Electrolux | EXI09HD1WE | User manual | Electrolux EXI09HD1WE User Manual

EXI09HD1W
EXI12HD1W
EXI18HD1W
EXI22HD1W
EN SPLIT TYPE ROOM AIR
CONDITIONER
FR CLIMATISEUR
INDIVIDUEL DE TYPE
SPLIT
EL ȀȁǿȂǹȉǿȈȉǿȀȅ
ǻȍȂǹȉǿȅȊ
ǻǿǹǿȇȅȊȂǼȃȅȊ ȉȊȆȅȊ
IT CONDIZIONATORE
SPLIT PER AMBIENTI
ES ACONDICIONADOR
DE AIRE TIPO SPLIT
PT AR CONDICIONADO
DE SALA, TIPO SPLIT
USER MANUAL
2
MANUEL D’UTILISATION
22
ǼīȋǼǿȇǿǻǿȅȋȇǾȈȉǾ
42
MANUALE PER L’UTENTE
62
MANUAL DE
INSTRUCCIONES
MANUAL DO UTILIZADOR
82
102
Table of Contents
Congratulations ...................................................................3
Safety Precautions ..............................................................4
Product´s Description ..........................................................6
Indoor Unit Display ..............................................................7
Remote Control ....................................................................7
Remote Control Description ................................................8
Remote Control Display Indicators ......................................9
First Use ..............................................................................10
How to use the Remote Control ...........................................10
How to use the Indoor Unit ..................................................15
Emergency Operation ..........................................................16
Optimal Operation .................................................... ...........16
Cleaning and Maintenance ..................................................17
Operation Tips .....................................................................19
Troubleshooting ...................................................................20
Important Reminder
‡ Keep the remote control where its signal can reach the
receiver of the indoor unit.
‡ When operate the air conditioner, make sure the remote
control is pointing to the signal receiver of the indoor
unit.
‡ When the remote control sends out a signal, the symbol
will blink for about 1 second on the display of the
remote control.
‡ The indoor unit will acknowledge the signal with a beep
when it receives the signal from the remote control.
‡ Please press the button of the remote control and
resend the signal if you did not hear a beep from the
indoor unit.
2
Congratulations
Congratulations and thank you for choosing
Electrolux split-type air conditioner. We are sure
you will find your new air conditioner a pleasure to
use.
Before you use the air conditioner, we recommend
that you read through the entire user manual, which
provides the description of the air conditioner and
its functions.
To avoid the risks that are always present when
you use an electrical appliance, it is important that
the air conditioner is installed correctly and that
you read the safety instructions carefully to avoid
misuse and hazards.
We recommend that you keep this instruction
booklet for future reference and pass it on to any
future owners.
After unpacking the air conditioner please check
it is not damaged. If in doubt, do not use the
air conditioner but contact your local Electrolux
authorised service centre.
Conditions of use
This appliance is intended to be used in
household and similar applications such as:
‡ Staff kitchen areas in shops, offices and other
working environments.
‡ Farm houses.
‡ By clients in hotels, motels, and other
residential type environments.
‡ Bed and breakfast type environments.
environmental tip
Information on disposal for users
‡ Most of the packing materials are recyclable.
‡ Please dispose of those materials through
your local recycling depot or by placing them in
appropriate collection containers.
‡ If you wish to discard this air conditioner, please
contact your local authorities and ask for the
correct method of disposal.
Important notes
‡ Contact an authorised installer for installation of this unit.
‡ Contact an authorised service technician for repair or maintenance of this unit.
‡ The socket outlet required to supply power must be connected and commissioned by a
licenced contractor.
‡ This appliance can be used by children aged from 8 years and above and persons with
reduced physical, sensory or mental capabilities or lack of experience and knowledge if
they have been given supervision or instruction concerning use of the appliance in a safe
way and understand the hazards involved. Children shall not play with the appliance.
Cleaning and user maintenance shall not be made by children without supervision.
‡ If the supply cord is damaged, it must be replaced by the manufacturer, its service agent
or similarly qualified persons in order to avoid a hazard.
‡ Installation work must be performed in accordance with the national wiring standards and
the electricity suppliers service rules by authorised personnel only.
‡ If the unit is to be moved to another location or disposed of, only a suitably qualified person
is permitted to undertake such work.
‡ Take care not to catch fingers on the fan blade when adjusting vertical louvers.
‡ This air conditioner uses R410a refrigerant.
3
Safety precautions
Inside this manual you will find many helpful hints
on how to use and maintain your air conditioner
properly. Just a little preventive care on your part
can save you a great deal of time and money over
the life of your air conditioner. You’ll find many
answers to common problems in the chart of
troubleshooting tips on page 20-21. If you review the
chart of troubleshooting tips first, you may not need
to call for service.
Meanings of symbols used in this manual are shown
below:
caution
This indicates information concerning your personal
safetyand how to avoid damaging the appliance.
tips and information
This symbol indicates tips and information about use
of the appliance.
environmental tip
This symbol indicates tips and information about
economical and ecological use of the appliance.
This symbol indicates never to do this.
Always do this.
Important notes:
1 Do not operate unit with horizontal louvre inclosed
position.
2 Do not operate unit without the air filter.
warning
If you notice an unusal situation, such
as a burning smell, please switch off
the power to the air conditioner and
contact an Electrolux service agent. If
this abnormal status continues the air
conditioner may be damaged or even
cause electric shock or ¿UH
Do not operate the air conditioner with
wet hands. This may cause electric
shock.
Do not damage or cut off the power cord
or other wires. If this occurs, please have
it repaired or replaced by an accredited
technician
Do not connect this air conditioner to a
multi outlet powerboard.
Please switch off the power supply to
the air conditioner if it is not to be used
for an extended period. Otherwise, it will
accumulate dust and may cause a ¿UH
Before cleaning the air conditioner,
please disconnect the power supply in
order to eliminate the possibility of electric
shock.
The power supply should be matched
with the air conditioner according to
the installation manual. Air conditioners
provided with a supply cord should be
connected directly to a power outlet with
a suitable safety switch. Air conditioners
that are hard wired must be connected to
a suitable safety circuit breaker according
to the installation manual.
Please ensure that the power supply to
the air conditioner is stable and meets the
requirements set out in the installation
manual.
Always ensure the product is installed
with appropriate earthing.
For safety, be sure to turn off the
circuit breaker before performing any
maintenance or cleaning or when the
product is not used for an extended
period of time. Accumulated dust may
cause ¿UH or electric shock.
4
Safety precautions
Usage
caution
Select the most appropriate temperature.
It can save electricity.
Do not keep windows and doors open for
a long time during operation. It will result
in LQVXI¿FLHQW performance.
Do not block the air inlet or outlet.
It will result in LQVXI¿FLHQW performance
and cause malfunctions.
Keep combustible materials away from
the units at least 1m. It may cause ¿UH
Do not step on the top of the outdoor unit
or place heavy things on it.
It may cause damage or injury.
Do not attempt to repair the air
conditioner by yourself. Incorrect repairs
may cause electric shock or ¿UH Please
contact your local authorised service
centre.
Do not insert your hands or objects into
the air inlet or outlet. It may cause injury.
Do not expose animals or plants directly
to the air ÀRw.
Do not use the unit for any other purpose,
such as preserving food or drying clothes.
Do not splash water on the air
conditioner. It may cause electric shock
or malfunction.
Exposure to direct DLUÀRZ from the air
conditioner for an extended period of time could
be hazardous to your health.
Do not expose people, pets or plants to the
direct DLUÀRZ for an extended period.
Cleaning and maintenance
1 When cleaning the unit, first make sure that
the power and circuit breaker are turned off.
2 Do not touch the metal parts of the unit
when removing the filters. Injuries can occur
when handling sharp metal edges.
3 Do not use water to clean inside the air
conditioner. Exposure to water may lead to
possible electric shock.
Service
For repair and maintenance, contact your
authorised service dealer.
Prior to Operation
1 Contact an installation qualified for
installation.
2 Plug in the power plug properly.
3 Do not use a damaged or non-standard
power cord.
4 Do not share the same outlet with other
appliances.
5 Do not use an extension cord.
6 Do not start/stop operation by plugging /
unplugging the power cord.
You can also get this manual through your local distributor or by visiting our website.
Please find the Electrolux web addresses to your local country from below table.
Country
Website address
Country
Website address
Country
Website address
Albania
www.electrolux.al
Germany
www.electrolux.de
Romania
www.electrolux.ro
Austria
www.electrolux.at
Greece
www.electrolux.gr
Serbia
www.electrolux.rs
Belgium
www.electrolux.be
Hungary
www.electrolux.hu
Bulgaria
www.electrolux.bg
www.electrolux.hr
www.electrolux.it
www.electrolux.lu
www.electrolux.sk
www.electrolux.sl
Croatia
Italy
Luxembourg
Slovakia
Slovenia
Spain
www.electrolux.es
Czech Republik
www.electrolux.cz
Netherlands
www.electrolux.nl
Sweden
www.electrolux.se
Denmark
www.electrolux.dk
Norway
www.electrolux.no
Switzerland
www.electrolux.ch
Finland
France
www.electrolux.fi
www.electrolux.fr
Poland
www.electrolux.pl
Turkey
www.electrolux.com.tr
Portugal
www.electrolux.pt
UK & Ireland
www.electrolux.co.uk
Please visit www.electrolux.com for more information.
Correct Disposal of this product
This marking indicates that this product should not be disposed with other household wastes
throughout the EU. To prevent possible harm to the environment or human health from uncontrolled
waste disposal, recycle it responsibly to promote the sustainable reuse of material resources. To
return your used device, please use the return and collection systems or contact the retailer where
the product was purchased. They can take this product for environmental safe recycling.
5
Product Description
Air inlet
2
Indoor Unit
1
13
3
4
5
Air Outlet
6
7
8
Outdoor Unit
9
12
11
Air inlet (rear)
Mode
Fan
Temp
Timer-Off
Swing
Light
Turbo
Timer-On
Clock
I feel
Eco
Air inlet
(side)
10
Air Outlet
15
Front panel
Remote control
Digital display
Remote control holder
Healthy air ¿OWHU (behind the dust ¿OWHU
Refrigerant pipe (if applicable)
Pre-dust ¿OWHU
Drain hose (if applicable)
Horizontal air louvers
Power cable (if applicable)
Vertical air louvers
Mounting plate
Cold plasma generator (if applicable)
Connecting cable (if applicable)
Manual control button
Note: The above drawings are for explanation purpose only.
Your air conditioner may be slightly different.
The actual shape shall prevail.
6
14
Indoor Unit Display
‡ ,I\RXNHHSWKHUHPRWHFRQWUROLQDSRVLWLRQWKDW
KLQGHUVSURSHUVLJQDOWUDQVPLVVLRQDWLPHODJRI
XSWRPLQXWHVPD\RFFXU
6LJQDO
UHFHLYHU
I Feel indicator
,WOLJKWVZKHQ,)HHOIXQFWLRQLVDFWLYDWHG
Turbo indicator
,OOXPLQDWHVGXULQJTXUERRSHUDWLRQ
‡ :KHQWKHUHPRWHFRQWUROVHQGVRXWDVLJQDOWKH
V\PERO ZLOOEOLQNIRUDERXWVHFRQGRQWKH
GLVSOD\7KHLQGRRUXQLWZLOODFNQRZOHGJHWKH
VLJQDOZLWKDEHHSZKHQLWUHFHLYHVDQHfIHFWLYH
VLJQDO
caution
Eco (Economy) indicator
,OOXPLQDWHVZKHQ(&2IXQFWLRQLVLQRSHUDWLRQ
‡ 7KHDLUFRQGLWLRQHUZLOOQRWRSHUDWHLIFXUWDLQV
GRRUVRURWKHUPDWHULDOVEORFNWKHVLJQDOVIURP
WKHUHPRWHFRQWUROWRWKHLQGRRUXQLW
Temperature indicator
'LVSOD\VWKHWHPSHUDWXUHVHWWLQJVZKHQWKHDLU
FRQGLWLRQHULVLQRSHUDWLRQ
‡ 3UHYHQWDQ\OLTXLGIURPIDOOLQJLQWRWKHUHPRWH
FRQWURO'RQRWH[SRVHWKHUHPRWHFRQWUROWR
GLUHFWVXQOLJKWRUKHDW
Timer indicator
7KHLQGLFDWRULOOXPLQDWHVZKHQTLPHULVVHW21
DQGRU2))
‡ ,IWKHLQIUDUHGVLJQDOUHFHLYHURQWKHLQGRRU
XQLWLVH[SRVHGWRGLUHFWVXQOLJKWWKHDLU
FRQGLWLRQHUPD\QRWIXQFWLRQSURSHUO\8VH
FXUWDLQVWRSUHYHQWWKHVXQOLJKWIURPIDOOLQJRQ
WKHUHFHLYHU
Swing indicator
,WOLJKWVZKHQWKH6ZLQJIXQFWLRQLVDFWLYDWHG
Remote Control
‡ ,IRWKHUHOHFWULFDODSSOLDQFHVUHDFWWRWKH
UHPRWHFRQWUROHLWKHUPRYHWKHVHDSSOLDQFHV
RUFRQVXOW\RXUORFDOGHDOHU
How to use the Remote Control
‡ 3RLQWWKHUHPRWHFRQWUROWRWKHVLJQDOUHFHLYHURI
LQGRRUXQLW
‡ 0DNHVXUHWKHUHLVQRREVWDFOHWKDWPD\LQWHUIHUH
ZLWKWKHVLJQDO
Location of the remote control
Battery installation/replacement
‡ 6OLGHWKHEDWWHU\FRPSDUWPHQWFRYHURfIDQG
LQVHUWWZRQHZDONDOLQHGU\EDWWHULHV
[$$$VROW0DNHVXUHWKDWWKHSRODULW\RI
RULVLQVWDOOHGFRUUHFWO\
‡ 6OLGHWKHEDWWHU\FRPSDUWPHQWFRYHUEDFNRQ
tips and information
‡ :KHQFKDQJLQJEDWWHULHVGRQRWXVHROG
RUYDULHGRQHVRWKHUZLVHLWPD\FDXVH
SUREOHPVZLWKWKHUHPRWHFRQWURO
8m
Mode
Fan
Temp
Timer-Off
Swing
Light
Turbo
Timer-On
Clock
I feel
Eco
‡ .HHSWKHUHPRWHFRQWUROZKHUHLWVVLJQDO
FDQUHDFKWKHUHFHLYHURIWKHLQGRRUXQLWD
PD[LPXPGLVWDQFHRIPLVDOORZHG
‡ :KHQ\RXVHOHFWWKHWLPHURSHUDWLRQWKH
UHPRWHFRQWURODXWRPDWLFDOO\WUDQVPLWVDVLJQDO
WRWKHLQGRRUXQLWDWWKHVSHFL¿HGWLPH
‡ ,IWKHUHPRWHFRQWUROLVQRWXVHGIRUDORQJ
WLPHUHPRYHWKHEDWWHULHVDVROGEDWWHULHV
PD\OHDNRUFRUURGHDQGGDPDJHWKHUHPRWH
FRQWURO
‡ 7KHEDWWHU\OLIHGXULQJQRUPDOXVHLVDERXWVL[
PRQWKV
‡ ,IWKHUHPRWHFRQWUROGRHVQRWRSHUDWH
QRUPDOO\SOHDVHUHPRYHDQGUH¿WWKH
EDWWHULHV,IDEQRUPDORSHUDWLRQFRQWLQXHV
UHSODFHZLWKQHZEDWWHULHV
7
Remote Control Description
Turbo Button
Press this button in COOL or HEAT mode to put
the fan into the high speed Turbo mode and the air
conditoner will work at maximum power.
Press again to cancel this function.
X-Fan Button
Press the X-Fan button to active the
Self-Cleaning. After the unit is turned off the indoor
fan will continue operation for 2 minutes to dry
the indoor unit prevent from bacteria and mildew
growing.
Timer On Button
Press this button to set the start time.
Timer Off Button
Press this button to set the stop time.
Swing Button:
Press this button, the louver will swing up and
down automatically. Press again to cancel it and
the louver will stay at its last position.
ON/OFF Button
Press this button to turn the air conditioner
ON or OFF.
Mode Button
By pressing this button, AUTO, DEHUMIDIFY,
FAN, COOL, and HEAT (COOL only model
has no HEAT feature) mode can be selected
progressively.
AUTO mode is default while power on.
Under AUTO mode, the initial value would not be
displayed, and it will run in the desirable Tem.
Under HEAT mode, the initial value is 28°C;
Under other modes, the initial value is 25°C.
AUTO
DEHUMIDIFY
FAN
COOL
Control Button:
Forward
Backward
Press the
setting.
button to increase the temperature
Press the
setting.
button to decrease the temperature
In Timer On/Off or Clock functions, use these
buttons to set the clock or timer adjustment.
Clock Button:
Press this button and the Clock symbol will
blink. You can press Control buttons and to
set the time you want.
HEAT
Light Button
Press this button to switch the indicating lights
of the indoor unit ON or OFF.
The normal condition at start up is ON.
Fan Button
By pressing this button, Auto, Low, Medium and
High speed can be progressively selected.
When the unit is turned on, Auto fan speed is
the default.
In DEHUMIDIFY mode, the fan speed is ¿[HG at
Low speed.
8
I Feel Button:
Press this button, the remote control will send the
temperature information to the indoor unit every
10 minutes. The unit will operate to reach the set
temperature at the location of remote control.
Presss again to cancel this function.
Temp (Temperature) Button
Press this button to change the indoor unit
display of the set temperature to the room
temperature.
Eco (Economy) Button
Press this button to start the Eco operation.
This is ideal for the users to use while sleeping.
Press again to cancel the function.
Note:
Under heating mode, press Temp and Clock
buttons to turn on the function of heating the
indoor room temperature to 8°C.
Remote Control Display
Indicator
Transmission Indicator:
Displays when the remote control transmits
signals to the indoor unit.
Fan Speed Display
Displays the selected fan speed in the following
sequence:
Turbo Display
Displays when Turbo function is selected.
“ ” (Low), “
Auto.
I Feel Display
Displays when I Feel function is activated.
In Auto speed, only “ ” symbol displays.
Eco Display
Displays when Eco function is selected.
Healthy Display
Displayed by pressing the Healthy button.
Press the Healthy button again to remove.
NOTE: there is no such indicator for the
models without Cold-Plasma function.
Room Temperature Display
Displays when the temperature shown on the
LCD screen is room temperature. It can be
switched on/off by pressing the Temp button.
Programmed Temperature Display
Lights when the remote control displays the
set temperature. It can be switched on/off by
pressing the Temp button.
Timer On/Off Display
Displays when the Timer On/Off function is
activated.
” (Medium), “
” (High) and
Swing Display
Displays when the Swing function is selected.
X-Fan Display
Displays when the X-Fan function is activated by
pressing Turbo and Healthy buttons at the same
time (for models with Cold-plasma function) or by
pressing X-Fan button (for models without Coldplasma function)
Temperature Display
Displays the room or set temperature in °C or °F.
No display in Fan mode.
Time Display
Displays the Clock time (must be set) and/or the
on/off time of the timer.
Mode Display
Displays the current operation mode, including
Auto (
), Dehumidify ( ), Fan ( ), Cool (
and Heat ( ).
)
NOTE: The Cool model does not offer a Heating
option.
9
First Use
1 Ensure the unit is plugged in and power is
available.
2 Be sure the batteries are inserted correctly in the
remote control (the lights on the remote control
will be on).
3 Set the time by Control buttons and FRQ¿UP by
pressing the Clock button.
4 Point the remote control to the indoor unit and
press ON/OFF button to turn the unit on.
The default operating mode is AUTO. Once you
select the operating mode with remote control,
the operating conditions will be saved in the
indoor unit’s microcomputer memory. The next
time the air conditioner will start operating under
the same conditions when you simply push the
ON/OFF button of the remote control.
tips and information
In case of energy cut off or product shut
down when removing the power cord, or
even when changing the remote control
batteries the microprocessor will return
back to the AUTO mode.
How to Use the Remote Control
If the AUTO mode is uncomfortable, you
can select the desired conditions manually.
tips and information
When the AUTO operating mode is selected,
the fan speed and temperature will be
automatically controlled and can not be set.
Automatic Operation
When the AUTO mode is selected, the air
conditioner will automatically select COOL, HEAT
(if applicable), or FAN only operation, depending on
the programmed and/or the room temperature.
Start
1 ON/OFF Button
Press this button to turn the air conditioner on.
The temperature indicator on the indoor unit
display lights on.
Dehumidifying Operation
The DEHUMIDIFY mode works based on the
difference between the set temperature and the
actual room temperature.
The temperature is regulated while dehumidifying
through repeatedly turning on/off of the COOLING
operation or FAN only operation.
2 Mode Button Press to select AUTO.
ng
oli
Co
n
Fa
oli
Co
n
Fa
Set the desired temperature.
ng
3 Control Buttons
The air conditioner starts functioning after approx
3 minutes.
Stop
1 ON/OFF Button
Press this button again to turn the air conditioner
off. The horizontal louver returns back to the
position upon shut down.
10
Programmed temp.
Time
Dehumidifying Operation
Start
1 ON/OFF Button
Press this button to turn the air conditioner on.
The temperature indicator on the indoor unit
display lights on.
2 Mode Button
Press to select DEHUMIDIFY.
2 Mode Button
Press to select FAN.
3 Fan Button
Press to select the desired fan speed at: Auto,
Low, Medium and High.
The default fan speed is Auto.
3 Control Buttons
Set the desired temperature.
Normally, set between 21ºC to 28ºC.
Stop
1 ON/OFF Button
Press this button again to turn the air
conditioner off. The horizontal louver returns
back to the position upon shut down.
Stop
1 ON/OFF Button
Press this button again to turn the air
conditioner off. The horizontal louver returns
back to the position upon shut down.
tips and information
‡ No fan speed indication disaplys on the
remote control if Auto fan speed is selected.
tips and information
In DEHUMIDIFY mode the fan speed is ¿[HG
at Low, and Turbo function can’t be used.
Fan Operation
When you select the FAN operating mode the air
conditioner will just vent the indoor air.
1 ON/OFF Button
Press this button to turn the air conditioner on.
The temperature indicator on the indoor unit
display lights on.
Cooling and Heating Operation
Start
1 ON/OFF Button
Press this button to turn the air conditioner on.
The temperature indicator on the indoor unit
display lights on.
2 Mode Button
Press to select COOL or HEAT (if applicable)
mode.
11
3 Control Buttons
Set the desired temperature.
Normally, set between 21ºC to 28ºC.
4 Fan Button
Press to select the desired fan speed at: Auto,
Low, Medium and High.
The defaul fan speed is Auto.
tips and information
No fan speed indication disaplys on the
remote control if Auto fan speed is selected.
3 Point the remote control to the indoor unit, FRQ¿UP
the set time by pressing the Timer-On button.
symbol will stay on the remote control’s display.
Check that the Timer indicator on the display panel
of indoor unit is illuminated.
Canceling the Settings
Point the remote control to the indoor unit and press
again the Timer-On button. Make sure the symbol
on the remote control is turned off.
Timer Off Operation
1 Press the Timer-Off button,
will ÀDVK on the display of the remote
control in case of the ¿UVW use of Timer-Off
operation. Otherwise, the last set time will ÀDVK
2 Set the desired time by pressing the Control
buttons:
Forward
Backward
Each time you press the buttons, the time will
moves forward or backward by 1 minute.
Holding the button down will scroll more rapidly
through the time display.
3 Point the remote control to the indoor unit, FRQ¿UP
the set time by pressing the Timer-Off button.
symbol will stay on the remote control’s display.
Check that the Timer indicator on the display panel
of indoor unit is illuminated.
Canceling the Settings
Point the remote control to the indoor unit and press
again the Timer-Off button. Make sure the symbol
on the remote control is turned off.
Stop
1 ON/OFF Button
Press this button again to turn the air
conditioner off. The horizontal louver returns
back to the position upon shut down.
Timer Settings
Timer On Operation
1 Press the Timer-On button,
will ÀDVK on the display of the remote
control in case of the ¿UVW use of Timer-On
operation. Otherwise, the last set time will
ÀDVK
2 Set the desired time by pressing the Control
buttons:
Forward
Backward
Each time you press the buttons, the time will
moves forward or backward by 1 minute.
Holding the button down will scroll more
rapidly through the time display.
12
tips and information
‡ The working time of the timer function set by
the remote control depends on the Clock time.
Check that the Clock on the remote control is
set correctly in order to prevent malfunctioning.
‡ The effective operation time set by the remote
control is limited in 24 hours.
Examples of Timer Settings
Timer On Operation (Timer Start Operation)
This function is recommended when you want the
unit to be turned on automatically before returning
home. The air conditioner will automatically start
operating at the set time.
Example: It is 8:00 AM and you want the air
conditioner to start working at 6:00 PM.
1 Press the Timer-On button.
2 Set the desired time by pressing repeatedly or
holding down the Control buttons until 18:00
shows in the display of the remote control.
3 &RQ¿UP the set time by pointing the remote
control to the indoor unit and pressing again the
Timer-On button.
4 Press the Timer-Off button.
3 &RQ¿UP the set time by pointing the remote
control to the indoor unit and pressing again
the Timer-On button.
5 Set the desired time by pressing repeatedly or
holding down the Control buttons until 09:30
shows in the display of the remote control.
symbol will stay on the remote control’s
display.
The Timer indicator on the display panel of
indoor unit is illuminated.
Timer Off Operation (Timer Stop Operation)
This function is recommended when you want
the unit to be turned off automatically for bed
time.
The air conditioner will automatically stop
operating at the set time.
Example: It is 6:00 PM and you want the Air
Conditioner to turn off at 11:55 PM.
1 Press the Timer-Off button.
6 Confirm the set time by pointing the remote
control to the indoor unit and pressing again the
Timer-Off button.
symbol is displayed on the remote control and
the function is activated.
Timer Off
Timer On
(On-Stop-Start operation)
This function is recommended when you want to
turn the air conditioner off after going to bed and
start it again before waking up in the morning or
returning back home.
Example:It is 8:00 AM and you want to stop the
air conditioner at 9:30AM and restart at 6:00PM
1 Press the Timer-Off button.
2 Set the desired time by pressing repeatedly or
holding down the Control buttons until 23:55
shows in the display of the remote control.
2 Set the desired time by pressing repeatedly or
holding down the Control buttons until 09:30
shows in the display of the remote control.
3 &RQ¿UP the set time by pointing the remote
control to the indoor unit and pressing again
the Timer-Off button.
symbol will stay on the remote control’s
display.
The Timer indicator on the display panel of
indoor unit is illuminated.
3 &RQ¿UP the set time by pointing the remote
control to the indoor unit and pressing again the
Timer-Off button.
4 Press the Timer-On button.
Combined Timer
Timer Off
Timer On
(Off-Start-Stop operation)
5 Set the desired time by pressing repeatedly or
holding down the Control buttons until 18:00
shows in the display of the remote control.
This function is recommended when you want to
turn the air conditioner on before waking up and
turn it off after leaving the house.
Example: It is 10:00 PM and you want to start
the air conditioner at 6:30 AM and stop it at
9:30 AM.
1 Press the Timer On button.
2 Set the desired time by pressing repeatedly or
holding down the Control buttons until 06:30
shows in the display of the remote control.
6 &RQ¿UP the set time by pointing the remote
control to the indoor unit and pressing again the
Timer-On button.
symbol is displayed on the remote control and
the function is activated.
13
Setting the Clock
Economy (Eco) Operation
3UHVV(FREXWWRQLQ&22LRU+(ATLIDSSOLFDEOH
PRGHWKHDLUFRQGLWLRQHUZLOODXWRPDWLFDOO\LQFUHDVH
LQ&22LPRGHRUGHFUHDVHLQ+(ATPRGHƒ&SHU
KRXURYHUDKRXUSHULRG7KHVHWWHPSHUDWXUHZLOOEH
VWHDG\IRUWKHQH[WKRXUVWKHQWKHXQLWZLOOVWRS
7KLVIXQFWLRQSHUPLWVPRUHFRPIRUWDQGVDYHVHQHUJ\
7KLVRSHUDWLRQLVUHFRPPHQGHGIRUEHGWLPH
1
Set
Temperature
1
1 hour
1 hour
Cooling
Set
Temperature
1
1
%HIRUH\RXVWDUWRSHUDWLQJWKHDLUFRQGLWLRQHU
VHWWKHFORFNRIWKHUHPRWHFRQWUROXVLQJWKH
SURFHGXUHJLYHQLQWKLVVHFWLRQ7KHFORFNSDQHO
RQWKHUHPRWHFRQWUROZLOOGLVSOD\WKHWLPH
UHJDUGOHVVRIZKHWKHUWKHDLUFRQGLWLRQHULVLQ
RSHUDWLRQRUQRW
$IWHUEDWWHULHVDUHLQVHUWHGLQWKHUHPRWHFRQWURO
ZLOOGLVSOD\DQGEHJLQWRÀDVK
1 &RQWURO%XWWRQV
3UHVVWKH&RQWUROEXWWRQVWRVHWWKHGHVLUHG
WLPH
)RUZDUG
%DFNZDUG
(DFKWLPH\RXSUHVVWKHEXWWRQVWKHWLPHZLOO
PRYHVIRUZDUGRUEDFNZDUGE\PLQXWH
+ROGLQJWKHEXWWRQGRZQZLOOVFUROOPRUHUDSLGO\
WKURXJKWKHWLPHGLVSOD\
&ORFN%XWWRQ
:KHQWKHGHVLUHGWLPHLVDFKLHYHGSUHVVWKH
&ORFNEXWWRQDJDLQRUDIWHUVHFRQGVZLWKQR
RSHUDWLRQWKHFORFNWLPHVWRSVÀDVKLQJDQGWKH
FORFNLVVHW
3 5HVHWWKH&ORFN
3UHVVWKH&ORFNEXWWRQDQGWKHFORFNGLVSOD\
ZLOOVWDUWWRÀDVK
)ROORZVWHSDQGWRVHWWKHQHZWLPH
tips and information
‡ 7KHFORFNWLPHUXVHVDKRXUFORFNPRGH
‡ 7KHGHIDXOWWLPHIRUUHPRWHFRQWUROLV
30DQGLWZLOOUHYHUWWRWKLVZKHQWKH
EDWWHULHVDUHFKDQJHG
14
1hour
1 hour
Heating
I Feel Operation
7KHUHPRWHFRQWUROZRUNVDVDUHPRWHWKHUPRVWDW
SURYLGLQJDQDFFXUDWHWHPSHUDWXUHFRQWURODQG
PD[LPXPFRPIRUW
3RLQWWKHUHPRWHFRQWUROWRWKHLQGRRUXQLWDQGSUHVV,
)HHOEXWWRQDEHHSIURPWKHLQGRRUXQLWLVWRFRQ¿UP
WKDWWKLVIXQFWLRQLVDFWLYDWHG
7KH,)HHOV\PERO ZLOOVWD\RQWKHGLVSOD\RIWKH
UHPRWHFRQWUROXQWLO,)HHOEXWWRQLVSUHVVHGDJDLQ
7KHDLUFRQGLWLRQHUZLOORSHUDWHWRUHDFKWKHVHW
WHPSHUDWXUHDWWKHORFDWLRQRIWKHUHPRWHFRQWURO
7KHUHPRWHFRQWUROVHQGVWKHWHPSHUDWXUHLQIRUPDWLRQ
DWLWVORFDWLRQWRWKHLQGRRUXQLWHYHU\PLQXWHV
7KHDLUFRQGLWLRQHUZLOOTXLW,)HHORSHUDWLRQLIQR
WHPSHUDWXUHLQIRUPDWLRQLVUHFHLYHGIURPWKHUHPRWH
FRQWUROIRUVXFFHVVLYH1PLQXWHV
How to Use the Indoor Unit
Additional Options
1 Smart Restart Function
The air conditioner resumes automatically with
the previous settings after a possible power
failure.
‡ When the louver moves to the desired direction,
press the Swing button again and the louver will
stay at where it is.
‡ Press the Swing button again and the louver will
start swing up and down automatically.
2 Removable Panel
The front panel of indoor unit can be easily
removed for cleaning and maintenance.
3 Self Diagnose and Auto Protection
This air conditioner can detect the malfunctions,
showing the diagnosis on the display of the
indoor unit by means of an error code.
The air conditioner will change operation
automatically for self-protection.
Range
Up and down DLUÀRZ
To adjust the horizontal (left/right) airflow
direction manually
Airflow Direction Control
‡ Adjust the vertical louvers manually by means of
the Left/Right lever of the vertical louver arm.
‡ Adjust the DLUÀRZ direction properly, otherwise,
it might cause discomfort or uneven room
temperatures.
‡ Perform these adjustments before you start the
unit because once it has been started, there is a
risk of your ¿QJHUV getting caught on the fan.
‡ Adjust the horizontal louvers with the remote
control.
‡ Adjust the vertical louvers manually.
Vertical
louver
Range
Left/ and right DLUÀRZ
caution
To set the vertical (up/down) airflow direction
automatically
‡ Perform this function while the unit is in
operation.
‡ Press the Swing button on the remote control,
the horizontal louver will swing up and down
automatically.
‡ The Swing button will be disabled when the
air conditioner is not in operation (even if the
Timer On is set).
‡ Do not operate the air conditioner for long
time with the DLUÀRZ direction set downward
in COOL or DEHUMIDIFY mode. Otherwise,
condensate may occur on the surface of the
horizontal louver and drop onto the ÀRRU or
furnishings.
15
‡ Do not move the horizontal louver
manually. Always use the Swing button.
Moving the louver manually may
cause malfunction during operation.
If the louver malfunctions, stop the air
conditioner and restart it.
‡ Open angle of the horizontal louver
should not be set too small, as cooling
or heating performance may be impaired
due to too restricted DLUÀRZ area.
‡ Do not operate the air conditioner with
horizontal louver in closed position.
‡ When the air conditioner is connected to
power (initial operation), the horizontal
louver may generate a sound for
10 seconds, this is a normal operation.
Emergency Operation
When the remote control is lost or fails to operate,
please use the manual switch on the indoor unit.
The air conditioner will operate in AUTO mode and
the temperature setting or fan speed can not be
changed.
‡ Press the Manual Control button again to turn the
air conditioner off.
The operation mode is seen in the following table.
Mode
Model
Indoor Temperature
$LUÀRZ
AUTO
HEAT PUMP
25°C
COOL/FAN
AUTO
HEAT PUMP
20°C
HEAT/FAN
Operating Temperature
Operating temperature ranges
Indoor Side
DB/WB(°C)
Outdoor Side
DB/WB(°C)
Maximum Cooling
32/23
43/26
Minimum Cooling
21/15
21/-
Maximum Heating
27/-
24/18
Minimum Heating
20/-
The operation temperature range (outdoor
temperature) for cooling only model is -7ºC~43ºC,
for heat pump model is -7ºC~24ºC.
If the air conditioner is used outside of the above
conditions, certain safety protection features may
come into operation and cause the unit to function
abnormally.
Optimal Operation
To achieve optimal performance, please note:
‡ Adjust the DLUÀRZ direction correctly so that it is
not directed on people.
‡ Adjust the temperature to achieve the highest
comfort level. Do not adjust the unit to excessive
temperature levels.
Manual control
button
‡ Close doors and windows in the operation
of COOL or HEAT mode, otherwise, product
performance will be impaired.
‡ Use the Timer On and Timer Off buttons on the
remote control to select the desired time for
startup and shut-down.
Manual control button
‡ Press the Manual Control button to enter
AUTO mode. The air conditioner will select the
mode of COOL, HEAT (heat pump model only)
and FAN automatically according to the room
temperature for reaching the best comfort.
16
‡ Do not place any object close to the air inlets
or outlets, as the product HI¿FLHQF\ may be
reduced and the air conditioner may stop
running.
‡ Clean the air ¿OWHUV frequently, otherwise cooling
or heating performance may be reduced.
Cleaning and Maintenance
Maintenance
The following maintenance operations must be performed regularly.
Maintenance
operations
Items
Recommended frequency
Dust ¿OWHU
Clean
Every month or more often if necessary
Healthy air ¿OWHUV
Replace/clean
Every 3 months or more often if necessary
Unit casing
Clean
Every month or more often if necessary
Water tray and
evacuation piping
Clean and check for
obstructions
Each season before start up*
Indoor and outdoor
coils
Clean
Each season before start up*
* The operation must be performed by TXDOL¿HG personnel only.
warning
‡ Stop the air conditioner and disconnect the
power supply before cleaning.
Indoor Unit and Remote
Control Cleaning
‡ Use a dry cloth to wipe the indoor unit and
remote control.
‡ A cloth dampened with cold water may be used
on the indoor unit if it is too dirty.
Panel
bracket
1 Lift the indoor unit front panel up to an angle until
it stops with a full support from the bracket.
‡ The front panel of the indoor unit cant be
removed and cleaned with water. Then wipe
with a dry cloth.
‡ Do not use brushes, emery paper or burnishes
to clean the unit because it may cause
damages.
‡ Do not use a chemically treated cloth or duster
to clean the unit.
‡ Do not use benzine, thinner, polishing powder
or similar solvents for cleaning. These may
cause the plastic surface to crack or deform.
Dust ¿OWHU handle
2 Hold the dust ¿OWHU handle and lift it up slightly to
take it out from the ¿OWHU holder.
‡ Never use warm water over 40°C to clean
the front panel, it may cause deformation or
discoloration.
Cleaning the Filters
Note: Supply power must be disconnected before
cleaning.
A clogged dust ¿OWHU reduces the cooling/heating
HI¿FLHQF\ of this unit. Please clean the ¿OWHU every
month or more often if necessary.
3 Then pull the dust ¿OWHU downwards out of the
indoor unit.
17
Dust ¿OWHU
warning
Do not touch or try to clean the cold
plasma generator (if applicable). It
may cause an electric shock.
General maintenance
Clean the Dust ¿OWHU with a vacuum cleaner or
water, then dry it up in cool place.
If the air conditioner is not going to be used for a
long period of time:
‡ Operate in FAN only mode for 3~4 hours to allow
the unit to completely dry out.
Dust ¿OWHU
‡ Switch off the unit and pull out the power plug.
Remove the batteries from the remote control.
Healthy ¿OWHU
‡ The outdoor unit requires periodic maintenance
and cleaning. Do not attempt to do this yourself.
Contact your dealer or service technician.
4 The healthy air freshening ¿OWHUV (if applicable) like
Active carbon ¿OWHU / BIO ¿OWHU / Vitamin C ¿OWHU /
Silver ion ¿OWHU are ¿[HG on the dust ¿OWHr.
Remove the healthy ¿OWHUV from the support frame
of the dust ¿OWHr.
Checks before operation
‡ Check that the wiring is not broken or
disconnected
‡ Check that the dust ¿OWHU is installed.
‡ Check if the air outlet or inlet is blocked if the air
conditioner has not been used for a long time.
Clean the healthy ¿OWHUV at least every three (3)
months and replace every 6 months.
Clean with vacuum cleaner if possible.
warning
‡ Do not touch the metal parts of the unit when
removing the ¿OWHr. Injuries can occur when
handling sharp metal edges.
5 Install the healthy air freshening ¿OWHUV back
in position.
6 Install the upper portion of dust ¿OHUV back
into the unit, taking care that the left and right
edges line up correctly and place dust ¿OWHUV
into position.
18
‡ Do not use water to clean inside the air
conditioner. Exposure to water can destroy
the insulation, leading to possible electric
shock.
‡ When cleaning the unit, ¿UVW make sure that
the power and circuit breaker are turned off.
‡ Defrosting
Frost may form on the outdoor unit in heating
operation when the outdoor temperature
is low but humidity is high, resulting in low
heating HI¿FLHQFy.
environment that has a high relative humidity.
‡ A white mist may generate due to moisture
generated from defrosting process when the air
conditioner restarts in HEAT mode operation after
defrosting.
4. Low noise of the air conditioner
‡ You may hear a low hissing sound when the
compressor is running or has just stop running.
This is the sound of the refrigerant ÀRZLQJ or
coming to a stop.
‡ You also may hear a low “squeak” sound when
the compressor is running or just stopped
running. This is caused by heat expansion and
cold contraction of the plastic parts in the unit
when the temperature is changing.
‡ A noise may be heard due to louver restoring to
its original position when power is furst turned on.
5. Dust is blown out from the indoor unit
This is a normal condition when the air conditioner
has not been used for a long time or during ¿UVW use
of the unit.
During this condition the air conditioner will
stop heating operation and start defrosting
automatically. The time to defrost may vary
from 3 to 12 minutes.
6. A peculiar smell comes out from the indoor unit
This is caused by the indoor unit giving off smells
permeated from building material, furniture or
smoke.
During defrosting, the fan motors of indoor
unit and outdoor unit will stop, the indoor
indicator ÀDVKHV “H1” and the outdoor unit
may emit vapor. This is not malfunction. After
defrosting is ¿QLVKHG the heating operation
will recover automatically.
7. The air conditioner turnes to FAN only mode
from COOL or HEAT mode
When the indoor temperature reaches the setting
value, the compressor will stop automatically, and
the air conditioner turns to FAN mode.
‡ Anti-cold air
In HEAT mode, the indoor fan will not operate
in order to prevent cold air being blown into
the room (within 5 minutes), if the indoor
heat exchanger does not reach a minimum
temperature under the following states:
The compressor will start again when the indoor
temperature rises in COOL mode or falls in HEAT
mode to the set point.
Operation Tips
The following events may occur during normal
operation:
1. Protection of the air conditioner.
‡ Compressor protection
The compressor can’t restart for 3 minutes
after it stops
‡ Anti-freezing
If the unit is operating in COOL mode and
in low ambient temperature, frost may be
formed on the heat exchanger. When indoor
heat exchanger temperature decreases
below 0°C, the compressor will stop
operation to protect the unit.
(1) Heating operation just start.
(2) After auto defrosting is just ¿QLVKHG
(3) Heating at low temperature.
2. Gentle breeze
The indoor unit may blow gentle breeze and the
louver rotate to a certain position in the following
situation:
(1) In HEAT mode, the unit is turned on, the
compressor does not reach the starting
condition.
(2) In HEAT mode, the temperature reaches the
set value and the compressor stops running
for about 1 minute.
3. A white mist coming out from the indoor unit
‡ A white mist may generate due to a large
temperature difference between air inlet
and air outlet in COOL mode in an indoor
8. Condensation
Condensate water is likely to form at the air outlet
if cooling or drying for a long time when the relative
humidity is more than 80% (with doors and windows
open).
Set the vertical louver to its maximum angle (to
the ÀRRU and High fan speed. Close the doors and
windows.
9. Lighting or a car wireless telephone operating
nearby may cause the unit to malfunction.
Disconnect the unit with power and then re-connect
the unit with power again. Push ON/OFF button on
the remote control to restart operation.
10. X-Fan function
The indoor unit may keep running after you switch
off the unit by pressing ON/OFF button.
Please check whether the X-Fan function is
switched off.
19
Troubleshooting
The air conditioner is not user serviceable. Incorrect repair may cause electric shock or ¿UH
Please contact an authorised service center for professional repair.
warning
If one of the following situations occur, immediately stop the air conditioner,
disconnect the power, and contact the authorised service center.
‡ If error code appear on the display window of
indoor unit.
‡ Power indicator or other indicator ÀDVK rapidly
and this ÀDVKLQJ can not be stopped by
disconnecting the power and then connecting
it again.
‡ Fuse blows frequently or circuit breaker often
trips.
‡ Water or other liquid is splashed into the unit.
‡ Water is leaking from the unit.
‡ There is a harsh sound during operation.
‡ Strong odours are emmited during operation.
‡ Power cord and power plug are overheating.
‡ Other abnormal situations.
The pressure in the refrigeration system is low and could result in the unit breaking down.
Ask a FHUWL¿HG installer to control it.
Malfunctions
The unit does not
start
The unit does not
cool or heat (if
applicable) the room
very well while air
ÀRZV out from the air
conditioner
Cause
What should be done
Power cut
Wait for power to be restored.
The unit may have become unplugged.
Check that plug is securely in wall
receptacle.
Fuse may have blown.
Replace the fuse.
Voltage is too high or too low.
Test the voltage by professionals.
Batteries in remote control may have
been exhausted.
Replace the batteries.
The time you have set with timer is
incorrect.
Wait or cancel timer setting.
Inappropriate temperature setting.
Set the temperature correctly.
For details please refer to “Using
Remote Control” section
Air ¿OWHU is blocked.
Clean the air ¿OWHr.
Doors or windows are open.
Close the doors or windows.
Air inlet or outlet of indoor or outdoor
unit has been blocked.
Clear the obstructions away ¿UVW
then restart the unit.
Compressor 3 minutes protection has
been activated.
Wait for 3 minutes.
If the trouble has not been corrected, please contact a local dealer or the nearest customer service
center. Be sure to inform them of the detailed malfunctions and unit model.
20
The following checks prior to contact may save you time and money.
Malfunctions
Cause
Malfunctions
Cause
The unit does
not operate
The unit does not operate if it is
turned on immediately after it is
turned off. This is to protect the
unit. Please wait about 3 minutes.
Water leakage
of indoor unit
‡The humidity is high.
‡Condensing water RYHUÀRZV
‡Drain hose is loose or
obstructed.
Odours are
emitted
‡Some odours may be emmited
from the indoor unit. This is the
result of room smells (such as
furniture, tobacco, etc.) which
have been taken into the unit.
‡Consult authorised service
center for cleaning if the odours
persist.
Water leakage
of outdoor unit
‡During cooling operation, water
condensates around the pipes
and connection joints.
‡During defrosting operation,
thawed water ÀRZV out.
‡During heating operation, water
on the heat exchanger drips out.
“Water ÀRZLQJ´
noise
The swishing noise like water
ÀRZLQJ is the refrigerant ÀRZLQJ
inside the unit.
Noise from
indoor unit
Mist is
emmited in
COOL mode
During cooling operation, a thin
mist may be seen emmited from
the indoor unit due to high room
temperature and humidity.
After a period of time, the mist
will disappear as the decrease of
room temperature and humidity.
‡The noise emmited when the fan
or compressor relay is switched
on or off.
‡When the defrosting operation
is started or stopped, there is a
sound of refrigerant ÀRZLQJ in
the reverse direction.
Cracking noise
This is the sound of friction
caused by expansion and/or
contraction of panel or other
parts due to the change of
temperature.
Indoor unit can
not blow air
The unit can
not be started
up
‡Is the power cut off?
‡Is the power plug loose?
(if applicable)
‡Is the circuit protection device
tripped off?
‡Is voltage higher or lower?
(tested by professionals)
‡Is the TIMER correctly used?
‡Are the batteries exhausted?
Cooling
/Heating effect
is poor
‡Is the temperature setting
appropriate?
‡Is the air inlet/outlet blocked?
‡Is the ¿OWHU dirty?
‡Is the door or window open?
‡Is low fan speed set?
‡Are there heat sources in the
room?
‡In HEAT mode, when the
temperature of indoor heat
exchanger is very low, DLUÀRZ is
stopped in order to prevent cold
air. (within 2 minutes)
‡In HEAT mode, when the
outdoor temperature is low or
humidity is high, frost will be
formed on the outdoor heat
exchanger. The unit will defrost
automatically and indoor unit will
stop blowing air for 2-3 mintues.
‡During defrosting operation,
water or vapour may be
emmited.
‡In DEHUMIDIFY mode, the
indoor fan will stop blowing air
for 3-12 minutes in order to
avoid condensing water being
vaporised again.
Moisture on air
outlet
If the unit operates at high
humidity for a long time, moisture
may be generated on air outlet
grill and then drip off.
H1 error code:
defrosting
It is normal. The unit is in
defrosting operation and heating
will recommence soon.
Do not dispose this product as unsorted municipal waste.
Collection of such waste separately for special treatment
is necessary.
21
Sommaire
Félicitations ..........................................................................23
Consignes de sécurité .........................................................24
Description de l'appareil ......................................................26
$I¿FKDJHGHO
pOpPHQWLQWpULHXU ...........................................27
7pOpFRPPDQGH .....................................................................27
'HVFULSWLRQGHODWpOpFRPPDQGH .........................................28
9R\DQWVGHO
DI¿FKDJHGHODWpOpFRPPDQGH ........................29
3UHPLqUHXWLOLVDWLRQ ..............................................................30
&RPPHQWXWLOLVHUODWpOpFRPPDQGH ......................................30
&RPPHQWXWLOLVHUO
pOpPHQWLQWpULHXU ....................................35
Opération d'urgence ............................................................36
8WLOLVDWLRQRSWLPDOH ..............................................................36
Nettoyage et entretien .........................................................37
Conseils d'utilisation ............................................................39
(QFDVG
DQRPDOLHGHIRQFWLRQQHPHQW.................................40
Rappel important
‡ /DLVVH]ODWpOpFRPPDQGHGDQVXQHQGURLWRVRQVLJQDO
SHXWrWUHFDSWpSDUOHUpFHSWHXUGHO
pOpPHQWLQWpULHXU
‡ /RUVTXHYRXVXWLOLVH]OHFOLPDWLVHXUDVVXUH]YRXVTXHOD
WpOpFRPPDQGHHVWSRLQWpHYHUVOHUpFHSWHXUGHVLJQDOGH
O
pOpPHQWLQWpULHXU
‡ /RUVTXHODWpOpFRPPDQGHpPHWXQVLJQDOOHV\PEROH
FOLJQRWHSHQGDQWHQYLURQVHFRQGHVXUO
DI¿FKDJHGHOD
WpOpFRPPDQGH
‡ /
pOpPHQWLQWpULHXUUHFRQQDvWOHVLJQDOHQpPHWWDQWXQ
ELSORUVTX
LOUHoRLWOHVLJQDOGHODWpOpFRPPDQGH
‡ $SSX\H]VXUODWRXFKHGHODWpOpFRPPDQGHHWUHQYR\H]
OHVLJQDOVLYRXVQ
HQWHQGH]SDVOHELSSURYHQDQWGH
O
pOpPHQWLQWpULHXU
22
)pOLFLWDWLRQV
1RXVYRXVIpOLFLWRQVHWYRXVUHPHUFLRQVG
DYRLU
FKRLVLXQFOLPDWLVHXUGHW\SHVSOLW(OHFWUROX[1RXV
VRPPHVSHUVXDGpVTXHYRXVDXUH]SODLVLUjXWLOLVHU
YRWUHQRXYHDXFOLPDWLVHXU
$YDQWG
XWLOLVHUOHFOLPDWLVHXUQRXVYRXV
UHFRPPDQGRQVGHOLUHDWWHQWLYHPHQWO
HQVHPEOHGH
ODSUpVHQWHQRWLFHRYRXVWURXYHUH]ODGHVFULSWLRQ
de l'appareil et de ses fonctions.
$¿QG
pYLWHUOHVULVTXHVOLpVjO
XWLOLVDWLRQGHV
DSSDUHLOVpOHFWULTXHVHWXQHPDXYDLVHXWLOLVDWLRQ
GHO
DSSDUHLOLOHVWLPSRUWDQWTXHOHFOLPDWLVHXU
VRLWFRUUHFWHPHQWLQVWDOOpHWTXHYRXVOLVLH]
DWWHQWLYHPHQWOHVFRQVLJQHVGHVpFXULWp
1RXVYRXVFRQVHLOORQVGHFRQVHUYHUFHWWHQRWLFH
d'utilisation pour toute consultation ultérieure et
GHODIRXUQLUjO
DFKHWHXUHQFDVGHUHYHQWHGH
l'appareil.
$SUqVDYRLUUHWLUpOHFOLPDWLVHXUGHVRQHPEDOODJH
YpUL¿H]TX
LOQ
HVWSDVHQGRPPDJp(QFDVGH
GRXWHQ
XWLOLVH]SDVOHFOLPDWLVHXUHWFRQWDFWH]
YRWUHVHUYLFHDSUqVYHQWH(OHFWUROX[ORFDO
conseil pour l'environnement
,QIRUPDWLRQVVXUODPLVHDXUHEXWGHO
DSSDUHLO
GHVWLQpHVjO
DFKHWHXU
‡ /DSOXSDUWGHVPDWpULDX[XWLOLVpVSRXUOHV
HPEDOODJHVVRQWUHF\FODEOHV
‡ 3RXUODPLVHDXUHEXWGHFHVPDWpULDX[
FRQWDFWH]YRWUHFHQWUHGHUHF\FODJHORFDORX
XWLOLVH]OHVFRQWHQHXUVGHWULVpOHFWLIDSSURSULpV
‡ 3RXUODPLVHDXUHEXWGHFHFOLPDWLVHXU
LQIRUPH]YRXVGHODGpPDUFKHjVXLYUHDXSUqV
des autorités locales.
attention
‡ &HFOLPDWLVHXUQ
HVWSDVSUpYXSRXUrWUHXWLOLVp
par de jeunes enfants ou des personnes
LQ¿UPHVVDQVVXUYHLOODQFH
‡ (PSrFKH]OHVHQIDQWVGHMRXHUDYHFOH
FOLPDWLVHXU
‡ &RQWDFWH]XQLQVWDOODWHXUDJUppSRXULQVWDOOHU
FHFOLPDWLVHXU
‡ Les opérations de réparation et d'entretien
VRQWGXUHVVRUWH[FOXVLIG
XQWHFKQLFLHQ
TXDOL¿p
&RQGLWLRQVG
XWLOLVDWLRQ
&HWDSSDUHLOHVWFRQoXXQLTXHPHQWSRXUXQXVDJH
GRPHVWLTXHHWGHVXWLOLVDWLRQWHOOHVTXH
‡ &XLVLQHVUpVHUYpHVDX[HPSOR\pVGDQVGHV
PDJDVLQVEXUHDX[HWDXWUHVOLHX[GHWUDYDLO
‡ %kWLPHQWVGHIHUPH
‡ 3RXUXQHXWLOLVDWLRQSULYpHSDUOHVFOLHQWVGDQV
GHVK{WHOVHWDXWUHVOLHX[GHVpMRXU
‡ (QFKDPEUHG
K{WH
Remarques importantes
&RQWDFWH]XQLQVWDOODWHXUDJUppSRXULQVWDOOHUFHW
appareil.
Les opérations de réparation et d'entretien sont
GXUHVVRUWH[FOXVLIG
XQWHFKQLFLHQTXDOL¿p
‡ /DSULVHGHVRUWLHUHTXLVHSRXUO
DOLPHQWDWLRQ
GRLWrWUHUDFFRUGpHHWDFFUpGLWpHSDUXQ
entrepreneur agréé.
‡ &HWDSSDUHLOQ
HVWSDVFRQoXSRXUrWUHXWLOLVp
SDUGHVSHUVRQQHV\FRPSULVGHVHQIDQWV
GRQWOHVIDFXOWpVSK\VLTXHVVHQVRULHOOHVRX
PHQWDOHVVRQWUpGXLWHVRXTXLPDQTXHQW
G
H[SpULHQFHHWGHFRQQDLVVDQFHVjPRLQV
qu'une personne responsable de leur
VpFXULWpQHOHVVXSHUYLVHRXOHXUGRQQH
GHVLQVWUXFWLRQVVXUODPDQLqUHGHO
XWLOLVHU
‡ (PSrFKH]OHVHQIDQWVGHMRXHUDYHFOH
FOLPDWLVHXU
‡ 6LOHFkEOHG
DOLPHQWDWLRQGRLWrWUHUHPSODFp
LOQHGRLWrWUHUHPSODFpTXHSDUXQUpSDUDWHXU
agréé.
‡ /
LQVWDOODWLRQGRLWrWUHHIIHFWXpHHQDFFRUG
DYHFOHVVWDQGDUGVGHFkEODJHQDWLRQDX[
HWOHVUpJOHPHQWDWLRQVGHVVHUYLFHVGH
IRXUQLWXUHG
pOHFWULFLWpSDUXQWHFKQLFLHQ
DJUppXQLTXHPHQW
‡ 6LYRXVGHYH]GpSODFHURXPHWWUHO
DSSDUHLO
DXUHEXWVHXOHXQHSHUVRQQHTXDOL¿pHHVW
DXWRULVpHjHQWUHSUHQGUHFHWWHWkFKH
‡ 9HLOOH]jQHSDVWRXFKHUODSDOHGXYHQWLODWHXU
DYHFYRVGRLJWVORUVTXHYRXVDMXVWH]OHV
YROHWVYHUWLFDX[
‡ 6LOHFkEOHG
DOLPHQWDWLRQGRLWrWUHUHPSODFp
LOQHGRLWrWUHUHPSODFpTXHSDUXQUpSDUDWHXU
agréé.
‡ /
LQVWDOODWLRQGRLWrWUHHIIHFWXpHHQDFFRUGDYHF
OHVVWDQGDUGVGHFkEODJHQDWLRQDX[SDUXQ
WHFKQLFLHQDJUppXQLTXHPHQW
23
&RQVLJQHVGHVpFXULWp
'DQVFHPDQXHOYRXVWURXYHUH]GHQRPEUHX[
FRQVHLOVVXUODIDoRQG
XWLOLVHUHWG
HQWUHWHQLUYRWUH
FOLPDWLVHXU8QSHXGHSUpYHQWLRQGHYRWUHSDUWSHXW
YRXVIDLUHpFRQRPLVHUGXWHPSVHWGHO
DUJHQWVXUOD
GXUpHGHYLHGHYRWUHFOLPDWLVHXU9RXVWURXYHUH]GH
QRPEUHXVHVUpSRQVHVjGHVSUREOqPHVFRPPXQV
GDQVOHWDEOHDXGHVFRQVHLOVHQFDVG
DQRPDOLHGH
IRQFWLRQQHPHQWDX[SDJHVHW(QUHJDUGDQWFH
WDEOHDXHQSUHPLHUOLHXYRXVQ
DXUH]SHXWrWUHSDV
EHVRLQG
DSSHOHUOHVHUYLFHDSUqVYHQWH
6LJQL¿FDWLRQGHVV\PEROHVXWLOLVpVGDQVFHPDQXHO
attention
&HV\PEROHLQGLTXHXQHLQIRUPDWLRQFRQFHUQDQW
YRWUHVpFXULWpSHUVRQQHOOHHWODIDoRQG
pYLWHUWRXW
GRPPDJHVXUO
DSSDUHLO
conseils et informations
&HV\PEROHLQGLTXHGHVFRQVHLOVHWGHVLQIRUPDWLRQV
concernant l'utilisation de l'appareil.
conseil pour l'environnement
&HV\PEROHLQGLTXHGHVFRQVHLOVHWGHVLQIRUPDWLRQV
FRQFHUQDQWO
XWLOLVDWLRQpFRQRPLTXHHWpFRORJLTXHGH
l'appareil.
&HV\PEROHLQGLTXHXQHDFWLRQjQHMDPDLV
entreprendre.
3URFpGH]WRXMRXUVFRPPHFHOD
5HPDUTXHVLPSRUWDQWHV
1HIDLWHVSDVIRQFWLRQQHUO
DSSDUHLODYHFXQYROHW
KRUL]RQWDOHQSRVLWLRQIHUPpH
2 1
XWLOLVH]MDPDLVO
DSSDUHLOVDQV¿OWUHjDLU
24
avertissement
6LYRXVUHPDUTXH]XQHVLWXDWLRQ
LQKDELWXHOOHFRPPHXQHRGHXUGHEU€Op
FRXSH]O
DOLPHQWDWLRQDXFOLPDWLVHXU
HWFRQWDFWH]OHVHUYLFHDSUqVYHQWH
(OHFWUROX[6LFHWWHVLWXDWLRQFRQWLQXH
OHFOLPDWLVHXUSHXWrWUHHQGRPPDJp
RXSURYRTXHUXQFKRFpOHFWULTXHRXXQ
incendie.
1
XWLOLVH]MDPDLVOHFOLPDWLVHXUDYHFOHV
PDLQVPRXLOOpHV&HFLSHXWSURYRTXHUXQ
FKRFpOHFWULTXH
1HFRXSH]SDVRXQ
HQGRPPDJH]SDV
OHFRUGRQG
DOLPHQWDWLRQRXG
DXWUHV
FkEOHV6LFHODDUULYHIDLWHVOHUpSDUHURX
UHPSODFHUSDUXQWHFKQLFLHQDJUpp
1HEUDQFKH]SDVGHFOLPDWLVHXUjXQH
FDUWHG
DOLPHQWDWLRQPXOWLVRUWLHV
6LYRXVQ
XWLOLVH]SDVOHFOLPDWLVHXU
SHQGDQWXQFHUWDLQWHPSVGpEUDQFKH]
O
DOLPHQWDWLRQ6LQRQLOSRXUUDLWDFFXPXOHU
ODSRXVVLqUHHWSURYRTXHUXQLQFHQGLH
$YDQWGHQHWWR\HUOHFOLPDWLVHXU
GpEUDQFKH]O
DOLPHQWDWLRQD¿Q
G
HPSrFKHUWRXWFKRFpOHFWULTXH
/
DOLPHQWDWLRQGRLWrWUHUDFFRUGpHDX
FOLPDWLVHXUVHORQOHPDQXHOG
LQVWDOODWLRQ
/HVFOLPDWLVHXUVIRXUQLVDYHFXQFkEOH
G
DOLPHQWDWLRQGRLYHQWrWUHGLUHFWHPHQW
UDFFRUGpVjODSULVHDYHFXQLQWHUUXSWHXU
GHVpFXULWp/HVFOLPDWLVHXUVDYHF
UDFFRUGHPHQW¿[HGRLYHQWrWUHUDFFRUGpV
jXQGLVMRQFWHXUDGDSWpHQDFFRUGDYHFOH
PDQXHOG
LQVWDOODWLRQ
$VVXUH]YRXVTXHO
DOLPHQWDWLRQDX
FOLPDWLVHXUHVWVWDEOHHWTX
HOOHUpSRQG
DX[H[LJHQFHVGXPDQXHOG
LQVWDOODWLRQ
$VVXUH]YRXVWRXMRXUVTXHO
DSSDUHLOHVW
LQVWDOOpDYHFXQHPLVHjODWHUUHDGDSWpH
3RXUSOXVGHVpFXULWppWHLJQH]OH
GLVMRQFWHXUDYDQWWRXWHQWUHWLHQRX
nettoyage ou lorsque le produit ne sera
SDVXWLOLVpSHQGDQWXQFHUWDLQWHPSV/D
SRXVVLqUHDFFXPXOpHSHXWSURYRTXHUXQ
LQFHQGLHRXXQFKRFpOHFWULTXH
&RQVLJQHVGHVpFXULWp
attention
6pOHFWLRQQH]ODWHPSpUDWXUHODSOXV
appropriée.
9RXVpFRQRPLVHUH]GHO
pOHFWULFLWp
1HODLVVH]SDVOHVIHQrWUHVHWOHV
SRUWHVRXYHUWHVWURSORQJWHPSVGXUDQW
OHIRQFWLRQQHPHQW/HVSHUIRUPDQFHV
SRXUUDLHQWrWUHLQVXI¿VDQWHV
1
REVWUXH]SDVO
HQWUpHHWODVRUWLHG
DLU
/HVSHUIRUPDQFHVSRXUUDLHQW
rWUHLQVXI¿VDQWHVHWFDXVHUGHV
G\VIRQFWLRQQHPHQWV
&RQVHUYH]OHVPDWLqUHVFRPEXVWLEOHV
jDXPRLQVPGHVDSSDUHLOV5LVTXH
d'incendie.
1HPDUFKH]SDVVXUO
pOpPHQWH[WpULHXUHW
QHSODFH]SDVGHFKRVHVORXUGHVGHVVXV
5LVTXHGHGpJkWVHWGHEOHVVXUHV
1
HVVD\H]SDVGHUpSDUHUOHFOLPDWLVHXU
YRXVPrPH'HPDXYDLVHVUpSDUDWLRQV
SHXYHQWSURYRTXHUXQFKRFpOHFWULTXHRX
XQLQFHQGLH&RQWDFWH]OHVHUYLFHDSUqV
YHQWHORFDODJUpp
8WLOLVDWLRQ
/
H[SRVLWLRQSURORQJpHDXÀX[G
DLUGLUHFWGX
FOLPDWLVHXUSRXUUDLWrWUHGDQJHUHX[SRXUYRWUH
santé.
1HODLVVH]SDVOHVJHQVOHVDQLPDX[RXOHV
SODQWHVUHVWHUWURSORQJWHPSVGDQVOHÀX[G
DLU
direct de l'appareil.
1HWWR\DJHHWHQWUHWLHQ
/RUVTXHYRXVQHWWR\H]O
pOpPHQW
FRPPHQFH]SDUYRXVDVVXUHUTXHOHFRXUDQW
et le disjoncteur sont éteints.
2 1HWRXFKH]SDVOHVSDUWLHVPpWDOOLTXHVGH
O
pOpPHQWORUVTXHYRXVUHWLUH]OHV¿OWUHV
9RXVSRXUULH]YRXVEOHVVHUHQPDQLSXODQW
GHVSDUWLHVPpWDOOLTXHVFRXSDQWHV
3 1
XWLOLVH]SDVG
HDXSRXUQHWWR\HUO
LQWpULHXU
GXFOLPDWLVHXU/
HDXSRXUUDLWSURYRTXHUXQ
FKRFpOHFWULTXH
0DLQWHQDQFH
3RXUOHVUpSDUDWLRQVHWO
HQWUHWLHQFRQWDFWH]OH
VHUYLFHDSUqVYHQWHDJUppGHYRWUHUHYHQGHXU
1
LQVpUH]SDVYRVPDLQVRXGHVREMHWV
GDQVO
DUULYpHRXODVRUWLHG
DLU5LVTXHGH
blessure.
1HSODFH]SDVG
DQLPDX[RXGHSODQWHV
GLUHFWHPHQWjSUR[LPLWpGXÀX[G
DLU
1
XWLOLVH]SDVO
DSSDUHLOSRXUXQHDXWUH
XWLOLVDWLRQSDUH[HPSOHSRXUFRQVHUYHU
GHVDOLPHQWVRXVpFKHUGHVYrWHPHQWV
1
DVSHUJH]SDVG
HDXVXUOHFOLPDWLVHXU
5LVTXHGHFKRFpOHFWULTXHRXGH
G\VIRQFWLRQQHPHQW
$YDQWXWLOLVDWLRQ
&RQWDFWH]XQWHFKQLFLHQG
LQVWDOODWLRQ
TXDOL¿pSRXULQVWDOOHUO
DSSDUHLO
2 ,QVpUH]FRUUHFWHPHQWOD¿FKH
G
DOLPHQWDWLRQ
3 1
XWLOLVH]SDVGHFkEOHG
DOLPHQWDWLRQ
HQGRPPDJpRXQRQVWDQGDUG
4 1
XWLOLVH]SDVODPrPHVRUWLHSRXU
d'autres appareils.
5 1
XWLOLVH]SDVGHUDOORQJH
6 1HGpPDUUH]Q
DUUrWH]SDVO
DSSDUHLO
HQEUDQFKDQWGpEUDQFKDQWOHFkEOH
G
DOLPHQWDWLRQ
25
'HVFULSWLRQGHO
DSSDUHLO
eOpPHQWLQWpULHXU
$UULYpHG
DLU
2
3
5
Sortie d'air
6
7
8
eOpPHQWH[WpULHXU
9
$UULYpHG
DLUDUULqUH
0RGe
FaQ
Temp
7LPHU2II
6ZLQJ
$UULYpHG
DLU
ODWpUDOH
Sortie d'air
/LJKW
7XUEo
7LPHU2Q
&ORFk
,IHHO
(Fo
)DoDGHDYDQW
7pOpFRPPDQGH
$I¿FKDJHQXPpULTXH
6XSSRUWGHODWpOpFRPPDQGH
)LOWUHjDLUVDLQGHUULqUHOH¿OWUHjSRXVVLqUH
7X\DXUpIULJpUDQWVLGLVSRQLEOH
3Up¿OWUHjSRXVVLqUH
7X\DXGHYLGDQJHVLGLVSRQLEOH
9ROHWVG
DLUKRUL]RQWDX[
&kEOHG
DOLPHQWDWLRQVLGLVSRQLEOH
9ROHWVG
DLUYHUWLFDX[
3ODTXHGHPRQWDJH
*pQpUDWHXUGHSODVPDIURLGVLGLVSRQLEOH
&kEOHGHUDFFRUGHPHQWVLGLVSRQLEOH
7RXFKHGHFRPPDQGHPDQXHOOH
5HPDUTXH Les dessins ci-dessus sont fournis à titre indicatif uniquement.
Votre climatiseur peut être légèrement différent.
La forme réelle prévaut.
26
$I¿FKDJHGHO
pOpPHQWLQWpULHXU
‡ 6LYRXVODLVVH]ODWpOpFRPPDQGHGDQVXQH
SRVLWLRQQHSHUPHWWDQWSDVODERQQHWUDQVPLVVLRQ
GXVLJQDOLOSHXW\DYRLUXQGpFDODJHGH
PLQXWHV
5pFHSWHXU
du signal
9R\DQW,)HHO
,OV
DOOXPHORUVTXHODIRQFWLRQ,)HHOHVWDFWLYpH
9R\DQWGHWXUER
,OV
DOOXPHGXUDQWOHPRGH7XUER
9R\DQW(FReFRQRPLTXH
,OV
DOOXPHORUVTXHODIRQFWLRQ(&2HVWHQFRXUV
GHIRQFWLRQQHPHQW
,QGLFDWHXUGHWHPSpUDWXUH
$I¿FKHOHVUpJODJHVGHWHPSpUDWXUHORUVTXHOH
FOLPDWLVHXUHVWHQIRQFWLRQQHPHQW
$I¿FKDJHGHODPLQXWHULH
/HYR\DQWV
DOOXPHORUVTXHOHPLQXWHXUHVW
$&7,9eHWRX'e6$&7,9e
9R\DQW6ZLQJ
,OV
DOOXPHORUVTXHODIRQFWLRQ6ZLQJHVWDFWLYpH
7pOpFRPPDQGH
&RPPHQWXWLOLVHUODWpOpFRPPDQGH
‡ 3RLQWH]ODWpOpFRPPDQGHHQGLUHFWLRQGX
UpFHSWHXUGHVLJQDOGHO
pOpPHQWLQWpULHXU
‡ $VVXUH]YRXVTX
DXFXQREVWDFOHQHSHXW
LQWHUIpUHUDYHFOHVLJQDO
(PSODFHPHQWGHODWpOpFRPPDQGH
‡ /RUVTXHODWpOpFRPPDQGHpPHWXQVLJQDOOH
V\PEROH FOLJQRWHSHQGDQWHQYLURQVHFRQGH
VXUO
DI¿FKDJH/
pOpPHQWLQWpULHXUUHFRQQDvW
OHVLJQDOHQpPHWWDQWXQELSORUVTX
LOUHoRLWXQ
VLJQDOYDOLGH
attention
‡ /HFOLPDWLVHXUQHIRQFWLRQQHUDSDVVLGHV
ULGHDX[GHVSRUWHVRXG
DXWUHVREMHWVEORTXHQW
OHVVLJQDX[GHODWpOpFRPPDQGHjO
pOpPHQW
intérieur.
‡ eYLWH]TXHOHVOLTXLGHVQHVHUpSDQGHQW
VXUODWpOpFRPPDQGH1
H[SRVH]SDVOD
WpOpFRPPDQGHjODFKDOHXURXDX[UD\RQV
directs du soleil.
‡ Si le récepteur du signal infrarouge de
O
pOpPHQWLQWpULHXUHVWH[SRVpDX[UD\RQVGX
VROHLOOHFOLPDWLVHXUSHXWQHSDVIRQFWLRQQHU
FRUUHFWHPHQW8WLOLVH]GHVULGHDX[SRXUpYLWHU
que les rayons du soleil n'atteignent
le récepteur.
‡ Si d'autres appareils électriques réagissent aux
VLJQDX[GHODWpOpFRPPDQGHGpSODFH]FHV
DSSDUHLOVRXFRQVXOWH]YRWUHUHYHQGHXUORFDO
,QVWDOODWLRQUHPSODFHPHQWGHVSLOHV
‡ )DLWHVJOLVVHUOHFDFKHGXFRPSDUWLPHQWGHVSLOHV
SRXUOHVRUWLUSXLVLQVpUH]GHX[QRXYHOOHVSLOHV
DOFDOLQHV[$$$9$VVXUH]YRXVTXHOHV
SRODULWpVHWVRQWFRUUHFWHPHQWLQVWDOOpHV
‡ 5HPHWWH]OHFDFKHGXFRPSDUWLPHQWGHVSLOHVHQ
place.
conseils et informations
‡ /RUVTXHYRXVFKDQJH]OHVSLOHVQ
XWLOLVH]SDV
GHYLHLOOHVSLOHVRXGHVSLOHVGLIIpUHQWHVFDU
HOOHVSRXUUDLHQWSURYRTXHUXQSUREOqPHjOD
WpOpFRPPDQGH
8m
0RGe
FaQ
Temp
7LPHU2II
6ZLQJ
/LJKW
7XUER
7LPHU2Q
&ORFk
,IHHO
(Fo
‡ /DLVVH]ODWpOpFRPPDQGHGDQVXQHQGURLWR
VRQVLJQDOSHXWrWUHFDSWpSDUOHUpFHSWHXUGH
O
pOpPHQWLQWpULHXUODGLVWDQFHPD[LPDOHHVWGH
P
‡ /RUVTXHYRXVUpJOH]OHPLQXWHXUOD
WpOpFRPPDQGHWUDQVPHWDXWRPDWLTXHPHQWOH
VLJQDOjO
pOpPHQWLQWpULHXUjO
KHXUHFKRLVLH
‡ 6LODWpOpFRPPDQGHQ
HVWSDVXWLOLVpHGXUDQW
ORQJWHPSVUHWLUH]OHVSLOHVFDUGHYLHLOOHV
SLOHVSHXYHQWIXLURXURXLOOHUHWSURYRTXHUGHV
GpJkWVVXUODWpOpFRPPDQGH
‡ /DGXUpHGHYLHGHVSLOHVHQXWLOLVDWLRQ
QRUPDOHHVWG
HQYLURQPRLV
‡ 6LODWpOpFRPPDQGHQHIRQFWLRQQHSDV
QRUPDOHPHQWUHWLUH]SXLVUHSODFH]OHVSLOHV
6LOHSUREOqPHSHUVLVWHUHPSODFH]OHVSLOHV
SDUGHVQHXYHV
27
'HVFULSWLRQGHODWpOpFRPPDQGH
7RXFKH7XUER
(QPRGH&22/UHIURLGLVVHPHQWRX+($7
FKDXIIDJHDSSX\H]VXUFHWWHWRXFKHSRXUUpJOHUOD
YLWHVVHGXYHQWLODWHXUjYLWHVVHPD[LPDOHHQPRGH
7XUERSRXUTXHOHFOLPDWLVHXUIRQFWLRQQHjSOHLQH
puissance.
$SSX\H]GHQRXYHDXVXUFHWWHWRXFKHSRXUDQQXOHU
cette fonction.
7RXFKH;)DQ
$SSX\H]VXUODWRXFKH;)DQSRXUDFWLYHUOHQHWWR\DJH
DXWRPDWLTXH$SUqVDYRLUpWHLQWO¶DSSDUHLOOHYHQWLODWHXU
LQWpULHXUFRQWLQXHGHWRXUQHUGXUDQWPLQXWHVSRXU
VpFKHUO¶pOpPHQWLQWpULHXUHWHPSrFKHUODIRUPDWLRQGH
EDFWpULHVHWGHPRLVLVVXUHV
0RGH
/LJKW
7XUER
;)DQ
)DQ
7LPHU2Q
7HPS
7LPHU2II
&ORFN
6ZLQJ
,)HHO
(FR
7RXFKH212))0$5&+($55Ç7
$SSX\H]VXUFHWWHWRXFKHSRXUDOOXPHURXpWHLQGUHOH
FOLPDWLVHXU
7RXFKH0RGH
(QDSSX\DQWVXUFHWWHWRXFKHYRXVSRXUUH]
VpOHFWLRQQHUSURJUHVVLYHPHQWOHVPRGHV
$872&22/UHIURLGLVVHPHQW'(+80,',)<
GpVKXPLGL¿FDWLRQ)$1YHQWLODWHXUHW+($7
FKDXIIDJHOHVPRGqOHVD\DQWXQLTXHPHQWOHPRGH
&22/QHGLVSRVHQWSDVGHODIRQFWLRQ+($7
/RUVTXHYRXVDOOXPH]O
DSSDUHLOOHPRGH$872HVW
Gp¿QLSDUGpIDXW
(QPRGH$872ODYDOHXULQLWLDOHQ¶HVWSDVDI¿FKpH
HWO¶DSSDUHLOIRQFWLRQQHjODWHPSpUDWXUHVRXKDLWpH
(QPRGH+($7ODYDOHXULQLWLDOHHVWGHƒ&
$YHFOHVDXWUHVPRGHVODYDOHXULQLWLDOHHVWGHƒ&
7RXFKH7LPHU2QGpSDUWGXPLQXWHXU
$SSX\H]VXUFHWWHWRXFKHSRXUUpJOHUO¶KHXUHGH
départ.
7RXFKH7LPHU2IIDUUrWGXPLQXWHXU
$SSX\H]VXUFHWWHWRXFKHSRXUUpJOHUO¶KHXUHG¶DUUrW
7RXFKH6ZLQJRVFLOODWLRQ
$SSX\H]VXUFHWWHWRXFKHSRXUTXHOHYROHWRVFLOOH
DXWRPDWLTXHPHQWGHKDXWHQEDV$SSX\H]GH
QRXYHDXVXUFHWWHWRXFKHSRXUDQQXOHUOHYROHWUHVWH
DORUVGDQVVDGHUQLqUHSRVLWLRQ
7RXFKH,)HHO
$SSX\H]VXUFHWWHWRXFKHSRXUTXHODWpOpFRPPDQGH
HQYRLHGHVLQIRUPDWLRQVVXUODWHPSpUDWXUHWRXWHVOHV
PLQXWHVjO¶pOpPHQWLQWpULHXU/¶DSSDUHLOVHPHWWUD
HQPDUFKHSRXUDWWHLQGUHODWHPSpUDWXUHUpJOpHj
O¶HPSODFHPHQWGHODWpOpFRPPDQGH$SSX\H]GH
QRXYHDXVXUFHWWHWRXFKHSRXUDQQXOHUFHWWHIRQFWLRQ
7RXFKHGHFRPPDQGH
+DXW Bas
$SSX\H]VXUFHWWHWRXFKH SRXUDXJPHQWHUOD
WHPSpUDWXUH
$SSX\H]VXUFHWWHWRXFKH SRXUGLPLQXHUOD
WHPSpUDWXUH
$YHFOHVIRQFWLRQV7LPHU2Q2IIGpSDUWDUUrWGX
PLQXWHXUHW&ORFNKRUORJHXWLOLVH]FHVWRXFKHVD¿Q
GHUpJOHUO¶KRUORJHRXOHPLQXWHXU
7RXFKH&ORFNKRUORJH
$SSX\H]VXUFHWWHWRXFKHHWOHV\PEROHGHO¶KRUORJH
FOLJQRWH9RXVSRXYH]DSSX\HUVXUOHVWRXFKHVGH
FRPPDQGH et SRXUVpOHFWLRQQHUO¶KHXUHGpVLUpH
$872'(+80,',)<'e6+80,',),&$7,21)$19(17,/$7(85&22/5()52,',66(0(17+($7&+$8))$*(
7RXFKH/LJKWpFODLUDJH
$SSX\H]VXUFHWWHWRXFKHSRXUDFWLYHURX
GpVDFWLYHUOHVYR\DQWVGHO
pOpPHQWLQWpULHXU
$XGpPDUUDJHLOVVRQWDFWLYpV
7RXFKH9HQWLODWHXU
(QDSSX\DQWVXUFHWWHWRXFKHYRXVSRXUUH]
VpOHFWLRQQHUSURJUHVVLYHPHQWOHVYLWHVVHV
$XWR/RZEDVVH0HGLXPPR\HQQHHW+LJK
pOHYpH
/RUVTXHYRXVDOOXPH]O
DSSDUHLOODYLWHVVH
DXWRPDWLTXHGXYHQWLODWHXUHVWGp¿QLHSDUGpIDXW
(QPRGH'(+80,',)<GpVKXPLGL¿FDWLRQOD
YLWHVVHGXYHQWLODWHXUHVWUpJOpHVXUEDVVH
28
7RXFKH7HPS7HPSpUDWXUH
$SSX\H]VXUFHWWHWRXFKHSRXUPRGL¿HUO¶DI¿FKDJHVXU
O¶pOpPHQWLQWpULHXUGHODWHPSpUDWXUHUpJOpHSRXUOD
SLqFH
7RXFKH(FReFRQRPLTXH
$SSX\H]VXUFHWWHWRXFKHSRXUGpPDUUHUOHPRGH(FR
&HOXLFLHVWLGpDOODQXLW
$SSX\H]GHQRXYHDXVXUFHWWHWRXFKHSRXUDQQXOHU
cette fonction.
5HPDUTXH
(QPRGHFKDXIIDJHDSSX\H]VXUOHVWRXFKHV7HPS
WHPSpUDWXUHHW&ORFNKRUORJHSRXUDFWLYHUOD
IRQFWLRQGHFKDXIIDJHGHODSLqFHjSDUWLUGHƒ&
9R\DQWGHO
DI¿FKDJHGHOD
WpOpFRPPDQGH
9R\DQWGHWUDQVPLVVLRQ
6
DI¿FKHORUVTXHODWpOpFRPPDQGHWUDQVPHWXQ
VLJQDOjO
pOpPHQWLQWpULHXU
$I¿FKDJH)DQ6SHHGYLWHVVHGXYHQWLODWHXU
$I¿FKHODYLWHVVHGXYHQWLODWHXUVpOHFWLRQQpHGDQV
O
RUGUHVXLYDQW
$I¿FKDJH7XUER
$SSDUDvWORUVTXHODIRQFWLRQ7XUERHVW
sélectionnée.
« ªEDVVH©
pOHYpHHW$XWR
$I¿FKDJH,)HHO
,QGLTXHjTXHOPRPHQWODIRQFWLRQ,)HHOHVW
DFWLYpH
$I¿FKDJH6ZLQJ
,OV
DI¿FKHORUVTXHODIRQFWLRQ6ZLQJHVWVpOHFWLRQQpH
$I¿FKDJH(FR
$SSDUDvWORUVTXHODIRQFWLRQ(FRHVWVpOHFWLRQQpH
ªPR\HQQH©
»
(QYLWHVVH$XWRVHXOOHV\PEROH© ªV
DI¿FKH
$I¿FKDJH+HDOWK\VDLQ
$SSDUDvWHQDSSX\DQWVXUODWRXFKH+HDOWK\
$SSX\H]GHQRXYHDXVXUODWRXFKH+HDOWK\SRXU
qu'il disparaisse.
$I¿FKDJH;)DQ
6
DI¿FKHORUVTXHODIRQFWLRQ;)DQHVWDFWLYpH
HQDSSX\DQWVXUOHVWRXFKHV7XUERHW+HDOWK\
VLPXOWDQpPHQWSRXUOHVPRGqOHVDYHFIRQFWLRQ&ROG
3ODVPDSODVPDIURLGRXHQDSSX\DQWVXUODWRXFKH
;)DQSRXUOHVPRGqOHVDYHFIRQFWLRQ&ROG3ODVPD
REMARQUE : ces indicateurs ne sont pas
présents sur les modèles sans la fonction
Cold-Plasma (plasma froid).
,QGLFDWHXUGHODWHPSpUDWXUH
$I¿FKHODWHPSpUDWXUHGHODSLqFHRXVpOHFWLRQQpHHQ
ƒ&RXƒ)
$I¿FKDJH5RRP7HPSHUDWXUHWHPSpUDWXUH
DPELDQWH
6
DI¿FKHORUVTXHODWHPSpUDWXUHLQGLTXpHVXU
O
pFUDQ/&'HVWODWHPSpUDWXUHGHODSLqFH,O
SHXWrWUHDFWLYppWHLQWHQDSSX\DQWVXUODWRXFKH
7HPS
3DVG
DI¿FKDJHHQPRGH)DQYHQWLODWHXU
$I¿FKDJHGH3URJUDPPHG7HPSHUDWXUH
WHPSpUDWXUHSURJUDPPpH
,OV
DOOXPHORUVTXHODWpOpFRPPDQGHDI¿FKHOD
WHPSpUDWXUHSURJUDPPpH,OSHXWrWUHDFWLYp
pWHLQWHQDSSX\DQWVXUODWRXFKH7HPS
$I¿FKDJH7LPHU2Q2IIPLQXWHXUGHGpSDUW
G
DUUrW
,OV
DI¿FKHORUVTXHODIRQFWLRQ7LPHU2Q2IIHVW
DFWLYpH
$I¿FKDJH7LPHKHXUH
$I¿FKHO
KHXUHGHO
KRUORJHGHYDQWrWUHUpJOpHHWRX
O
KHXUHGHGpSDUWDUUrWGp¿QLHSRXUOHPLQXWHXU
$I¿FKDJH0RGH
$I¿FKHOHPRGHGHIRQFWLRQQHPHQWDFWXHOQRWDPPHQW
Auto ( 'HKXPLGLI\ )DQ &RRO HW
+HDW REMARQUE : Les modèles avec Refroidissement
uniquement ne disposent pas de l'option
Chauffage.
29
3UHPLqUHXWLOLVDWLRQ
$VVXUH]YRXVTXHO
DSSDUHLOHVWEUDQFKpHWTXH
le courant passe.
2 $VVXUH]YRXVTXHOHVSLOHVVRQWFRUUHFWHPHQW
LQVpUpHVGDQVODWpOpFRPPDQGHOHVYR\DQWVGH
ODWpOpFRPPDQGHVRQWDOOXPpV
3 5pJOH]O
KHXUHjO
DLGHGHVWRXFKHV&RQWURO
FRPPDQGHHWFRQ¿UPH]HQDSSX\DQWVXUOD
WRXFKH&ORFNKRUORJH
4 3RLQWH]ODWpOpFRPPDQGHGDQVODGLUHFWLRQGH
O
pOpPHQWLQWpULHXUHWDSSX\H]VXUODWRXFKH21
2))SRXUDOOXPHUO
DSSDUHLO
/HPRGHGHIRQFWLRQQHPHQWSDUGpIDXWHVW
$8728QHIRLVTXHYRXVDYH]VpOHFWLRQQpOH
PRGHGHIRQFWLRQQHPHQWDYHFODWpOpFRPPDQGH
OHVFRQGLWLRQVGHIRQFWLRQQHPHQWVHURQW
VDXYHJDUGpHVGDQVODPpPRLUHGHO
pOpPHQW
LQWpULHXU/DIRLVVXLYDQWHOHFOLPDWLVHXU
FRPPHQFHUDjIRQFWLRQQHUGDQVOHVPrPHV
FRQGLWLRQVORUVTXHYRXVDSSXLHUH]VXUODWRXFKH
212))GHODWpOpFRPPDQGH
conseils et informations
/HFOLPDWLVHXUFRPPHQFHVRQIRQFWLRQQHPHQW
DSUqVHQYLURQPLQXWHV
$UUrW
7RXFKH212))0$5&+($55Ç7
$SSX\H]VXUFHWWHWRXFKHSRXUpWHLQGUHOH
FOLPDWLVHXU/HYROHWKRUL]RQWDOUHWRXUQHjVD
SRVLWLRQGHIHUPHWXUH
30
7HPSSURJUDPPpH
W
VH
PH
Q
IUR
LGL
V
U
5H
HX
LGL
V
ODW
9H
QWL
VH
PH
Q
W
/DWHPSpUDWXUHHVWUpJXOpHHQGpFOHQFKDQW
ODGpVKXPLGL¿FDWLRQGHIDoRQUpSpWpHHQ
DFWLYDQWGpVDFWLYDQWOHIRQFWLRQQHPHQW&22/
UHIURLGLVVHPHQWRX)$1YHQWLODWHXUXQLTXHPHQW
IUR
2 $SSX\H]VXUODWRXFKH0RGHSRXUVpOHFWLRQQHU
AUTO.
3 7RXFKHV&RQWUROFRPPDQGH
5pJOH]ODWHPSpUDWXUHVRXKDLWpH
/HPRGH'(+80,',)<GpVKXPLGL¿FDWLRQVH
EDVHVXUOHVGLIIpUHQFHVHQWUHODWHPSpUDWXUH
VpOHFWLRQQpHHWODWHPSpUDWXUHGHODSLqFH
5H
'pSDUW
7RXFKH212))0$5&+($55Ç7
$SSX\H]VXUFHWWHWRXFKHSRXUDOOXPHUOH
FOLPDWLVHXU
/
LQGLFDWHXUGHWHPSpUDWXUHVXUO
DI¿FKDJHGH
O
pOpPHQWLQWpULHXUV
DOOXPH
)RQFWLRQQHPHQWGHOD
GpVKXPLGL¿FDWLRQ
U
/RUVTXHOHPRGH$872HVWVpOHFWLRQQpOH
FOLPDWLVHXUVpOHFWLRQQHDXWRPDWLTXHPHQWOH
IRQFWLRQQHPHQW&22/UHIURLGLVVHPHQW+($7
FKDXIIDJHVLGLVSRQLEOHRX)$1YHQWLODWHXUVHORQ
ODWHPSpUDWXUHSURJUDPPpHHWRXODWHPSpUDWXUHGH
ODSLqFH
/RUVTXHOHPRGHGHIRQFWLRQQHPHQW$872
HVWVpOHFWLRQQpODYLWHVVHGXYHQWLODWHXU
HWODWHPSpUDWXUHVRQWDXWRPDWLTXHPHQW
FRQWU{OpHHWQHSHXYHQWSDVrWUHUpJOpHV
HX
)RQFWLRQQHPHQWDXWRPDWLTXH
conseils et informations
ODW
&RPPHQWXWLOLVHUODWpOpFRPPDQGH
6LOHPRGH$872QHYRXVFRQYLHQWSDVYRXV
SRXYH]VpOHFWLRQQHUOHVFRQGLWLRQVVRXKDLWpHV
PDQXHOOHPHQW
9H
QWL
(QFDVGHFRXSXUHG
pOHFWULFLWpRXG
XQH
FRXSXUHGHO
DSSDUHLOHQGpEUDQFKDQW
OHFkEOHG
DOLPHQWDWLRQRXPrPHHQ
FKDQJHDQWOHVSLOHVGHODWpOpFRPPDQGHOH
PLFURSURFHVVHXUUHWRXUQHHQPRGH$872
0LQXWHULH
)RQFWLRQQHPHQWGHOD
GpVKXPLGL¿FDWLRQ
'pSDUW
7RXFKH212))0$5&+($55Ç7
$SSX\H]VXUFHWWHWRXFKHSRXUDOOXPHUOH
FOLPDWLVHXU
/
LQGLFDWHXUGHWHPSpUDWXUHVXUO
DI¿FKDJHGH
O
pOpPHQWLQWpULHXUV
DOOXPH
2 7RXFKH0RGH
$SSX\H]SRXUVpOHFWLRQQHU'(+80,',)<
2 7RXFKH0RGH
$SSX\H]SRXUVpOHFWLRQQHU)$1
3 7RXFKH9HQWLODWHXU
$SSX\H]SRXUVpOHFWLRQQHUODYLWHVVH
VRXKDLWpHVXU$XWR/RZEDVVH0HGLXP
PR\HQQHHW+LJKpOHYpH
/DYLWHVVHGXYHQWLODWHXUSDUGpIDXWHVW$XWR
3 7RXFKHV&RQWUROFRPPDQGH
5pJOH]ODWHPSpUDWXUHVRXKDLWpH
1RUPDOHPHQWHOOHHVWUpJOpHHQWUHƒ&HW
ƒ&
$UUrW
7RXFKH212))0$5&+($55Ç7
$UUrW
7RXFKH212))0$5&+($55Ç7
$SSX\H]VXUFHWWHWRXFKHSRXUpWHLQGUHOH
FOLPDWLVHXU/HYROHWKRUL]RQWDOUHWRXUQHjVD
SRVLWLRQGHIHUPHWXUH
conseils et informations
(QPRGH'(+80,',)<GpVKXPLGL¿FDWLRQ
ODYLWHVVHGXYHQWLODWHXUHVWUpJOpHVXU/RZ
EDVVHHWODIRQFWLRQ7XUERQHSHXWSDVrWUH
utilisée.
)RQFWLRQQHPHQWGXYHQWLODWHXU
/RUVTXHYRXVVpOHFWLRQQH]OHPRGHGH
IRQFWLRQQHPHQW)$1YHQWLODWHXUOHFOLPDWLVHXU
pYDFXHUDVLPSOHPHQWO
DLULQWpULHXU
7RXFKH212))0$5&+($55Ç7
$SSX\H]VXUFHWWHWRXFKHSRXUDOOXPHUOH
FOLPDWLVHXU
/
LQGLFDWHXUGHWHPSpUDWXUHVXUO
DI¿FKDJHGH
O
pOpPHQWLQWpULHXUV
DOOXPH
$SSX\H]VXUFHWWHWRXFKHSRXUpWHLQGUHOH
FOLPDWLVHXU/HYROHWKRUL]RQWDOUHWRXUQHjVD
SRVLWLRQGHIHUPHWXUH
conseils et informations
‡ $XFXQHYLWHVVHGHYHQWLODWHXUQHV
DI¿FKHVXU
ODWpOpFRPPDQGHVLODYLWHVVHGHYHQWLODWHXU
Auto est sélectionnée.
)RQFWLRQQHPHQWGHUHIURLGLVVHPHQW
HWFKDXIIDJH
'pSDUW
7RXFKH212))0$5&+($55Ç7
$SSX\H]VXUFHWWHWRXFKHSRXUDOOXPHUOH
FOLPDWLVHXU
/
LQGLFDWHXUGHWHPSpUDWXUHVXUO
DI¿FKDJHGH
O
pOpPHQWLQWpULHXUV
DOOXPH
2 7RXFKH0RGH
$SSX\H]SRXUVpOHFWLRQQHUOHPRGH&22/
UHIURLGLVVHPHQWRX+($7FKDXIIDJHVL
GLVSRQLEOH
3 7RXFKHV&RQWUROFRPPDQGH
5pJOH]ODWHPSpUDWXUHVRXKDLWpH
1RUPDOHPHQWHOOHHVWUpJOpHHQWUHƒ&HW
ƒ&
4 7RXFKH9HQWLODWHXU
$SSX\H]SRXUVpOHFWLRQQHUODYLWHVVH
VRXKDLWpHVXU$XWR/RZEDVVH0HGLXP
PR\HQQHHW+LJKpOHYpH
/DYLWHVVHGXYHQWLODWHXUSDUGpIDXWHVW$XWR
conseils et informations
$XFXQHYLWHVVHGHYHQWLODWHXUQHV
DI¿FKHVXU
ODWpOpFRPPDQGHVLODYLWHVVHGHYHQWLODWHXU
Auto est sélectionnée.
3 3RLQWH]ODWpOpFRPPDQGHGDQVODGLUHFWLRQGHO
pOpPHQW
LQWpULHXUHWFRQ¿UPH]OHWHPSVUpJOpHQDSSX\DQWVXUOD
WRXFKH7LPHU2Q
FHV\PEROHUHVWHDOOXPpVXUO
DI¿FKDJHGHOD
WpOpFRPPDQGH
9pUL¿H]TXHOHYR\DQW7LPHUPLQXWHXUHVWDOOXPpVXU
O
DI¿FKDJHGHO
pOpPHQWLQWpULHXU
$QQXODWLRQGHVUpJODJHV
3RLQWH]ODWpOpFRPPDQGHGDQVODGLUHFWLRQGHO
pOpPHQW
LQWpULHXUHWDSSX\H]GHQRXYHDXVXUODWRXFKH7LPHU2Q
$VVXUH]YRXVTXHOHV\PEROH VXUODWpOpFRPPDQGHHVW
éteint.
)RQFWLRQQHPHQW7LPHU2II
PLQXWHXUG
DUUrW
$SSX\H]VXUODWRXFKH7LPHU2II
FOLJQRWHVXUO
DI¿FKDJHGHODWpOpFRPPDQGH
HQFDVGHSUHPLqUHXWLOLVDWLRQGHODIRQFWLRQ7LPHU2II
PLQXWHXUG
DUUrW6LQRQODGHUQLqUHKHXUHVpOHFWLRQQpH
clignote.
2 5pJOH]OHWHPSVVRXKDLWpHQDSSX\DQWVXUOHVWRXFKHV
&RQWUROFRPPDQGH
6XLYDQW
Précédent
¬FKDTXHSUHVVLRQVXUOHVWRXFKHVOHWHPSVDYDQFHRX
UHFXOHG
XQHPLQXWH
(OOHVGp¿OHURQWSOXVUDSLGHPHQWVXUO
DI¿FKDJHHQ
PDLQWHQDQWODWRXFKHHQIRQFpH
3 3RLQWH]ODWpOpFRPPDQGHGDQVODGLUHFWLRQGHO
pOpPHQW
LQWpULHXUHWFRQ¿UPH]OHWHPSVUpJOpHQDSSX\DQWVXUOD
WRXFKH7LPHU2II
FHV\PEROHUHVWHDOOXPpVXUO
DI¿FKDJHGHOD
WpOpFRPPDQGH
9pUL¿H]TXHOHYR\DQW7LPHUPLQXWHXUHVWDOOXPpVXU
O
DI¿FKDJHGHO
pOpPHQWLQWpULHXU
$QQXODWLRQGHVUpJODJHV
$UUrW
7RXFKH212))0$5&+($55Ç7
$SSX\H]VXUFHWWHWRXFKHSRXUpWHLQGUHOH
FOLPDWLVHXU/HYROHWKRUL]RQWDOUHWRXUQHjVD
SRVLWLRQGHIHUPHWXUH
5pJODJHVGXPLQXWHXU
)RQFWLRQQHPHQW7LPHU2Q
PLQXWHXUGHGpSDUW
$SSX\H]VXUODWRXFKH7LPHU2Q
FOLJQRWHVXUO
DI¿FKDJHGHOD
WpOpFRPPDQGHHQFDVGHSUHPLqUHXWLOLVDWLRQGHOD
IRQFWLRQ7LPHU2QPLQXWHXUGHGpSDUW6LQRQOD
GHUQLqUHKHXUHVpOHFWLRQQpHFOLJQRWH
2 5pJOH]OHWHPSVVRXKDLWpHQDSSX\DQWVXUOHV
WRXFKHV&RQWUROFRPPDQGH
6XLYDQW
Précédent
¬FKDTXHSUHVVLRQVXUOHVWRXFKHVOHWHPSV
DYDQFHRXUHFXOHG
XQHPLQXWH
(OOHVGp¿OHURQWSOXVUDSLGHPHQWVXUO
DI¿FKDJHHQ
PDLQWHQDQWODWRXFKHHQIRQFpH
32
3RLQWH]ODWpOpFRPPDQGHGDQVODGLUHFWLRQGHO
pOpPHQW
LQWpULHXUHWDSSX\H]GHQRXYHDXVXUODWRXFKH7LPHU2II
$VVXUH]YRXVTXHOHV\PEROH VXUODWpOpFRPPDQGHHVW
éteint.
conseils et informations
‡ /
KHXUHGHIRQFWLRQQHPHQWGHODIRQFWLRQPLQXWHXU
UpJOpHSDUODWpOpFRPPDQGHGpSHQGGHO
KHXUHGH
O
KRUORJH9pUL¿H]TXHO
KRUORJHGHODWpOpFRPPDQGH
HVWFRUUHFWHPHQWUpJOpHD¿QG
pYLWHUWRXW
G\VIRQFWLRQQHPHQW
‡ /
KHXUHGHIRQFWLRQQHPHQWHIIHFWLIUpJOpHSDUOD
WpOpFRPPDQGHHVWOLPLWpHjKHXUHV
([HPSOHVGHUpJODJHVGHPLQXWHXU
)RQFWLRQQHPHQW7LPHU2QPLQXWHXUGHGpSDUW
&HWWHIRQFWLRQHVWUHFRPPDQGpHORUVTXH
YRXVVRXKDLWH]TXHO
DSSDUHLOVHPHWWH
DXWRPDWLTXHPHQWHQPDUFKHDYDQWYRWUH
UHWRXUFKH]YRXV/HFOLPDWLVHXUGpPDUUHUD
DXWRPDWLTXHPHQWjO
KHXUHGp¿QLH
Exemple : Il est 8 h 00 du matin et vous
souhaitez que le climatiseur se mette en route
à 18 h 00.
$SSX\H]VXUODWRXFKH7LPHU2Q
2 5pJOH]O
KHXUHVRXKDLWpHHQDSSX\DQWGHIDoRQ
UpSpWpHRXHQPDLQWHQDQWHQIRQFpHVOHVWRXFKHV
&RQWUROMXVTX
jFHTXHV
DI¿FKHVXUOD
WpOpFRPPDQGH
3 &RQ¿UPH]O
KHXUHUpJOpHHQSRLQWDQWOD
WpOpFRPPDQGHYHUVO
pOpPHQWLQWpULHXUHWHQ
DSSX\DQWGHQRXYHDXVXUODWRXFKH7LPHU2Q
4 $SSX\H]VXUODWRXFKH7LPHU2II
3 &RQ¿UPH]O
KHXUHUpJOpHHQSRLQWDQWOD
WpOpFRPPDQGHYHUVO
pOpPHQWLQWpULHXUHWHQ
DSSX\DQWGHQRXYHDXVXUODWRXFKH7LPHU2Q
FHV\PEROHUHVWHDOOXPpVXUO
DI¿FKDJHGHOD
WpOpFRPPDQGH
/HYR\DQW7LPHUPLQXWHXUHVWDOOXPpVXU
O
DI¿FKDJHGHO
pOpPHQWLQWpULHXU
)RQFWLRQQHPHQW7LPHU2IIPLQXWHXUG
DUUrW
&HWWHIRQFWLRQHVWUHFRPPDQGpHORUVTXHYRXV
VRXKDLWH]TXHO
DSSDUHLOV
pWHLJQHDXWRPDWLTXHPHQW
DXPRPHQWG
DOOHUYRXVFRXFKHU
/HFOLPDWLVHXUV
DUUrWHUDDXWRPDWLTXHPHQWjO
KHXUH
Gp¿QLH
Exemple : Il est 18 h 00 et vous souhaitez que le
climatiseur s'arrête à 23 h 55.
$SSX\H]VXUODWRXFKH7LPHU2II
5 5pJOH]O
KHXUHVRXKDLWpHHQDSSX\DQWGHIDoRQ
UpSpWpHRXHQPDLQWHQDQWHQIRQFpHVOHVWRXFKHV
&RQWUROMXVTX
jFHTXHV
DI¿FKHVXUOD
WpOpFRPPDQGH
6 &RQ¿UPH]O
KHXUHUpJOpHHQSRLQWDQWOD
WpOpFRPPDQGHYHUVO
pOpPHQWLQWpULHXUHWHQ
DSSX\DQWGHQRXYHDXVXUODWRXFKH7LPHU2II
FHV\PEROHDSSDUDvWVXUODWpOpFRPPDQGHHW
ODIRQFWLRQHVWDFWLYpH
7LPHU2IIPLQXWHXUG
DUUrW 7LPHU2Q
PLQXWHXUGHGpSDUW
)RQFWLRQQHPHQW$OOXPp$UUrW'pSDUW
&HWWHIRQFWLRQHVWUHFRPPDQGpHORUVTXHYRXV
VRXKDLWH]pWHLQGUHO
DSSDUHLODSUqVrWUHSDUWLYRXV
FRXFKHUHWOHUHGpPDUUHUDYDQWGHYRXVUpYHLOOHUOH
PDWLQRXGHUHYHQLUFKH]YRXV
Par exemple, il est 8 h 00 et vous souhaitez
que le climatiseur s'arrête à 9 h 30 et qu'il se
rallume à 18 h 00.
2 5pJOH]O
KHXUHVRXKDLWpHHQDSSX\DQWGHIDoRQ
UpSpWpHRXHQPDLQWHQDQWHQIRQFpHVOHVWRXFKHV
&RQWUROMXVTX
jFHTXHV
DI¿FKHVXUOD
WpOpFRPPDQGH
3 &RQ¿UPH]O
KHXUHUpJOpHHQSRLQWDQWOD
WpOpFRPPDQGHYHUVO
pOpPHQWLQWpULHXUHWHQ
DSSX\DQWGHQRXYHDXVXUODWRXFKH7LPHU2II
$SSX\H]VXUODWRXFKH7LPHU2II
2 5pJOH]O
KHXUHVRXKDLWpHHQDSSX\DQWGHIDoRQ
UpSpWpHRXHQPDLQWHQDQWHQIRQFpHVOHVWRXFKHV
&RQWUROMXVTX
jFHTXHV
DI¿FKHVXUOD
WpOpFRPPDQGH
FHV\PEROHUHVWHDOOXPpVXUO
DI¿FKDJHGHOD
WpOpFRPPDQGH
/HYR\DQW7LPHUPLQXWHXUHVWDOOXPpVXU
O
DI¿FKDJHGHO
pOpPHQWLQWpULHXU
0LQXWHXUFRPELQp
7LPHU2QPLQXWHXUGHGpSDUW 7LPHU2II
PLQXWHXUG
DUUrW
)RQFWLRQQHPHQWeWHLQW'pSDUW$UUrW
&HWWHIRQFWLRQHVWUHFRPPDQGpHORUVTXHYRXV
VRXKDLWH]DOOXPHUOHFOLPDWLVHXUDYDQWGHYRXV
UpYHLOOHUHWO
pWHLQGUHDSUqVrWUHSDUWLGHFKH]YRXV
3 &RQ¿UPH]O
KHXUHUpJOpHHQSRLQWDQWOD
WpOpFRPPDQGHYHUVO
pOpPHQWLQWpULHXUHWHQ
DSSX\DQWGHQRXYHDXVXUODWRXFKH7LPHU2II
4 $SSX\H]VXUODWRXFKH7LPHU2Q
5 5pJOH]O
KHXUHVRXKDLWpHHQDSSX\DQWGHIDoRQ
UpSpWpHRXHQPDLQWHQDQWHQIRQFpHVOHVWRXFKHV
&RQWUROMXVTX
jFHTXHV
DI¿FKHVXUOD
WpOpFRPPDQGH
Exemple : Il est 22 h 00 et vous souhaitez que
le climatiseur se mette en route à 6 h 30 et qu'il
s'éteigne à 9 h 30.
$SSX\H]VXUODWRXFKH7LPHU2Q
2 5pJOH]O
KHXUHVRXKDLWpHHQDSSX\DQWGHIDoRQ
UpSpWpHRXHQPDLQWHQDQWHQIRQFpHVOHVWRXFKHV
&RQWUROMXVTX
jFHTXHV
DI¿FKHVXUOD
WpOpFRPPDQGH
6 &RQ¿UPH]O
KHXUHUpJOpHHQSRLQWDQWOD
WpOpFRPPDQGHYHUVO
pOpPHQWLQWpULHXUHWHQ
DSSX\DQWGHQRXYHDXVXUODWRXFKH7LPHU2Q
FHV\PEROHDSSDUDvWVXUODWpOpFRPPDQGHHW
ODIRQFWLRQHVWDFWLYpH
33
5pJODJHGHO
KHXUH
)RQFWLRQQHPHQW(FRQRP\(FRpFRQRPLTXH
$SSX\H]VXUODWRXFKH(&2HQPRGH&22/
UHIURLGLVVHPHQWRX+($7FKDXIIDJHVLGLVSRQLEOHOH
FOLPDWLVHXUDXJPHQWHUDDXWRPDWLTXHPHQWHQPRGH&22/
RXGLPLQXHUDHQPRGH+($7G
ƒ&WRXWHVOHVKHXUHV
/DWHPSpUDWXUHVHUDVWDELOLVpHGXUDQWOHVKHXUHV
VXLYDQWHVSXLVO
DSSDUHLOV
DUUrWHUD
&HWWHIRQFWLRQRIIUHSOXVGHFRQIRUWHWpFRQRPLVHO
pQHUJLH
&HPRGHHVWUHFRPPDQGpDXPRPHQWG
DOOHUYRXVFRXFKHU
7HPSpUDWXUH
UpJOpH
KHXUH
KHXUH
5HIURLGLVVHPHQW
7HPSpUDWXUH
UpJOpH
$YDQWGHGpPDUUHUOHIRQFWLRQQHPHQWGX
FOLPDWLVHXUUpJOH]O
KRUORJHGHODWpOpFRPPDQGH
en utilisant la procédure indiquée dans
FHFKDSLWUH/
DI¿FKDJHGHO
KRUORJHVXUOD
WpOpFRPPDQGHDI¿FKHO
KHXUHTXHOHFOLPDWLVHXU
VRLWHQPDUFKHRXSDV
)RQFWLRQQHPHQW,)HHO
$SUqVDYRLULQVpUpOHVSLOHVGDQVOD
V
DI¿FKHHWFRPPHQFHj
WpOpFRPPDQGH
clignoter.
/DWpOpFRPPDQGHIRQFWLRQQHFRPPHXQWKHUPRVWDWj
GLVWDQFHHQYRXVSURSRVDQWXQFRQWU{OHGHODWHPSpUDWXUH
SUpFLVHWXQPD[LPXPGHFRQIRUW
7RXFKHV&RQWUROFRPPDQGH
3RLQWH]ODWpOpFRPPDQGHGDQVODGLUHFWLRQGHO
pOpPHQW
LQWpULHXUHWDSSX\H]VXUODWRXFKH,)HHO8QELSHVWpPLV
SDUO
pOpPHQWLQWpULHXUSRXUFRQ¿UPHUTXHODIRQFWLRQHVW
DFWLYpH
$SSX\H]VXUOHVWRXFKHV&RQWUROSRXUUpJOHU
O
KHXUHVRXKDLWpH
6XLYDQW
Précédent
¬FKDTXHSUHVVLRQVXUOHVWRXFKHVOHWHPSV
DYDQFHRXUHFXOHG
XQHPLQXWH
(OOHVGp¿OHURQWSOXVUDSLGHPHQWVXUO
DI¿FKDJH
HQPDLQWHQDQWODWRXFKHHQIRQFpH
2 7RXFKH&ORFNKRUORJH
/RUVTXHO
KHXUHVRXKDLWpHHVWDWWHLQWH
DSSX\H]GHQRXYHDXVXUODWRXFKH&ORFNRX
DWWHQGH]VHFRQGHVVDQVULHQWRXFKHUO
KHXUH
GHO
KRUORJHV
DUUrWHGHFOLJQRWHUHWO
KRUORJH
est réglée.
3 5pLQLWLDOLVDWLRQGHO
KRUORJH
$SSX\H]VXUODWRXFKH&ORFNHWO
DI¿FKDJHGH
O
KRUORJHFRPPHQFHjFOLJQRWHU
6XLYH]GHQRXYHDXOHVpWDSHVHWSRXU
UpJOHUODQRXYHOOHKHXUH
conseils et informations
‡ /
KRUORJHXWLOLVHOHIRUPDWGHKHXUHV
‡ 3DUGpIDXWO
KHXUHGHODWpOpFRPPDQGHHVW
jKHW\UHWRXUQHUDVLOHVSLOHVVRQW
FKDQJpHV
34
KHXUH
KHXUH
&KDXIIDJH
/HV\PEROH,)HHO UHVWHDOOXPpVXUO
DI¿FKDJHGHOD
WpOpFRPPDQGHMXVTX
jFHTXHYRXVDSSX\LH]jQRXYHDX
VXUODWRXFKH,)HHO
/HFOLPDWLVHXUVHPHWHQPDUFKHSRXUDWWHLQGUHOD
WHPSpUDWXUHUpJOpHjO
HPSODFHPHQWGHODWpOpFRPPDQGH
/DWpOpFRPPDQGHHQYRLHOHVLQIRUPDWLRQVVXUOD
WHPSpUDWXUHGHVRQHPSODFHPHQWjO
pOpPHQWLQWpULHXU
WRXWHVOHVPLQXWHV/HFOLPDWLVHXUTXLWWHUDOHPRGH
,)HHOVLDXFXQHLQIRUPDWLRQVXUODWHPSpUDWXUHQ
HVWUHoXH
GHODSDUWGHODWpOpFRPPDQGHSHQGDQWPLQXWHV
&RPPHQWXWLOLVHUO
pOpPHQWLQWpULHXU
2SWLRQVVXSSOpPHQWDLUHV
)RQFWLRQ6PDUW5HVWDUWUHGpPDUUDJH
LQWHOOLJHQW
$SUqVXQHpYHQWXHOOHFRXSXUHGHFRXUDQWOH
FOLPDWLVHXUUHWRXUQHDXWRPDWLTXHPHQWDX[
réglages précédents.
‡ /RUVTXHOHYROHWWRXUQHGDQVODGLUHFWLRQ
VRXKDLWpHDSSX\H]GHQRXYHDXVXUODWRXFKH
6ZLQJHWOHYROHWUHVWHUDGDQVVDSRVLWLRQ
‡ $SSX\H]GHQRXYHDXVXUODWRXFKH6ZLQJHWOH
YROHWFRPPHQFHUDjEDVFXOHUDXWRPDWLTXHPHQW
3DQQHDXDPRYLEOH
/DIDoDGHDYDQWGHO
pOpPHQWLQWpULHXUSHXW
rWUHIDFLOHPHQWUHWLUpHSRXUODQHWWR\HURXSRXU
l'entretien.
$XWRGLDJQRVWLFHWDXWRSURWHFWLRQ
&HFOLPDWLVHXUSHXWGpWHFWHUOHV
G\VIRQFWLRQQHPHQWVHQDI¿FKDQWOHGLDJQRVWLFVXU
O
pOpPHQWLQWpULHXUHQXWLOLVDQWXQFRGHG
HUUHXU
/HFOLPDWLVHXUFKDQJHUDDXWRPDWLTXHPHQWGH
PRGHSRXUV
DXWRSURWpJHU
*DPPH
)OX[G
DLU+DXWHW%DV
3RXUDMXVWHUODGLUHFWLRQGXÀX[G
DLUKRUL]RQWDO
JDXFKHGURLWHPDQXHOOHPHQW
&RQWU{OHGHODGLUHFWLRQGXÀX[G
DLU
‡ $MXVWH]OHYROHWYHUWLFDOHQXWLOLVDQWOHOHYLHU
GURLWHJDXFKHGXEUDVGXYROHWYHUWLFDO
‡ $MXVWH]FRUUHFWHPHQWODGLUHFWLRQGXÀX[G
DLU
FDULOSRXUUDLWHQWUDvQHUXQHWHPSpUDWXUHLQpJDOH
RXLQFRQIRUWDEOHGDQVODSLqFH
‡ (IIHFWXH]FHVDMXVWHPHQWVDYDQWGHGpPDUUHU
O
DSSDUHLOFDUXQHIRLVTX
LODGpPDUUpYRVGRLJWV
SRXUUDLHQWrWUHHQWUDvQpVSDUOHYHQWLODWHXU
‡ $MXVWH]OHVYROHWVKRUL]RQWDX[DYHFOD
WpOpFRPPDQGH
‡ $MXVWH]OHVYROHWVYHUWLFDX[jODPDLQ
Volet
YHUWLFDO
*DPPH
)OX[G
DLUJDXFKHHWGURLW
attention
3RXUUpJOHUODGLUHFWLRQGXÀX[G
DLUYHUWLFDO
KDXWEDVDXWRPDWLTXHPHQW
‡ 8WLOLVH]FHWWHIRQFWLRQORUVTXHO
DSSDUHLOHVWHQ
IRQFWLRQQHPHQW
‡ $SSX\H]VXUODWRXFKH6ZLQJVXUOD
WpOpFRPPDQGHOHYROHWKRUL]RQWDOEDVFXOH
DXWRPDWLTXHPHQW
‡ /DWRXFKH6ZLQJHVWGpVDFWLYpHORUVTXH
OHFOLPDWLVHXUQ
HVWSDVHQIRQFWLRQQHPHQW
PrPHORUVTXH7LPHU2QPLQXWHXUGH
GpSDUWHVWUpJOp
‡ (QPRGH&22/RX'(+80,',)<QHIDLWHV
SDVIRQFWLRQQHUORQJWHPSVOHFOLPDWLVHXU
DYHFOHÀX[G
DLUYHUVOHEDV6LQRQOD
condensation peut se déposer sur la surface
GXYROHWKRUL]RQWDOHWFRXOHUVXUOHVRORXOHV
PHXEOHV
35
‡ 1HGpSODFH]SDVOHYROHWKRUL]RQWDO
jODPDLQ8WLOLVH]WRXMRXUVODWRXFKH
6ZLQJ/HGpSODFHUjODPDLQSRXUUDLW
HQWUDvQHUXQG\VIRQFWLRQQHPHQW
GXUDQWOHIRQFWLRQQHPHQW(QFDVGH
G\VIRQFWLRQQHPHQWGXYROHWDUUrWH]OH
FOLPDWLVHXUHWUHGpPDUUH]OH
‡ 2XYUH]OHYROHWKRUL]RQWDOHQDQJOH
SDVWURSSHWLWFDUOHVSHUIRUPDQFHVGX
UHIURLGLVVHPHQWRXGXFKDXIIDJHSRXUUDLW
rWUHUpGXLWHVHQUDLVRQGXÀX[G
DLUOLPLWp
‡ 1HIDLWHVSDVIRQFWLRQQHUOHFOLPDWLVHXU
DYHFOHYROHWKRUL]RQWDOHQSRVLWLRQIHUPpH
‡ /RUVTXHOHFOLPDWLVHXUHVWEUDQFKp
IRQFWLRQQHPHQWLQLWLDOOHYROHWKRUL]RQWDO
SHXWJpQpUHUXQVRQSHQGDQWVHFRQGHV
FHTXLHVWQRUPDO
2SpUDWLRQG
XUJHQFH
/RUVTXHYRXVSHUGH]ODWpOpFRPPDQGHRXTX
HOOH
QHIRQFWLRQQHSOXVXWLOLVH]O
LQWHUUXSWHXUPDQXHO
VHWURXYDQWVXUO
pOpPHQWLQWpULHXU/HFOLPDWLVHXU
IRQFWLRQQHDORUVHQPRGH$872HWOHUpJODJHGHOD
WHPSpUDWXUHRXGHODYLWHVVHGXYHQWLODWHXUQHSHXW
SDVrWUHPRGL¿p
‡ $SSX\H]GHQRXYHDXVXUODWRXFKH0DQXDO&RQWURO
FRPPDQGHPDQXHOOHSRXUpWHLQGUHOHFOLPDWLVHXU
/HPRGHGHIRQFWLRQQHPHQWGHO
DSSDUHLOVHWURXYH
GDQVOHWDEOHDXVXLYDQW
0RGH
0RGqOH
5pJODJHGHWHPSpUDWXUH Circulation d'air
AUTO
3203(¬
&+$/(85
ƒ&
&22/)$1
AUTO
3203(¬
&+$/(85
ƒ&
+($7)$1
7HPSpUDWXUHGHIRQFWLRQQHPHQW
3ODJHVGHVWHPSpUDWXUHVGHIRQFWLRQQHPHQW
&{WpLQWpULHXU
'%:%ƒ&
&{WpH[WpULHXU
'%:%ƒ&
5HIURLGLVVHPHQWPD[LPDO
5HIURLGLVVHPHQWPLQLPDO
&KDXIIDJHPD[LPDO
&KDXIIDJHPLQLPDO
/DSODJHGHWHPSpUDWXUHVGHIRQFWLRQQHPHQW
WHPSpUDWXUHH[WpULHXUHSRXUOHVPRGqOHVj
UHIURLGLVVHPHQWXQLTXHPHQWHVWGHƒ&jƒ&
HWGHƒ&jƒ&SRXUOHPRGqOHDYHFSRPSHj
FKDOHXU
6LOHFOLPDWLVHXUHVWXWLOLVpHQH[WpULHXUGDQVOHV
FRQGLWLRQVFLGHVVXVFHUWDLQHVFDUDFWpULVWLTXHVGH
VpFXULWpSHXYHQWV
HQFOHQFKHUHWHPSrFKHUO
DSSDUHLO
GHIRQFWLRQQHUQRUPDOHPHQW
8WLOLVDWLRQRSWLPDOH
3RXUDWWHLQGUHGHVSHUIRUPDQFHVRSWLPDOHVQRWH]
‡ $MXVWH]FRUUHFWHPHQWODGLUHFWLRQGXÀX[G
DLU
pour qu'il ne soit pas dirigé sur les gens.
‡ $MXVWH]ODWHPSpUDWXUHSRXUDWWHLQGUHOHSOXV
KDXWQLYHDXGHFRQIRUW1HUpJOH]SDVO
DSSDUHLO
VXUGHVWHPSpUDWXUHVH[FHVVLYHV
7RXFKHGHFRPPDQGH
PDQXHOOH
‡ (QPRGH&22/UHIURLGLVVHPHQWRX+($7
FKDXIIDJHIHUPH]OHVSRUWHVHWOHVIHQrWUHV
FDUOHVSHUIRUPDQFHVGXSURGXLWSRXUUDLHQWrWUH
réduites.
‡ 8WLOLVH]OHVWRXFKHV7LPHU2QPLQXWHXUGH
GpSDUWHW7LPHU2IIPLQXWHXUG
DUUrWGHOD
WpOpFRPPDQGHSRXUVpOHFWLRQQHUO
KHXUHGH
GpSDUWHWG
DUUrWVRXKDLWpH
7RXFKHGHFRPPDQGH
PDQXHOOH
‡ $SSX\H]VXUODWRXFKH0DQXDO&RQWURO
FRPPDQGHPDQXHOOHSRXUHQWUHUHQ
PRGH$872/HFOLPDWLVHXUFKRLVLW
DORUVDXWRPDWLTXHPHQWOHPRGH&22/
UHIURLGLVVHPHQW+($7FKDXIIDJHXQLTXHPHQW
VXUOHPRGqOHDYHFSRPSHjFKDOHXUHW)$1
YHQWLODWHXUVHORQODWHPSpUDWXUHGHODSLqFH
pour atteindre un confort idéal.
36
‡ 1HSODFH]DXFXQREMHWjSUR[LPLWpGHVDUULYpHV
HWVRUWLHVG
DLUFDUO
HI¿FDFLWpGXSURGXLWSHXW
rWUHUpGXLWHHWOHFOLPDWLVHXUSRXUUDLWQHSOXV
fonctionner.
‡ 1HWWR\H]IUpTXHPPHQWOHV¿OWUHVjDLUVLQRQ
OHVSHUIRUPDQFHVGHUHIURLGLVVHPHQWHWGH
FKDXIIDJHSRXUUDLHQWrWUHUpGXLWHV
1HWWR\DJHHWHQWUHWLHQ
5pJLPHGHPDLQWLHQ
/HVRSpUDWLRQVGHPDLQWHQDQFHVXLYDQWHVGRLYHQWrWUHHIIHFWXpHVUpJXOLqUHPHQW
eOpPHQWV
Opérations
d'entretien
)UpTXHQFHUHFRPPDQGpH
)LOWUHjSRXVVLqUH
Nettoyage
7RXVOHVPRLVSOXVVLQpFHVVDLUH
)LOWUHVjDLUVDLQ
5HPSODFHPHQW
nettoyage
7RXVOHVPRLVSOXVVLQpFHVVDLUH
(QYHORSSHGHO
pOpPHQW Nettoyage
7RXVOHVPRLVSOXVVLQpFHVVDLUH
Nettoyage et
%DFjHDXHWWX\DXWHULH
UHFKHUFKHGH
G
pYDFXDWLRQ
ERXFKRQV
¬FKDTXHVDLVRQDYDQWOHGpPDUUDJH
Bobines intérieure et
extérieure
¬FKDTXHVDLVRQDYDQWOHGpPDUUDJH
Nettoyage
* &HWWHLQWHUYHQWLRQQHGRLWrWUHHIIHFWXpHTXHSDUXQWHFKQLFLHQTXDOL¿p
avertissement
‡ $UUrWH]OHFOLPDWLVHXUHWGpEUDQFKH]OHFkEOH
G
DOLPHQWDWLRQDYDQWOHQHWWR\DJH
1HWWR\DJHGHO
pOpPHQWLQWpULHXU
HWGHODWpOpFRPPDQGH
‡ 8WLOLVH]XQFKLIIRQVHFSRXUHVVX\HUO
pOpPHQW
LQWpULHXUHWODWpOpFRPPDQGH
‡ 6LO
pOpPHQWLQWpULHXUHVWWURSVDOHYRXVSRXYH]
OHQHWWR\HUDYHFXQFKLIIRQKXPLGL¿pG
HDXIURLGH
Support du
panneau
6RXOHYH]OHSDQQHDXDYDQWGHO
pOpPHQWLQWpULHXU
HQDQJOHMXVTX
jFHTX
LOVHEORTXHHWUHSRVHVXU
OHFURFKHW
‡ /HSDQQHDXDYDQWGHO
pOpPHQWLQWpULHXUSHXWrWUH
UHWLUpHWQHWWR\pjO
HDX(VVX\H]OHHQVXLWHDYHF
XQFKLIIRQVHF
‡ 1
XWLOLVH]SDVGHEURVVHGHSDSLHUGHYHUUHRX
jSROLUSRXUQHWWR\HUO
pOpPHQWFDUFHFLSRXUUDLW
FDXVHUGHVGRPPDJHV
‡ 1
XWLOLVH]SDVGHFKLIIRQWUDLWpFKLPLTXHPHQWSRXU
QHWWR\HUO
pOpPHQW
‡ 1
XWLOLVH]SDVGHEHQ]LQHGHGLOXDQWGHSRXGUH
GHSROLVVDJHRXG
DXWUHVVROYDQWVVLPLODLUHVSRXU
le nettoyage. La surface en plastique pourrait se
IrOHURXVHGpIRUPHU
3RLJQpHGX¿OWUHjSRXVVLqUH
2 7HQH]ODSRLJQpHGX¿OWUHjSRXVVLqUHHW
VRXOHYH]OHOpJqUHPHQWSRXUOHVRUWLUGXVXSSRUW
GH¿OWUH
‡ 1
XWLOLVH]MDPDLVG
HDXFKDXGHGHSOXVGHƒ&
SRXUQHWWR\HUOHSDQQHDXDYDQWFDUHOOHSRXUUDLW
FDXVHUXQHGpIRUPDWLRQRXXQHGpFRORUDWLRQ
1HWWR\DJHGHV¿OWUHV
Remarque : L'alimentation électrique doit être
débranchée avant le nettoyage.
8Q¿OWUHjSRXVVLqUHREVWUXpUpGXLWO
HI¿FDFLWp
GXUHIURLGLVVHPHQWFKDXIIDJHGHFHWDSSDUHLO
1HWWR\H]OH¿OWUHWRXVOHVPRLVSOXVVRXYHQWVL
nécessaire.
3 7LUH]OH¿OWUHjSRXVVLqUHYHUVOHEDVSRXUOH
VRUWLUGHO
pOpPHQWLQWpULHXU
37
)LOWUHjSRXVVLqUH
avertissement
1HWRXFKH]SDVHWQHQHWWR\H]SDV
OHJpQpUDWHXUGHSODVPDIURLGVL
GLVSRQLEOH&HODSHXWSURYRTXHU
XQFKRFpOHFWULTXH
1HWWR\H]OH¿OWUHjSRXVVLqUHDYHFXQ
DVSLUDWHXURXGHO
HDXSXLVIDLWHVOHVpFKHU
dans un endroit frais.
0DLQWHQDQFHJpQpUDOH
6LYRXVQ
XWLOLVH]SDVOHFOLPDWLVHXUGXUDQWXQH
ORQJXHSpULRGH
‡ )DLWHVIRQFWLRQQHUO
DSSDUHLOHQPRGH)$1
YHQWLODWHXUXQLTXHPHQWSHQGDQWRXKHXUHV
SRXUSHUPHWWUHjO
DSSDUHLOGHVpFKHU
)LOWUHj
SRXVVLqUH
‡ eWHLJQH]O
DSSDUHLOHWGpEUDQFKH]OHFkEOH
G
DOLPHQWDWLRQ5HWLUH]OHVSLOHVGHOD
WpOpFRPPDQGH
Filtre sain
‡ /
pOpPHQWH[WpULHXUGRLWrWUHQHWWR\pHWHQWUHWHQX
UpJXOLqUHPHQW1
HVVD\H]SDVGHOHIDLUH
YRXVPrPH&RQWDFWH]YRWUHUHYHQGHXU
RXXQWHFKQLFLHQGHPDLQWHQDQFH
4 /HV¿OWUHVUDIUDvFKLVVHXUVG
DLUVDLQVL
GLVSRQLEOHVWHOVTXHOH¿OWUHDXFKDUERQDFWLIOH
¿OWUH%,2OH¿OWUHj9LWDPLQH&OH¿OWUHDX[LRQV
G
DUJHQWVRQWDWWDFKpVDX¿OWUHjSRXVVLqUH
5HWLUH]OHV¿OWUHVVDLQVGXFDGUHGXVXSSRUWGX
¿OWUHjSRXVVLqUH
1HWWR\H]OHV¿OWUHVVDLQVDXPRLQVXQHIRLVWRXV
OHVPRLVHWUHPSODFH]OHVWRXVOHVPRLV
6LSRVVLEOHQHWWR\H]OHVDYHFXQDVSLUDWHXU
9pUL¿FDWLRQVDYDQWXWLOLVDWLRQ
‡ 9pUL¿H]TXHOHFkEODJHQ
HVWSDVFDVVpRX
GpEUDQFKp
‡ $VVXUH]YRXVTXHOH¿OWUHjSRXVVLqUHHVWLQVWDOOp
‡ 9pUL¿H]TXHO
HQWUpHHWODVRUWLHG
DLUGX
FOLPDWLVHXUQHVRQWSDVREVWUXpHVVLO
DSSDUHLOQ
D
SDVpWpXWLOLVpSHQGDQWXQFHUWDLQWHPSV
avertissement
‡ 1HWRXFKH]SDVOHVSDUWLHVPpWDOOLTXHVGH
O
pOpPHQWORUVTXHYRXVUHWLUH]OH¿OWUH9RXV
SRXUULH]YRXVEOHVVHUHQPDQLSXODQWGHV
SDUWLHVPpWDOOLTXHVFRXSDQWHV
5 5HPHWWH]OHV¿OWUHVUDIUDvFKLVVHXUVG
DLUVDLQV
en place.
6 5HSODFH]ODSDUWLHVXSpULHXUHGHV¿OWUHVj
SRXVVLqUHGDQVO
DSSDUHLOHQYRXVDVVXUDQW
TXHOHVERUGVGURLWHWJDXFKHV
DOLJQHQW
FRUUHFWHPHQWSXLVUHPHWWH]OHV¿OWUHVHQSODFH
38
‡ 1
XWLOLVH]SDVG
HDXSRXUQHWWR\HUO
LQWpULHXU
GXFOLPDWLVHXU/
HDXSHXWGpWUXLUHO
LVRODWLRQ
FRQGXLVDQWjXQSRVVLEOHFKRFpOHFWULTXH
‡ /RUVTXHYRXVQHWWR\H]O
pOpPHQWFRPPHQFH]
SDUYRXVDVVXUHUTXHOHFRXUDQWHWOH
disjoncteur sont éteints.
&RQVHLOVG
XWLOLVDWLRQ
/HVSKpQRPqQHVVXLYDQWVSHXYHQWVHSURGXLUH
GXUDQWOHIRQFWLRQQHPHQWQRUPDO
3URWHFWLRQGXFOLPDWLVHXU
‡ 3URWHFWLRQGXFRPSUHVVHXU
$SUqVV
rWUHDUUrWpOHFRPSUHVVHXUQHSHXW
SDVUHGpPDUUHUGXUDQWPLQXWHV
‡ $QWLJHO
6LO
DSSDUHLOIRQFWLRQQHHQPRGH&22/
UHIURLGLVVHPHQWHWGDQVXQHSLqFHD\DQW
XQHWHPSpUDWXUHDPELDQWHEDVVHGXJLYUH
SHXWVHIRUPHUVXUOHFRQGHQVHXU/RUVTXH
ODWHPSpUDWXUHGXFRQGHQVHXUGHO
pOpPHQW
LQWpULHXUSDVVHHQGHVVRXVGHƒ&OH
FRPSUHVVHXUV
DUUrWHSRXUSURWpJHUO
DSSDUHLO
‡ 'pJLYUDJH
'XJLYUHSHXWVHIRUPHUVXUO
pOpPHQW
H[WpULHXUHQPRGHFKDXIIDJHORUVTXHOD
WHPSpUDWXUHH[WpULHXUHHVWEDVVHPDLVTX
LO\
DEHDXFRXSG
KXPLGLWpUpGXLVDQWO
HI¿FDFLWp
GXFKDXIIDJH
'DQVFHVFRQGLWLRQVOHFOLPDWLVHXU
DUUrWHOHPRGHFKDXIIDJHHWFRPPHQFH
DXWRPDWLTXHPHQWOHGpJLYUDJH/H
WHPSVSRXUGpJLYUHUSHXWYDULHUHQWUH
HWPLQXWHV
'XUDQWOHGpJLYUDJHOHVPRWHXUVGX
YHQWLODWHXUGHVpOpPHQWVLQWpULHXUHW
H[WpULHXUV
DUUrWHQW©+ªFOLJQRWHVXU
O
LQGLFDWHXULQWpULHXUHWO
pOpPHQWH[WpULHXU
SHXWpPHWWUHGHODYDSHXU&HQ
HVWSDVXQ
G\VIRQFWLRQQHPHQW$SUqVOD¿QGXGpJLYUDJH
OHFKDXIIDJHUHFRPPHQFHDXWRPDWLTXHPHQW
jIRQFWLRQQHU
‡ $LUDQWLIURLG
(QPRGH+($7FKDXIIDJHOHYHQWLODWHXU
GHO
pOpPHQWLQWpULHXUQHGpPDUUHSDVD¿Q
G
pYLWHUTXHO
DLUIURLGQHSpQqWUHGDQVOD
SLqFHGXUDQWPLQXWHVVLOHFRQGHQVHXU
LQWpULHXUQ
DWWHLQWSDVODWHPSpUDWXUHPLQLPDOH
GDQVOHVFRQGLWLRQVVXLYDQWHV
/HPRGHFKDXIIDJHYLHQWGHGpPDUUHU
-XVWHjOD¿QGXGpJLYUDJHDXWRPDWLTXH
&KDXIIDJHjEDVVHWHPSpUDWXUH
%ULVHGRXFH
/
pOpPHQWLQWpULHXUSHXWVRXIÀHUXQHEULVHGRXFH
HWOHYROHWWRXUQHUMXVTX
jXQHFHUWDLQHSRVLWLRQ
GDQVODVLWXDWLRQVXLYDQWH
(QPRGH+($7FKDXIIDJHO
DSSDUHLOHVW
DOOXPpOHFRPSUHVVHXUQ
DWWHLQWSDVOHV
FRQGLWLRQVGHGpPDUUDJH
(QPRGH+($7FKDXIIDJHODWHPSpUDWXUH
DWWHLQWODYDOHXUGp¿QLHHWOHFRPSUHVVHXU
V
DUUrWHSHQGDQWHQYLURQPLQXWH
8QHEXpHEODQFKHVRUWDQWGHO
pOpPHQW
LQWpULHXU
‡ 8QHEXpHEODQFKHSHXWrWUHJpQpUpH
en raison d'une grande différence de
WHPSpUDWXUHHQWUHO
DUULYpHHWODVRUWLH
G
DLUHQPRGH&22/UHIURLGLVVHPHQWORUVTXH
O
HQYLURQQHPHQWLQWpULHXUDXQWDX[G
KXPLGLWp
UHODWLYHPHQWKXPLGH
‡ 8QHEXpHEODQFKHSHXWrWUHJpQpUpHHQUDLVRQGH
O
KXPLGLWpSURYHQDQWGXSURFHVVXVGHGpJLYUDJH
ORUVTXHOHFOLPDWLVHXUUHGpPDUUHHQPRGH+($7
FKDXIIDJHDSUqVOHGpJLYUDJH
/pJHUEUXLWGXFOLPDWLVHXU
‡ 9RXVSRXYH]HQWHQGUHXQOpJHUVLIÀHPHQWORUVTXH
OHFRPSUHVVHXUIRQFWLRQQHRXYLHQWGHV
DUUrWHU
,OV
DJLWGXVRQpPLVSDUOHUpIULJpUDQWORUVTX
LO
V
pFRXOHRXTX
LOV
DUUrWH
‡ 9RXVSRXYH]pJDOHPHQWHQWHQGUHXQOpJHU
©JULQFHPHQWªORUVTXHOHFRPSUHVVHXUHVW
HQFRXUVGHIRQFWLRQQHPHQWRXTX
LOYLHQWGH
V
DUUrWHU&HODHVWG€jODGLODWDWLRQHWjOD
FRQWUDFWLRQWKHUPLTXHVGHVFRPSRVDQWVHQ
SODVWLTXHGHO
DSSDUHLOORUVGXFKDQJHPHQWGH
WHPSpUDWXUH
‡ ,OHVWSRVVLEOHTXHYRXVHQWHQGLH]XQEUXLWG€DX
YROHWUHYHQDQWGDQVVDSRVLWLRQG
RULJLQHORUVTXH
O
DOLPHQWDWLRQHVWUDOOXPpH
/
pOpPHQWLQWpULHXUH[SXOVHGHODSRXVVLqUH
&HODHVWQRUPDOORUVTXHOHFOLPDWLVHXUQ
DSDVpWp
XWLOLVpSHQGDQWORQJWHPSVRXTX
LOHVWXWLOLVpSRXUOD
SUHPLqUHIRLV
/
pOpPHQWLQWpULHXUpPHWXQHRGHXUSDUWLFXOLqUH
&HODHVWFDXVpSDUO
pOpPHQWLQWpULHXUTXLGpJDJH
OHVRGHXUVLPSUpJQpHVSURYHQDQWGHVPDWpULDX[GH
FRQVWUXFWLRQGXPRELOLHURXGHODIXPpH
/HFOLPDWLVHXUSDVVHHQPRGH)$1
YHQWLODWHXUXQLTXHPHQWDSUqVOHPRGH&22/
UHIURLGLVVHPHQWRX+($7FKDXIIDJH
/RUVTXHODWHPSpUDWXUHLQWpULHXUHDWWHLQWODYDOHXU
Gp¿QLHOHFRPSUHVVHXUV
DUUrWHDXWRPDWLTXHPHQWHW
OHFOLPDWLVHXUSDVVHHQPRGH)$1YHQWLODWHXU
/HFRPSUHVVHXUUHGpPDUUHORUVTXHODWHPSpUDWXUH
DXJPHQWHVLO
DSSDUHLOHVWHQPRGH&22/
UHIURLGLVVHPHQWRXGLPLQXHVLO
DSSDUHLOHVWHQ
PRGH+($7FKDXIIDJH
&RQGHQVDWLRQ
/
HDXGHFRQGHQVDWLRQSHXWVHIRUPHUjODVRUWLH
G
DLUHQFDVGHUHIURLGLVVHPHQWRXGHVpFKDJHORQJV
ORUVTXHOHWDX[G
KXPLGLWpHVWGHSOXVGHDYHF
OHVSRUWHVHWOHVIHQrWUHVRXYHUWHV
3RVLWLRQQH]OHYROHWYHUWLFDOjVRQDQJOHPD[LPDO
YHUVOHVROHWUpJOH]ODYLWHVVHGXYHQWLODWHXUDX
PD[LPXP)HUPH]OHVSRUWHVHWOHVIHQrWUHV
/
pFODLUDJHRXO
XWLOLVDWLRQSURFKHG
XQWpOpSKRQH
SRUWDEOHSHXWFDXVHUXQG\VIRQFWLRQQHPHQWGH
l'appareil.
'pEUDQFKH]O
DSSDUHLOGHO
DOLPHQWDWLRQSXLV
UHEUDQFKH]OH$SSX\H]VXUODWRXFKH212))
PDUFKHDUUrWGHODWpOpFRPPDQGHSRXUUHGpPDUUHU
OHIRQFWLRQQHPHQW
)RQFWLRQ;)DQ
/
pOpPHQWLQWpULHXUSHXWFRQWLQXHUjIRQFWLRQQHU
DSUqVTXHYRXVD\H]pWHLQWO
DSSDUHLOHQDSSX\DQW
VXUODWRXFKH212))PDUFKHDUUrW
9pUL¿H]TXHODIRQFWLRQ;)DQHVWELHQpWHLQWH
39
'pSDQQDJH
/HFOLPDWLVHXUQ
HVWSDVUpSDUDEOHSDUO
XWLOLVDWHXU8QHPDXYDLVHUpSDUDWLRQSHXWSURYRTXHU
XQFKRFpOHFWULTXHRXXQLQFHQGLH9HXLOOH]FRQWDFWHUXQVHUYLFHDSUqVYHQWHDJUppSRXU
obtenir une réparation professionnelle.
avertissement
6LO
XQHGHVVLWXDWLRQVVXLYDQWHVVHSURGXLWDUUrWH]LPPpGLDWHPHQWOHFOLPDWLVHXU
GpEUDQFKH]O
DOLPHQWDWLRQHWFRQWDFWH]OHVHUYLFHDSUqVYHQWHDJUpp
‡ 6LXQFRGHG
HUUHXUDSSDUDvWVXUO
DI¿FKDJHGH
O
pOpPHQWLQWpULHXU
‡ De l'eau ou un autre liquide éclabousse
l'intérieur de l'appareil.
‡ /HWpPRLQG
DOLPHQWDWLRQRXXQDXWUH
LQGLFDWHXUSHXYHQWFOLJQRWHUUDSLGHPHQWHW
FHFOLJQRWHPHQWQHSHXWSDVrWUHDUUrWpHQ
GpEUDQFKDQWO
DSSDUHLOGHO
DOLPHQWDWLRQHWHQ
OHUHEUDQFKDQW
‡ De l'eau fuit de l'appareil.
‡ /HIXVLEOHGLVMRQFWHIUpTXHPPHQWRXOH
GLVMRQFWHXUV
HQFOHQFKHVRXYHQW
‡ /HFkEOHHWOD¿FKHG
DOLPHQWDWLRQVXUFKDXIIHQW
‡ 8QEUXLWVHFHVWpPLVGXUDQWOHIRQFWLRQQHPHQW
‡ 'HIRUWHVRGHXUVVRQWpPLVHVGXUDQWOH
IRQFWLRQQHPHQW
‡ $XWUHVVLWXDWLRQVDQRUPDOHV
/DSUHVVLRQGDQVOHV\VWqPHGHUpIULJpUDWLRQHVWEDVVHHWSHXWFRQGXLUHjXQHSDQQHGH
O
DSSDUHLO'HPDQGH]jXQLQVWDOODWHXUDJUppGHODFRQWU{OHU
0DXYDLV
IRQFWLRQQHPHQW
L'appareil ne
GpPDUUHSDV
L'appareil ne refroidit
RXQHFKDXIIHSDVVL
GLVSRQLEOHELHQOD
SLqFHWDQGLVTXHGH
l'air est expulsé du
FOLPDWLVHXU
Cause
Que faire
Coupure de courant
$WWHQGH]OHUHWRXUGXFRXUDQW
/
pOpPHQWDSHXWrWUHpWpGpEUDQFKp
9pUL¿H]TXHOD¿FKHHVW
FRUUHFWHPHQWLQVpUpHGDQVOD
SULVHPXUDOH
/HIXVLEOHDSHXWrWUHGLVMRQFWp
5HPSODFH]OHIXVLEOH
La tension est trop basse ou trop
pOHYpH
&RQWDFWH]GHVSURIHVVLRQQHOV
pour tester la tension.
/HVSLOHVGHODWpOpFRPPDQGHVRQW
SHXWrWUHXVpHV
5HPSODFH]OHVSLOHV
/DGXUpHTXHYRXVDYH]UpJOpHDYHFOH
PLQXWHXUHVWLQFRUUHFWH
$WWHQGH]RXDQQXOH]OHUpJODJHGX
PLQXWHXU
0DXYDLVUpJODJHGHODWHPSpUDWXUH
5pJOH]FRUUHFWHPHQWOD
WHPSpUDWXUH3RXUSOXVGH
GpWDLOVUHSRUWHYRXVDX
FKDSLWUH©8WLOLVDWLRQGHOD
WpOpFRPPDQGHª
/H¿OWUHjDLUHVWREVWUXp
1HWWR\H]OH¿OWUH
/HVSRUWHVHWIHQrWUHVVRQWRXYHUWHV
)HUPH]OHVSRUWHVHWOHVIHQrWUHV
/
DUULYpHRXODVRUWLHG
DLUGHO
pOpPHQW
intérieur ou extérieur est obstruée.
5HWLUH]WRXWFHTXLERXFKHSXLV
UHGpPDUUH]O
pOpPHQW
/DSURWHFWLRQGHPLQXWHVGX
FRPSUHVVHXUDpWpDFWLYpH
3DWLHQWH]SHQGDQWPLQXWHV
6LOHSUREOqPHQ
HVWSDVUpJOpFRQWDFWH]YRWUHUHYHQGHXURXOHVHUYLFHDSUqVYHQWHOHSOXVSURFKH
'RQQH]OHXUGHVLQIRUPDWLRQVGpWDLOOpHVVXUOHVG\VIRQFWLRQQHPHQWVHWOHPRGqOHGHO
DSSDUHLO
40
3URFpGHUDX[YpUL¿FDWLRQVVXLYDQWHVDYDQWGHOHFRQWDFWHUSHXWYRXVIDLUHpFRQRPLVHUGXWHPSVHWGHO
DUJHQW
0DXYDLV
IRQFWLRQQHPHQW
&DXVH
L'appareil ne
fonctionne pas.
L'appareil ne fonctionne pas s'il
HVWDOOXPpLPPpGLDWHPHQWDSUqV
DYRLUpWppWHLQW&HODSHUPHWGH
SURWpJHUO
DSSDUHLO3DWLHQWH]HQYLURQ
PLQXWHV
Des odeurs sont
pPLVHV
‡&HUWDLQHVRGHXUVSURYHQDQWGH
O
pOpPHQWLQWpULHXUSHXYHQWrWUH
pPLVHV&HVRQWOHVRGHXUVGHOD
SLqFHPRELOLHUWDEDFHWFTXLRQW
pWpDEVRUEpHVSDUO
pOpPHQW
‡6LOHVRGHXUVSHUVLVWHQWFRQVXOWH]OH
VHUYLFHDSUqVYHQWHDJUppSRXUXQ
nettoyage.
Bruit
G
©pFRXOHPHQW
d'eau »
/HEUXLWUHVVHPEODQWjXQ
pFRXOHPHQWG
HDXHVWOHÀX[GH
UpIULJpUDQWjO
LQWpULHXUGHO
pOpPHQW
0DXYDLV
IRQFWLRQQHPHQW
Fuite d'eau
VXUO
pOpPHQW
intérieur
‡/HWDX[G
KXPLGLWpHVWpOHYp
‡L'eau de condensation déborde.
‡/HWX\DXGHYLGDQJHHVWGHVVHUUpRX
obstrué.
Fuite d'eau
VXUO
pOpPHQW
extérieur
‡'XUDQWOHPRGHGHUHIURLGLVVHPHQW
l'eau se condense autour des tuyaux
HWGHVMRLQWVGHUDFFRUGHPHQW
‡'XUDQWOHGpJLYUDJHO
HDXV
pFRXOH
‡'XUDQWOHPRGHFKDXIIDJHO
HDXVXU
le condenseur s'égoutte.
%UXLWSURYHQDQW
GHO
pOpPHQW
intérieur
‡/HEUXLWHVWpPLVORUVTXHOHUHODLV
GXYHQWLODWHXURXGXFRPSUHVVHXU
V
DOOXPHRXV
pWHLQW
‡/RUVTXHOHPRGHGHGpJLYUDJH
GpPDUUHRXV
DUUrWHOHEUXLWGXÀX[
de réfrigérant se fait entendre dans
la direction opposée.
/
pOpPHQW
intérieur ne
VRXIÀHSDVG
DLU
‡(QPRGH+($7FKDXIIDJHORUVTXH
ODWHPSpUDWXUHGXFRQGHQVHXU
LQWpULHXUHVWWUqVEDVVHOHÀX[G
DLU
HVWDUUrWpD¿QG
pYLWHUTXHO
DLUIURLG
QHUHQWUHGDQVOHVPLQXWHV
‡(QPRGH+($7FKDXIIDJHORUVTXH
ODWHPSpUDWXUHH[WpULHXUHHVW
EDVVHRXTXHOHWDX[G
KXPLGLWp
HVWpOHYpGXJLYUHVHIRUPHVXUOH
FRQGHQVHXUH[WpULHXU/
pOpPHQW
VHGpJLYUHDXWRPDWLTXHPHQWHW
O
pOpPHQWLQWpULHXUQHVRXIÀHSOXV
G
DLUSHQGDQWjPLQXWHV
‡'XUDQWOHGpJLYUDJHGHO
HDXRXGH
ODYDSHXUSHXYHQWrWUHpPLVHV
‡(QPRGH'(+80,',)<
GpVKXPLGL¿HUOHYHQWLODWHXU
LQWpULHXUDUUrWHGHVRXIÀHUGH
O
DLUGXUDQWjPLQXWHVD¿Q
G
HPSrFKHUO
HDXGHFRQGHQVDWLRQ
GHVHYDSRULVHUGHQRXYHDX
+XPLGLWpVXUOD
sortie d'air
6LO
DSSDUHLOIRQFWLRQQHDYHFXQWDX[
G
KXPLGLWppOHYpGXUDQWXQHORQJXH
SpULRGHGHO
KXPLGLWpSRXUUDLWrWUH
générée sur la grille de sortie d'air
et s'égoutter.
Code d'erreur
+GpJLYUDJH
&
HVWQRUPDO/
pOpPHQWHVWHQ
FRXUVGHGpJLYUDJHHWOHFKDXIIDJH
UHFRPPHQFHUDUDSLGHPHQW
'XUDQWOHPRGHUHIURLGLVVHPHQW
XQHOpJqUHEXpHSHXWrWUHpPLVHSDU
O
pOpPHQWLQWpULHXUHQUDLVRQG
XQH
De la buée est
WHPSpUDWXUHHWG
XQWDX[G
KXPLGLWp
générée en
WURSpOHYpVGDQVODSLqFH
PRGH&22/
$SUqVXQFHUWDLQWHPSVODEXpH
UHIURLGLVVHPHQW
GLVSDUDvWDYHFODGLPLQXWLRQGHOD
WHPSpUDWXUHHWGXWDX[G
KXPLGLWp
GHODSLqFH
Bruit de
FUDTXHPHQW
Il s'agit d'un son de friction causé
SDUODGLODWDWLRQHWRXODFRQWUDFWLRQ
du panneau ou d'autres parties
HQUDLVRQGXFKDQJHPHQWGH
WHPSpUDWXUH
L'appareil ne
GpPDUUHSDV
‡/HFRXUDQWHVWLOFRXSp"
‡/DSULVHpOHFWULTXHHVWHOOHPDO
¿[pH"OHFDVpFKpDQW
‡Le dispositif de protection du circuit
V
HVWLOGpFOHQFKp"
‡/DWHQVLRQHVWHOOHSOXVpOHYpH
RXSOXVEDVVH"WHVWpHSDUXQ
SURIHVVLRQQHO
‡$YH]YRXVFRUUHFWHPHQWXWLOLVpOH
PLQXWHXU"
‡/HVSLOHVVRQWHOOHVXVpHV"
/
HIIHW&RROLQJ
+HDWLQJ
UHIURLGLVVHPHQW
FKDXIIDJHHVW
PDXYDLV
‡/HUpJODJHGHODWHPSpUDWXUHHVWLO
DGDSWp"
‡/
DUULYpHVRUWLHG
DLUHVWHOOH
EORTXpH"
‡/H¿OWUHHVWLOVDOH"
‡<DWLOXQHSRUWHRXXQHIHQrWUH
RXYHUWH"
‡/HYHQWLODWHXUHVWLOUpJOpVXUXQH
YLWHVVHEDVVH"
‡<DWLOGHVVRXUFHVGHFKDOHXUGDQV
ODSLqFH"
&DXVH
1HPHWWH]SDVFHSURGXLWDXUHEXWVDQVWULSUpDODEOH&ROOHFWLRQRIVXFK
ZDVWHVHSDUDWHO\IRUVSHFLDOWUHDWPHQWLVQHFHVVDU\&HW\SHGHGpFKHWV
GRLWrWUHFROOHFWpVpSDUpPHQWSRXUWUDLWHPHQWVSpFLDOVLQpFHVVDLUH
ȆȓȞĮțĮȢʌİȡȚİȤȠȝȑȞȦȞ
ȈȣȖȤĮȡȘIJȒȡȚĮ
ȆȡȠijȣȜȐȟİȚȢĮıijĮȜİȓĮȢ
ȆİȡȚȖȡĮijȒʌȡȠȧȩȞIJȠȢ
ȅșȩȞȘIJȘȢİıȦIJİȡȚțȒȢȝȠȞȐįĮȢ
ȉȘȜİȤİȚȡȚıIJȒȡȚȠ
ȆİȡȚȖȡĮijȒIJȘȜİȤİȚȡȚıIJȘȡȓȠȣ
ǼȞįİȓȟİȚȢȠșȩȞȘȢIJȘȜİȤİȚȡȚıIJȘȡȓȠȣ
ȆȡȫIJȘȤȡȒıȘ
ȆȫȢȞĮȤȡȘıȚȝȠʌȠȚİȓIJİIJȠIJȘȜİȤİȚȡȚıIJȒȡȚȠ
ȆȫȢȞĮȤȡȘıȚȝȠʌȠȚİȓIJİIJȘȞİıȦIJİȡȚțȒȝȠȞȐįĮ
ȁİȚIJȠȣȡȖȓĮȑțIJĮțIJȘȢĮȞȐȖțȘȢ
ǺȑȜIJȚıIJȘȜİȚIJȠȣȡȖȓĮ
ȀĮșĮȡȚıȝȩȢțĮȚıȣȞIJȒȡȘıȘ
ȈȣȝȕȠȣȜȑȢȜİȚIJȠȣȡȖȓĮȢ
ǹȞIJȚȝİIJȫʌȚıȘʌȡȠȕȜȘȝȐIJȦȞ
ƴLjǍǂǎǕNJNjƿǖǑdžǎljǞǍNJǔLj
‡ ǻȚĮIJȘȡİȓIJİIJȠIJȘȜİȤİȚȡȚıIJȒȡȚȠıİșȑıȘȩʌȠȣIJȠıȒȝĮIJȠȣ
ȞĮȝʌȠȡİȓȞĮijIJȐıİȚIJȠįȑțIJȘIJȘȢİıȦIJİȡȚțȒȢȝȠȞȐįĮȢ
‡ ȀĮIJȐIJȘȜİȚIJȠȣȡȖȓĮIJȠȣțȜȚȝĮIJȚıIJȚțȠȪȕİȕĮȚȦșİȓIJİȩIJȚIJȠ
IJȘȜİȤİȚȡȚıIJȒȡȚȠİȓȞĮȚıIJȡĮȝȝȑȞȠʌȡȠȢIJȠįȑțIJȘıȒȝĮIJȠȢ
IJȘȢİıȦIJİȡȚțȒȢȝȠȞȐįĮȢ
‡ ǵIJĮȞIJȠIJȘȜİȤİȚȡȚıIJȒȡȚȠıIJȑȜȞİȚȑȞĮıȒȝĮIJȠıȪȝȕȠȜȠ
ĮȞĮȕȠıȕȒȞİȚȖȚĮʌİȡȓʌȠȣįİȣIJİȡȩȜİʌIJȠıIJȘȞ
ȠșȩȞȘIJȠȣIJȘȜİȤİȚȡȚıIJȘȡȓȠȣ
‡ ǾİıȦIJİȡȚțȒȝȠȞȐįĮĮȞĮȖȞȦȡȓȗİȚIJȠıȒȝĮȝİȑȞĮ
ȘȤȘIJȚțȩıȒȝĮȝʌȚʌȩIJĮȞȜĮȝȕȐȞİȚIJȠıȒȝĮĮʌȩIJȠ
IJȘȜİȤİȚȡȚıIJȒȡȚȠ
‡ ȆĮIJȒıIJİIJȠʌȜȒțIJȡȠIJȠȣIJȘȜİȤİȚȡȚıIJȘȡȓȠȣțĮȚıIJİȓȜIJİ
ʌȐȜȚIJȠıȒȝĮĮȞįİȞĮțȠȪıİIJİȑȞĮȘȤȘIJȚțȩıȒȝĮĮʌȩ
IJȘȞİıȦIJİȡȚțȒȝȠȞȐįĮ
42
ȈȣȖȤĮȡȘIJȒȡȚĮ
ȈȣȖȤĮȡȘIJȒȡȚĮțĮȚİȣȤĮȡȚıIJȠȪȝİʌȠȣİʌȚȜȑȟĮIJİ
IJȠțȜȚȝĮIJȚıIJȚțȩįȚĮȚȡȠȪȝİȞȠȣIJȪʌȠȣIJȘȢ
(OHFWUROX[ǼȓȝĮıIJİıȓȖȠȣȡȠȚȩIJȚȘȤȡȒıȘIJȠȣȞȑȠȣ
țȜȚȝĮIJȚıIJȚțȠȪıĮȢșĮıĮȢİȓȞĮȚĮʌȩȜȣIJĮİȣȤȐȡȚıIJȘ
ȆȡȚȞȤȡȘıȚȝȠʌȠȚȒıİIJİIJȠțȜȚȝĮIJȚıIJȚțȩıȣȞȚıIJȠȪȝİ
ȞĮįȚĮȕȐıİIJİȠȜȩțȜȘȡȠIJȠİȖȤİȚȡȓįȚȠȤȡȒıIJȘIJȠ
ȠʌȠȓȠʌĮȡȑȤİȚȝȚĮʌİȡȚȖȡĮijȒIJȠȣțȜȚȝĮIJȚıIJȚțȠȪțĮȚ
IJȦȞȜİȚIJȠȣȡȖȚȫȞIJȠȣ
īȚĮIJȘȞĮʌȠijȣȖȒIJȦȞțȚȞįȪȞȦȞʌȠȣȣʌȐȡȤȠȣȞ
ʌȐȞIJĮțĮIJȐIJȘȤȡȒıȘȝȚĮȢȘȜİțIJȡȚțȒȢıȣıțİȣȒȢ
İȓȞĮȚıȘȝĮȞIJȚțȩIJȠțȜȚȝĮIJȚıIJȚțȩıĮȢȞĮİȖțĮIJĮıIJĮșİȓ
ıȦıIJȐțĮȚȞĮįȚĮȕȐıİIJİIJȚȢȠįȘȖȓİȢĮıijȐȜİȚĮȢ
ʌȡȠıİțIJȚțȐȫıIJİȞĮĮʌȠijȪȖİIJİIJȘȜĮȞșĮıȝȑȞȘ
ȤȡȒıȘțĮȚIJȠȣȢțȚȞįȪȞȠȣȢ
ȈȣȞȚıIJȠȪȝİȞĮįȚĮIJȘȡİȓIJİĮȣIJȩIJȠİȖȤİȚȡȓįȚȠ
ȠįȘȖȚȫȞȖȚĮȝİȜȜȠȞIJȚțȒĮȞĮijȠȡȐțĮȚȞĮIJȠ
ʌĮȡĮįȓįİIJİıİIJȣȤȩȞȝİȜȜȠȞIJȚțȩȚįȚȠțIJȒIJȘ
ȂİIJȐIJȘȞĮʌȠıȣıțİȣĮıȓĮȕİȕĮȚȦșİȓIJİȩIJȚIJȠ
țȜȚȝĮIJȚıIJȚțȩįİȞȑȤİȚȣʌȠıIJİȓȗȘȝȚȑȢǼȐȞȑȤİIJİ
ĮȝijȚȕȠȜȓİȢȝȘȤȡȘıȚȝȠʌȠȚȒıİIJİIJȠțȜȚȝĮIJȚıIJȚțȩ
țĮȚİʌȚțȠȚȞȦȞȒıIJİȝİIJȠİȟȠȣıȚȠįȠIJȘȝȑȞȠțȑȞIJȡȠ
ıȑȡȕȚȢIJȘȢ(OHFWUROX[
ǑdžǒNJǃǂnjnjǐǎǕNJNjƿǔǖǍǃǐǖnjƿ
ȆȜȘȡȠijȠȡȓİȢĮʌȩȡȡȚȥȘȢȖȚĮIJȠȣȢȤȡȒıIJİȢ
‡ ȉĮʌİȡȚııȩIJİȡĮĮʌȩIJĮȣȜȚțȐıȣıțİȣĮıȓĮȢİȓȞĮȚ
ĮȞĮțȣțȜȫıȚȝĮ
‡ ȆĮȡĮțĮȜȠȪȝİĮʌȠȡȡȓȥIJİIJĮȣȜȚțȐĮȣIJȐȝȑıȦIJȠȣ
IJȠʌȚțȠȪțȑȞIJȡȠȣĮȞĮțȪțȜȦıȘȢȒIJȠʌȠșİIJȒıIJİIJĮ
ıIJȠȣȢțĮIJȐȜȜȘȜȠȣȢțȐįȠȣȢıȣȜȜȠȖȒȢ
‡ ǼȐȞİʌȚșȣȝİȓIJİȞĮĮʌȠȡȡȓȥİIJİĮȣIJȩIJȠ
țȜȚȝĮIJȚıIJȚțȩİʌȚțȠȚȞȦȞȒıIJİȝİIJȚȢIJȠʌȚțȑȢĮȡȤȑȢ
țĮȚȡȦIJȒıIJİȖȚĮIJȘıȦıIJȒȝȑșȠįȠĮʌȩȡȡȚȥȘȢ
Ǒǒǐǔǐǘƿ
‡ ȉȠțȜȚȝĮIJȚıIJȚțȩĮȣIJȩįİȞʌȡȠȠȡȓȗİIJĮȚȖȚĮȤȡȒıȘĮʌȩ
ȝȚțȡȐʌĮȚįȚȐȒȐIJȠȝĮȝİȝİȚȦȝȑȞİȢȚțĮȞȩIJȘIJİȢȤȦȡȓȢ
İʌȠʌIJİȓĮ
ȈȣȞșȒțİȢȤȡȒıȘȢ
ǹȣIJȒȘıȣıțİȣȒʌȡȠȠȡȓȗİIJĮȚȖȚĮȠȚțȚĮțȒȤȡȒıȘ
țĮȚʌĮȡȩȝȠȚİȢİijĮȡȝȠȖȑȢȩʌȦȢ
‡ ȈİȤȫȡȠȣȢțȠȣȗȓȞĮȢʌȡȠıȦʌȚțȠȪıİ
țĮIJĮıIJȒȝĮIJĮȖȡĮijİȓĮțĮȚȐȜȜĮİȡȖĮıȚĮțȐ
ʌİȡȚȕȐȜȜȠȞIJĮ
‡ ǹȖȡȠȚțȓİȢ
‡ ǹʌȩʌİȜȐIJİȢıİȟİȞȠįȠȤİȓĮȝȠIJȑȜțĮȚȐȜȜĮ
ʌİȡȚȕȐȜȜȠȞIJĮıIJȑȖĮıȘȢ
‡ ȆĮȞıȚȩȞȖȚĮȪʌȞȠțĮȚʌȡȦȚȞȩ
ƴLjǍǂǎǕNJNjƾǓǔLjǍdžNJǟǔdžNJǓ
ǼʌȚțȠȚȞȦȞȒıIJİȝİȑȞĮȞİȟȠȣıȚȠįȠIJȘȝȑȞȠIJİȤȞȚțȩ
İȖțĮIJȐıIJĮıȘȢȖȚĮIJȘȞİȖțĮIJȐıIJĮıȘĮȣIJȒȢIJȘȢ
ȝȠȞȐįĮȢ
ǼʌȚțȠȚȞȦȞȒıIJİȝİȑȞĮȞİȟȠȣıȚȠįȠIJȘȝȑȞȠIJİȤȞȚțȩ
ıȣȞIJȒȡȘıȘȢȖȚĮIJȘȞİʌȚıțİȣȒȒıȣȞIJȒȡȘıȘĮȣIJȒȢ
IJȘȢȝȠȞȐįĮȢ
‡ ǾʌȡȓȗĮʌȠȣĮʌĮȚIJİȓIJĮȚȖȚĮIJȘȞIJȡȠijȠįȠıȓĮ
ʌȡȑʌİȚȞĮıȣȞįİșİȓțĮȚIJİșİȓıİȜİȚIJȠȣȡȖȓĮ
ĮʌȩİȟȠȣıȚȠįȠIJȘȝȑȞȠIJİȤȞȚțȩ
‡ ǾıȣıțİȣȒĮȣIJȒįİȞʌȡȠȠȡȓȗİIJĮȚȖȚĮ
ȤȡȒıȘĮʌȩȐIJȠȝĮıȣȝʌİȡȚȜĮȝȕĮȞȠȝȑȞȦȞ
IJȦȞʌĮȚįȚȫȞȝİȝİȚȦȝȑȞİȢıȦȝĮIJȚțȑȢ
ĮȚıșȘIJȘȡȚĮțȑȢȒʌȞİȣȝĮIJȚțȑȢȚțĮȞȩIJȘIJİȢȒ
ȑȜȜİȚȥȘİȝʌİȚȡȓĮȢțĮȚȖȞȫıȘȢİțIJȩȢțĮȚĮȞ
İʌȚȕȜȑʌȠȞIJĮȚȒȑȤȠȣȞȜȐȕİȚȠįȘȖȓİȢıȤİIJȚțȐ
ȝİIJȘȤȡȒıȘIJȘȢıȣıțİȣȒȢĮʌȩȐIJȠȝȠ
ȣʌİȪșȣȞȠȖȚĮIJȘȞĮıijȐȜİȚȐIJȠȣȢ
‡ ȉĮȝȚțȡȐʌĮȚįȚȐʌȡȑʌİȚȞĮİʌȠʌIJİȪȠȞIJĮȚ
ȫıIJİȞĮİȟĮıijĮȜȓȗİIJĮȚȩIJȚįİȞʌĮȓȗȠȣȞȝİ
IJȠțȜȚȝĮIJȚıIJȚțȩ
‡ ǼȐȞIJȠțĮȜȫįȚȠIJȡȠijȠįȠıȓĮȢʌȡȑʌİȚȞĮ
ĮȞIJȚțĮIJĮıIJĮșİȓʌȡȑʌİȚȞĮĮȞIJȚțĮIJĮıIJĮșİȓ
ȝȩȞȠĮʌȩİȟȠȣıȚȠįȠIJȘȝȑȞȠIJİȤȞȚțȩ
‡ ȅȚİȡȖĮıȓİȢİȖțĮIJȐıIJĮıȘȢʌȡȑʌİȚȞĮ
İțIJİȜȠȪȞIJĮȚıȪȝijȦȞĮȝİIJĮİșȞȚțȐ
ʌȡȩIJȣʌĮțĮȜȦįȓȦıȘȢțĮȚIJȠȣȢțĮȞȩȞİȢIJȘȢ
ȣʌȘȡİıȓĮȢʌĮȡȠȤȒȢȘȜİțIJȡȚıȝȠȪȝȩȞȠĮʌȩ
İȟȠȣıȚȠįȠIJȘȝȑȞȠIJİȤȞȚțȩ
‡ ȉĮȝȚțȡȐʌĮȚįȚȐʌȡȑʌİȚȞĮİʌȠʌIJİȪȠȞIJĮȚȫıIJİȞĮ
İȟĮıijĮȜȓȗİIJĮȚȩIJȚįİȞʌĮȓȗȠȣȞȝİIJȠțȜȚȝĮIJȚıIJȚțȩ
‡ ǼȐȞʌȡȩțİȚIJĮȚȞĮȝİIJĮijȑȡİIJİıİȐȜȜȘșȑıȘ
ȒȞĮĮʌȠȡȡȓȥİIJİIJȘȝȠȞȐįĮȝȩȞȠȑȞĮȢ
İʌĮȖȖİȜȝĮIJȓĮȢIJİȤȞȚțȩȢȝʌȠȡİȓȞĮĮȞĮȜȐȕİȚ
ĮȣIJȒIJȘȞİȡȖĮıȓĮ
‡ ǼʌȚțȠȚȞȦȞȒıIJİȝİȑȞĮȞİȟȠȣıȚȠįȠIJȘȝȑȞȠIJİȤȞȚțȩ
İȖțĮIJȐıIJĮıȘȢȖȚĮIJȘȞİȖțĮIJȐıIJĮıȘĮȣIJȠȪIJȠȣ
țȜȚȝĮIJȚıIJȚțȠȪ
‡ ȆȡȠıȑȟIJİȞĮȝȘȞʌȚĮıIJȠȪȞIJĮįȐțIJȣȜȐ
ıĮȢıIJĮʌIJİȡȪȖȚĮIJȠȣĮȞİȝȚıIJȒȡĮțĮIJȐIJȘȞ
ʌȡȠıĮȡȝȠȖȒIJȦȞțȐșİIJȦȞʌİȡıȓįȦȞ
‡ ǼʌȚțȠȚȞȦȞȒıIJİȝİȑȞĮȞİȟȠȣıȚȠįȠIJȘȝȑȞȠIJİȤȞȚțȩ
ıȣȞIJȒȡȘıȘȢȖȚĮIJȘȞİʌȚıțİȣȒȒıȣȞIJȒȡȘıȘĮȣIJȒȢ
IJȘȢȝȠȞȐįĮȢ
‡ ǼȐȞIJȠțĮȜȫįȚȠIJȡȠijȠįȠıȓĮȢʌȡȑʌİȚȞĮ
ĮȞIJȚțĮIJĮıIJĮșİȓʌȡȑʌİȚȞĮĮȞIJȚțĮIJĮıIJĮșİȓȝȩȞȠĮʌȩ
İȟȠȣıȚȠįȠIJȘȝȑȞȠIJİȤȞȚțȩ
‡ ȅȚİȡȖĮıȓİȢİȖțĮIJȐıIJĮıȘȢʌȡȑʌİȚȞĮİțIJİȜȠȪȞIJĮȚ
ıȪȝijȦȞĮȝİIJĮİșȞȚțȐʌȡȩIJȣʌĮțĮȜȦįȓȦıȘȢȝȩȞȠ
ĮʌȩİȟȠȣıȚȠįȠIJȘȝȑȞȠIJİȤȞȚțȩ
43
ȆȡȠijȣȜȐȟİȚȢĮıijĮȜİȓĮȢ
ȈIJȠİȖȤİȚȡȓįȚȠĮȣIJȩșĮȕȡİȓIJİʌȠȜȜȑȢȤȡȒıȚȝİȢıȣȝȕȠȣȜȑȢ
ȖȚĮIJȠıȦıIJȩIJȡȩʌȠȤȡȒıȘȢțĮȚıȣȞIJȒȡȘıȘȢIJȠȣ
țȜȚȝĮIJȚıIJȚțȠȪıĮȢȂİȜȓȖȘʌȡȠȜȘʌIJȚțȒijȡȠȞIJȓįĮİț
ȝȑȡȠȣȢıĮȢȝʌȠȡİȓIJİȞĮİȟȠȚțȠȞȠȝȒıİIJİȤȡȩȞȠțĮȚȤȡȒȝĮ
țĮIJȐIJȘįȚȐȡțİȚĮȗȦȒȢIJȠȣțȜȚȝĮIJȚıIJȚțȠȪıĮȢĬĮȕȡİȓIJİ
ʌȠȜȜȑȢĮʌĮȞIJȒıİȚȢıİțȠȚȞȐʌȡȠȕȜȒȝĮIJĮıIJȠȞʌȓȞĮțĮ
ıȣȝȕȠȣȜȫȞĮȞIJȚȝİIJȫʌȚıȘȢʌȡȠȕȜȘȝȐIJȦȞıIJȘıİȜȓįĮ
ǼȐȞįȚĮȕȐıİIJİʌȡȫIJĮIJȠȞʌȓȞĮțĮıȣȝȕȠȣȜȫȞ
ĮȞIJȚȝİIJȫʌȚıȘȢʌȡȠȕȜȘȝȐIJȦȞİȞįȑȤİIJĮȚȞĮȝȘȤȡİȚȐȗİIJĮȚ
ȞĮțĮȜȑıİIJİȖȚĮıȑȡȕȚȢ
ȅȚıȘȝĮıȓİȢIJȦȞıȣȝȕȩȜȦȞʌȠȣȤȡȘıȚȝȠʌȠȚȠȪȞIJĮȚıİ
ĮȣIJȩIJȠİȖȤİȚȡȓįȚȠijĮȓȞȠȞIJĮȚʌĮȡĮțȐIJȦ
Ǒǒǐǔǐǘƿ
ȊʌȠįİȚțȞȪİȚʌȜȘȡȠijȠȡȓİȢıȤİIJȚțȐȝİIJȘȞ
ʌȡȠıȦʌȚțȒıĮȢĮıijȐȜİȚĮțĮȚȖȚĮIJȠȞIJȡȩʌȠ
ĮʌȠijȣȖȒȢʌȡȩțȜȘıȘȢȗȘȝȚȐȢıIJȘıȣıțİȣȒ
ǔǖǍǃǐǖnjƾǓNjǂNJǑnjLjǒǐǗǐǒǀdžǓ
ȉȠıȪȝȕȠȜȠĮȣIJȩȣʌȠįİȚțȞȪİȚıȣȝȕȠȣȜȑȢțĮȚ
ʌȜȘȡȠijȠȡȓİȢȖȚĮIJȘȤȡȒıȘIJȘȢıȣıțİȣȒȢ
ǑdžǒNJǃǂnjnjǐǎǕNJNjƿǔǖǍǃǐǖnjƿ
ȉȠıȪȝȕȠȜȠĮȣIJȩȣʌȠįİȚțȞȪİȚıȣȝȕȠȣȜȑȢțĮȚʌȜȘȡȠijȠȡȓİȢ
ȖȚĮIJȘȞȠȚțȠȞȠȝȚțȒțĮȚȠȚțȠȜȠȖȚțȒȤȡȒıȘIJȘȢıȣıțİȣȒȢ
ȉȠıȪȝȕȠȜȠĮȣIJȩȣʌȠįİȚțȞȪİȚȩIJȚįİȞʌȡȑʌİȚȞĮ
țȐȞİIJİʌȠIJȑIJȘȞİȞȑȡȖİȚĮĮȣIJȒ
ȃĮțȐȞİIJİʌȐȞIJĮIJȘȞİȞȑȡȖİȚĮĮȣIJȒ
ȈȘȝĮȞIJȚțȑȢıȘȝİȚȫıİȚȢ
ȂȘșȑıİIJİIJȘȝȠȞȐįĮıİȜİȚIJȠȣȡȖȓĮȝİIJȘȞ
ȠȡȚȗȩȞIJȚĮʌİȡıȓįĮıIJȘȞțȜİȚıIJȒșȑıȘ
ȂȘșȑıİIJİIJȘȝȠȞȐįĮıİȜİȚIJȠȣȡȖȓĮȤȦȡȓȢIJȠ
ijȓȜIJȡȠĮȑȡĮ
ǑǒǐdžNJDžǐǑǐǀLjǔLj
ǼȐȞʌȡȠıȑȟİIJİțȐʌȠȚĮȝȘijȣıȚȠȜȠȖȚțȒ
țĮIJȐıIJĮıȘȩʌȦȢȝȣȡȦįȚȐțĮȝȑȞȠȣ
ĮʌİȞİȡȖȠʌȠȚȒıIJİIJȘȞȘȜİțIJȡȚțȒ
IJȡȠijȠįȠıȓĮIJȠȣțȜȚȝĮIJȚıIJȚțȠȪțĮȚ
İʌȚțȠȚȞȦȞȒıIJİȝİȑȞĮȞĮȞIJȚʌȡȩıȦʌȠ
ıȑȡȕȚȢIJȘȢ(OHFWUROX[ǼȐȞıȣȞİȤȚıIJİȓ
ĮȣIJȒȘȝȘijȣıȚȠȜȠȖȚțȒțĮIJȐıIJĮıȘIJȠ
țȜȚȝĮIJȚıIJȚțȩȝʌȠȡİȓȞĮȣʌȠıIJİȓȕȜȐȕȘȒ
ĮțȩȝĮțĮȚȞĮʌȡȠțȜȘșİȓȘȜİțIJȡȠʌȜȘȟȓĮȒ
ʌȣȡțĮȖȚȐ
ȂȘȤİȚȡȓȗİıIJİIJȠțȜȚȝĮIJȚıIJȚțȩȝİ
ȕȡİȖȝȑȞĮȤȑȡȚĮȂʌȠȡİȓȞĮʌȡȠțȜȘșİȓ
ȘȜİțIJȡȠʌȜȘȟȓĮ
ȂȘȞțȩȕİIJİȒijșİȓȡİIJİIJȠțĮȜȫįȚȠ
IJȡȠijȠįȠıȓĮȢȒȐȜȜĮțĮȜȫįȚĮǼȐȞıȣȝȕİȓ
ĮȣIJȩȗȘIJȒıIJİȞĮʌȡĮȖȝĮIJȠʌȠȚȘșİȓ
ȘĮȞIJȚțĮIJȐıIJĮıȘȒȘİʌȚıțİȣȒĮʌȩ
İȟȠȣıȚȠįȠIJȘȝȑȞȠIJİȤȞȚțȩ
ȂȘıȣȞįȑİIJİIJȠțȜȚȝĮIJȚıIJȚțȩıİ
ʌȠȜȪʌȡȚȗȠ
ǹʌİȞİȡȖȠʌȠȚȒıIJİIJȘȞȘȜİțIJȡȚțȒ
IJȡȠijȠįȠıȓĮIJȠȣțȜȚȝĮIJȚıIJȚțȠȪİȐȞ
įİȞʌȡȩțİȚIJĮȚȞĮȤȡȘıȚȝȠʌȠȚȘșİȓȖȚĮ
ʌĮȡĮIJİIJĮȝȑȞȠįȚȐıIJȘȝĮǻȚĮijȠȡİIJȚțȐ
ȝʌȠȡİȓȞĮıȣııȦȡİȣIJİȓıțȩȞȘțĮȚȞĮ
ʌȡȠțȜȘșİȓʌȣȡțĮȖȚȐ
ȆȡȚȞĮʌȩIJȠȞțĮșĮȡȚıȝȩIJȠȣ
țȜȚȝĮIJȚıIJȚțȠȪĮʌȠıȣȞįȑıIJİIJȘȞȘȜİțIJȡȚțȒ
IJȡȠijȠįȠıȓĮȖȚĮȞĮĮʌȠijİȣȤșİȓȘ
ʌȚșĮȞȩIJȘIJĮȘȜİțIJȡȠʌȜȘȟȓĮȢ
ǾȘȜİțIJȡȚțȒIJȡȠijȠįȠıȓĮʌȡȑʌİȚȞĮ
ĮȞIJȚıIJȠȚȤİȓıIJȚȢʌȡȠįȚĮȖȡĮijȑȢIJȠȣ
țȜȚȝĮIJȚıIJȚțȠȪıȪȝijȦȞĮȝİIJȠİȖȤİȚȡȓįȚȠ
İȖțĮIJȐıIJĮıȘȢȉĮțȜȚȝĮIJȚıIJȚțȐʌȠȣ
ʌĮȡȑȤȠȞIJĮȚȝİțĮȜȫįȚȠIJȡȠijȠįȠıȓĮȢ
ʌȡȑʌİȚȞĮıȣȞįȑȠȞIJĮȚĮʌİȣșİȓĮȢıİʌȡȓȗĮ
ȝİțĮIJȐȜȜȘȜȠįȚĮțȩʌIJȘĮıijĮȜİȓĮȢȉĮ
țȜȚȝĮIJȚıIJȚțȐʌȠȣıȣȞįȑȠȞIJĮȚĮʌİȣșİȓĮȢ
ȝİIJȠțȪțȜȦȝĮʌȡȑʌİȚȞĮıȣȞįȑȠȞIJĮȚ
ȝİȑȞĮȞțĮIJȐȜȜȘȜȠĮıijĮȜİȚȠįȚĮțȩʌIJȘ
ıȪȝijȦȞĮȝİIJȠİȖȤİȚȡȓįȚȠİȖțĮIJȐıIJĮıȘȢ
ǺİȕĮȚȦșİȓIJİȩIJȚȘȘȜİțIJȡȚțȒIJȡȠijȠįȠıȓĮ
IJȠȣțȜȚȝĮIJȚıIJȚțȠȪİȓȞĮȚıIJĮșİȡȒțĮȚ
ʌȜȘȡȠȓIJȚȢĮʌĮȚIJȒıİȚȢʌȠȣʌĮȡĮIJȓșİȞIJĮȚ
ıIJȠİȖȤİȚȡȓįȚȠİȖțĮIJȐıIJĮıȘȢ
ȆȐȞIJĮȞĮȕİȕĮȚȫȞİıIJİȩIJȚIJȠʌȡȠȧȩȞȑȤİȚ
İȖțĮIJĮıIJĮșİȓȝİțĮIJȐȜȜȘȜȘȖİȓȦıȘ
īȚĮȜȩȖȠȣȢĮıijĮȜİȓĮȢijȡȠȞIJȓıIJİȞĮ
țȜİȓıİIJİIJȠȞĮıijĮȜİȚȠįȚĮțȩʌIJȘʌȡȚȞ
ʌȡĮȖȝĮIJȠʌȠȚȒıİIJİȠʌȠȚĮįȒʌȠIJİİȡȖĮıȓĮ
ıȣȞIJȒȡȘıȘȢȒțĮșĮȡȚıȝȠȪȒȩIJĮȞIJȠ
ʌȡȠȧȩȞįİȞʌȡȩțİȚIJĮȚȞĮȤȡȘıȚȝȠʌȠȚȘșİȓȖȚĮ
ʌĮȡĮIJİIJĮȝȑȞȠįȚȐıIJȘȝĮǾıȣııȦȡİȣȝȑȞȘ
ıțȩȞȘȝʌȠȡİȓȞĮʌȡȠțĮȜȑıİȚʌȣȡțĮȖȚȐȒ
ȘȜİțIJȡȠʌȜȘȟȓĮ
44
ȆȡȠijȣȜȐȟİȚȢĮıijĮȜİȓĮȢ
Ǒǒǐǔǐǘƿ
ǼʌȚȜȑȟIJİIJȘȞʌȚȠțĮIJȐȜȜȘȜȘșİȡȝȠțȡĮıȓĮ
ȂʌȠȡİȓIJİȑIJıȚȞĮİȟȠȚțȠȞȠȝȒıİIJİȘȜİțIJȡȚțȩ
ȡİȪȝĮ
ȂȘȞĮijȒȞİIJİIJĮʌĮȡȐșȣȡĮțĮȚIJȚȢʌȩȡIJİȢ
ĮȞȠȚȤIJȑȢȖȚĮʌȠȜȜȒȫȡĮțĮIJȐIJȘįȚȐȡțİȚĮ
IJȘȢȜİȚIJȠȣȡȖȓĮȢĬĮȑȤİȚȦȢĮʌȠIJȑȜİıȝĮ
ȝİȚȦȝȑȞȘĮʌȩįȠıȘ
ȂȘijȡȐȗİIJİIJȘȞİȓıȠįȠȒȑȟȠįȠIJȠȣĮȑȡĮ
ĬĮȑȤİȚȦȢĮʌȠIJȑȜİıȝĮȝİȚȦȝȑȞȘĮʌȩįȠıȘ
țĮȚșĮʌȡȠțȜȘșȠȪȞįȣıȜİȚIJȠȣȡȖȓİȢ
ĭȣȜȐııİIJİIJĮİȪijȜİțIJĮȣȜȚțȐȝĮțȡȚȐĮʌȩ
IJȚȢȝȠȞȐįİȢıİĮʌȩıIJĮıȘIJȠȣȜȐȤȚıIJȠȞP
ȂʌȠȡİȓȞĮʌȡȠțȜȘșİȓʌȣȡțĮȖȚȐ
ȂȘȞʌĮIJȐIJİİʌȐȞȦıIJȘȞİȟȦIJİȡȚțȒȝȠȞȐįĮ
țĮȚȝȘȞIJȠʌȠșİIJİȓIJİȕĮȡȚȐĮȞIJȚțİȓȝİȞĮ
İʌȐȞȦIJȘȢ
ȂʌȠȡİȓȞĮʌȡȠțȜȘșİȓȕȜȐȕȘȒ
IJȡĮȣȝĮIJȚıȝȩȢ
ȂȘȞİʌȚȤİȚȡȒıİIJİȞĮİʌȚıțİȣȐıİIJİIJȠ
țȜȚȝĮIJȚıIJȚțȩȝȩȞȠȚıĮȢȅȚİıijĮȜȝȑȞİȢ
İʌȚıțİȣȑȢȝʌȠȡİȓȞĮʌȡȠțĮȜȑıȠȣȞ
ȘȜİțIJȡȠʌȜȘȟȓĮȒʌȣȡțĮȖȚȐǼʌȚțȠȚȞȦȞȒıİIJİ
ȝİIJȠİȟȠȣıȚȠįȠIJȘȝȑȞȠțȑȞIJȡȠıȑȡȕȚȢIJȘȢ
ʌİȡȚȠȤȒȢıĮȢ
ȋȡȒıȘ
ǾȑțșİıȘıIJȘȞȐȝİıȘȡȠȒĮȑȡĮĮʌȩIJȠ
țȜȚȝĮIJȚıIJȚțȩȖȚĮʌĮȡĮIJİIJĮȝȑȞȠįȚȐıIJȘȝĮȝʌȠȡİȓ
ȞĮİȓȞĮȚİʌȚțȓȞįȣȞȠȖȚĮIJȘȞȣȖİȓĮıĮȢ
ȂȘȞİțșȑIJİIJİȐIJȠȝĮțĮIJȠȚțȓįȚĮȒijȣIJȐıIJȘȞ
ȐȝİıȘȡȠȒĮȑȡĮȖȚĮʌĮȡĮIJİIJĮȝȑȞȠįȚȐıIJȘȝĮ
ȀĮșĮȡȚıȝȩȢțĮȚıȣȞIJȒȡȘıȘ
ȀĮIJȐIJȠȞțĮșĮȡȚıȝȩIJȘȢȝȠȞȐįĮȢ
ȕİȕĮȚȦșİȓIJİʌȡȫIJĮȩIJȚȘȘȜİțIJȡȚțȒ
IJȡȠijȠįȠıȓĮțĮȚȠĮıijĮȜİȚȠįȚĮțȩʌIJȘȢ
İȓȞĮȚțȜİȚıIJȐ
ȂȘȞĮȖȖȓȗİIJİIJĮȝİIJĮȜȜȚțȐȝȑȡȘIJȘȢȝȠȞȐįĮȢ
țĮIJȐIJȘȞĮijĮȓȡİıȘIJȦȞijȓȜIJȡȦȞȂʌȠȡİȓȞĮ
ʌȡȠțȜȘșȠȪȞIJȡĮȣȝĮIJȚıȝȠȓțĮIJȐIJȠȤİȚȡȚıȝȩ
ĮȚȤȝȘȡȫȞȝİIJĮȜȜȚțȫȞȐțȡȦȞ
ȂȘȤȡȘıȚȝȠʌȠȚİȓIJİȞİȡȩȖȚĮIJȠȞțĮșĮȡȚıȝȩ
IJȠȣİıȦIJİȡȚțȠȪIJȠȣțȜȚȝĮIJȚıIJȚțȠȪǾȑțșİıȘ
ıİȞİȡȩȝʌȠȡİȓȞĮȠįȘȖȒıİȚıİʌȚșĮȞȒ
ȘȜİțIJȡȠʌȜȘȟȓĮ
ȈȑȡȕȚȢ
īȚĮİʌȚıțİȣȑȢțĮȚıȣȞIJȒȡȘıȘİʌȚțȠȚȞȦȞȒıIJİȝİ
IJȠȞİȟȠȣıȚȠįȠIJȘȝȑȞȠĮȞIJȚʌȡȩıȦʌȠIJȠȣıȑȡȕȚȢ
ȂȘȞIJȠʌȠșİIJİȓIJİIJĮȤȑȡȚĮıĮȢȒĮȞIJȚțİȓȝİȞĮ
ȝȑıĮıIJȘȞİȓıȠįȠȒȑȟȠįȠIJȠȣĮȑȡĮȂʌȠȡİȓ
ȞĮʌȡȠțȜȘșİȓIJȡĮȣȝĮIJȚıȝȩȢ
ȂȘȞİțșȑIJİIJİȗȫĮȒijȣIJȐĮʌİȣșİȓĮȢıIJȘ
ȡȠȒIJȠȣĮȑȡĮ
ȂȘȤȡȘıȚȝȠʌȠȚİȓIJİIJȘȝȠȞȐįĮȖȚĮ
ȠʌȠȚȠȞįȒʌȠIJİȐȜȜȠıțȠʌȩȩʌȦȢIJȘ
ıȣȞIJȒȡȘıȘIJȡȠijȓȝȦȞȒIJȠıIJȑȖȞȦȝĮ
ȡȠȪȤȦȞ
ȂȘȞʌȚIJıȚȜȐIJİIJȠțȜȚȝĮIJȚıIJȚțȩȝİȞİȡȩ
ȂʌȠȡİȓȞĮʌȡȠțȜȘșİȓȘȜİțIJȡȠʌȜȘȟȓĮȒ
įȣıȜİȚIJȠȣȡȖȓĮ
ȆȡȚȞĮʌȩIJȘȜİȚIJȠȣȡȖȓĮ
ǼʌȚțȠȚȞȦȞȒıIJİȝİȑȞĮȞİȟİȚįȚțİȣȝȑȞȠIJİȤȞȚțȩ
ȖȚĮIJȘȞİȖțĮIJȐıIJĮıȘ
ȈȣȞįȑıIJİıȦıIJȐIJȠijȚȢIJȡȠijȠįȠıȓĮȢ
ȂȘȤȡȘıȚȝȠʌȠȚİȓIJİijșĮȡȝȑȞȠȒȝȘ
ıȣȝȕĮIJȚțȩțĮȜȫįȚȠIJȡȠijȠįȠıȓĮȢ
ȂȘȞțȐȞİIJİțȠȚȞȒȤȡȒıȘIJȘȢȓįȚĮȢʌȡȓȗĮȢȝİ
ȐȜȜİȢıȣıțİȣȑȢ
ȂȘȤȡȘıȚȝȠʌȠȚİȓIJİțĮȜȫįȚȠʌȡȠȑțIJĮıȘȢ
ȂȘȞȟİțȚȞȐIJİįȚĮțȩʌIJİIJİIJȘȜİȚIJȠȣȡȖȓĮ
ıȣȞįȑȠȞIJĮȢĮʌȠıȣȞįȑȠȞIJĮȢIJȠțĮȜȫįȚȠ
IJȡȠijȠįȠıȓĮȢ
45
ȆİȡȚȖȡĮijȒʌȡȠȧȩȞIJȠȢ
ǼıȦIJİȡȚțȒȝȠȞȐįĮ
ǼȓıȠįȠȢĮȑȡĮ
2
3
5
ǼȟȦIJİȡȚțȒȝȠȞȐįĮ
DzȟȠįȠȢ
ĮȑȡĮ
6
7
8
9
ǼȓıȠįȠȢĮȑȡĮʌȓıȦ
Mode
Fan
Temp
&ORFk
Timer-Off
Swing
Light
Turbo
Timer-On
,IHHO
Eco
ǼȓıȠįȠȢ
ĮȑȡĮ
ʌȜİȣȡȚțȒ
DzȟȠįȠȢ
ĮȑȡĮ
ȂʌȡȠıIJȚȞȩțȐȜȣȝȝĮ
ȉȘȜİȤİȚȡȚıIJȒȡȚȠ
ȌȘijȚĮțȒȠșȩȞȘ
ǺȐıȘIJȘȜİȤİȚȡȚıIJȘȡȓȠȣ
ĭȓȜIJȡȠȣȖȚİȚȞȠȪĮȑȡĮʌȓıȦĮʌȩIJȠijȓȜIJȡȠıțȩȞȘȢ
ȈȦȜȒȞĮȢȥȣțIJȚțȠȪİȐȞįȚĮIJȓșİIJĮȚ
ȆȡȠijȓȜIJȡȠıțȩȞȘȢ
ȈȦȜȒȞĮȢĮʌȠıIJȡȐȖȖȚıȘȢİȐȞįȚĮIJȓșİIJĮȚ
ȅȡȚȗȩȞIJȚİȢʌİȡıȓįİȢĮȑȡĮ
ȀĮȜȫįȚȠIJȡȠijȠįȠıȓĮȢİȐȞįȚĮIJȓșİIJĮȚ
ȀȐșİIJİȢʌİȡıȓįİȢĮȑȡĮ
ǺȐıȘıIJȒȡȚȟȘȢ
īİȞȞȒIJȡȚĮȥȣȤȡȠȪʌȜȐıȝĮIJȠȢİȐȞįȚĮIJȓșİIJĮȚ
ȀĮȜȫįȚȠıȪȞįİıȘȢİȐȞįȚĮIJȓșİIJĮȚ
ȀȠȣȝʌȓȤİȚȡȠțȓȞȘIJȠȣİȜȑȖȤȠȣ
ȈȘȝİȓȦıȘ ȅȚʌĮȡĮʌȐȞȦİȚțȩȞİȢİȓȞĮȚȝȩȞȠȖȚĮıțȠʌȠȪȢ
İʌİȟȒȖȘıȘȢ
ȉȠțȜȚȝĮIJȚıIJȚțȩıĮȢİȞįȑȤİIJĮȚȞĮįȚĮijȑȡİȚȜȓȖȠ
ȉȠʌȡĮȖȝĮIJȚțȩıȤȒȝĮȣʌİȡȚıȤȪİȚ
46
ȅșȩȞȘIJȘȢİıȦIJİȡȚțȒȢȝȠȞȐįĮȢ
‡ ǼȐȞijȣȜȐııİIJİIJȠIJȘȜİȤİȚȡȚıIJȒȡȚȠıİșȑıȘʌȠȣ
İȝʌȠįȓȗİȚIJȘıȦıIJȒȝİIJȐįȠıȘıȒȝĮIJȠȢȝʌȠȡİȓ
ȞĮȣʌȐȡȟİȚȝȚĮȤȡȠȞȚțȒțĮșȣıIJȑȡȘıȘȑȦȢțĮȚ
ȜİʌIJȫȞ
ǻȑțIJȘȢ
ıȒȝĮIJȠȢ
DzȞįİȚȟȘ,)HHO
ǹȞȐȕİȚȩIJĮȞİȞİȡȖȠʌȠȚİȓIJĮȚȘȜİȚIJȠȣȡȖȓĮ,)HHO
ǹȓıșȘıȘ
DzȞįİȚȟȘ7XUER
ǹȞȐȕİȚțĮIJȐIJȘȜİȚIJȠȣȡȖȓĮ7XUER
DzȞįİȚȟȘ(FRȅȚțȠȞȠȝȚțȩ
ǹȞȐȕİȚȩIJĮȞİȓȞĮȚİȞİȡȖȠʌȠȚȘȝȑȞȘȘȜİȚIJȠȣȡȖȓĮ(&2
ȅǿȀȅȃȅȂǿȀȅ
DzȞįİȚȟȘșİȡȝȠțȡĮıȓĮȢ
ǼȝijĮȞȓȗİȚIJȚȢȡȣșȝȓıİȚȢșİȡȝȠțȡĮıȓĮȢȩIJĮȞIJȠ
țȜȚȝĮIJȚıIJȚțȩȕȡȓıțİIJĮȚıİȜİȚIJȠȣȡȖȓĮ
DzȞįİȚȟȘȤȡȠȞȠįȚĮțȩʌIJȘ
ǾȑȞįİȚȟȘĮȞȐȕİȚȩIJĮȞȠȤȡȠȞȠįȚĮțȩʌIJȘȢȡȣșȝȓȗİIJĮȚ
ıİ21ǼȞİȡȖȠʌȠȓȘıȘȒțĮȚ2))ǹʌİȞİȡȖȠʌȠȓȘıȘ
DzȞįİȚȟȘ6ZLQJ
ǹȞȐȕİȚȩIJĮȞİȞİȡȖȠʌȠȚİȓIJĮȚȘȜİȚIJȠȣȡȖȓĮ6ZLQJ
ȆĮȜȚȞįȡȩȝȘıȘ
ȉȘȜİȤİȚȡȚıIJȒȡȚȠ
‡ ǵIJĮȞIJȠIJȘȜİȤİȚȡȚıIJȒȡȚȠıIJȑȜȞİȚȑȞĮıȒȝĮ
IJȠıȪȝȕȠȜȠ ĮȞĮȕȠıȕȒȞİȚȖȚĮʌİȡȓʌȠȣ
įİȣIJİȡȩȜİʌIJȠıIJȘȞȠșȩȞȘǾİıȦIJİȡȚțȒ
ȝȠȞȐįĮĮȞĮȖȞȦȡȓȗİȚIJȠıȒȝĮȝİȑȞĮȘȤȘIJȚțȩ
ıȒȝĮȝʌȚʌȩIJĮȞȜĮȝȕȐȞİȚȑȞĮȑȖțȣȡȠıȒȝĮ
Ǒǒǐǔǐǘƿ
‡ ȉȠțȜȚȝĮIJȚıIJȚțȩįİȞșĮȜİȚIJȠȣȡȖȒıİȚĮȞțȠȣȡIJȓȞİȢ
ʌȩȡIJİȢȒȐȜȜĮȣȜȚțȐijȡȐȗȠȣȞIJĮıȒȝĮIJĮĮʌȩIJȠ
IJȘȜİȤİȚȡȚıIJȒȡȚȠʌȡȠȢIJȘȞİıȦIJİȡȚțȒȝȠȞȐįĮ
‡ ǹʌȠijȪȖİIJİIJȘȞʌIJȫıȘȣȖȡȫȞİʌȐȞȦıIJȠ
IJȘȜİȤİȚȡȚıIJȒȡȚȠȆȠIJȑȝȘȞİțșȑIJİIJİIJȠ
IJȘȜİȤİȚȡȚıIJȒȡȚȠıİȐȝİıȠȘȜȚĮțȩijȦȢȒșİȡȝȩIJȘIJĮ
‡ ǼȐȞȠįȑțIJȘȢȣʌȑȡȣșȡȦȞıȘȝȐIJȦȞıIJȘȞ
İıȦIJİȡȚțȒȝȠȞȐįĮİȓȞĮȚİțIJİșİȚȝȑȞȠȢıİȐȝİıȠ
ȘȜȚĮțȩijȦȢIJȠțȜȚȝĮIJȚıIJȚțȩİȞįȑȤİIJĮȚȞĮȝȘ
ȜİȚIJȠȣȡȖȒıİȚıȦıIJȐȋȡȘıȚȝȠʌȠȚȒıIJİțȠȣȡIJȓȞİȢ
ȖȚĮȞĮĮʌȠIJȡȑȥİIJİIJȠȘȜȚĮțȩijȦȢȞĮʌȑijIJİȚİʌȐȞȦ
ıIJȠįȑțIJȘ
‡ ǼȐȞȐȜȜİȢȘȜİțIJȡȚțȑȢıȣıțİȣȑȢİʌȘȡİȐȗȠȣȞ
IJȠIJȘȜİȤİȚȡȚıIJȒȡȚȠȝİIJĮțȚȞȒıIJİIJȚȢıȣıțİȣȑȢȒ
İʌȚțȠȚȞȦȞȒıIJİȝİIJȠȞIJȠʌȚțȩĮȞIJȚʌȡȩıȦʌȠ
ȆȫȢȞĮȤȡȘıȚȝȠʌȠȚİȓIJİIJȠIJȘȜİȤİȚȡȚıIJȒȡȚȠ
ȉȠʌȠșȑIJȘıȘĮȞIJȚțĮIJȐıIJĮıȘȝʌĮIJĮȡȚȫȞ
‡ ȈIJȡȑȥIJİIJȠIJȘȜİȤİȚȡȚıIJȒȡȚȠʌȡȠȢIJȠįȑțIJȘ
ıȒȝĮIJȠȢIJȘȢİıȦIJİȡȚțȒȢȝȠȞȐįĮȢ
‡ ȈȪȡİIJİIJȠțȐȜȣȝȝĮIJȠȣįȚĮȝİȡȓıȝĮIJȠȢȝʌĮIJĮȡȚȫȞ
ȖȚĮȞĮIJȠĮijĮȚȡȑıİIJİțĮȚIJȠʌȠșİIJȒıIJİįȪȠȞȑİȢ
ĮȜțĮȜȚțȑȢȝʌĮIJĮȡȓİȢ[$$$9ROWĭȡȠȞIJȓıIJİ
ȞĮIJȚȢIJȠʌȠșİIJȒıİIJİıȦıIJȐıȪȝijȦȞĮȝİIJȘȞ
ʌȠȜȚțȩIJȘIJĮȒ
‡ ǺİȕĮȚȦșİȓIJİȩIJȚįİȞȣʌȐȡȤȠȣȞİȝʌȩįȚĮʌȠȣ
ȝʌȠȡİȓȞĮʌĮȡİȝʌȠįȓıȠȣȞIJȠıȒȝĮ
ĬȑıȘIJȠȣIJȘȜİȤİȚȡȚıIJȘȡȓȠȣ
‡ ȈȪȡİIJİʌȐȜȚıIJȘșȑıȘIJȠȣIJȠțȐȜȣȝȝĮIJȠȣ
įȚĮȝİȡȓıȝĮIJȠȢȝʌĮIJĮȡȚȫȞ
ǔǖǍǃǐǖnjƾǓNjǂNJǑnjLjǒǐǗǐǒǀdžǓ
‡ ȀĮIJȐIJȘȞĮȜȜĮȖȒIJȦȞȝʌĮIJĮȡȚȫȞȝȘ
ȤȡȘıȚȝȠʌȠȚİȓIJİʌĮȜȚȑȢȒįȚĮijȠȡİIJȚțȠȪIJȪʌȠȣ
ȝʌĮIJĮȡȓİȢįȚĮijȠȡİIJȚțȐȝʌȠȡİȓȞĮʌȡȠțȜȘșȠȪȞ
ʌȡȠȕȜȒȝĮIJĮıIJȠIJȘȜİȤİȚȡȚıIJȒȡȚȠ
P
Mode
Fan
Temp
&ORFk
Timer-Off
Swing
Light
Turbo
Timer-On
,IHHO
Eco
‡ ĭȣȜȐııİIJİIJȠIJȘȜİȤİȚȡȚıIJȒȡȚȠıİıȘȝİȓȠȩʌȠȣ
IJȠıȒȝĮIJȠȣȝʌȠȡİȓȞĮijIJȐıİȚIJȠįȑțIJȘIJȘȢ
İıȦIJİȡȚțȒȢȝȠȞȐįĮȢİʌȚIJȡȑʌİIJĮȚȝȚĮȝȑȖȚıIJȘ
ĮʌȩıIJĮıȘP
‡ ǵIJĮȞİʌȚȜȑȖİIJİIJȘȜİȚIJȠȣȡȖȓĮȤȡȠȞȠįȚĮțȩʌIJȘ
IJȠIJȘȜİȤİȚȡȚıIJȒȡȚȠȝİIJĮįȓįİȚĮȣIJȩȝĮIJĮȑȞĮ
ıȒȝĮıIJȘȞİıȦIJİȡȚțȒȝȠȞȐįĮIJȘȞțĮșȠȡȚıȝȑȞȘ
ȫȡĮ
‡ ǼȐȞIJȠIJȘȜİȤİȚȡȚıIJȒȡȚȠįİȞʌȡȩțİȚIJĮȚȞĮ
ȤȡȘıȚȝȠʌȠȚȘșİȓȖȚĮȝİȖȐȜȠȤȡȠȞȚțȩįȚȐıIJȘȝĮ
ĮijĮȚȡȑıIJİIJȚȢȝʌĮIJĮȡȓİȢțĮșȫȢȠȚʌĮȜȚȑȢȝʌĮIJĮȡȓİȢ
ȝʌȠȡİȓȞĮʌĮȡȠȣıȚȐıȠȣȞįȚĮȡȡȠȒȒįȚȐȕȡȦıȘțĮȚ
ȞĮʌȡȠțĮȜȑıȠȣȞȕȜȐȕȘıIJȠIJȘȜİȤİȚȡȚıIJȒȡȚȠ
‡ ǾįȚȐȡțİȚĮȗȦȒȢIJȦȞȝʌĮIJĮȡȚȫȞȝİțĮȞȠȞȚțȒȤȡȒıȘ
İȓȞĮȚʌİȡȓʌȠȣȑȟȚȝȒȞİȢ
‡ ǼȐȞIJȠIJȘȜİȤİȚȡȚıIJȒȡȚȠįİȞȜİȚIJȠȣȡȖİȓțĮȞȠȞȚțȐ
ĮijĮȚȡȑıIJİțĮȚIJȠʌȠșİIJȒıIJİʌȐȜȚIJȚȢȝʌĮIJĮȡȓİȢ
ǼȐȞıȣȞİȤȚıIJİȓȘȝȘijȣıȚȠȜȠȖȚțȒȜİȚIJȠȣȡȖȓĮ
ĮȞIJȚțĮIJĮıIJȒıIJİIJȚȢȝʌĮIJĮȡȓİȢȝİțĮȚȞȠȪȡȖȚİȢ
47
ȆİȡȚȖȡĮijȒIJȘȜİȤİȚȡȚıIJȘȡȓȠȣ
ȆȜȒțIJȡȠ7XUER
ȆĮIJȒıIJİĮȣIJȩIJȠʌȜȒțIJȡȠıIJȘȜİȚIJȠȣȡȖȓĮ&22/ȌȊȄǾ
Ȓ+($7ĬǼȇȂǹȃȈǾȖȚĮȞĮȝİIJĮȕİȓȠĮȞİȝȚıIJȒȡĮȢ
ıIJȘȜİȚIJȠȣȡȖȓĮȣȥȘȜȒȢIJĮȤȪIJȘIJĮȢ7XUERțĮȚȞĮ
ȜİȚIJȠȣȡȖȒıİȚIJȠțȜȚȝĮIJȚıIJȚțȩıIJȘȝȑȖȚıIJȘȚıȤȪ
ȆĮIJȒıIJİIJȠʌȐȜȚȖȚĮȞĮĮțȣȡȦșİȓȘȜİȚIJȠȣȡȖȓĮĮȣIJȒ
ȆȜȒțIJȡȠ;)DQ
ȆĮIJȒıIJİIJȠʌȜȒțIJȡȠ;)DQȖȚĮȞĮİȞİȡȖȠʌȠȚȒıİIJİIJȠȞ
ǹȣIJȩȝĮIJȠțĮșĮȡȚıȝȩǹijȠȪĮʌİȞİȡȖȠʌȠȚȘșİȓȘȝȠȞȐįĮ
ȠİıȦIJİȡȚțȩȢĮȞİȝȚıIJȒȡĮȢșĮıȣȞİȤȓıİȚȞĮȜİȚIJȠȣȡȖİȓ
İʌȓȜİʌIJȐȖȚĮȞĮıIJİȖȞȫıİȚIJȘȞİıȦIJİȡȚțȒȝȠȞȐįĮ
țĮȚȞĮĮʌȠijİȣȤșİȓȘĮȞȐʌIJȣȟȘȕĮțIJȘȡȓȦȞțĮȚȝȣțȒIJȦȞ
ȆȜȒțIJȡȠ7LPHU2Q
ȆĮIJȒıIJİĮȣIJȩIJȠʌȜȒțIJȡȠȖȚĮȞĮȡȣșȝȓıİIJİIJȘȞȫȡĮ
ȑȞĮȡȟȘȢ
0RGH
/LJKW
)DQ
7XUER
;)DQ
7LPHU2Q
7HPS
7LPHU2II
&ORFN
6ZLQJ
,)HHO
(FR
ȆȜȒțIJȡȠ212))
ȆĮIJȒıIJİĮȣIJȩIJȠʌȜȒțIJȡȠȖȚĮȞĮİȞİȡȖȠʌȠȚȒıİIJİȒȞĮ
ĮʌİȞİȡȖȠʌȠȚȒıİIJİIJȠțȜȚȝĮIJȚıIJȚțȩ
ȆȜȒțIJȡȠ0RGH
ȆĮIJȫȞIJĮȢĮȣIJȩIJȠʌȜȒțIJȡȠȝʌȠȡİȓIJİȞĮİʌȚȜȑȟİIJİ
įȚĮįȠȤȚțȐIJȘȜİȚIJȠȣȡȖȓĮ$872ǹȊȉȅȂǹȉǾ
'(+80,',)<ǹĭȊīȇǹȃȈǾ)$1ǹȃǼȂǿȈȉǾȇǹȈ
&22/ȌȊȄǾțĮȚ+($7ĬǼȇȂǹȃȈǾIJȠȝȠȞIJȑȜȠ
ȝȩȞȠ&22/ȌȊȄǾįİȞįȚĮșȑIJİȚIJȘȜİȚIJȠȣȡȖȓĮ+($7
ĬǼȇȂǹȃȈǾ
ǾȜİȚIJȠȣȡȖȓĮ$872ǹȊȉȅȂǹȉǾİȓȞĮȚȘ
ʌȡȠİʌȚȜİȖȝȑȞȘțĮIJȐIJȘȞİȞİȡȖȠʌȠȓȘıȘ
ȈIJȘȜİȚIJȠȣȡȖȓĮ$872ǹȊȉȅȂǹȉǾȘĮȡȤȚțȒIJȚȝȒ
įİȞİȝijĮȞȓȗİIJĮȚțĮȚșĮȜİȚIJȠȣȡȖȒıİȚıIJȘȞİʌȚșȣȝȘIJȒ
șİȡȝȠțȡĮıȓĮ
ȈIJȘȜİȚIJȠȣȡȖȓĮ+($7ĬǼȇȂǹȃȈǾȘĮȡȤȚțȒIJȚȝȒ
İȓȞĮȚƒ&
ȈIJȚȢȐȜȜİȢȜİȚIJȠȣȡȖȓİȢȘĮȡȤȚțȒIJȚȝȒİȓȞĮȚƒ&
$872ǹȊȉȅȂǹȉǾ'(+80,',)<ǹĭȊīȇǹȃȈǾ)$1ǹȃǼȂǿȈȉǾȇǹȈ&22/ȌȊȄǾ+($7ĬǼȇȂǹȃȈǾ
ȆȜȒțIJȡȠ/LJKW
ȆĮIJȒıIJİĮȣIJȩIJȠʌȜȒțIJȡȠȖȚĮȞĮİȞİȡȖȠʌȠȚȘșȠȪȞ
ȒȞĮĮʌİȞİȡȖȠʌȠȚȘșȠȪȞȠȚİȞįİȚțIJȚțȑȢȜȣȤȞȓİȢIJȘȢ
İıȦIJİȡȚțȒȢȝȠȞȐįĮȢ
ǾțĮȞȠȞȚțȒțĮIJȐıIJĮıȘțĮIJȐIJȘȞȑȞĮȡȟȘİȓȞĮȚȞĮİȓȞĮȚ
İȞİȡȖȠʌȠȚȘȝȑȞİȢ
ȆȜȒțIJȡȠ)DQ
ȆĮIJȫȞIJĮȢĮȣIJȩIJȠʌȜȒțIJȡȠȝʌȠȡİȓIJİȞĮİʌȚȜȑȟİIJİ
įȚĮįȠȤȚțȐIJȘȞǹȣIJȩȝĮIJȘȋĮȝȘȜȒȂİıĮȓĮțĮȚȊȥȘȜȒ
IJĮȤȪIJȘIJĮ
ǵIJĮȞİȞİȡȖȠʌȠȚİȓIJĮȚȘȝȠȞȐįĮȘǹȣIJȩȝĮIJȘIJĮȤȪIJȘIJĮ
ĮȞİȝȚıIJȒȡĮİȓȞĮȚȘʌȡȠİʌȚȜİȖȝȑȞȘ
ȈIJȘȜİȚIJȠȣȡȖȓĮ'(+80,',)<ǹĭȊīȇǹȃȈǾȘ
IJĮȤȪIJȘIJĮĮȞİȝȚıIJȒȡĮİȓȞĮȚȡȣșȝȚıȝȑȞȘıIJȘȋĮȝȘȜȒ
IJĮȤȪIJȘIJĮ
48
ȆȜȒțIJȡȠ7LPHU2II
ȆĮIJȒıIJİĮȣIJȩIJȠʌȜȒțIJȡȠȖȚĮȞĮȡȣșȝȓıİIJİIJȘȞȫȡĮ
ȜȒȟȘȢ
ȆȜȒțIJȡȠ6ZLQJ
ȆĮIJȫȞIJĮȢĮȣIJȩIJȠʌȜȒțIJȡȠȘʌİȡıȓįĮʌĮȜȚȞįȡȠȝİȓ
ĮȣIJȩȝĮIJĮʌȐȞȦțĮȚțȐIJȦȆĮIJȫȞIJĮȢIJȠʌȐȜȚ
ĮțȣȡȫȞİIJĮȚȘȜİȚIJȠȣȡȖȓĮțĮȚȘʌİȡıȓįĮʌĮȡĮȝȑȞİȚıIJȘȞ
IJİȜİȣIJĮȓĮIJȘȢșȑıȘ
ȆȜȒțIJȡȠ,)HHO
ȆĮIJȫȞIJĮȢĮȣIJȩIJȠʌȜȒțIJȡȠIJȠIJȘȜİȤİȚȡȚıIJȒȡȚȠ
ĮʌȠıIJȑȜȜİȚIJȚȢʌȜȘȡȠijȠȡȓİȢșİȡȝȠțȡĮıȓĮȢıIJȘȞ
İıȦIJİȡȚțȒȝȠȞȐįĮțȐșİȜİʌIJȐǾȝȠȞȐįĮȜİȚIJȠȣȡȖİȓ
ȖȚĮȞĮİʌȚIJȪȤİȚIJȘȡȣșȝȚıȝȑȞȘșİȡȝȠțȡĮıȓĮʌȠȣ
ȣʌȐȡȤİȚıIJȘșȑıȘIJȠȣIJȘȜİȤİȚȡȚıIJȘȡȓȠȣȆĮIJȒıIJİIJȠ
ʌȐȜȚȖȚĮȞĮĮțȣȡȦșİȓȘȜİȚIJȠȣȡȖȓĮĮȣIJȒ
ȆȜȒțIJȡȠȡȪșȝȚıȘȢ
ǼȝʌȡȩȢ
ȆȓıȦ
ȆĮIJȒıIJİIJȠʌȜȒțIJȡȠ ȖȚĮȞĮĮȣȟȘșİȓȘȡȪșȝȚıȘIJȘȢ
șİȡȝȠțȡĮıȓĮȢ
ȆĮIJȒıIJİIJȠʌȜȒțIJȡȠ ȖȚĮȞĮȝİȚȦșİȓȘȡȪșȝȚıȘIJȘȢ
șİȡȝȠțȡĮıȓĮȢ
ȈIJȚȢȜİȚIJȠȣȡȖȓİȢ7LPHU2Q2IIȋȡȠȞȠįȚĮțȩʌIJȘȢ
İȞİȡȖȠʌȠȓȘıȘȢĮʌİȞİȡȖȠʌȠȓȘıȘȢȒ&ORFNȇȠȜȩȚ
ȤȡȘıȚȝȠʌȠȚȒıIJİĮȣIJȐIJĮʌȜȒțIJȡĮȖȚĮȞĮȡȣșȝȓıİIJİIJȠ
ȡȠȜȩȚȒIJȠȤȡȠȞȠįȚĮțȩʌIJȘ
ȆȜȒțIJȡȠ&ORFN
ȆĮIJȫȞIJĮȢĮȣIJȩIJȠʌȜȒțIJȡȠIJȠıȪȝȕȠȜȠȡȠȜȠȖȚȠȪ
ĮȞĮȕȠıȕȒȞİȚȂʌȠȡİȓIJİȞĮʌĮIJȒıİIJİIJĮʌȜȒțIJȡĮ
ȡȪșȝȚıȘȢ țĮȚ ȖȚĮȞĮȡȣșȝȓıİIJİIJȘȞȫȡĮʌȠȣșȑȜİIJİ
ȆȜȒțIJȡȠ7HPSĬİȡȝȠțȡĮıȓĮ
ȆĮIJȒıIJİĮȣIJȩIJȠʌȜȒțIJȡȠȖȚĮȞĮĮȜȜȐȟİIJİIJȘȞȠșȩȞȘIJȘȢ
İıȦIJİȡȚțȒȢȝȠȞȐįĮȢĮʌȩIJȘȡȣșȝȚıȝȑȞȘșİȡȝȠțȡĮıȓĮ
ıIJȘșİȡȝȠțȡĮıȓĮįȦȝĮIJȓȠȣ
ȆȜȒțIJȡȠ(FRȅȚțȠȞȠȝȚțȩ
ȆĮIJȒıIJİĮȣIJȩIJȠʌȜȒțIJȡȠȖȚĮȞĮȟİțȚȞȒıİȚȘȜİȚIJȠȣȡȖȓĮ
(FRȅȚțȠȞȠȝȚțȩǹȣIJȩİȓȞĮȚȚįĮȞȚțȩȖȚĮȤȡȒıȘĮʌȩ
IJȠȣȢȤȡȒıIJİȢİȞȫțȠȚȝȠȪȞIJĮȚ
ȆĮIJȒıIJİIJȠʌȐȜȚȖȚĮȞĮĮțȣȡȦșİȓȘȜİȚIJȠȣȡȖȓĮ
ȈȘȝİȓȦıȘ
ȈIJȘȜİȚIJȠȣȡȖȓĮșȑȡȝĮȞıȘȢʌĮIJȒıIJİIJĮʌȜȒțIJȡĮ7HPS
țĮȚ&ORFNȖȚĮȞĮİȞİȡȖȠʌȠȚȒıİIJİIJȘȜİȚIJȠȣȡȖȓĮIJȘȢ
șȑȡȝĮȞıȘȢIJȘȢİıȦIJİȡȚțȒȢșİȡȝȠțȡĮıȓĮȢįȦȝĮIJȓȠȣ
ıIJȠȣȢ°&
DzȞįİȚȟȘȠșȩȞȘȢ
IJȘȜİȤİȚȡȚıIJȘȡȓȠȣ
DzȞįİȚȟȘȝİIJȐįȠıȘȢ
ǼȝijĮȞȓȗİIJĮȚȩIJĮȞIJȠIJȘȜİȤİȚȡȚıIJȒȡȚȠȝİIJĮįȓįİȚ
ıȒȝĮIJĮıIJȘȞİıȦIJİȡȚțȒȝȠȞȐįĮ
DzȞįİȚȟȘIJĮȤȪIJȘIJĮȢĮȞİȝȚıIJȒȡĮ
ǼȝijĮȞȓȗİȚIJȘȞİʌȚȜİȖȝȑȞȘIJĮȤȪIJȘIJĮĮȞİȝȚıIJȒȡĮȝİIJȘȞ
ʌĮȡĮțȐIJȦıİȚȡȐ
DzȞįİȚȟȘ7XUER
ǼȝijĮȞȓȗİIJĮȚȩIJĮȞİʌȚȜȑȖİIJĮȚȘȜİȚIJȠȣȡȖȓĮ7XUER
ȉȠȪȡȝʌȠ
“ ªȋĮȝȘȜȒ©
țĮȚǹȣIJȩȝĮIJȘ
DzȞįİȚȟȘ,)HHO
ǼȝijĮȞȓȗİIJĮȚȩIJĮȞİȞİȡȖȠʌȠȚİȓIJĮȚȘȜİȚIJȠȣȡȖȓĮ,
)HHOǹȓıșȘıȘ
DzȞįİȚȟȘ(FR
ǼȝijĮȞȓȗİIJĮȚȩIJĮȞİʌȚȜȑȖİIJĮȚȘȜİȚIJȠȣȡȖȓĮ(FR
ȅȚțȠȞȠȝȚțȩ
DzȞįİȚȟȘ+HDOWK\
ǼȝijĮȞȓȗİIJĮȚʌĮIJȫȞIJĮȢIJȠʌȜȒțIJȡȠ+HDOWK\
ȆĮIJȒıIJİʌȐȜȚIJȠʌȜȒțIJȡȠ+HDOWK\ȖȚĮȞĮ
İȟĮijĮȞȚıIJİȓ
ȈǾȂǼǿȍȈǾįİȞȣʌȐȡȤİȚĮȣIJȒȘȑȞįİȚȟȘȖȚĮ
IJĮȝȠȞIJȑȜĮȤȦȡȓȢIJȘȜİȚIJȠȣȡȖȓĮȥȣȤȡȠȪ
ʌȜȐıȝĮIJȠȢ
ªȂİıĮȓĮ©
ªȊȥȘȜȒ
ȈIJȘȞǹȣIJȩȝĮIJȘIJĮȤȪIJȘIJĮȝȩȞȠIJȠıȪȝȕȠȜȠ© ª
İȝijĮȞȓȗİIJĮȚ
DzȞįİȚȟȘ6ZLQJ
ǼȝijĮȞȓȗİIJĮȚȩIJĮȞİʌȚȜȑȖİIJĮȚȘȜİȚIJȠȣȡȖȓĮ6ZLQJ
ȆĮȜȚȞįȡȩȝȘıȘ
DzȞįİȚȟȘ;)DQ
ǼȝijĮȞȓȗİIJĮȚȩIJĮȞİȞİȡȖȠʌȠȚİȓIJĮȚȘȜİȚIJȠȣȡȖȓĮ;)DQ
ǹȞİȝȚıIJȒȡĮȢȋʌĮIJȫȞIJĮȢIJĮʌȜȒțIJȡĮ7XUERțĮȚ+HDOWK\
IJĮȣIJȩȤȡȠȞĮȖȚĮIJĮȝȠȞIJȑȜĮȝİȜİȚIJȠȣȡȖȓĮȥȣȤȡȠȪ
ʌȜȐıȝĮIJȠȢȒʌĮIJȫȞIJĮȢIJȠʌȜȒțIJȡȠ;)DQȖȚĮIJĮ
ȝȠȞIJȑȜĮȤȦȡȓȢȜİȚIJȠȣȡȖȓĮȥȣȤȡȠȪʌȜȐıȝĮIJȠȢ
DzȞįİȚȟȘșİȡȝȠțȡĮıȓĮȢ
ǼȝijĮȞȓȗİȚIJȘșİȡȝȠțȡĮıȓĮįȦȝĮIJȓȠȣȒIJȘȡȣșȝȚıȝȑȞȘ
șİȡȝȠțȡĮıȓĮı݃&Ȓƒ)
DzȞįİȚȟȘșİȡȝȠțȡĮıȓĮȢįȦȝĮIJȓȠȣ
ǼȝijĮȞȓȗİIJĮȚȩIJĮȞȘșİȡȝȠțȡĮıȓĮʌȠȣʌȡȠȕȐȜȜİIJĮȚ
ıIJȘȞȠșȩȞȘ/&'İȓȞĮȚȘșİȡȝȠțȡĮıȓĮįȦȝĮIJȓȠȣ
ȂʌȠȡİȓȞĮİȞİȡȖȠʌȠȚȘșİȓĮʌİȞİȡȖȠʌȠȚȘșİȓ
ʌĮIJȫȞIJĮȢIJȠʌȜȒțIJȡȠ7HPS
ǻİȞİȝijĮȞȓȗİIJĮȚıIJȘȜİȚIJȠȣȡȖȓĮ)DQǹȞİȝȚıIJȒȡĮȢ
DzȞįİȚȟȘșİȡȝȠțȡĮıȓĮȢȡȪșȝȚıȘȢ
ǹȞȐȕİȚȩIJĮȞIJȠIJȘȜİȤİȚȡȚıIJȒȡȚȠİȝijĮȞȓȗİȚ
IJȘȡȣșȝȚıȝȑȞȘșİȡȝȠțȡĮıȓĮȂʌȠȡİȓȞĮ
İȞİȡȖȠʌȠȚȘșİȓĮʌİȞİȡȖȠʌȠȚȘșİȓʌĮIJȫȞIJĮȢIJȠ
ʌȜȒțIJȡȠ7HPS
DzȞįİȚȟȘ0RGH
ǼȝijĮȞȓȗİȚIJȘȞIJȡȑȤȠȣıĮȜİȚIJȠȣȡȖȓĮ
ıȣȝʌİȡȚȜĮȝȕĮȞȠȝȑȞȘȢIJȘȢǹȣIJȩȝĮIJȘȢ IJȘȢ
ǹijȪȖȡĮȞıȘȢ IJȠȣǹȞİȝȚıIJȒȡĮ IJȘȢ
ȌȪȟȘȢ țĮȚIJȘȢĬȑȡȝĮȞıȘȢ DzȞįİȚȟȘ7LPHU2Q2II
ǼȝijĮȞȓȗİIJĮȚȩIJĮȞİȞİȡȖȠʌȠȚİȓIJĮȚȘȜİȚIJȠȣȡȖȓĮ
7LPHU2Q2IIȋȡȠȞȠįȚĮțȩʌIJȘȢİȞİȡȖȠʌȠȓȘıȘȢ
ĮʌİȞİȡȖȠʌȠȓȘıȘȢ
ȈǾȂǼǿȍȈǾȉȠȝȠȞIJȑȜȠȌȪȟȘȢįİȞʌĮȡȑȤİȚİʌȚȜȠȖȒ
ĬȑȡȝĮȞıȘȢ
DzȞįİȚȟȘȫȡĮȢ
ǼȝijĮȞȓȗİȚIJȘȞȫȡĮIJȠȣȡȠȜȠȖȚȠȪʌȡȑʌİȚȞĮ
ȑȤİȚȡȣșȝȚıIJİȓȒțĮȚIJȘȞȫȡĮİȞİȡȖȠʌȠȓȘıȘȢ
ĮʌİȞİȡȖȠʌȠȓȘıȘȢIJȠȣȤȡȠȞȠįȚĮțȩʌIJȘ
49
ȆȡȫIJȘȤȡȒıȘ
ǺİȕĮȚȦșİȓIJİȩIJȚȘȝȠȞȐįĮİȓȞĮȚıȣȞįİįİȝȑȞȘțĮȚ
ȣʌȐȡȤİȚįȚĮșȑıȚȝȘȘȜİțIJȡȚțȒIJȡȠijȠįȠıȓĮ
ǺİȕĮȚȦșİȓIJİȩIJȚȑȤİIJİIJȠʌȠșİIJȒıİȚıȦıIJȐIJȚȢ
ȝʌĮIJĮȡȓİȢıIJȠIJȘȜİȤİȚȡȚıIJȒȡȚȠȠȚİȞįİȚțIJȚțȑȢȜȣȤȞȓİȢ
ıIJȠIJȘȜİȤİȚȡȚıIJȒȡȚȠİȓȞĮȚĮȞĮȝȝȑȞİȢ
ȇȣșȝȓıIJİIJȘȞȫȡĮȝİIJĮʌȜȒțIJȡĮȡȪșȝȚıȘȢțĮȚ
İʌȚȕİȕĮȚȫıIJİʌĮIJȫȞIJĮȢIJȠʌȜȒțIJȡȠ&ORFN
ȈIJȡȑȥIJİIJȠIJȘȜİȤİȚȡȚıIJȒȡȚȠʌȡȠȢIJȘȞİıȦIJİȡȚțȒ
ȝȠȞȐįĮțĮȚʌĮIJȒıIJİIJȠʌȜȒțIJȡȠ212))ȖȚĮȞĮ
İȞİȡȖȠʌȠȚȘșİȓȘȝȠȞȐįĮ
ȅʌȡȠİʌȚȜİȖȝȑȞȠȢIJȡȩʌȠȢȜİȚIJȠȣȡȖȓĮȢİȓȞĮȚ$872
ǹȊȉȅȂǹȉǾȂȩȜȚȢİʌȚȜȑȟİIJİIJȠȞIJȡȩʌȠȜİȚIJȠȣȡȖȓĮȢ
ȝİIJȠIJȘȜİȤİȚȡȚıIJȒȡȚȠȠȚıȣȞșȒțİȢȜİȚIJȠȣȡȖȓĮȢ
ĮʌȠșȘțİȪȠȞIJĮȚıIJȘȝȞȒȝȘIJȠȣȝȚțȡȠİʌİȟİȡȖĮıIJȒ
IJȘȢİıȦIJİȡȚțȒȢȝȠȞȐįĮȢȉȘȞİʌȩȝİȞȘijȠȡȐIJȠ
țȜȚȝĮIJȚıIJȚțȩșĮȟİțȚȞȒıİȚȞĮȜİȚIJȠȣȡȖİȓȣʌȩIJȚȢȓįȚİȢ
ıȣȞșȒțİȢȩIJĮȞĮʌȜȐʌĮIJȒıİIJİIJȠʌȜȒțIJȡȠ212))
IJȠȣIJȘȜİȤİȚȡȚıIJȘȡȓȠȣ
ǔǖǍǃǐǖnjƾǓNjǂNJǑnjLjǒǐǗǐǒǀdžǓ
ĮȢ
Ȓȡ
ȌȪ
ȟȘ
ȆȜȒțIJȡĮȡȪșȝȚıȘȢ
ȚıIJ
ȆȜȒțIJȡȠ0RGHȆĮIJȒıIJİIJȠȖȚĮȞĮİʌȚȜȑȟİIJİ$872
ǹȊȉȅȂǹȉǾ
ǹȞ
İȝ
ǹȞȐȕİȚȘȑȞįİȚȟȘșİȡȝȠțȡĮıȓĮȢıIJȘȞȠșȩȞȘIJȘȢ
İıȦIJİȡȚțȒȢȝȠȞȐįĮȢ
ȆĮIJȒıIJİĮȣIJȩIJȠʌȜȒțIJȡȠȖȚĮȞĮİȞİȡȖȠʌȠȚȒıİIJİIJȠ
țȜȚȝĮIJȚıIJȚțȩ
ǾșİȡȝȠțȡĮıȓĮȡȣșȝȓȗİIJĮȚțĮIJȐIJȘȞĮijȪȖȡĮȞıȘ
ȝȑıȦIJȘȢİʌĮȞİȚȜȘȝȝȑȞȘȢİȞİȡȖȠʌȠȓȘıȘȢ
ĮʌİȞİȡȖȠʌȠȓȘıȘȢIJȘȢȜİȚIJȠȣȡȖȓĮȢ&22/ȌȊȄǾ
ȒȝȩȞȠ)$1ǹȃǼȂǿȈȉǾȇǹȈ
ȆȜȒțIJȡȠ212))
ǾȜİȚIJȠȣȡȖȓĮ'(+80,',)<ǹĭȊīȇǹȃȈǾ
ȕĮıȓȗİIJĮȚıIJȘįȚĮijȠȡȐȝİIJĮȟȪIJȘȢȡȣșȝȚıȝȑȞȘȢ
șİȡȝȠțȡĮıȓĮȢțĮȚIJȘȢʌȡĮȖȝĮIJȚțȒȢșİȡȝȠțȡĮıȓĮȢ
įȦȝĮIJȓȠȣ
ȪȟȘ
DzȞĮȡȟȘ
ȁİȚIJȠȣȡȖȓĮĮijȪȖȡĮȞıȘȢ
Ȍ
ǵIJĮȞȑȤİȚİʌȚȜİȖİȓȘȜİȚIJȠȣȡȖȓĮ$872ǹȊȉȅȂǹȉǾIJȠ
țȜȚȝĮIJȚıIJȚțȩșĮİʌȚȜȑȟİȚĮȣIJȩȝĮIJĮIJȘȜİȚIJȠȣȡȖȓĮ&22/
ȌȊȄǾ+($7ĬǼȇȂǹȃȈǾİȐȞįȚĮIJȓșİIJĮȚȒȝȩȞȠ
)$1ǹȃǼȂǿȈȉǾȇǹȈĮȞȐȜȠȖĮȝİIJȘȡȣșȝȚıȝȑȞȘ
șİȡȝȠțȡĮıȓĮȒțĮȚIJȘșİȡȝȠțȡĮıȓĮįȦȝĮIJȓȠȣ
ĮȢ
ǹȣIJȩȝĮIJȘȜİȚIJȠȣȡȖȓĮ
ǵIJĮȞȑȤİȚİʌȚȜİȖİȓȘȜİȚIJȠȣȡȖȓĮ$872
ǹȊȉȅȂǹȉǾȘIJĮȤȪIJȘIJĮĮȞİȝȚıIJȒȡĮțĮȚȘ
șİȡȝȠțȡĮıȓĮİȜȑȖȤİIJĮȚĮȣIJȩȝĮIJĮțĮȚįİȞȝʌȠȡİȓ
ȞĮȡȣșȝȚıIJİȓ
Ȓȡ
ȆȫȢȞĮȤȡȘıȚȝȠʌȠȚİȓIJİIJȠ
IJȘȜİȤİȚȡȚıIJȒȡȚȠ
ǔǖǍǃǐǖnjƾǓNjǂNJǑnjLjǒǐǗǐǒǀdžǓ
ȚıIJ
IJȡȠijȠįȠıȓĮȢȒĮțȩȝĮțĮȚțĮIJȐIJȘȞĮȜȜĮȖȒIJȦȞ
ȝʌĮIJĮȡȚȫȞıIJȠIJȘȜİȤİȚȡȚıIJȒȡȚȠȠȝȚțȡȠİʌİȟİȡȖĮıIJȒȢ
İʌȚıIJȡȑijİȚıIJȘȜİȚIJȠȣȡȖȓĮ$872ǹȊȉȅȂǹȉǾ
ǼȐȞįİȞıĮȢȕȠȜİȪİȚȘȜİȚIJȠȣȡȖȓĮ$872
ǹȊȉȅȂǹȉǾȝʌȠȡİȓIJİȞĮİʌȚȜȑȟİIJİȝİȝȘ
ĮȣIJȩȝĮIJȠIJȡȩʌȠIJȚȢİʌȚșȣȝȘIJȑȢıȣȞșȒțİȢ
ǹȞ
İȝ
ȈİʌİȡȓʌIJȦıȘįȚĮțȠʌȒȢȡİȪȝĮIJȠȢȒĮʌİȞİȡȖȠʌȠȓȘıȘȢ
IJȠȣʌȡȠȧȩȞIJȠȢȜȩȖȦĮijĮȓȡİıȘȢIJȠȣțĮȜȦįȓȠȣ
ȇȣșȝȓıIJİIJȘșİȡȝȠțȡĮıȓĮʌȠȣİʌȚșȣȝİȓIJİ
ȉȠțȜȚȝĮIJȚıIJȚțȩĮȡȤȓȗİȚȞĮȜİȚIJȠȣȡȖİȓȝİIJȐĮʌȩʌİȡȓʌȠȣ
ȜİʌIJȐ
ȉİȡȝĮIJȚıȝȩȢ
ȇȣșȝȚıȝȑȞȘșİȡȝ
ȋȡȩȞȠȢ
ȆȜȒțIJȡȠ212))
ȆĮIJȒıIJİʌȐȜȚĮȣIJȩIJȠʌȜȒțIJȡȠȖȚĮȞĮ
ĮʌİȞİȡȖȠʌȠȚȒıİIJİIJȠțȜȚȝĮIJȚıIJȚțȩǾȠȡȚȗȩȞIJȚĮʌİȡıȓįĮ
İʌȚıIJȡȑijİȚıIJȘșȑıȘIJȘȢțĮIJȐIJȘȞĮʌİȞİȡȖȠʌȠȓȘıȘ
50
ȁİȚIJȠȣȡȖȓĮĮijȪȖȡĮȞıȘȢ
DzȞĮȡȟȘ
ȆȜȒțIJȡȠ212))
ȆĮIJȒıIJİĮȣIJȩIJȠʌȜȒțIJȡȠȖȚĮȞĮ
İȞİȡȖȠʌȠȚȒıİIJİIJȠțȜȚȝĮIJȚıIJȚțȩ
ǹȞȐȕİȚȘȑȞįİȚȟȘșİȡȝȠțȡĮıȓĮȢıIJȘȞȠșȩȞȘIJȘȢ
İıȦIJİȡȚțȒȢȝȠȞȐįĮȢ
ȆȜȒțIJȡȠ0RGH
ȆĮIJȒıIJİIJȠȖȚĮȞĮİʌȚȜȑȟİIJİ'(+80,',)<
ǹĭȊīȇǹȃȈǾ
ȆȜȒțIJȡȠ0RGH
ȆĮIJȒıIJİIJȠȖȚĮȞĮİʌȚȜȑȟİIJİ)$1ǹȃǼȂǿȈȉǾȇǹȈ
ȆȜȒțIJȡȠ)DQ
ȆĮIJȒıIJİIJȠȖȚĮȞĮİʌȚȜȑȟİIJİIJȘȞİʌȚșȣȝȘIJȒIJĮȤȪIJȘIJĮ
ĮȞİȝȚıIJȒȡĮǹȣIJȩȝĮIJȘȋĮȝȘȜȒȂİıĮȓĮțĮȚȊȥȘȜȒ
ǾʌȡȠİʌȚȜİȖȝȑȞȘIJĮȤȪIJȘIJĮĮȞİȝȚıIJȒȡĮİȓȞĮȚȘ
ǹȣIJȩȝĮIJȘ
ȆȜȒțIJȡĮȡȪșȝȚıȘȢ
ȇȣșȝȓıIJİIJȘșİȡȝȠțȡĮıȓĮʌȠȣİʌȚșȣȝİȓIJİ
ȈȣȞȒșȦȢȡȣșȝȓȗİIJĮȚȝİIJĮȟȪž&țĮȚž&
ȉİȡȝĮIJȚıȝȩȢ
ȆȜȒțIJȡȠ212))
ȉİȡȝĮIJȚıȝȩȢ
ȆȜȒțIJȡȠ212))
ȆĮIJȒıIJİʌȐȜȚĮȣIJȩIJȠʌȜȒțIJȡȠȖȚĮȞĮ
ĮʌİȞİȡȖȠʌȠȚȒıİIJİIJȠțȜȚȝĮIJȚıIJȚțȩǾȠȡȚȗȩȞIJȚĮ
ʌİȡıȓįĮİʌȚıIJȡȑijİȚıIJȘșȑıȘIJȘȢțĮIJȐIJȘȞ
ĮʌİȞİȡȖȠʌȠȓȘıȘ
ǔǖǍǃǐǖnjƾǓNjǂNJǑnjLjǒǐǗǐǒǀdžǓ
ȈIJȘȜİȚIJȠȣȡȖȓĮ'(+80,',)<ǹĭȊīȇǹȃȈǾȘ
IJĮȤȪIJȘIJĮĮȞİȝȚıIJȒȡĮİȓȞĮȚȡȣșȝȚıȝȑȞȘıIJȘȋĮȝȘȜȒ
IJĮȤȪIJȘIJĮțĮȚȘȜİȚIJȠȣȡȖȓĮ7XUERįİȞȝʌȠȡİȓȞĮ
ȤȡȘıȚȝȠʌȠȚȘșİȓ
ȁİȚIJȠȣȡȖȓĮĮȞİȝȚıIJȒȡĮ
ǵIJĮȞİʌȚȜȑȖİIJİIJȠȞIJȡȩʌȠȜİȚIJȠȣȡȖȓĮȢ)$1
ǹȃǼȂǿȈȉǾȇǹȈIJȠțȜȚȝĮIJȚıIJȚțȩĮʌȜȐțȣțȜȠijȠȡİȓIJȠȞ
İıȦIJİȡȚțȩĮȑȡĮ
ȆȜȒțIJȡȠ212))
ȆĮIJȒıIJİĮȣIJȩIJȠʌȜȒțIJȡȠȖȚĮȞĮİȞİȡȖȠʌȠȚȒıİIJİIJȠ
țȜȚȝĮIJȚıIJȚțȩ
ȆĮIJȒıIJİʌȐȜȚĮȣIJȩIJȠʌȜȒțIJȡȠȖȚĮȞĮ
ĮʌİȞİȡȖȠʌȠȚȒıİIJİIJȠțȜȚȝĮIJȚıIJȚțȩǾȠȡȚȗȩȞIJȚĮ
ʌİȡıȓįĮİʌȚıIJȡȑijİȚıIJȘșȑıȘIJȘȢțĮIJȐIJȘȞ
ĮʌİȞİȡȖȠʌȠȓȘıȘ
ǔǖǍǃǐǖnjƾǓNjǂNJǑnjLjǒǐǗǐǒǀdžǓ
‡ ǻİȞİȝijĮȞȓȗİIJĮȚțĮȝȓĮȑȞįİȚȟȘIJĮȤȪIJȘIJĮȢıIJȠ
IJȘȜİȤİȚȡȚıIJȒȡȚȠİȐȞȑȤİȚİʌȚȜİȖİȓȘĮȣIJȩȝĮIJȘ
IJĮȤȪIJȘIJĮĮȞİȝȚıIJȒȡĮ
ȁİȚIJȠȣȡȖȓĮȥȪȟȘȢțĮȚșȑȡȝĮȞıȘȢ
DzȞĮȡȟȘ
ȆȜȒțIJȡȠ212))
ȆĮIJȒıIJİĮȣIJȩIJȠʌȜȒțIJȡȠȖȚĮȞĮİȞİȡȖȠʌȠȚȒıİIJİIJȠ
țȜȚȝĮIJȚıIJȚțȩ
ǹȞȐȕİȚȘȑȞįİȚȟȘșİȡȝȠțȡĮıȓĮȢıIJȘȞȠșȩȞȘIJȘȢ
İıȦIJİȡȚțȒȢȝȠȞȐįĮȢ
ȆȜȒțIJȡȠ0RGH
ȆĮIJȒıIJİIJȠȖȚĮȞĮİʌȚȜȑȟİIJİIJȘȜİȚIJȠȣȡȖȓĮ&22/
ȌȊȄǾȒ+($7ĬǼȇȂǹȃȈǾİȐȞįȚĮIJȓșİIJĮȚ
ǹȞȐȕİȚȘȑȞįİȚȟȘșİȡȝȠțȡĮıȓĮȢıIJȘȞȠșȩȞȘIJȘȢ
İıȦIJİȡȚțȒȢȝȠȞȐįĮȢ
51
ȆȜȒțIJȡĮȡȪșȝȚıȘȢ
ȇȣșȝȓıIJİIJȘșİȡȝȠțȡĮıȓĮʌȠȣİʌȚșȣȝİȓIJİ
ȈȣȞȒșȦȢȡȣșȝȓȗİIJĮȚȝİIJĮȟȪž&țĮȚž&
ȆȜȒțIJȡȠ)DQ
ȆĮIJȒıIJİIJȠȖȚĮȞĮİʌȚȜȑȟİIJİIJȘȞİʌȚșȣȝȘIJȒIJĮȤȪIJȘIJĮ
ĮȞİȝȚıIJȒȡĮǹȣIJȩȝĮIJȘȋĮȝȘȜȒȂİıĮȓĮțĮȚȊȥȘȜȒ
ǾʌȡȠİʌȚȜİȖȝȑȞȘIJĮȤȪIJȘIJĮĮȞİȝȚıIJȒȡĮİȓȞĮȚȘ
ǹȣIJȩȝĮIJȘ
ǔǖǍǃǐǖnjƾǓNjǂNJǑnjLjǒǐǗǐǒǀdžǓ
ǻİȞİȝijĮȞȓȗİIJĮȚțĮȝȓĮȑȞįİȚȟȘIJĮȤȪIJȘIJĮȢıIJȠ
IJȘȜİȤİȚȡȚıIJȒȡȚȠİȐȞȑȤİȚİʌȚȜİȖİȓȘĮȣIJȩȝĮIJȘ
IJĮȤȪIJȘIJĮĮȞİȝȚıIJȒȡĮ
ȈIJȡȑȥIJİIJȠIJȘȜİȤİȚȡȚıIJȒȡȚȠʌȡȠȢIJȘȞİıȦIJİȡȚțȒȝȠȞȐįĮ
țĮȚİʌȚȕİȕĮȚȫıIJİIJȘȡȣșȝȚıȝȑȞȘȫȡĮʌĮIJȫȞIJĮȢIJȠ
ʌȜȒțIJȡȠ7LPHU2Q
ȉȠıȪȝȕȠȜȠ#ʌĮȡĮȝȑȞİȚĮȞĮȝȝȑȞȠıIJȘȞȠșȩȞȘIJȠȣ
IJȘȜİȤİȚȡȚıIJȘȡȓȠȣ
ǼȜȑȖȟIJİȩIJȚȘȑȞįİȚȟȘȤȡȠȞȠįȚĮțȩʌIJȘİȓȞĮȚĮȞĮȝȝȑȞȘıIJȘȞ
ȠșȩȞȘIJȘȢİıȦIJİȡȚțȒȢȝȠȞȐįĮȢ
ǹțȪȡȦıȘIJȦȞȡȣșȝȓıİȦȞ
ȈIJȡȑȥIJİIJȠIJȘȜİȤİȚȡȚıIJȒȡȚȠʌȡȠȢIJȘȞİıȦIJİȡȚțȒȝȠȞȐįĮ
țĮȚʌĮIJȒıIJİʌȐȜȚIJȠʌȜȒțIJȡȠ7LPHU2QǺİȕĮȚȦșİȓIJİȩIJȚIJȠ
ıȪȝȕȠȜȠ ıIJȠIJȘȜİȤİȚȡȚıIJȒȡȚȠȑȤİȚıȕȒıİȚ
ȁİȚIJȠȣȡȖȓĮȤȡȠȞȠįȚĮțȩʌIJȘ
ĮʌİȞİȡȖȠʌȠȓȘıȘȢ
ȆĮIJȫȞIJĮȢIJȠʌȜȒțIJȡȠ7LPHU2IIȘȑȞįİȚȟȘ
ĮȞĮȕȠıȕȒȞİȚıIJȘȞȠșȩȞȘIJȠȣ
IJȘȜİȤİȚȡȚıIJȒȡȚȠȣıİʌİȡȓʌIJȦıȘʌȠȣİȓȞĮȚȘʌȡȫIJȘ
ijȠȡȐʌȠȣȤȡȘıȚȝȠʌȠȚİȓIJİIJȘȜİȚIJȠȣȡȖȓĮ7LPHU2II
ȋȡȠȞȠįȚĮțȩʌIJȘȢĮʌİȞİȡȖȠʌȠȓȘıȘȢǻȚĮijȠȡİIJȚțȐ
ĮȞĮȕȠıȕȒȞİȚȘIJİȜİȣIJĮȓĮȡȣșȝȚıȝȑȞȘȫȡĮ
ȇȣșȝȓıIJİIJȘȞİʌȚșȣȝȘIJȒȫȡĮʌĮIJȫȞIJĮȢIJĮʌȜȒțIJȡĮ
ȡȪșȝȚıȘȢ ǼȝʌȡȩȢ
ȆȓıȦ
ȀȐșİijȠȡȐʌȠȣʌĮIJȐIJİIJĮʌȜȒțIJȡĮȘȫȡĮĮȣȟȐȞİIJĮȚȒ
ȝİȚȫȞİIJĮȚțĮIJȐȜİʌIJȩ
ȀȡĮIJȫȞIJĮȢʌĮIJȘȝȑȞȠIJȠĮȞIJȓıIJȠȚȤȠʌȜȒțIJȡȠȘȫȡĮ
ĮȣȟȐȞİIJĮȚȒȝİȚȫȞİIJĮȚʌȚȠȖȡȒȖȠȡĮ
ȈIJȡȑȥIJİIJȠIJȘȜİȤİȚȡȚıIJȒȡȚȠʌȡȠȢIJȘȞİıȦIJİȡȚțȒȝȠȞȐįĮ
țĮȚİʌȚȕİȕĮȚȫıIJİIJȘȡȣșȝȚıȝȑȞȘȫȡĮʌĮIJȫȞIJĮȢIJȠ
ʌȜȒțIJȡȠ7LPHU2II
ȉȠıȪȝȕȠȜȠ#ʌĮȡĮȝȑȞİȚĮȞĮȝȝȑȞȠıIJȘȞȠșȩȞȘIJȠȣ
IJȘȜİȤİȚȡȚıIJȘȡȓȠȣ
ǼȜȑȖȟIJİȩIJȚȘȑȞįİȚȟȘȤȡȠȞȠįȚĮțȩʌIJȘİȓȞĮȚĮȞĮȝȝȑȞȘıIJȘȞ
ȠșȩȞȘIJȘȢİıȦIJİȡȚțȒȢȝȠȞȐįĮȢ
ȉİȡȝĮIJȚıȝȩȢ
ȆȜȒțIJȡȠ212))
ȆĮIJȒıIJİʌȐȜȚĮȣIJȩIJȠʌȜȒțIJȡȠȖȚĮȞĮ
ĮʌİȞİȡȖȠʌȠȚȒıİIJİIJȠțȜȚȝĮIJȚıIJȚțȩǾȠȡȚȗȩȞIJȚĮ
ʌİȡıȓįĮİʌȚıIJȡȑijİȚıIJȘșȑıȘIJȘȢțĮIJȐIJȘȞ
ĮʌİȞİȡȖȠʌȠȓȘıȘ
ȇȣșȝȓıİȚȢIJȠȣȤȡȠȞȠįȚĮțȩʌIJȘ
ȁİȚIJȠȣȡȖȓĮȤȡȠȞȠįȚĮțȩʌIJȘ
İȞİȡȖȠʌȠȓȘıȘȢ
ȆĮIJȫȞIJĮȢIJȠʌȜȒțIJȡȠ7LPHU2QȘȑȞįİȚȟȘ
ĮȞĮȕȠıȕȒȞİȚıIJȘȞȠșȩȞȘIJȠȣ
IJȘȜİȤİȚȡȚıIJȒȡȚȠȣıİʌİȡȓʌIJȦıȘʌȠȣİȓȞĮȚȘʌȡȫIJȘ
ijȠȡȐʌȠȣȤȡȘıȚȝȠʌȠȚİȓIJİIJȘȜİȚIJȠȣȡȖȓĮ7LPHU2Q
ȋȡȠȞȠįȚĮțȩʌIJȘȢİȞİȡȖȠʌȠȓȘıȘȢǻȚĮijȠȡİIJȚțȐ
ĮȞĮȕȠıȕȒȞİȚȘIJİȜİȣIJĮȓĮȡȣșȝȚıȝȑȞȘȫȡĮ
ȈIJȡȑȥIJİIJȠIJȘȜİȤİȚȡȚıIJȒȡȚȠʌȡȠȢIJȘȞİıȦIJİȡȚțȒȝȠȞȐįĮ
țĮȚʌĮIJȒıIJİʌȐȜȚIJȠʌȜȒțIJȡȠ7LPHU2IIǺİȕĮȚȦșİȓIJİȩIJȚIJȠ
ıȪȝȕȠȜȠ
ıIJȠIJȘȜİȤİȚȡȚıIJȒȡȚȠȑȤİȚıȕȒıİȚZ
ǔǖǍǃǐǖnjƾǓNjǂNJǑnjLjǒǐǗǐǒǀdžǓ
‡ ȅȤȡȩȞȠȢȜİȚIJȠȣȡȖȓĮȢIJȘȢȜİȚIJȠȣȡȖȓĮȢȤȡȠȞȠįȚĮțȩʌIJȘ
ʌȠȣȡȣșȝȓȗİIJĮȚĮʌȩIJȠIJȘȜİȤİȚȡȚıIJȒȡȚȠİȟĮȡIJȐIJĮȚ
ĮʌȩIJȘȞȫȡĮIJȠȣȡȠȜȠȖȚȠȪǼȜȑȖȟIJİȩIJȚIJȠȡȠȜȩȚ
ıIJȠIJȘȜİȤİȚȡȚıIJȒȡȚȠȑȤİȚȡȣșȝȚıIJİȓıȦıIJȐȖȚĮIJȘȞ
ĮʌȠijȣȖȒįȣıȜİȚIJȠȣȡȖȓĮȢ
‡ ȅȠȣıȚĮıIJȚțȩȢȤȡȩȞȠȢȜİȚIJȠȣȡȖȓĮȢʌȠȣȡȣșȝȓȗİIJĮȚ
ĮʌȩIJȠIJȘȜİȤİȚȡȚıIJȒȡȚȠʌİȡȚȠȡȓȗİIJĮȚıIJȚȢȫȡİȢ
ȆĮȡĮįİȓȖȝĮIJĮȡȣșȝȓıİȦȞȤȡȠȞȠįȚĮțȩʌIJȘ
ȀȐșİijȠȡȐʌȠȣʌĮIJȐIJİIJĮʌȜȒțIJȡĮȘȫȡĮ
ĮȣȟȐȞİIJĮȚȒȝİȚȫȞİIJĮȚțĮIJȐȜİʌIJȩ
ȁİȚIJȠȣȡȖȓĮȤȡȠȞȠįȚĮțȩʌIJȘİȞİȡȖȠʌȠȓȘıȘȢ
ȁİȚIJȠȣȡȖȓĮȤȡȠȞȠįȚĮțȩʌIJȘȑȞĮȡȟȘȢ
ǾȜİȚIJȠȣȡȖȓĮĮȣIJȒıȣȞȚıIJȐIJĮȚȩIJĮȞșȑȜİIJİȘȝȠȞȐįĮȞĮ
İȞİȡȖȠʌȠȚȘșİȓĮȣIJȩȝĮIJĮʌȡȚȞİʌȚıIJȡȑȥİIJİıIJȠıʌȓIJȚ
ȉȠțȜȚȝĮIJȚıIJȚțȩșĮĮȡȤȓıİȚȞĮȜİȚIJȠȣȡȖİȓĮȣIJȩȝĮIJĮIJȘ
ȡȣșȝȚıȝȑȞȘȫȡĮ
ȀȡĮIJȫȞIJĮȢʌĮIJȘȝȑȞȠIJȠĮȞIJȓıIJȠȚȤȠʌȜȒțIJȡȠȘ
ȫȡĮĮȣȟȐȞİIJĮȚȒȝİȚȫȞİIJĮȚʌȚȠȖȡȒȖȠȡĮ
ȆĮȡȐįİȚȖȝĮǼȓȞĮȚȆȂțĮȚșȑȜİIJİIJȠ
țȜȚȝĮIJȚıIJȚțȩȞĮĮȡȤȓıİȚȞĮȜİȚIJȠȣȡȖİȓıIJȚȢȂȂ
ȇȣșȝȓıIJİIJȘȞİʌȚșȣȝȘIJȒȫȡĮʌĮIJȫȞIJĮȢIJĮ
ʌȜȒțIJȡĮȡȪșȝȚıȘȢ ǼȝʌȡȩȢ
ȆȓıȦ
52
ǹțȪȡȦıȘIJȦȞȡȣșȝȓıİȦȞ
ȆĮIJȒıIJİIJȠʌȜȒțIJȡȠ7LPHU2Q
ȇȣșȝȓıIJİIJȘȞİʌȚșȣȝȘIJȒȫȡĮʌĮIJȫȞIJĮȢ
İʌĮȞİȚȜȘȝȝȑȞĮȒțȡĮIJȫȞIJĮȢʌĮIJȘȝȑȞĮIJĮʌȜȒțIJȡĮ
ȡȪșȝȚıȘȢȑȦȢȩIJȠȣİȝijĮȞȚıIJİȓȘȑȞįİȚȟȘıIJȘȞ
ȠșȩȞȘIJȠȣIJȘȜİȤİȚȡȚıIJȘȡȓȠȣ
ǼʌȚȕİȕĮȚȫıIJİIJȘȡȣșȝȚıȝȑȞȘȫȡĮıIJȡȑijȠȞIJĮȢIJȠ
IJȘȜİȤİȚȡȚıIJȒȡȚȠʌȡȠȢIJȘȞİıȦIJİȡȚțȒȝȠȞȐįĮțĮȚ
ʌĮIJȫȞIJĮȢʌȐȜȚIJȠʌȜȒțIJȡȠ7LPHU2Q
ȆĮIJȒıIJİIJȠʌȜȒțIJȡȠ7LPHU2II
ǼʌȚȕİȕĮȚȫıIJİIJȘȡȣșȝȚıȝȑȞȘȫȡĮıIJȡȑijȠȞIJĮȢIJȠ
IJȘȜİȤİȚȡȚıIJȒȡȚȠʌȡȠȢIJȘȞİıȦIJİȡȚțȒȝȠȞȐįĮțĮȚ
ʌĮIJȫȞIJĮȢʌȐȜȚIJȠʌȜȒțIJȡȠ7LPHU2Q
ȇȣșȝȓıIJİIJȘȞİʌȚșȣȝȘIJȒȫȡĮʌĮIJȫȞIJĮȢ
İʌĮȞİȚȜȘȝȝȑȞĮȒțȡĮIJȫȞIJĮȢʌĮIJȘȝȑȞĮIJĮʌȜȒțIJȡĮ
ȡȪșȝȚıȘȢȑȦȢȩIJȠȣİȝijĮȞȚıIJİȓȘȑȞįİȚȟȘıIJȘȞ
ȠșȩȞȘIJȠȣIJȘȜİȤİȚȡȚıIJȘȡȓȠȣ
ȉȠıȪȝȕȠȜȠ#ʌĮȡĮȝȑȞİȚĮȞĮȝȝȑȞȠıIJȘȞȠșȩȞȘ
IJȠȣIJȘȜİȤİȚȡȚıIJȘȡȓȠȣ
ǹȞȐȕİȚȘȑȞįİȚȟȘȤȡȠȞȠįȚĮțȩʌIJȘıIJȘȞȠșȩȞȘIJȘȢ
İıȦIJİȡȚțȒȢȝȠȞȐįĮȢ
ȁİȚIJȠȣȡȖȓĮȤȡȠȞȠįȚĮțȩʌIJȘĮʌİȞİȡȖȠʌȠȓȘıȘȢ
ȁİȚIJȠȣȡȖȓĮȤȡȠȞȠįȚĮțȩʌIJȘIJİȡȝĮIJȚıȝȠȪ
ǾȜİȚIJȠȣȡȖȓĮĮȣIJȒıȣȞȚıIJȐIJĮȚȩIJĮȞșȑȜİIJİȘȝȠȞȐįĮȞĮ
ĮʌİȞİȡȖȠʌȠȚȘșİȓĮȣIJȩȝĮIJĮȖȚĮIJȘȞȫȡĮȪʌȞȠȣ
ȉȠțȜȚȝĮIJȚıIJȚțȩșĮıIJĮȝĮIJȒıİȚȞĮȜİȚIJȠȣȡȖİȓĮȣIJȩȝĮIJĮ
IJȘȡȣșȝȚıȝȑȞȘȫȡĮ
ȆĮȡȐįİȚȖȝĮǼȓȞĮȚȂȂțĮȚșȑȜİIJİIJȠ
țȜȚȝĮIJȚıIJȚțȩȞĮĮʌİȞİȡȖȠʌȠȚȘșİȓıIJȚȢ23ȆȂ
ȆĮIJȒıIJİIJȠʌȜȒțIJȡȠ7LPHU2II
ǼʌȚȕİȕĮȚȫıIJİIJȘȡȣșȝȚıȝȑȞȘȫȡĮıIJȡȑijȠȞIJĮȢ
IJȠIJȘȜİȤİȚȡȚıIJȒȡȚȠʌȡȠȢIJȘȞİıȦIJİȡȚțȒȝȠȞȐįĮțĮȚ
ʌĮIJȫȞIJĮȢʌȐȜȚIJȠʌȜȒțIJȡȠ7LPHU2II
ȉȠıȪȝȕȠȜȠ#İȝijĮȞȓȗİIJĮȚıIJȠIJȘȜİȤİȚȡȚıIJȒȡȚȠțĮȚ
ȘȜİȚIJȠȣȡȖȓĮİȞİȡȖȠʌȠȚİȓIJĮȚ
ȋȡȠȞȠįȚĮțȩʌIJȘȢĮʌİȞİȡȖȠʌȠȓȘıȘȢ ȋȡȠȞȠįȚĮțȩʌIJȘȢİȞİȡȖȠʌȠȓȘıȘȢ
ǼȞİȡȖȠʌȠȓȘıȘȉİȡȝĮIJȚıȝȩȢDzȞĮȡȟȘȜİȚIJȠȣȡȖȓĮȢ
ǾȜİȚIJȠȣȡȖȓĮĮȣIJȒıȣȞȚıIJȐIJĮȚȩIJĮȞșȑȜİIJİȞĮ
ĮʌİȞİȡȖȠʌȠȚȘșİȓIJȠțȜȚȝĮIJȚıIJȚțȩĮijȠȪʌȐIJİȖȚĮȪʌȞȠ
țĮȚȞĮİȞİȡȖȠʌȠȚȘșİȓʌȐȜȚʌȡȚȞȟȣʌȞȒıİIJİIJȠʌȡȦȓȒ
İʌȚıIJȡȑȥİIJİıIJȠıʌȓIJȚ
ȆĮȡȐįİȚȖȝĮǼȓȞĮȚȆȂțĮȚșȑȜİIJİIJȠțȜȚȝĮIJȚıIJȚțȩ
ȞĮıIJĮȝĮIJȒıİȚȞĮȜİȚIJȠȣȡȖİȓıIJȚȢȆȂțĮȚȞĮ
ȟİțȚȞȒıİȚʌȐȜȚıIJȚȢȂȂ
ȇȣșȝȓıIJİIJȘȞİʌȚșȣȝȘIJȒȫȡĮʌĮIJȫȞIJĮȢ
İʌĮȞİȚȜȘȝȝȑȞĮȒțȡĮIJȫȞIJĮȢʌĮIJȘȝȑȞĮIJĮʌȜȒțIJȡĮ
ȡȪșȝȚıȘȢȑȦȢȩIJȠȣİȝijĮȞȚıIJİȓȘȑȞįİȚȟȘıIJȘȞ
ȠșȩȞȘIJȠȣIJȘȜİȤİȚȡȚıIJȘȡȓȠȣ
ǼʌȚȕİȕĮȚȫıIJİIJȘȡȣșȝȚıȝȑȞȘȫȡĮıIJȡȑijȠȞIJĮȢIJȠ
IJȘȜİȤİȚȡȚıIJȒȡȚȠʌȡȠȢIJȘȞİıȦIJİȡȚțȒȝȠȞȐįĮțĮȚ
ʌĮIJȫȞIJĮȢʌȐȜȚIJȠʌȜȒțIJȡȠ7LPHU2II
ȆĮIJȒıIJİIJȠʌȜȒțIJȡȠ7LPHU2II
ȇȣșȝȓıIJİIJȘȞİʌȚșȣȝȘIJȒȫȡĮʌĮIJȫȞIJĮȢ
İʌĮȞİȚȜȘȝȝȑȞĮȒțȡĮIJȫȞIJĮȢʌĮIJȘȝȑȞĮIJĮʌȜȒțIJȡĮ
ȡȪșȝȚıȘȢȑȦȢȩIJȠȣİȝijĮȞȚıIJİȓȘȑȞįİȚȟȘıIJȘȞ
ȠșȩȞȘIJȠȣIJȘȜİȤİȚȡȚıIJȘȡȓȠȣ
ȉȠıȪȝȕȠȜȠ#ʌĮȡĮȝȑȞİȚĮȞĮȝȝȑȞȠıIJȘȞȠșȩȞȘ
IJȠȣIJȘȜİȤİȚȡȚıIJȘȡȓȠȣ
ǹȞȐȕİȚȘȑȞįİȚȟȘȤȡȠȞȠįȚĮțȩʌIJȘıIJȘȞȠșȩȞȘIJȘȢ
İıȦIJİȡȚțȒȢȝȠȞȐįĮȢ
ȈȣȞįȣĮıIJȚțȩȢȤȡȠȞȠįȚĮțȩʌIJȘȢ
ȋȡȠȞȠįȚĮțȩʌIJȘȢİȞİȡȖȠʌȠȓȘıȘȢ ȋȡȠȞȠįȚĮțȩʌIJȘȢĮʌİȞİȡȖȠʌȠȓȘıȘȢ
ǹʌİȞİȡȖȠʌȠȓȘıȘDzȞĮȡȟȘȉİȡȝĮIJȚıȝȩȢȜİȚIJȠȣȡȖȓĮȢ
ǾȜİȚIJȠȣȡȖȓĮĮȣIJȒıȣȞȚıIJȐIJĮȚȩIJĮȞșȑȜİIJİȞĮ
İȞİȡȖȠʌȠȚȘșİȓIJȠțȜȚȝĮIJȚıIJȚțȩʌȡȚȞȟȣʌȞȒıİIJİțĮȚȞĮ
ĮʌİȞİȡȖȠʌȠȚȘșİȓĮijȠȪijȪȖİIJİĮʌȩIJȠıʌȓIJȚ
ǼʌȚȕİȕĮȚȫıIJİIJȘȡȣșȝȚıȝȑȞȘȫȡĮıIJȡȑijȠȞIJĮȢIJȠ
IJȘȜİȤİȚȡȚıIJȒȡȚȠʌȡȠȢIJȘȞİıȦIJİȡȚțȒȝȠȞȐįĮțĮȚ
ʌĮIJȫȞIJĮȢʌȐȜȚIJȠʌȜȒțIJȡȠ7LPHU2II
ȆĮIJȒıIJİIJȠʌȜȒțIJȡȠ7LPHU2Q
ȇȣșȝȓıIJİIJȘȞİʌȚșȣȝȘIJȒȫȡĮʌĮIJȫȞIJĮȢ
İʌĮȞİȚȜȘȝȝȑȞĮȒțȡĮIJȫȞIJĮȢʌĮIJȘȝȑȞĮIJĮʌȜȒțIJȡĮ
ȡȪșȝȚıȘȢȑȦȢȩIJȠȣİȝijĮȞȚıIJİȓȘȑȞįİȚȟȘıIJȘȞ
ȠșȩȞȘIJȠȣIJȘȜİȤİȚȡȚıIJȘȡȓȠȣ
ȆĮȡȐįİȚȖȝĮǼȓȞĮȚȂȂțĮȚșȑȜİIJİIJȠ
țȜȚȝĮIJȚıIJȚțȩȞĮĮȡȤȓıİȚȞĮȜİȚIJȠȣȡȖİȓıIJȚȢȆȂ
țĮȚȞĮıIJĮȝĮIJȒıİȚıIJȚȢȆȂ
ȆĮIJȒıIJİIJȠʌȜȒțIJȡȠ7LPHU2Q
ȇȣșȝȓıIJİIJȘȞİʌȚșȣȝȘIJȒȫȡĮʌĮIJȫȞIJĮȢ
İʌĮȞİȚȜȘȝȝȑȞĮȒțȡĮIJȫȞIJĮȢʌĮIJȘȝȑȞĮIJĮʌȜȒțIJȡĮ
ȡȪșȝȚıȘȢȑȦȢȩIJȠȣİȝijĮȞȚıIJİȓȘȑȞįİȚȟȘıIJȘȞ
ȠșȩȞȘIJȠȣIJȘȜİȤİȚȡȚıIJȘȡȓȠȣ
ǼʌȚȕİȕĮȚȫıIJİIJȘȡȣșȝȚıȝȑȞȘȫȡĮıIJȡȑijȠȞIJĮȢIJȠ
IJȘȜİȤİȚȡȚıIJȒȡȚȠʌȡȠȢIJȘȞİıȦIJİȡȚțȒȝȠȞȐįĮțĮȚ
ʌĮIJȫȞIJĮȢʌȐȜȚIJȠʌȜȒțIJȡȠ7LPHU2Q
ȉȠıȪȝȕȠȜȠ#İȝijĮȞȓȗİIJĮȚıIJȠIJȘȜİȤİȚȡȚıIJȒȡȚȠțĮȚ
ȘȜİȚIJȠȣȡȖȓĮİȞİȡȖȠʌȠȚİȓIJĮȚ
53
ȇȪșȝȚıȘIJȠȣȡȠȜȠȖȚȠȪ
ȁİȚIJȠȣȡȖȓĮ(FRȅȚțȠȞȠȝȚțȩ
ȆĮIJȒıIJİIJȠțȠȣȝʌȓ(FRıIJȘȜİȚIJȠȣȡȖȓĮ&22/ȌȊȄǾ
Ȓ+($7ĬǼȇȂǹȃȈǾİȐȞįȚĮIJȓșİIJĮȚIJȠțȜȚȝĮIJȚıIJȚțȩ
ĮȣȟȐȞİȚıIJȘȜİȚIJȠȣȡȖȓĮ&22/ȌȊȄǾȒȝİȚȫȞİȚ
ıIJȘȜİȚIJȠȣȡȖȓĮ+($7ĬǼȇȂǹȃȈǾĮȣIJȩȝĮIJĮIJȘ
șİȡȝȠțȡĮıȓĮțĮIJȐƒ&ĮȞȐȫȡĮıİȝȚĮʌİȡȓȠįȠ
ȦȡȫȞǾȡȣșȝȚıȝȑȞȘșİȡȝȠțȡĮıȓĮʌĮȡĮȝȑȞİȚ
ıIJĮșİȡȒȖȚĮIJȚȢİʌȩȝİȞİȢȫȡİȢțĮȚıIJȘıȣȞȑȤİȚĮȘ
ȝȠȞȐįĮĮʌİȞİȡȖȠʌȠȚİȓIJĮȚ
ǾȜİȚIJȠȣȡȖȓĮĮȣIJȒİʌȚIJȡȑʌİȚȝİȖĮȜȪIJİȡȘȐȞİıȘțĮȚ
İȟȠȚțȠȞȠȝİȓİȞȑȡȖİȚĮǾȜİȚIJȠȣȡȖȓĮĮȣIJȒıȣȞȚıIJȐIJĮȚȖȚĮ
ȤȡȒıȘȩIJĮȞʌȘȖĮȓȞİIJİȖȚĮȪʌȞȠ
ȇȣșȝȚıȝȑȞȘ
șİȡȝȠțȡĮıȓĮ
ȫȡĮ
ȫȡĮ
ȌȪȟȘ
ȇȣșȝȚıȝȑȞȘ
șİȡȝȠțȡĮıȓĮ
ȆȡȚȞĮȡȤȓıİIJİȞĮȜİȚIJȠȣȡȖİȓIJİIJȠțȜȚȝĮIJȚıIJȚțȩȡȣșȝȓıIJİ
IJȠȡȠȜȩȚIJȠȣIJȘȜİȤİȚȡȚıIJȘȡȓȠȣĮțȠȜȠȣșȫȞIJĮȢIJȘ
įȚĮįȚțĮıȓĮʌȠȣĮȞĮijȑȡİIJĮȚıİĮȣIJȒIJȘȞİȞȩIJȘIJĮǾ
ȠșȩȞȘȡȠȜȠȖȚȠȪıIJȠIJȘȜİȤİȚȡȚıIJȒȡȚȠİȝijĮȞȓȗİȚIJȘȞȫȡĮ
ĮȞİȟȐȡIJȘIJĮĮʌȩIJȠĮȞȜİȚIJȠȣȡȖİȓIJȠțȜȚȝĮIJȚıIJȚțȩ
ǹijȠȪIJȠʌȠșİIJȒıİIJİIJȚȢȝʌĮIJĮȡȓİȢıIJȠIJȘȜİȤİȚȡȚıIJȒȡȚȠ
ȘȑȞįİȚȟȘ
İȝijĮȞȓȗİIJĮȚțĮȚĮȡȤȓȗİȚȞĮĮȞĮȕȠıȕȒȞİȚ
ȆȜȒțIJȡĮȡȪșȝȚıȘȢ
ȆĮIJȒıIJİIJĮʌȜȒțIJȡĮȡȪșȝȚıȘȢȖȚĮȞĮȡȣșȝȓıİIJİIJȘȞ
İʌȚșȣȝȘIJȒȫȡĮ
ȫȡĮ
ȫȡĮ
ĬȑȡȝĮȞıȘ
ȁİȚIJȠȣȡȖȓĮ,)HHOǹȓıșȘıȘ
ȉȠIJȘȜİȤİȚȡȚıIJȒȡȚȠȜİȚIJȠȣȡȖİȓȦȢȑȞĮȢĮʌȠȝĮțȡȣıȝȑȞȠȢ
șİȡȝȠıIJȐIJȘȢʌĮȡȑȤȠȞIJĮȢĮțȡȚȕȒȑȜİȖȤȠIJȘȢșİȡȝȠțȡĮıȓĮȢțĮȚ
ȝȑȖȚıIJȘȐȞİıȘ
ȀȐșİijȠȡȐʌȠȣʌĮIJȐIJİIJĮʌȜȒțIJȡĮȘȫȡĮ
ĮȣȟȐȞİIJĮȚȒȝİȚȫȞİIJĮȚțĮIJȐȜİʌIJȩ
ȈIJȡȑȥIJİIJȠIJȘȜİȤİȚȡȚıIJȒȡȚȠʌȡȠȢIJȘȞİıȦIJİȡȚțȒȝȠȞȐįĮ
țĮȚʌĮIJȒıIJİIJȠʌȜȒțIJȡȠ,)HHOǹʌȩIJȘȞİıȦIJİȡȚțȒȝȠȞȐįĮ
ĮțȠȪȖİIJĮȚȑȞĮȘȤȘIJȚțȩıȒȝĮȝʌȚʌȖȚĮȞĮİʌȚȕİȕĮȚȫıİȚȩIJȚȘ
ȜİȚIJȠȣȡȖȓĮȑȤİȚİȞİȡȖȠʌȠȚȘșİȓ
ȀȡĮIJȫȞIJĮȢʌĮIJȘȝȑȞȠIJȠĮȞIJȓıIJȠȚȤȠʌȜȒțIJȡȠȘȫȡĮ
ĮȣȟȐȞİIJĮȚȒȝİȚȫȞİIJĮȚʌȚȠȖȡȒȖȠȡĮ
ȉȠıȪȝȕȠȜȠ,)HHO ʌĮȡĮȝȑȞİȚĮȞĮȝȝȑȞȠıIJȘȞȠșȩȞȘIJȠȣ
IJȘȜİȤİȚȡȚıIJȘȡȓȠȣȑȦȢȩIJȠȣʌĮIJȘșİȓʌȐȜȚIJȠʌȜȒțIJȡȠ,)HHO
ǼȝʌȡȩȢ
ȆȓıȦ
ȆȜȒțIJȡȠ&ORFN
ǵIJĮȞijIJȐıİIJİıIJȘȞİʌȚșȣȝȘIJȒȫȡĮʌĮIJȒıIJİ
ʌȐȜȚIJȠʌȜȒțIJȡȠ&ORFNįȚĮijȠȡİIJȚțȐȝİIJȐĮʌȩ
įİȣIJİȡȩȜİʌIJĮȤȦȡȓȢțĮȝȓĮİȞȑȡȖİȚĮȘȫȡĮIJȠȣ
ȡȠȜȠȖȚȠȪıIJĮȝĮIJȐİȚȞĮĮȞĮȕȠıȕȒȞİȚțĮȚȡȣșȝȓȗİIJĮȚ
IJȠȡȠȜȩȚ
ǼțȞȑȠȣȡȪșȝȚıȘIJȠȣȡȠȜȠȖȚȠȪ
ȆĮIJȫȞIJĮȢIJȠʌȜȒțIJȡȠ&ORFNȘȑȞįİȚȟȘȡȠȜȠȖȚȠȪ
ĮȡȤȓȗİȚȞĮĮȞĮȕȠıȕȒȞİȚ
ǹțȠȜȠȣșȒıIJİIJĮȕȒȝĮIJĮțĮȚȖȚĮȞĮȡȣșȝȓıİIJİIJȘ
ȞȑĮȫȡĮ
ǔǖǍǃǐǖnjƾǓNjǂNJǑnjLjǒǐǗǐǒǀdžǓ
‡ ȅȤȡȠȞȠįȚĮțȩʌIJȘȢȤȡȘıȚȝȠʌȠȚİȓȜİȚIJȠȣȡȖȓĮ
ȡȠȜȠȖȚȠȪȦȡȫȞ
‡ ǾʌȡȠİʌȚȜİȖȝȑȞȘȫȡĮȖȚĮIJȠ
IJȘȜİȤİȚȡȚıIJȒȡȚȠİȓȞĮȚȂȂțĮȚ
İʌĮȞȑȡȤİIJĮȚıİĮȣIJȒȞȩIJĮȞĮȜȜȐȗİIJİIJȚȢ
ȝʌĮIJĮȡȓİȢ
54
ȉȠțȜȚȝĮIJȚıIJȚțȩȜİȚIJȠȣȡȖİȓȖȚĮȞĮİʌȚIJȪȤİȚIJȘȡȣșȝȚıȝȑȞȘ
șİȡȝȠțȡĮıȓĮıIJȘșȑıȘIJȠȣIJȘȜİȤİȚȡȚıIJȘȡȓȠȣ
ȉȠIJȘȜİȤİȚȡȚıIJȒȡȚȠıIJȑȜȞİȚIJȚȢʌȜȘȡȠijȠȡȓİȢșİȡȝȠțȡĮıȓĮȢ
IJȘȢșȑıȘȢIJȠȣıIJȘȞİıȦIJİȡȚțȒȝȠȞȐįĮțȐșİȜİʌIJȐȉȠ
țȜȚȝĮIJȚıIJȚțȩĮʌİȞİȡȖȠʌȠȚİȓIJȘȜİȚIJȠȣȡȖȓĮ,)HHOǹȓıșȘıȘ
İȐȞįİȞȜȐȕİȚțĮȝȓĮʌȜȘȡȠijȠȡȓĮșİȡȝȠțȡĮıȓĮȢĮʌȩIJȠ
IJȘȜİȤİȚȡȚıIJȒȡȚȠȖȚĮįȚĮįȠȤȚțȐȜİʌIJȐ
ȆȫȢȞĮȤȡȘıȚȝȠʌȠȚİȓIJİIJȘȞ
İıȦIJİȡȚțȒȝȠȞȐįĮ
‡ ǵIJĮȞȘʌİȡıȓįĮȝİIJĮțȚȞȘșİȓıIJȘȞİʌȚșȣȝȘIJȒ
țĮIJİȪșȣȞıȘʌĮIJȒıIJİʌȐȜȚIJȠʌȜȒțIJȡȠ6ZLQJțĮȚ
ȘʌİȡıȓįĮșĮʌĮȡĮȝİȓȞİȚıIJȘșȑıȘʌȠȣİȓȞĮȚ
ȆȡȩıșİIJİȢİʌȚȜȠȖȑȢ
‡ ȆĮIJȒıIJİʌȐȜȚIJȠʌȜȒțIJȡȠ6ZLQJțĮȚȘʌİȡıȓįĮșĮ
ĮȡȤȓıİȚȞĮʌĮȜȚȞįȡȠȝİȓĮȣIJȩȝĮIJĮʌȐȞȦțĮȚțȐIJȦ
ȁİȚIJȠȣȡȖȓĮȑȟȣʌȞȘȢİʌĮȞİțțȓȞȘıȘȢ
ȉȠțȜȚȝĮIJȚıIJȚțȩİʌĮȞȑȡȤİIJĮȚĮȣIJȩȝĮIJĮıIJȚȢ
ʌȡȠȘȖȠȪȝİȞİȢȡȣșȝȓıİȚȢȝİIJȐĮʌȩʌȚșĮȞȒįȚĮțȠʌȒ
ȡİȪȝĮIJȠȢ
ǹijĮȚȡȠȪȝİȞȠțȐȜȣȝȝĮ
ȉȠȝʌȡȠıIJȚȞȩțȐȜȣȝȝĮIJȘȢİıȦIJİȡȚțȒȢȝȠȞȐįĮȢ
ȝʌȠȡİȓȞĮĮijĮȚȡİșİȓİȪțȠȜĮȖȚĮțĮșĮȡȚıȝȩțĮȚ
ıȣȞIJȒȡȘıȘ
ǹȣIJȠįȚȐȖȞȦıȘțĮȚĮȣIJȠʌȡȠıIJĮıȓĮ
ȉȠțȜȚȝĮIJȚıIJȚțȩĮȣIJȩȝʌȠȡİȓȞĮĮȞȚȤȞİȪıİȚIJȚȢ
įȣıȜİȚIJȠȣȡȖȓİȢİȝijĮȞȓȗȠȞIJĮȢIJȘįȚȐȖȞȦıȘıIJȘȞȠșȩȞȘ
IJȘȢİıȦIJİȡȚțȒȢȝȠȞȐįĮȢȝİȑȞĮȞțȦįȚțȩıijȐȜȝĮIJȠȢ
ȉȠțȜȚȝĮIJȚıIJȚțȩĮȜȜȐȗİȚĮȣIJȩȝĮIJĮIJȘȜİȚIJȠȣȡȖȓĮȖȚĮ
ĮȣIJȠʌȡȠıIJĮıȓĮ
DzȜİȖȤȠȢțĮIJİȪșȣȞıȘȢȡȠȒȢĮȑȡĮ
‡ ȇȣșȝȓıIJİıȦıIJȐIJȘȞțĮIJİȪșȣȞıȘȡȠȒȢĮȑȡĮ
țĮșȫȢȝʌȠȡİȓȞĮʌȡȠțȜȘșİȓȑȜȜİȚȥȘȐȞİıȘȢȒ
ĮȞȠȝȠȚȩȝȠȡijȘșİȡȝȠțȡĮıȓĮIJȠȣįȦȝĮIJȓȠȣ
‡ ȇȣșȝȓıIJİIJȚȢȠȡȚȗȩȞIJȚİȢʌİȡıȓįİȢȝİIJȠ
IJȘȜİȤİȚȡȚıIJȒȡȚȠ
ǼȪȡȠȢ
ȇȠȒĮȑȡĮİʌȐȞȦțĮȚțȐIJȦ
īȚĮIJȘȤİȚȡȠțȓȞȘIJȘȡȪșȝȚıȘIJȘȢȠȡȚȗȩȞIJȚĮȢ
ĮȡȚıIJİȡȐįİȟȚȐțĮIJİȪșȣȞıȘȢȡȠȒȢIJȠȣĮȑȡĮ
‡ ȇȣșȝȓıIJİIJȚȢțȐșİIJİȢʌİȡıȓįİȢȤİȚȡȠțȓȞȘIJĮȝİ
IJȠȞĮȡȚıIJİȡȩįİȟȓȝȠȤȜȩIJȠȣȕȡĮȤȓȠȞĮțȐșİIJȦȞ
ʌİȡıȓįȦȞ
‡ ȆȡĮȖȝĮIJȠʌȠȚȒıIJİĮȣIJȑȢIJȚȢȡȣșȝȓıİȚȢʌȡȚȞ
İȞİȡȖȠʌȠȚȒıİIJİIJȘȝȠȞȐįĮțĮșȫȢȝȩȜȚȢ
İȞİȡȖȠʌȠȚȘșİȓȣʌȐȡȤİȚțȓȞįȣȞȠȢȞĮʌȚĮıIJȠȪȞIJĮ
įȐțIJȣȜȐıĮȢıIJȠȞĮȞİȝȚıIJȒȡĮ
‡ ȇȣșȝȓıIJİIJȚȢțȐșİIJİȢʌİȡıȓįİȢȤİȚȡȠțȓȞȘIJĮ
ȀȐșİIJȘ
ʌİȡıȓįĮ
ǼȪȡȠȢ
ȇȠȒĮȑȡĮĮȡȚıIJİȡȐțĮȚįİȟȚȐ
Ǒǒǐǔǐǘƿ
īȚĮȞĮȡȣșȝȓıİIJİIJȘȞțȐșİIJȘİʌȐȞȦțȐIJȦ
țĮIJİȪșȣȞıȘȡȠȒȢIJȠȣĮȑȡĮĮȣIJȩȝĮIJĮ
‡ ǼțIJİȜȑıIJİĮȣIJȒIJȘȜİȚIJȠȣȡȖȓĮİȞȫȘȝȠȞȐįĮ
ȕȡȓıțİIJĮȚıİȜİȚIJȠȣȡȖȓĮ
‡ ȆĮIJȫȞIJĮȢIJȠʌȜȒțIJȡȠ6ZLQJıIJȠ
IJȘȜİȤİȚȡȚıIJȒȡȚȠȘȠȡȚȗȩȞIJȚĮʌİȡıȓįĮ
ʌĮȜȚȞįȡȠȝİȓĮȣIJȩȝĮIJĮʌȐȞȦțȐIJȦ
‡ ȉȠʌȜȒțIJȡȠ6ZLQJĮʌİȞİȡȖȠʌȠȚİȓIJĮȚȩIJĮȞIJȠ
țȜȚȝĮIJȚıIJȚțȩİȓȞĮȚĮʌİȞİȡȖȠʌȠȚȘȝȑȞȠĮțȩȝĮ
țĮȚĮȞȑȤİȚȡȣșȝȚıIJİȓȘȜİȚIJȠȣȡȖȓĮ7LPHU2Q
ȋȡȠȞȠįȚĮțȩʌIJȘȢİȞİȡȖȠʌȠȓȘıȘȢ
‡ ȂȘȜİȚIJȠȣȡȖİȓIJİIJȠțȜȚȝĮIJȚıIJȚțȩȖȚĮȝİȖȐȜȠ
ȤȡȠȞȚțȩįȚȐıIJȘȝĮȝİIJȘȞțĮIJİȪșȣȞıȘȡȠȒȢ
ĮȑȡĮȡȣșȝȚıȝȑȞȘʌȡȠȢIJĮțȐIJȦıIJȘȜİȚIJȠȣȡȖȓĮ
&22/ȌȊȄǾȒ'(+80,',)<ǹĭȊīȇǹȃȈǾ
ǻȚĮijȠȡİIJȚțȐȝʌȠȡİȓȞĮįȘȝȚȠȣȡȖȘșİȓ
ıȣȝʌȪțȞȦıȘıIJȘȞİʌȚijȐȞİȚĮIJȘȢȠȡȚȗȩȞIJȚĮȢ
ʌİȡıȓįĮȢțĮȚȞĮıIJȐȟİȚıIJȠįȐʌİįȠȒıIJĮȑʌȚʌȜĮ
55
‡ ȂȘȝİIJĮțȚȞİȓIJİȤİȚȡȠțȓȞȘIJĮIJȘȞȠȡȚȗȩȞIJȚĮ
ʌİȡıȓįĮȋȡȘıȚȝȠʌȠȚİȓIJİʌȐȞIJĮIJȠ
ʌȜȒțIJȡȠ6ZLQJǾȤİȚȡȠțȓȞȘIJȘȝİIJĮțȓȞȘıȘ
IJȘȢʌİȡıȓįĮȢȝʌȠȡİȓȞĮʌȡȠțĮȜȑıİȚ
įȣıȜİȚIJȠȣȡȖȓĮțĮIJȐIJȘȜİȚIJȠȣȡȖȓĮǼȐȞ
ʌĮȡȠȣıȚĮıIJİȓįȣıȜİȚIJȠȣȡȖȓĮIJȘȢʌİȡıȓįĮȢ
ĮʌİȞİȡȖȠʌȠȚȒıIJİIJȠțȜȚȝĮIJȚıIJȚțȩțĮȚ
İʌĮȞİțțȚȞȒıIJİIJȠ
‡ ǾȖȦȞȓĮĮȞȠȓȖȝĮIJȠȢIJȘȢȠȡȚȗȩȞIJȚĮȢʌİȡıȓįĮȢ
įİȞʌȡȑʌİȚȞĮİȓȞĮȚʌȠȜȪȝȚțȡȒțĮșȫȢ
ȝʌȠȡİȓȞĮȝİȚȦșİȓȘĮʌȩįȠıȘȥȪȟȘȢȒ
șȑȡȝĮȞıȘȢȜȩȖȦIJȘȢʌȠȜȪʌİȡȚȠȡȚıȝȑȞȘȢ
ʌİȡȚȠȤȒȢȡȠȒȢIJȠȣĮȑȡĮ
‡ ȂȘȜİȚIJȠȣȡȖİȓIJİIJȠțȜȚȝĮIJȚıIJȚțȩȝİIJȘȞ
ȠȡȚȗȩȞIJȚĮʌİȡıȓįĮıIJȘȞțȜİȚıIJȒșȑıȘ
‡ ǵIJĮȞIJȠțȜȚȝĮIJȚıIJȚțȩıȣȞįİșİȓıIJȘȞȘȜİțIJȡȚțȒ
IJȡȠijȠįȠıȓĮĮȡȤȚțȒȜİȚIJȠȣȡȖȓĮȘȠȡȚȗȩȞIJȚĮ
ʌİȡıȓįĮȝʌȠȡİȓȞĮʌĮȡĮȖȐȖİȚȑȞĮȞȒȤȠȖȚĮ
įİȣIJİȡȩȜİʌIJĮʌȡȩțİȚIJĮȚȖȚĮijȣıȚȠȜȠȖȚțȒ
ȜİȚIJȠȣȡȖȓĮ
ȁİȚIJȠȣȡȖȓĮȑțIJĮțIJȘȢĮȞȐȖțȘȢ
ǵIJĮȞIJȠIJȘȜİȤİȚȡȚıIJȒȡȚȠȑȤİȚȤĮșİȓȒįİȞȜİȚIJȠȣȡȖİȓ
ȤȡȘıȚȝȠʌȠȚȒıIJİIJȠȤİȚȡȠțȓȞȘIJȠįȚĮțȩʌIJȘıIJȘȞ
İıȦIJİȡȚțȒȝȠȞȐįĮȉȠțȜȚȝĮIJȚıIJȚțȩșĮȜİȚIJȠȣȡȖȒıİȚ
ıIJȘȜİȚIJȠȣȡȖȓĮ$872ǹȊȉȅȂǹȉǾțĮȚįİȞİȓȞĮȚ
įȣȞĮIJȒȘĮȜȜĮȖȒIJȘȢȡȪșȝȚıȘȢIJȘȢșİȡȝȠțȡĮıȓĮȢȒ
IJȘȢIJĮȤȪIJȘIJĮȢIJȠȣĮȞİȝȚıIJȒȡĮ
‡ ȆĮIJȒıIJİʌȐȜȚIJȠțȠȣȝʌȓȤİȚȡȠțȓȞȘIJȠȣİȜȑȖȤȠȣȖȚĮ
ȞĮĮʌİȞİȡȖȠʌȠȚȒıİIJİIJȠțȜȚȝĮIJȚıIJȚțȩ
ȅIJȡȩʌȠȢȜİȚIJȠȣȡȖȓĮȢʌĮȡĮIJȓșİIJĮȚıIJȠȞʌĮȡĮțȐIJȦ
ʌȓȞĮțĮ
ȁİȚIJȠȣȡȖȓĮ
ȂȠȞIJȑȜȠ
ȇȪșȝȚıȘ
șİȡȝȠțȡĮıȓĮȢ
ȇȠȒĮȑȡĮ
$872ǹȊȉȅȂǹȉǾ
ǹȃȉȁǿǹȈ
ĬǼȇȂȅȉǾȉǹȈ
ƒ&
&22/ȌȊȄǾ
)$1ǹȃǼȂǿȈȉǾȇǹȈ
$872ǹȊȉȅȂǹȉǾ
ǹȃȉȁǿǹȈ
ĬǼȇȂȅȉǾȉǹȈ
ƒ&
+($7ĬǼȇȂǹȃȈǾ
)$1ǹȃǼȂǿȈȉǾȇǹȈ
ĬİȡȝȠțȡĮıȓĮȜİȚIJȠȣȡȖȓĮȢ
ǼȪȡȠȢșİȡȝȠțȡĮıȓĮȢȜİȚIJȠȣȡȖȓĮȢ
ǼıȦIJİȡȚțȒʌȜİȣȡȐ
ȄȘȡȠȪȣȖȡȠȪ
ȕȠȜȕȠȪ°&
ǼȟȦIJİȡȚțȒʌȜİȣȡȐ
ȄȘȡȠȪȣȖȡȠȪ
ȕȠȜȕȠȪ°&
ȂȑȖȚıIJȘȥȪȟȘ
ǼȜȐȤȚıIJȘȥȪȟȘ
ȂȑȖȚıIJȘșȑȡȝĮȞıȘ
ǼȜȐȤȚıIJȘ
șȑȡȝĮȞıȘ
ȉȠİȪȡȠȢIJȘȢșİȡȝȠțȡĮıȓĮȢȜİȚIJȠȣȡȖȓĮȢİȟȦIJİȡȚțȒ
șİȡȝȠțȡĮıȓĮȖȚĮIJȠȝȠȞIJȑȜȠȝȩȞȠȥȪȟȘȢİȓȞĮȚ
ž&až&ȖȚĮIJȠȝȠȞIJȑȜȠĮȞIJȜȓĮȢșİȡȝȩIJȘIJĮȢİȓȞĮȚ
ž&až&
ǼȐȞIJȠțȜȚȝĮIJȚıIJȚțȩȤȡȘıȚȝȠʌȠȚİȓIJĮȚİțIJȩȢIJȦȞ
ʌĮȡĮʌȐȞȦȠȡȓȦȞȝʌȠȡİȓȞĮİȞİȡȖȠʌȠȚȘșȠȪȞ
ȠȡȚıȝȑȞĮȤĮȡĮțIJȘȡȚıIJȚțȐʌȡȠıIJĮıȓĮȢĮıijĮȜİȓĮȢ
țĮȚȞĮʌȡȠțĮȜȑıȠȣȞįȣıȜİȚIJȠȣȡȖȓĮIJȘȢȝȠȞȐįĮȢ
ǺȑȜIJȚıIJȘȜİȚIJȠȣȡȖȓĮ
īȚĮȞĮİʌȚIJİȣȤșİȓȘȕȑȜIJȚıIJȘĮʌȩįȠıȘıȘȝİȚȫıIJİ
‡ ȇȣșȝȓıIJİıȦıIJȐIJȘȞțĮIJİȪșȣȞıȘȡȠȒȢIJȠȣĮȑȡĮȫıIJİ
ȞĮȝȘȞİȓȞĮȚıIJȡĮȝȝȑȞȘİʌȐȞȦıİȐIJȠȝĮ
ȀȠȣȝʌȓ
ȤİȚȡȠțȓȞȘIJȠȣ
İȜȑȖȤȠȣ
‡ ȇȣșȝȓıIJİIJȘșİȡȝȠțȡĮıȓĮȖȚĮȞĮİʌȚIJİȣȤșİȓIJȠ
ȝȑȖȚıIJȠİʌȓʌİįȠȐȞİıȘȢȂȘȡȣșȝȓȗİIJİIJȘȝȠȞȐįĮıİ
ȣʌİȡȕȠȜȚțȐİʌȓʌİįĮșİȡȝȠțȡĮıȓĮȢ
‡ ȀȜİȓıIJİIJȚȢʌȩȡIJİȢțĮȚIJĮʌĮȡȐșȣȡĮțĮIJȐIJȘ
ȜİȚIJȠȣȡȖȓĮ&22/ȌȊȄǾȒ+($7ĬǼȇȂǹȃȈǾ
įȚĮijȠȡİIJȚțȐȘĮʌȩįȠıȘIJȠȣʌȡȠȧȩȞIJȠȢșĮȝİȚȦșİȓ
ȀȠȣȝʌȓȤİȚȡȠțȓȞȘIJȠȣ
İȜȑȖȤȠȣ
‡ ȆĮIJȒıIJİIJȠțȠȣȝʌȓȤİȚȡȠțȓȞȘIJȠȣİȜȑȖȤȠȣȖȚĮȞĮ
ȝİIJĮȕİȓIJİıIJȘȜİȚIJȠȣȡȖȓĮ$872ǹȊȉȅȂǹȉǾȉȠ
țȜȚȝĮIJȚıIJȚțȩİʌȚȜȑȖİȚIJȘȜİȚIJȠȣȡȖȓĮ&22/ȌȊȄǾ
+($7ĬǼȇȂǹȃȈǾȝȩȞȠıIJȠȝȠȞIJȑȜȠĮȞIJȜȓĮȢ
șİȡȝȩIJȘIJĮȢțĮȚ)$1ǹȃǼȂǿȈȉǾȇǹȈĮȣIJȩȝĮIJĮ
ıȪȝijȦȞĮȝİIJȘșİȡȝȠțȡĮıȓĮįȦȝĮIJȓȠȣȖȚĮȞĮ
İʌȚIJİȣȤșİȓȘȕȑȜIJȚıIJȘȐȞİıȘ
56
‡ ȋȡȘıȚȝȠʌȠȚȒıIJİIJĮʌȜȒțIJȡĮ7LPHU2QțĮȚ7LPHU2II
ıIJȠIJȘȜİȤİȚȡȚıIJȒȡȚȠȖȚĮȞĮİʌȚȜȑȟİIJİIJȘȞİʌȚșȣȝȘIJȒ
ȫȡĮİȞİȡȖȠʌȠȓȘıȘȢțĮȚĮʌİȞİȡȖȠʌȠȓȘıȘȢ
‡ ȂȘȞIJȠʌȠșİIJİȓIJİĮȞIJȚțİȓȝİȞĮțȠȞIJȐıIJȚȢİȚıȩįȠȣȢȒ
İȟȩįȠȣȢĮȑȡĮțĮșȫȢȘĮʌȠįȠIJȚțȩIJȘIJĮIJȠȣʌȡȠȧȩȞIJȠȢ
ȝʌȠȡİȓȞĮȝİȚȦșİȓțĮȚIJȠțȜȚȝĮIJȚıIJȚțȩȞĮıIJĮȝĮIJȒıİȚ
ȞĮȜİȚIJȠȣȡȖİȓ
‡ ȀĮșĮȡȓȗİIJİIJĮijȓȜIJȡĮĮȑȡĮIJĮțIJȚțȐįȚĮijȠȡİIJȚțȐȘ
ĮʌȩįȠıȘIJȘȢȥȪȟȘȢȒșȑȡȝĮȞıȘȢȝʌȠȡİȓȞĮȝİȚȦșİȓ
ȀĮșĮȡȚıȝȩȢțĮȚıȣȞIJȒȡȘıȘ
ȈȣȞIJȒȡȘıȘ
ȅȚʌĮȡĮțȐIJȦİȡȖĮıȓİȢıȣȞIJȒȡȘıȘȢʌȡȑʌİȚȞĮİțIJİȜȠȪȞIJĮȚIJĮțIJȚțȐ
ȈIJȠȚȤİȓĮ
ǼȡȖĮıȓİȢıȣȞIJȒȡȘıȘȢ
ȈȣȞȚıIJȫȝİȞȘıȣȤȞȩIJȘIJĮ
ĭȓȜIJȡȠıțȩȞȘȢ
ȀĮșĮȡȚıȝȩȢ
ȀȐșİȝȒȞĮȒʌȚȠıȣȤȞȐİȐȞĮʌĮȚIJİȓIJĮȚ
ĭȓȜIJȡĮȣȖȚİȚȞȠȪĮȑȡĮ
ǹȞIJȚțĮIJȐıIJĮıȘ
țĮșĮȡȚıȝȩȢ
ȀȐșİȝȒȞİȢȒʌȚȠıȣȤȞȐİȐȞĮʌĮȚIJİȓIJĮȚ
ȆİȡȓȕȜȘȝĮȝȠȞȐįĮȢ
ȀĮșĮȡȚıȝȩȢ
ȀȐșİȝȒȞĮȒʌȚȠıȣȤȞȐİȐȞĮʌĮȚIJİȓIJĮȚ
ǻȓıțȠȢȞİȡȠȪ
țĮȚıȦȜȒȞȦıȘ
İțțȑȞȦıȘȢ
ȀĮșĮȡȚıȝȩȢțĮȚ
ȑȜİȖȤȠȢȖȚĮİȝʌȩįȚĮ
ȀȐșİİʌȠȤȒʌȡȚȞĮʌȩIJȘȞȑȞĮȡȟȘȜİȚIJȠȣȡȖȓĮȢ
ǼıȦIJİȡȚțȑȢ
țĮȚİȟȦIJİȡȚțȑȢ
ıİȡʌĮȞIJȓȞİȢ
ȀĮșĮȡȚıȝȩȢ
ȀȐșİİʌȠȤȒʌȡȚȞĮʌȩIJȘȞȑȞĮȡȟȘȜİȚIJȠȣȡȖȓĮȢ
*ǾİȡȖĮıȓĮʌȡȑʌİȚȞĮʌȡĮȖȝĮIJȠʌȠȚȘșİȓȝȩȞȠĮʌȩİȟİȚįȚțİȣȝȑȞȠʌȡȠıȦʌȚțȩ
ǑǒǐdžNJDžǐǑǐǀLjǔLj
‡ ǻȚĮțȩȥIJİIJȘȜİȚIJȠȣȡȖȓĮIJȠȣțȜȚȝĮIJȚıIJȚțȠȪțĮȚ
ĮʌȠıȣȞįȑıIJİIJȘȞȘȜİțIJȡȚțȒIJȡȠijȠįȠıȓĮʌȡȚȞ
ĮʌȩIJȠȞțĮșĮȡȚıȝȩ
ȀĮșĮȡȚıȝȩȢİıȦIJİȡȚțȒȢ
ȝȠȞȐįĮȢțĮȚIJȘȜİȤİȚȡȚıIJȘȡȓȠȣ
‡ ȋȡȘıȚȝȠʌȠȚȒıIJİȑȞĮıIJİȖȞȩʌĮȞȓȖȚĮȞĮıțȠȣʌȓıİIJİ
IJȘȞİıȦIJİȡȚțȒȝȠȞȐįĮțĮȚIJȠIJȘȜİȤİȚȡȚıIJȒȡȚȠ
‡ ȂʌȠȡİȓIJİȞĮȤȡȘıȚȝȠʌȠȚȒıİIJİȑȞĮʌĮȞȓȕȡİȖȝȑȞȠȝİ
țȡȪȠȞİȡȩȖȚĮIJȘȞİıȦIJİȡȚțȒȝȠȞȐįĮĮȞİȓȞĮȚʌȠȜȪ
ȕȡȩȝȚțȘ
ǺȡĮȤȓȠȞĮȢ
țĮȜȪȝȝĮIJȠȢ
ȈȘțȫıIJİIJȠȝʌȡȠıIJȚȞȩțȐȜȣȝȝĮIJȘȢİıȦIJİȡȚțȒȢ
ȝȠȞȐįĮȢıİȖȦȞȓĮȑȦȢȩIJȠȣıIJĮȝĮIJȒıİȚȝİʌȜȒȡȘ
ȣʌȠıIJȒȡȚȟȘĮʌȩIJȠȕȡĮȤȓȠȞĮ
‡ ȉȠȝʌȡȠıIJȚȞȩțȐȜȣȝȝĮIJȘȢİıȦIJİȡȚțȒȢȝȠȞȐįĮȢ
ȝʌȠȡİȓȞĮĮijĮȚȡİșİȓțĮȚȞĮțĮșĮȡȚıIJİȓȝİȞİȡȩȈIJȘ
ıȣȞȑȤİȚĮıțȠȣʌȓıIJİȝİȑȞĮıIJİȖȞȩʌĮȞȓ
‡ ȂȘȤȡȘıȚȝȠʌȠȚİȓIJİȕȠȪȡIJıİȢȖȣĮȜȩȤĮȡIJȠȒ
ıIJȚȜȕȦIJȚțȐȖȚĮȞĮțĮșĮȡȓıİIJİIJȘȝȠȞȐįĮțĮșȫȢ
ȝʌȠȡİȓȞĮʌȡȠțȜȘșȠȪȞȕȜȐȕİȢ
‡ ȂȘȤȡȘıȚȝȠʌȠȚİȓIJİȤȘȝȚțȫȢİʌİȟİȡȖĮıȝȑȞȠʌĮȞȓȒ
ȟİıțȠȞȚıIJȒȡȚȖȚĮȞĮțĮșĮȡȓıİIJİIJȘȝȠȞȐįĮ
‡ ȂȘȤȡȘıȚȝȠʌȠȚİȓIJİȕİȞȗȓȞȘȞȑijIJȚıțȩȞȘ
ȖȣĮȜȓıȝĮIJȠȢȒʌĮȡȩȝȠȚĮįȚĮȜȣIJȚțȐȖȚĮIJȠȞ
țĮșĮȡȚıȝȩȂʌȠȡİȓȞĮʌȡȠțĮȜȑıȠȣȞȡȦȖȝȑȢȒ
ʌĮȡĮȝȩȡijȦıȘIJȘȢʌȜĮıIJȚțȒȢİʌȚijȐȞİȚĮȢ
ȁĮȕȒijȓȜIJȡȠȣıțȩȞȘȢ
ȆȚȐıIJİIJȘȜĮȕȒIJȠȣijȓȜIJȡȠȣıțȩȞȘȢțĮȚıȘțȫıIJİ
IJȠİȜĮijȡȐȖȚĮȞĮIJȠĮijĮȚȡȑıİIJİĮʌȩIJȘȕȐıȘIJȠȣ
ijȓȜIJȡȠȣ
‡ ȆȠIJȑȝȘȤȡȘıȚȝȠʌȠȚİȓIJİȗİıIJȩȞİȡȩȐȞȦIJȦȞ&
ȖȚĮȞĮțĮșĮȡȓıİIJİIJȠȝʌȡȠıIJȚȞȩțȐȜȣȝȝĮȝʌȠȡİȓȞĮ
ʌȡȠțȜȘșİȓʌĮȡĮȝȩȡijȦıȘȒĮʌȠȤȡȦȝĮIJȚıȝȩȢ
ȀĮșĮȡȚıȝȩȢIJȦȞijȓȜIJȡȦȞ
ȈȘȝİȓȦıȘǾʌĮȡȠȤȒȡİȪȝĮIJȠȢʌȡȑʌİȚȞĮȑȤİȚ
ĮʌȠıȣȞįİșİȓʌȡȚȞĮʌȩIJȠȞțĮșĮȡȚıȝȩ
DzȞĮijȡĮȖȝȑȞȠijȓȜIJȡȠıțȩȞȘȢȝİȚȫȞİȚIJȘȞ
ĮʌȠįȠIJȚțȩIJȘIJĮȥȪȟȘȢșȑȡȝĮȞıȘȢIJȘȢȝȠȞȐįĮȢ
ȀĮșĮȡȓȗİIJİIJȠijȓȜIJȡȠțȐșİȝȒȞĮȒʌȚȠıȣȤȞȐİȐȞ
ĮʌĮȚIJİȓIJĮȚ
ȈIJȘıȣȞȑȤİȚĮIJȡĮȕȒȟIJİIJȠijȓȜIJȡȠıțȩȞȘȢʌȡȠȢ
IJĮțȐIJȦȖȚĮȞĮIJȠĮijĮȚȡȑıİIJİĮʌȩIJȘȞİıȦIJİȡȚțȒ
ȝȠȞȐįĮ
57
ĭȓȜIJȡȠıțȩȞȘȢ
ǑǒǐdžNJDžǐǑǐǀLjǔLj
ȂȘȞĮȖȖȓȗİIJİȒİʌȚȤİȚȡȒıİIJİȞĮ
țĮșĮȡȓıİIJİIJȘȖİȞȞȒIJȡȚĮȥȣȤȡȠȪ
ʌȜȐıȝĮIJȠȢİȐȞįȚĮIJȓșİIJĮȚȂʌȠȡİȓ
ȞĮʌȡȠțȜȘșİȓȘȜİțIJȡȠʌȜȘȟȓĮ
īİȞȚțȒıȣȞIJȒȡȘıȘ
ȀĮșĮȡȓıIJİIJȠijȓȜIJȡȠıțȩȞȘȢȝİIJȘȞȘȜİțIJȡȚțȒ
ıțȠȪʌĮȒȞİȡȩțĮȚıIJİȖȞȫıIJİIJȠıİȑȞĮ
įȡȠıİȡȩȝȑȡȠȢ
ǼȐȞIJȠțȜȚȝĮIJȚıIJȚțȩįİȞʌȡȩțİȚIJĮȚȞĮȤȡȘıȚȝȠʌȠȚȘșİȓ
ȖȚĮʌĮȡĮIJİIJĮȝȑȞȠįȚȐıIJȘȝĮ
‡ ȁİȚIJȠȣȡȖȒıIJİIJȠțȜȚȝĮIJȚıIJȚțȩıİȜİȚIJȠȣȡȖȓĮȝȩȞȠ
)$1ǹȃǼȂǿȈȉǾȇǹȈȖȚĮaȫȡİȢȖȚĮȞĮ
ıIJİȖȞȫıİȚʌȜȒȡȦȢȘȝȠȞȐįĮ
ĭȓȜIJȡȠıțȩȞȘȢ
‡ ǹʌİȞİȡȖȠʌȠȚȒıIJİIJȘȝȠȞȐįĮțĮȚĮijĮȚȡȑıIJİIJȠijȚȢ
IJȡȠijȠįȠıȓĮȢǹijĮȚȡȑıIJİIJȚȢȝʌĮIJĮȡȓİȢĮʌȩIJȠ
IJȘȜİȤİȚȡȚıIJȒȡȚȠ
ĭȓȜIJȡȠȣȖȚİȚȞȠȪ
ĮȑȡĮ
‡ ǾİȟȦIJİȡȚțȒȝȠȞȐįĮĮʌĮȚIJİȓʌİȡȚȠįȚțȒıȣȞIJȒȡȘıȘ
țĮȚțĮșĮȡȚıȝȩȂȘȞİʌȚȤİȚȡȒıİIJİȞĮİțIJİȜȑıİIJİ
ĮȣIJȑȢIJȚȢİȡȖĮıȓİȢȝȩȞȠȚıĮȢǼʌȚțȠȚȞȦȞȒıIJİȝİ
IJȠȞĮȞIJȚʌȡȩıȦʌȠȒIJȠȞIJİȤȞȚțȩIJȠȣıȑȡȕȚȢ
ȉĮijȓȜIJȡĮijȡİıțĮȡȓıȝĮIJȠȢȣȖȚİȚȞȠȪĮȑȡĮĮȞ
įȚĮIJȓșİȞIJĮȚȩʌȦȢIJȠijȓȜIJȡȠİȞİȡȖȠȪȐȞșȡĮțĮijȓȜIJȡȠ
%,2ijȓȜIJȡȠȕȚIJĮȝȓȞȘȢ&ijȓȜIJȡȠȚȩȞIJȦȞĮȡȖȪȡȠȣİȓȞĮȚ
ıIJİȡİȦȝȑȞĮʌȐȞȦıIJȠijȓȜIJȡȠıțȩȞȘȢ
ǹijĮȚȡȑıIJİIJĮijȓȜIJȡĮȣȖȚİȚȞȠȪĮȑȡĮĮʌȩIJȠʌȜĮȓıȚȠ
ıIJȒȡȚȟȘȢIJȠȣijȓȜIJȡȠȣıțȩȞȘȢ
ȀĮșĮȡȓȗİIJİIJĮijȓȜIJȡĮȣȖȚİȚȞȠȪĮȑȡĮIJȠȣȜȐȤȚıIJȠȞțȐșİ
IJȡİȚȢȝȒȞİȢțĮȚĮȞIJȚțĮșȚıIJȐIJİIJĮțȐșİȝȒȞİȢ
DzȜİȖȤȠȚʌȡȚȞĮʌȩIJȘȜİȚIJȠȣȡȖȓĮ
‡ ǼȜȑȖȟIJİȩIJȚȘțĮȜȦįȓȦıȘįİȞȑȤİȚijșĮȡİȓȒ
ĮʌȠıȣȞįİșİȓ
‡ ǼȜȑȖȟIJİȩIJȚIJȠijȓȜIJȡȠıțȩȞȘȢİȓȞĮȚİȖțĮIJİıIJȘȝȑȞȠ
‡ ǼȜȑȖȟIJİĮȞȘȑȟȠįȠȢȒȘİȓıȠįȠȢĮȑȡĮ
İȓȞĮȚijȡĮȖȝȑȞȘĮȞIJȠțȜȚȝĮIJȚıIJȚțȩįİȞȑȤİȚ
ȤȡȘıȚȝȠʌȠȚȘșİȓȖȚĮȝİȖȐȜȠįȚȐıIJȘȝĮ
ȀĮșĮȡȓıIJİIJĮȝİȘȜİțIJȡȚțȒıțȠȪʌĮİȐȞİȓȞĮȚİijȚțIJȩ
ǑǒǐdžNJDžǐǑǐǀLjǔLj
‡ ȂȘȞĮȖȖȓȗİIJİIJĮȝİIJĮȜȜȚțȐȝȑȡȘIJȘȢȝȠȞȐįĮȢ
țĮIJȐIJȘȞĮijĮȓȡİıȘIJȠȣijȓȜIJȡȠȣȂʌȠȡİȓȞĮ
ʌȡȠțȜȘșȠȪȞIJȡĮȣȝĮIJȚıȝȠȓțĮIJȐIJȠȤİȚȡȚıȝȩ
ĮȚȤȝȘȡȫȞȝİIJĮȜȜȚțȫȞȐțȡȦȞ
ǼȖțĮIJĮıIJȒıIJİʌȐȜȚIJĮijȓȜIJȡĮ
ijȡİıțĮȡȓıȝĮIJȠȢȣȖȚİȚȞȠȪĮȑȡĮ
ıIJȘșȑıȘIJȠȣȢ
‡ ȂȘȤȡȘıȚȝȠʌȠȚİȓIJİȞİȡȩȖȚĮIJȠȞțĮșĮȡȚıȝȩ
IJȠȣİıȦIJİȡȚțȠȪIJȠȣțȜȚȝĮIJȚıIJȚțȠȪǾȑțșİıȘ
ıİȞİȡȩȝʌȠȡİȓȞĮțĮIJĮıIJȡȑȥİȚIJȘȝȩȞȦıȘ
ȠįȘȖȫȞIJĮȢıİʌȚșĮȞȒȘȜİțIJȡȠʌȜȘȟȓĮ
‡ ȀĮIJȐIJȠȞțĮșĮȡȚıȝȩIJȘȢȝȠȞȐįĮȢ
ȕİȕĮȚȦșİȓIJİʌȡȫIJĮȩIJȚȘȘȜİțIJȡȚțȒ
IJȡȠijȠįȠıȓĮțĮȚȠĮıijĮȜİȚȠįȚĮțȩʌIJȘȢ
İȓȞĮȚțȜİȚıIJȐ
ȉȠʌȠșİIJȒıIJİIJȠȐȞȦIJȝȒȝĮIJȦȞijȓȜIJȡȦȞ
ĮȑȡĮıIJȘșȑıȘIJȠȣıIJȘȝȠȞȐįĮʌȡȠıȑȤȠȞIJĮȢ
ȘĮȡȚıIJİȡȒțĮȚįİȟȚȐȐțȡȘȞĮİȓȞĮȚ
İȣșȣȖȡĮȝȝȚıȝȑȞȘıȦıIJȐțĮȚIJȠʌȠșİIJȒıIJİIJĮ
ijȓȜIJȡĮıțȩȞȘȢıIJȘșȑıȘIJȠȣȢ
58
ȈȣȝȕȠȣȜȑȢȜİȚIJȠȣȡȖȓĮȢ
ȉĮʌĮȡĮțȐIJȦıȣȝȕȐȞIJĮȝʌȠȡİȓȞĮʌȡȠțȪȥȠȣȞțĮIJȐ
IJȘįȚȐȡțİȚĮIJȘȢțĮȞȠȞȚțȒȢȜİȚIJȠȣȡȖȓĮȢ
ȆȡȠıIJĮıȓĮIJȠȣțȜȚȝĮIJȚıIJȚțȠȪ
‡ ȆȡȠıIJĮıȓĮIJȠȣıȣȝʌȚİıIJȒ
ǻİȞİȓȞĮȚİijȚțIJȒȘİʌĮȞİțțȓȞȘıȘIJȠȣıȣȝʌȚİıIJȒ
ȖȚĮȜİʌIJȐĮijȠȪįȚĮțȠʌİȓȘȜİȚIJȠȣȡȖȓĮIJȠȣ
‡ ȆȡȠıIJĮıȓĮțĮIJȐIJȠȣʌĮȖȫȝĮIJȠȢ
ǼȐȞȘȝȠȞȐįĮȜİȚIJȠȣȡȖİȓıIJȘȜİȚIJȠȣȡȖȓĮ
&22/ȌȊȄǾțĮȚıİȤĮȝȘȜȒșİȡȝȠțȡĮıȓĮ
ʌİȡȚȕȐȜȜȠȞIJȠȢȝʌȠȡİȓȞĮıȤȘȝĮIJȚıIJİȓʌȐȖȠȢ
ıIJȠȞİȞĮȜȜȐțIJȘșİȡȝȩIJȘIJĮȢǵIJĮȞȘİıȦIJİȡȚțȒ
șİȡȝȠțȡĮıȓĮIJȠȣİȞĮȜȜȐțIJȘșİȡȝȩIJȘIJĮȢ
ȝİȚȦșİȓțȐIJȦĮʌȩIJȠȣȢƒ&ȠıȣȝʌȚİıIJȒȢșĮ
ıIJĮȝĮIJȒıİȚȞĮȜİȚIJȠȣȡȖİȓȖȚĮʌȡȠıIJĮıȓĮIJȘȢ
ȝȠȞȐįĮȢ
‡ ǹʌȩȥȣȟȘ
ȂʌȠȡİȓȞĮıȤȘȝĮIJȚıIJİȓʌȐȖȠȢıIJȘȞİȟȦIJİȡȚțȒ
ȝȠȞȐįĮțĮIJȐIJȘȜİȚIJȠȣȡȖȓĮșȑȡȝĮȞıȘȢȩIJĮȞȘ
İȟȦIJİȡȚțȒșİȡȝȠțȡĮıȓĮİȓȞĮȚȤĮȝȘȜȒĮȜȜȐȘ
ȣȖȡĮıȓĮİȓȞĮȚȣȥȘȜȒȝİĮʌȠIJȑȜİıȝĮIJȘȝİȓȦıȘ
IJȘȢĮʌȠįȠIJȚțȩIJȘIJĮȢșȑȡȝĮȞıȘȢ
ȈİĮȣIJȒIJȘȞʌİȡȓʌIJȦıȘIJȠțȜȚȝĮIJȚıIJȚțȩșĮ
įȚĮțȩȥİȚIJȘȜİȚIJȠȣȡȖȓĮșȑȡȝĮȞıȘȢțĮȚșĮĮȡȤȓıİȚ
ĮȣIJȩȝĮIJĮIJȘȞĮʌȩȥȣȟȘȅȤȡȩȞȠȢĮʌȩȥȣȟȘȢ
ȝʌȠȡİȓȞĮʌȠȚțȓȜȜİȚĮʌȩȑȦȢȜİʌIJȐ
ȀĮIJȐIJȘįȚȐȡțİȚĮIJȘȢĮʌȩȥȣȟȘȢIJĮȝȠIJȑȡ
ĮȞİȝȚıIJȒȡĮIJȘȢİıȦIJİȡȚțȒȢȝȠȞȐįĮȢțĮȚIJȘȢ
İȟȦIJİȡȚțȒȢȝȠȞȐįĮȢıIJĮȝĮIJȠȪȞȘȑȞįİȚȟȘIJȘȢ
İıȦIJİȡȚțȒȢȝȠȞȐįĮȢĮȞĮȕȠıȕȒȞİȚȝİIJȠ©+ª
țĮȚȘİȟȦIJİȡȚțȒȝȠȞȐįĮİȞįȑȤİIJĮȚȞĮȕȖȐȗİȚ
ĮIJȝȠȪȢǹȣIJȩįİȞĮʌȠIJİȜİȓįȣıȜİȚIJȠȣȡȖȓĮ
ǹijȠȪȠȜȠțȜȘȡȦșİȓȘĮʌȩȥȣȟȘȘȜİȚIJȠȣȡȖȓĮ
șȑȡȝĮȞıȘȢșĮĮʌȠțĮIJĮıIJĮșİȓĮȣIJȩȝĮIJĮ
‡ ȆȡȠıIJĮıȓĮĮʌȩIJȠȞțȡȪȠĮȑȡĮ
ȈIJȘȜİȚIJȠȣȡȖȓĮ+($7ĬǼȇȂǹȃȈǾȠ
ĮȞİȝȚıIJȒȡĮȢIJȘȢİıȦIJİȡȚțȒȢȝȠȞȐįĮȢįİȞ
șĮȜİȚIJȠȣȡȖȒıİȚʌȡȠțİȚȝȑȞȠȣȞĮĮʌȠijİȣȤșİȓ
ȘİȓıȠįȠȢțȡȪȠȣĮȑȡĮıIJȠįȦȝȐIJȚȠİȞIJȩȢ
ȜİʌIJȫȞĮȞȠİȞĮȜȜȐțIJȘȢșİȡȝȩIJȘIJĮȢIJȘȢ
İıȦIJİȡȚțȒȢȝȠȞȐįĮȢįİȞİʌȚIJȪȤİȚȝȚĮİȜȐȤȚıIJȘ
șİȡȝȠțȡĮıȓĮıIJȚȢʌĮȡĮțȐIJȦʌİȡȚʌIJȫıİȚȢ
ǾȜİȚIJȠȣȡȖȓĮșȑȡȝĮȞıȘȢȝȩȜȚȢȟİțȓȞȘıİ
ȂȩȜȚȢȠȜȠțȜȘȡȦșİȓȘĮȣIJȩȝĮIJȘĮʌȩȥȣȟȘ
ĬȑȡȝĮȞıȘıİȤĮȝȘȜȒșİȡȝȠțȡĮıȓĮ
ǹʌĮȜȒĮȪȡĮ
ǾİıȦIJİȡȚțȒȝȠȞȐįĮȝʌȠȡİȓȞĮijȣıȐİȚȝȚĮĮʌĮȜȒ
ĮȪȡĮțĮȚȘʌİȡıȓįĮȞĮıIJȡĮijİȓıİıȣȖțİțȡȚȝȑȞȘ
șȑıȘıIJȚȢʌĮȡĮțȐIJȦʌİȡȚʌIJȫıİȚȢ
ȈIJȘȜİȚIJȠȣȡȖȓĮ+($7ĬǼȇȂǹȃȈǾȘ
ȝȠȞȐįĮİȞİȡȖȠʌȠȚİȓIJĮȚțĮȚȠıȣȝʌȚİıIJȒȢįİȞ
İʌȚIJȣȖȤȐȞİȚIJȚȢıȣȞșȒțİȢİțțȓȞȘıȘȢ
ȈIJȘȜİȚIJȠȣȡȖȓĮ+($7ĬǼȇȂǹȃȈǾ
İʌȚIJȣȖȤȐȞİIJĮȚȘȡȣșȝȚıȝȑȞȘIJȚȝȒIJȘȢ
șİȡȝȠțȡĮıȓĮȢțĮȚįȚĮțȩʌIJİIJĮȚȘȜİȚIJȠȣȡȖȓĮIJȠȣ
ıȣȝʌȚİıIJȒȖȚĮʌİȡȓʌȠȣȜİʌIJȩ
ȂȚĮȜİȣțȒʌȐȤȞȘȕȖĮȓȞİȚĮʌȩIJȘȞİıȦIJİȡȚțȒ
ȝȠȞȐįĮ
‡ ȂʌȠȡİȓȞĮıȤȘȝĮIJȚıIJİȓȜİȣțȒʌȐȤȞȘȜȩȖȦIJȘȢ
ȝİȖȐȜȘȢįȚĮijȠȡȐȢșİȡȝȠțȡĮıȓĮȢȝİIJĮȟȪIJȘȢ
İȚıȩįȠȣĮȑȡĮțĮȚIJȘȢİȟȩįȠȣĮȑȡĮıIJȘȜİȚIJȠȣȡȖȓĮ
&22/ȌȊȄǾıİİıȦIJİȡȚțȩʌİȡȚȕȐȜȜȠȞʌȠȣȑȤİȚ
ȣȥȘȜȒıȤİIJȚțȒȣȖȡĮıȓĮ
‡ ȂʌȠȡİȓȞĮıȤȘȝĮIJȚıIJİȓȜİȣțȒʌȐȤȞȘȜȩȖȦIJȘȢ
ȣȖȡĮıȓĮȢʌȠȣįȘȝȚȠȣȡȖİȓIJĮȚĮʌȩIJȘįȚĮįȚțĮıȓĮ
ĮʌȩȥȣȟȘȢȩIJĮȞIJȠțȜȚȝĮIJȚıIJȚțȩʌȡĮȖȝĮIJȠʌȠȚİȓ
İʌĮȞİțțȓȞȘıȘıIJȘȜİȚIJȠȣȡȖȓĮ+($7ĬǼȇȂǹȃȈǾ
ȝİIJȐĮʌȩĮʌȩȥȣȟȘ
ȋĮȝȘȜȩȢșȩȡȣȕȠȢIJȠȣțȜȚȝĮIJȚıIJȚțȠȪ
‡ ȂʌȠȡİȓȞĮĮțȠȪȖİIJĮȚȑȞĮȢȤĮȝȘȜȩȢıȣȡȚȖȝȩȢ
ȩIJĮȞȜİȚIJȠȣȡȖİȓȠıȣȝʌȚİıIJȒȢȒȝȩȜȚȢįȚĮțȠʌİȓȘ
ȜİȚIJȠȣȡȖȓĮIJȠȣǹȣIJȩȢİȓȞĮȚȠȒȤȠȢIJȘȢȡȠȒȢIJȠȣ
ȥȣțIJȚțȠȪȒIJȘȢȡȠȒȢʌȠȣıIJĮȝĮIJȐİȚ
‡ ȂʌȠȡİȓİʌȓıȘȢȞĮĮțȠȪȖİIJĮȚȑȞĮȤĮȝȘȜȩIJȡȓȟȚȝȠ
ȩIJĮȞȜİȚIJȠȣȡȖİȓȠıȣȝʌȚİıIJȒȢȒȝȩȜȚȢįȚĮțȠʌİȓȘ
ȜİȚIJȠȣȡȖȓĮIJȠȣǹȣIJȩʌȡȠțĮȜİȓIJĮȚĮʌȩIJȘșİȡȝȚțȒ
įȚĮıIJȠȜȒțĮȚIJȘıȣıIJȠȜȒȥȪȟȘȢIJȦȞʌȜĮıIJȚțȫȞ
ȝİȡȫȞIJȘȢȝȠȞȐįĮȢțĮșȫȢĮȜȜȐȗİȚȘșİȡȝȠțȡĮıȓĮ
‡ ȂʌȠȡİȓȞĮĮțȠȣıIJİȓȑȞĮȢșȩȡȣȕȠȢțĮșȫȢȘʌİȡıȓįĮ
İʌĮȞȑȡȤİIJĮȚıIJȘȞĮȡȤȚțȒIJȘȢșȑıȘțĮIJȐIJȘȞĮȡȤȚțȒ
İȞİȡȖȠʌȠȓȘıȘIJȘȢȝȠȞȐįĮȢ
ǺȖĮȓȞİȚıțȩȞȘĮʌȩIJȘȞİıȦIJİȡȚțȒȝȠȞȐįĮ
ǹȣIJȩİȓȞĮȚijȣıȚȠȜȠȖȚțȩȩIJĮȞIJȠțȜȚȝĮIJȚıIJȚțȩįİȞȑȤİȚ
ȤȡȘıȚȝȠʌȠȚȘșİȓȖȚĮȝİȖȐȜȠȤȡȠȞȚțȩįȚȐıIJȘȝĮȒțĮIJȐ
IJȘȞʌȡȫIJȘȤȡȒıȘIJȘȢȝȠȞȐįĮȢ
ȂȚĮʌİȡȓİȡȖȘȝȣȡȦįȚȐĮȞĮįȪİIJĮȚĮʌȩIJȘȞ
İıȦIJİȡȚțȒȝȠȞȐįĮ
ǹȣIJȩʌȡȠțĮȜİȓIJĮȚȩIJĮȞȘİıȦIJİȡȚțȒȝȠȞȐįĮĮȞĮįȪİȚ
ȝȣȡȦįȚȑȢʌȠȣIJȘȞȑȤȠȣȞįȚĮʌȠIJȓıİȚĮʌȩȠȚțȠįȠȝȚțȐ
ȣȜȚțȐȑʌȚʌȜĮȒțĮʌȞȩ
ȉȠțȜȚȝĮIJȚıIJȚțȩȝİIJĮȕĮȓȞİȚıIJȘȜİȚIJȠȣȡȖȓĮȝȩȞȠ
)$1ǹȃǼȂǿȈȉǾȇǹȈĮʌȩIJȘȜİȚIJȠȣȡȖȓĮ&22/
ȌȊȄǾȒ+($7ĬǼȇȂǹȃȈǾ
ǵIJĮȞİʌȚIJȣȖȤȐȞİIJĮȚȘIJȚȝȒȡȪșȝȚıȘȢIJȘȢİıȦIJİȡȚțȒȢ
șİȡȝȠțȡĮıȓĮȢȠıȣȝʌȚİıIJȒȢıIJĮȝĮIJȐİȚĮȣIJȩȝĮIJĮ
țĮȚIJȠțȜȚȝĮIJȚıIJȚțȩȝİIJĮȕĮȓȞİȚıIJȘȜİȚIJȠȣȡȖȓĮ)$1
ǹȃǼȂǿȈȉǾȇǹȈ
ȅıȣȝʌȚİıIJȒȢșĮȟİțȚȞȒıİȚʌȐȜȚȩIJĮȞȘİıȦIJİȡȚțȒ
șİȡȝȠțȡĮıȓĮĮȞȑȕİȚıIJȘȜİȚIJȠȣȡȖȓĮ&22/ȌȊȄǾȒ
ʌȑıİȚıIJȘȜİȚIJȠȣȡȖȓĮ+($7ĬǼȇȂǹȃȈǾĮʌȩIJȘȞ
IJȚȝȒȡȪșȝȚıȘȢ
ȈȣȝʌȪțȞȦıȘ
ǼȓȞĮȚʌȚșĮȞȩȞĮıȤȘȝĮIJȚıIJİȓıȣȝʌȪțȞȦıȘıIJȘȞȑȟȠįȠ
ĮȑȡĮĮȞʌȡĮȖȝĮIJȠʌȠȚİȓIJĮȚȥȪȟȘȒĮijȪȖȡĮȞıȘȖȚĮ
ȝİȖȐȜȠȤȡȠȞȚțȩįȚȐıIJȘȝĮȩIJĮȞȘıȤİIJȚțȒȣȖȡĮıȓĮ
İȓȞĮȚʌȐȞȦĮʌȩȝİIJȚȢʌȩȡIJİȢțĮȚIJĮʌĮȡȐșȣȡĮ
ĮȞȠȚțIJȐ
ȇȣșȝȓıIJİIJȘȞțȐșİIJȘʌİȡıȓįĮıIJȘȝȑȖȚıIJȘȖȦȞȓĮIJȘȢ
ʌȡȠȢIJȠįȐʌİįȠțĮȚIJȘȞȣȥȘȜȒIJĮȤȪIJȘIJĮĮȞİȝȚıIJȒȡĮ
ȀȜİȓıIJİIJȚȢʌȩȡIJİȢțĮȚIJĮʌĮȡȐșȣȡĮ
ǹıIJȡĮʌȑȢȒȘȜİȚIJȠȣȡȖȓĮİȞȩȢĮıȪȡȝĮIJȠȣIJȘȜİijȫȞȠȣ
ĮȣIJȠțȚȞȒIJȠȣıİțȠȞIJȚȞȒĮʌȩıIJĮıȘȝʌȠȡİȓȞĮ
ʌȡȠțĮȜȑıȠȣȞįȣıȜİȚIJȠȣȡȖȓĮIJȘȢȝȠȞȐįĮȢ
ǹʌȠıȣȞįȑıIJİIJȘȝȠȞȐįĮĮʌȩIJȘȞIJȡȠijȠįȠıȓĮțĮȚ
ıIJȘıȣȞȑȤİȚĮİʌĮȞĮıȣȞįȑıIJİIJȘȝȠȞȐįĮȝİIJȘȞ
IJȡȠijȠįȠıȓĮȆĮIJȒıIJİIJȠʌȜȒțIJȡȠ212))ıIJȠ
IJȘȜİȤİȚȡȚıIJȒȡȚȠȖȚĮȞĮȟİțȚȞȒıİȚʌȐȜȚȘȜİȚIJȠȣȡȖȓĮ
ȁİȚIJȠȣȡȖȓĮ;)DQǹȞİȝȚıIJȒȡĮȢȋ
ǾİıȦIJİȡȚțȒȝȠȞȐįĮȝʌȠȡİȓȞĮıȣȞİȤȓıİȚȞĮȜİȚIJȠȣȡȖİȓ
ĮijȠȪĮʌİȞİȡȖȠʌȠȚȒıİIJİIJȘȝȠȞȐįĮʌĮIJȫȞIJĮȢIJȠ
ʌȜȒțIJȡȠ212))
ǼȜȑȖȟIJİĮȞȘȜİȚIJȠȣȡȖȓĮ;)DQǹȞİȝȚıIJȒȡĮȢȋİȓȞĮȚ
ĮʌİȞİȡȖȠʌȠȚȘȝȑȞȘ
59
ǹȞIJȚȝİIJȫʌȚıȘʌȡȠȕȜȘȝȐIJȦȞ
ȉȠțȜȚȝĮIJȚıIJȚțȩįİȞȝʌȠȡİȓȞĮİʌȚıțİȣĮıIJİȓĮʌȩIJȠȤȡȒıIJȘǾİıijĮȜȝȑȞȘİʌȚıțİȣȒȝʌȠȡİȓȞĮ
ʌȡȠțĮȜȑıİȚȘȜİțIJȡȠʌȜȘȟȓĮȒʌȣȡțĮȖȚȐǼʌȚțȠȚȞȦȞȒıIJİȝİİȟȠȣıȚȠįȠIJȘȝȑȞȠțȑȞIJȡȠıȑȡȕȚȢȖȚĮ
İʌĮȖȖİȜȝĮIJȚțȒİʌȚıțİȣȒ
ǑǒǐdžNJDžǐǑǐǀLjǔLj
ǹȞʌĮȡȠȣıȚĮıIJİȓȝȚĮĮʌȩIJȚȢʌĮȡĮțȐIJȦțĮIJĮıIJȐıİȚȢįȚĮțȩȥIJİĮȝȑıȦȢIJȘ
ȜİȚIJȠȣȡȖȓĮIJȠȣțȜȚȝĮIJȚıIJȚțȠȪĮʌȠıȣȞįȑıIJİIJȘȞIJȡȠijȠįȠıȓĮțĮȚİʌȚțȠȚȞȦȞȒıIJİ
ȝİIJȠİȟȠȣıȚȠįȠIJȘȝȑȞȠțȑȞIJȡȠıȑȡȕȚȢ
‡ ǼȐȞİȝijĮȞȚıIJİȓțȦįȚțȩȢıijȐȜȝĮIJȠȢıIJȘȞ
ȠșȩȞȘIJȘȢİıȦIJİȡȚțȒȢȝȠȞȐįĮȢ
‡ ȃİȡȩȒȐȜȜȠȣȖȡȩȑȤİȚʌȚIJıȚȜȓıİȚIJȠİıȦIJİȡȚțȩIJȘȢ
ȝȠȞȐįĮȢ
‡ ǾȑȞįİȚȟȘȜİȚIJȠȣȡȖȓĮȢȒȐȜȜȘȑȞįİȚȟȘ
ĮȞĮȕȠıȕȒȞİȚȖȡȒȖȠȡĮțĮȚįİȞıȕȒȞİȚȝİ
IJȘȞĮʌȠıȪȞįİıȘțĮȚİʌĮȞĮıȪȞįİıȘIJȘȢ
IJȡȠijȠįȠıȓĮȢ
‡ ǹțȠȪȖİIJĮȚȑȞĮȢıțȜȘȡȩȢȒȤȠȢțĮIJȐIJȘįȚȐȡțİȚĮIJȘȢ
ȜİȚIJȠȣȡȖȓĮȢ
‡ DzȤİȚʌĮȡȠȣıȚĮıIJİȓįȚĮȡȡȠȒȞİȡȠȪĮʌȩIJȘȝȠȞȐįĮ
‡ ǹȞĮįȪȠȞIJĮȚȑȞIJȠȞİȢȠıȝȑȢțĮIJȐIJȘįȚȐȡțİȚĮIJȘȢ
ȜİȚIJȠȣȡȖȓĮȢ
‡ ǾĮıijȐȜİȚĮțĮȓȖİIJĮȚıȣȤȞȐȒʌȑijIJİȚıȣȤȞȐȠ
ĮıijĮȜİȚȠįȚĮțȩʌIJȘȢ
‡ ȉȠțĮȜȫįȚȠIJȡȠijȠįȠıȓĮȢțĮȚIJȠijȚȢIJȡȠijȠįȠıȓĮȢ
ȑȤȠȣȞȣʌİȡșİȡȝĮȞșİȓ
‡ DZȜȜİȢȝȘijȣıȚȠȜȠȖȚțȑȢțĮIJĮıIJȐıİȚȢ
ǾʌȓİıȘıIJȠıȪıIJȘȝĮȥȪȟȘȢİȓȞĮȚȤĮȝȘȜȒțĮȚȝʌȠȡİȓȞĮʌȡȠțĮȜȑıİȚȕȜȐȕȘIJȘȢȝȠȞȐįĮȢ
ǽȘIJȒıIJİĮʌȩȑȞĮȞʌȚıIJȠʌȠȚȘȝȑȞȠİȖțĮIJĮıIJȐIJȘȞĮIJȘȡȣșȝȓıİȚ
ǻȣıȜİȚIJȠȣȡȖȓİȢ
ǾȝȠȞȐįĮįİȞIJȓșİIJĮȚ
ıİȜİȚIJȠȣȡȖȓĮ
ǾȝȠȞȐįĮįİȞ
ȥȪȤİȚȒșİȡȝĮȓȞİȚ
İȐȞįȚĮIJȓșİIJĮȚIJȠ
įȦȝȐIJȚȠʌȠȜȪțĮȜȐ
İȞȫȡȑİȚĮȑȡĮȢĮʌȩ
IJȠțȜȚȝĮIJȚıIJȚțȩ
ǹȚIJȓĮ
ǼȞȑȡȖİȚİȢıIJȚȢȠʌȠȓİȢʌȡȑʌİȚȞĮ
ʌȡȠȕİȓIJİ
ǻȚĮțȠʌȒȡİȪȝĮIJȠȢ
ȆİȡȚȝȑȞİIJİȞĮİʌĮȞȑȜșİȚIJȠ
ȡİȪȝĮ
ǼȞįȑȤİIJĮȚȞĮȑȤİȚĮʌȠıȣȞįİșİȓȘ
ȝȠȞȐįĮ
ǼȜȑȖȟIJİȩIJȚIJȠijȚȢİȓȞĮȚ
IJȠʌȠșİIJȘȝȑȞȠțĮȜȐıIJȘȞʌȡȓȗĮ
IJȠȓȤȠȣ
ǼȞįȑȤİIJĮȚȞĮȑȤİȚțĮİȓȘĮıijȐȜİȚĮ
ǹȞIJȚțĮIJĮıIJȒıIJİIJȘȞĮıijȐȜİȚĮ
ǾIJȐıȘİȓȞĮȚʌȠȜȪȣȥȘȜȒȒʌȠȜȪ
ȤĮȝȘȜȒ
ǽȘIJȒıIJİĮʌȩİʌĮȖȖİȜȝĮIJȓĮȞĮ
İȜȑȖȟİȚIJȘȞIJȐıȘ
ǼȞįȑȤİIJĮȚȞĮȑȤȠȣȞİȟĮȞIJȜȘșİȓȠȚ
ȝʌĮIJĮȡȓİȢıIJȠIJȘȜİȤİȚȡȚıIJȒȡȚȠ
ǹȞIJȚțĮIJĮıIJȒıIJİIJȚȢȝʌĮIJĮȡȓİȢ
ǾȫȡĮʌȠȣȑȤİIJİȠȡȓıİȚȝİIJȠ
ȤȡȠȞȠįȚĮțȩʌIJȘįİȞİȓȞĮȚıȦıIJȒ
ȆİȡȚȝȑȞİIJİȒĮțȣȡȫıIJİIJȘ
ȡȪșȝȚıȘIJȠȣȤȡȠȞȠįȚĮțȩʌIJȘ
ǹțĮIJȐȜȜȘȜȘȡȪșȝȚıȘșİȡȝȠțȡĮıȓĮȢ
ȇȣșȝȓıIJİıȦıIJȐIJȘșİȡȝȠțȡĮıȓĮ
īȚĮȜİʌIJȠȝȑȡİȚİȢĮȞĮIJȡȑȟIJİ
ıIJȘȞİȞȩIJȘIJĮ©ȋȡȒıȘIJȠȣ
IJȘȜİȤİȚȡȚıIJȘȡȓȠȣª
ȉȠijȓȜIJȡȠĮȑȡĮİȓȞĮȚijȡĮȖȝȑȞȠ
ȀĮșĮȡȓıIJİIJȠijȓȜIJȡȠĮȑȡĮ
ȆȩȡIJİȢȒʌĮȡȐșȣȡĮİȓȞĮȚĮȞȠȚȤIJȐ
ȀȜİȓıIJİIJȚȢʌȩȡIJİȢȒIJĮ
ʌĮȡȐșȣȡĮ
ǾİȓıȠįȠȢȒȑȟȠįȠȢĮȑȡĮIJȘȢ
İıȦIJİȡȚțȒȢȒİȟȦIJİȡȚțȒȢȝȠȞȐįĮȢİȓȞĮȚ
ijȡĮȖȝȑȞȘ
ǹʌȠȝĮțȡȪȞİIJİʌȡȫIJĮIJĮİȝʌȩįȚĮ
țĮȚıIJȘıȣȞȑȤİȚĮİʌĮȞİțțȚȞȒıIJİIJȘ
ȝȠȞȐįĮ
DzȤİȚİȞİȡȖȠʌȠȚȘșİȓȘʌȡȠıIJĮıȓĮ
ȜİʌIJȫȞIJȠȣıȣȝʌȚİıIJȒ
ȆİȡȚȝȑȞİIJİȖȚĮȜİʌIJȐ
ǼȐȞIJȠʌȡȩȕȜȘȝĮįİȞįȚȠȡșȦșİȓİʌȚțȠȚȞȦȞȒıIJİȝİIJȠȞIJȠʌȚțȩĮȞIJȚʌȡȩıȦʌȠȒIJȠʌȜȘıȚȑıIJİȡȠțȑȞIJȡȠ
İȟȣʌȘȡȑIJȘıȘȢʌİȜĮIJȫȞĭȡȠȞIJȓıIJİȞĮIJȠȣȢİȞȘȝİȡȫıİIJİȝİȜİʌIJȠȝȑȡİȚİȢȖȚĮIJȘįȣıȜİȚIJȠȣȡȖȓĮțĮȚIJȠ
ȝȠȞIJȑȜȠIJȘȢȝȠȞȐįĮȢ
60
ȅȚʌĮȡĮțȐIJȦȑȜİȖȤȠȚʌȡȚȞĮʌȩIJȘȞİʌȚțȠȚȞȦȞȓĮȝʌȠȡİȓȞĮıĮȢİȟȠȚțȠȞȠȝȒıȠȣȞȤȡȩȞȠțĮȚȤȡȒȝĮ
ǻȣıȜİȚIJȠȣȡȖȓİȢ
ǹȚIJȓĮ
ǾȝȠȞȐįĮįİȞ
ȜİȚIJȠȣȡȖİȓ
ǾȝȠȞȐįĮįİȞȜİȚIJȠȣȡȖİȓİȐȞ
İȞİȡȖȠʌȠȚȘșİȓĮȝȑıȦȢȝİIJȐIJȘȞ
ĮʌİȞİȡȖȠʌȠȓȘıȒIJȘȢǹȣIJȩȖȓȞİIJĮȚȖȚĮ
ʌȡȠıIJĮıȓĮIJȘȢȝȠȞȐįĮȢȆİȡȚȝȑȞİIJİ
ȖȚĮʌİȡȓʌȠȣȜİʌIJȐ
ǹȞĮįȪȠȞIJĮȚ
ȠıȝȑȢ
‡ȂʌȠȡİȓȞĮĮȞĮįȣșȠȪȞȠıȝȑȢĮʌȩ
IJȘȞİıȦIJİȡȚțȒȝȠȞȐįĮǹȣIJȩİȓȞĮȚ
ĮʌȠIJȑȜİıȝĮȠıȝȫȞIJȠȣįȦȝĮIJȓȠȣ
ȩʌȦȢĮʌȩIJĮȑʌȚʌȜĮIJıȚȖȐȡĮ
țȜʌʌȠȣȑȤȠȣȞİȚıȑȜșİȚıIJȘ
ȝȠȞȐįĮ
‡ȈȣȝȕȠȣȜİȣIJİȓIJİȑȞĮ
İȟȠȣıȚȠįȠIJȘȝȑȞȠțȑȞIJȡȠıȑȡȕȚȢ
ȖȚĮIJȠȞțĮșĮȡȚıȝȩİȐȞȠȚȠıȝȑȢ
ʌĮȡĮȝȑȞȠȣȞ
ĬȩȡȣȕȠȢ©ȡȠȒȢ
ȞİȡȠȪª
DzȞĮȢıȣȡȚıIJȚțȩȢșȩȡȣȕȠȢıĮȞȞİȡȩ
ʌȠȣȡȑİȚİȓȞĮȚIJȠȥȣțIJȚțȩʌȠȣȡȑİȚ
ıIJȠİıȦIJİȡȚțȩIJȘȢȝȠȞȐįĮȢ
ǺȖĮȓȞİȚʌȐȤȞȘ
ıIJȘȜİȚIJȠȣȡȖȓĮ
&22/ȌȊȄǾ
ȀĮIJȐIJȘȜİȚIJȠȣȡȖȓĮȥȪȟȘȢȝʌȠȡİȓȞĮ
įİȓIJİȝȚĮİȜĮijȡȚȐʌȐȤȞȘȞĮȕȖĮȓȞİȚ
ĮʌȩIJȘȞİıȦIJİȡȚțȒȝȠȞȐįĮȜȩȖȦIJȘȢ
ȣȥȘȜȒȢșİȡȝȠțȡĮıȓĮȢțĮȚȣȖȡĮıȓĮȢ
IJȠȣįȦȝĮIJȓȠȣ
ȂİIJȐĮʌȩȜȓȖȠȘʌȐȤȞȘșĮ
İȟĮijĮȞȚıIJİȓțĮșȫȢȝİȚȫȞİIJĮȚȘ
șİȡȝȠțȡĮıȓĮțĮȚȘȣȖȡĮıȓĮIJȠȣ
įȦȝĮIJȓȠȣ
ȅȟȪȢțȡȩIJȠȢ
ǹȣIJȩȢİȓȞĮȚȠȒȤȠȢIJȘȢIJȡȚȕȒȢʌȠȣ
ʌȡȠțĮȜİȓIJĮȚĮʌȩIJȘįȚĮıIJȠȜȒȒțĮȚ
ıȣıIJȠȜȒIJȠȣțĮȜȪȝȝĮIJȠȢȒȐȜȜȦȞ
IJȝȘȝȐIJȦȞȜȩȖȦIJȘȢĮȜȜĮȖȒȢIJȘȢ
șİȡȝȠțȡĮıȓĮȢ
ǻİȞİȓȞĮȚİijȚțIJȒ
ȘİțțȓȞȘıȘIJȘȢ
ȝȠȞȐįĮȢ
‡ȊʌȐȡȤİȚįȚĮțȠʌȒȡİȪȝĮIJȠȢ
‡DzȤİȚȤĮȜĮȡȫıİȚIJȠijȚȢIJȡȠijȠįȠıȓĮȢ
İȐȞįȚĮIJȓșİIJĮȚ
‡DzȤİȚİȞİȡȖȠʌȠȚȘșİȓȠȝȘȤĮȞȚıȝȩȢ
ʌȡȠıIJĮıȓĮȢțȣțȜȫȝĮIJȠȢ
‡ǼȓȞĮȚȘIJȐıȘȣȥȘȜȩIJİȡȘȒ
ȤĮȝȘȜȩIJİȡȘİȜȑȖȤİIJĮȚĮʌȩ
İʌĮȖȖİȜȝĮIJȓİȢ
‡DzȤİȚȤȡȘıȚȝȠʌȠȚȘșİȓıȦıIJȐȠ
ȤȡȠȞȠįȚĮțȩʌIJȘȢ
‡DzȤȠȣȞIJİȜİȚȫıİȚȠȚȝʌĮIJĮȡȓİȢ
‡ǼȓȞĮȚıȦıIJȒȘȡȪșȝȚıȘIJȘȢ
șİȡȝȠțȡĮıȓĮȢ
‡ǼȓȞĮȚijȡĮȖȝȑȞȘȘİȓıȠįȠȢȑȟȠįȠȢ
ĮȑȡĮ
ǾĮʌȩįȠıȘ
‡ǼȓȞĮȚȕȡȩȝȚțȠIJȠijȓȜIJȡȠ
ȥȪȟȘȢ
șȑȡȝĮȞıȘȢİȓȞĮȚ ‡ǼȓȞĮȚĮȞȠȚȤIJȒțȐʌȠȚĮʌȩȡIJĮȒ
țȐʌȠȚȠʌĮȡȐșȣȡȠ
ĮȞİʌĮȡțȒȢ
‡DzȤİȚȡȣșȝȚıIJİȓȤĮȝȘȜȐȘIJĮȤȪIJȘIJĮ
IJȠȣĮȞİȝȚıIJȒȡĮ
‡ȊʌȐȡȤȠȣȞʌȘȖȑȢșİȡȝȩIJȘIJĮȢıIJȠ
įȦȝȐIJȚȠ
ǻȣıȜİȚIJȠȣȡȖȓİȢ
ǹȚIJȓĮ
ǻȚĮȡȡȠȒȞİȡȠȪ
IJȘȢİıȦIJİȡȚțȒȢ
ȝȠȞȐįĮȢ
‡ǾȣȖȡĮıȓĮİȓȞĮȚʌȠȜȪȣȥȘȜȒ
‡ȉȠȞİȡȩıȣȝʌȣțȞȫȝĮIJȠȢ
ȣʌİȡȤİȚȜȓȗİȚ
‡ȅİȪțĮȝʌIJȠȢıȦȜȒȞĮȢ
ĮʌȠıIJȡȐȖȖȚıȘȢȑȤİȚȤĮȜĮȡȫıİȚȒ
İȓȞĮȚijȡĮȖȝȑȞȠȢ
ǻȚĮȡȡȠȒȞİȡȠȪ
IJȘȢİȟȦIJİȡȚțȒȢ
ȝȠȞȐįĮȢ
‡ȀĮIJȐIJȘȜİȚIJȠȣȡȖȓĮȥȪȟȘȢIJȠ
ȞİȡȩıȣȝʌȣțȞȫȞİIJĮȚȖȪȡȦĮʌȩ
IJȠȣȢıȦȜȒȞİȢțĮȚIJȚȢİȞȫıİȚȢIJȦȞ
ıȣȞįȑıİȦȞ
‡ȀĮIJȐIJȘȜİȚIJȠȣȡȖȓĮĮʌȩȥȣȟȘȢIJȠ
ȞİȡȩʌȠȣȟİʌĮȖȫȞİȚȡȑİȚʌȡȠȢIJĮ
ȑȟȦ
‡ȀĮIJȐIJȘȜİȚIJȠȣȡȖȓĮșȑȡȝĮȞıȘȢIJȠ
ȞİȡȩıIJȠȞİȞĮȜȜȐțIJȘșİȡȝȩIJȘIJĮȢ
ıIJȐȗİȚ
ĬȩȡȣȕȠȢĮʌȩ
IJȘȞİıȦIJİȡȚțȒ
ȝȠȞȐįĮ
‡ȅșȩȡȣȕȠȢʌĮȡȐȖİIJĮȚȩIJĮȞ
ȠĮȞİȝȚıIJȒȡĮȢȒIJȠȡİȜȑIJȠȣ
ıȣȝʌȚİıIJȒİȞİȡȖȠʌȠȚİȓIJĮȚȒ
ĮʌİȞİȡȖȠʌȠȚİȓIJĮȚ
‡ǵIJĮȞȟİțȚȞȐİȚȒıIJĮȝĮIJȐİȚȘ
ȜİȚIJȠȣȡȖȓĮĮʌȩȥȣȟȘȢĮțȠȪȖİIJĮȚȠ
ȒȤȠȢȡȠȒȢIJȠȣȥȣțIJȚțȠȪʌȡȠȢIJȘȞ
ĮȞIJȓșİIJȘțĮIJİȪșȣȞıȘ
ǻİȞİȟȑȡȤİIJĮȚ
ĮȑȡĮȢĮʌȩ
IJȘȞİıȦIJİȡȚțȒ
ȝȠȞȐįĮ
‡ȈIJȘȜİȚIJȠȣȡȖȓĮ+($7ĬǼȇȂǹȃȈǾ
ȩIJĮȞȘșİȡȝȠțȡĮıȓĮIJȠȣİıȦIJİȡȚțȠȪ
İȞĮȜȜȐțIJȘșİȡȝȩIJȘIJĮȢİȓȞĮȚʌȠȜȪ
ȤĮȝȘȜȒȘȡȠȒIJȠȣĮȑȡĮįȚĮțȩʌIJİIJĮȚ
ȖȚĮIJȘȞĮʌȠijȣȖȒİȚıȩįȠȣțȡȪȠȣ
ĮȑȡĮȖȚĮȜİʌIJȐ
‡ȈIJȘȜİȚIJȠȣȡȖȓĮ+($7ĬǼȇȂǹȃȈǾ
ȩIJĮȞȘİȟȦIJİȡȚțȒșİȡȝȠțȡĮıȓĮİȓȞĮȚ
ȤĮȝȘȜȒȒȘȣȖȡĮıȓĮİȓȞĮȚȣȥȘȜȒ
ıȤȘȝĮIJȓȗİIJĮȚʌȐȖȠȢıIJȠȞİȟȦIJİȡȚțȩ
İȞĮȜȜȐțIJȘșİȡȝȩIJȘIJĮȢǾȝȠȞȐįĮ
șĮʌȡĮȖȝĮIJȠʌȠȚȒıİȚĮʌȩȥȣȟȘ
ĮȣIJȩȝĮIJĮțĮȚȘİıȦIJİȡȚțȒȝȠȞȐįĮ
șĮıIJĮȝĮIJȒıİȚȞĮȕȖȐȗİȚĮȑȡĮȖȚĮ
ȜİʌIJȐ
‡ȀĮIJȐIJȘȜİȚIJȠȣȡȖȓĮĮʌȩȥȣȟȘȢ
ȝʌȠȡİȓȞĮįȘȝȚȠȣȡȖȘșİȓȞİȡȩȒ
ĮIJȝȩȢ
‡ȈIJȘȜİȚIJȠȣȡȖȓĮ'(+80,',)<
ǹĭȊīȇǹȃȈǾȠİıȦIJİȡȚțȩȢ
ĮȞİȝȚıIJȒȡĮȢșĮıIJĮȝĮIJȒıİȚȞĮ
țȣțȜȠijȠȡİȓIJȠȞĮȑȡĮȖȚĮ
ȜİʌIJȐʌȡȠțİȚȝȑȞȠȣȞĮĮʌȠijİȣȤșİȓ
ȘİțȞȑȠȣİȟȐIJȝȚıȘIJȠȣȞİȡȠȪ
ıȣȝʌȣțȞȫȝĮIJȠȢ
ȊȖȡĮıȓĮıIJȘȞ
ȑȟȠįȠĮȑȡĮ
ǼȐȞȘȝȠȞȐįĮȜİȚIJȠȣȡȖİȓıİ
ʌİȡȚȕȐȜȜȠȞȝİȣȥȘȜȒȣȖȡĮıȓĮȖȚĮ
ȝİȖȐȜȠȤȡȠȞȚțȩįȚȐıIJȘȝĮȝʌȠȡİȓ
ȞĮįȘȝȚȠȣȡȖȘșİȓȣȖȡĮıȓĮıIJȘȖȡȓȜȚĮ
İȟȩįȠȣĮȑȡĮȘȠʌȠȓĮıIJȘıȣȞȑȤİȚĮ
șĮıIJȐȟİȚ
ȀȦįȚțȩȢ
ıijȐȜȝĮIJȠȢ+
ĮʌȩȥȣȟȘ
ǹȣIJȩİȓȞĮȚijȣıȚȠȜȠȖȚțȩǾȝȠȞȐįĮ
ȕȡȓıțİIJĮȚıİȜİȚIJȠȣȡȖȓĮĮʌȩȥȣȟȘȢ
țĮȚȘȜİȚIJȠȣȡȖȓĮșȑȡȝĮȞıȘȢșĮ
ıȣȞİȤȚıIJİȓıȪȞIJȠȝĮ
ȂȘȞĮʌȠȡȡȓʌIJİIJİIJȠʌȡȠȧȩȞĮȣIJȩıIJȠȣȢțȐįȠȣȢ
ĮʌȠȡȡȚȝȝȐIJȦȞIJȠȣįȒȝȠȣǹʌĮȚIJİȓIJĮȚȟİȤȦȡȚıIJȒıȣȜȜȠȖȒ
ĮȣIJȫȞIJȦȞĮʌȠȡȡȚȝȝȐIJȦȞȖȚĮİȚįȚțȒİʌİȟİȡȖĮıȓĮ
61
Indice
Congratulazioni ....................................................................63
Norme di sicurezza ..............................................................64
Descrizione del prodotto ......................................................66
Display unità interna ............................................................67
Telecomando ........................................................................67
Descrizione del telecomando ..............................................68
Indicatori del display del telecomando .................................69
Primo utilizzo .......................................................................70
Come usare il telecomando ..................................................70
Come usare l'unità interna ...................................................75
Funzionamento di emergenza .............................................76
Funzionamento ottimale .................................................... ..76
Pulizia e manutenzione .......................................................77
Suggerimenti per il funzionamento ......................................79
Risoluzione dei problemi .....................................................80
Promemoria importante
‡ 7HQHUHLOWHOHFRPDQGRLQXQSXQWRGDFXLLOVHJQDOH
SRVVDUDJJLXQJHUHLOULFHYLWRUHGHOO
XQLWjLQWHUQD
‡ 4XDQGRVLXVDLOFRQGL]LRQDWRUHYHUL¿FDUHFKHLO
WHOHFRPDQGRVWLDSXQWDQGRDOULFHYLWRUHGLVHJQDOH
GHOO
XQLWjLQWHUQD
‡ 4XDQGRLOWHOHFRPDQGRODQFLDXQVHJQDOHLOVLPEROR
ODPSHJJLDSHUFLUFDVHFRQGRVXOGLVSOD\GHO
WHOHFRPDQGR
‡ /
XQLWjLQWHUQDULFRQRVFHUjLOVHJQDOHFRQXQELSTXDQGR
ULFHYHLOVHJQDOHGDOWHOHFRPDQGR
‡ 3UHPHUHLOWDVWRGHOWHOHFRPDQGRHLQYLDUHQXRYDPHQWHLO
VHJQDOHQHOFDVRLQFXLQRQVLVLDVHQWLWRLOELSGDOO
XQLWj
LQWHUQD
62
&RQJUDWXOD]LRQL
Complimenti e grazie per aver scelto un
condizionatore split Electrolux. È un condizionatore
di qualità studiato per un uso pratico e semplice.
&RQGL]LRQLG
XVR
Prima di iniziare a usare il condizionatore, leggere
attentamente il libretto di istruzioni, contenente
la descrizione dell’apparecchiatura e delle sue
funzioni.
‡ &XFLQHGLQHJR]LXI¿FLHDOWULDPELHQWLGL
lavoro.
Come per tutte le apparecchiature elettriche, è
importante eseguire l’installazione correttamente
e leggere attentamente le avvertenze per la
sicurezza, per evitare usi impropri e condizioni di
pericolo.
‡ Clienti di hotel, motel e altri ambienti
residenziali.
Conservare questo manuale di istruzioni per
riferimenti futuri e consegnarlo al nuovo proprietario
in caso di cessione dell’apparecchiatura.
Contattare un installatore autorizzato per
installare questa apparecchiatura.
Dopo avere estratto il condizionatore
dall’imballaggio, controllare che non sia
danneggiato. In caso di dubbi, non utilizzare il
condizionatore e contattare un centro assistenza
autorizzato Electrolux.
protezione dell’ambiente
Informazioni sullo smaltimento
‡ La maggior parte dei materiali di imballaggio
è riciclabile.
‡ Consegnare questi materiali al centro di
smaltimento e riciclaggio più vicino o usare
i contenitori di raccolta appropriati.
‡ Al termine della durata utile del condizionatore,
ULYROJHUVLDOO¶XI¿FLRGLFRPSHWHQ]DORFDOHSHU
informazioni sul metodo di smaltimento corretto.
attenzione
‡ Il condizionatore non deve essere utilizzato
da bambini o da persone inferme senza la
supervisione di una persona responsabile.
‡ È consigliabile controllare che i bambini non
giochino con il condizionatore.
‡ Contattare un installatore autorizzato per
installare questo condizionatore.
L'apparecchiatura è destinata all'uso domestico e
applicazioni simili, tra cui:
‡ Fattorie.
‡ Nei bed and breakfast.
Note importanti
Contattare un tecnico autorizzato per riparare
o eseguire la manutenzione di questa
apparecchiatura.
‡ La presa di corrente deve essere collegata
da un ente autorizzato.
‡ Questa apparecchiatura non è destinata
all'uso da parte di bambini o adulti con
OLPLWDWHFDSDFLWj¿VLFKHVHQVRULDOLRPHQWDOL
o con scarsa esperienza o conoscenza
sull'uso dell'apparecchiatura stessa, a meno
che non siano sorvegliati o istruiti da una
persona responsabile della loro sicurezza.
‡ È consigliabile controllare che i bambini non
giochino con il condizionatore.
‡ Se il cavo di alimentazione è danneggiato,
può essere sostituito solo dal personale
autorizzato.
‡ I lavori di installazione possono essere
eseguiti conformemente agli standard
nazionali vigenti e alle regole dei fornitori
di corrente elettrica esclusivamente da
personale autorizzato.
‡ Prima di spostare l’unità in un altro luogo o
smaltirla, contattare il personale autorizzato.
‡ Prestare attenzione a non incastrare le dita
nella ventola durante la regolazione dei
GHÀHWWRULYHUWLFDOL
‡ Contattare un tecnico autorizzato per riparare
o eseguire la manutenzione di questa
apparecchiatura.
‡ Se il cavo di alimentazione è danneggiato,
può essere sostituito solo dal personale
autorizzato.
‡ I lavori di installazione possono essere eseguiti
conformemente agli standard nazionali vigenti
dal personale autorizzato.
63
1RUPHGLVLFXUH]]D
All’interno del manuale sono riportati molti consigli
utili per il corretto utilizzo e la manutenzione del
condizionatore. Con pochi accorgimenti preventivi
è possibile risparmiare tempo e denaro per l’intera
durata del condizionatore. Troverete molte risposte
a problemi comuni nella tabella dei suggerimenti
per la risoluzione dei problemi di pagina 80 - 81.
Analizzando prima questa tabella, potrebbe non
essere necessario richiedere l'intervento di un
tecnico.
Altri simboli usati in questo libretto:
attenzione
Suggerimenti e informazioni legate alla sicurezza
personale e alle modalità per evitare di danneggiare
l'apparecchiatura.
suggerimenti e informazioni
Questo simbolo indica la disponibilità di
suggerimenti e informazioni sull’utilizzo
dell'apparecchiatura.
protezione dell’ambiente
Questo simbolo indica la disponibilità di
suggerimenti e informazioni sull’utilizzo economico
ed ecologico dell'apparecchiatura.
Questo simbolo indica le operazioni da evitare.
Cosa fare.
1RWHLPSRUWDQWL
1 1RQD]LRQDUHO¶XQLWjFRQLGHÀHWWRULRUL]]RQWDOL
nella posizione chiusa.
2 1RQD]LRQDUHO¶XQLWjVHQ]DLO¿OWURSHUO
DULD
avvertenza
Nel caso in cui si riscontri una situazione
anomala, ad esempio odore di
bruciato, scollegare l'alimentazione al
condizionatore e contattare un agente
di servizio Electrolux. Nel caso in cui
questo stato anomalo si protragga,
il condizionatore potrebbe essere
danneggiato o produrre scosse elettriche
o fuoco.
Non utilizzare il condizionatore con le
mani bagnate. Può essere causa di
scosse elettriche.
Non danneggiare o tagliare il cavo di
alimentazione o altri cavi. Nel caso in cui
FLzVLYHUL¿FKLFKLHGHUHODULSDUD]LRQHR
la sostituzione dello stesso da parte di un
tecnico accreditato
Non collegare questo condizionatore a
una ciabatta di corrente.
Scollegare l'alimentazione al
condizionatore nel caso in cui si preveda
di non usarlo a lungo. In caso contrario
l'apparecchiatura accumulerà sporco e
potrebbe provocare un incendio.
Prima di pulire il condizionatore,
VFROOHJDUHO
DOLPHQWD]LRQHDO¿QH
di eliminare la possibilità di scosse
elettriche.
L'alimentazione dovrebbe corrispondere
a quella del condizionatore, come
da manuale di installazione. I
condizionatori forniti con un cavo di
alimentazione dovrebbero essere
collegati direttamente a una presa di
corrente con un interruttore di sicurezza
adatto. I condizionatori cablati devono
essere collegati a un interruttore di
sicurezza adeguato come da manuale di
installazione.
9HUL¿FDUHFKHO
DOLPHQWD]LRQHDO
FRQGL]LRQDWRUHVLDVWDELOHHVRGGLV¿
i requisiti delineati nel manuale di
installazione.
9HUL¿FDUHVHPSUHFKHLOSURGRWWR
disponga di una messa a terra adeguata.
Per motivi di sicurezza invitiamo a
spegnere l'interruttore del circuito
prima di eseguire eventuali interventi
di manutenzione o pulizia o quando
si prevede di non usare il prodotto a
lungo. La polvere accumulata potrebbe
provocare incendi o scosse elettriche.
64
1RUPHGLVLFXUH]]D
attenzione
Selezionare la temperatura più adeguata.
Ciò consente di risparmiare elettricità.
1RQWHQHUH¿QHVWUHHSRUWHDSHUWHDOXQJR
in fase di funzionamento. Le prestazioni
non risulterebbero soddisfacenti.
Non bloccare l'ingresso o l'uscita dell'aria.
Le prestazioni non risulterebbero
soddisfacenti con anomalie di
funzionamento.
Tenere i materiali combustibili lontani
dalle unità di almeno 1 m. Potrebbe
provocare incendi.
Non salire sopra all'unità esterna e non
appoggiare oggetti pesanti sulla stessa.
Ciò potrebbe provocare danni o lesioni.
Non cercare di riparare il condizionatore
da soli. Una riparazione sbagliata
può essere causa di scosse elettriche
o incendio. Contattare il centro di
assistenza locale autorizzato.
8VR
(VSRUVLDOÀXVVRGLUHWWRGDOFRQGL]LRQDWRUHD
lungo potrebbe provocare rischi per la salute.
Non esporre persone, animali od oggetti al
ÀXVVRGLUHWWRDOXQJR
3XOL]LDHPDQXWHQ]LRQH
1 Quando si pulisce l’apparecchiatura,
YHUL¿FDUHFKHO¶DOLPHQWD]LRQHHLOGLVJLXQWRUH
siano scollegati.
2 4XDQGRVLHVWUDHLO¿OWURGHOO¶DULDQRQ
toccare le parti metalliche dell’unità.
Attenzione a non ferirsi toccando le
SDUWLPHWDOOLFKHDI¿ODWH
3 Non pulire la parte interna del
condizionatore con acqua. L'esposizione
all'acqua potrebbe portare a scosse
elettriche.
$VVLVWHQ]D7HFQLFD
Per le operazioni di riparazione e manutenzione
rivolgersi a un centro di assistenza autorizzato.
Non inserire mani od oggetti all'interno
dell'entrata o dell'uscita dell'aria.
Potrebbe provocare lesioni.
Non esporre animali o piante
GLUHWWDPHQWHDOÀXVVRG
DULD
Non usare l'unità per altri scopi, ad
esempio conservare alimenti o asciugare
indumenti.
Non spruzzare acqua sul condizionatore.
Ciò può causare scosse elettriche o
anomalie di funzionamento.
3ULPDGHOO
XVR
1 Contattare un tecnico specializzato per
l’installazione.
2 Inserire correttamente la spina nella
presa.
3 Non utilizzare un cavo di alimentazione
danneggiato o non idoneo.
4 Non utilizzare prese multiple.
5 Non utilizzare una prolunga.
6 Non accendere/spegnere
l’apparecchiatura inserendo/estraendo
la spina dalla presa di corrente.
65
'HVFUL]LRQHGHOSURGRWWR
8QLWjLQWHUQD
Entrata aria
2
3
5
Uscita aria
6
7
8
8QLWjHVWHUQD
9
Entrata aria (posteriore)
0RGe
)Dn
7HPS
7LPHU2II
SwinJ
/LJKW
7XUER
7LPHU2Q
&ORFk
,IHHO
EcR
Entrata aria
(laterale)
Uscita aria
Pannello anteriore
Telecomando
Display digitale
Supporto telecomando
)LOWURDULDVDQDGLHWURDO¿OWURGHOODSROYHUH
Tubo del refrigerante (se disponibile)
Filtro pre-polvere
7XERÀHVVLELOHGLVFDULFRVHGLVSRQLELOH
'HÀHWWRULGHOO
DULDRUL]]RQWDOL
Cavo di alimentazione (se disponibile)
'HÀHWWRULGHOO
DULDYHUWLFDOL
3LDVWUDGL¿VVDJJLR
Generatore di plasma freddo (se disponibile)
Cavo di collegamento (se disponibile)
Tasto controllo manuale
Nota: ,GLVHJQLSUHFHGHQWLKDQQRXQLFDPHQWHXQRVFRSRHVHPSOL¿FDWLYR
,OYRVWURFRQGL]LRQDWRUHSRWUHEEHHVVHUHOHJJHUPHQWHGLYHUVR
6DUjODIRUPDGHOFRQGL]LRQDWRUHFKHVLSRVVLHGHDGDYHUHODSULRULWj
66
'LVSOD\XQLWjLQWHUQD
‡ Se si tiene il telecomando in una posizione che
impedisce la corretta trasmissione del segnale,
possono passare anche 15 minuti prima che il
segnale sia ricevuto.
Ricevitore
del segnale
,QGLFDWRUH,)HHO
Si accende quando è attivata la funzione I Feel.
,QGLFDWRUH7XUER
Si accende durante il funzionamento in
modalità Turbo.
,QGLFDWRUH(FR(FRQRP\
Si illumina quando è operativa la funzione ECO.
,QGLFDWRUHGHOODWHPSHUDWXUD
Visualizza le temperature impostate quando il
condizionatore è in funzione.
6SLDWLPHU
Questa spia si accende quando il Timer viene
ATTIVATO/DISATTIVATO.
,QGLFDWRUHGLRVFLOOD]LRQH
Si accende quando è attivata la funzione Swing
(oscillazione).
7HOHFRPDQGR
&RPHXVDUHLOWHOHFRPDQGR
‡ Puntare il telecomando sul ricevitore del segnale
dell'unità interna.
‡ 9HUL¿FDUHFKHQRQYLVLDQRRVWDFROLFKH
potrebbero interferire col segnale.
3RVL]LRQHGHOWHOHFRPDQGR
‡ Quando il telecomando lancia un segnale, il
lampeggia per circa 1 secondo sul
simbolo
display. L'unità interna conferma la ricezione del
segnale con un bip quando riceve un segnale.
attenzione
‡ Il condizionatore non funziona se tende, porte
o altri oggetti ostruiscono la ricezione dei
segnali del telecomando da parte dell’unità
interna.
‡ Evitare di versare liquidi sul telecomando. Non
esporre il telecomando alla luce diretta del sole
o a fonti di calore.
‡ Se il ricevitore dei segnali infrarossi sull’unità
interna è esposto alla luce diretta del
sole, il condizionatore può non funzionare
correttamente. Usare delle tende per evitare
che la luce solare diretta colpisca il ricevitore.
‡ Se altre apparecchiature elettriche rispondono
al telecomando, spostarle oppure consultare il
rivenditore locale.
,QVWDOOD]LRQHVRVWLWX]LRQHGHOODEDWWHULD
‡ Togliere il coperchio dell'alloggiamento delle
batterie e inserire due nuove batterie alcaline
VHFFKH[$$$YROW9HUL¿FDUHFKHOD
polarità (+) o (-) sia stata rispettata.
‡ Riposizionare il coperchio
suggerimenti e informazioni
‡ In fase di sostituzione delle batterie, non
usarne di vecchie e non mescolare batterie
di tipo diverso. Ciò potrebbe provocare dei
problemi di funzionamento al telecomando.
P
0RGe
)Dn
7HPS
7LPHU2II
SwinJ
/LJKW
7XUER
7LPHU2Q
&ORFk
,IHHO
EcR
‡ Mantenere il telecomando a una distanza tale
da potere raggiungere il ricevitore sull’unità
interna (distanza massima 8 m).
‡ Se si seleziona il funzionamento con il timer,
il telecomando trasmette automaticamente
DOO
XQLWjLQWHUQDLOVHJQDOHDOO¶RUDVSHFL¿FDWD
‡ Nel caso in cui il telecomando non venga
usato a lungo, estrarre le batterie, dato
che quelle vecchie potrebbero perdere o
corrodersi danneggiando il telecomando.
‡ La normale durata delle batterie con impiego
normale è di circa sei mesi.
‡ Nel caso in cui il telecomando non funzioni
normalmente, estrarre e inserire nuovamente
le batterie. Nel caso in cui il comportamento
anomalo continui, sostituire con batterie
nuove.
67
'HVFUL]LRQHGHOWHOHFRPDQGR
7DVWR7XUER
Premere questo tasto in modalità COOL o HEAT per
mettere la ventola in modalità Turbo ad alta velocità e il
condizionatore funzionerà alla potenza massima.
Premere nuovamente per annullare questa funzione.
7DVWRGHOODYHQWROD;;)DQ
Premere il tasto X-Fan per attivare la pulizia
automatica dell’apparecchiatura. Dopo aver spento
l’apparecchiatura, la ventola interna continuerà a
funzionare per 10 minuti per asciugare l’unità interna ed
impedire la proliferazione di batteri e muffe.
7DVWRGLDYYLRFRQLOWLPHU7LPHU2Q
0RGH
/LJKW
)DQ
7XUER
;)DQ
7DVWRGLDUUHVWRFRQLOWLPHU7LPHU2II
Premere questo tasto per impostare l’orario di
spegnimento.
7LPHU2Q
7HPS
7DVWRGLURWD]LRQH6ZLQJ
7LPHU2II
&ORFN
Premendo questo tasto, l’aletta verrà inclinata e
sollevata automaticamente. Premere di nuovo per
annullare il comando: l’aletta manterrà l’ultima
posizione assunta.
6ZLQJ
,)HHO
(FR
7DVWR212))
Premere questo tasto per ACCENDERE o
SPEGNERE il condizionatore.
7DVWRPRGDOLWj
Premendo questo tasto sarà possibile scegliere,
in sequenza, una delle seguenti modalità:
AUTO, DEHUMIDIFY, FAN, COOL, e HEAT
(solo il modello COOL non ha la funzione
HEAT).
La modalità AUTO viene impostata in
automatico all'accensione dell'apparecchiatura.
Nella modalità AUTOMATICA, il valore iniziale
non verrà visualizzato e l’apparecchiatura
funzionerà secondo la temperatura desiderata.
7DVWRWHPSHUDWXUDSHUFHSLWD,)HHO
Premendo questo tasto, il telecomando invierà le
informazioni sulla temperatura all’unità interna ogni
10 minuti. L’unità funzionerà per raggiungere la
temperatura impostata rispetto alla posizione del
telecomando. Premere di nuovo per annullare questa
funzione.
7DVWRGLFRQWUROOR&RQWURO
Avanti
Indietro
Premere questo tasto
impostata.
per aumentare la temperatura
Premere questo tasto
impostata.
per ridurre la temperatura
Nelle funzioni On/Off o Clock, utilizzare questi tasti per
impostare l’orologio o il timer.
In modalità HEAT, il valore iniziale è 28°C;
7DVWRGHOO¶RURORJLR&ORFN
Nelle altre modalità il valore iniziale è 25°C.
Premendo questo tasto, il simbolo dell’orologio inizierà
a
lampeggia. Premere il tasto Control e per
impostare l’orario desiderato.
AUTO
DEUMIDIFICAZIONE
VENTOLA
RAFFRESCAMENTO RISCALDAMENTO
7DVWR/XFH
Premere questo tasto per accendere le spie
che indicano se l'unità interna è su ON od OFF.
7DVWRGHOODWHPSHUDWXUD7HPS
La condizione normale, l'avvio, è ON.
7DVWR(FR(FRQRP\
7DVWR)$1
Premendo questo tasto, sarà possibile
selezionare, in successione, la velocità Auto,
Basso, Medio e Alto.
Premere questo tasto per attivare la modalità di
Risparmio di energia. Questa funzione è perfetta per
utilizzare la temperatura quando si dorme.
Quando l'unità viene accesa, la velocità della
YHQWRODDXWRqLPSRVWDWDLQPRGRSUHGH¿QLWR
1RWD
In modalità DEHUMIDIFY, la velocità della
ventola è impostata a bassa velocità.
68
Premere questo tasto per impostare l’orario di
accensione.
Premere questo tasto per sostituire il contenuto
visualizzato dall’unità interna relativo alla temperatura
impostata con la temperatura ambiente.
Premere di nuovo per annullare questa funzione.
In modalità riscaldamento, premere i tasti Temp e
Orologio per attivare la funzione di riscaldamento della
temperatura interna a 8°C.
,QGLFDWRUHGHOGLVSOD\GHO
WHOHFRPDQGR
,QGLFDWRUHGLWUDVPLVVLRQH
Visualizza quando il telecomando trasmette
segnali verso l'unità interna.
'LVSOD\GHOODYHORFLWjGHOODYHQWROD
Visualizza la velocità della ventola selezionata
nella seguente sequenza:
'LVSOD\7XUER
Compare quando è selezionata la funzione
Turbo.
“
'LVSOD\,)HHO
Si accende quando è attivata la funzione I
Feel.
'LVSOD\(FR
Compare quando è selezionata la funzione
Eco.
'LVSOD\+HDOWK\
Viene visualizzata quando si preme il tasto
Healthy. Premere nuovamente il tasto
Healthy per toglierla.
N.B. questo indicatore non è previsto nei
modelli senza funzione Plasma Freddo.
'LVSOD\7HPSHUDWXUDGHOODVWDQ]D
Visualizza quando la temperatura indicata
sullo schermo LCD è la temperatura della
stanza. Può essere accesa/spenta premendo
il tasto Temp.
'LVSOD\7HPSHUDWXUD3URJUDPPDWD
Si accende quando il telecomando visualizza
la temperatura impostata. Può essere
accesa/spenta premendo il tasto Temp.
'LVSOD\WLPHUDFFHVRVSHQWR
Visualizza quando la funzione Timer On/Off è
attivata.
” (Low - Bassa), “
” (Medium - Media), “
” (High - Alta) e Auto.
In velocità Auto, compare solo il simbolo " ".
'LVSOD\RVFLOOD]LRQH
Visualizza quando viene selezionata la funzione
Swing (Oscillazione).
'LVSOD\;)DQ
Visualizza quando è attivata la funzione X-Fan
premendo contemporaneamente i tasti Turbo
e Healthy (per i modelli con funzione Plasma
Freddo) oppure premendo il tasto X-Fan (per i
modelli senza funzione Plasma Freddo).
'LVSOD\GHOODWHPSHUDWXUD
Visualizza la temperatura della stanza o la
temperatura impostata in °C o °F.
Nessuna visualizzazione in modalità Fan.
'LVSOD\RUD
Visualizza l'ora dell'orologio (deve essere
impostata) e/o l'ora on/off del timer.
'LVSOD\PRGDOLWj
Visualizza la modalità operativa corrente,
compresa Auto (
), Dehumidify ( ), Fan (
Cool ( ) e Heat ( ).
),
N.B. Il modello Cool non offre l'opzione
Riscaldamento.
69
3ULPRXWLOL]]R
1 9HUL¿FDUHFKHODVSLQDGHOO¶XQLWjVLDLQVHULWDH
che vi sia corrente.
2 9HUL¿FDUHFKHOHEDWWHULHVLDQRVWDWHLQVHULWH
correttamente nel telecomando (le spie sul
telecomando sono accese).
3 Impostare l'ora con i tasti di Controllo e
confermare premendo il tasto Clock.
4 Puntare il telecomando verso l'unità interna e
premere il tasto ON/OFF per accendere l'unità.
/DPRGDOLWjGLIXQ]LRQDPHQWRSUHGH¿QLWDq
AUTO. Dopo avere selezionato la modalità
operativa col telecomando, le condizioni di
funzionamento sono memorizzate nella memoria
del microcomputer dell’unità interna. Pertanto
il condizionatore incomincia a funzionare alle
stesse condizioni semplicemente premendo il
tasto ON/OFF sul telecomando.
suggerimenti e informazioni
HQ
WR
GG
DP
IIUH
OD
5D
3 Tasti di controllo
9H
QWR
2 Tasto Modalità Premere per selezionare AUTO.
La temperatura viene regolata durante la
GHXPLGL¿FD]LRQHPHGLDQWHVXFFHVVLYDDWWLYD]LRQH
disattivazione della funzione COOLING o solo
FAN.
QWR
Premere questo tasto per accendere il
condizionatore.
L'indicatore della temperatura sul display
dell'unità interna si accende.
La modalità DEHUMIDIFY funziona sulla base
della differenza fra la temperatura impostata e la
temperatura reale della stanza.
DP
H
,QL]LR
1 Tasto ON/OFF
)XQ]LRQDPHQWRGLGHXPLGL¿FD]LRQH
IIUH
GG
Quando viene selezionata la modalità AUTO,
il condizionatore imposta automaticamente il
funzionamento COOL, HEAT (ove presente), o solo
FAN, a seconda della temperatura programmata e/o
della temperatura ambiente.
4XDQGRVLLPSRVWDODPRGDOLWj$872OD
YHORFLWjGHOODYHQWRODHODWHPSHUDWXUD
YHUUDQQRFRQWUROODWHDXWRPDWLFDPHQWH
HQRQSRWUDQQRHVVHUHLPSRVWDWH
5D
)XQ]LRQDPHQWRDXWRPDWLFR
suggerimenti e informazioni
OD
&RPHXVDUHLOWHOHFRPDQGR
6HQRQVLJUDGLVFHODPRGDOLWj$872
VHOH]LRQDUHPDQXDOPHQWHOHFRQGL]LRQL
GHVLGHUDWH
9H
Q WR
,QFDVRGLLQWHUUX]LRQHGHOO
HQHUJLDRGL
SURGRWWRVSHQWRLQIDVHGLULPR]LRQHGHO
FDYRGLDOLPHQWD]LRQHRDQFKHTXDQGR
VLVWDQQRVRVWLWXHQGROHEDWWHULHGHO
WHOHFRPDQGRLOPLFURSURFHVVRUHWRUQDDOOD
PRGDOLWj$872
Impostare la temperatura desiderata.
Il condizionatore inizia a funzionare dopo circa
3 minuti.
$UUHVWR
1 Tasto ON/OFF
Premere nuovamente questo tasto per spegnere
LOFRQGL]LRQDWRUH,OGHÀHWWRUHRUL]]RQWDOHWRUQD
alla posizione di spegnimento.
70
Temp. programmata
7HPSR
)XQ]LRQDPHQWRGL
GHXPLGL¿FD]LRQH
,QL]LR
1 Tasto ON/OFF
Premere questo tasto per accendere il
condizionatore.
L'indicatore della temperatura sul display
dell'unità interna si accende.
2 Tasto Modalità
Premere e selezionare FAN.
3 Tasto FAN
Premere per selezionare la velocità della
ventola desiderata: Auto, Bassa, Media e Alta.
/DYHORFLWjSUHGH¿QLWDGHOODYHQWRODq$XWR
2 Tasto Modalità
Premere e selezionare DEHUMIDIFY.
3 Tasti di controllo
Impostare la temperatura desiderata.
Di norma, impostare fra 21°C e 28°C.
$UUHVWR
1 Tasto ON/OFF
$UUHVWR
1 Tasto ON/OFF
Premere nuovamente questo tasto per
VSHJQHUHLOFRQGL]LRQDWRUH,OGHÀHWWRUH
orizzontale torna alla posizione di
spegnimento.
Premere nuovamente questo tasto per
VSHJQHUHLOFRQGL]LRQDWRUH,OGHÀHWWRUH
orizzontale torna alla posizione di
spegnimento.
suggerimenti e informazioni
‡ Nessuna indicazione della velocità della
ventola compare sul telecomando se la
velocità della ventola è impostata su Auto.
suggerimenti e informazioni
In modalità DEHUMIDIFY la velocità della
ventola è impostata su Low (Bassa), e non è
possibile usare la funzione Turbo.
)XQ]LRQDPHQWRGHOODYHQWROD
Quando viene selezionata la modalità di
funzionamento FAN il condizionatore muove
semplicemente l'aria interna.
1 Tasto ON/OFF
Premere questo tasto per accendere il
condizionatore.
L'indicatore della temperatura sul display
dell'unità interna si accende.
)XQ]LRQHGLUDIIUHGGDPHQWR
HULVFDOGDPHQWR
,QL]LR
1 Tasto ON/OFF
Premere questo tasto per accendere il
condizionatore.
L'indicatore della temperatura sul display
dell'unità interna si accende.
2 Tasto Modalità
Premere per selezionare la modalità COOL o
HEAT (ove presente).
71
3 Tasti di controllo
Impostare la temperatura desiderata.
Di norma, impostare fra 21°C e 28°C.
4 Tasto FAN
Premere per selezionare la velocità della
ventola desiderata: Auto, Bassa, Media e Alta.
/DYHORFLWjSUHGH¿QLWDGHOODYHQWRODq$XWR
suggerimenti e informazioni
Nessuna indicazione della velocità della
ventola compare sul telecomando se la
velocità della ventola è impostata su Auto.
3 Puntare il telecomando all'unità interna, confermare
l'ora impostata premendo il tasto Timer-On.
resterà presente sul display del telecomando.
9HUL¿FDUHFKHO
LQGLFDWRUHGHOWLPHUVXOSDQQHOORGHO
display dell'unità interna sia illuminato.
$QQXOODPHQWRGHOOHLPSRVWD]LRQL
Puntare il telecomando all'unità interna e premere
nuovamente il tasto Timer-On. Accertarsi che il
simbolo sul telecomando sia spento.
)XQ]LRQDPHQWR7LPHU2II
1 Premere il tasto Timer-Off,
lampeggia sul display del telecomando
nel caso in cui si tratti del primo uso della funzione
Timer-Off. In caso contrario, lampeggerà l'ultimo
orario impostato.
2 Impostare l'orario desiderato premendo i tasti di
Indietro
controllo: Avanti
Ogni volta che vengono premuti questi tasti, l'ora si
sposta avanti o indietro di 1 minuto.
Tenendo premuto il tasto ci si sposterà più
rapidamente all'interno della visualizzazione
dell'ora.
3 Puntare il telecomando all'unità interna, confermare
l'ora impostata premendo il tasto Timer-Off.
resterà presente sul display del telecomando.
9HUL¿FDUHFKHO
LQGLFDWRUHGHOWLPHUVXOSDQQHOORGHO
display dell'unità interna sia illuminato.
$QQXOODPHQWRGHOOHLPSRVWD]LRQL
Puntare il telecomando verso l'unità interna e premere
nuovamente il tasto Timer-Off. Accertarsi che il
simbolo sul telecomando sia spento.
$UUHVWR
1 Tasto ON/OFF
Premere nuovamente questo tasto per
VSHJQHUHLOFRQGL]LRQDWRUH,OGHÀHWWRUH
orizzontale torna alla posizione di
spegnimento.
,PSRVWD]LRQHWLPHU
)XQ]LRQDPHQWR7LPHU2Q
1 Premere il tasto Timer-On,
lampeggia sul display del
telecomando nel caso in cui si tratti del
primo uso della funzione Timer-On. In
caso contrario, lampeggerà l'ultimo orario
impostato.
2 Impostare l'orario desiderato premendo i tasti
Indietro
di controllo: Avanti
Ogni volta che vengono premuti questi tasti,
l'ora si sposta avanti o indietro di 1 minuto.
Tenendo premuto il tasto ci si sposterà più
rapidamente all'interno della visualizzazione
dell'ora.
72
suggerimenti e informazioni
‡ L'orario di funzionamento della funzione timer
impostato dal telecomando dipende dall'ora
GHOO
2URORJLR9HUL¿FDUHFKHO
2URORJLRVXO
telecomando sia impostato correttamente per
evitare malfunzionamenti.
‡ L’orario effettivo di funzionamento impostato
mediante il telecomando è limitato a 24 ore.
(VHPSLRGLLPSRVWD]LRQHGHOWLPHU
)XQ]LRQDPHQWR7LPHU2Q)XQ]LRQDPHQWR
7LPHU6WDUW
Questa funzione è consigliata quando si vuole
che l'unità venga accesa in automatico prima
di tornare a casa. Il condizionatore si accende
automaticamente all’ora impostata.
Esempio: Sono le 8 di mattina e si vuole che il
condizionatore inizi a funzionare alle ore 18:00.
1 Premere il tasto Timer-On.
2 Impostare l'ora desiderata premendo
ripetutamente o tenendo premuti i tasti di
FRQWUROOR¿QRDFKHVXOGLVSOD\GHOWHOHFRPDQGR
non compare 18:00.
3 Confermare l'ora impostata puntando il
telecomando verso l'unità interna e premendo
nuovamente il tasto Timer-On.
4 Premere il tasto Timer-Off.
3 Confermare l'ora impostata puntando il
telecomando verso l'unità interna e premendo
nuovamente il tasto Timer-On.
5 Impostare l'ora desiderata premendo
ripetutamente o tenendo premuti i tasti di
FRQWUROOR¿QRDFKHVXOGLVSOD\GHOWHOHFRPDQGR
non compare 09:30.
resterà presente sul display del telecomando.
L'indicatore del timer sul pannello del display
dell'unità interna è illuminato.
)XQ]LRQDPHQWR7LPHU2II)XQ]LRQDPHQWR
7LPHU6WRS
Questa funzione è consigliata quando si vuole che
l'unità venga spenta in automatico prima di andare
a letto.
Il condizionatore si ferma automaticamente all’ora
impostata.
Esempio: Sono le 18 e si vuole che il
condizionatore si spenga alle 23:55.
1 Premere il tasto Timer-Off.
6 6 Confermare l'ora impostata puntando il
telecomando verso l'unità interna e premendo
nuovamente il tasto Timer-Off.
questo simbolo compare sul telecomando è la
funzione è attivata.
7LPHU2II 7LPHU2Q
(acceso – spento – avvio funzionamento)
Questa funzione è consigliata quando si vuole
spegnere il condizionatore dopo essere andati e
letto e riavviarlo prima di svegliarsi alla mattina o
prima di tornare a casa la sera.
Ad esempio: sono le 8:00 e si vuole fermare il
condizionatore alle 9:30 per riavviarlo alle 18:00
1 Premere il tasto Timer-Off.
2 Impostare l'ora desiderata premendo
ripetutamente o tenendo premuti i tasti di
FRQWUROOR¿QRDFKHVXOGLVSOD\GHOWHOHFRPDQGR
non compare 23:55.
2 Impostare l'ora desiderata premendo
ripetutamente o tenendo premuti i tasti di
FRQWUROOR¿QRDFKHVXOGLVSOD\GHOWHOHFRPDQGR
non compare 09:30.
3 Confermare l'ora impostata puntando il
telecomando verso l'unità interna e premendo
nuovamente il tasto Timer-Off.
resterà presente sul display del telecomando.
L'indicatore del timer sul pannello del display
dell'unità interna è illuminato.
3 Confermare l'ora impostata puntando il
telecomando verso l'unità interna e premendo
nuovamente il tasto Timer-Off.
7LPHUFRPELQDWR
4 Premere il tasto Timer-On.
7LPHU2Q 7LPHU2II
(spento – avvio – arresto funzionamento)
5 Impostare l'ora desiderata premendo
ripetutamente o tenendo premuti i tasti di
FRQWUROOR¿QRDFKHVXOGLVSOD\GHOWHOHFRPDQGR
non compare 18:00.
Questa funzione è consigliata quando si vuole
accendere il condizionatore prima di svegliarsi e
spegnerlo dopo essere usciti di casa.
Esempio: Sono le 22:00 e si vuole far partire
il condizionatore alle 6:30 e farlo fermare alle
9:30.
1 Premere il tasto Timer On.
2 Impostare l'ora desiderata premendo
ripetutamente o tenendo premuti i tasti di
FRQWUROOR¿QRDFKHVXOGLVSOD\GHOWHOHFRPDQGR
non compare 06:30.
6 Confermare l'ora impostata puntando il
telecomando verso l'unità interna e premendo
nuovamente il tasto Timer-On.
questo simbolo compare sul telecomando è la
funzione è attivata.
73
,PSRVWD]LRQHGHOO
RURORJLR
)XQ]LRQDPHQWR(FRQRP\(FR
Premere il tasto Eco in modalità COOL o HEAT (ove
presente), il condizionatore aumenterà la temperatura
(in modalità COOL) o la diminuirà (in modalità HEAT)
di 1 °C all'ora per un periodo di 2 ore. La temperatura
LPSRVWDWDULPDUUj¿VVDSHUOHRUHVXFFHVVLYHTXLQGL
l'unità si interromperà.
Questa funzione consente una maggiore comodità e
consente di risparmiare energia. Il funzionamento è
consigliato per quando si va a letto la sera.
,PSRVWD
WHPSHUDWXUD
RUD
RUD
5DIIUHGGDPHQWR
,PSRVWD
WHPSHUDWXUD
Prima di azionare il condizionatore, impostare
l’orologio del telecomando seguendo la
procedura indicata in questa sezione Il pannello
dell’orologio sul telecomando visualizza l’ora
indipendentemente che il condizionatore sia in
funzione o meno.
RUD
RUD
5LVFDOGDPHQWR
)XQ]LRQDPHQWR,)HHO
Dopo che le batterie vengono inserite all'interno
del telecomando,
si illumina e inizia a
lampeggiare.
Il telecomando funziona come termostato remoto, e
fornisce un accurato controllo della temperatura oltre
che una comodità ottimale.
1 Tasti di controllo
Premere i tasti di controllo per impostare l'ora
desiderata.
Puntare il telecomando verso l'unità interna e premere
il tasto I Feel; un bip dall'unità interna conferma che la
funzione è stata attivata.
Avanti
Indietro
Ogni volta che vengono premuti questi tasti,
l'ora si sposta avanti o indietro di 1 minuto.
Tenendo premuto il tasto ci si sposterà più
rapidamente all'interno della visualizzazione
dell'ora.
2 Tasto Clock
Quando viene raggiunto il tempo desiderato,
premere nuovamente il tasto Clock per
5 secondi senza funzionamento; l'ora
dell'orologio smette di lampeggiare e
l'orologio sarà stato impostato.
3 Reimpostare l'orologio
Premere il tasto Orologio e il display orologio
inizierà a lampeggiare.
Seguire i passaggi 1 e 2 per impostare
nuovamente l'ora.
suggerimenti e informazioni
‡ Il timer dell'orologio usa un orologio in
modalità 24 ore.
‡ /
RUDSUHGH¿QLWDSHULOWHOHFRPDQGRVRQROH
12:00 e tornerà a questa impostazione ogni
volta che vengono sostituite le batterie.
74
Il simbolo I Feel
rimane sul display del telecomando
¿QRDFKHLOWDVWR,)HHOQRQYLHQHQXRYDPHQWH
premuto.
Il condizionatore funzionerà per raggiungere
la temperatura impostata nella posizione del
telecomando.
Il telecomando invia le informazioni della temperatura
nella sua posizione all'unità interna ogni 10 minuti.
Il condizionatore uscirà dalla funzione I Feel nel
caso in cui non vengano ricevute informazioni
sulla temperatura dal telecomando per i 11 minuti
successivi.
&RPHXVDUHO
XQLWjLQWHUQD
2S]LRQLDJJLXQWLYH
)XQ]LRQHGL5LDYYLR5DSLGR
Il condizionatore riprende automaticamente con
le impostazioni precedenti dopo un possibile
guasto di corrente.
‡ 4XDQGRLOGHÀHWWRUHVLSRUWDQHOODGLUH]LRQH
desiderata, premere nuovamente il tasto Swing e
LOGHÀHWWRUHULPDUUjQHOODSRVL]LRQHLQFXLVLWURYD
‡ Premendo nuovamente il tasto Swing, il
GHÀHWWRUHLQL]LHUjDGRVFLOODUHLQDOWRHLQEDVVR
automaticamente.
3DQQHOORULPRYLELOH
Il pannello anteriore dell'unità interna può
essere rimosso con facilità a scopo di pulizia e
manutenzione.
$XWRGLDJQRVLHDXWRSURWH]LRQH
Questo condizionatore è in grado di rilevare
anomalie di funzionamento mostrando la
diagnosi sul display dell'unità interna tramite un
codice errore.
Il condizionatore cambia automaticamente
modalità di funzionamento come forma di
auto-protezione.
Portata
Flusso dell'aria verso l'alto
e verso il basso
3HUUHJRODUHODGLUH]LRQHGHOÀXVVRGHOO
DULD
RUL]]RQWDOHVLQLVWUDGHVWUDPDQXDOPHQWH
&RQWUROORGHOODGLUH]LRQHGHO
ÀXVVRGLDULD
‡ 5HJRODUHLGHÀHWWRULYHUWLFDOLWUDPLWHODOHYD
Sinistra/Destra del braccio verticale del
GHÀHWWRUH
‡ 5HJRODUHODGLUH]LRQHGHOÀXVVRG¶DULDFRUUHWWDPHQWH
per evitare di creare situazioni sgradevoli o creare
differenze di temperatura in un locale.
‡ Eseguire queste regolazioni prima di accendere
l’apparecchiatura perché, se accesa, le dita
potrebbero rimanere intrappolate nella ventola.
‡ 5HJRODUHLGHÀHWWRULRUL]]RQWDOLFROWHOHFRPDQGR
‡ 5HJRODUHLGHÀHWWRULYHUWLFDOLPDQXDOPHQWH
'HÀHWWRUH
verticale
Portata
Flusso dell'aria verso sinistra e verso destra
attenzione
3HULPSRVWDUHODGLUH]LRQHGHOÀXVVRGHOO
DULD
YHUWLFDOHVXJLLQPRGRDXWRPDWLFR
‡ Eseguire questa funzione mentre l’unità è in
funzione.
‡ Premere il tasto Swing sul telecomando per
PXRYHUHLOGHÀHWWRUHRUL]]RQWDOHYHUVRO¶DOWR
e il basso automaticamente.
‡ Il tasto di Oscillazione verrà disattivato quando il
condizionatore non è in funzione (anche quando
è impostata la funzione Timer On).
‡ Non azionare il condizionatore per lunghi periodi
FRQODGLUH]LRQHGHOÀXVVRG¶DULDULYROWDYHUVR
il basso nelle modalità COOL o DEHUMIDIFY.
In caso contrario si potrebbe formare della
FRQGHQVDVXOODVXSHU¿FLHGHOGHÀHWWRUH
orizzontale che a sua volta potrebbe far cadere
delle gocce sul pavimento o sugli arredi.
75
‡ 1RQVSRVWDUHPDQXDOPHQWHLGHÀHWWRUL
orizzontali. Utilizzare sempre il tasto Swing.
8QRVSRVWDPHQWRPDQXDOHGHOGHÀHWWRUHSXz
provocare anomalie in fase di funzionamento.
4XDORUDLGHÀHWWRULQRQIXQ]LRQLQR
correttamente, spegnere immediatamente e
riavviare il condizionatore.
‡ Non si dovrebbe impostare un angolo di
DSHUWXUDGHOGHÀHWWRUHRUL]]RQWDOHWURSSR
piccolo, poiché sia il raffreddamento che il
riscaldamento potrebbero non funzionare
DGHJXDWDPHQWHDFDXVDGLXQDVXSHU¿FLHSHU
LOÀXVVRG¶DULDWURSSROLPLWDWD
‡ Non azionare il condizionatore con il
GHÀHWWRUHRUL]]RQWDOHQHOODSRVL]LRQHFKLXVD
‡ Quando il condizionatore viene collegato
all’alimentazione (funzionamento iniziale), il
GHÀHWWRUHRUL]]RQWDOHSXzHPHWWHUHXQVXRQR
per circa 10 secondi: tutto ciò è normale.
)XQ]LRQDPHQWRGLHPHUJHQ]D
Quando il telecomando va smarrito o non funziona,
servirsi dell'interruttore manuale sull'unità interna.
Il condizionatore funziona in modalità AUTO e
l'impostazione della temperatura o la velocità della
YHQWRODQRQSRWUDQQRHVVHUHPRGL¿FDWH
‡ Premere nuovamente il tasto di Controllo Manuale per
spegnere il condizionatore.
La modalità di funzionamento viene vista nella seguente
tabella.
Modalità Modello
Impostazione
temperatura
Flusso
dell'aria
AUTO
HEAT PUMP
25°C
COOL/FAN
AUTO
HEAT PUMP
20°C
HEAT/FAN
7HPSHUDWXUDGLIXQ]LRQDPHQWR
Intervalli di temperature di funzionamento
Lato interno
DB/WB(°C)
Lato esterno
DB/WB(°C)
Raffreddamento massimo
32/23
43/26
Raffreddamento minimo
21/15
21/-
Riscaldamento massimo
27/-
24/18
Riscaldamento minimo
20/-
La gamma della temperatura di funzionamento
(temperatura esterna) per il modello con solo
raffreddamento è di -7ºC~43ºC, per il modello
con pompa di calore è -7ºC~24ºC.
Se il condizionatore viene impiegato in condizioni
diverse da quelle precedenti, alcune funzioni di
protezione possono essere attivate e causare un
funzionamento anomalo dell'apparecchiatura.
)XQ]LRQDPHQWRRWWLPDOH
Per raggiungere le prestazioni ottimali, si noti
quanto segue:
‡ ,QGLUL]]DUHODGLUH]LRQHGHOÀXVVRG
DULDLQPRGR
che non investa direttamente le persone.
‡ Regolare la temperatura per raggiungere il più
alto livello di comfort. Non regolare l'unità a livelli
eccessivi di temperatura.
7DVWRFRQWUROOR
PDQXDOH
‡ &KLXGHUHSRUWHH¿QHVWUHTXDQGR
l'apparecchiatura funziona in modalità COOL
o HEAT; in caso contrario, le prestazioni
dell'apparecchiatura potrebbero risentirne.
‡ Servirsi dei tasti Timer On e Timer Off sul
telecomando per impostare l'ora desiderata di
avvio e spegnimento.
7DVWRFRQWUROOR
PDQXDOH
‡ Premere il tasto di Controllo manuale per
accedere alla Modalità AUTO. Il condizionatore
selezionerà la modalità COOL, HEAT (solo
modello con pompa di calore) e FAN in
automatico conformemente alla temperatura
della stanza per raggiungere un ottimo livello
di comodità.
76
‡ Non posizionare alcun oggetto vicino alle
SUHVHGLHQWUDWDRXVFLWDGDWRFKHO
HI¿FDFLD
dell'apparecchiatura potrebbe essere ridotta e il
condizionatore potrebbe smettere di funzionare.
‡ 3XOLUHIUHTXHQWHPHQWHLO¿OWURGHOO¶DULDSHU
non ridurre la capacità di raffreddamento/
riscaldamento dell’apparecchiatura.
3XOL]LDHPDQXWHQ]LRQH
0DQXWHQ]LRQH
Occorre eseguire con regolarità le seguenti operazioni di manutenzione.
Voci
Operazioni di
manutenzione
Frequenza consigliata
Filtro antipolveri
Pulire
Ogni mese o più spesso, se necessario
Filtri aria sana
Sostituire/pulire
Ogni 3 mesi o più spesso, se necessario
Unità interna
Pulire
Ogni mese o più spesso, se necessario
Vaschetta dell’acqua
e tubazione di
evacuazione
Pulire ed eliminare
eventuali intasamenti
Ogni stagione prima di avviare l’apparecchiatura*
Bobine interne ed
esterne
Pulire
Ogni stagione prima di avviare l’apparecchiatura*
* 4XHVWDRSHUD]LRQHGHYHHVVHUHHVHJXLWDHVFOXVLYDPHQWHGDSHUVRQDOHTXDOL¿FDWR
avvertenza
‡ Spegnere il condizionatore e scollegare
l'alimentazione prima di procedere alla pulizia.
3XOL]LDGHOO
XQLWjLQWHUQDHGHO
WHOHFRPDQGR
‡ Utilizzare un panno asciutto per pulire l’unità
interna e il telecomando.
‡ Se l’unità interna dovesse essere
eccessivamente sporca, si può utilizzare un
panno bagnato con acqua fredda.
Staffa
pannello
1 Afferrare e sollevare il pannello anteriore dell’unità
LQWHUQD¿QRDFKHQRQVLVHQWHFKHqVDOGDPHQWH
bloccato dalla staffa.
‡ Il pannello anteriore dell’unità interna può
essere smontato e pulito con acqua. Asciugare
poi con un panno asciutto.
‡ Non usare spazzole, carta smerigliata o
strumenti di lucidatura per pulire l'unità, in
quanto si potrebbe danneggiare.
‡ Per pulire l’unità non utilizzare panni o piumini
imbevuti di sostanze chimiche.
‡ Non usare benzene, solvente, polveri per la
lucidatura o solventi simili per le operazioni
di pulizia. Ciò potrebbe provocare crepe o
GHIRUPD]LRQLVXOODVXSHU¿FLHLQSODVWLFD
0DQLJOLDGHO¿OWURDQWLSROYHUL
2 7HQHUHODPDQLJOLDGHO¿OWURDQWLSROYHULH
sollevarlo leggermente per estrarlo dal supporto
¿OWUR
‡ Non usare mai acqua tiepida al di sopra dei
40°C per pulire il pannello anteriore. Potrebbe
provocare deformazioni o scolorimenti.
3XOL]LDGHL¿OWUL
1RWD3ULPDGLHVHJXLUHTXDOVLDVLRSHUD]LRQHGL
SXOL]LDRFFRUUHGLVDWWLYDUHO¶DOLPHQWD]LRQHHOHWWULFD
6HLO¿OWURDQWLSROYHULqLQWDVDWRO¶HI¿FLHQ]D
di raffreddamento/riscaldamento dell’unità è
OLPLWDWD3XOLUHLO¿OWURRJQLPHVHRSLVSHVVRVH
necessario.
3 4XLQGLHVWUDUUHLO¿OWURDQWLSROYHULGDOEDVVR
dell'unità interna.
77
avvertenza
Filtro antipolveri
1RQWRFFDUHRFHUFDUHGLSXOLUHLO
JHQHUDWRUHGLSODVPDIUHGGRVH
GLVSRQLELOH3XzHVVHUHFDXVDGL
VFRVVHHOHWWULFKH
Manutenzione generale
3XOLUHLO¿OWURDQWLSROYHULFRQXQDVSLUDSROYHUHR
con acqua, poi asciugarlo in un luogo fresco.
Se non si prevede di utilizzare il condizionatore per
lunghi periodi di tempo:
‡ Azionare l’apparecchiatura nella modalità solo
FAN per 3~4 ore per asciugare completamente
l’unità
Filtro antipolveri
Filtro sanitario
4 ,O¿OWULULQIUHVFDQWLSHUDYHUHXQ
DULDVDQDVH
GLVSRQLELOLFRPHDGHVHPSLRLO¿OWURDFDUERQL
DWWLYL¿OWUR%,2¿OWURYLWDPLQD&¿OWURDJOLLRQL
G
DUJHQWRVRQR¿VVDWLVXO¿OWURDQWLSROYHUL
5LPXRYHUHL¿OWULVDQLWDULGDOWHODLRGLVXSSRUWRGHO
¿OWURDQWLSROYHUL
3XOLUHL¿OWULVDQLWDULDOPHQRRJQLWUHPHVLH
sostituirli ogni 6 mesi.
Pulire con un aspirapolvere, ove possibile.
‡ Spegnere l’apparecchiatura e togliere la spina.
Estrarre le batterie dal telecomando.
‡ L’unità esterna richiede operazioni di
manutenzione e pulizia periodiche. Non cercare
di eseguire tali operazioni personalmente.
Contattare il rivenditore o il centro di assistenza
locale.
&RQWUROOLGDHVHJXLUHSULPDGHOODPHVVDLQ
IXQ]LRQH
‡ Controllare che i cavi non siano rotti o scollegati
‡ &RQWUROODUHFKHLO¿OWURSHUODSROYHUHVLDLQVWDOODWR
‡ Controllare che l’entrata e l'uscita dell’aria non
siano ostruite se il condizionatore è rimasto
inoperativo per un lungo periodo di tempo.
avvertenza
‡ 4XDQGRVLHVWUDHLO¿OWURGHOO¶DULDQRQWRFFDUH
le parti metalliche dell’unità. Attenzione a non
IHULUVLWRFFDQGROHSDUWLPHWDOOLFKHDI¿ODWH
5 5HLQVWDOODUHL¿OWULSHUULQIUHVFDUHO
DULDLQ
posizione.
6 ,QVHULUHODSDUWHVXSHULRUHGHO¿OWURDQWLSROYHUL
nell’unità, prestando attenzione che i bordi
sinistro e destro siano correttamente installati
HULPRQWDUHLO¿OWUR
78
‡ Non pulire la parte interna del condizionatore
con acqua. La penetrazione di acqua
all’interno può danneggiare l’isolamento e
portare a scosse elettriche.
‡ Quando si pulisce l’apparecchiatura,
YHUL¿FDUHFKHO¶DOLPHQWD]LRQHHLOGLVJLXQWRUH
siano scollegati.
6XJJHULPHQWLSHULOIXQ]LRQDPHQWR
4XDQWRVHJXHSXzYHUL¿FDUVLGXUDQWHLOQRUPDOH
funzionamento:
3URWH]LRQHGHOFRQGL]LRQDWRUH
‡ 3URWH]LRQHGHOFRPSUHVVRUH
Dopo un’interruzione il compressore deve
attendere 3 minuti prima di potere essere
riacceso.
‡ $QWLFRQJHODPHQWR
Nel caso in cui l'unità stia funzionando in
modalità COOL e con una temperatura
ambiente bassa, si potrebbe formare del
gelo sullo scambiatore di calore. Quando
la temperatura dello scambiatore di
calore interno scende al di sotto dei 0°C,
il compressore smette di funzionare per
proteggere l'unità.
‡ 6EULQDPHQWR
Si potrebbe formare del gelo sull'unità
esterna durante l'operazione di riscaldamento
quando la temperatura esterna è bassa ma
l'umidità è alta. Il che porta a una scarsa
HI¿FDFLDDOLYHOORGLULVFDOGDPHQWR
In tali casi, il condizionatore interrompe il
riscaldamento e avvia automaticamente lo
sbrinamento. Il tempo di sbrinamento può
variare dai 3 ai 12 minuti.
In fase di sbrinamento, i motori delle
ventole dell'unità interna e dell'unità esterna
si interrompono; sull'indicatore interno
lampeggia la dicitura "H1" e dall'unità esterna
potrebbero fuoriuscire dei vapori. Non si
tratta di un'anomalia di funzionamento. Al
termine dello sbrinamento, l'operazione di
riscaldamento ripartirà in modo automatico.
‡ 'LVSRVLWLYRDQWLDULDIUHGGD
In modalità HEAT la ventola interna non
IXQ]LRQDSHUHYLWDUHFKHYHQJDVRI¿DWD
dell'aria fredda all'interno della stanza (entro
5 minuti), nel caso in cui lo scambiatore di
calore interno non raggiunga una temperatura
minima nelle seguenti condizioni:
(1) L'opzione di riscaldamento si è appena
attivata.
(2) Al termine dell'opzione di sbrinamento
automatico.
(3) Riscaldamento a bassa temperatura.
9HQWLFHOORGHOLFDWR
L'unità interna può emettere un venticello
GHOLFDWRHIDUUXRWDUHLOGHÀHWWRUHLQXQD
determinata posizione nella seguente
situazione:
(1) In modalità HEAT, l'unità viene accesa, il
compressore non raggiunge la condizione di
avvio.
(2) In modalità HEAT, la temperatura raggiunge
il valore impostato e il compressore smette di
funzionare per circa 1 minuto.
8QDQHEELDELDQFDHVFHGDOO¶XQLWjLQWHUQD
‡ Si potrebbe generare una nebbia bianca a causa
di una grande differenza di temperatura fra
l'ingresso e l'uscita dell' aria in modalità COOL
in un ambiente chiuso con un'elevata umidità
relativa.
‡ L’umidità derivante dal processo di sbrinamento
può determinare la formazione di una nebbia
bianca quando il condizionatore viene riacceso
in modalità HEAT dopo lo sbrinamento.
/HJJHURUXPRUHGHOFRQGL]LRQDWRUH
‡ Quando il compressore funziona o ha appena
smesso di funzionare si può sentire un leggero
suono sibilante. Si tratta dello scorrere o del
fermarsi del refrigerante.
‡ Quando il compressore funziona o ha appena
smesso di funzionare si può sentire anche un
basso “cigolio". Si tratta dell’espansione dovuta al
calore e della contrazione dovuta al freddo delle
parti in plastica nell'unità quando la temperatura
cambia.
‡ Un rumore può inoltre essere dovuto al ritorno
DOODSRVL]LRQHRULJLQDOHGHLGHÀHWWRULDOODSULPD
accensione.
'DOO¶XQLWjLQWHUQDHVFHGHOODSROYHUH
Si tratta di un fenomeno normale quando il
condizionatore non è stato utilizzato per un lungo
periodo o al primo impiego dell’apparecchiatura.
'DOO¶XQLWjLQWHUQDHVFHXQRGRUHSDUWLFRODUH
Ciò è causato dal fatto che l’unità interna rilascia
odori permeati da materiali di costruzione, mobili o
fumo.
,OFRQGL]LRQDWRUHSDVVDDOODPRGDOLWj)$1VROR
GDOOHPRGDOLWj&22/R+($7
Quando la temperatura interna raggiunge il
valore dell'impostazione, il compressore si ferma
automaticamente e il condizionatore passa in
modalità FAN.
Il compressore si avvia nuovamente quando la
temperatura interna si alza o si abbassa rispetto
a quella impostata, rispettivamente nella modalità
COOL o HEAT.
&RQGHQVD
L'acqua di condensa si potrebbe formare all'uscita
dell'aria se l'apparecchiatura ha raffreddato o
asciugato a lungo con una temperatura relativa
VXSHULRUHDOO
FRQSRUWHH¿QHVWUHFKLXVH
,PSRVWDUHLOGHÀHWWRUHYHUWLFDOHDOODVXDDQJROD]LRQH
massima (verso il pavimento) e la velocità della
YHQWRODVX+LJK&KLXGHUHSRUWHH¿QHVWUH
,ODPSLRODYLFLQDQ]DGLWHOHIRQLVHQ]D¿OLSRVVRQR
determinare il cattivo funzionamento dell’unità.
Scollegare e successivamente ricollegare
l'alimentazione all’unità. Per riprendere il
funzionamento, premere il tasto ON/OFF sul
telecomando.
)XQ]LRQH;)DQ
L'unità interna potrebbe continuare a funzionare
anche dopo aver spento l'unità premendo il tasto
ON/OFF.
9HUL¿FDUHFKHODIXQ]LRQH;)DQVLDGLVDWWLYDWD
79
5LVROX]LRQHGHLSUREOHPL
Il condizionatore non può essere riparato dall'utente. Una riparazione sbagliata può essere
causa di scosse elettriche o incendio. Rivolgersi a un centro di assistenza autorizzato per una
riparazione di livello professionale.
avvertenza
1HOFDVRLQFXLVLYHUL¿FKLXQDGHOOHVHJXHQWLVLWXD]LRQLIHUPDUHVXELWRLOFRQGL]LRQDWRUH
scollegare l'alimentazione e contattare il centro di assistenza autorizzato.
‡ Nel caso in cui compaia un errore sulla
¿QHVWUDGLVSOD\GHOO
XQLWjLQWHUQD
‡ Acqua o altri liquidi vengono spruzzati nell'unità.
‡ L'indicatore di potenza o un altro indicatore
lampeggia rapidamente; non sarà possibile
interrompere questo lampeggiamento
scollegando l'alimentazione e ricollegandola
nuovamente.
‡ Si sente un suono brusco durante il funzionamento.
‡ Durante il funzionamento vengono emessi dei forti
odori.
‡ Il fusibile salta spesso o l'interruttore scatta
frequentemente.
‡ C'è una perdita di acqua dall'unità.
‡ Il cavo di alimentazione e la presa si stanno
surriscaldando.
‡ Altre situazioni anomale.
La pressione nel sistema refrigerante è bassa e potrebbe comportare una rottura dell'unità.
&KLHGHUHDXQLQVWDOODWRUHFHUWL¿FDWRGLHVHJXLUHXQFRQWUROOR
Difetti
L'unità non si avvia
L'unità non raffredda
o non scalda (ove
possibile) la stanza
molto bene quando
l'aria fuoriesce dal
condizionatore
Causa
Intervento
Interruzione alimentazione
Attendere il ripristino della
corrente.
L'unità può essere scollegata.
Controllare che la spina sia
correttamente inserita nella presa.
Il fusibile potrebbe essere saltato.
Sostituire il fusibile.
La tensione è troppo alta o troppo
bassa.
Richiedere il controllo della
tensione da parte di professionisti.
Le batteria del telecomando possono
essere scariche.
Sostituire le batterie.
L’ora impostata con il timer può non
essere corretta.
Attendere o annullare le
impostazioni.
Impostazione sbagliata della
temperatura.
Impostare la temperatura in modo
corretto. Per ulteriori dettagli
rimandiamo alla sezione "Utilizzo
del telecomando"
,O¿OWURGHOO¶DULDqEORFFDWR
3XOLUHLO¿OWURGHOO¶DULD
/HSRUWHROH¿QHVWUHVRQRDSHUWH
&KLXGHUHSRUWHR¿QHVWUH
L’entrata o l’uscita dell’aria sull’unità
interna o esterna sono ostruite.
Eliminare le ostruzioni, poi avviare
nuovamente l’unità.
La protezione del compressore di
3 minuti è stata attivata.
Attendere 3 minuti.
Se non è possibile risolvere il problema, contattare il rivenditore locale o il più vicino centro di
assistenza. Informare il personale contattato dei problemi riscontrati e del modello dell’unità.
80
,QYLWLDPRDHVHJXLUHLVHJXHQWLFRQWUROOLSULPDGLFRQWDWWDUHTXDOVLDVLLQVWDOODWRUHDO¿QHGLULVSDUPLDUHWHPSRH
soldi.
'LIHWWL
L'apparecchiatura
non funziona
Vengono emessi
degli odori
&DXVD
L'apparecchiatura non funziona se
viene accesa subito dopo essere
spenta. Ciò serve per proteggere
l'unità. Attendere circa 3 minuti.
‡L'unità interna potrebbe emettere
degli odori. Si tratta del risultato
degli odori della stanza (ad esempio
mobili, tabacco, ecc.) che sono stati
assorbiti dall'unità.
‡Rivolgersi a un centro di assistenza
autorizzato per l'esecuzione della
pulizia nel caso in cui gli odori
persistano.
Rumore di
"acqua che
scorre"
Il sibilo simile all'acqua che scorre è
causato dal refrigerante che scorre
all'interno dell'unità.
In modalità
COOL viene
emessa della
nebbia
Durante l'opzione di raffreddamento,
l'unità interna potrebbe emettere
GHOODQHEELD¿QHDFDXVDGHOO
HOHYDWD
temperatura della stanza e
dell'umidità.
Dopo un po' di tempo la nebbia
sparisce, mano a mano che la
temperatura della stanza e l'umidità
diminuiscono.
Rumore simile a
crepitio
Questo è il rumore dell'attrito
causato dall'espansione e/o dalla
contrazione del pannello di altre
componenti a causa della variazione
di temperatura.
‡È stata tolta la corrente?
'LIHWWL
‡L'umidità è elevata.
Perdite di acqua
dell'unità interna
Perdite di acqua
dell'unità esterna
Rumore
dall'unità interna
L'unità interna
non emette aria
‡In modalità HEAT, quando la
temperatura esterna è bassa o
l'umidità è alta, si forma del gelo
sullo scambiatore di calore esterno.
L'unità si sbrina in modo automatico
e l'unità interna smette di emettere
aria per 2 - 3 minuti.
‡Durante l'operazione di sbrinamento
potrebbe fuoriuscire dell'acqua
o potrebbero essere emessi dei
vapori.
‡In modalità DEHUMIDIFY, la ventola
interna smette di emettere aria per
3 - 12 minuti per evitare che l'acqua
di condensa venga nuovamente
vaporizzata.
‡Le batterie sono scariche?
‡L'impostazione della temperatura è
adeguata?
Umidità
sull'uscita
dell'aria
Nel caso in cui l'unità funzioni
con un'umidità elevata a lungo, si
potrebbe generare dell'umidità sulla
griglia di uscita aria che potrebbe poi
portare a dei gocciolamenti.
Codice di errore
H1: sbrinamento
È normale. L'unità si trova in modalità
di sbrinamento e il riscaldamento
riprenderà a breve.
‡/DSRUWDROD¿QHVWUDVRQRDSHUWH"
‡È stata impostata la velocità bassa
della ventola?
‡Quando lo sbrinamento viene
avviato o interrotto, si sente
un rumore: si tratta del liquido
refrigerante che scorre in direzione
opposta.
‡In modalità HEAT, quando la
temperatura dello scambiatore di
calore interno è molto bassa, il
ÀXVVRGHOO
DULDYLHQHLQWHUURWWRSHU
evitare l'emissione di aria fredda.
(per 2 minuti)
‡La tensione è più alta o più bassa?
(testata da professionisti)
‡,O¿OWURqVSRUFR"
‡Durante l'operazione di sbrinamento,
l'acqua sbrinata fuoriesce.
‡Il rumore emesso quando la ventola
o il relè del compressore vengono
accesi o spenti.
‡Il TIMER è stato usato in modo
corretto?
L'effetto di
raffreddamento/
riscaldamento è
scadente
‡,OWXERÀHVVLELOHGLVFDULFRqDOOHQWDWR
od ostruito.
‡Durante l'operazione di
riscaldamento, gocciola dell'acqua
dallo scambiatore di calore.
‡È saltato il salvavita dell'impianto?
‡L'entrata/uscita dell'aria sono
bloccate?
‡L'acqua di condensa fuoriesce.
‡Durante l'operazione di
raffreddamento, l'acqua si condensa
intorno ai tubi e ai giunti di
collegamento.
‡La spina è allentata?
(ove prevista)
Non è possibile
avviare l'unità
&DXVD
‡Vi sono fonti di calore nella stanza?
1RQVPDOWLUHTXHVWRSURGRWWRFRPHUL¿XWRFRPXQDOHQRQ
FODVVL¿FDWR6DUjQHFHVVDULRVPDOWLUHTXHVWRGLVSRVLWLYR
separatamente, in quanto viene trattato in modo speciale.
81
Índice
Enhorabuena .......................................................................83
Precauciones de seguridad .................................................84
Descripción del producto .....................................................86
Pantalla de la unidad interior ...............................................87
Mando a distancia ................................................................87
Descripción del mando a distancia ......................................88
Indicadores de la pantalla del mando a distancia ...............89
Primer uso ...........................................................................90
Uso del mando a distancia ...................................................90
Uso de la unidad interior ......................................................95
Funcionamiento de emergencia ..........................................96
Funcionamiento óptimo.................................................... ....96
Limpieza y mantenimiento ...................................................97
Consejos de funcionamiento ...............................................99
Solución de problemas ........................................................100
Recordatorio importante
‡ *XDUGHHOPDQGRDGLVWDQFLDGRQGHVXVHxDOSXHGD
OOHJDUDOUHFHSWRUGHODXQLGDGLQWHULRU
‡ &XDQGRXWLOLFHHODFRQGLFLRQDGRUGHDLUHDVHJ~UHVHGH
TXHHOPDQGRDGLVWDQFLDDSXQWDDOUHFHSWRUGHVHxDOHV
GHODXQLGDGLQWHULRU
‡ &XDQGRHOPDQGRDGLVWDQFLDHQYtDXQDVHxDOHOVtPEROR
SDUSDGHDGXUDQWHVHJXQGRHQODSDQWDOODGHO
PDQGRDGLVWDQFLD
‡ /DXQLGDGLQWHULRUUHFRQRFHODVHxDOFRQXQSLWLGR
FXDQGRODUHFLEHGHOPDQGRDGLVWDQFLD
‡ 3XOVHODWHFODGHOPDQGRDGLVWDQFLD\YXHOYDDHQYLDUOD
VHxDOVLQRR\HHOSLWLGRGHODXQLGDG
82
(QKRUDEXHQD
Le damos la enhorabuena y las gracias por
elegir un acondicionador de aire de tipo split de
Electrolux. Estamos seguros de que le resultará un
placer usar su nuevo acondicionador de aire.
Antes de utilizarlo, le recomendamos que lea
atentamente todo el manual del usuario, en el que
se ofrece la descripción del acondicionador de aire
y sus funciones.
&RQGLFLRQHVGHXVR
Este aparato está concebido para utilizarse en
aplicaciones domésticas y similares, tales como:
‡ &RFLQDVGHOSHUVRQDOHQWLHQGDVR¿FLQDV\
otros entornos de trabajo.
‡ Granjas.
‡ Por clientes en hoteles, moteles y otros
entornos de tipo residencial.
Para evitar riesgos que siempre están presentes
al usar un aparato eléctrico, es importante que el
acondicionador de aire se instale correctamente y
que lea atentamente las instrucciones de seguridad
para evitar peligros y usos indebidos.
‡ Entornos tipo hostales o pensiones.
Se recomienda guardar este folleto de
instrucciones para consultas posteriores y, si fuera
el caso, proporcionárselo a los futuros propietarios.
Póngase en contacto con el servicio autorizado
para las reparaciones o tareas de mantenimiento
de la unidad.
Una vez desembalado el acondicionador de aire,
asegúrese de que no está dañado. En caso de
duda, no lo use y póngase en contacto con el
centro local de servicio técnico de Electrolux.
consejo ecológico
Información sobre desechos para el usuario
‡ La mayoría de los materiales de embalaje son
reciclables.
‡ Deséchelos en el lugar de reciclaje local o
colóquelos en los contenedores adecuados.
‡ Si desea desechar este acondicionador de aire,
póngase en contacto con las autoridades locales
para consultar la forma correcta de hacerlo.
precaución
‡ El acondicionador de aire no debe ser utilizado
por niños o personas discapacitadas sin
supervisión.
‡ Es necesario vigilar a los niños pequeños para
que no jueguen con el acondicionador de aire.
‡ Póngase en contacto con el instalador para
instalar este acondicionador de aire.
‡ Póngase en contacto con el servicio
autorizado para las reparaciones o tareas de
mantenimiento de la unidad.
Notas importantes
Póngase en contacto con el instalador para
instalar esta unidad.
‡ La toma de red necesaria para su suministro
eléctrico debe conectarla y ponerla en
servicio un contratista debidamente
FHUWL¿FDGR
‡ Este aparato no debe ser utilizado
por personas (incluidos niños) cuyas
capacidades físicas, sensoriales o mentales
estén disminuidas o que carezcan de la
H[SHULHQFLD\FRQRFLPLHQWRVVX¿FLHQWHVSDUD
manejarlo, a menos que cuenten con las
instrucciones o la supervisión de la persona
responsable de su seguridad.
‡ Es necesario vigilar a los niños pequeños
para que no jueguen con el acondicionador
de aire.
‡ Si fuera necesario cambiar el cable de
alimentación, la sustitución solo debe llevarla
a cabo personal autorizado.
‡ Las tareas de instalación las ejecutarán
sola y exclusivamente personal autorizado,
de conformidad con las normas nacionales
de cableado y los reglamentos de servicio
y mantenimiento de los proveedores de
electricidad.
‡ Si la unidad va a trasladarse a otra
posición o va a ser desechada, las tareas
correspondientes solo podrá ejecutarlas una
persona debidamente titulada.
‡ Tenga cuidado de no pillarse los dedos en
las aspas del ventilador cuando ajuste las
láminas verticales.
‡ Este acondicionador de aire usa refrigerante
R410a.
‡ Si fuera necesario cambiar el cable de
alimentación, la sustitución solo debe llevarla
a cabo personal autorizado.
‡ El trabajo de instalación debe realizarse de
acuerdo con las normativas nacionales de
cableado y solo por personal autorizado.
83
3UHFDXFLRQHVGHVHJXULGDG
En su interior encontrará muchas sugerencias válidas
sobre cómo utilizar y mantener debidamente su
acondicionador de aire. Si se molesta en observar
un mínimo de cuidados preventivos se ahorrará gran
cantidad de tiempo y dinero a lo largo de la vida
útil de su acondicionador de aire. En el cuadro de
recomendaciones para la solución de problemas de
las páginas 100-101 encontrará muchas respuestas
a los problemas más comunes. Si examina
primeramente el cuadro Solución de problemas
puede que no le haga falta llamar al servicio técnico.
(OVLJQL¿FDGRGHORVVtPERORVXWLOL]DGRVHQHVWH
manual se indican a continuación:
precaución
Indica información relativa a su seguridad personal
y la forma de evitar daños en el aparato.
consejos e información
Este símbolo indica consejos e información sobre la
utilización del aparato.
consejo ecológico
Este símbolo indica consejos e información sobre la
utilización ecológica y económica del aparato.
Este símbolo indica que nunca se debe hacer eso.
Proceda siempre de esta forma.
1RWDVLPSRUWDQWHV
1 No utilice la unidad con las láminas horizontales
en posición cerrada.
2 1RXWLOLFHODXQLGDGVLQHO¿OWURGHDLUH
advertencia
Si observa una situación anómala,
como olor a quemado, apague la
alimentación del acondicionador de aire
y póngase en contacto con un agente
de servicio de Electrolux. Si la situación
anómala continúa, es posible que el
acondicionador de aire esté dañado
o que cause descargas eléctricas o
incendios.
No utilice el acondicionador de aire con
las manos húmedas. Puede causar
descargas eléctricas.
No corte ni dañe el cable de alimentación
ni otros hilos. En caso contrario,
deberá repararlo o sustituirlo un técnico
FXDOL¿FDGR
No conecte el acondicionador de aire
a una placa de alimentación de varias
tomas.
Apague el suministro eléctrico del
acondicionador de aire si no va a
utilizarlo durante un período de tiempo
prolongado. De lo contrario, acumulará
polvo y podrá causar incendios.
Antes de limpiar el acondicionador
de aire, desconecte la alimentación
para eliminar el riesgo de descargas
eléctricas.
El suministro eléctrico debe
corresponderse con el acondicionador
de aire de acuerdo con el manual de
instalación. Los acondicionadores de aire
provistos de cable de alimentación deben
conectarse directamente a una toma de
corriente con interruptor de seguridad
adecuado. Los acondicionadores de
aire conectados permanentemente
deben conectarse a un disyuntor de
seguridad adecuado según el manual de
instalación.
Asegúrese de que el suministro eléctrico
al acondicionador de aire es estable y
cumple los requisitos establecidos en el
manual de instalación.
Asegúrese siempre de que el producto se
instala con la conexión a tierra adecuada.
Por motivos de seguridad, asegúrese
de apagar el disyuntor antes de realizar
ninguna tarea de mantenimiento o
limpieza o cuando el producto no se
utilice durante un largo período de
tiempo. La acumulación de polvo puede
causar descargas eléctricas o incendios.
84
3UHFDXFLRQHVGHVHJXULGDG
precaución
Seleccione la temperatura más
adecuada.
Puede ahorrarle electricidad.
No deje las puertas y ventanas abiertas
durante mucho tiempo durante el
funcionamiento. Puede tener como
resultado un bajo rendimiento.
No bloquee la entrada ni salida de aire.
Puede tener como resultado un bajo
rendimiento y provocar averías.
Mantenga los materiales combustibles
alejados a 1 m como mínimo de las
unidades. Pueden causar incendios.
No se suba encima de la unidad exterior
ni coloque objetos pesados sobre la
misma.
Puede causar daños o lesiones.
No intente reparar el acondicionador
de aire usted mismo. Las reparaciones
incorrectas pueden causar incendios
o descargas eléctricas. Póngase en
contacto con el centro de servicio técnico.
8VR
/DH[SRVLFLyQDOÀXMRGHDLUHGLUHFWRGHO
acondicionador de aire durante largos períodos
de tiempo puede resultar peligroso para su
salud.
No exponga a las personas, los animales ni las
SODQWDVDOÀXMRGHDLUHGLUHFWRGXUDQWHODUJRV
períodos de tiempo.
0DQWHQLPLHQWR\OLPSLH]D
1 Al limpiar el aparato asegúrese primero de
que el suministro eléctrico y el disyuntor
están apagados.
2 No toque las partes metálicas de la unidad
DOVDFDUORV¿OWURV3XHGHQSURGXFLUVH
lesiones al manipular bordes de metal
D¿ODGRV
3 No utilice agua para limpiar el interior del
acondicionador de aire. La exposición al
agua puede causar descargas eléctricas.
$VLVWHQFLD
Para las tareas de reparación y mantenimiento,
póngase en contacto con el centro de servicio
autorizado.
No introduzca las manos ni objetos en la
entrada ni la salida de aire. Puede causar
lesiones.
No exponga los animales ni las plantas
GLUHFWDPHQWHDOÀXMRGHDLUH
1RXWLOLFHODXQLGDGSDUDQLQJ~QRWUR¿Q
como conservar alimentos o secar ropa.
No salpique agua en el acondicionador
de aire. Puede causar descargas
eléctricas o averías.
$QWHVGHOIXQFLRQDPLHQWR
1 'LUtMDVHDXQHVSHFLDOLVWDFXDOL¿FDGR
para la instalación.
2 Conecte el enchufe debidamente.
3 No utilice un cable de suministro
eléctrico dañado o atípico.
4 No comparta la misma toma de
suministro eléctrico con otros aparatos.
5 No conecte un alargador.
6 No ponga el aparato en funcionamiento
ni lo apague enchufando y
desenchufando.
85
'HVFULSFLyQGHOSURGXFWR
8QLGDGLQWHULRU
Entrada de
aire
2
3
5
8QLGDGH[WHULRU
Salida de
aire
6
7
8
9
Entrada de aire
(trasera)
0RGe
)Dn
7HPS
7LPHU2II
SwinJ
Entrada
de aire
(lateral)
Salida de
aire
/LJKW
7XUER
7LPHU2Q
&ORFk
,IHHO
EcR
Panel frontal
Mando a distancia
Pantalla digital
Soporte del mando a distancia
)LOWURDPELHQWDGRUGHWUiVGHO¿OWURGHSROYR
Tubo de refrigerante (en su caso)
3UH¿OWURGHSROYR
Manguera de desagüe (en su caso)
Láminas horizontales
Cable de suministro eléctrico (en su caso)
Láminas verticales
Placa de montaje
Generador de frío de plasma (en su caso)
Cable de conexión (en su caso)
Tecla de control manual
Nota: Las ilustraciones anteriores son solo a título ilustrativo.
Es posible que su acondicionador de aire sea ligeramente diferente.
La forma actual prevalece.
86
3DQWDOODGHODXQLGDGLQWHULRU
‡ Si se mantiene el mando a distancia en una
posición que imposibilite la transmisión correcta
de la señal, puede que se produzca un retardo
de hasta 15 minutos.
Receptor de
señales
,QGLFDGRU,)HHO
Se enciende cuando la función I Feel está activada.
,QGLFDGRU7XUER
Se enciende durante el funcionamiento Turbo.
,QGLFDGRU(FR(FRQRPtD
Se enciende cuando la función ECO está activada.
,QGLFDGRUGHWHPSHUDWXUD
Muestra los ajustes de temperatura cuando el
acondicionador de aire está operativo.
,QGLFDGRUGHOWHPSRUL]DGRU
El indicador se enciende cuando el Temporizador
está ajustado en ON/OFF (encendido/apagado).
,QGLFDGRU6ZLQJ
Se enciende cuando la función Swing está activada.
0DQGRDGLVWDQFLD
‡ Cuando el mando a distancia envía una señal,
parpadea durante 1 segundo en la
el símbolo
pantalla. La unidad interior reconoce la señal con
un pitido cuando la recibe.
precaución
‡ El acondicionador de aire no funcionará si
hay cortinas, puertas u otros materiales que
bloqueen las señales que el mando a distancia
envía a la unidad interior.
‡ Impida que caigan líquidos en el mando a
distancia. No someta el mando a distancia al
calor ni a la luz directa del sol.
‡ Si el receptor de señales de infrarrojos
de la unidad interior está expuesto a la
luz directa del sol cabe la posibilidad de
que el acondicionador de aire no funcione
debidamente. Utilice cortinas para proteger el
receptor de la luz directa del sol.
‡ Si hay otros aparatos eléctricos que
reaccionan a las señales del mando
a distancia, muévalos o consulte a su
distribuidor local.
8VRGHOPDQGRDGLVWDQFLD
‡ Apunte el mando a distancia hacia el receptor de
señales de la unidad interior.
‡ Asegúrese de que no hay obstáculos que
puedan interferir con la señal.
3RVLFLyQGHOPDQGRDGLVWDQFLD
,QVWDODFLyQFDPELRGHODVSLODV
‡ Deslice hacia afuera la tapa del compartimento
de las pilas e inserte dos pilas alcalinas nuevas
secas (2 x AAA 1,5 voltios). Compruebe que la
polaridad (+) o (-) es correcta.
‡ Vuelva a cerrar la tapa del compartimento de la
pila, deslizándola en sentido contrario.
consejos e información
‡ Al cambiar las pilas, no utilice otras viejas o
GHGLIHUHQWHHVSHFL¿FDFLyQGHORFRQWUDULR
puede que el mando a distancia no funcione
bien.
P
0RGe
)Dn
7HPS
7LPHU2II
SwinJ
/LJKW
7XUER
7LPHU2Q
&ORFk
,IHHO
EcR
‡ Mantenga el mando a distancia en una
posición en la que su señal pueda llegar
al receptor de la unidad interior (distancia
máxima de 8 m).
‡ Al poner el temporizador en funcionamiento, el
mando a distancia transmite automáticamente
una señal a la unidad interior a la hora
seleccionada.
‡ Si no va a utilizar el mando a distancia
durante un tiempo, saque las pilas, ya que las
antiguas pueden sulfatarse y dañar el mando.
‡ Un uso normal de las pilas proporciona una
vida útil media de aproximadamente seis
meses.
‡ Si el mando a distancia no funciona con
normalidad, quite las pilas y vuelva a
colocarlas. Si persiste el funcionamiento
anómalo, cámbielas por otras nuevas.
87
'HVFULSFLyQGHOPDQGR
DGLVWDQFLD
7HFOD7XUER
Pulse esta tecla en el modo COOL o HEAT para
que el ventilador pase al modo Turbo de alta
velocidad y el acondicionador de aire funcione a la
máxima potencia.
Púlsela de nuevo si desea cancelar esta función.
7HFOD;)DQ
Pulse la tecla X-Fan para activar la limpieza
automática. Después de apagar la unidad, el
ventilador interior sigue funcionando durante
10 minutos para secar la unidad interior y evitar
el crecimiento de moho y bacterias.
0RGH
/LJKW
)DQ
7XUER
;)DQ
7LPHU2Q
7HPS
7LPHU2II
&ORFN
6ZLQJ
,)HHO
(FR
7HFOD212))HQFHQGLGRDSDJDGR
Pulse esta tecla para encender o apagar el
acondicionador de aire.
7HFOD0RGH
Al pulsar esta tecla, se pueden seleccionar por
orden AUTO, DEHUMIDIFY, FAN, COOL y HEAT
(el modelo de solo COOL no tiene función HEAT).
El modo AUTO es el predeterminado cuando el
aparato está encendido.
En modo AUTO el valor inicial no se muestra y
funciona con la temperatura deseada.
Con el modo HEAT, el valor inicial es de 28ºC.
Con los demás modos, el valor inicial es de 25ºC.
AUTO
DEHUMIDIFY
FAN
COOL
HEAT
7HFOD/LJKW
Pulse esta tecla para encender o apagar los
pilotos indicadores de la unidad interior.
El caso normal al arrancar es ON (encendido).
7HFOD)DQ
Al pulsar esta tecla, se puede seleccionar por
orden las velocidades de ventilador Auto, Low,
Medium y High.
Cuando la unidad está encendida, la velocidad
Auto es el valor predeterminado.
En el modo DEHUMIDIFY, la velocidad del
YHQWLODGRUVH¿MDHQ/RZEDMD
88
7HFOD7LPHU2Q
Pulse esta tecla para ajustar la hora de inicio.
7HFOD7LPHU2II
3XOVHHVWDWHFODSDUDDMXVWDUODKRUDGH¿Q
7HFOD6ZLQJ
Pulse esta tecla para que la lámina oscile hacia
arriba y hacia abajo automáticamente. Púlsela de
nuevo para cancelarla: las láminas permanecen
en la última posición.
7HFOD,)HHO
Al pulsar esta tecla, el mando a distancia envía
la información de temperatura a la unidad interior
cada 10 minutos. La unidad funciona para
alcanzar la temperatura ajustada en la ubicación
del mando a distancia. Púlsela de nuevo si desea
cancelar esta función.
7HFOD&RQWURO
Adelante
Hacia atrás
Pulse la tecla de
para aumentar la temperatura.
Pulse la tecla de
para reducir la temperatura.
Con las funciones Timer On/Off o Clock, use estas
teclas para ajustar el temporizador o el reloj.
7HFOD&ORFN
Pulse esta tecla y el símbolo Clock
Puede pulsar las teclas Control y
seleccionar la hora que desee.
parpadeará.
para
7HFOD7HPS7HPSHUDWXUD
Pulse esta tecla para que la pantalla de la unidad
interior cambie de la temperatura programada a la
temperatura ambiente.
7HFOD(FR(FRQRPtD
Pulse esta tecla para iniciar el modo Eco. Es
la opción es perfecta para el usuario mientras
duerme.
Púlsela de nuevo si desea cancelar esta función.
1RWD
En modo de calefacción, pulse las teclas Temp
y Clock para activar la función de calentar la
temperatura de la unidad interior a 8ºC.
,QGLFDGRUGHODSDQWDOODGHO
PDQGRDGLVWDQFLD
,QGLFDGRUGHWUDQVPLVLyQ
Muestra cuándo el mando a distancia
transmite señales a la unidad interior.
3DQWDOOD)DQ6SHHGYHORFLGDGGHOYHQWLODGRU
Muestra la velocidad seleccionada para el
ventilador en el orden siguiente:
3DQWDOOD7XUER
Muestra cuándo la función Turbo está
seleccionada.
“ ” (Low), “
Auto.
3DQWDOOD,)HHO
Muestra cuando la función I Feel está
activada.
3DQWDOOD(FR
Muestra cuándo la función Eco está
seleccionada.
3DQWDOOD+HDOWK\
Se enciende pulsando la tecla Healthy.
Púlsela de nuevo para apagarla.
NOTA: este indicador no existe en los
modelos sin función Cold-Plasma.
3DQWDOOD5RRP7HPSHUDWXUHWHPSHUDWXUD
DPELHQWH
Muestra cuándo la temperatura indicada en
la pantalla LCD es la temperatura ambiente.
Se puede encender o apagar pulsando la
tecla Temp.
3DQWDOOD3URJUDPPHG7HPSHUDWXUH
WHPSHUDWXUDSURJUDPDGD
Se enciende cuando el mando a distancia
muestra la temperatura ajustada. Se puede
encender o apagar pulsando la tecla Temp.
3DQWDOOD7LPHU2Q2II
Muestra cuándo la función Timer On/Off está
activada.
” (Medium), “
” (High) y
En la velocidad Auto, solo aparece el símbolo “ ".
3DQWDOOD6ZLQJ
Muestra cuándo la función Swing está
seleccionada.
3DQWDOOD;)DQ
Muestra cuándo la función X-Fan está activada
pulsando las teclas Turbo y Healthy al mismo
tiempo (para los modelos con función Coldplasma) o pulsando la tecla X-Fan (para los
modelos sin función Cold-plasma)
3DQWDOOD7HPSHUDWXUH
Muestra la temperatura ambiente o programada en
°C o °F.
No hay indicación en el modo Fan.
3DQWDOOD7LPH
Muestra la hora del reloj (se debe ajustar) y/o la
hora de encendido/apagado del temporizador.
3DQWDOOD0RGH
Presenta el modo de funcionamiento actual,
incluido Auto (
), Dehumidify ( ), Fan ( ),
Cool ( ) y Heat ( ).
NOTA: El modo Cool no ofrece la opción de
calefacción (Heating).
89
3ULPHUXVR
1 Cerciórese de que el aparato está enchufado a
la red y que le llega corriente.
2 Asegúrese de que las pilas se han introducido
correctamente en el mando a distancia (los
pilotos del mando están encendidos).
3 Ajuste la hora con las teclas de Control y
FRQ¿UPHSXOVDQGRODWHFOD&ORFNUHORM
4 Apunte con el mando a distancia a la unidad
interior y pulse la tecla ON/OFF para encender
la unidad.
El modo de funcionamiento predeterminado
es AUTO. Tras seleccionar el modo de
funcionamiento con el mando a distancia,
las condiciones de trabajo se guardan en la
memoria del microordenador de la unidad.
La próxima vez, el acondicionador de aire
comenzará a funcionar en el mismo modo
cuando pulse la tecla ON/OFF del mando a
distancia.
consejos e información
(QFDVRGHFRUWHGHDOLPHQWDFLyQRVL
VHDSDJDHODSDUDWRDOTXLWDUHOFDEOH
GHDOLPHQWDFLyQRLQFOXVRFXDQGRVH
FDPELHQODVSLODVGHOPDQGRDGLVWDQFLDHO
PLFURSURFHVDGRUYXHOYHDOPRGR$872
8VRGHOPDQGRDGLVWDQFLD
)XQFLRQDPLHQWRDXWRPiWLFR
Cuando está seleccionado el modo AUTO, el
acondicionador de aire selecciona automáticamente
COOL, HEAT (en su caso) o FAN solo, en función
de la temperatura ambiente o programada.
,QLFLR
1 Tecla ON/OFF (encendido/apagado)
consejos e información
&XDQGRHVWiVHOHFFLRQDGRHOPRGR$872
ODYHORFLGDGGHOYHQWLODGRU\ODWHPSHUDWXUD
VHFRQWURODQDXWRPiWLFDPHQWH\QRVH
SXHGHQDMXVWDU
0RGRGHGHVKXPLGL¿FDFLyQ
(OPRGR'(+80,',)<GHVKXPLGL¿FDFLyQ
funciona según la diferencia entre la temperatura
ajustada y la actual.
La temperatura se regula al tiempo que tiene lugar
ODGHVKXPLGL¿FDFLyQDFWLYDQGR\GHVDFWLYDQGR
el modo de enfriamiento (COOLING) o de solo
ventilador (FAN only).
Q
HUD
FLy
IULJ
RU
5H
ODG
9H
QWL
FLy
5H
IULJ
HUD
ODG
3 Teclas Control
9H
QWL
2 Pulse la tecla Mode para seleccionar AUTO.
RU
Q
Pulse esta tecla para encender el acondicionador
de aire.
El indicador de temperatura de la pantalla de la
unidad interior se enciende.
6LHOPRGR$872QRSURGXFHODWHPSHUDWXUD
DPELHQWHTXHVHGHVHDSXHGHVHOHFFLRQDU
PDQXDOPHQWHODVFRQGLFLRQHVTXHSUH¿HUD
Programe la temperatura que desee.
El acondicionador de aire empieza a funcionar
después de aprox. 3 minutos.
3DUDGD
1 Tecla ON/OFF (encendido/apagado)
Pulse de nuevo esta tecla para apagar el
acondicionador de aire. La lámina horizontal
vuelve a la posición de apagado.
90
Temp. programada
7LHPSR
0RGRGHGHVKXPLGL¿FDFLyQ
,QLFLR
1 Tecla ON/OFF (encendido/apagado)
Pulse esta tecla para encender el
acondicionador de aire.
El indicador de temperatura de la pantalla de la
unidad interior se enciende.
2 Tecla Mode
Púlsela para seleccionar DEHUMIDIFY.
2 Tecla Mode
Púlsela para seleccionar FAN (ventilador).
3 Tecla Fan
Pulse para seleccionar la velocidad deseada
del ventilador entre: Auto, Low (baja), Medium
(media) y High (alta).
La velocidad predeterminada es Auto.
3 Teclas Control
Programe la temperatura que desee.
Normalmente ajustado entre 21ºC y 28ºC.
3DUDGD
1 Tecla ON/OFF (encendido/apagado)
3DUDGD
1 Tecla ON/OFF (encendido/apagado)
Pulse de nuevo esta tecla para apagar el
acondicionador de aire. La lámina horizontal
vuelve a la posición de apagado.
Pulse de nuevo esta tecla para apagar el
acondicionador de aire. La lámina horizontal
vuelve a la posición de apagado.
consejos e información
‡ No aparece ninguna indicación de velocidad
del ventilador en el mando a distancia si se
ha seleccionado la velocidad Auto.
consejos e información
En el modo DEHUMIDIFY, la velocidad del
ventilador se establece en Low (baja); la
función Turbo no se puede utilizar.
)XQFLRQDPLHQWRGHOYHQWLODGRU
Cuando se selecciona el modo FAN el
acondicionador de aire solo ventila el aire interior.
1 Tecla ON/OFF (encendido/apagado)
Pulse esta tecla para encender el
acondicionador de aire.
El indicador de temperatura de la pantalla de la
unidad interior se enciende.
)XQFLRQDPLHQWRGHHQIULDPLHQWR
\FDOHIDFFLyQ
,QLFLR
1 Tecla ON/OFF (encendido/apagado)
Pulse esta tecla para encender el
acondicionador de aire.
El indicador de temperatura de la pantalla de la
unidad interior se enciende.
2 Tecla Mode
Pulse para seleccionar los modos COOL o
HEAT (en su caso).
91
3 Teclas Control
Programe la temperatura que desee.
Normalmente ajustado entre 21ºC y 28ºC.
4 Tecla Fan
Pulse para seleccionar la velocidad deseada
del ventilador entre: Auto, Low (baja), Medium
(media) y High (alta).
La velocidad predeterminada es Auto.
consejos e información
No aparece ninguna indicación de velocidad
del ventilador en el mando a distancia si se
ha seleccionado la velocidad Auto.
3 Apunte con el mando a distancia a la unidad
LQWHULRU\FRQ¿UPHODKRUDDMXVWDGDSXOVDQGROD
tecla Timer-On.
permanece en la pantalla del mando a distancia.
Asegúrese de que el indicador del temporizador
(Timer) en panel de la pantalla de la unidad interior
está encendido.
&DQFHODUORVDMXVWHV
Apunte con el mando a distancia a la unidad interior y
pulse de nuevo la tecla Timer-On. Asegúrese de que
el símbolo del mando a distancia está apagado.
)XQFLRQDPLHQWRGH7LPHU2II
1 Pulse la tecla Timer-Off,
parpadea en la pantalla del mando a
distancia en el primer uso del Timer-Off. De lo
contrario, parpadea la última hora ajustada.
2 Ajuste la hora pulsando las teclas Control:
Adelante
Hacia atrás
Cada vez que se pulsan las teclas, la hora se
incrementa o decrementa 1 minuto.
Al mantener pulsada la tecla, se desplaza más
rápidamente por la hora.
3 Apunte con el mando a distancia a la unidad
LQWHULRU\FRQ¿UPHODKRUDDMXVWDGDSXOVDQGROD
tecla Timer-Off.
permanece en la pantalla del mando a distancia.
Asegúrese de que el indicador del temporizador
(Timer) en panel de la pantalla de la unidad interior
está encendido.
&DQFHODUORVDMXVWHV
3DUDGD
1 Tecla ON/OFF (encendido/apagado)
Pulse de nuevo esta tecla para apagar el
acondicionador de aire. La lámina horizontal
vuelve a la posición de apagado.
$MXVWHVGHOWHPSRUL]DGRU
)XQFLRQDPLHQWRGH7LPHU2Q
1 Pulse la tecla Timer-On,
parpadea en la pantalla del mando a
distancia en el primer uso del Timer-On. De lo
contrario, parpadea la última hora ajustada.
2 Ajuste la hora pulsando las teclas Control:
Adelante
Hacia atrás
Cada vez que se pulsan las teclas, la hora se
incrementa o decrementa 1 minuto.
Al mantener pulsada la tecla, se desplaza
más rápidamente por la hora.
92
Apunte con el mando a distancia a la unidad interior y
pulse de nuevo la tecla Timer-Off. Asegúrese de que
el símbolo del mando a distancia está apagado.
consejos e información
‡ La duración de la función del temporizador
ajustada con el mando a distancia depende de
la hora del reloj. Asegúrese de que el reloj del
mando a distancia está correctamente ajustado
para evitar errores de funcionamiento.
‡ (OWLHPSRGHIXQFLRQDPLHQWRH¿FD]DMXVWDGRFRQ
el mando a distancia se limita a 24 horas.
(MHPSORVGHDMXVWHVGHOWHPSRUL]DGRU
)XQFLRQDPLHQWRGH7LPHU2QLQLFLRGHO
WHPSRUL]DGRU
Se recomienda usar esta función cuando se desea
que la unidad se encienda automáticamente antes
de volver a casa. El acondicionador de aire comienza
automáticamente a funcionar a la hora seleccionada.
Ejemplo: Son las 8:00 y desea que el
acondicionador de aire empiece a funcionar
a las 18:00.
1 Pulse la tecla Timer-On.
2 Ajuste la hora que desee pulsando
repetidamente o manteniendo pulsadas las
teclas Control hasta que 18:00 aparezca en la
pantalla del mando a distancia.
3 &RQ¿UPHODKRUDDSXQWDQGRFRQHOPDQGRD
distancia a la unidad interior y pulsando de
nuevo la tecla Timer-On.
permanece en la pantalla del mando a
distancia.
El indicador Timer en el panel de la pantalla
de la unidad interior se enciende.
)XQFLRQDPLHQWRGH7LPHU2II¿QGHO
WHPSRUL]DGRU
Se recomienda usar esta función cuando
se desea que la unidad se apague
automáticamente para ir a dormir.
El acondicionador de aire se detiene
automáticamente a la hora seleccionada.
Ejemplo: Son las 18:00 y desea que el
acondicionador de aire empiece a funcionar a
las 11:55.
1 Pulse la tecla Timer-Off.
3 &RQ¿UPHODKRUDDSXQWDQGRFRQHOPDQGRD
distancia a la unidad interior y pulsando de
nuevo la tecla Timer-On.
4 Pulse la tecla Timer-Off.
5 Ajuste la hora que desee pulsando
repetidamente o manteniendo pulsadas las
teclas Control hasta que 09:30 aparezca en la
pantalla del mando a distancia.
6 &RQ¿UPHODKRUDDSXQWDQGRFRQHOPDQGR
a distancia a la unidad interior y pulsando de
nuevo la tecla Timer-Off.
aparece en el mando a distancia y la función
se activa.
7LPHU2II 7LPHU2Q
(Funcionamiento en la secuencia Activación Parada - Inicio)
Se recomienda usar esta función cuando desee
apagar el acondicionador de aire después de
irse a la cama y encenderlo de nuevo antes de
despertarse por la mañana o al volver a casa.
Ejemplo: Son las 08:00 y desea que el
acondicionador de aire se apague a las 09:30 y
se vuelva a poner en marcha a las 18:00.
2 Ajuste la hora que desee pulsando
repetidamente o manteniendo pulsadas las
teclas Control hasta que 23:55 aparezca en la
pantalla del mando a distancia.
3 &RQ¿UPHODKRUDDSXQWDQGRFRQHOPDQGRD
distancia a la unidad interior y pulsando de
nuevo la tecla Timer-Off.
permanece en la pantalla del mando a
distancia.
El indicador Timer en el panel de la pantalla
de la unidad interior se enciende.
7HPSRUL]DGRUFRPELQDGR
7LPHU2Q 7LPHU2II
(Funcionamiento en la secuencia Desactivación Inicio - Parada)
1 Pulse la tecla Timer-Off.
2 Ajuste la hora que desee pulsando
repetidamente o manteniendo pulsadas las
teclas Control hasta que 09:30 aparezca en la
pantalla del mando a distancia.
3 &RQ¿UPHODKRUDDSXQWDQGRFRQHOPDQGRD
distancia a la unidad interior y pulsando de
nuevo la tecla Timer-Off.
4 Pulse la tecla Timer-On.
5 Ajuste la hora que desee pulsando
repetidamente o manteniendo pulsadas las
teclas Control hasta que 18:00 aparezca en la
pantalla del mando a distancia.
Se recomienda usar esta función cuando desee
encender el acondicionador de aire antes de
despertarse y apagarlo después de salir de
casa.
Ejemplo: Son las 22:00 y desea que el
acondicionador de aire se encienda a las 6:30
y se pare a las 9:30.
1 Pulse la tecla Timer-On.
2 Ajuste la hora que desee pulsando
repetidamente o manteniendo pulsadas las
teclas Control hasta que 06:30 aparezca en la
pantalla del mando a distancia.
6 &RQ¿UPHODKRUDDSXQWDQGRFRQHOPDQGRD
distancia a la unidad interior y pulsando de
nuevo la tecla Timer-On.
aparece en el mando a distancia y la función
se activa.
93
$MXVWHGHOUHORM
)XQFLRQDPLHQWRGHDKRUUR(FR
Pulse la tecla Eco en el modo COOL o HEAT (en su
caso); el acondicionador de aire aumenta (en modo
COOL) o disminuye (en modo HEAT) automáticamente
1ºC por hora en un período de 2 horas. La temperatura
DMXVWDGDTXHGD¿MDGXUDQWHODVSUy[LPDVKRUDV\
después la unidad se para.
Esta función ofrece más comodidad y ahorra energía.
Se recomienda para dormir.
7HPSHUDWXUD
DMXVWDGD
KRUD
KRUD
5HIULJHUDFLyQ
7HPSHUDWXUD
DMXVWDGD
Antes de poner el acondicionador de aire en
funcionamiento programe el reloj del mando
a distancia siguiendo los procedimientos que
se recogen en esta sección. El panel del
reloj del mando a distancia presenta la hora,
independientemente de que el acondicionador de
aire esté o no funcionando.
Una vez introducidas las pilas en el mando a
aparece y empieza a parpadear.
distancia,
1 Teclas Control
Pulse las teclas de control para ajustar la hora.
Adelante
Hacia atrás
Cada vez que se pulsan las teclas, la hora se
incrementa o decrementa 1 minuto.
Al mantener pulsada la tecla, se desplaza más
rápidamente por la hora.
2 Tecla Clock
Cuando alcance la hora deseada, pulse
la tecla Clock de nuevo o después de
5 segundos sin funcionar; la hora del reloj
deja de parpadear y el reloj se ajusta.
3 Poner en hora el reloj
Pulse la tecla Clock para que la pantalla del
reloj empiece a parpadear.
Siga los pasos 1 y 2 para ajustar la nueva
hora.
consejos e información
‡ El temporizador del reloj utiliza el modo
horario de 24 horas.
‡ La hora predeterminada del mando a
distancia son las 24:00 y vuelve a esta
hora cuando se cambian las pilas.
94
KRUD
KRUD
&DOHIDFFLyQ
)XQFLRQDPLHQWRGH,)HHO
El mando a distancia funciona como un termostato
remoto que ofrece un control preciso de la temperatura
y la máxima comodidad.
Apunte con el mando a distancia a la unidad interior y
pulse la tecla I Feel; la unidad interior emite un pitido
SDUDFRQ¿UPDUTXHODIXQFLyQHVWiDFWLYDGD
permanece en la pantalla del
El símbolo I Feel
mando a distancia hasta que se vuelve a pulsar la
tecla I Feel.
El acondicionador de aire funciona para alcanzar la
temperatura ajustada en la ubicación del mando a
distancia.
El mando a distancia envía la información sobre la
temperatura en su ubicación a la unidad interior cada
10 minutos. El acondicionador de aire abandona
el modo I Feel si no se recibe información sobre la
temperatura del mando a distancia durante 11 minutos
consecutivos.
8VRGHODXQLGDGLQWHULRU
2SFLRQHVDGLFLRQDOHV
)XQFLyQGHUHDUUDQTXHLQWHOLJHQWH
El acondicionador de aire se reanuda
automáticamente con los ajustes anteriores tras
un eventual corte de corriente.
‡ Cuando la lámina se mueva en la dirección
deseada, pulse de nuevo la tecla Swing para que
la lámina permanezca donde se encuentra.
‡ Pulse la tecla Swing de nuevo para que la lámina
empiece a oscilar hacia arriba y hacia abajo
automáticamente.
3DQHOH[WUDtEOH
El panel frontal de la unidad interior puede
quitarse fácilmente para su limpieza y
mantenimiento.
3URWHFFLyQ\GLDJQyVWLFRDXWRPiWLFRV
Este acondicionador de aire puede detectar
averías y mostrar el diagnóstico en la pantalla de
la unidad interior por medio de un código de error.
El acondicionador de aire cambia el
funcionamiento automáticamente para la
protección automática.
&RQWUROGHGLUHFFLyQGHOÀXMRGHDLUH
‡ $MXVWHODGLUHFFLyQGHOÀXMRGHDLUH
correctamente para evitar situaciones poco
agradables o cambios de temperatura en la
habitación.
‡ Ajuste las láminas horizontales con el mando a
distancia.
Rango
Flujo de aire arriba y abajo
3DUDDMXVWDUPDQXDOPHQWHODGLUHFFLyQGHOÀXMR
GHDLUHKRUL]RQWDOL]TXLHUGDGHUHFKD
‡ Ajuste manualmente las láminas verticales por
medio de la palanca izquierda/derecha del brazo
vertical.
‡ Realice estos ajustes antes de poner el aparato
en funcionamiento, puesto que una vez que
lo haga cabe la posibilidad de que se pille los
dedos con el ventilador.
‡ Ajuste las láminas verticales manualmente.
Lámina
vertical
Rango
Flujo de aire izquierda y derecha
precaución
3DUDDMXVWDUDXWRPiWLFDPHQWHODGLUHFFLyQGHO
ÀXMRGHDLUHYHUWLFDODUULEDDEDMR
‡ Ejecute esta función con el aparato
funcionando.
‡ Pulse la tecla Swing (oscilación) del mando
a distancia: la lámina horizontal oscila hacia
arriba y hacia abajo automáticamente.
‡ La tecla Swing (oscilación) se desactiva
cuando el acondicionador de aire no está
funcionando (incluso cuando se haya
seleccionado Timer On).
‡ No tenga el acondicionador de aire
funcionando durante mucho tiempo con
HOÀXMRGHDLUHRULHQWDGRKDFLDDEDMRHQ
el modo COOL o DEHUMIDIFY. De lo
contrario, puede producirse condensación
HQODVXSHU¿FLHGHODOiPLQDKRUL]RQWDO\
provocar que caiga humedad sobre el suelo
o los muebles.
95
‡ No mueva la lámina horizontal
manualmente. Utilice siempre la
tecla Swing. Si se mueve la lámina
manualmente, puede provocar averías
durante el funcionamiento. Si la lámina
funciona mal, detenga el acondicionador
de aire y arránquelo de nuevo.
‡ El ángulo de abertura de la lámina
horizontal no debe establecerse
demasiado pequeño, dado que puede
menoscabar el rendimiento de enfriamiento
o calefacción debido a lo restringido de la
]RQDSDUDHOÀXMRGHDLUH
‡ No utilice el acondicionador de aire con las
láminas horizontales en posición cerrada.
‡ Si el acondicionador de aire está
conectado al suministro eléctrico
(funcionamiento inicial), la lámina
horizontal puede emitir un sonido por
espacio de 10 segundos, lo que puede
considerarse normal.
)XQFLRQDPLHQWRGHHPHUJHQFLD
Cuando el mando a distancia se ha perdido o no
funciona, use el interruptor manual de la unidad
interior. El acondicionador de aire funcionará
en modo AUTO y el ajuste de temperatura o la
velocidad del ventilador no podrán cambiarse.
‡ Pulse de nuevo la tecla Manual Control para
apagar el acondicionador de aire.
El modo de funcionamiento se observa en la
siguiente tabla.
Modo
Modelo
Ajuste de la
temperatura
Flujo de aire
AUTO
HEAT PUMP
25°C
COOL/FAN
AUTO
HEAT PUMP
20°C
HEAT/FAN
7HPSHUDWXUDGHIXQFLRQDPLHQWR
Rangos de temperatura de funcionamiento
Lado interior
DB/WB(°C)
Lado exterior
DB/WB(°C)
Enfriamiento máximo
32/23
43/26
Enfriamiento mínimo
21/15
21/-
Calor máximo
27/-
24/18
Calor mínimo
20/-
El rango de temperaturas (temperatura exterior)
para el modelo de solo enfriamiento es de
-7ºC~43ºC; para el modelo con bomba de calor de
-7ºC~24ºC.
Si el acondicionador de aire se usa sin tener
en cuenta las condiciones anteriores, cabe la
posibilidad de que ciertas características de
seguridad, cuya función es la de proteger, se
activen y fuercen al aparato a funcionar mal.
)XQFLRQDPLHQWRySWLPR
Si desea alcanzar un rendimiento óptimo deberá
observar lo siguiente:
‡ $MXVWHFRUUHFWDPHQWHHOVHQWLGRGHÀXMRGHODLUH
de forma que no quede dirigido a las personas.
‡ Ajuste la temperatura para alcanzar el mayor
grado de comodidad posible. No ajuste el aparato
a temperaturas demasiado elevadas.
7HFODGHFRQWURO
PDQXDO
‡ Cierre las puertas y las ventanas cuando esté en
los modos COOL o HEAT, ya que de lo contrario
el rendimiento puede verse afectado.
‡ Use las teclas Timer On y Timer Off del mando
a distancia para seleccionar la hora deseada de
encendido y apagado.
7HFODGHFRQWURO
PDQXDO
‡ Pulse la tecla Manual Control para pasar
al modo AUTO. El acondicionador de aire
selecciona automáticamente los modos COOL,
HEAT (solo modelos con bomba de calor) y
FAN en función de la temperatura ambiente
para lograr el mayor confort.
96
‡ No coloque ningún objeto junto a la entrada o
VDOLGDGHDLUHGDGRTXHODH¿FDFLDGHODSDUDWR
puede verse reducida y puede incluso dejar de
funcionar.
‡ /LPSLHFRQIUHFXHQFLDORV¿OWURVGHDLUH\DTXHGH
lo contrario el rendimiento del enfriamiento o de la
calefacción puede verse reducido.
/LPSLH]D\PDQWHQLPLHQWR
0DQWHQLPLHQWR
Se deben realizar periódicamente las siguientes operaciones de mantenimiento.
Artículos
Operaciones de
mantenimiento
Frecuencia recomendada
Filtro de polvo
Limpieza
Mensualmente o con mayor frecuencia si fuera
necesario
Filtros ambientadores
Cambio / limpieza
Cada 3 meses o con mayor frecuencia si fuera
necesario
Carcasa del aparato
Limpieza
Mensualmente o con mayor frecuencia si fuera
necesario
Bandeja de recogida de agua y
tuberías de evacuación
/LPSLDU\YHUL¿FDUVL
hay obstrucciones
Al principio de cada estación antes de ponerlo en
funcionamiento*
Bobinas interior y exterior
Limpieza
Al principio de cada estación antes de ponerlo en
funcionamiento*
* (VWDRSHUDFLyQGHEHOOHYDUODDFDER~QLFDPHQWHSHUVRQDOFXDOL¿FDGR
advertencia
‡ Apague el acondicionador de aire y
desconecte el suministro eléctrico antes de
proceder a la limpieza.
/LPSLH]DGHODXQLGDGLQWHULRU
\HOPDQGRDGLVWDQFLD
‡ Utilice un paño seco para limpiar la unidad
interior y el mando a distancia.
‡ Puede utilizar un paño humedecido con agua
fría para limpiar la unidad interior si está muy
sucia.
Abrazadera
del panel
1 Levante el panel frontal de la unidad interior hasta
un ángulo en el que se pare con soporte total de
la abrazadera.
‡ El panel frontal de la unidad interior puede
quitarse y limpiarse con agua. Después pase
un paño seco.
‡ No utilice cepillos, papel de lija ni elementos
de pulido para limpiar la unidad, ya que puede
causar daños.
‡ No utilice un paño tratado químicamente ni un
paño de quitar el polvo para limpiar el aparato.
‡ No utilice disolventes, diluyentes, polvo para
pulir ni disolventes similares para la limpieza.
Pueden causar roturas o deformaciones en la
VXSHU¿FLHGHSOiVWLFR
$VDGHO¿OWURGHSROYR
2 6XMHWHHODVDGHO¿OWURGHSROYR\OHYiQWHOR
OLJHUDPHQWHSDUDVDFDUORGHOSRUWD¿OWURV
‡ Nunca utilice agua caliente a más de 40ºC
para limpiar el panel frontal, ya puede causar
deformaciones o decoloraciones.
/LPSLH]DGHORV¿OWURV
Nota: Hay que desconectar el suministro eléctrico
antes de proceder a la limpieza.
8Q¿OWURFRQWUDHOSROYRTXHHVWpDWDVFDGR
UHGXFHODH¿FDFLDGHHQIULDPLHQWRRFDOHIDFFLyQ
GHODSDUDWR/LPSLHHO¿OWURPHQVXDOPHQWHRFRQ
mayor frecuencia si fuera necesario.
3 7LUHGHVSXpVGHO¿OWURKDFLDDEDMRSDUDH[WUDHUOR
de la unidad interior.
97
advertencia
Filtro de polvo
1RWRTXHQLLQWHQWHOLPSLDUHO
JHQHUDGRUGHIUtRGHSODVPDHQ
VXFDVR3XHGHFDXVDUGHVFDUJDV
HOpFWULFDV
Mantenimiento general
/LPSLHHO¿OWURGHSROYRFRQXQDDVSLUDGRUDR
agua y, seguidamente, séquelo en un lugar
fresco.
Filtro de polvo
Si el acondicionador de aire no va a usarse durante
un largo período de tiempo:
‡ Póngalo en funcionamiento en el modo de solo
ventilador (FAN) durante aproximadamente
3 ó 4 horas para que la unidad se seque
completamente.
‡ Apague el aparato y tire del enchufe. Saque las
baterías del mando a distancia.
Filtro
ambientador
4 /RV¿OWURVDPELHQWDGRUHVHQVXFDVRFRPR
HO¿OWURGHFDUEyQDFWLYRHOELR¿OWURHO¿OWURGH
YLWDPLQD&RHO¿OWURGHSODWDLyQLFDHVWiQ¿MDGRV
DO¿OWURGHSROYR
5HWLUHORV¿OWURVDPELHQWDGRUHVGHOPDUFRGHO
VRSRUWHGHO¿OWUR
/LPSLHORV¿OWURVDPELHQWDGRUHVFRPRPtQLPR
cada tres (3) meses y cámbielos cada 6 meses.
Límpielos con una aspiradora en la medida de lo
posible.
‡ La unidad exterior requiere limpieza y
mantenimiento periódicos. No intente hacerlo
usted mismo. Diríjase a su distribuidor o técnico
de servicio.
&RPSUREDFLRQHVDQWHVGHODSXHVWDHQ
IXQFLRQDPLHQWR
‡ Asegúrese de que el cableado no está roto ni
desconectado.
‡ $VHJ~UHVHGHTXHHO¿OWURGHSROYRHVWiLQVWDODGR
‡ Asegúrese de que la entrada o salida de aire no
están bloqueadas si el aparato no se ha usado
durante mucho tiempo.
advertencia
‡ No toque las partes metálicas de la unidad al
VDFDUHO¿OWUR3XHGHQSURGXFLUVHOHVLRQHVDO
PDQLSXODUERUGHVGHPHWDOD¿ODGRV
5 9XHOYDDFRORFDUORV¿OWURVDPELHQWDGRUHVHQ
su sitio.
6 9XHOYDDFRORFDUODSDUWHVXSHULRUGHO¿OWUR
de polvo en la unidad, teniendo cuidado para
que los bordes izquierdo y derecho queden
debidamente alineados y coloque en su sitio
ORV¿OWURVGHSROYR
98
‡ No utilice agua para limpiar el interior del
acondicionador de aire. El contacto con el
agua puede destruir el aislamiento y acarrear
posibles descargas eléctricas.
‡ Al limpiar el aparato asegúrese primero de
que el suministro eléctrico y el disyuntor
están apagados.
&RQVHMRVGHIXQFLRQDPLHQWR
Cabe la posibilidad de que durante un
funcionamiento normal se produzcan los
siguientes sucesos:
3URWHFFLyQGHODFRQGLFLRQDGRUGHDLUH
‡ 3URWHFFLyQGHOFRPSUHVRU
El compresor no puede volver a arrancar
antes de que transcurran 3 minutos después
de pararse.
‡ $QWLFRQJHODFLyQ
Si la unidad funciona en el modo COOL y a
baja temperatura ambiente, puede formarse
escarcha en el condensador. Cuando la
temperatura del condensador baja por debajo
de los 0ºC, el compresor se detiene para
proteger la unidad.
‡ 'HVFRQJHODFLyQ
En la unidad exterior puede formarse hielo
durante el ciclo de calefacción, cuando la
temperatura exterior es baja y cuando la
humedad es elevada, lo que conlleva una
UHGXFFLyQGHODH¿FDFLDFDOHIDFWRUD
En estos casos el acondicionador de aire
dejará de calentar y comenzará a deshelar
automáticamente. El periodo necesario para
la descongelación puede variar entre 3 y 12
minutos.
Durante la descongelación, los motores de
ventilación de la unidad interior y exterior se
paran, el indicador interior parpadea “H1” y la
unidad exterior puede emitir vapores. No se
trata de ninguna avería. Una vez terminada
la descongelación, el modo de calefacción se
recupera automáticamente.
‡ 3URWHFFLyQFRQWUDHODLUHIUtR
En el modo HEAT, el ventilador interior no
funciona para evitar que se introduzca aire
frío en la habitación (durante 5 minutos),
si el condensador interior no alcanza una
temperatura mínima en los siguientes casos:
(1) El modo de calefacción acaba de
empezar.
(2) Exactamente después de que la
descongelación automática termine.
(3) Calefacción a baja temperatura.
6XDYHEULVD
Es posible que la unidad interior genere una
suave brisa y las láminas giren a una posición
determinada en los siguientes casos:
'HODXQLGDGLQWHULRUVDOHXQDQHEOLQDEODQFD
‡ Puede generarse una neblina blanca debido a la
gran diferencia de temperatura entre la entrada y
la salida de aire en el modo COOL en un entorno
interior que tenga una elevada humedad relativa.
‡ Esta neblina blanca puede generarse por
la humedad generada en el proceso de
descongelación cuando el acondicionador
arranca en el modo HEAT tras la descongelación.
(ODFRQGLFLRQDGRUGHDLUHHPLWHXQOLJHURUXLGR
‡ Puede oírse un ligero silbido cuando el
compresor funciona o deja de hacerlo. Este
VRQLGRHVHOGHOUHIULJHUDQWHDOÀXLURGHWHQHUVH
‡ Puede oírse un ligero "chirrido" al funcionar el
compresor o al dejar de hacerlo. Ello se debe a la
dilatación por el calor y a la contracción por el frío
de las partes de plástico del aparato cuando la
temperatura cambia.
‡ Puede que se oiga un ruido ocasionado por la
lámina al volver a su posición original al encender
el suministro eléctrico.
/DXQLGDGLQWHULRUH[SXOVDSROYR
Esto es normal cuando el acondicionador de aire no
se ha usado desde hace tiempo o cuando se pone
en funcionamiento por primera vez.
'HODXQLGDGLQWHULRUVDOHXQRORUSHFXOLDU
Ello se debe a que la unidad interior emite olores
ocasionados por los materiales de construcción,
muebles o humos.
(ODFRQGLFLRQDGRUGHDLUHSDVDGHOPRGR&22/
R+($7DOGHVROR)$1YHQWLODGRU
Al llegar la temperatura interior al valor ajustado,
el compresor se para automáticamente y el
acondicionador de aire cambia al modo de
ventilador (FAN).
El compresor volverá a funcionar cuando la
temperatura interior suba en el modo COOL o baje
en el de HEAT hasta alcanzar el punto de ajuste
seleccionado.
&RQGHQVDFLyQ
Es probable que se forme agua de condensación en
la salida de aire si se enfría o seca durante mucho
tiempo cuando la humedad relativa es de más del
80% (con las puertas y ventanas abiertas).
Ajuste la lámina vertical al ángulo máximo (respecto
al suelo) y seleccione el modo de velocidad del
ventilador High (alta). Cierre puertas y ventanas.
(1) En el modo HEAT, la unidad está encendida,
el compresor no alcanza la condición de
arranque.
La iluminación o el teléfono inalámbrico de un
vehículo funcionando en las cercanías puede
ocasionar un funcionamiento incorrecto del aparato.
Desconecte la unidad del suministro eléctrico y,
seguidamente, vuelva a conectarla. Pulse la tecla
ON/OFF del mando a distancia para reiniciar el
funcionamiento.
(2) En el modo HEAT, la temperatura alcanza
el valor programado y el compresor deja de
funcionar durante 1 minuto.
)XQFLyQGHOYHQWLODGRU;)DQ
La unidad interior puede seguir funcionando
después de apagarla pulsando la tecla ON/OFF.
Compruebe si se ha apagado la función X-Fan.
99
6ROXFLyQGHSUREOHPDV
El acondicionador de aire no lo puede reparar el usuario. Las reparaciones incorrectas
pueden causar incendios o descargas eléctricas. Póngase en contacto con un centro de
servicio autorizado para obtener una reparación profesional.
advertencia
Si se produce alguna de las siguientes situaciones, pare inmediatamente el acondicionador de
aire, desconecte la alimentación y póngase en contacto con el centro de servicio técnico.
‡ Si aparece un código de error en la pantalla
de la unidad interior.
‡ Se ha salpicado agua u otros líquidos a la unidad.
‡ El indicador de corriente u otros indicadores
parpadean rápidamente y no se puede
detener desconectando la alimentación y
volviendo a encenderla.
‡ Se produce un sonido brusco durante el
funcionamiento.
‡ El fusible se funde o el disyuntor salta con
frecuencia.
‡ La unidad pierde agua.
‡ Se emiten olores fuertes durante el
funcionamiento.
‡ El cable de alimentación y el enchufe están
sobrecalentados.
‡ Otras situaciones anómalas.
La presión del sistema de refrigeración es baja y puede provocar roturas en la unidad.
6ROLFLWHDXQLQVWDODGRUFXDOL¿FDGRTXHORVXSHUYLVH
Anomalías
La unidad no se
inicia
La unidad no enfría
o no calienta bien
la habitación (en
su caso), al tiempo
que sale aire del
acondicionador.
Causa
¿Qué se debe hacer?
Corte eléctrico
Espere a que se restablezca el
servicio.
Puede que la unidad se haya
desenchufado.
Asegúrese de que está
correctamente enchufada.
Puede que el fusible se haya fundido.
Cambie el fusible.
La tensión es demasiado alta o
demasiado baja.
Solicite que un profesional pruebe
la tensión.
Puede que las pilas del mando a
distancia se hayan agotado.
Cambie las pilas.
La hora que ha seleccionado para el
temporizador no es correcta.
Espere o cancele el ajuste del
temporizador.
El ajuste de la temperatura no es
apropiado.
'H¿QDFRUUHFWDPHQWHOD
temperatura. Para obtener más
información, consulte el apartado
“Uso del mando a distancia”.
(O¿OWURGHDLUHHVWiEORTXHDGR
/LPSLHHO¿OWUR
Las puertas o ventanas están abiertas.
Cierre puertas y ventanas.
La entrada o salida de aire de la
unidad interior o exterior están
bloqueadas.
Quite las obstrucciones antes de
volver a arrancar el aparato.
Se ha activado la protección de
3 minutos del compresor.
Espere 3 minutos.
Si el problema no se ha solucionado, póngase en contacto con un distribuidor local o con el centro
de servicio al cliente más cercano. Cerciórese de que les informa detalladamente de las averías y del
modelo de unidad.
100
Las siguientes comprobaciones antes de ponerse en contacto pueden ahorrarle tiempo y dinero.
$QRPDOtDV
La unidad no
funciona.
Se producen
olores.
&DXVD
La unidad no funciona si se enciende
inmediatamente después de
apagarse. Esto sirve para proteger la
unidad. Espere unos 3 minutos.
‡Es posible que la unidad interior
desprenda olores. Es el resultado
de los olores de la habitación (como
muebles, tabaco, etc.) que ha
absorbido la unidad.
‡Póngase en contacto con el centro
de servicio técnico para la limpieza
si persisten los olores.
Ruido de “agua
ÀX\HQGR´
El ruido de siseo como agua
FRUULHQGRHVHOUHIULJHUDQWHTXHÀX\H
en el interior de la unidad.
Se genera
neblina en el
modo COOL.
Durante el modo de enfriamiento,
es posible que se genere una suave
neblina de la unidad interior debido
a la alta temperatura ambiente y a la
humedad.
Después de un lapso de tiempo, la
neblina desaparece a medida que se
reduce la temperatura y la humedad.
$QRPDOtDV
‡La humedad es alta.
Fuga de agua de
la unidad interior
Fuga de agua
de la unidad
exterior
La unidad no se
puede encender.
‡¿Se ha disparado el dispositivo de
protección del circuito?
Ruido de la
unidad interior
La unidad
interior no puede
expulsar aire.
‡¿Es adecuado el ajuste de
temperatura?
‡En el modo HEAT, cuando la
temperatura exterior es baja o la
humedad es alta, se forma hielo en
el condensador exterior. La unidad
se descongela automáticamente y la
unidad interior para el aire durante
unos 2-3 minutos.
Humedad en la
salida de aire
Si la unidad funciona con humedad
elevada durante mucho tiempo, se
puede generar humedad en la rejilla
de salida del aire y después gotear.
Código de
error H1:
descongelación
Esto es correcto. La unidad
se encuentra en el modo de
descongelación y la calefacción se
reanuda pronto.
‡¢(VWiVXFLRHO¿OWUR"
‡¿Se ha ajustado la velocidad baja
del ventilador?
‡Cuando se inicia o detiene el modo
de descongelación, se produce un
VRQLGRGHÀXMRGHUHIULJHUDQWHHQOD
dirección opuesta.
‡En el modo DEHUMIDIFY, el
ventilador interior para el aire
durante unos 3-12 minutos para
evitar que el agua de condensación
se evapore de nuevo.
‡¿Se han agotado las pilas?
‡¿Están abiertas las puertas o
ventanas?
‡Ruido emitido cuando el relé
del compresor o el ventilador se
encienden o apagan.
‡Durante la descongelación, pueden
emitirse vapores o agua.
‡¿Se ha utilizado correctamente el
temporizador (TIMER)?
El efecto de
refrigeración
/ calefacción es
de baja calidad.
‡Durante el modo de descongelación,
HODJXDGHVFRQJHODGDÀX\HKDFLD
afuera.
‡En el modo HEAT, cuando la
temperatura del condensador
LQWHULRUHVPX\EDMDHOÀXMRGHDLUH
se detiene para evitar el aire frío (en
2 minutos).
‡¿Es la tensión más alta o más baja?
(prueba por parte de técnicos)
‡¿Están bloqueadas la entrada o
salida de aire?
‡/DPDQJXHUDGHGHVDJHHVWiÀRMD
u obstruida.
‡Durante el modo de calefacción, el
agua del condensador gotea hacia
afuera.
‡¿Está cortado el suministro
eléctrico?
‡¿Está suelto el enchufe?
(en su caso)
‡Desbordamiento del agua de
condensación.
‡Durante el modo de enfriamiento, el
agua se condensa alrededor de los
tubos y juntas de conexión.
Es el sonido de la fricción causada
por la expansión o contracción del
panel u otras partes por el cambio
de temperatura.
Crujido
&DXVD
‡¿Hay fuentes de calor en la
habitación?
No se deshaga de este producto en los vertederos como si fuera
XQUHVLGXRVLQFODVL¿FDU(VQHFHVDULRFODVL¿FDUORVGHVHFKRVSRU
separado para que reciban el tratamiento adecuado.
101
Índice
Parabéns .............................................................................103
Precauções de segurança ...................................................104
Descrição do produto ..........................................................106
Visor do aparelho interior ....................................................107
Controlo remoto ....................................................................107
Descrição do controlo remoto ..............................................108
Indicadores do visor do controlo remoto .............................109
Primeira utilização ...............................................................110
Como utilizar o controlo remoto............................................110
Como utilizar o aparelho interior ..........................................115
Funcionamento de emergência ...........................................116
Funcionamento óptimo .................................................... ....116
Limpeza e manutenção .......................................................117
Sugestões para a utilização ................................................119
Resolução de problemas .....................................................120
Notas importantes
‡ 0DQWHQKDRFRQWURORUHPRWRRQGHRVLQDODOFDQFHR
UHFHSWRUGRDSDUHOKRLQWHULRU
‡ 4XDQGRXWLOL]DURDUFRQGLFLRQDGRQmRVHHVTXHoDGH
DSRQWDURFRQWURORUHPRWRSDUDRUHFHSWRUGRVLQDOQR
DSDUHOKRLQWHULRU
‡ 4XDQGRRFRQWURORUHPRWRHQYLDXPVLQDORVtPEROR
SLVFDGXUDQWHVHJXQGRQRYLVRUGRFRQWURORUHPRWR
‡ 2DSDUHOKRLQWHULRUFRQ¿UPDRVLQDOFRPXPVLQDO
VRQRURTXDQGRUHFHEHRVLQDOGRFRQWURORUHPRWR
‡ 6HQmRRXYLURVLQDOVRQRURGRDSDUHOKRLQWHULRUSULPD
RPHVPRERWmRGRFRQWURORUHPRWRSDUDHQYLDURVLQDO
QRYDPHQWH
102
3DUDEpQV
Parabéns e obrigado por ter escolhido um ar
condicionado tipo split da Electrolux. Temos a
certeza de que vai achar a utilização do seu novo
ar condicionado muito agradável.
&RQGLo}HVGHXWLOL]DomR
Antes de utilizar o ar condicionado, é recomendável
que leia todo o manual do utilizador, que descreve
o ar condicionado e as respectivas funções.
‡ Áreas de cozinha em lojas, escritórios e outros
ambientes de trabalho.
Para evitar riscos que estão sempre presentes
quando se utiliza um aparelho eléctrico, é
importante que o ar condicionado seja instalado
correctamente e que o utilizador leia todas as
instruções de segurança atentamente para evitar
utilizações incorrectas e perigos.
‡ Utilização por clientes de hotéis, motéis e
outros ambientes do tipo residencial.
Recomendamos que conserve este livro de
instruções para consultas futuras e que o entregue
a quaisquer futuros proprietários.
Quando retirar o ar condicionado da embalagem,
FHUWL¿TXHVHGHTXHQmRHVWiGDQL¿FDGR6HWLYHU
dúvidas, não utilize o ar condicionado e contacte
um centro de assistência técnica autorizado da
Electrolux.
sugestão ambiental
Informação para os utilizadores acerca da
eliminação
‡ A maior parte dos materiais de embalagem é
reciclável.
‡ Elimine esses materiais através de um centro de
UHFLFODJHPORFDORXFRORFDQGRRVQRVSRQWRVGH
recolha apropriados.
‡ Se pretender eliminar este ar condicionado,
contacte as suas autoridades locais e pergunte
qual é o método de eliminação correcto.
atenção
‡ O ar condicionado não deve ser utilizado por
crianças ou pessoas doentes sem vigilância.
(VWHDSDUHOKRGHVWLQDVHH[FOXVLYDPHQWHD
utilizações domésticas ou semelhantes, tais
como:
‡ Turismo rural.
‡ Ambientes hoteleiros do tipo residencial.
Notas importantes
Contacte um instalador autorizado para a
instalação deste aparelho.
Contacte um técnico de assistência autorizado
para efectuar qualquer reparação ou manutenção
deste aparelho.
‡ A tomada necessária para a alimentação de
energia tem de ser ligada e disponibilizada
por um empreiteiro autorizado.
‡ Este aparelho não se destina a ser
utilizado por pessoas (incluindo crianças)
com capacidades físicas, sensoriais ou
motoras reduzidas ou falta de experiência
e conhecimentos, a menos que recebam
supervisão ou instrução relativamente à
utilização do aparelho por uma pessoa
responsável pela sua segurança.
‡ As crianças devem ser vigiadas para garantir
que não brincam com o ar condicionado.
‡ Se for necessário substituir o cabo de
alimentação, o trabalho de substituição
deve ser efectuado apenas por pessoal
autorizado.
‡ A instalação tem de ser feita apenas por
pessoal autorizado, em conformidade
com as normas eléctricas nacionais e as
regulamentações para fornecedores de
serviços de electricidade.
‡ As crianças devem ser vigiadas para garantir
que não brincam com o ar condicionado.
‡ Se for necessário mover o aparelho para
RXWURORFDORXHOLPLQiORHVVDWDUHIDVySRGH
VHUHIHFWXDGDSRUSHVVRDOTXDOL¿FDGRSDUD
tais trabalhos.
‡ Contacte um instalador autorizado para a
instalação deste ar condicionado.
‡ Tenha cuidado para não tocar com os dedos
na ventoinha quando ajustar o direccionador
vertical.
‡ Contacte um técnico de assistência autorizado
para efectuar qualquer reparação ou
manutenção deste aparelho.
‡ Este ar condicionado utiliza refrigerante
R410a.
‡ Se for necessário substituir o cabo de
alimentação, o trabalho de substituição deve
ser efectuado apenas por pessoal autorizado.
‡ A instalação tem de ser feita apenas por
pessoal autorizado e em conformidade com
as normas eléctricas nacionais.
103
3UHFDXo}HVGHVHJXUDQoD
Este manual contém várias sugestões úteis para
utilizar o seu ar condicionado correctamente e
PDQWrORHPERPHVWDGR%DVWDDOJXPFXLGDGR
preventivo da sua parte para poupar bastante
tempo e dinheiro durante a vida útil do seu ar
condicionado. Pode encontrar muitas respostas
para problemas comuns na tabela com sugestões
SDUDDUHVROXomRGHSUREOHPDVQDVSiJLQDV
121. Se consultar primeiro a tabela de sugestões
para a resolução de problemas, poderá não ter de
contactar a assistência técnica.
2VVLJQL¿FDGRVGRVVtPERORVXWLOL]DGRVQHVWH
manual são apresentados em baixo:
atenção
Isto indica informação importante para a sua
segurança pessoal e para evitar danos no aparelho.
sugestões e informação
Este símbolo indica sugestões e informações
relativas à utilização do aparelho.
sugestão ambiental
Este símbolo indica sugestões e informações para
uma utilização económica e ecológica do aparelho.
Este símbolo indica uma acção que nunca deve
fazer.
Faça sempre isto.
1RWDVLPSRUWDQWHV
1 Não deixe o aparelho funcionar com o
direccionador horizontal do ar fechado.
2 1mRXWLOL]HRDSDUHOKRVHPR¿OWURGRDU
aviso
Se observar uma situação anormal,
como um cheiro a queimado, desligue o
ar condicionado e contacte um agente
de assistência da Electrolux. Se permitir
que a situação anormal continue, o ar
FRQGLFLRQDGRSRGH¿FDUGDQL¿FDGRRXDWp
provocar choque eléctrico ou incêndio.
Não toque no ar condicionado com
as mãos molhadas. Isso pode causar
choque eléctrico.
1mRFRUWHQHPGDQL¿TXHRFDERGH
DOLPHQWDomRRXRXWURV¿RV6HLVVR
ocorrer, solicite a reparação ou a
VXEVWLWXLomRDXPWpFQLFRFHUWL¿FDGR
Não ligue este ar condicionado a uma
extensão com várias tomadas.
Desligue a alimentação eléctrica do ar
FRQGLFLRQDGRVHQmRSUHWHQGHUXWLOL]i
lo durante um longo período de tempo.
Caso contrário, a acumulação de pó pode
provocar um incêndio.
Antes de limpar o ar condicionado,
desligue a alimentação eléctrica para não
correr riscos de choque eléctrico.
A corrente eléctrica fornecida ao ar
condicionado deve ser a correcta,
conforme indicado no manual de
instalação. Os aparelhos de ar
condicionado que forem fornecidos com
FDERGHDOLPHQWDomRH¿FKDGHYHPVHU
ligados directamente numa tomada com
interruptor de segurança adequado.
Os aparelhos de ar condicionado que
QmRWLYHUHPFDERFRP¿FKDGHYHPVHU
ligados a um circuito com disjuntor,
conforme indicado no manual de
instalação.
&HUWL¿TXHVHGHTXHDDOLPHQWDomR
eléctrica fornecida ao ar condicionado é
HVWiYHOHFXPSUHRVUHTXLVLWRVGH¿QLGRV
no manual de instalação.
&HUWL¿TXHVHVHPSUHGHTXHRSURGXWRp
instalado com boa ligação à terra.
Por questões de segurança, não se
esqueça de desligar o disjuntor antes
de qualquer acção de manutenção ou
limpeza se o produto não tiver sido
utilizado durante um longo período de
tempo. O pó acumulado pode causar
incêndio ou choque eléctrico.
104
3UHFDXo}HVGHVHJXUDQoD
atenção
Seleccione a temperatura mais
adequada.
Isso pode poupar electricidade.
Não mantenha portas e janelas abertas
por muito tempo com o aparelho a
funcionar. Isso resulta num desempenho
LQVX¿FLHQWH
Não tape a saída e a entrada de ar.
Isso resulta num desempenho
LQVX¿FLHQWHHSURYRFDDQRPDOLDV
Mantenha todos os materiais
combustíveis a mais de 1 m dos
aparelhos. Podem causar incêndio.
Não se coloque em pé sobre o aparelho
exterior, nem coloque objectos pesados
sobre ele.
3RGHIHULUVHRXFDXVDUGDQRV
Não tente reparar o aparelho de ar
condicionado. Quaisquer reparações
incorrectas podem causar choque
eléctrico ou incêndio. Contacte um centro
de assistência autorizado.
8WLOL]DomR
$H[SRVLomRGLUHFWDDRÀX[RGHDUGRDSDUHOKR
de ar condicionado por períodos prolongados
pode ser prejudicial para a sua saúde.
Não exponha pessoas, animais ou plantas
GLUHFWDPHQWHDRÀX[RGHDUSRUSHUtRGRV
prolongados.
/LPSH]DHPDQXWHQomR
1 $QWHVGHOLPSDURDSDUHOKRFHUWL¿TXHVH
de que a alimentação eléctrica e o disjuntor
estão desligados.
2 Não toque nas peças de metal do aparelho
TXDQGRUHWLUDURV¿OWURV$VDUHVWDV
PHWiOLFDVD¿DGDVSRGHPFDXVDUIHULPHQWRV
3 Não utilize água para limpar o interior do
ar condicionado. A exposição à água pode
causar choque eléctrico.
$VVLVWrQFLD7pFQLFD
Para reparações e manutenção, contacte um
centro de assistência autorizado.
Não introduza as mãos ou objectos na
VDtGDHQDHQWUDGDGHDU3RGHIHULUVH
Não exponha animais ou plantas
GLUHFWDPHQWHDRÀX[RGHDU
1mRXWLOL]HRDSDUHOKRSDUDRXWURV¿QV
como conservar alimentos ou secar
roupa.
Não derrame água sobre o ar
condicionado. Isso pode causar choque
eléctrico ou avarias.
$QWHVGHFRORFDUHP
IXQFLRQDPHQWR
1 &RQWDFWHXPLQVWDODGRUTXDOL¿FDGRSDUD
a instalação.
2 /LJXHD¿FKDGHDOLPHQWDomR
correctamente.
3 Não utilize um cabo de alimentação
GDQL¿FDGRRXIRUDGDVQRUPDV
4 Não partilhe a mesma tomada com
outros aparelhos.
5 Não utilize um cabo de extensão.
6 Não inicie/pare o funcionamento
ligando/desligando o cabo de
alimentação.
105
'HVFULomRGRSURGXWR
$SDUHOKRLQWHULRU
Entrada de ar
2
3
5
Saída de ar
6
7
8
$SDUHOKRH[WHULRU
9
Entrada de ar (traseira)
0RGe
)Dn
7HPS
7LPHU2If
6ZLQJ
/LJKW
7XUER
7LPHU2Q
&ORFk
,IHHO
EcR
Entrada de
ar (lateral)
Saída de
ar
Painel frontal
Controlo remoto
Visor digital
Suporte do controlo remoto
)LOWURGHDUVDXGiYHODWUiVGR¿OWURGRSy
Tubo de refrigerante (se aplicável)
3Up¿OWURGRSy
Mangueira de escoamento (se aplicável)
Direccionador horizontal do ar
Cabo de alimentação (se aplicável)
Direccionador vertical do ar
Placa de montagem
Gerador de plasma frio (se aplicável)
Cabo de ligação (se aplicável)
%RWmRGHFRQWURORPDQXDO
Nota: As ilustrações acima servem apenas para explicação.
O seu ar condicionado pode ser ligeiramente diferente.
A forma essencial mantém-se.
106
9LVRUGRDSDUHOKRLQWHULRU
‡ Se mantiver o controlo remoto numa posição
TXHGL¿FXOWHDWUDQVPLVVmRDGHTXDGDGRVLQDO
pode ocorrer um atraso de até 15 minutos.
Receptor
de sinal
‡ Quando o controlo remoto envia um sinal, o
símbolo
pisca durante 1 segundo no visor. O
DSDUHOKRLQWHULRUFRQ¿UPDRVLQDOFRPXPVLQDO
sonoro quando recebe um sinal correcto.
,QGLFDGRU,)HHO
Acende quando a função I Feel está activa.
,QGLFDGRU7XUER
Acende no modo Turbo.
,QGLFDGRU(FR(FRQRPLD
Acende quando a função ECO está activa.
,QGLFDGRUGHWHPSHUDWXUD
Apresenta as regulações de temperatura
quando o ar condicionado está a funcionar.
,QGLFDGRUGRWHPSRUL]DGRU
Este indicador acende quando o temporizador
está activado (ON) ou desactivado (OFF).
,QGLFDGRUGHRVFLODomR
Acende quando a função Swing (Oscilação)
está activa.
&RQWURORUHPRWR
&RPRXWLOL]DURFRQWURORUHPRWR
‡ Aponte o controlo remoto para o receptor de
sinal do aparelho interior.
‡ &HUWL¿TXHVHGHTXHQmRKiREVWiFXORVD
interferir com o sinal.
/RFDOL]DomRGRFRQWURORUHPRWR
atenção
‡ O ar condicionado não funcionará se houver
cortinas, portas ou outros materiais a bloquear
os sinais do controlo remoto para o aparelho
interior.
‡ Evite a entrada de líquidos no controlo remoto.
Não exponha o controlo remoto a luz solar
directa ou calor.
‡ Se o receptor de sinais infravermelhos do
aparelho interior for exposto à luz solar
directa, o ar condicionado pode não funcionar
correctamente. Utilize cortinas para evitar que
a luz solar incida sobre o receptor.
‡ Se outros aparelhos eléctricos reagirem ao
controlo remoto, afaste esses aparelhos ou
contacte um concessionário local.
,QVWDODomRVXEVWLWXLomRGDVSLOKDV
‡ Deslize a tampa do compartimento das pilhas
para fora e introduza duas pilhas alcalinas
VHFDV[$$$9&HUWL¿TXHVHGHTXHDV
SRODULGDGHVH¿FDPFRUUHFWDV
‡ Feche a tampa do compartimento das pilhas
sugestões e informação
‡ Quando substituir as pilhas, não use pilhas
gastas ou de tipos diferentes porque isso
pode causar problemas no controlo remoto.
P
0RGe
)Dn
7HPS
7LPHU2If
6ZLQJ
/LJKW
7XUER
7LPHU2Q
&ORFk
,IHHO
EcR
‡ Mantenha o controlo remoto onde o sinal
alcance o receptor do aparelho interior (a
distância máxima é 8 metros).
‡ Quando seleccionar o funcionamento
temporizado, o controlo remoto transmite
automaticamente um sinal ao aparelho interior
jKRUDHVSHFL¿FDGD
‡ Se não pretender utilizar o controlo remoto
durante um longo período de tempo, remova
as pilhas porque as pilhas usadas podem
YHUWHUOtTXLGRHFRUURHUHGDQL¿FDURFRQWUROR
remoto.
‡ A duração média das pilhas em utilização
normal é seis meses.
‡ Se o controlo remoto não funcionar
normalmente, remova e volte a instalar as
pilhas. Se continuar a não funcionar bem,
substitua as pilhas por pilhas novas.
107
'HVFULomRGRFRQWURORUHPRWR
%RWmR7XUER
Prima este botão no modo FRIO ou CALOR para
colocar a ventoinha no modo Turbo de velocidade
máxima e o ar condicionado na potência máxima.
Prima novamente para cancelar esta função.
%RWmR;)DQ
3ULPDRERWmR;)DQSDUDDFWLYDUDDXWROLPSH]D
Quando o aparelho é desligado, a ventoinha
interior continua a funcionar durante 10 minutos
para secar o aparelho interior e impedir a
formação de bactérias e bolores.
%RWmR7LPHU2Q
3ULPDHVWHERWmRSDUDGH¿QLUDKRUDGHLQtFLR
0RGH
/LJKW
7XUER
;)DQ
)DQ
7LPHU2Q
7HPS
7LPHU2II
&ORFN
6ZLQJ
,)HHO
(FR
%RWmR212))
Prima este botão para ligar (ON) ou desligar
(OFF) o ar condicionado.
%RWmR0RGH
Este botão permite seleccionar os modos
AUTO, DESUMIDIFICAR, VENTILADOR,
FRIO e CALOR (a função CALOR não existe
no modelo que só tem a função FRIO) em
sequência.
2PRGR$872pRPRGRSUHGH¿QLGRTXDQGRR
aparelho é ligado.
No modo AUTO, o valor inicial não é
apresentado e o aparelho funciona com a
temperatura mais confortável.
No modo CALOR, o valor inicial é 28 °C.
Nos outros modos, o valor inicial é 25 °C.
AUTO
DESUMIDIFICAR
VENTILADOR
FRIO
CALOR
%RWmR/LJKW
Prima este botão para acender (ON) e apagar
(OFF) os indicadores luminosos no aparelho
interior.
Quando o aparelho é ligado, os indicadores
estão acesos (ON).
%RWmR)DQ
Prima este botão para seleccionar a velocidade
$XWR%DL[D0pGLDH$OWDHPVHTXrQFLD
$YHORFLGDGHGDYHQWRLQKDSUHGH¿QLGDp$XWR
quando o aparelho é ligado.
No modo DESUMIDIFICAR, a velocidade da
YHQWRLQKDp¿[DGDHP%DL[D
108
%RWmR7LPHU2II
3ULPDHVWHERWmRSDUDGH¿QLUDKRUDGHSDUDJHP
%RWmR6ZLQJ
Prima este botão para que o direccionador de ar
oscile automaticamente para cima e para baixo.
Prima novamente para cancelar e o direccionador
¿FDQD~OWLPDSRVLomR
%RWmR,)HHO
Prima este botão para que o controlo remoto
envie a temperatura seleccionada ao aparelho
interior a cada 10 minutos. O aparelho funcionará
QRVHQWLGRGHDWLQJLUDWHPSHUDWXUDGH¿QLGDQR
sítio em que o controlo remoto se encontra. Prima
novamente para cancelar esta função.
%RWmRGHFRQWUROR
Para a frente
Para trás
Prima este botão
seleccionada.
para aumentar a temperatura
Prima este botão
seleccionada.
para diminuir a temperatura
Utilize estes botões para acertar o relógio e
regular o temporizador das funções Timer On/Off
e Clock.
%RWmR&ORFN
Prima este botão para que o símbolo do relógio
¿TXHLQWHUPLWHQWH3RGHSUHPLURVERW}HVGH
controlo e SDUDGH¿QLUDKRUDTXHGHVHMDU
%RWmR7HPS7HPSHUDWXUD
Prima este botão para ver no aparelho interior
TXDOpDWHPSHUDWXUDGH¿QLGDSDUDDGLYLVmR
%RWmR(FR(FRQRPLD
Prima este botão para activar o funcionamento
Eco. É ideal para utilizar durante a noite.
Prima novamente para cancelar a função.
1RWD
No modo de aquecimento, prima os botões Temp
e Clock para activar a função de aquecimento do
interior até à temperatura de 8 °C.
,QGLFDGRUGRYLVRUGR
FRQWURORUHPRWR
,QGLFDGRUGHWUDQVPLVVmR
Acende quando o controlo remoto transmite
sinais para o aparelho interior.
,QGLFDGRUGDYHORFLGDGHGDYHQWRLQKD
Apresenta a velocidade da ventoinha seleccionada
na seguinte sequência:
,QGLFDGRUGH7XUER
Acende quando a função Turbo está
seleccionada.
“ ´%DL[D³
Auto.
,QGLFDGRU,)HHO
Acende quando a função I Feel está activa.
,QGLFDGRU(FR
Acende quando a função Eco está
seleccionada.
,QGLFDGRU+HDOWK\
Acende se o botão Healthy tiver sido
premido. Prima o botão Healthy novamente
para o apagar.
NOTA: este indicador não existe nos
modelos que não têm a função ColdPlasma (Plasma Frio).
,QGLFDGRUGHWHPSHUDWXUDGDGLYLVmR
Acende quando a temperatura indicada no
ecrã LCD é a temperatura da divisão. Pode
ser ligado/desligado com o botão Temp.
,QGLFDGRUGHWHPSHUDWXUDSURJUDPDGD
Acende quando o controlo remoto está a
apresentar a temperatura seleccionada.
Pode ser ligado/desligado com o botão Temp.
,QGLFDGRUGH7LPHU2Q2II
Acende quando a função Timer On/Off
(activação/desactivação por temporizador)
está activa.
” (Média), “
” (Alta) e
Na velocidade Auto, aparece apenas o símbolo
“ ”.
,QGLFDGRUGHRVFLODomR
Acende quando a função Swing (Oscilação) está
seleccionada.
,QGLFDGRUGH;)DQ
$FHQGHVHDIXQomR;)DQWLYHUVLGRDFWLYDGD
com os botões Turbo e Healthy (Saudável) em
simultâneo (nos modelos com função Plasma Frio)
RXFRPRERWmR;)DQQRVPRGHORVVHPIXQomR
Plasma Frio)
,QGLFDGRUGDWHPSHUDWXUD
Apresenta a temperatura da divisão ou a
WHPSHUDWXUDGH¿QLGDHPƒ&RXƒ)
Não aparece no modo Ventilador.
,QGLFDGRUGDKRUD
Apresenta a hora do relógio (é necessário acertar)
e/ou as horas de activação/desactivação pelo
temporizador.
,QGLFDGRUGHPRGR
Indica o modo de funcionamento actual, incluindo
Auto ( 'HVXPLGL¿FDU ), Ventilador ( ),
Frio ( ) e Calor ( ).
NOTA: O modelo que só arrefece não tem a
função de aquecimento.
109
3ULPHLUDXWLOL]DomR
1 &HUWL¿TXHVHGHTXHRDSDUHOKRHVWiOLJDGRj
electricidade.
2 &HUWL¿TXHVHGHTXHDVSLOKDVHVWmREHP
colocadas no controlo remoto (as luzes do
controlo remoto acendem).
3 Acerte o relógio com os botões de controlo e
SULPDRERWmR&ORFNSDUDFRQ¿UPDU
4 Aponte o controlo remoto para o aparelho
interior e prima o botão ON/OFF para ligar o
aparelho.
2PRGRGHIXQFLRQDPHQWRSUHGH¿QLGRp
AUTO. Uma vez seleccionado o modo de
funcionamento com o controlo remoto, as
condições de funcionamento são guardadas
na memória do microcomputador do aparelho
interior. Na próxima vez, o ar condicionado
começará a funcionar com as mesmas
condições quando premir o botão ON/OFF do
controlo remoto.
sugestões e informação
Prima este botão para ligar o ar condicionado.
O indicador de temperatura do visor do aparelho
LQWHULRUDFHQGHVH
O modo DESUMIDIFICAR funciona com base
QDGLIHUHQoDHQWUHDWHPSHUDWXUDGH¿QLGDHD
temperatura ambiente actual.
A temperatura é regulada durante a
GHVXPLGL¿FDomRDWUDYpVGDDFWLYDomRHGD
desactivação repetidas dos modos FRIO e
VENTILADOR.
O ar condicionado começa a funcionar após
cerca de 3 minutos.
3DUDU
1 %RWmR212))
Prima este botão novamente para desligar o ar
condicionado. O direccionador horizontal volta à
posição inicial após o encerramento.
110
ODG
'H¿QDDWHPSHUDWXUDGHVHMDGD
9H
QWL
3 %RW}HVGHFRQWUROR
RU
2 Prima o botão Mode para seleccionar AUTO.
Temp. programada
RU
,QLFLDU
1 %RWmR212))
)XQFLRQDPHQWRGHGHVXPLGL¿FDomR
$U
UHI
HF
LP
HQ
WR
Quando o modo AUTO está seleccionado, o ar
condicionado selecciona automaticamente o modo
FRIO, CALOR (se aplicável) ou VENTILADOR,
dependendo da temperatura programada e/ou da
temperatura ambiente.
4XDQGRHVWiVHOHFFLRQDGRRPRGRGH
IXQFLRQDPHQWR$872DYHORFLGDGHGD
YHQWRLQKDHDWHPSHUDWXUDVmRFRQWURODGDV
DXWRPDWLFDPHQWHHQmRSRGHPVHU
DOWHUDGDV
ODG
)XQFLRQDPHQWRDXWRPiWLFR
sugestões e informação
9H
QWL
&RPRXWLOL]DURFRQWURORUHPRWR
6HRPRGR$872IRUGHVFRQIRUWiYHOSRGH
VHOHFFLRQDUPDQXDOPHQWHDVFRQGLo}HV
TXHGHVHMDU
$U
UHI
HF
LP
HQ
WR
6HRDSDUHOKRIRUGHVOLJDGRSRUXPFRUWH
GHHQHUJLDHOpFWULFDSRUUHPRomRGR
FDERGHDOLPHQWDomRRXGHYLGRDXPD
VXEVWLWXLomRGDVSLOKDVGRFRQWURORUHPRWR
RPLFURSURFHVVDGRUYROWDDRPRGR$872
7HPSR
)XQFLRQDPHQWRGH
GHVXPLGL¿FDomR
,QLFLDU
1 %RWmR212))
Prima este botão para ligar o ar condicionado.
O indicador de temperatura do visor do
DSDUHOKRLQWHULRUDFHQGHVH
2 %RWmR0RGH
Prima para seleccionar DESUMIDIFICAR.
2 %RWmR0RGH
Prima para seleccionar VENTILADOR.
3 %RWmR)DQ
Prima para seleccionar a velocidade da
YHQWRLQKDHQWUH$XWR%DL[D0pGLDH$OWD
$YHORFLGDGHGDYHQWRLQKDSUHGH¿QLGDp$XWR
3 %RW}HVGHFRQWUROR
'H¿QDDWHPSHUDWXUDGHVHMDGD
1XPDVLWXDomRQRUPDOGH¿QDHQWUHž&H
ž&
3DUDU
1 %RWmR212))
3DUDU
1 %RWmR212))
Prima este botão novamente para desligar o ar
condicionado. O direccionador horizontal volta
à posição inicial após o encerramento.
Prima este botão novamente para desligar o ar
condicionado. O direccionador horizontal volta
à posição inicial após o encerramento.
sugestões e informação
‡ Se estiver seleccionada a velocidade Auto da
ventoinha, o controlo remoto não mostra a
velocidade da ventoinha.
sugestões e informação
No modo DESUMIDIFICAR, a velocidade da
YHQWRLQKDp¿[DGDHP%DL[DHDIXQomR7XUER
não pode ser utilizada.
)XQFLRQDPHQWRGHYHQWLODomR
Se seleccionar o modo VENTILADOR, o ar
condicionado apenas ventila o ar interior.
1 %RWmR212))
Prima este botão para ligar o ar condicionado.
O indicador de temperatura do visor do
DSDUHOKRLQWHULRUDFHQGHVH
)XQFLRQDPHQWRGHDUUHIHFLPHQWR
HDTXHFLPHQWR
,QLFLDU
1 %RWmR212))
Prima este botão para ligar o ar condicionado.
O indicador de temperatura do visor do
DSDUHOKRLQWHULRUDFHQGHVH
2 %RWmR0RGH
Prima para seleccionar o modo FRIO ou
CALOR (se aplicável).
111
3 %RW}HVGHFRQWUROR
'H¿QDDWHPSHUDWXUDGHVHMDGD
1XPDVLWXDomRQRUPDOGH¿QDHQWUHž&H
ž&
4 %RWmR)DQ
Prima para seleccionar a velocidade da
YHQWRLQKDHQWUH$XWR%DL[D0pGLDH$OWD
$YHORFLGDGHGDYHQWRLQKDSUHGH¿QLGDp$XWR
sugestões e informação
Se estiver seleccionada a velocidade Auto da
ventoinha, o controlo remoto não mostra a
velocidade da ventoinha.
3 Aponte o controlo remoto para o aparelho interior e
FRQ¿UPHDKRUDSUHPLQGRRERWmR7LPHU2Q
¿FD¿[RQRYLVRUGRFRQWURORUHPRWR
9HUL¿TXHVHRLQGLFDGRUGR7HPSRUL]DGRUQRYLVRU
do aparelho interior está aceso.
&DQFHODUDVGH¿QLo}HV
Aponte o controlo remoto para o aparelho interior e
SULPDRERWmR7LPHU2QRXWUDYH]&HUWL¿TXHVHGH
que o símbolo desaparece do controlo remoto.
)XQomR7LPHU2II
1 Prima o botão Timer Off e
¿FDLQWHUPLWHQWHQRYLVRUGRFRQWUROR
remoto se for a primeira vez que utiliza a função
7LPHU2II&DVRFRQWUiULRDSDUHFHD~OWLPDKRUD
GH¿QLGDLQWHUPLWHQWH
2 'H¿QDDKRUDTXHGHVHMDUFRPRVERW}HVGH
controlo:
Para a frente
Para trás
De cada vez que premir os botões, a hora avança
ou recua 1 minuto.
Se premir um botão continuamente, a hora muda
mais rapidamente no visor.
3 Aponte o controlo remoto para o aparelho interior e
FRQ¿UPHDKRUDSUHPLQGRRERWmR7LPHU2II
¿FD¿[RQRYLVRUGRFRQWURORUHPRWR
9HUL¿TXHVHRLQGLFDGRUGR7HPSRUL]DGRUQRYLVRU
do aparelho interior está aceso.
&DQFHODUDVGH¿QLo}HV
3DUDU
1 %RWmR212))
Prima este botão novamente para desligar o
ar condicionado. O direccionador horizontal
volta à posição inicial após o encerramento.
'H¿QLo}HVGRWHPSRUL]DGRU
)XQomR7LPHU2Q
1 Prima o botão Timer On e
¿FDLQWHUPLWHQWHQRYLVRUGRFRQWUROR
remoto se for a primeira vez que utiliza a
função Timer On. Caso contrário, aparece a
~OWLPDKRUDGH¿QLGDLQWHUPLWHQWH
2 'H¿QDDKRUDTXHGHVHMDUFRPRVERW}HVGH
Para a frente
Para trás
controlo:
De cada vez que premir os botões, a hora
avança ou recua 1 minuto.
Se premir um botão continuamente, a hora
muda mais rapidamente no visor.
112
Aponte o controlo remoto para o aparelho interior e
SULPDRERWmR7LPHU2IIRXWUDYH]&HUWL¿TXHVHGH
que o símbolo desaparece do controlo remoto.
sugestões e informação
‡ A hora de funcionamento da função de
WHPSRUL]DGRUGH¿QLGDFRPRFRQWURORUHPRWR
GHSHQGHGDKRUDGRUHOyJLR9HUL¿TXHVHR
relógio do controlo remoto está certo para evitar
um funcionamento indesejado.
‡ 2WHPSRGHIXQFLRQDPHQWRHIHFWLYRGH¿QLGR
pelo controlo remoto está limitado a 24 horas.
([HPSORVGHGH¿QLo}HVGR
WHPSRUL]DGRU
)XQFLRQDPHQWRFRP7LPHU2QLQtFLR
Esta função é útil quando pretender que o
aparelho se active automaticamente antes de
chegar a casa. O ar condicionado começa a
IXQFLRQDUDXWRPDWLFDPHQWHjKRUDGH¿QLGD
Exemplo: São 8:00h e pretende que o ar
condicionado comece a funcionar às 18:00h.
1 Prima o botão Timer On.
2 'H¿QDDKRUDSUHWHQGLGDSUHPLQGR
repetidamente ou mantendo premidos os
botões de controlo até que o visor do controlo
remoto indique 18:00.
3 &RQ¿UPHDKRUDDSRQWDQGRRFRQWURORUHPRWR
para o aparelho interior e premindo o botão
Timer On outra vez.
4 Prima o botão Timer Off.
3 &RQ¿UPHDKRUDDSRQWDQGRRFRQWURORUHPRWR
para o aparelho interior e premindo o botão
Timer On outra vez.
5 'H¿QDDKRUDSUHWHQGLGDSUHPLQGR
repetidamente ou mantendo premidos os botões
de controlo até que o visor do controlo remoto
indique 09:30.
¿FD¿[RQRYLVRUGRFRQWURORUHPRWR
O indicador do Temporizador no visor do
aparelho interior está aceso.
)XQFLRQDPHQWRFRP7LPHU2IISDUDJHP
Esta função é útil quando pretender que o
aparelho se desactive automaticamente à hora
de ir dormir.
O ar condicionado pára de funcionar
DXWRPDWLFDPHQWHjKRUDGH¿QLGD
Exemplo: São 18:00h e pretende que o ar
condicionado pare de funcionar às 23:55h.
1 Prima o botão Timer Off.
6 &RQ¿UPHDKRUDDSRQWDQGRRFRQWURORUHPRWR
para o aparelho interior e premindo o botão
Timer Off outra vez.
é apresentado no controlo remoto e a função
¿FDDFWLYDGD
7LPHU2II 7LPHU2Q
/LJDGR3DUDU,QLFLDU
Esta função é útil quando pretende desligar o ar
condicionado depois de ir para a cama e voltar
DOLJiORGHPDQKmTXDQGRDFRUGDURXTXDQGR
regressar a casa.
Exemplo: São 8:00h e pretende que o ar
condicionado pare de funcionar às 9:30h e
recomece às 18:30h
1 Prima o botão Timer Off.
2 'H¿QDDKRUDSUHWHQGLGDSUHPLQGR
repetidamente ou mantendo premidos os
botões de controlo até que o visor do controlo
remoto indique 23:55.
2 'H¿QDDKRUDSUHWHQGLGDSUHPLQGR
repetidamente ou mantendo premidos os botões
de controlo até que o visor do controlo remoto
indique 09:30.
3 &RQ¿UPHDKRUDDSRQWDQGRRFRQWURORUHPRWR
para o aparelho interior e premindo o botão
Timer Off outra vez.
¿FD¿[RQRYLVRUGRFRQWURORUHPRWR
O indicador do Temporizador no visor do
aparelho interior está aceso.
3 &RQ¿UPHDKRUDDSRQWDQGRRFRQWURORUHPRWR
para o aparelho interior e premindo o botão
Timer Off outra vez.
&RPELQDomRGHWHPSRUL]DGRUHV
4 Prima o botão Timer On.
7LPHU2Q 7LPHU2II
'HVOLJDGR,QLFLDU3DUDU
5 'H¿QDDKRUDSUHWHQGLGDSUHPLQGR
repetidamente ou mantendo premidos os botões
de controlo até que o visor do controlo remoto
indique 18:00.
Esta função é útil quando pretender que o ar
condicionado se ligue antes de acordar e se
desligue quando sair de casa.
Exemplo: São 22:00h e pretende que o ar
condicionado comece a funcionar às 6:30h
e pare às 9:30h.
1 Prima o botão Timer On.
2 'H¿QDDKRUDSUHWHQGLGDSUHPLQGR
repetidamente ou mantendo premidos os
botões de controlo até que o visor do controlo
remoto indique 06:30.
6 &RQ¿UPHDKRUDDSRQWDQGRRFRQWURORUHPRWR
para o aparelho interior e premindo o botão
Timer On outra vez.
é apresentado no controlo remoto e a função
¿FDDFWLYDGD
113
$FHUWDURUHOyJLR
)XQFLRQDPHQWR(FR(FRQRPLD
Prima o botão Eco quando estiver no modo FRIO ou
CALOR (se aplicável) e o ar condicionado aumenta
(se estiver no modo FRIO) ou diminui (se estiver no
modo CALOR) automaticamente 1 °C por hora durante
um período de 2 horas. A temperatura seleccionada
PDQWHUVHi¿[DGXUDQWHKRUDVHRDSDUHOKRGHVOLJD
se em seguida.
Esta função proporciona mais conforto e poupa energia.
5HFRPHQGDVHSDUDDKRUDGHLUGRUPLU
7HPSHUDWXUD
GH¿QLGD
KRUD
KRUD
$UUHIHFLPHQWR
7HPSHUDWXUD
GH¿QLGD
Antes de colocar o ar condicionado em
funcionamento, acerte o relógio do controlo
remoto utilizando o procedimento indicado nesta
secção. O relógio do controlo remoto apresenta
a hora independentemente de o ar condicionado
estar a funcionar ou não.
Após colocar pilhas novas no controlo remoto, o
visor apresenta
e começa a piscar.
1 %RW}HVGHFRQWUROR
3ULPDRVERW}HVGHFRQWURORSDUDGH¿QLUDKRUD
certa.
Para a frente
Para trás
De cada vez que premir os botões, a hora
avança ou recua 1 minuto.
Se premir um botão continuamente, a hora
muda mais rapidamente no visor.
2 %RWmR&ORFN
Quando chegar à hora correcta, prima o botão
Clock outra vez ou aguarde 5 segundos sem
premir botões; a hora do relógio pára de piscar
HRUHOyJLR¿FDFHUWR
3 Voltar a acertar o relógio
3ULPDRERWmR&ORFNHDKRUD¿FDLQWHUPLWHQWH
6LJDRVSDVVRVHSDUDGH¿QLUDQRYDKRUD
sugestões e informação
‡ O relógio do temporizador utiliza o formato
de 24 horas.
‡ $KRUDSUHGH¿QLGDGRFRQWURORUHPRWRp
12:00PM, voltando sempre a esta hora
quando as pilhas são substituídas.
114
KRUD
KRUD
$TXHFLPHQWR
)XQFLRQDPHQWR,)HHO
O controlo remoto funciona como termóstato remoto
e permite controlar a temperatura com precisão e
máximo conforto.
Aponte o controlo remoto para o aparelho interior,
prima o botão I Feel e ouvirá um sinal sonoro a
FRQ¿UPDUTXHDIXQomRIRLDFWLYDGD
O símbolo I Feel
é apresentado no visor do controlo
remoto até que o botão I Feel seja premido outra vez.
O ar condicionado funcionará no sentido de atingir
DWHPSHUDWXUDGH¿QLGDQRORFDOHPTXHRFRQWUROR
remoto se encontra.
O controlo remoto envia a temperatura que mede
para o aparelho interior a cada 10 minutos. O ar
condicionado sai da função I Feel se não receber
uma temperatura do controlo remoto durante
11 minutos sucessivos.
&RPRXWLOL]DURDSDUHOKRLQWHULRU
2XWUDVRSo}HV
)XQomRGHUHLQtFLRDXWRPiWLFR
O ar condicionado retoma automaticamente
DFRQ¿JXUDomRDQWHULRUDSyVXPDIDOKDGH
electricidade.
‡ Quando o direccionador estiver na direcção
desejada, prima o botão Swing outra vez para
¿[DURGLUHFFLRQDGRUQDSRVLomRHPTXHHVWLYHU
‡ Prima o botão Swing outra vez e o direccionador
volta a oscilar para cima e para baixo
automaticamente.
3DLQHODPRYtYHO
O painel frontal do aparelho interior pode ser
removido facilmente para limpeza e manutenção.
)XQomRGHDXWRGLDJQyVWLFRHDXWRSURWHFomR
Este ar condicionado consegue detectar
anomalias e apresentar o diagnóstico na forma
de código de erro no visor do aparelho interior.
O ar condicionado pára de funcionar
automaticamente para autoprotecção.
&RQWURORGDGLUHFomRGRÀX[RGHDU
‡ $MXVWHDGLUHFomRGRÀX[RGHDUFRUUHFWDPHQWH
para evitar desconforto ou temperaturas não
uniformes na divisão.
‡ Ajuste o direccionador horizontal com o controlo
remoto.
Variação
Fluxo de ar para cima e
para baixo
5HJXODUDGLUHFomRGRÀX[RGHDUQDKRUL]RQWDO
HVTXHUGDGLUHLWDPDQXDOPHQWH
‡ Ajuste o direccionador vertical manualmente
na respectiva alavanca Left/Right (Esquerda/
Direita).
‡ Faça estes ajustes antes de ligar o aparelho
porque existe o perigo de ferir os seus dedos na
ventoinha se o aparelho já estiver a funcionar.
‡ Ajuste o direccionador vertical manualmente.
Direccionador
vertical
Variação
Fluxo de ar para a esquerda e direita
atenção
5HJXODUDGLUHFomRGRÀX[RGHDUQDYHUWLFDO
SDUDFLPDEDL[RDXWRPDWLFDPHQWH
‡ Execute esta operação com o aparelho a
funcionar.
‡ Prima o botão Swing no controlo remoto para
que o direccionador horizontal oscile para
cima e para baixo automaticamente.
‡ O botão Swing está desactivado quando o ar
condicionado está desligado (mesmo com a
função Timer On activa).
‡ Não deixe o ar condicionado a funcionar
PXLWRWHPSRFRPRÀX[RGHDUGLULJLGR
para baixo nos modos FRIO ou
DESUMIDIFICAR. Caso contrário, pode
ocorrer condensação na superfície do
direccionador horizontal e gotejamento para
o chão ou para móveis.
115
‡ Não mova o direccionador horizontal com
a mão. Utilize sempre o botão Swing.
Mover o direccionador manualmente
durante o funcionamento pode causar
avarias. Se um direccionador não
funcionar correctamente, desligue o ar
FRQGLFLRQDGRHOLJXHRGHQRYR
‡ O ângulo de abertura do direccionador
horizontal não deve ser demasiado
pequeno porque a restrição excessiva
GDiUHDGHÀX[RGHDUSRGHUHGX]LUR
desempenho do arrefecimento ou do
aquecimento.
‡ Não utilize o ar condicionado com o
direccionador horizontal fechado.
‡ Quando o ar condicionado é ligado à
corrente (inicialização), o direccionador
horizontal pode emitir ruído durante 10
segundos, mas isso é normal.
)XQFLRQDPHQWRGHHPHUJrQFLD
Se perder o controlo remoto ou se este deixar de
funcionar, utilize o interruptor manual do aparelho
interior. O ar condicionado funciona no modo
AUTO e não é possível alterar a regulação de
temperatura ou a velocidade da ventoinha.
‡ Prima o botão de controlo manual outra vez para
desligar o ar condicionado.
2PRGRGHIXQFLRQDPHQWRHQFRQWUDVHLQGLFDGRQD
tabela seguinte.
Símbolo
'H¿QLomRGH
temperatura
Modelo
Fluxo de ar
AUTO
%20%$'(&$/25
25 °C
FRIO/VENTILADOR
AUTO
%20%$'(&$/25
20 °C
CALOR/VENTILADOR
7HPSHUDWXUDGHIXQFLRQDPHQWR
Intervalos de temperatura de
funcionamento
Lado interior
'%:%°C)
Lado exterior
'%:%°C)
Arrefecimento máx.
32/23
43/26
Arrefecimento mín.
21/15
Aquecimento máx.
24/18
Aquecimento mín.
O intervalo de temperaturas de funcionamento
(temperatura exterior) do modelo equipado apenas
FRPDUUHIHFLPHQWRpƒ&aƒ&HRGRPRGHOR
FRPERPEDGHFDORUpƒ&aƒ&
Se o ar condicionado for utilizado fora das
condições indicadas, é possível que algumas
funções de protecção sejam activadas e provoquem
um funcionamento anormal do aparelho.
)XQFLRQDPHQWRySWLPR
Para obter o melhor desempenho, tenha em
atenção o seguinte:
‡ $MXVWHDGLUHFomRGRÀX[RGHDUFRUUHFWDPHQWH
GHIRUPDDTXHQmR¿TXHGLUHFFLRQDGRSDUDDV
pessoas.
‡ Ajuste a temperatura de forma a alcançar o
melhor nível de conforto. Não ajuste o aparelho
para níveis de temperatura excessivos.
%RWmRGH
FRQWUROR
PDQXDO
‡ Feche as portas e as janelas quando utilizar o
aparelho nos modos FRIO ou CALOR, para não
prejudicar o desempenho do produto.
%RWmRGHFRQWUROR
PDQXDO
‡ Prima o botão de controlo manual para
entrar no modo AUTO. O ar condicionado
selecciona o modo FRIO, CALOR (apenas no
modelo com bomba de calor) e VENTILADOR
automaticamente em função da temperatura
ambiente, para proporcionar o melhor conforto.
116
‡ Utilize os botões Timer On (Activação por
temporizador) e Timer Off (Desactivação
por temporizador) do controlo remoto
para seleccionar as horas de activação e
desactivação que pretender.
‡ Não coloque objectos perto da entrada ou
da saída de ar porque isso pode diminuir a
H¿FLrQFLDGRDUFRQGLFLRQDGRHDWpID]HUFRP
que pare de funcionar.
‡ /LPSHRV¿OWURVGRDUFRPIUHTXrQFLDSDUDHYLWDU
uma redução do desempenho de arrefecimento
ou aquecimento.
/LPSH]DHPDQXWHQomR
0DQXWHQomR
As seguintes operações de manutenção devem ser executadas regularmente.
Itens
Operações de
manutenção
Frequência recomendada
Filtro do pó
Limpar
Uma vez por mês ou mais vezes se
necessário
Filtros de ar saudável
Substituir/limpar
Uma vez em cada 3 meses ou mais vezes se
necessário
Estrutura do aparelho
Limpar
Uma vez por mês ou mais vezes se
necessário
Tabuleiro da água e
tubagem de escoamento
/LPSDUHYHUL¿FDUVH
existem obstruções
Em cada estação, antes de ligar o aparelho*
Serpentinas interior/
exterior
Limpar
Em cada estação, antes de ligar o aparelho*
* (VWDRSHUDomRWHPGHVHUH[HFXWDGDDSHQDVSRUSHVVRDOTXDOL¿FDGR
aviso
‡ 3DUHRDUFRQGLFLRQDGRHGHVOLJXHRGD
alimentação eléctrica antes de o limpar.
/LPSH]DGRDSDUHOKRLQWHULRU
HGRFRQWURORUHPRWR
‡ Utilize um pano seco para limpar o aparelho
interior e o controlo remoto.
‡ Pode utilizar um pano humedecido com água
fria para limpar o aparelho interior se estiver
muito sujo.
Suporte do
painel
1 Levante o painel frontal do aparelho interior até
DRkQJXORHPTXHHOHSiUDH¿FDWRWDOPHQWH
apoiado no suporte.
‡ O painel frontal do aparelho interior pode ser
removido e lavado com água. A seguir, limpe
com um pano seco.
‡ Não utilize escovas, papel de lixa ou produtos
de polimento para limpar o aparelho porque
SRGHPGDQL¿FiOR
‡ Não use um pano ou espanador tratado com
produtos químicos para limpar o aparelho.
‡ Não utilize benzina, diluente, produtos de
polimento ou solventes para limpar. Estes
produtos podem provocar quebras ou
deformações nas superfícies de plástico.
3HJDGR¿OWURGRSy
2 6HJXUHQDSHJDGR¿OWURGRSyHOHYDQWHR
ligeiramente para o retirar do respectivo suporte.
‡ 1XQFDXWLOL]HiJXDTXHQWHDPDLVGHž&
para limpar o painel frontal, porque pode
causar deformação ou descoloração.
/LPSDURV¿OWURV
Nota: É obrigatório desligar a alimentação
eléctrica antes de limpar.
2¿OWURGRSyHQWXSLGRUHGX]DH¿FLrQFLDGH
arrefecimento/aquecimento deste aparelho. Limpe
R¿OWURWRGRVRVPHVHVRXPDLVIUHTXHQWHPHQWHVH
necessário.
3 'HVHJXLGDSX[HR¿OWURSDUDEDL[RHUHWLUHRGR
aparelho interior.
117
aviso
Filtro do pó
1mRWRTXHQHPWHQWHOLPSDURJHUDGRU
GHSODVPDIULRVHDSOLFiYHO3RGH
FDXVDUFKRTXHHOpFWULFR
Manutenção geral
/LPSHR¿OWURGRSyFRPXPDVSLUDGRURXiJXD
HVHTXHRQXPORFDOIUHVFR
Se não pretender utilizar o ar condicionado durante
um longo período de tempo:
‡ Coloque em funcionamento no modo
9(17,/$'25GXUDQWHaKRUDVSDUDVHFDU
totalmente o aparelho.
Filtro do pó
Filtro saudável
4 2V¿OWURVVDXGiYHLVHUHIUHVFDQWHVGRDUVH
DSOLFiYHOFRPRR¿OWURGH&DUYmR$FWLYRR¿OWUR
%,2R¿OWURGH9LWDPLQD&HR¿OWURGH,}HVGH
3UDWDVmR¿[DGRVQR¿OWURGRSy
5HPRYDRV¿OWURVVDXGiYHLVGDHVWUXWXUDGH
VXSRUWHGR¿OWURGRSy
/LPSHRV¿OWURVVDXGiYHLVSHORPHQRVXPDYH]
HPFDGDWUrVPHVHVHVXEVWLWXDRVDFDGD
6 meses.
Limpe com aspirador se possível.
‡ 'HVOLJXHRDSDUHOKRHUHWLUHD¿FKDGDWRPDGD
Remova as pilhas no controlo remoto.
‡ O aparelho exterior requer manutenção e limpeza
FRPUHJXODULGDGH1mRWHQWHID]rORSRUVL
mesmo. Contacte um concessionário ou técnico
da assistência.
9HUL¿FDo}HVDQWHVGRIXQFLRQDPHQWR
‡ 9HUL¿TXHVHRVFDERVQmRHVWmRSDUWLGRVRX
desligados
‡ 9HUL¿TXHVHR¿OWURGRSyHVWiLQVWDODGR
‡ Se não tiver utilizado o ar condicionado durante
XPORQJRSHUtRGRGHWHPSRYHUL¿TXHVHKi
obstruções na saída ou na entrada de ar.
aviso
‡ Não toque nas peças de metal do aparelho
TXDQGRUHWLUDUR¿OWUR$VDUHVWDVPHWiOLFDV
D¿DGDVSRGHPFDXVDUIHULPHQWRV
5 9ROWHDLQVWDODURV¿OWURVVDXGiYHLV
refrescantes do ar na devida posição.
6 ,QVLUDDSDUWHVXSHULRUGRV¿OWURVGRSyQR
aparelho, tendo o cuidado de alinhar as arestas
esquerda e direita correctamente, e coloque os
¿OWURVGRSyQDGHYLGDSRVLomR
118
‡ Não utilize água para limpar o interior
do ar condicionado. A exposição à água
pode anular o isolamento e causar choque
eléctrico.
‡ $QWHVGHOLPSDURDSDUHOKRFHUWL¿TXHVH
de que a alimentação eléctrica e o disjuntor
estão desligados.
6XJHVW}HVSDUDDXWLOL]DomR
As seguintes situações podem ocorrer durante o
funcionamento normal:
3URWHFomRGRDUFRQGLFLRQDGR
‡ 3URWHFomRGRFRPSUHVVRU
Após uma paragem, o compressor não pode
reiniciar durante 3 minutos
‡ $QWLFRQJHODomR
Se o aparelho estiver a funcionar no modo
FRIO com baixa temperatura ambiente, é
possível que se forme gelo no permutador de
calor. Quando a temperatura do permutador
de calor desce abaixo dos 0 °C, o
compressor pára de funcionar para proteger
o aparelho.
‡ 'HVFRQJHODU
É possível que se forme gelo no aparelho
exterior durante o funcionamento em modo
de aquecimento se a temperatura exterior for
baixa e a humidade for elevada, resultando
HPPHQRUH¿FLrQFLDGRDTXHFLPHQWR
Nesta situação, o ar condicionado pára
de aquecer e inicia a descongelação
automaticamente. O tempo da função de
descongelação varia entre 3 e 12 minutos.
Durante a descongelação, os motores
dos ventiladores do aparelho interior e do
aparelho exterior param, o indicador interior
apresenta “H1” e o aparelho exterior pode
emitir vapor. Não se trata de uma anomalia.
Quando a descongelação terminar, o
aquecimento é retomado automaticamente.
‡ 3URWHFomRFRQWUDDUIULR
No modo CALOR, a ventoinha interior não
funciona nos primeiros 5 minutos para evitar
que seja soprado ar frio para a divisão se
o permutador de calor interior não atingir
uma determinada temperatura mínima nas
seguintes situações:
(1) O funcionamento em modo de
aquecimento acabou de começar.
,PHGLDWDPHQWHDSyVR¿PGDIXQomRGH
descongelação.
(3) Aquecimento com temperatura ambiente
baixa.
%ULVDVXDYH
O aparelho interior pode soprar uma
brisa suave acompanhada de rotação do
direccionador para uma determinada posição
na seguinte situação:
(1) O aparelho é ligado no modo CALOR
e o compressor não atinge a condição
necessária para começar a funcionar.
(2) No modo CALOR, a temperatura atinge
RYDORUGH¿QLGRHRFRPSUHVVRUSiUDGH
funcionar durante cerca de 1 minuto.
2EVHUYDVHXPDQpYRDEUDQFDDVDLUGRDSDUHOKR
LQWHULRU
‡ É possível que seja gerada uma névoa branca
devido a uma diferença de temperatura entre o
ar que entra e o ar que sai com o aparelho no
modo FRIO num ambiente interior que tenha muita
humidade relativa.
‡ É possível que seja gerada uma névoa branca
devido à humidade produzida pelo processo de
descongelação quando o ar condicionado reinicia
no modo CALOR após a descongelação.
5XtGREDL[RYLQGRGRDUFRQGLFLRQDGR
‡ Pode ouvir um som sibilante quando o compressor
está a funcionar ou tiver acabado de parar. Este
som corresponde ao refrigerante a circular ou a
parar.
‡ Também pode ouvir um som baixo de “chiar”
quando o compressor está a funcionar ou tiver
DFDEDGRGHSDUDU,VVRGHYHVHjH[SDQVmRSHOR
calor ou contracção pelo frio das partes plásticas
do aparelho quando a temperatura está a mudar.
‡ 3RGHRXYLUVHXPUXtGRRULJLQDGRSHOR
direccionador do ar a regressar à posição original
quando o aparelho é ligado.
2EVHUYDVHSyDVDLUGRDSDUHOKRLQWHULRU
É uma situação normal se o ar condicionado tiver
estado sem funcionar durante um longo período de
tempo, bem como na primeira utilização do aparelho.
2DSDUHOKRLQWHULRUHPLWHXPRGRUHVWUDQKR
,VVRGHYHVHDRIDFWRGHRDSDUHOKRLQWHULRUHVWDUD
emitir cheiros emanados de materiais de construção,
móveis ou fumo.
2DUFRQGLFLRQDGRPXGDSDUDRPRGR
9(17,/$'25DSDUWLUGRPRGR)5,2RX&$/25
Quando a temperatura interior atinge a temperatura
seleccionada, o compressor pára automaticamente e
o ar condicionado muda para o modo VENTILADOR.
O compressor volta a arrancar quando a temperatura
interior subir, se estiver no modo FRIO, ou descer,
se estiver no modo CALOR, até à temperatura
seleccionada.
&RQGHQVDomR
É provável que alguma água condense na saída de
ar com o aparelho em modo de arrefecimento ou
modo de aquecimento se a humidade relativa for
superior a 80% (com portas e janelas abertas).
Coloque o direccionador vertical no ângulo máximo
(apontado para o chão) e seleccione a velocidade
Alta da ventoinha. Feche as portas e as janelas.
8PUHOkPSDJRRXXPWHOHIRQHVHP¿RVDIXQFLRQDU
perto podem causar anomalias no aparelho.
Desligue a alimentação eléctrica do aparelho e volte
DOLJiOD3ULPDRERWmR212))OLJDUGHVOLJDUQR
controlo remoto para reiniciar o funcionamento.
)XQomR;)DQ
2DSDUHOKRLQWHULRUSRGHPDQWHUVHDIXQFLRQDUDSyV
ser desligado no botão ON/OFF (ligar/desligar).
9HUL¿TXHVHDIXQomR;)DQHVWiGHVDFWLYDGD
119
5HVROXomRGHSUREOHPDV
O ar condicionado não pode ser reparado pelo utilizador. Uma reparação incorrecta pode
causar choque eléctrico ou incêndio. Contacte um centro de assistência autorizado para
REWHUXPDUHSDUDomRSUR¿VVLRQDO
aviso
Se ocorrer uma das seguintes situações, pare o ar condicionado imediatamente,
desligue a alimentação eléctrica e contacte um centro de assistência autorizado.
‡ Se aparecer um código de erro no visor do
aparelho interior.
‡ Entrou água ou outro líquido para o aparelho.
‡ O indicador de funcionamento ou outro
indicador pisca rapidamente e continua
mesmo que se desligue e volte a ligar o
aparelho.
‡ 2XYHVHXPVRPGHVDJUDGiYHOGXUDQWHR
funcionamento.
‡ O fusível queima ou o disjuntor dispara
frequentemente.
‡ 2FDERHD¿FKDGHDOLPHQWDomRVREUHDTXHFHP
‡ O aparelho verte água.
‡ Há emissão de odores fortes durante o
funcionamento.
‡ Outras situações anormais.
A pressão do sistema de refrigeração está baixa e pode avariar o aparelho. Solicite a
YHUL¿FDomRDXPLQVWDODGRUFHUWL¿FDGR
Avarias
O aparelho não inicia
O aparelho não
arrefece nem aquece
(se aplicável) bem a
GLYLVmRPDVKiÀX[R
de ar a sair do ar
condicionado
Causa
O que deve fazer
Falha de energia
Aguarde que a energia seja
restabelecida.
O aparelho pode estar desligado da
electricidade.
9HUL¿TXHVHD¿FKDHVWiEHP
colocada na tomada.
O disjuntor pode ter disparado.
Ligue o disjuntor.
A voltagem é demasiado elevada ou
baixa.
Solicite o teste da voltagem a um
SUR¿VVLRQDO
As pilhas do controlo remoto podem
estar sem carga.
Substitua as pilhas.
$KRUDTXHGH¿QLXQRWHPSRUL]DGRU
está incorrecta.
Aguarde ou cancele a regulação
do temporizador.
Regulação incorrecta da temperatura.
'H¿QDXPDWHPSHUDWXUDUD]RiYHO
Para mais informação, consulte
a secção “Utilizar o controlo
remoto”
2¿OWURGRDUHVWiREVWUXtGR
/LPSHR¿OWURGRDU
Há portas ou janelas abertas.
Feche as portas e as janelas.
A entrada ou a saída de ar do aparelho
interior ou exterior está obstruída.
Comece por afastar as
obstruções e depois reinicie o
aparelho.
A protecção de 3 minutos do
compressor foi activada.
Aguarde 3 minutos.
6HRSUREOHPDQmRWLYHU¿FDGRUHVROYLGRFRQWDFWHXPFRQFHVVLRQiULRORFDORXRFHQWURGHDVVLVWrQFLD
técnica mais próximo. Não se esqueça de lhes transmitir detalhadamente as falhas e o modelo do
aparelho.
120
$VVHJXLQWHVYHUL¿FDo}HVDQWHVGHFRQWDFWDUDOJXpPSRGHPSRXSDUOKHWHPSRHGLQKHLUR
$YDULDV
&DXVD
O aparelho não
funciona
O aparelho não funciona se for
ligado imediatamente após ter sido
desligado. Isso protege o aparelho.
Aguarde cerca de 3 minutos.
Há emissão de
odores
‡O aparelho interior pode emitir
alguns odores. Isso é uma
consequência dos odores
existentes na divisão (móveis,
tabaco, etc.) e que foram
aspirados pelo aparelho.
‡Consulte um centro de assistência
autorizado para lhe fazerem uma
limpeza se os odores persistirem.
Ruído de água
DÀXLU
O ruído semelhante a água a
FDLUYHPGRUHIULJHUDQWHDÀXLUQR
interior do aparelho.
Há emissão de
vapor no modo
FRIO
Em modo de arrefecimento, o
aparelho interior pode emitir um
YDSRU¿QRVHDWHPSHUDWXUDH
a humidade na divisão forem
elevadas.
O vapor desaparece após
algum tempo, à medida que a
temperatura e humidade forem
diminuindo.
Ruído de
estalidos
Esse som provém da fricção
causada pela dilatação e/ou
contracção do painel e de outras
peças devido à mudança de
temperatura.
O aparelho
não começa a
funcionar
‡A alimentação eléctrica está
desligada?
‡$¿FKDHOpFWULFDHVWiVROWD"
(se aplicável)
‡O dispositivo de protecção do
circuito disparou?
‡A voltagem é demasiado
elevada ou baixa? (testada por
SUR¿VVLRQDLV
‡O TIMER (Temporizador) foi
utilizado correctamente?
‡As pilhas estão sem carga?
O efeito de
arrefecimento/
aquecimento é
fraco
‡A temperatura seleccionada é
razoável?
‡Existe alguma obstrução na
entrada/saída de ar?
‡2¿OWURHVWiVXMR"
‡Existe alguma porta ou janela
aberta?
‡Seleccionou a velocidade baixa da
ventoinha?
‡Existem fontes de calor na
divisão?
$YDULDV
&DXVD
‡A humidade é elevada.
Fuga de água
no aparelho
interior
Fuga de água
no aparelho
exterior
‡A água condensada transborda.
‡A mangueira de escoamento está
solta ou obstruída.
‡Em modo de arrefecimento, há
condensação de água à volta dos
tubos e das uniões.
‡Em modo de descongelação, a
água descongelada transborda.
‡Em modo de aquecimento, pinga
água do permutador de calor.
Ruído do
aparelho interior
‡O ruído é emitido quando o relé
da ventoinha ou do compressor
liga ou desliga.
‡Após o início ou a paragem do
PRGRGHGHVFRQJHODomRRXYHVH
XPVRPGHUHIULJHUDQWHDÀXLUQD
direcção oposta.
‡No modo CALOR, quando a
temperatura do permutador de
FDORULQWHULRUpPXLWREDL[DRÀX[R
de ar pára para evitar ar frio. (nos
primeiros 2 minutos)
O aparelho
interior não
sopra ar
‡No modo CALOR, quando a
temperatura exterior é baixa ou a
humidade é elevada, é possível
que se forme gelo no permutador
de calor exterior. O aparelho
descongela automaticamente e o
aparelho interior pára de soprar ar
GXUDQWHPLQXWRV
‡Em modo de descongelação, pode
ocorrer emissão de água ou vapor.
‡No modo DESUMIDIFICAR, a
ventoinha interior pára durante
PLQXWRVSDUDHYLWDUTXHD
água condensada seja de novo
vaporizada.
Humidade na
saída de ar
Se o aparelho funcionar bastante
tempo num ambiente com
muita humidade, pode aparecer
humidade na grelha de saída de ar
e até gotejar.
Código de
erro H1:
descongelação
É normal. O aparelho está no
modo de descongelação e em
breve retomará o aquecimento.
Não elimine este aparelho como resíduo municipal comum.
É necessário que este aparelho seja recolhido em separado
para tratamento especial.
121
www.electrolux.com/shop
66129912943
Download PDF

advertising