
TIPO TV:
16:9
PROTECTOR PANTALLA:
SI
FONDO:
IMAGEN ÍNDICE
$MXVWHVHOHFFLRQDGR
Ajuste del idioma de las
indicaciones o de la pista
de sonido (AJUSTE DE IDIOMA)
³$-867('(,',20$´SHUPLWHHVWDEOHFHU
YDULRVLGLRPDVSDUDODVLQGLFDFLRQHVHQ
SDQWDOODRODSLVWDGHVRQLGR
6HOHFFLRQH³$-867('(,',20$´HQOD
SDQWDOODGHDMXVWHV3DUDXVDUODSDQWDOOD
FRQVXOWH³8VRGHODSDQWDOODGHDMXVWHV´
SiJLQD AJUSTE DE IDIOMA
MENU PANTALLA:
MENU:
AUDIO:
SUBTITULO:
Para apagar el reproductor
3UHVLRQH',63/$<LQGLFDFLyQYDULDVYHFHV
KDVWDTXHVHGHVDFWLYHODSDQWDOODGHDMXVWHV
ESPAÑOL
ESPAÑOL
ORIGINAL
ESPAÑOL
Para entrar en el modo Configuración
rápida
6HOHFFLRQH³5È3,'2´HQHO3DVR5HDOLFHOD
RSHUDFLyQDSDUWLUGHO3DVRGHODGHVFULSFLyQ
GH&RQILJXUDFLyQUiSLGDSDUDUHDOL]DUDMXVWHV
EiVLFRVSiJLQD Para restaurar todos los ajustes de
“AJUSTE”
6LVHOHFFLRQD³5(67$85$5´HQHO3DVRSRGUi
UHVWDXUDUWRGRVORVYDORUHVGH³$-867(´HQSiJLQDV
DDORVYDORUHVSRURPLVLyQ'HVSXpVGH
VHOHFFLRQDU³5(67$85$5´\SUHVLRQDU(17(5
LQWURGXFFLyQVHOHFFLRQH³6,´\SUHVLRQH(17(5
LQWURGXFFLyQSDUDUHVWDXUDUORVDMXVWHVWDUGDXQRV
VHJXQGRVHQFRPSOHWDUVHRVHOHFFLRQH³12´\
SUHVLRQH(17(5LQWURGXFFLyQSDUDYROYHUDOD
EDUUDGHFRQWURO1RSUHVLRQH[/1FXDQGRUHVWDXUD
ORVYDORUHVGHOUHSURGXFWRU
◆ MENU PANTALLA
&DPELDHOLGLRPDGHODVLQGLFDFLRQHVHQ
SDQWDOOD
◆ MENU (sólo DVD)
3XHGHVHOHFFLRQDUHOLGLRPDGHVHDGRSDUDHO
PHQ~GHOGLVFR
◆ AUDIO (sólo DVD)
&DPELDHOLGLRPDGHODSLVWDGHVRQLGR
6LHOLJH³25,*,1$/´VHVHOHFFLRQDUiHO
LGLRPDTXHWHQJDSULRULGDGHQHOGLVFR
◆ SUBTITULO (sólo DVD)
&DPELDHOLGLRPDGHORVVXEWtWXORVJUDEDGRV
HQHO'9'
6LVHOHFFLRQD³6(*8,5(/$8',2´HO
LGLRPDGHORVVXEWtWXORVFDPELDUiGHDFXHUGR
FRQHOLGLRPDVHOHFFLRQDGRSDUDODSLVWDGH
VRQLGR
z &RQVHMR
6LVHOHFFLRQD³27526t´HQ³0(18´
³68%7,78/2´\³$8',2´VHOHFFLRQDHLQJUHVD
XQFyGLJRGHLGLRPDGHVGH³/LVWDGHFyGLJRVGH
LGLRPDV´HQODSiJLQD FRQORVERWRQHVQXPpULFRV
1RWD
6LVHOHFFLRQDXQLGLRPDHQ³0(18´
³68%7,78/2´R³$8',2´TXHQRHVWpJUDEDGR
HQHO'9'VHVHOHFFLRQDUiDXWRPiWLFDPHQWHXQRGH
ORVLGLRPDVJUDEDGRV
62
Ajustes de la pantalla
/(77(5%2;
(AJUSTE PANTALLA)
(OLMDORVYDORUHVVHJ~QHO79TXHYD\DD
FRQHFWDU
6HOHFFLRQH³$-867(3$17$//$´HQOD
SDQWDOODGHDMXVWHV3DUDXVDUODSDQWDOOD
FRQVXOWH³8VRGHODSDQWDOODGHDMXVWHV´HQOD
SiJLQD /RVDMXVWHVSRURPLVLyQDSDUHFHQVXEUD\DGRV
/DVLQGLFDFLRQHVGHSDQWDOODVHUiQGLIHUHQWHV
GHSHQGLHQGRGHOPRGHORGHOUHSURGXFWRU
AJUSTE PANTALLA
TIPO TV:
4:3 LETTER BOX
SI
PROTECTOR PANTALLA:
IMAGEN ÍNDICE
FONDO:
3$16&$1
1RWD
&RQDOJXQRVGLVFRV'9'VHSXHGHVHOHFFLRQDU³
/(77(5%2;´DXWRPiWLFDPHQWHHQOXJDUGH³
3$16&$1´RYLFHYHUVD
◆ SISTEMA COLOR (sólo VIDEO CD; Sólo
para los modelos de Asia/Oceanía)
6HOHFFLRQDHOVLVWHPDGHFRORUFXDQGR
UHSURGXFHXQ9,'(2&'
(PLWHODVHxDOGHYLGHRHQHO
VLVWHPD9,'(2&'\DVHDHQ
3$/R176&6LVX79HVGH
VLVWHPD'8$/VHOHFFLRQH
$872
3$/
&DPELDODVHxDOGHYLGHRGHXQ
9,'(2&'HQ176&\HPLWHOD
VHxDOHQHOVLVWHPD3$/
176&
&DPELDODVHxDOGHYLGHRGHXQ
9,'(2&'HQ3$/\HPLWHOD
VHxDOHQHOVLVWHPD176&
6HOHFFLRQDODUHODFLyQGHDVSHFWRGHO79
FRQHFWDGRHVWiQGDURSDQRUiPLFR
/(77(5 6HOHFFLRQHHVWHHOHPHQWR
%2;
FXDQGRFRQHFWHXQ79GH
SDQWDOOD0XHVWUDXQD
LPDJHQSDQRUiPLFDFRQEDQGDV
HQODVSDUWHVVXSHULRUHLQIHULRU
GHODSDQWDOOD
3$1
6&$1
6HOHFFLRQHHVWHHOHPHQWR
FXDQGRFRQHFWHXQ79GH
SDQWDOOD0XHVWUD
DXWRPiWLFDPHQWHODLPDJHQ
SDQRUiPLFDHQWRGDODSDQWDOOD\
FRUWDODVSDUWHVTXHQRVH
DGDSWHQDpVWD
6HOHFFLRQHHVWHHOHPHQWR
FXDQGRFRQHFWHXQ79GH
SDQWDOODSDQRUiPLFDRXQRFRQ
XQDIXQFLyQGHPRGR
SDQRUiPLFR
Ajustes
$872
◆ TIPO TV
1RWDV
‡ 1RSXHGHFDPELDUHOVLVWHPDGHFRORUSDUDORV
'9'V
‡ 3XHGHFDPELDUHOVLVWHPDGHFRORUGHHVWH
UHSURGXFWRUGHDFXHUGRFRQHO79FRQHFWDGR
&RQVXOWHSiJLQD ◆ PROTECTOR PANTALLA
/DLPDJHQGHOSURWHFWRUGHSDQWDOODDSDUHFH
FXDQGRGHMDHOUHSURGXFWRUHQPRGRSDXVDR
SDUDGDGXUDQWHPLQXWRVRFXDQGRUHSURGXFH
XQ&'RXQ&''('$726DXGLR03
GXUDQWHPiVGHPLQXWRV/DSURWHFFLyQGH
SDQWDOODHYLWDTXHHOGLVSRVLWLYRGHYLVXDOL]DFLyQ
VHGDxHLPiJHQHVIDQWDVPD3UHVLRQHH SDUD
GHVDFWLYDUODSURWHFFLyQGHSDQWDOOD
6,
$FWLYDHOSURWHFWRUGHSDQWDOOD
12
'HVDFWLYDHOSURWHFWRUGH
SDQWDOOD
c FRQWLQ~D
63
◆ FONDO
6HOHFFLRQDODLPDJHQRHOFRORUGHIRQGRGHOD
SDQWDOODGHO79HQHOPRGRGHSDUDGDR
PLHQWUDVVHUHSURGXFHXQ&'RXQ&''(
'$726DXGLR03
,0$*(1
Ë1',&(
/DLPDJHQtQGLFHLPDJHQILMD
DSDUHFHGHIRQGRSHURVyORVL
GLFKDLPDJHQ\DHVWiJUDEDGDHQ
HOGLVFR&'(;75$HWF6L
HOGLVFRQRFRQWLHQHQLQJXQD
LPDJHQtQGLFHDSDUHFHUiOD
LPDJHQ³*5È),&26´
*5È),&26 $SDUHFHHQSDQWDOODXQDLPDJHQ
SUHGHWHUPLQDGDDOPDFHQDGDHQHO
UHSURGXFWRU
$=8/
(OFRORUGHIRQGRHVD]XO
1(*52
(OFRORUGHIRQGRHVQHJUR
Ajustes personalizados
(AJUSTE PERSONALIZADO)
8WLOLFHHVWHHOHPHQWRSDUDFRQILJXUDUYDORUHV
UHODFLRQDGRVFRQODUHSURGXFFLyQ\RWURV
DMXVWHV
6HOHFFLRQH³$-867(3(5621$/,=$'2´
HQODSDQWDOODGHDMXVWHV3DUDXVDUODSDQWDOOD
FRQVXOWH³8VRGHODSDQWDOODGHDMXVWHV´
SiJLQD /RVDMXVWHVSRURPLVLyQDSDUHFHQVXEUD\DGRV
AJUSTE PERSONALIZADO
REPRODUCCION AUTO:
NO
ATENUADOR:
BRILLO
MODO PAUSA:
AUTO
NO
SELECCION PISTA:
REANUDACION MULTIDISCO:
SI
◆ DESCONEXION AUTOMATICA (Sólo para
modelos de EE.UU./Canadá)
$FWLYDRGHVDFWLYDODIXQFLyQ'HVFRQH[LyQ
DXWRPiWLFD3DUDORVPRGHORVGH$PpULFD
/DWLQDODIXQFLyQ'HVFRQH[LyQDXWRPiWLFD
VHHQFXHQWUDDFWLYDGD
12
'HVDFWLYDHVWDIXQFLyQ
6,
(OUHSURGXFWRUHQWUDHQPRGR
HVSHUDFXDQGRVHORGHMDHQ
PRGRSDUDGDSRUPiVGH
PLQXWRV
◆ REPRODUCCION AUTO
$FWLYDRGHVDFWLYDODIXQFLyQ5HSURGXFFLyQ
DXWRPiWLFD(VWDIXQFLyQHV~WLOFXDQGRHO
UHSURGXFWRUVHHQFXHQWUDFRQHFWDGRDXQ
WHPSRUL]DGRUQRVXPLQLVWUDGR
12
'HVDFWLYDHVWDIXQFLyQ
6,
,QLFLDODUHSURGXFFLyQ
DXWRPiWLFDPHQWHDOHQFHQGHUHO
UHSURGXFWRU
◆ ATENUADOR
$MXVWDODLOXPLQDFLyQGHOYLVXDOL]DGRUGHO
SDQHOIURQWDO
64
%5,//2
,QWHQVLILFDODLOXPLQDFLyQ
26&852
$WHQ~DODLOXPLQDFLyQ
12
$SDJDODLOXPLQDFLyQ
◆ MODO PAUSA (sólo DVD)
6HOHFFLRQDODLPDJHQHQHOPRGRGHSDXVD
$872
&8$'52
6HHPLWHODLPDJHQHVWDEOH
LQFOX\HQGRPRWLYRVFRQ
PRYLPLHQWRGLQiPLFR\VLQ
GLVWRUVLRQHV1RUPDOPHQWH
VHOHFFLRQHHVWDSRVLFLyQ
6HHPLWHODLPDJHQLQFOX\HQGR
PRWLYRVVLQPRYLPLHQWR
GLQiPLFRFRQDOWDUHVROXFLyQ
◆ SELECCION PISTA (sólo DVD)
'DSULRULGDGDODSLVWDGHVRQLGRTXHFRQWHQJD
HOQ~PHURPiVDOWRGHFDQDOHVDOUHSURGXFLU
XQ'9'HQHOTXHKD\DJUDEDGRVYDULRV
IRUPDWRVGHDXGLR3&0'76RDXGLR
03(*R'ROE\'LJLWDO
12
1RVHGDSULRULGDG
$872
6HGDSULRULGDG
1RWDV
◆ REANUDACION MULTIDISCO (sólo DVD/
VIDEO CD)
$FWLYDRGHVDFWLYDODIXQFLyQ5HDQXGDFLyQ
PXOWLGLVFR5HDQXGDFLyQGHUHSURGXFFLyQ
SXHGHDOPDFHQDUVHHQODPHPRULDGHKDVWD
GLVFRV'9'9,'(2&'GLIHUHQWHV
SiJLQD 6,
$OPDFHQDORVDMXVWHVGH
UHDQXGDFLyQHQODPHPRULDSDUD
KDVWDGLVFRV(ODMXVWH
SHUPDQHFHHQODPHPRULDD~Q
FXDQGRKD\DVHOHFFLRQDGR
³12´
12
1RDOPDFHQDORVDMXVWHVGH
UHDQXGDFLyQHQODPHPRULD/D
UHSURGXFFLyQFRPLHQ]D
QXHYDPHQWHHQHOSXQWRGH
UHDQXGDFLyQSDUDHOGLVFRDFWXDO
HQHOUHSURGXFWRU
(AJUSTE AUDIO)
³$-867($8',2´SHUPLWHFRQILJXUDUHO
VRQLGRVHJ~QODVFRQGLFLRQHVGHUHSURGXFFLyQ
\FRQH[LyQ
6HOHFFLRQH³$-867($8',2´HQODSDQWDOOD
GHDMXVWHV3DUDXVDUODSDQWDOODFRQVXOWH
³8VRGHODSDQWDOODGHDMXVWHV´SiJLQD /RVDMXVWHVSRURPLVLyQDSDUHFHQVXEUD\DGRV
/DVLQGLFDFLRQHVGHSDQWDOODVHUiQGLIHUHQWHV
GHSHQGLHQGRGHOPRGHORGHOUHSURGXFWRU
AJUSTE AUDIO
NO
ATENUACION DE AUDIO:
AUDIO DRC:
ESTANDAR
MEZCLA:
DOLBY SURROUND
SALIDA DIGITAL:
SI
D-PCM
DOLBY DIGITAL:
DTS:
NO
◆ ATENUACION DE AUDIO (atenuación)
6LHOVRQLGRGHUHSURGXFFLyQVHGLVWRUVLRQD
DMXVWHHVWHHOHPHQWRHQ³6,´(OUHSURGXFWRU
UHGXFHHOQLYHOGHVDOLGDGHDXGLR
(VWDIXQFLyQDIHFWDODVDOLGDGHODVWRPDV
/,1(287/5$8',2VDOLGDGHDXGLR
L]TXLHUGDGHUHFKD
12
1RUPDOPHQWHVHOHFFLRQHHVWDSRVLFLyQ
6,
6HOHFFLRQHHVWHHOHPHQWRFXDQGRVH
GLVWRUVLRQHHOVRQLGRGHUHSURGXFFLyQ
GHORVDOWDYRFHV
Ajustes
‡ 6LDMXVWDHOHOHPHQWRHQ³$872´HVSRVLEOHTXH
HOLGLRPDFDPELH(ODMXVWHGH³6(/(&&,21
3,67$´WLHQHPD\RUSULRULGDGTXHORV³$8',2´
GHQWURGH³$-867('(,',20$´SiJLQD ‡ 6LDMXVWD³'76´HQ³12´SiJLQD ODSLVWDGH
VRQLGR'76QRVHUHSURGXFLUiDXQTXHDMXVWH
³6(/(&&,213,67$´HQ³$872´
‡ 6LODVSLVWDVGHVRQLGR3&0'76DXGLR03(*\
'ROE\'LJLWDOWLHQHQHOPLVPRQ~PHURGHFDQDOHV
HOUHSURGXFWRUVHOHFFLRQDUiODVSLVWDVGHVRQLGR
3&0'76'ROE\'LJLWDO\DXGLR03(*HQHVWH
RUGHQ
Ajustes de sonido
◆ AUDIO DRC (Control de gama dinámica)
(sólo DVD)
/RJUDXQVRQLGRQtWLGRDOGLVPLQXLUHO
YROXPHQFXDQGRVHUHSURGXFHXQ'9'TXH
GLVSRQJDGHODIXQFLyQ³$8',2'5&´(VWR
DIHFWDDODVDOLGDGHODVVLJXLHQWHVWRPDV
± 7RPDV/,1(287/5$8',2VDOLGDGH
DXGLRL]TXLHUGDGHUHFKD
± 7RPD',*,7$/287&2$;,$/VDOLGD
GLJLWDOFRD[LDOVyORFXDQGR³'2/%<
',*,7$/´HVWiFRQILJXUDGRHQ³'3&0´
SiJLQD (67$1'$5 1RUPDOPHQWHVHOHFFLRQHHVWD
SRVLFLyQ
79
3HUPLWHHVFXFKDUHOVRQLGR
EDMRFRQQLWLGH]DXQTXH
UHGX]FDHOYROXPHQ
*$0$
$03/,$
6HREWLHQHODVHQVDFLyQGHHVWDU
HQXQDUHSUHVHQWDFLyQHQYLYR
c FRQWLQ~D
65
◆ MEZCLA (sólo DVD)
&DPELDHOPpWRGRGHFRPELQDUORVFDQDOHV
FXDQGRUHSURGXFHXQ'9'TXHWLHQH
HOHPHQWRVGHVRQLGRSRVWHULRUHVFDQDOHVR
HVWiJUDEDGRHQHOIRUPDWR'ROE\'LJLWDO
3DUDPD\RULQIRUPDFLyQVREUHORV
FRPSRQHQWHVGHVHxDOSRVWHULRUHVFRQVXOWH
³&RPSUREDFLyQGHOIRUPDWRGHVHxDOGH
DXGLR´SiJLQD (VWDIXQFLyQDIHFWDDOD
VDOLGDGHODVVLJXLHQWHVWRPDV
± 7RPDV/,1(287/5$8',2VDOLGDGH
DXGLRL]TXLHUGDGHUHFKD
± 7RPD',*,7$/287&2$;,$/VDOLGD
GLJLWDOFRD[LDOVyORFXDQGR³'2/%<
',*,7$/´HVWiFRQILJXUDGDHQ³'3&0´
SiJLQD 6HOHFFLRQHHVWHHOHPHQWR
'2/%<
6855281' FXDQGRHOUHSURGXFWRUHVWp
FRQHFWDGRDXQFRPSRQHQWHGH
DXGLRFRPSDWLEOHFRQ'ROE\
6XUURXQG3UR/RJLF
1250$/
6HOHFFLRQHHVWHHOHPHQWR
FXDQGRHOUHSURGXFWRUHVWp
FRQHFWDGRDXQFRPSRQHQWHGH
DXGLRFRPSDWLEOHFRQ'ROE\
6XUURXQG3UR/RJLF
◆ SALIDA DIGITAL
6HOHFFLRQDVLODVVHxDOHVGHDXGLRVHHQYtDQ
PHGLDQWHODWRPD',*,7$/287
&2$;,$/VDOLGDGLJLWDOFRD[LDO
66
6,
1RUPDOPHQWHVHOHFFLRQHHVWD
SRVLFLyQ&XDQGRVHOHFFLRQH³6,´
FRQVXOWH³$MXVWHGHODVHxDOGHVDOLGD
GLJLWDO´SDUDREWHQHULQIRUPDFLyQ
VREUHDMXVWHV
12
/DLQIOXHQFLDGHOFLUFXLWRGLJLWDOVREUH
HODQDOyJLFRVHUiPtQLPD
Ajuste de la señal de salida
digital
&DPELDHOPpWRGRGHWUDQVPLVLyQGHVHxDOGH
DXGLRFXDQGRFRQHFWDXQFRPSRQHQWHFRPR
XQDPSOLILFDGRUUHFHSWRURXQDSODWLQD0'
FRQXQDWRPDGHHQWUDGDGLJLWDO
3DUDREWHQHULQIRUPDFLyQGHWDOODGDVREUHOD
FRQH[LyQFRQVXOWHODSiJLQD 6HOHFFLRQH³'2/%<',*,7$/´³03(*´\
³'76´GHVSXpVGHDMXVWDU³6$/,'$
',*,7$/´HQ³6,´
AJUSTE AUDIO
ATENUACION DE AUDIO:
NO
AUDIO DRC:
ESTANDAR
MEZCLA:
DOLBY SURROUND
SALIDA DIGITAL:
SI
D-PCM
DOLBY DIGITAL:
DTS:
NO
6LFRQHFWDXQFRPSRQHQWHTXHQRHVWXYLHUD
FRQIRUPHDODVHxDOGHDXGLRVHOHFFLRQDGDORV
DOWDYRFHVQRHPLWLUiQHOVRQLGRRHPLWLUiQXQ
UXLGRLQWHQVRDIHFWDQGRDVXVRtGRVR
FDXVDQGRGDxRVDORVDOWDYRFHV
◆ DOLBY DIGITAL (sólo DVD)
6HOHFFLRQDHOWLSRGHVHxDO'ROE\'LJLWDO
'3&0
6HOHFFLRQHHVWHHOHPHQWR
FXDQGRHOUHSURGXFWRUHVWp
FRQHFWDGRDXQFRPSRQHQWHGH
DXGLRVLQGHFRGLILFDGRU'ROE\
'LJLWDOLQFRUSRUDGR3XHGH
VHOHFFLRQDUTXHODVVHxDOHV
DGPLWDQRQR'ROE\6XUURXQG
3UR/RJLFUHDOL]DQGRDMXVWHV
HQHOHOHPHQWR³0(=&/$´HQ
³$-867($8',2´
SiJLQD '2/%<
',*,7$/
6HOHFFLRQHHVWHHOHPHQWR
FXDQGRHOUHSURGXFWRUHVWp
FRQHFWDGRDXQFRPSRQHQWHGH
DXGLRFRQGHFRGLILFDGRU'ROE\
'LJLWDOLQFRUSRUDGR
◆ MPEG (sólo DVD; Sólo para los modelos
de Asia/Oceanía)
Selecciona el tipo de señal de audio MPEG.
PCM
Seleccione este elemento
cuando el reproductor esté
conectado a un componente de
audio que no disponga de
decodificador MPEG
incorporado. Si reproduce
pistas de audio MPEG, el
reproductor transmite señales
estéreo por medio de la toma
DIGITAL OUT (COAXIAL)
(salida digital coaxial).
MPEG
Seleccione este elemento
cuando el reproductor esté
conectado a un componente de
audio que disponga de
decodificador MPEG
incorporado.
◆ DTS (sólo DVD)
Selecciona si transmite o no una señal DTS.
Seleccione este elemento
cuando el reproductor esté
conectado a un componente de
audio que no disponga de
decodificador DTS
incorporado.
SI
Seleccione este elemento
cuando el reproductor esté
conectado a un componente de
audio que disponga de
decodificador DTS
incorporado.
Ajustes
NO
67
La imagen está en blanco y negro.
Información complementaria
Solución de problemas
Si le surge cualquiera de las siguientes
dificultades mientras emplea el reproductor,
utilice esta guía de solución de problemas
para eliminar el problema antes de solicitar
asistencia técnica. Si el problema persiste,
consulte al distribuidor Sony más cercano.
Alimentación
La alimentación no se activa.
, Compruebe que el cable de alimentación de
ca está correctamente conectado.
Imagen
Sin imagen/aparece ruido de imagen.
, Vuelva a conectar firmemente el cable de
conexión.
, El cable de conexión está dañado.
, Verifique la conexión a su TV (página 18) y
cambie el selector de entrada de su TV, para
que la señal del reproductor aparezca en la
pantalla del TV.
, El disco está sucio o es defectuoso.
, Si la imagen enviada desde el reproductor se
transmite mediante la videograbadora para
llegar al TV o si está conectado a una
combinación de TV/Reproductor de
VIDEO, la señal de protección contra
copias aplicada a ciertos programas DVD
podría afectar la calidad de imagen. Si sigue
experimentando problemas incluso al
conectar el reproductor directamente al TV,
intente conectar el reproductor a la entrada
S VIDEO del TV (página 18).
, Si el sistema de color de su reproductor no
coincide con el de su TV, cambie el sistema
de color de su reproductor. Para obtener
información detallada, consulte página 16.
(No puede cambiar el sistema de color del
disco de DVD.)
Aunque ajuste la relación de aspecto en
“TIPO TV” de “AJUSTE PANTALLA”, la
imagen no llena la pantalla.
, La relación de aspecto del disco es fija en el
DVD.
68
, Dependiendo del TV, la imagen en pantalla
está en blanco y negro cuando se reproduce
de un disco en sistema de color NTSC.
Sonido
No se oye el sonido.
, Vuelva a conectar firmemente el cable de
conexión.
, El cable de conexión está dañado.
, El reproductor está conectado a la toma de
entrada incorrecta del amplificador
(receptor) (página 22, 23, 24).
, La entrada del amplificador (receptor) no
está ajustada correctamente.
, El reproductor se encuentra en el modo de
pausa o en el de reproducción a cámara
lenta.
, El reproductor se encuentra en el modo de
avance o retroceso rápido.
, Si la señal de audio no se transmite a través
de la toma DIGITAL OUT (COAXIAL)
(salida digital coaxial), compruebe los
ajustes de audio en la (página 66).
, Cuando reproduzca un Super VCD en el que
la pista de audio 2 no estuviera grabada, no
se oirá ningún sonido cuando seleccione
“2:ESTANDAR”, “2:1/IZQ.” o “2:2/DER.”.
El sonido se oye con ruido.
, Al reproducir un CD con pistas de sonido
DTS, se oirá ruido a través de la toma LINE
OUT L/R (AUDIO) (salida de audio
izquierda/derecha) o toma DIGITAL OUT
(COAXIAL) (salida digital coaxial)
(página 28).
El sonido se distorsiona.
, Ajuste “ATENUACION DE AUDIO” en
“AJUSTE AUDIO” a “SI” (página 65).
El volumen del sonido es bajo.
, El volumen del sonido es bajo en algunos
DVDs. El volumen del sonido puede
mejorar si ajusta “AUDIO DRC” a “TV”
(página 65).
, Ajuste “ATENUACION DE AUDIO” en
“AJUSTE AUDIO” a “NO” (página 65).
Operación
El control remoto no funciona.
, +D\REVWiFXORVHQWUHHOFRQWUROUHPRWR\HO
UHSURGXFWRU
, (OFRQWUROUHPRWR\HOUHSURGXFWRUHVWiQ
GHPDVLDGRVHSDUDGRV
, 1RRULHQWDHOFRQWUROUHPRWRKDFLDHOVHQVRU
UHPRWRGHOUHSURGXFWRU
, /DVSLODVGHOFRQWUROUHPRWRGLVSRQHQGH
SRFDHQHUJtD
El disco no se reproduce.
, (OGLVFRHVWiLQFRUUHFWDPHQWHLQVHUWDGR
,QVHUWHHOGLVFRFRQODFDUDGHUHSURGXFFLyQ
KDFLDDEDMRHQODEDQGHMDGHGLVFRV
, (OGLVFRHVWiLQFOLQDGR
, (OUHSURGXFWRUQRSXHGHUHSURGXFLUFLHUWRV
GLVFRVSiJLQD , (OFyGLJRGHUHJLyQGHO'9'QRFRLQFLGH
FRQHOUHSURGXFWRU
, 6HKDFRQGHQVDGRKXPHGDGHQHOLQWHULRU
GHOUHSURGXFWRUSiJLQD
, (OUHSURGXFWRUQRSXHGHUHSURGXFLU&'5V
&'5:V'9'5VR'9'5:VPRGRGH
YLGHRTXHQRIXHILQDOL]DGRSiJLQD Aparece el siguiente mensaje cuando
reproduce un CD DE DATOS.
La pista de audio MP3 no puede
reproducirse (página 35).
, (O&''('$726QRIXHJUDEDGRHQ
IRUPDWR03VHJ~QODQRUPD,62
1LYHO1LYHOR-ROLHW
, /DSLVWDGHDXGLR03QRWLHQHH[WHQVLyQ
³03´
, /RVGDWRVQRSUHVHQWDQHOIRUPDWR03D~Q
FXDQGRWLHQHQH[WHQVLyQ³03´
, /RVGDWRVQRHVWiQHQ03(*$XGLR
&DSD , (OUHSURGXFWRUQRSXHGHUHSURGXFLUSLVWDVGH
DXGLRHQIRUPDWR03352
El título del álbum o la pista de audio MP3
no se visualiza correctamente.
, (OUHSURGXFWRUVyORSHUPLWHYLVXDOL]DU
Q~PHURV\OHWUDVGHODOIDEHWR2WURV
FDUDFWHUHVVHYLVXDOL]DQFRPRDVWHULVFRV
, +DVHOHFFLRQDGRODUHSURGXFFLyQGH
SURJUDPDDOHDWRULDUHSHWLGDRGHUHSHWLFLyQ
$%SiJLQD , +DVHOHFFLRQDGRODUHDQXGDFLyQGH
UHSURGXFFLyQSiJLQD El reproductor comienza a reproducir el
disco automáticamente.
, (OGLVFRGLVSRQHGHXQDIXQFLyQGH
UHSURGXFFLyQDXWRPiWLFD
, $MXVWH³5(352'8&&,21$872´HQ
³$-867(3(5621$/,=$'2´D³6,´
SiJLQD La reproducción se detiene
automáticamente.
, $OUHSURGXFLUGLVFRVFRQXQDVHxDOGHSDXVD
DXWRPiWLFDHOUHSURGXFWRUGHWLHQHOD
UHSURGXFFLyQFRQODVHxDOGHSDXVD
DXWRPiWLFD
No es posible realizar algunas funciones,
como la detención, exploración,
reproducción a cámara lenta, repetida,
aleatoria o de programa.
, &RQDOJXQRVGLVFRVHVSRVLEOHTXHQRSXHGD
UHDOL]DUDOJXQDVGHODVRSHUDFLRQHV
GHVFULWDV&RQVXOWHODVLQVWUXFFLRQHVGHXVR
VXPLQLVWUDGDVFRQHOGLVFR
No es posible cambiar el idioma de la
pista de sonido.
, ,QWHQWHXVDUHOPHQ~GHO'9'HQOXJDUGHO
ERWyQGHVHOHFFLyQGLUHFWDHQHOFRQWURO
UHPRWRSiJLQD , (O'9'HQUHSURGXFFLyQQRGLVSRQHGH
SLVWDVJUDEDGDVHQYDULRVLGLRPDV
, (O'9'SURKLEHHOFDPELRGHOLGLRPDSDUD
ODSLVWDGHVRQLGR
Información complementaria
³(UURUHQORVGDWRV´
, /DSLVWDGHDXGLR03TXHGHVHDUHSURGXFLU
HVWiGDxDGD
, /RVGDWRVQRHVWiQHQ03(*$XGLR
&DSD El disco no comienza a reproducirse desde
el principio.
El idioma de los subtítulos no puede
modificarse ni anularse.
, ,QWHQWHXVDUHOPHQ~GHO'9'HQOXJDUGHO
ERWyQGHVHOHFFLyQGLUHFWDHQHOFRQWURO
UHPRWRSiJLQD , (O'9'HQUHSURGXFFLyQQRGLVSRQHGH
VXEWtWXORVJUDEDGRVHQYDULRVLGLRPDV
, (O'9'SURKLEHHOFDPELRGHORVVXEWtWXORV
c FRQWLQ~D
69
No es posible cambiar los ángulos.
, ,QWHQWHXVDUHOPHQ~GHO'9'HQOXJDUGHO
ERWyQGHVHOHFFLyQGLUHFWDHQHOFRQWURO
UHPRWRSiJLQD , (O'9'HQUHSURGXFFLyQQRGLVSRQHGH
YDULRViQJXORVJUDEDGRV
, (OiQJXORSXHGHFDPELDUVHFXDQGRHO
LQGLFDGRU³$1*/(´iQJXORVHLOXPLQDHQ
HOYLVXDOL]DGRUGHOSDQHOIURQWDOSiJLQD , (O'9'SURKLEHHOFDPELRGHORViQJXORV
El reproductor no funciona correctamente.
, /DHOHFWULFLGDGHVWiWLFDHWFRFDVLRQDTXHHO
UHSURGXFWRUQRIXQFLRQHQRUPDOPHQWH
GHVHQFK~IHOR
No aparece nada en el visualizador del
panel frontal.
Función de
autodiagnóstico (Cuando
aparecen letras/números en el
visualizador)
&XDQGRODIXQFLyQGHDXWRGLDJQyVWLFRVH
DFWLYDSDUDHYLWDUTXHHOUHSURGXFWRUIXQFLRQH
LQFRUUHFWDPHQWHXQQ~PHURGHVHUYLFLRGH
FLQFRFDUDFWHUHVSRUHMHPSOR&FRQ
XQDFRPELQDFLyQGHXQDOHWUD\FXDWURGtJLWRV
DSDUHFHHQODSDQWDOOD\HQHOYLVXDOL]DGRUGHO
SDQHOIURQWDO(QHVWHFDVRFRQVXOWHOD
VLJXLHQWHWDEOD
, $MXVWH³$7(18$'25´HQ³$-867(
3(5621$/,=$'2´D³12´$MXVWH
³$7(18$'25´HQ³%5,//2´R
³26&852´SiJLQD Aparecen 5 números o letras en pantalla y
en el visualizador del panel frontal.
, 6HKDDFWLYDGRODIXQFLyQGH
DXWRGLDJQyVWLFR&RQVXOWHODWDEODGHOD
SiJLQD La bandeja de discos no se abre y aparece
el mensaje “LOCKED” (bloqueado) en el
visualizador del panel frontal.
, (OFRQWUROGHEORTXHRHVWiDMXVWDGR
SiJLQD La bandeja de discos no se abre y aparece
el mensaje “TRAY LOCKED” (bandeja
bloqueada) en el visualizador del panel
frontal.
, 3yQJDVHHQFRQWDFWRFRQHOSURYHHGRU6RQ\
RFRQXQFHQWURGHVHUYLFLRWpFQLFR6RQ\
ORFDODXWRUL]DGR
70
3ULPHURVWUHV &DXVD\RDFFLyQ
FDUDFWHUHVGHO FRUUHFWLYD
Q~PHURGH
VHUYLFLR
&
(OGLVFRHVWiVXFLR
, /LPSLHHOGLVFRFRQXQ
SDxRVXDYHSiJLQD &
(OGLVFRQRVHKDLQVHUWDGR
FRUUHFWDPHQWH
, 9XHOYDDLQVHUWDUHOGLVFR
FRUUHFWDPHQWH
3DUDHYLWDUIDOORVGH
(;;
[[HVXQQ~PHUR IXQFLRQDPLHQWRHO
UHSURGXFWRUKDDFWLYDGROD
IXQFLyQGHDXWRGLDJQyVWLFR
, 3yQJDVHHQFRQWDFWRFRQ
HOSURYHHGRU6RQ\RFRQ
HOFHQWURGHVHUYLFLR
WpFQLFR6RQ\ORFDO
DXWRUL]DGR\
SURSRUFLyQHOHHOQ~PHUR
GHVHUYLFLRGH
FDUDFWHUHV
(MHPSOR(
Glosario
AV (Audio Visual) (Audiovisual)
(página 18)
$9VLJQLILFD$XGLR9LVXDODXGLRYLVXDO
Audio MPEG (página 24, 67)
6LVWHPDGHFRGLILFDFLyQHVWiQGDU
LQWHUQDFLRQDOXWLOL]DGRSDUDFRPSULPLU
VHxDOHVGHDXGLRGLJLWDODXWRUL]DGDSRU,62
,(&03(*VRSRUWDKDVWDFDQDOHVHQ
HVWpUHR03(*XWLOL]DGRHQHO'9'
VRSRUWDKDVWDFDQDOHVHQYROYHQWHV
DTS (Sistema digital de sala de cine)
(página 24, 67)
7HFQRORJtDGHFRPSUHVLyQGHDXGLRGLJLWDO
GHVDUUROODGDSRU'LJLWDO7KHDWHU6\VWHPV
,QF(VWDWHFQRORJtDDGPLWHHOVRQLGR
HQYROYHQWHGHFDQDOHV(OFDQDOSRVWHULRU
HVHVWpUHR\H[LVWHXQFDQDOGHSRWHQFLDFLyQ
GHJUDYHVLQGHSHQGLHQWHHQHVWHIRUPDWR'76
SURSRUFLRQDORVPLVPRVFDQDOHV
LQGHSHQGLHQWHVGHVRQLGRGLJLWDOGHDOWD
FDOLGDG
6HREWLHQHXQDySWLPDVHSDUDFLyQHQWUH
FDQDOHV\DTXHWRGRVORVGDWRVGHFDQDOVH
JUDEDQSRUVHSDUDGRVLHQGRPtQLPRHO
GHWHULRURJUDFLDVDTXHHOSURFHVDPLHQWRGH
WRGRVORVGDWRVGHFDQDOHVGLJLWDO
Capítulo (página 10)
6HFFLRQHVGHXQDLPDJHQRGHXQDSLH]D
PXVLFDOPHQRUHVTXHORVWtWXORV8QWtWXORVH
FRPSRQHGHYDULRVFDStWXORV$OJXQRVGLVFRV
QRGLVSRQHQGHFDStWXORV
DVD (Videodisco Digital) (página 7)
Dolby Surround (Pro Logic) (página 23)
Escena (página 10)
CD-ROM (Disco compacto de sólo lectura)
(página 7)
&'520VLJQLILFD&RPSDFW'LVF5HDG2QO\
0HPRU\GLVFRFRPSDFWRGHVyOROHFWXUD
Dolby Digital (página 24, 66)
7HFQRORJtDGHSURFHVDPLHQWRGHVHxDOGH
DXGLRGHVDUUROODGDSRU'ROE\/DERUDWRULHV
SDUDHOVRQLGRHQYROYHQWH&XDQGRODVHxDOGH
HQWUDGDFRQWLHQHXQFRPSRQHQWHGHVRQLGR
HQYROYHQWHHOSURFHVR3UR/RJLFHPLWHODV
VHxDOHVIURQWDOHVFHQWUDOHV\SRVWHULRUHV(O
FDQDOSRVWHULRUHVPRQRIyQLFR
Información complementaria
7HFQRORJtDGHFRPSUHVLyQGHDXGLRGLJLWDO
GHVDUUROODGDSRU'ROE\/DERUDWRULHV(VWD
WHFQRORJtDDGPLWHHOVRQLGRHQYROYHQWHGH
FDQDOHV(OFDQDOSRVWHULRUHVHVWpUHR\H[LVWH
XQFDQDOGHSRWHQFLDFLyQGHJUDYHV
LQGHSHQGLHQWHHQHVWHIRUPDWR'ROE\'LJLWDO
SURSRUFLRQDORVPLVPRVFDQDOHV
LQGHSHQGLHQWHVGHDXGLRGLJLWDOGHDOWD
FDOLGDGSUHVHQWHVHQORVVLVWHPDVGHDXGLR
FLQHPDWRJUiILFR'ROE\'LJLWDO6HREWLHQH
XQDySWLPDVHSDUDFLyQHQWUHFDQDOHV\DTXH
WRGRVORVGDWRVGHFDQDOVHJUDEDQSRU
VHSDUDGRVLHQGRPtQLPRHOGHWHULRURJUDFLDV
DTXHHOSURFHVDPLHQWRGHWRGRVORVGDWRVGH
FDQDOHVGLJLWDO
'LVFRTXHFRQWLHQHKDVWDKRUDVGHLPiJHQHV
HQPRYLPLHQWRDXQTXHVXGLiPHWURHVLJXDO
DOGHXQ&'
/DFDSDFLGDGGHGDWRVGHXQ'9'GHXQD
FDSD\XQDFDUDHVGH*%*LJD%\WHTXH
HVYHFHVPD\RUTXHODGHXQ&'/D
FDSDFLGDGGHGDWRVGHXQ'9'GHGRVFDSDV\
XQDFDUDHVGH*%*LJD%\WHXQRGHXQD
FDSD\GRVFDUDVHVGH*%\XQRGHGRV
FDSDV\GRVFDUDVHVGH*%
/RVGDWRVGHLPDJHQXWLOL]DQHOIRUPDWR
03(*XQRGHORVHVWiQGDUHVPXQGLDOHVGH
WHFQRORJtDGHFRPSUHVLyQGLJLWDO/RVGDWRV
GHLPDJHQVHFRPSULPHQHQXQPHGLD
DSUR[LPDGDPHQWHGHVXWDPDxRRULJLQDO(O
'9'WDPELpQHPSOHDXQDWHFQRORJtDGH
FRGLILFDFLyQGHYHORFLGDGYDULDEOHTXH
FDPELDORVGDWRVSDUDDVLJQDUORVVHJ~QHO
HVWDGRGHODLPDJHQ6HJUDEDODLQIRUPDFLyQ
GHDXGLRHQXQIRUPDWRGHP~OWLSOHVFDQDOHV
FRPR'ROE\'LJLWDOSHUPLWLpQGROHGLVIUXWDU
GHXQDVHQVDFLyQGHDXGLRPiVUHDO
$GHPiVHO'9'SURSRUFLRQDGLYHUVDV
IXQFLRQHVDYDQ]DGDVFRPRODGHP~OWLSOHV
iQJXORVPXOWLOLQJHV\GHFRQWUROGH
EORTXHR
(QGLVFRV9,'(2&'FRQIXQFLRQHV3%&
&RQWUROGHUHSURGXFFLyQODVSDQWDOODVGH
PHQ~ODVLPiJHQHVHQPRYLPLHQWR\ODVILMDV
VHGLYLGHQHQVHFFLRQHVGHQRPLQDGDV
³HVFHQDV´
c FRQWLQ~D
71
Índice (CD (Disco compacto))/Índice de
video (VIDEO CD (Disco compacto de
video)) (página 10)
1~PHURTXHGLYLGHXQDSLVWDHQVHFFLRQHV
SDUDORFDOL]DUIiFLOPHQWHXQSXQWR
GHWHUPLQDGRHQXQ9,'(2&'R&'
$OJXQRVGLVFRVQRGLVSRQHQGHtQGLFHV
Pista (página 10)
6HFFLRQHVGHXQDLPDJHQRGHXQDSLH]D
PXVLFDOHQXQ9,'(2&'R&'ORQJLWXGGH
XQDFDQFLyQ
Título (página 10)
/DVHFFLyQPiVODUJDGHXQDLPDJHQRGH
P~VLFDGHORVGLVFRV'9'SHOtFXODVHWFHQ
VRIWZDUHGHYLGHRRHOiOEXPFRPSOHWRHQ
VRIWZDUHGHDXGLR
72
Especificaciones
Sistema
General
Láser: Láser semiconductor
Sistema de formato de señal:
Modelos para América Latina: NTSC
Modelos para Asia/Oceanía: PAL/
NTSC
(Consulte la página 16 para cambiar.)
Requisitos de alimentación:
120 V de ca, 60 Hz
110 a 240 V de ca, 50/60 Hz
220 a 240V de ca, 50/60 Hz
Consulte la página 3 para obtener más
información.
Consumo de alimentación: 13 W/14 W
Consulte la página 3 para obtener más
información.
Dimensiones (aprox.): 430 × 108 × 409 mm
(ancho/alto/prof.) incluidas partes
salientes
Peso (aprox.): 5,1 kg
Temperatura de funcionamiento: 5 ° C a
35 ° C
Humedad de funcionamiento: 25 % a 80 %
Características de audio
Respuesta de frecuencia: DVD VIDEO
(PCM 96 kHz): 2 Hz a 44 kHz (±1,0 dB)/
DVD VIDEO (PCM 48 kHz): 2 Hz a
22 kHz (±0,5 dB)/CD: 2 Hz a 20 kHz
(±0,5 dB)
Relación señal-ruido (relación S/N):
115 dB (sólo toma LINE OUT L/R
(AUDIO) (salida de audio izquierda/
derecha)
Distorsión de armónica: 0,003 %
Gama dinámica: DVD VIDEO: 103 dB/CD:
99 dB
Fluctuación y trémolo: Inferior al valor
detectado (±0,001% W PICO)
Salidas
(Nombre de la toma: Tipo de toma/Nivel de
salida/Impedancia de carga)
LINE OUT L/R (AUDIO) (salida de
audio): Toma fonográfica/2 Vrms/
10 kiloohm
DIGITAL OUT (COAXIAL) (salida
digital coaxial): Toma fonográfica/
0,5 Vp-p/75 ohm
COMPONENT VIDEO OUT (salida de
video componente) (Y, PB/CB, PR/CR):
Toma fonográfica/Y: 1,0 Vp-p/PB, PR, CB,
CR,: 0,7 Vp-p/75 ohm
LINE OUT (VIDEO) (salida de video):
Toma fonográfica/1,0 Vp-p/75 ohm
S VIDEO OUT (salida de video S): Mini
DIN de 4-pines/
Y: 1,0 Vp-p/C: 0,3 Vp-p (PAL),
0,286 Vp-p (NTSC)/75 ohm
Consulte página 15.
Las especificaciones y el diseño están sujetos
a cambios sin previo aviso.
Información complementaria
Se miden las señales de las tomas LINE OUT
L/R (AUDIO) (salida de audio izquierda/
derecha). Al reproducir pistas de sonido PCM
con una frecuencia de muestreo de 96 kHz, las
señales de salida de la toma DIGITAL OUT
(COAXIAL) (salida digital coaxial) se
convierten a frecuencia de muestreo de 48 kHz
Accesorios suministrados
73
Lista de códigos de idiomas
3DUDREWHQHULQIRUPDFLyQGHWDOODGDFRQVXOWHODVSiJLQDV
&yGLJRGHLGLRPD
&yGLJRGHLGLRPD
&yGLJRGHLGLRPD
&yGLJRGHLGLRPD
74
$IDU
$EMDVLDQR
$IULNDDQV
$PKDULF
$UDEH
$VVDPHVH
$\PDUD
$]HUED\DQR
%DVKNLU
%LHORUXVR
%~OJDUR
%LKDUL
%LVODPD
%HQJDOt
%DQJOD
7LEHWDQR
%UHWyQ
&DWDOiQ
&RUVR
&KHFR
*DOpV
'DQpV
$OHPiQ
%XWDQt
*ULHJR
,QJOpV
(VSHUDQWR
(VSDxRO
(VWRQLR
9DVFR
3HUVD
)LQODQGpV
)LML
)HURpV
)UDQFpV
)ULVLR
,UODQGpV
*DpOLFR
*DOOHJR
*XDUDQt
*XMDUDWt
+DXVD
+LQGL
&URDWD
+~QJDUR
$UPHQLR
,QWHUOLQJXD
,QWHUOLQJXH
,QXSLDN
,QGRQHVLR
,VODQGpV
,WDOLDQR
+HEUHR
-DSRQpV
<LGGLVK
-DYDQpV
*HRUJLDQR
.D]DMR
*URHQODQGpV
&DPER\DQR
.DQQDGD
&RUHDQR
.DVKPLUL
.XUGR
.LUJXLVR
/DWtQ
/LQJDOD
/DRVLDQR
/LWXDQR
/HWyQ/HWWLVK
0DODJDVLR
0DRUt
0DFHGRQLR
0DOD\DODP
0RQJROLDQR
0ROGDYR
0DUDWKL
0DOD\R
0DOWpV
%XUPpV
1DXUX
1HSDOt
+RODQGpV
1RUXHJR
2FFLWDQR
$IDQ2URPR
2UL\D
3XQMDEt
3RODFR
3DVKWR
3XVKWR
3RUWXJXpV
4XHFKXD
5KDHWR
5RPDQFH
.LUXQGL
5XPDQR
5XVR
.LQ\DUZDQGD
6iQVFULWR
6LQGKL
6DQJKR
6HUER&URDWD
6LQJKDOpV
(VORYDFR
(VORYHQLR
6DPRDQR
6KRQD
6RPDOt
$OEDQR
6HUELR
6LVZDWL
6HVRWKR
6XQGDQpV
6XHFR
6DZDKLOL
7DPLO
7HOXJX
7DMLN
7KDLODQGpV
7LJULQ\D
7XUNPHQR
7DJDOR
6HWVZDQD
7RQJD
7XUFR
7VRQJD
7DWDU
7ZL
8FUDQLDQR
8UGX
8]EHNR
9LHWQDPLWD
9RODSN
:RORI
;KRVD
<RUXED
&KLQR
=XO~
6LQ
HVSHFLILFDU
Índice alfabético
1XPpULFRV
/RFDOL]DFLyQ
GHXQSXQWRHVSHFtILFR
REVHUYDQGRODSDQWDOODGHO
79
5(3/$<UHSHWLFLyQ
5HSURGXFFLyQDFiPDUDOHQWD
5HSURGXFFLyQDOHDWRULD
5(352'8&&,21$872
5HSURGXFFLyQFRQWLQXD
&''('$726
&'9,'(2&'
'9'
5HSURGXFFLyQGHSURJUDPD
5HSURGXFFLyQ3%&
5(352'8&&,21
352+,%,'$3(5621$/
5HSURGXFFLyQUHSHWLGD
5(67$85$5
5HWURFHVRUiSLGR
0
6
)
/(77(5%2;
3$16&$1
)21'2
)RUPDWRGHVHxDOGHDXGLR
$
,QGLFDFLyQHQSDQWDOOD
,QGLFDGRUGHODEDUUDGH
FRQWURO
3DQWDOODGHDMXVWHV
,1',&(
ËQGLFH
$-867(
$-867($8',2
$-867('(,',20$
$-867(3$17$//$
$-867(3(5621$/,=$'2
$/%80 ÈOEXP
$/($725,$
$OWDYRFHV
&RQH[LyQ
$1*/(iQJXOR
$7(18$&,21'($8',2
$7(18$'25
$8',2
$8',2'5&
$YDQFHUiSLGR
%
%DUUDGHFRQWURO
%15
%~VTXHGD
&
&$3,78/2
&DStWXOR
&'
&''('$726
&RQH[LyQ
&RQILJXUDFLyQUiSLGD
&21752/'(%/248(2
&RQWUROGHEORTXHR
&RQWUROUHPRWR
'
'(6&21(;,21
$8720$7,&$
'LVFRVTXHSXHGHQXWLOL]DUVH
'2/%<',*,7$/
'766LVWHPDGLJLWDOGHVDOD
GHFLQH
'9'
(
(1$/7(&('259,'(2
',*,7$/
(6&(1$
(VFHQD
,
/
0DQHMRGHGLVFRV
0HQ~
0HQ~GHWtWXORV
0HQ~GHO'9'
0(18PHQ~
0(183$17$//$
0(=&/$
02'2'(
9,68$/,=$&,21
3(5621$/,=$'2
02'23$86$
03
03(*
2
2PLWLUXQGLVFR
3
3DQWDOODGHDMXVWHV
3(5621$/,=$'2
3LODV
3,67$
3LVWD
352/2*,&
352*5$0$
3527(&7253$17$//$
5
5È3,'2
5HDQXGDFLyQGHUHSURGXFFLyQ
5($18'$&,21
08/7,',6&2
5HHPSOD]RGHGLVFRVPLHQWUDV
UHSURGXFHXQR
5(3(7,&,21
5(3(7,&,Ï1$%
6DOLGDGHYLGHR6
6$/,'$',*,7$/
6DOLGDGLJLWDO
6(/(&&,213,67$
6HOHFFLRQDUXQGLVFR
6,67(0$&2/25
6ROXFLyQGHSUREOHPDV
6RQLGRHQYROYHQWHGH
FDQDOHV
68%7,7/(VXEWtWXOR
6855281'VXUURXQG
7
7H[WR'9'&'
7,(0327(;72
7,3279
7,78/2
7tWXOR
7230(18PHQ~GHWtWXORV
796799LUWXDO6XUURXQG
8
8QGLVFR7RGRVORVGLVFRV
9
9,'(2&'
9LVXDOL]DGRU
,QGLFDGRUGHODEDUUDGH
FRQWURO
3DQWDOODGHDMXVWHV
9LVXDOL]DGRUGHOSDQHO
IURQWDO
9LVXDOL]DGRUGHOSDQHOIURQWDO
75
6RQ\&RUSRUDWLRQ3ULQWHGLQ0DOD\VLD
Download PDF